2UXCM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxcM02
1Z5CA 1XMQM 4DR3M 4JI0M 3U6DA 2ZBKB 4DV0M 2UU9M 5LMUM 4KHPM 4DR4M 4X62M 2E5LM 4DV7M 1R2YA 3T1YM 3JR4A 4DR5M 4DR1M 5ITUA 4NXNM 1L1ZA 1HR0M 4B3TM 3GPXA 3JR5A 1FJGM 4DV1M 4GKKM 4LF5M 2OPFA 1Z5AA 1N36M 4ITQA 1IBKM 1Q3BA 4JV5M 1TDZA 3U6QA 2UUCM 3SBJA 4JI3M 4X65M 1MX0A 4PCZA 1Q39A 4DV3M 4LF7M 1PJJA 2VQEM 3DOAA 1L1TA 2F5QA 4JI7M 3U6SA 1KFVA 5ITTA 2UXDM 2HKJA 1NNJA 3GPYA 2F5NA 3SAUA 3U6OA 4B3SM 4PDIA 4NXMM 1K3WA 1L2CA 3U6CA 2ZM6M 1J5EM 3GP1A 4G4QA 1XNRM 1TDHA 4JI6M 3SAVA 4JI5M 1N32M 4DV5M 3U6PA 1PM5A 4X66M 3SATA 4DV2M 5LMNM 4DV6M 4LF4M 1HNWM 3U6LA 3GPPA 3W0FA 3TWMA 3T1HM 5ITYA 3SARA 1IBLM 1HNZM 3SASA 3TWKA 2EA0A 4AQYM 3GO8A 4LFCM 4G4RA 1Z59A 5ITXE 4LFBM 4LFAM 4DR6M 3A45A 3C58A 4MB7A 4DV4M 5IWAM 4JI2M 1HNXM 2XZUA 1EE8A 4LF8M 2XZFA 4DR2M 4JI8M 5ITXA 4G4OA 4DR7M 4DUYM 2F5SA 1N34M 2F5PA 3GQ5A 4YHHM 5FLXS 3J81S 3A46A 3J80S 5A2QS 2UUAM 2OQ4A 2VQFM 2UXCM 5ITRA 1Q3CA 1K3XA 1L2DA 2Q2EB 1N33M 4GKJM 3VK8A 2HHHM 4JI1M 4NRVA 1Z5BA 4LF9M 4JYAM 4B3RM 3GQ4A 1R2ZA 4X64M 4NRWA 4PD2A 1PJIA 3U6EA 3J7AS 1MU5A 4LF6M 4G4NA 1L2BA 2F5OA 2UXBM 3SAWA 1IBMM 4B3MM 4JI4M 1I94M 2F4VM 3OTOM 2UUBM 4PDGA 1XC8A 3TWLA 3JAMS 5ITQA 3GPUA 4DUZM 1XNQM 4OX9M 1XMOM 3VK7A 4CISA 3A42A 5IT9S 3U6MA 3GQ3A 4YY3M 1K82A 4K0KM 5BR8M
chains in the Genus database with same CATH superfamily
3FTDA 1Z5CA 3MMPA 3FKEA 1GJTA 1IN5A 3J7BA 2WSCF 1PGYA 2H5XA 4JI0M 2ZBKB 3GLGA 2Z4RA 2UU9M 5LMUM 1QUSA 4FW9A 4DR4M 1GJSA 4MGYE 4GMQA 3B7QA 3T1YM 2K6BA 4LGMA 2JP7A 2DWNA 4DR1M 2JY8A 4MGIE 5ITUA 1HR0M 3LVWA 3HHYA 1KSFX 2J7OA 2I7PA 3I4VA 1FJGM 4IJFA 1F4IA 3LMMA 1IN7A 3IG5A 4L15A 2OPFA 4UN2B 4ITQA 1IBKM 1S3SA 3IG8A 3W68A 2CUZA 4GEWA 2GNOA 2ERCA 1IXSB 4NC6A 1LTMA 2V6ZM 4Z6YA 4GC5A 2VQEM 3DOAA 1L1TA 2F5QA 4AKIA 1QDRA 3F92A 2CWBA 5ITTA 2X49A 3U5ZA 1NNJA 1NHWC 3IECA 1WGLA 2MJ5B 3EIEA 3ILKA 3C3DA 3GLFB 4B3SM 2X8AA 3B7NA 1KYIA 1K3WA 4BLCA 2L4FA 1ZV1A 1VEJA 2XFSA 3KXEC 1TDHA 2FNAA 3LQRA 3SAVA 1OTRA 4MM3B 4JI5M 3PVSA 5IREB 2KRKA 2KZUA 4DV5M 1PJQA 4OVZB 1VEKA 1SG9A 3KS4A 5LMNM 4DV2M 1E9SA 1GVNA 4W5WA 3J2PB 1RU3A 3QYEA 5EP2A 3TPZA 3HHWA 3VFDA 1EFUB 1ZMWA 1GL6A 4LJ7A 1A5TA 3W0FA 3GPPA 3I4YA 3GLFA 1YE9A 2O25A 2OO9A 4R3DA 1D2NA 4IBFA 3L26A 1G3IA 4F1IA 3GLHB 3K9OA 1VQ1A 3RGSA 1NY5A 4OVZA 3AL0C 5FTMA 2I7NA 4LFAM 3EIHA 3SMPA 4AKGA 5KQ8A 3PNVA 1D0KA 1HNXM 3L2AA 4IJEA 4L6V6 2R45A 3A98B 3RE8A 2DWZB 3K9PA 4D80A 4LJ9A 4RNAA 4JN6A 1T6OA 2DWLA 2D7EA 3GLHA 4YHHM 1ZMUA 3SC3A 3U60A 3DA1A 4FWDA 3FUXA 3L25A 2FS1A 1IN6A 4BB9A 3RFWA 4IBGA 2HCBA 3HJ8A 2Q2EB 1IXZA 3SHFA 4GKJM 1JR3E 3KOZE 2DXIA 1N33M 3FTEA 3TQSA 1V33A 2DNAA 2KXEA 4KO8A 3GQ4A 2WSEF 1R2ZA 4JYAM 3J7AS 3LQQA 2RKOA 1WGNA 1XWIA 2JXNA 1YLAA 3GLIB 1L2BA 4L8RC 3B7ZA 1E94E 3BXWA 2CE7A 4M0DA 2VF8A 3AJIB 4I4LA 1IQPA 2Y0QA 1XC8A 2YQZA 3WHKA 2LVNC 1E32A 2M60A 5FSWA 4DUZM 2BNKA 4FCTA 3HU1A 2DHYA 3A42A 3GQ3A 4YY3M 1VG5A 5BR8M 3GLIA 4R7GA 2JNHA 4GC9A 1TH3A 3KP0E 1TTEA 8CATA 1NVMA 3U6DA 1IM2A 2J7NA 4DV0M 2JY5A 4LRTA 2QP9X 5EXTA 2E5LM 1WJ7A 3FUTA 2Z4SA 2Z3XA 1TF0B 3JR4A 5EJCA 2OOAA 3LVVA 3UK6A 4G6ZA 1XB2B 4NXNM 1L1ZA 1C7YA 3HJQA 5C18A 2KNZA 2BWBA 2R65A 1HT2E 4GKKM 1V34A 4LF5M 2LVAA 2JA2A 4JV5M 3AV0A 2FFJA 1R6BX 1H6UA 4JI3M 4X65M 2DAIA 1C1KA 1QZMA 4LF7M 1N77A 2GQFA 2QZ4A 5F3WA 4NL4H 3KS8A 1OKSA 1IY1A 3U6SA 3C3EA 1KFVA 1IXRC 3HWSA 2JZ1A 2HKJA 2UXDM 4MGKE 1QAQA 4CJ6A 4MH0E 3L29A 3M6AA 2C99A 2N35A 3U6OA 4KODA 4NXMM 3ZCBB 1TR8A 1L2CA 4P17A 1MN3A 2KZSA 2R44A 3QWLA 4LRSA 5EP1A 2DENA 2XF3A 1W5SA 3FRIA 2ZM6M 1XNRM 1MJGM 4AZFA 3HY5A 1NJGA 1GLNA 1PM5A 2R6FA 4X66M 3SATA 1IFYA 3U5ZB 4IBBA 2KW0A 4LF4M 2CEAA 3U6LA 1TGUA 4S12A 2XLJA 1HQYE 1OAOC 2WSFF 3K8ZA 4IBIA 4QHSA 4LCBA 3T1HM 3KSXA 4IBKA 4FWGA 4LJ6A 1DGBA 3B74A 2XGNA 2RRUA 4ZPXA 4AQYM 2G3QA 2A5YB 3GO8A 1EIJA 4GITA 3FYDA 4AG6A 1Z59A 4G4RA 5ITXE 4LFBM 2CV1A 2BJWA 1JB0F 1PJTA 3WHLA 4MGHA 1R4GA 5BPVA 3UMMA 5IWAM 1GL7A 4A3VB 2MROB 3GRYA 4LF8M 4JI8M 4F2LA 1NNUC 1OAIA 3VKHA 4DUYM 3H4JA 3LCVB 1N34M 1G41A 2L6OA 2CRUA 4NSOB 5FLXS 2ZTCA 3T6PA 3DZDA 3ZH9B 3GLGE 3A46A 4LJ4A 3VKGA 2O5RA 2R46A 2LH0A 1QANA 2Y0TA 3GRUA 2OQ4A 1SXJE 1OIZA 2UXCM 1OFHA 3VDUA 2R62A 3NBXX 3E4RA 4XGIA 2EJSA 3FUUA 1Z5BA 2HL7A 4JI1M 4I81A 4FD2A 2BJVA 1TH4A 3U60B 4QNRA 1CUKA 3V76A 3KP1E 3K1JA 4FVMA 1L8QA 4Y28F 3THGA 2C9CA 3MHVC 2LBCA 4B3MM 2F4VM 1PJSA 1P3QQ 2JY6B 4PDGA 2G8LA 4MGZE 3W0LB 3JAMS 5ITQA 3QYBA 3GPUA 4Q7JA 1XNQM 2CHGA 3AOEC 3AOGA 2XH9A 1IY2A 4LZZA 3FRHA 1XMOM 2R0IA 4CISA 4R71A 3H4MA 3QAUA 4DBGB 4EIWA 1K82A 4L4UA 2KA6B 1XMQM 4DR3M 2C9OA 5EP3A 2QPAA 4QOSA 3VLFB 4X62M 4DV7M 2AHMA 3D8BA 3U61A 1QAMA 4FWHA 4RF0A 1NSFA 3AKZA 1D0LA 5EP4A 4CHTB 3I01M 3GLFE 4GHAA 3E21A 2DZNB 3GPXA 5KPRA 1IN8A 2XSZA 1XXHB 3M7GA 4DV1M 2V1UA 2ZAMA 2WZJA 2D7GA 2C96A 2CFOA 3FD9A 1ZAEA 2DAGA 1N78A 2CP8A 4IBEA 1TDZA 1BVSA 2K0BX 3RGPA 2MH8A 3U6QA 2UUCM 4HEOA 1MX0A 3NWLA 2C98A 4WW0A 1PJJA 4G3OA 1X37A 3HKPA 3SFZA 4IBDA 1XXHA 3KDSE 2ZTDA 5C1BA 1IY0A 1NO1A 3GLHE 2F5NA 1JQJC 4RKUF 4REZA 4PDIA 5EXPA 2Z8YM 3U6CA 1QVRA 1OFIA 1V92A 4B7GA 2APLA 3GP1A 4WURA 1G59A 1R7RA 3FE3A 1UM8A 1N32M 3NBIA 1Q02A 2D7HA 3B9PA 2DHRA 1E9RA 4DV6M 1GO5A 1DGHA 2MGWA 1W5TA 1GKIA 3TWMA 3SARA 5DYGA 2BWEA 1Y8GA 2VIIA 1DO2A 4D81A 1HNZM 1OQYA 3SASA 3TWKA 1VDLA 2KNVA 4LJ8A 2LXEA 5EXSA 3KSJA 5EQTA 2QQ8A 4XBOA 3GRRA 3FYCA 2KEBA 2Y20A 1PRBA 2Y21A 4ANRA 2EKFA 1OIPA 3AOEA 4MB7A 1JR3D 3CF6E 4DV4M 2DVWB 4JI2M 1NHGC 2DAEA 3MK6A 2XZUA 4B7FA 3E46A 3SMSA 2XZFA 3GLIE 2XFTA 4DR2M 5ITXA 5EXXA 2OOBA 4M9ZA 2DI0A 1AIPC 3LCUA 2QSFX 3KW6A 1ZQ9A 2JY7A 3J81S 1Z6TA 2QHOB 3J80S 1N75A 1XHBA 1T3TA 2DKLA 2V1CA 3SHGB 5A2QS 2UUAM 3CF2A 3LW5F 1WR1B 2VQFM 2YR0A 7CATA 3HX3A 1J7KA 3C9PA 1I4WA 3HHXA 4HLQA 4XK8F 1L2DA 4WP2A 1VEGA 4NRVA 2LHCA 4B7HA 4B3RM 4M0WA 4X64M 4NRWA 3L28A 2FE8A 3SYLA 3GRVA 1MU5A 2ZAOA 1SXJA 3HU2A 4LF6M 2R4EA 2L7HA 4LZJA 2DAMA 5IZ7D 4GIPA 4QNMA 3SAWA 1IBMM 3D8LA 2L2DA 2XSZD 3KVWA 3TL4X 4JI4M 1HQCA 4LJ5A 1QDTA 2UUBM 1NV9A 3I04M 2HWJA 3CGWA 3BOSA 3IHPA 4LY6A 2CV2A 3I51A 1G4AE 2CHVA 3TWLA 3FTCA 4JXJA 5KO3A 3B89A 3M0EA 4OX9M 2K47A 2KHHA 1NY6A 1IN4A 3U6MA 2F5PA 3KOWE 3L27A 3CF0A 4K0KM 4GRIA 4P16A 4LG2A 2NQ8C 3J27B 1T43A 2LWXA 2LVQD 2RGOA 3HGIA 3KOXE 4QHTA 1QAOA 3UZUA 1VDDA 2R4JA 4KHPM 4QOZC 5GKNA 1R2YA 2JUJA 3PFIA 2L7IA 2Z7JA 4I5SA 2LVOC 5FTNA 3UGJA 4DR5M 2HAKA 1IXSA 2KDLA 4Z8XA 1J09A 1JR3A 4B3TM 3JR5A 1DGFA 2MR9A 3MJ5A 2LVPC 1Z5AA 1N36M 2VF7A 4OW0A 4B08A 1Q3BA 3U61B 4D82A 2X4AA 1AUAA 5KPZA 1ZMVA 3AFHA 3SBJA 2B3TA 4IBJA 4PCZA 1Q39A 2RGHA 5DNYA 4DV3M 5FTJA 4NOOB 1QQWA 2FOIC 4JI7M 1OJLA 5L8RF 2YNMD 2L4EA 2QCUA 2J5YA 3FUVA 3GPYA 4LGYA 2EUCA 2K9DA 3HZJA 3Q8XA 3SAUA 4BBAA 1WIVA 2JWSA 4CIZA 2DZOB 3VDPA 1WXQA 4PT5A 4NSRA 1J5EM 4G4QA 2L09A 3SYKA 4JI6M 2EO2A 3U6PA 2QENA 3K92A 3KFUG 1WHCA 3K2LA 4AI6A 2QBYB 2LHGA 1SXJC 1HNWM 5JI3E 3E9SA 2XEPA 1D0MA 5H37D 5ITYA 1IBLM 4L16A 4GH9A 2EA0A 1ORYB 2M5ZA 4AW4A 4LFCM 1SXJD 3FUWA 2KNAA 3DFZA 4FCVA 2QBYA 4KT0F 1DGHB 3A45A 3C58A 4DR6M 3KOYE 5FTKA 2YFQA 4II7A 3UJNA 2FH0A 2ZANA 2G5GX 5DFLA 1EE8A 4IIWA 3HU3A 3PXGA 3T38A 2CHQA 4AG5A 4G4OA 4DR7M 2F5SA 2LTUA 3GQ5A 4RF1A 3Q8GA 1G8PA 1NJFA 2VDBB 4KLNA 4I8OA 3HHZA 1QYRA 1UFZA 1HT1E 5E26A 3R9XB 3CTWB 2DZLA 1LV7A 1Q3CA 3W67A 5ITRA 2R18A 5KPTA 1K3XA 1QZEA 3T15A 1QUTA 4M9XA 5DYIA 4FCWA 3VK8A 4M9SA 2HHHM 5FTLA 4LF9M 3ZC7B 5E6JA 4PD2A 1PJIA 3U6EA 2O01F 2P5TA 1YSYA 1R5LA 2KRUA 3BBZA 2W82A 4LJAA 4CGYB 4G4NA 1DV0A 2F5OA 2H1RA 1DO0A 1TH2A 5JI2E 2UXBM 4AKHA 1I94M 3PNYA 2DWMA 3HJSA 5KQDA 3R8FA 3FTFA 4GHLA 2DAKA 1G71A 2JZ0A 3OTOM 3GLGB 3TE6A 2QNJA 4OU7A 1YUBA 4TUWA 1FNNA 1DGGA 2C5RA 1GABA 1XXHE 1NV8A 4L78A 3ZQJA 1SXJB 3VK7A 4HL4A 2CV0A 2LNHC 1HJPA 5IT9S 4IBCA 2EKKA
chains in the Genus database with same CATH topology
3FTDA 1Z5CA 3FKEA 1IN5A 3J7BA 4JI0M 2ZBKB 3GLGA 2Z4RA 2UU9M 5LMUM 4FW9A 4DR4M 4MGYE 4GMQA 3T1YM 4LGMA 2DWNA 4DR1M 4MGIE 5ITUA 1HR0M 3LVWA 3HHYA 1KSFX 2J7OA 2I7PA 3I4VA 1FJGM 4IJFA 3LMMA 1IN7A 3IG5A 4L15A 2OPFA 4ITQA 1IBKM 1S3SA 3IG8A 2CUZA 2ERCA 1IXSB 2V6ZM 4Z6YA 4GC5A 2VQEM 3DOAA 1L1TA 2F5QA 4AKIA 5ITTA 2X49A 3U5ZA 1NNJA 1NHWC 3EIEA 3ILKA 3GLFB 4B3SM 2X8AA 1KYIA 1K3WA 4BLCA 3KXEC 2XFSA 3LQRA 1TDHA 2FNAA 3SAVA 4JI5M 4MM3B 3PVSA 5IREB 2KRKA 2KZUA 4DV5M 4OVZB 3KS4A 4DV2M 5LMNM 1GVNA 4W5WA 3J2PB 5EP2A 3TPZA 3HHWA 3VFDA 3W0FA 4LJ7A 1GL6A 3GPPA 3GLFA 3I4YA 1YE9A 4R3DA 1D2NA 4IBFA 3L26A 1G3IA 3GLHB 3RGSA 1NY5A 4OVZA 3AL0C 5FTMA 2I7NA 4LFAM 3EIHA 3SMPA 4AKGA 5KQ8A 3PNVA 1HNXM 3L2AA 4IJEA 2R45A 3A98B 3RE8A 2DWZB 4D80A 4LJ9A 4RNAA 4JN6A 2DWLA 2D7EA 3GLHA 4YHHM 3SC3A 3U60A 3DA1A 4FWDA 3FUXA 3L25A 1IN6A 4BB9A 3RFWA 4IBGA 2HCBA 3HJ8A 2Q2EB 1IXZA 3SHFA 4GKJM 3KOZE 1N33M 2DXIA 3FTEA 3TQSA 2KXEA 4KO8A 3GQ4A 1R2ZA 4JYAM 3J7AS 3LQQA 2RKOA 1XWIA 3GLIB 1L2BA 4L8RC 1E94E 2CE7A 4M0DA 3AJIB 4I4LA 1IQPA 2Y0QA 1XC8A 2YQZA 3WHKA 2M60A 1E32A 5FSWA 4DUZM 2BNKA 4FCTA 3HU1A 3A42A 3GQ3A 4YY3M 5BR8M 3GLIA 4R7GA 4GC9A 1TH3A 3KP0E 8CATA 1NVMA 3U6DA 1IM2A 2J7NA 4DV0M 4LRTA 2QP9X 5EXTA 2E5LM 3FUTA 2Z4SA 2Z3XA 3JR4A 5EJCA 3LVVA 3UK6A 4G6ZA 4NXNM 1L1ZA 3HJQA 5C18A 2R65A 1HT2E 4GKKM 4LF5M 2JA2A 4JV5M 3AV0A 2FFJA 1R6BX 1H6UA 4JI3M 4X65M 1C1KA 1QZMA 4LF7M 1N77A 3KS8A 2QZ4A 5F3WA 4NL4H 1IY1A 3U6SA 1KFVA 1IXRC 3HWSA 2UXDM 2HKJA 4MGKE 1QAQA 4MH0E 3L29A 3M6AA 2C99A 3U6OA 4KODA 4NXMM 3ZCBB 1L2CA 2KZSA 4LRSA 3QWLA 5EP1A 2ZM6M 2XF3A 1W5SA 1XNRM 4AZFA 1NJGA 1GLNA 1PM5A 4X66M 3SATA 3U5ZB 4IBBA 2KW0A 4LF4M 2CEAA 3U6LA 1TGUA 4S12A 2XLJA 1HQYE 3K8ZA 4IBIA 4QHSA 4LCBA 3T1HM 3KSXA 4IBKA 4FWGA 4LJ6A 1DGBA 2XGNA 4ZPXA 4AQYM 2A5YB 3GO8A 4GITA 3FYDA 4AG6A 1Z59A 4G4RA 5ITXE 4LFBM 2CV1A 2BJWA 3WHLA 4MGHA 5BPVA 3UMMA 5IWAM 1GL7A 4A3VB 3GRYA 4LF8M 4JI8M 1NNUC 3VKHA 4DUYM 1N34M 1G41A 2L6OA 4NSOB 5FLXS 3ZH9B 3DZDA 3A46A 4LJ4A 3VKGA 2O5RA 2R46A 2LH0A 1QANA 2Y0TA 3GRUA 2OQ4A 1SXJE 2UXCM 1OFHA 3VDUA 2R62A 4XGIA 3E4RA 3FUUA 4JI1M 1Z5BA 2HL7A 4I81A 4FD2A 2BJVA 1TH4A 3U60B 4QNRA 3KP1E 3K1JA 4FVMA 1L8QA 3THGA 2C9CA 3MHVC 4B3MM 2F4VM 4PDGA 2G8LA 4MGZE 3W0LB 3JAMS 5ITQA 1XNQM 3GPUA 2CHGA 3AOEC 3AOGA 2XH9A 1IY2A 4LZZA 1XMOM 4CISA 3H4MA 3QAUA 4EIWA 1K82A 4L4UA 2KA6B 1XMQM 4DR3M 2C9OA 5EP3A 2QPAA 4QOSA 3VLFB 4X62M 4DV7M 2AHMA 3D8BA 3U61A 1QAMA 4FWHA 4RF0A 1NSFA 3AKZA 5EP4A 4CHTB 4GHAA 2DZNB 3GPXA 5KPRA 1IN8A 2XSZA 1XXHB 3M7GA 4DV1M 2V1UA 2ZAMA 2D7GA 2C96A 2CFOA 3FD9A 1ZAEA 1N78A 4IBEA 1TDZA 3RGPA 3U6QA 2UUCM 1MX0A 3NWLA 2C98A 4WW0A 1PJJA 1X37A 3HKPA 3SFZA 4IBDA 1XXHA 3KDSE 5C1BA 1IY0A 2F5NA 1JQJC 4REZA 4PDIA 5EXPA 3U6CA 1QVRA 1OFIA 4B7GA 3GP1A 4WURA 1G59A 1R7RA 1UM8A 1N32M 3NBIA 2D7HA 3B9PA 2DHRA 1E9RA 4DV6M 1DGHA 1W5TA 1GKIA 3TWMA 3SARA 5DYGA 2VIIA 1DO2A 4D81A 1HNZM 3SASA 3TWKA 4LJ8A 5EXSA 2LXEA 3KSJA 5EQTA 4XBOA 3GRRA 3FYCA 2KEBA 2Y20A 2Y21A 3AOEA 4MB7A 1JR3D 3CF6E 4DV4M 2DVWB 4JI2M 1NHGC 3MK6A 2XZUA 4B7FA 3SMSA 2XZFA 2XFTA 4DR2M 5ITXA 5EXXA 4M9ZA 3KW6A 1ZQ9A 3J81S 1Z6TA 3J80S 1N75A 1XHBA 1T3TA 2V1CA 3SHGB 5A2QS 2UUAM 3CF2A 2VQFM 2YR0A 7CATA 1J7KA 1I4WA 3HHXA 4HLQA 1L2DA 4NRVA 4B7HA 4B3RM 4M0WA 4X64M 4NRWA 3L28A 2FE8A 3SYLA 3GRVA 2ZAOA 1MU5A 1SXJA 3HU2A 4LF6M 2R4EA 2L7HA 4LZJA 5IZ7D 4GIPA 4QNMA 3SAWA 1IBMM 3D8LA 4JI4M 2XSZD 3KVWA 3TL4X 1HQCA 4LJ5A 2UUBM 4LY6A 3BOSA 2CV2A 3I51A 1G4AE 2CHVA 3TWLA 3FTCA 4JXJA 5KO3A 3M0EA 4OX9M 2K47A 1NY6A 1IN4A 3U6MA 2F5PA 3KOWE 3L27A 3CF0A 4K0KM 4GRIA 4P16A 4LG2A 2NQ8C 3J27B 2LWXA 3KOXE 2RGOA 3HGIA 4QHTA 3UZUA 1QAOA 1VDDA 2R4JA 4KHPM 4QOZC 5GKNA 1R2YA 3PFIA 2L7IA 2Z7JA 4I5SA 4DR5M 5FTNA 3UGJA 4Z8XA 1J09A 1JR3A 4B3TM 3JR5A 1DGFA 3MJ5A 1Z5AA 1N36M 4OW0A 4B08A 1Q3BA 3U61B 4D82A 2X4AA 5KPZA 3AFHA 3SBJA 4IBJA 4PCZA 1Q39A 2RGHA 5DNYA 4DV3M 5FTJA 4NOOB 1QQWA 2FOIC 4JI7M 1OJLA 2YNMD 2QCUA 3FUVA 3GPYA 4LGYA 2EUCA 3Q8XA 3SAUA 4BBAA 2DZOB 3VDPA 1WXQA 4PT5A 4NSRA 1J5EM 4G4QA 2L09A 3SYKA 4JI6M 2EO2A 3U6PA 2QENA 3K92A 3KFUG 3K2LA 4AI6A 2QBYB 1SXJC 1HNWM 5JI3E 3E9SA 2XEPA 5H37D 5ITYA 1IBLM 4L16A 4GH9A 2EA0A 1ORYB 2M5ZA 4AW4A 4LFCM 1SXJD 3FUWA 3DFZA 4DR6M 4FCVA 2QBYA 1DGHB 3A45A 3C58A 3KOYE 5FTKA 2YFQA 4II7A 3UJNA 2ZANA 2G5GX 1EE8A 4IIWA 3HU3A 3PXGA 3T38A 2CHQA 4AG5A 4G4OA 4DR7M 2F5SA 3GQ5A 4RF1A 4KLNA 1G8PA 1NJFA 4I8OA 3HHZA 1QYRA 1HT1E 5E26A 3R9XB 3CTWB 1LV7A 1Q3CA 5ITRA 2R18A 5KPTA 1K3XA 3T15A 4M9XA 5DYIA 4FCWA 3VK8A 4M9SA 2HHHM 5FTLA 4LF9M 3ZC7B 5E6JA 4PD2A 1PJIA 3U6EA 2P5TA 1YSYA 2KRUA 4LJAA 2W82A 4CGYB 4G4NA 2F5OA 2H1RA 1DO0A 1TH2A 5JI2E 2UXBM 4AKHA 1I94M 3PNYA 2DWMA 3HJSA 5KQDA 3R8FA 3FTFA 4GHLA 3OTOM 3GLGB 3TE6A 4OU7A 1YUBA 4TUWA 1FNNA 1DGGA 2C5RA 4L78A 1SXJB 3VK7A 4HL4A 2CV0A 2LNHC 5IT9S 4IBCA 1E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5C A;  1XMQ M;  4DR3 M;  4JI0 M;  3U6D A;  2ZBK B;  4DV0 M;  2UU9 M;  5LMU M;  4KHP M;  4DR4 M;  4X62 M;  2E5L M;  4DV7 M;  1R2Y A;  3T1Y M;  3JR4 A;  4DR5 M;  4DR1 M;  5ITU A;  4NXN M;  1L1Z A;  1HR0 M;  4B3T M;  3GPX A;  3JR5 A;  1FJG M;  4DV1 M;  4GKK M;  4LF5 M;  2OPF A;  1Z5A A;  1N36 M;  4ITQ A;  1IBK M;  1Q3B A;  4JV5 M;  1TDZ A;  3U6Q A;  2UUC M;  3SBJ A;  4JI3 M;  4X65 M;  1MX0 A;  4PCZ A;  1Q39 A;  4DV3 M;  4LF7 M;  1PJJ A;  2VQE M;  3DOA A;  1L1T A;  2F5Q A;  4JI7 M;  3U6S A;  1KFV A;  5ITT A;  2UXD M;  2HKJ A;  1NNJ A;  3GPY A;  2F5N A;  3SAU A;  3U6O A;  4B3S M;  4PDI A;  4NXM M;  1K3W A;  1L2C A;  3U6C A;  2ZM6 M;  1J5E M;  3GP1 A;  4G4Q A;  1XNR M;  1TDH A;  4JI6 M;  3SAV A;  4JI5 M;  1N32 M;  4DV5 M;  3U6P A;  1PM5 A;  4X66 M;  3SAT A;  4DV2 M;  5LMN M;  4DV6 M;  4LF4 M;  1HNW M;  3U6L A;  3GPP A;  3W0F A;  3TWM A;  3T1H M;  5ITY A;  3SAR A;  1IBL M;  1HNZ M;  3SAS A;  3TWK A;  2EA0 A;  4AQY M;  3GO8 A;  4LFC M;  4G4R A;  1Z59 A;  5ITX E;  4LFB M;  4LFA M;  4DR6 M;  3A45 A;  3C58 A;  4MB7 A;  4DV4 M;  5IWA M;  4JI2 M;  1HNX M;  2XZU A;  1EE8 A;  4LF8 M;  2XZF A;  4DR2 M;  4JI8 M;  5ITX A;  4G4O A;  4DR7 M;  4DUY M;  2F5S A;  1N34 M;  2F5P A;  3GQ5 A;  4YHH M;  5FLX S;  3J81 S;  3A46 A;  3J80 S;  5A2Q S;  2UUA M;  2OQ4 A;  2VQF M;  2UXC M;  5ITR A;  1Q3C A;  1K3X A;  1L2D A;  2Q2E B;  1N33 M;  4GKJ M;  3VK8 A;  2HHH M;  4JI1 M;  4NRV A;  1Z5B A;  4LF9 M;  4JYA M;  4B3R M;  3GQ4 A;  1R2Z A;  4X64 M;  4NRW A;  4PD2 A;  1PJI A;  3U6E A;  3J7A S;  1MU5 A;  4LF6 M;  4G4N A;  1L2B A;  2F5O A;  2UXB M;  3SAW A;  1IBM M;  4B3M M;  4JI4 M;  1I94 M;  2F4V M;  3OTO M;  2UUB M;  4PDG A;  1XC8 A;  3TWL A;  3JAM S;  5ITQ A;  3GPU A;  4DUZ M;  1XNQ M;  4OX9 M;  1XMO M;  3VK7 A;  4CIS A;  3A42 A;  5IT9 S;  3U6M A;  3GQ3 A;  4YY3 M;  1K82 A;  4K0K M;  5BR8 M; 
#chains in the Genus database with same CATH topology
 3FTD A;  1Z5C A;  3MMP A;  3FKE A;  1GJT A;  1IN5 A;  3J7B A;  2WSC F;  1PGY A;  2H5X A;  4JI0 M;  2ZBK B;  3GLG A;  2Z4R A;  2UU9 M;  5LMU M;  1QUS A;  4FW9 A;  4DR4 M;  1GJS A;  4MGY E;  4GMQ A;  3B7Q A;  3T1Y M;  2K6B A;  4LGM A;  2JP7 A;  2DWN A;  4DR1 M;  2JY8 A;  4MGI E;  5ITU A;  1HR0 M;  3LVW A;  3HHY A;  1KSF X;  2J7O A;  2I7P A;  3I4V A;  1FJG M;  4IJF A;  1F4I A;  3LMM A;  1IN7 A;  3IG5 A;  4L15 A;  2OPF A;  4UN2 B;  4ITQ A;  1IBK M;  1S3S A;  3IG8 A;  3W68 A;  2CUZ A;  4GEW A;  2GNO A;  2ERC A;  1IXS B;  4NC6 A;  1LTM A;  2V6Z M;  4Z6Y A;  4GC5 A;  2VQE M;  3DOA A;  1L1T A;  2F5Q A;  4AKI A;  1QDR A;  3F92 A;  2CWB A;  5ITT A;  2X49 A;  3U5Z A;  1NNJ A;  1NHW C;  3IEC A;  1WGL A;  2MJ5 B;  3EIE A;  3ILK A;  3C3D A;  3GLF B;  4B3S M;  2X8A A;  3B7N A;  1KYI A;  1K3W A;  4BLC A;  2L4F A;  1ZV1 A;  1VEJ A;  2XFS A;  3KXE C;  1TDH A;  2FNA A;  3LQR A;  3SAV A;  1OTR A;  4MM3 B;  4JI5 M;  3PVS A;  5IRE B;  2KRK A;  2KZU A;  4DV5 M;  1PJQ A;  4OVZ B;  1VEK A;  1SG9 A;  3KS4 A;  5LMN M;  4DV2 M;  1E9S A;  1GVN A;  4W5W A;  3J2P B;  1RU3 A;  3QYE A;  5EP2 A;  3TPZ A;  3HHW A;  3VFD A;  1EFU B;  1ZMW A;  1GL6 A;  4LJ7 A;  1A5T A;  3W0F A;  3GPP A;  3I4Y A;  3GLF A;  1YE9 A;  2O25 A;  2OO9 A;  4R3D A;  1D2N A;  4IBF A;  3L26 A;  1G3I A;  4F1I A;  3GLH B;  3K9O A;  1VQ1 A;  3RGS A;  1NY5 A;  4OVZ A;  3AL0 C;  5FTM A;  2I7N A;  4LFA M;  3EIH A;  3SMP A;  4AKG A;  5KQ8 A;  3PNV A;  1D0K A;  1HNX M;  3L2A A;  4IJE A;  4L6V 6;  2R45 A;  3A98 B;  3RE8 A;  2DWZ B;  3K9P A;  4D80 A;  4LJ9 A;  4RNA A;  4JN6 A;  1T6O A;  2DWL A;  2D7E A;  3GLH A;  4YHH M;  1ZMU A;  3SC3 A;  3U60 A;  3DA1 A;  4FWD A;  3FUX A;  3L25 A;  2FS1 A;  1IN6 A;  4BB9 A;  3RFW A;  4IBG A;  2HCB A;  3HJ8 A;  2Q2E B;  1IXZ A;  3SHF A;  4GKJ M;  1JR3 E;  3KOZ E;  2DXI A;  1N33 M;  3FTE A;  3TQS A;  1V33 A;  2DNA A;  2KXE A;  4KO8 A;  3GQ4 A;  2WSE F;  1R2Z A;  4JYA M;  3J7A S;  3LQQ A;  2RKO A;  1WGN A;  1XWI A;  2JXN A;  1YLA A;  3GLI B;  1L2B A;  4L8R C;  3B7Z A;  1E94 E;  3BXW A;  2CE7 A;  4M0D A;  2VF8 A;  3AJI B;  4I4L A;  1IQP A;  2Y0Q A;  1XC8 A;  2YQZ A;  3WHK A;  2LVN C;  1E32 A;  2M60 A;  5FSW A;  4DUZ M;  2BNK A;  4FCT A;  3HU1 A;  2DHY A;  3A42 A;  3GQ3 A;  4YY3 M;  1VG5 A;  5BR8 M;  3GLI A;  4R7G A;  2JNH A;  4GC9 A;  1TH3 A;  3KP0 E;  1TTE A;  8CAT A;  1NVM A;  3U6D A;  1IM2 A;  2J7N A;  4DV0 M;  2JY5 A;  4LRT A;  2QP9 X;  5EXT A;  2E5L M;  1WJ7 A;  3FUT A;  2Z4S A;  2Z3X A;  1TF0 B;  3JR4 A;  5EJC A;  2OOA A;  3LVV A;  3UK6 A;  4G6Z A;  1XB2 B;  4NXN M;  1L1Z A;  1C7Y A;  3HJQ A;  5C18 A;  2KNZ A;  2BWB A;  2R65 A;  1HT2 E;  4GKK M;  1V34 A;  4LF5 M;  2LVA A;  2JA2 A;  4JV5 M;  3AV0 A;  2FFJ A;  1R6B X;  1H6U A;  4JI3 M;  4X65 M;  2DAI A;  1C1K A;  1QZM A;  4LF7 M;  1N77 A;  2GQF A;  2QZ4 A;  5F3W A;  4NL4 H;  3KS8 A;  1OKS A;  1IY1 A;  3U6S A;  3C3E A;  1KFV A;  1IXR C;  3HWS A;  2JZ1 A;  2HKJ A;  2UXD M;  4MGK E;  1QAQ A;  4CJ6 A;  4MH0 E;  3L29 A;  3M6A A;  2C99 A;  2N35 A;  3U6O A;  4KOD A;  4NXM M;  3ZCB B;  1TR8 A;  1L2C A;  4P17 A;  1MN3 A;  2KZS A;  2R44 A;  3QWL A;  4LRS A;  5EP1 A;  2DEN A;  2XF3 A;  1W5S A;  3FRI A;  2ZM6 M;  1XNR M;  1MJG M;  4AZF A;  3HY5 A;  1NJG A;  1GLN A;  1PM5 A;  2R6F A;  4X66 M;  3SAT A;  1IFY A;  3U5Z B;  4IBB A;  2KW0 A;  4LF4 M;  2CEA A;  3U6L A;  1TGU A;  4S12 A;  2XLJ A;  1HQY E;  1OAO C;  2WSF F;  3K8Z A;  4IBI A;  4QHS A;  4LCB A;  3T1H M;  3KSX A;  4IBK A;  4FWG A;  4LJ6 A;  1DGB A;  3B74 A;  2XGN A;  2RRU A;  4ZPX A;  4AQY M;  2G3Q A;  2A5Y B;  3GO8 A;  1EIJ A;  4GIT A;  3FYD A;  4AG6 A;  1Z59 A;  4G4R A;  5ITX E;  4LFB M;  2CV1 A;  2BJW A;  1JB0 F;  1PJT A;  3WHL A;  4MGH A;  1R4G A;  5BPV A;  3UMM A;  5IWA M;  1GL7 A;  4A3V B;  2MRO B;  3GRY A;  4LF8 M;  4JI8 M;  4F2L A;  1NNU C;  1OAI A;  3VKH A;  4DUY M;  3H4J A;  3LCV B;  1N34 M;  1G41 A;  2L6O A;  2CRU A;  4NSO B;  5FLX S;  2ZTC A;  3T6P A;  3DZD A;  3ZH9 B;  3GLG E;  3A46 A;  4LJ4 A;  3VKG A;  2O5R A;  2R46 A;  2LH0 A;  1QAN A;  2Y0T A;  3GRU A;  2OQ4 A;  1SXJ E;  1OIZ A;  2UXC M;  1OFH A;  3VDU A;  2R62 A;  3NBX X;  3E4R A;  4XGI A;  2EJS A;  3FUU A;  1Z5B A;  2HL7 A;  4JI1 M;  4I81 A;  4FD2 A;  2BJV A;  1TH4 A;  3U60 B;  4QNR A;  1CUK A;  3V76 A;  3KP1 E;  3K1J A;  4FVM A;  1L8Q A;  4Y28 F;  3THG A;  2C9C A;  3MHV C;  2LBC A;  4B3M M;  2F4V M;  1PJS A;  1P3Q Q;  2JY6 B;  4PDG A;  2G8L A;  4MGZ E;  3W0L B;  3JAM S;  5ITQ A;  3QYB A;  3GPU A;  4Q7J A;  1XNQ M;  2CHG A;  3AOE C;  3AOG A;  2XH9 A;  1IY2 A;  4LZZ A;  3FRH A;  1XMO M;  2R0I A;  4CIS A;  4R71 A;  3H4M A;  3QAU A;  4DBG B;  4EIW A;  1K82 A;  4L4U A;  2KA6 B;  1XMQ M;  4DR3 M;  2C9O A;  5EP3 A;  2QPA A;  4QOS A;  3VLF B;  4X62 M;  4DV7 M;  2AHM A;  3D8B A;  3U61 A;  1QAM A;  4FWH A;  4RF0 A;  1NSF A;  3AKZ A;  1D0L A;  5EP4 A;  4CHT B;  3I01 M;  3GLF E;  4GHA A;  3E21 A;  2DZN B;  3GPX A;  5KPR A;  1IN8 A;  2XSZ A;  1XXH B;  3M7G A;  4DV1 M;  2V1U A;  2ZAM A;  2WZJ A;  2D7G A;  2C96 A;  2CFO A;  3FD9 A;  1ZAE A;  2DAG A;  1N78 A;  2CP8 A;  4IBE A;  1TDZ A;  1BVS A;  2K0B X;  3RGP A;  2MH8 A;  3U6Q A;  2UUC M;  4HEO A;  1MX0 A;  3NWL A;  2C98 A;  4WW0 A;  1PJJ A;  4G3O A;  1X37 A;  3HKP A;  3SFZ A;  4IBD A;  1XXH A;  3KDS E;  2ZTD A;  5C1B A;  1IY0 A;  1NO1 A;  3GLH E;  2F5N A;  1JQJ C;  4RKU F;  4REZ A;  4PDI A;  5EXP A;  2Z8Y M;  3U6C A;  1QVR A;  1OFI A;  1V92 A;  4B7G A;  2APL A;  3GP1 A;  4WUR A;  1G59 A;  1R7R A;  3FE3 A;  1UM8 A;  1N32 M;  3NBI A;  1Q02 A;  2D7H A;  3B9P A;  2DHR A;  1E9R A;  4DV6 M;  1GO5 A;  1DGH A;  2MGW A;  1W5T A;  1GKI A;  3TWM A;  3SAR A;  5DYG A;  2BWE A;  1Y8G A;  2VII A;  1DO2 A;  4D81 A;  1HNZ M;  1OQY A;  3SAS A;  3TWK A;  1VDL A;  2KNV A;  4LJ8 A;  2LXE A;  5EXS A;  3KSJ A;  5EQT A;  2QQ8 A;  4XBO A;  3GRR A;  3FYC A;  2KEB A;  2Y20 A;  1PRB A;  2Y21 A;  4ANR A;  2EKF A;  1OIP A;  3AOE A;  4MB7 A;  1JR3 D;  3CF6 E;  4DV4 M;  2DVW B;  4JI2 M;  1NHG C;  2DAE A;  3MK6 A;  2XZU A;  4B7F A;  3E46 A;  3SMS A;  2XZF A;  3GLI E;  2XFT A;  4DR2 M;  5ITX A;  5EXX A;  2OOB A;  4M9Z A;  2DI0 A;  1AIP C;  3LCU A;  2QSF X;  3KW6 A;  1ZQ9 A;  2JY7 A;  3J81 S;  1Z6T A;  2QHO B;  3J80 S;  1N75 A;  1XHB A;  1T3T A;  2DKL A;  2V1C A;  3SHG B;  5A2Q S;  2UUA M;  3CF2 A;  3LW5 F;  1WR1 B;  2VQF M;  2YR0 A;  7CAT A;  3HX3 A;  1J7K A;  3C9P A;  1I4W A;  3HHX A;  4HLQ A;  4XK8 F;  1L2D A;  4WP2 A;  1VEG A;  4NRV A;  2LHC A;  4B7H A;  4B3R M;  4M0W A;  4X64 M;  4NRW A;  3L28 A;  2FE8 A;  3SYL A;  3GRV A;  1MU5 A;  2ZAO A;  1SXJ A;  3HU2 A;  4LF6 M;  2R4E A;  2L7H A;  4LZJ A;  2DAM A;  5IZ7 D;  4GIP A;  4QNM A;  3SAW A;  1IBM M;  3D8L A;  2L2D A;  2XSZ D;  3KVW A;  3TL4 X;  4JI4 M;  1HQC A;  4LJ5 A;  1QDT A;  2UUB M;  1NV9 A;  3I04 M;  2HWJ A;  3CGW A;  3BOS A;  3IHP A;  4LY6 A;  2CV2 A;  3I51 A;  1G4A E;  2CHV A;  3TWL A;  3FTC A;  4JXJ A;  5KO3 A;  3B89 A;  3M0E A;  4OX9 M;  2K47 A;  2KHH A;  1NY6 A;  1IN4 A;  3U6M A;  2F5P A;  3KOW E;  3L27 A;  3CF0 A;  4K0K M;  4GRI A;  4P16 A;  4LG2 A;  2NQ8 C;  3J27 B;  1T43 A;  2LWX A;  2LVQ D;  2RGO A;  3HGI A;  3KOX E;  4QHT A;  1QAO A;  3UZU A;  1VDD A;  2R4J A;  4KHP M;  4QOZ C;  5GKN A;  1R2Y A;  2JUJ A;  3PFI A;  2L7I A;  2Z7J A;  4I5S A;  2LVO C;  5FTN A;  3UGJ A;  4DR5 M;  2HAK A;  1IXS A;  2KDL A;  4Z8X A;  1J09 A;  1JR3 A;  4B3T M;  3JR5 A;  1DGF A;  2MR9 A;  3MJ5 A;  2LVP C;  1Z5A A;  1N36 M;  2VF7 A;  4OW0 A;  4B08 A;  1Q3B A;  3U61 B;  4D82 A;  2X4A A;  1AUA A;  5KPZ A;  1ZMV A;  3AFH A;  3SBJ A;  2B3T A;  4IBJ A;  4PCZ A;  1Q39 A;  2RGH A;  5DNY A;  4DV3 M;  5FTJ A;  4NOO B;  1QQW A;  2FOI C;  4JI7 M;  1OJL A;  5L8R F;  2YNM D;  2L4E A;  2QCU A;  2J5Y A;  3FUV A;  3GPY A;  4LGY A;  2EUC A;  2K9D A;  3HZJ A;  3Q8X A;  3SAU A;  4BBA A;  1WIV A;  2JWS A;  4CIZ A;  2DZO B;  3VDP A;  1WXQ A;  4PT5 A;  4NSR A;  1J5E M;  4G4Q A;  2L09 A;  3SYK A;  4JI6 M;  2EO2 A;  3U6P A;  2QEN A;  3K92 A;  3KFU G;  1WHC A;  3K2L A;  4AI6 A;  2QBY B;  2LHG A;  1SXJ C;  1HNW M;  5JI3 E;  3E9S A;  2XEP A;  1D0M A;  5H37 D;  5ITY A;  1IBL M;  4L16 A;  4GH9 A;  2EA0 A;  1ORY B;  2M5Z A;  4AW4 A;  4LFC M;  1SXJ D;  3FUW A;  2KNA A;  3DFZ A;  4FCV A;  2QBY A;  4KT0 F;  1DGH B;  3A45 A;  3C58 A;  4DR6 M;  3KOY E;  5FTK A;  2YFQ A;  4II7 A;  3UJN A;  2FH0 A;  2ZAN A;  2G5G X;  5DFL A;  1EE8 A;  4IIW A;  3HU3 A;  3PXG A;  3T38 A;  2CHQ A;  4AG5 A;  4G4O A;  4DR7 M;  2F5S A;  2LTU A;  3GQ5 A;  4RF1 A;  3Q8G A;  1G8P A;  1NJF A;  2VDB B;  4KLN A;  4I8O A;  3HHZ A;  1QYR A;  1UFZ A;  1HT1 E;  5E26 A;  3R9X B;  3CTW B;  2DZL A;  1LV7 A;  1Q3C A;  3W67 A;  5ITR A;  2R18 A;  5KPT A;  1K3X A;  1QZE A;  3T15 A;  1QUT A;  4M9X A;  5DYI A;  4FCW A;  3VK8 A;  4M9S A;  2HHH M;  5FTL A;  4LF9 M;  3ZC7 B;  5E6J A;  4PD2 A;  1PJI A;  3U6E A;  2O01 F;  2P5T A;  1YSY A;  1R5L A;  2KRU A;  3BBZ A;  2W82 A;  4LJA A;  4CGY B;  4G4N A;  1DV0 A;  2F5O A;  2H1R A;  1DO0 A;  1TH2 A;  5JI2 E;  2UXB M;  4AKH A;  1I94 M;  3PNY A;  2DWM A;  3HJS A;  5KQD A;  3R8F A;  3FTF A;  4GHL A;  2DAK A;  1G71 A;  2JZ0 A;  3OTO M;  3GLG B;  3TE6 A;  2QNJ A;  4OU7 A;  1YUB A;  4TUW A;  1FNN A;  1DGG A;  2C5R A;  1GAB A;  1XXH E;  1NV8 A;  4L78 A;  3ZQJ A;  1SXJ B;  3VK7 A;  4HL4 A;  2CV0 A;  2LNH C;  1HJP A;  5IT9 S;  4IBC A;  2EKK A; 
#chains in the Genus database with same CATH homology
 3FTD A;  1Z5C A;  3FKE A;  1IN5 A;  3J7B A;  4JI0 M;  2ZBK B;  3GLG A;  2Z4R A;  2UU9 M;  5LMU M;  4FW9 A;  4DR4 M;  4MGY E;  4GMQ A;  3T1Y M;  4LGM A;  2DWN A;  4DR1 M;  4MGI E;  5ITU A;  1HR0 M;  3LVW A;  3HHY A;  1KSF X;  2J7O A;  2I7P A;  3I4V A;  1FJG M;  4IJF A;  3LMM A;  1IN7 A;  3IG5 A;  4L15 A;  2OPF A;  4ITQ A;  1IBK M;  1S3S A;  3IG8 A;  2CUZ A;  2ERC A;  1IXS B;  2V6Z M;  4Z6Y A;  4GC5 A;  2VQE M;  3DOA A;  1L1T A;  2F5Q A;  4AKI A;  5ITT A;  2X49 A;  3U5Z A;  1NNJ A;  1NHW C;  3EIE A;  3ILK A;  3GLF B;  4B3S M;  2X8A A;  1KYI A;  1K3W A;  4BLC A;  3KXE C;  2XFS A;  3LQR A;  1TDH A;  2FNA A;  3SAV A;  4JI5 M;  4MM3 B;  3PVS A;  5IRE B;  2KRK A;  2KZU A;  4DV5 M;  4OVZ B;  3KS4 A;  4DV2 M;  5LMN M;  1GVN A;  4W5W A;  3J2P B;  5EP2 A;  3TPZ A;  3HHW A;  3VFD A;  3W0F A;  4LJ7 A;  1GL6 A;  3GPP A;  3GLF A;  3I4Y A;  1YE9 A;  4R3D A;  1D2N A;  4IBF A;  3L26 A;  1G3I A;  3GLH B;  3RGS A;  1NY5 A;  4OVZ A;  3AL0 C;  5FTM A;  2I7N A;  4LFA M;  3EIH A;  3SMP A;  4AKG A;  5KQ8 A;  3PNV A;  1HNX M;  3L2A A;  4IJE A;  2R45 A;  3A98 B;  3RE8 A;  2DWZ B;  4D80 A;  4LJ9 A;  4RNA A;  4JN6 A;  2DWL A;  2D7E A;  3GLH A;  4YHH M;  3SC3 A;  3U60 A;  3DA1 A;  4FWD A;  3FUX A;  3L25 A;  1IN6 A;  4BB9 A;  3RFW A;  4IBG A;  2HCB A;  3HJ8 A;  2Q2E B;  1IXZ A;  3SHF A;  4GKJ M;  3KOZ E;  1N33 M;  2DXI A;  3FTE A;  3TQS A;  2KXE A;  4KO8 A;  3GQ4 A;  1R2Z A;  4JYA M;  3J7A S;  3LQQ A;  2RKO A;  1XWI A;  3GLI B;  1L2B A;  4L8R C;  1E94 E;  2CE7 A;  4M0D A;  3AJI B;  4I4L A;  1IQP A;  2Y0Q A;  1XC8 A;  2YQZ A;  3WHK A;  2M60 A;  1E32 A;  5FSW A;  4DUZ M;  2BNK A;  4FCT A;  3HU1 A;  3A42 A;  3GQ3 A;  4YY3 M;  5BR8 M;  3GLI A;  4R7G A;  4GC9 A;  1TH3 A;  3KP0 E;  8CAT A;  1NVM A;  3U6D A;  1IM2 A;  2J7N A;  4DV0 M;  4LRT A;  2QP9 X;  5EXT A;  2E5L M;  3FUT A;  2Z4S A;  2Z3X A;  3JR4 A;  5EJC A;  3LVV A;  3UK6 A;  4G6Z A;  4NXN M;  1L1Z A;  3HJQ A;  5C18 A;  2R65 A;  1HT2 E;  4GKK M;  4LF5 M;  2JA2 A;  4JV5 M;  3AV0 A;  2FFJ A;  1R6B X;  1H6U A;  4JI3 M;  4X65 M;  1C1K A;  1QZM A;  4LF7 M;  1N77 A;  3KS8 A;  2QZ4 A;  5F3W A;  4NL4 H;  1IY1 A;  3U6S A;  1KFV A;  1IXR C;  3HWS A;  2UXD M;  2HKJ A;  4MGK E;  1QAQ A;  4MH0 E;  3L29 A;  3M6A A;  2C99 A;  3U6O A;  4KOD A;  4NXM M;  3ZCB B;  1L2C A;  2KZS A;  4LRS A;  3QWL A;  5EP1 A;  2ZM6 M;  2XF3 A;  1W5S A;  1XNR M;  4AZF A;  1NJG A;  1GLN A;  1PM5 A;  4X66 M;  3SAT A;  3U5Z B;  4IBB A;  2KW0 A;  4LF4 M;  2CEA A;  3U6L A;  1TGU A;  4S12 A;  2XLJ A;  1HQY E;  3K8Z A;  4IBI A;  4QHS A;  4LCB A;  3T1H M;  3KSX A;  4IBK A;  4FWG A;  4LJ6 A;  1DGB A;  2XGN A;  4ZPX A;  4AQY M;  2A5Y B;  3GO8 A;  4GIT A;  3FYD A;  4AG6 A;  1Z59 A;  4G4R A;  5ITX E;  4LFB M;  2CV1 A;  2BJW A;  3WHL A;  4MGH A;  5BPV A;  3UMM A;  5IWA M;  1GL7 A;  4A3V B;  3GRY A;  4LF8 M;  4JI8 M;  1NNU C;  3VKH A;  4DUY M;  1N34 M;  1G41 A;  2L6O A;  4NSO B;  5FLX S;  3ZH9 B;  3DZD A;  3A46 A;  4LJ4 A;  3VKG A;  2O5R A;  2R46 A;  2LH0 A;  1QAN A;  2Y0T A;  3GRU A;  2OQ4 A;  1SXJ E;  2UXC M;  1OFH A;  3VDU A;  2R62 A;  4XGI A;  3E4R A;  3FUU A;  4JI1 M;  1Z5B A;  2HL7 A;  4I81 A;  4FD2 A;  2BJV A;  1TH4 A;  3U60 B;  4QNR A;  3KP1 E;  3K1J A;  4FVM A;  1L8Q A;  3THG A;  2C9C A;  3MHV C;  4B3M M;  2F4V M;  4PDG A;  2G8L A;  4MGZ E;  3W0L B;  3JAM S;  5ITQ A;  1XNQ M;  3GPU A;  2CHG A;  3AOE C;  3AOG A;  2XH9 A;  1IY2 A;  4LZZ A;  1XMO M;  4CIS A;  3H4M A;  3QAU A;  4EIW A;  1K82 A;  4L4U A;  2KA6 B;  1XMQ M;  4DR3 M;  2C9O A;  5EP3 A;  2QPA A;  4QOS A;  3VLF B;  4X62 M;  4DV7 M;  2AHM A;  3D8B A;  3U61 A;  1QAM A;  4FWH A;  4RF0 A;  1NSF A;  3AKZ A;  5EP4 A;  4CHT B;  4GHA A;  2DZN B;  3GPX A;  5KPR A;  1IN8 A;  2XSZ A;  1XXH B;  3M7G A;  4DV1 M;  2V1U A;  2ZAM A;  2D7G A;  2C96 A;  2CFO A;  3FD9 A;  1ZAE A;  1N78 A;  4IBE A;  1TDZ A;  3RGP A;  3U6Q A;  2UUC M;  1MX0 A;  3NWL A;  2C98 A;  4WW0 A;  1PJJ A;  1X37 A;  3HKP A;  3SFZ A;  4IBD A;  1XXH A;  3KDS E;  5C1B A;  1IY0 A;  2F5N A;  1JQJ C;  4REZ A;  4PDI A;  5EXP A;  3U6C A;  1QVR A;  1OFI A;  4B7G A;  3GP1 A;  4WUR A;  1G59 A;  1R7R A;  1UM8 A;  1N32 M;  3NBI A;  2D7H A;  3B9P A;  2DHR A;  1E9R A;  4DV6 M;  1DGH A;  1W5T A;  1GKI A;  3TWM A;  3SAR A;  5DYG A;  2VII A;  1DO2 A;  4D81 A;  1HNZ M;  3SAS A;  3TWK A;  4LJ8 A;  5EXS A;  2LXE A;  3KSJ A;  5EQT A;  4XBO A;  3GRR A;  3FYC A;  2KEB A;  2Y20 A;  2Y21 A;  3AOE A;  4MB7 A;  1JR3 D;  3CF6 E;  4DV4 M;  2DVW B;  4JI2 M;  1NHG C;  3MK6 A;  2XZU A;  4B7F A;  3SMS A;  2XZF A;  2XFT A;  4DR2 M;  5ITX A;  5EXX A;  4M9Z A;  3KW6 A;  1ZQ9 A;  3J81 S;  1Z6T A;  3J80 S;  1N75 A;  1XHB A;  1T3T A;  2V1C A;  3SHG B;  5A2Q S;  2UUA M;  3CF2 A;  2VQF M;  2YR0 A;  7CAT A;  1J7K A;  1I4W A;  3HHX A;  4HLQ A;  1L2D A;  4NRV A;  4B7H A;  4B3R M;  4M0W A;  4X64 M;  4NRW A;  3L28 A;  2FE8 A;  3SYL A;  3GRV A;  2ZAO A;  1MU5 A;  1SXJ A;  3HU2 A;  4LF6 M;  2R4E A;  2L7H A;  4LZJ A;  5IZ7 D;  4GIP A;  4QNM A;  3SAW A;  1IBM M;  3D8L A;  4JI4 M;  2XSZ D;  3KVW A;  3TL4 X;  1HQC A;  4LJ5 A;  2UUB M;  4LY6 A;  3BOS A;  2CV2 A;  3I51 A;  1G4A E;  2CHV A;  3TWL A;  3FTC A;  4JXJ A;  5KO3 A;  3M0E A;  4OX9 M;  2K47 A;  1NY6 A;  1IN4 A;  3U6M A;  2F5P A;  3KOW E;  3L27 A;  3CF0 A;  4K0K M;  4GRI A;  4P16 A;  4LG2 A;  2NQ8 C;  3J27 B;  2LWX A;  3KOX E;  2RGO A;  3HGI A;  4QHT A;  3UZU A;  1QAO A;  1VDD A;  2R4J A;  4KHP M;  4QOZ C;  5GKN A;  1R2Y A;  3PFI A;  2L7I A;  2Z7J A;  4I5S A;  4DR5 M;  5FTN A;  3UGJ A;  4Z8X A;  1J09 A;  1JR3 A;  4B3T M;  3JR5 A;  1DGF A;  3MJ5 A;  1Z5A A;  1N36 M;  4OW0 A;  4B08 A;  1Q3B A;  3U61 B;  4D82 A;  2X4A A;  5KPZ A;  3AFH A;  3SBJ A;  4IBJ A;  4PCZ A;  1Q39 A;  2RGH A;  5DNY A;  4DV3 M;  5FTJ A;  4NOO B;  1QQW A;  2FOI C;  4JI7 M;  1OJL A;  2YNM D;  2QCU A;  3FUV A;  3GPY A;  4LGY A;  2EUC A;  3Q8X A;  3SAU A;  4BBA A;  2DZO B;  3VDP A;  1WXQ A;  4PT5 A;  4NSR A;  1J5E M;  4G4Q A;  2L09 A;  3SYK A;  4JI6 M;  2EO2 A;  3U6P A;  2QEN A;  3K92 A;  3KFU G;  3K2L A;  4AI6 A;  2QBY B;  1SXJ C;  1HNW M;  5JI3 E;  3E9S A;  2XEP A;  5H37 D;  5ITY A;  1IBL M;  4L16 A;  4GH9 A;  2EA0 A;  1ORY B;  2M5Z A;  4AW4 A;  4LFC M;  1SXJ D;  3FUW A;  3DFZ A;  4DR6 M;  4FCV A;  2QBY A;  1DGH B;  3A45 A;  3C58 A;  3KOY E;  5FTK A;  2YFQ A;  4II7 A;  3UJN A;  2ZAN A;  2G5G X;  1EE8 A;  4IIW A;  3HU3 A;  3PXG A;  3T38 A;  2CHQ A;  4AG5 A;  4G4O A;  4DR7 M;  2F5S A;  3GQ5 A;  4RF1 A;  4KLN A;  1G8P A;  1NJF A;  4I8O A;  3HHZ A;  1QYR A;  1HT1 E;  5E26 A;  3R9X B;  3CTW B;  1LV7 A;  1Q3C A;  5ITR A;  2R18 A;  5KPT A;  1K3X A;  3T15 A;  4M9X A;  5DYI A;  4FCW A;  3VK8 A;  4M9S A;  2HHH M;  5FTL A;  4LF9 M;  3ZC7 B;  5E6J A;  4PD2 A;  1PJI A;  3U6E A;  2P5T A;  1YSY A;  2KRU A;  4LJA A;  2W82 A;  4CGY B;  4G4N A;  2F5O A;  2H1R A;  1DO0 A;  1TH2 A;  5JI2 E;  2UXB M;  4AKH A;  1I94 M;  3PNY A;  2DWM A;  3HJS A;  5KQD A;  3R8F A;  3FTF A;  4GHL A;  3OTO M;  3GLG B;  3TE6 A;  4OU7 A;  1YUB A;  4TUW A;  1FNN A;  1DGG A;  2C5R A;  4L78 A;  1SXJ B;  3VK7 A;  4HL4 A;  2CV0 A;  2LNH C;  5IT9 S;  4IBC A;  1E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...