2UXCM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxcM02
1XC8A 4DR1M 4DV3M 4B3TM 1R2ZA 4LF8M 4JI3M 4JYAM 1K3XA 3A42A 2F5OA 4DV4M 1PJIA 3TWMA 1XMOM 1FJGM 4JI7M 3J7AS 5ITYA 2F5SA 2UUAM 5ITXA 4NXMM 4B3RM 3U6OA 4NXNM 1HNWM 5IT9S 1Q3CA 1L1TA 4ITQA 4G4OA 4DR4M 4JI4M 4GKJM 5ITXE 4PCZA 4AQYM 1HR0M 4LF6M 4JV5M 1Q39A 5BR8M 2HKJA 1XNRM 3VK8A 4DV2M 4CISA 1Z5AA 3J80S 4DR3M 3T1HM 1N36M 1K82A 3A45A 3GO8A 2F4VM 1PJJA 4LFAM 3GQ5A 4PDGA 2VQEM 1MX0A 3SAUA 1KFVA 5ITRA 4DV7M 3U6DA 4DV6M 1I94M 4LFBM 5LMUM 3SBJA 4LFCM 3DOAA 1L2DA 4B3MM 1L1ZA 3GPYA 3U6LA 3SASA 1TDHA 1TDZA 2E5LM 2Q2EB 4JI6M 2F5NA 4KHPM 4JI0M 4YHHM 5ITQA 1HNZM 2UXDM 1XNQM 2XZUA 4DV0M 2F5PA 4X64M 2UU9M 1Z59A 1N33M 3C58A 4LF5M 3JR5A 2UUBM 5ITUA 3GPUA 3SAVA 4JI5M 2UXBM 4NRVA 3GP1A 1L2CA 1Z5BA 4DR5M 5FLXS 5A2QS 2XZFA 1N34M 3T1YM 3TWLA 3U6CA 1IBMM 3SARA 3U6MA 3JR4A 4LF9M 1Q3BA 4LF4M 2ZM6M 4DUYM 3JAMS 4YY3M 4DR2M 3A46A 3VK7A 1EE8A 4PD2A 5LMNM 1IBLM 4OX9M 1Z5CA 1L2BA 4JI1M 2ZBKB 4X65M 4JI8M 4MB7A 1K3WA 3SATA 4K0KM 4DUZM 2HHHM 4G4NA 2UUCM 3W0FA 4G4QA 1N32M 3U6SA 3TWKA 2VQFM 2OPFA 3J81S 1XMQM 2F5QA 4JI2M 1HNXM 1IBKM 2UXCM 3U6QA 2OQ4A 3GPPA 4DV1M 4NRWA 4GKKM 1R2YA 3U6EA 1J5EM 4DR7M 2EA0A 4DV5M 3GQ3A 1MU5A 3U6PA 4PDIA 3SAWA 4LF7M 4B3SM 4X62M 5IWAM 3GPXA 1NNJA 5ITTA 4G4RA 1PM5A 3OTOM 4X66M 3GQ4A 4DR6M
chains in the Genus database with same CATH superfamily
2FH0A 1SXJE 3FYDA 1QAQA 3RE8A 3AKZA 1TH2A 1V34A 1E32A 7CATA 3HWSA 1R2ZA 3MK6A 4UN2B 3AJIB 3FTDA 4JI3M 4M0DA 4JYAM 2KW0A 4B7HA 1IN5A 1DV0A 1XMOM 4MGKE 3U61B 1NVMA 4IBJA 3NWLA 5DYGA 1S3SA 4NXMM 2WSCF 3KOZE 3C9PA 4QOZC 3KVWA 2BJWA 2OOBA 3K9OA 1ZV1A 4M0WA 3PXGA 3QWLA 3HZJA 3I4VA 1Q3CA 5L8RF 3KFUG 4AKGA 4G4OA 2DWMA 5EP2A 1PRBA 3IECA 3L27A 4P17A 3RGSA 1A5TA 4AQYM 1BVSA 2WZJA 1N77A 1QANA 2HCBA 1Q39A 1NHWC 1Y8GA 3H4JA 5BR8M 1E94E 2JA2A 4L4UA 4CISA 3J80S 3KS8A 1QZMA 1K82A 4A3VB 2JP7A 3GO8A 2G8LA 3RFWA 2Y21A 3FD9A 2VQEM 3M0EA 2CHGA 3LCUA 4LGYA 4CGYB 3KSXA 1I94M 4NSOB 3THGA 3DOAA 2RGHA 2MJ5B 1OAIA 4GRIA 3KDSE 3SASA 3LW5F 2QENA 3FRHA 1QUSA 3SFZA 1TDHA 2QP9X 2Q2EB 2XGNA 5C1BA 4KHPM 3I51A 2CHVA 2VF7A 3HHYA 5ITQA 4GMQA 2F5PA 4IBIA 1NY6A 1VEKA 1GJSA 1N33M 4KLNA 2ZANA 2RGOA 3JR5A 1QAMA 3GLHA 3V76A 2UXBM 1G8PA 3I4YA 3SHFA 3WHKA 3M6AA 5FLXS 2XZFA 2R62A 2RKOA 3WHLA 3MJ5A 3U6MA 1GL6A 3L2AA 3B9PA 5FTJA 4LF4M 1D2NA 1C1KA 1T6OA 1RU3A 2C9OA 3CF0A 3I04M 2LVOC 2D7HA 4DUYM 4QNRA 4YY3M 5JI3E 4OW0A 1G71A 5LMNM 3GRVA 1IBLM 2M60A 2K9DA 3GLHE 2VF8A 3KOYE 3FTCA 3PFIA 1NO1A 4FWDA 2ZAOA 4MB7A 4AG5A 4XGIA 1OFHA 2KHHA 1NY5A 2LXEA 2HHHM 3W0FA 3FTEA 4I8OA 3B89A 1SXJD 3U6SA 2FE8A 2QNJA 2JXNA 3J81S 1GLNA 4JI2M 1YUBA 1IBKM 2JY8A 4RNAA 2Z3XA 3SYLA 4IBKA 4BLCA 3B7NA 3B7ZA 2ZTCA 3HU1A 4FWGA 4LGMA 1R2YA 1G59A 1CUKA 4DR7M 2DAGA 4DV5M 1PJSA 3GQ3A 1MU5A 1MN3A 3AOEC 2G5GX 4ZPXA 3TPZA 3U5ZB 4D80A 1HJPA 1R5LA 1NNJA 5DNYA 1NV9A 3AOEA 2J5YA 3HJSA 4AZFA 2JY7A 1PM5A 2LBCA 1T3TA 1VEGA 3NBIA 2QBYA 4DR6M 1R6BX 1W5SA 4DR1M 2O25A 1V33A 2DWLA 4B3TM 4LF8M 2XSZA 4CIZA 3A42A 3IG8A 4DV4M 1VG5A 4REZA 1F4IA 2CEAA 4JI7M 3J7AS 3U60A 2F5SA 2L7HA 1G3IA 1NJGA 2G3QA 3HY5A 2CHQA 2D7EA 4LJ8A 2L4FA 2R44A 3DA1A 3LCVB 4R3DA 1T43A 2LVQD 2D7GA 2LH0A 3A98B 4NC6A 4QOSA 3DZDA 1TF0B 4Z8XA 1OQYA 1L1TA 4JXJA 4FCWA 4GH9A 3GLGB 1TR8A 4MM3B 2J7NA 3FUUA 1NHGC 3K2LA 1UM8A 2CV1A 1X37A 3ZH9B 4IBCA 3U61A 4PCZA 4JV5M 1HR0M 3CGWA 5EXTA 3C3DA 3GLGE 3QYEA 1XNRM 2MGWA 3E46A 1DO2A 4DV2M 1XB2B 1GL7A 1Z5AA 2FFJA 3T1HM 2XFSA 3HHXA 1XWIA 2F4VM 1PJJA 2C9CA 4FW9A 4M9SA 4L8RC 4PDGA 1MX0A 3KOWE 4MGIE 4DV7M 3U6DA 4IJFA 2OO9A 4LFBM 3LVWA 3L26A 1JR3A 4I4LA 3HKPA 4B3MM 2LHGA 2KRKA 3GPYA 5EQTA 1W5TA 1TDZA 4LJAA 5DYIA 1NV8A 3DFZA 5FTMA 3VDPA 1XNQM 4KT0F 2Z4SA 3PNYA 2UU9M 3ZC7B 4Z6YA 2XEPA 5KPTA 2R65A 2Y0TA 4RF1A 3T38A 4LF5M 2DZOB 4MGYE 2UUBM 5ITUA 1LTMA 1WHCA 3VFDA 1JR3E 3SMSA 1QZEA 5FSWA 1L2CA 2KRUA 2LWXA 3SC3A 1Z5BA 1IY0A 3SARA 1R7RA 3KW6A 3B74A 4F1IA 2WSEF 1QYRA 2LVPC 4G6ZA 2CFOA 2L7IA 2LNHC 4GC5A 1OTRA 2K0BX 4EIWA 3TQSA 4R7GA 2GQFA 3VK7A 5H37D 2CP8A 1IN4A 2R6FA 2DZNB 4S12A 4AG6A 1Z5CA 1L2BA 4JI1M 1QDTA 2ZBKB 2QSFX 2FNAA 3HHWA 5EP4A 2P5TA 4MGZE 1K3WA 1NJFA 4K0KM 4II7A 1GABA 3AV0A 1TH4A 3C3EA 4LJ7A 3KS4A 3ZCBB 1YE9A 2JNHA 1WXQA 4WW0A 4I81A 3FE3A 2DAKA 4MH0E 2EKFA 3AOGA 2I7NA 4QHTA 1IM2A 1Z6TA 4LY6A 3GPPA 3HHZA 3K9PA 3UK6A 4P16A 4GKKM 4Q7JA 4GITA 2VIIA 4FCTA 2VDBB 5KQ8A 4ANRA 3VKHA 3FUVA 3W68A 2DI0A 3CF6E 1D0KA 2HAKA 1IY1A 3EIEA 2ERCA 2CRUA 2DHRA 2XSZD 5ITTA 4L16A 2LVAA 4G4RA 3L25A 3OTOM 3GLIB 3HU3A 3IG5A 4LRTA 4RF0A 4OVZB 2CV0A 2A5YB 2HWJA 2M5ZA 2APLA 3PNVA 4QHSA 1IN6A 3QYBA 2CE7A 2DNAA 1E9RA 3T15A 1NNUC 1FJGM 3R9XB 1L8QA 2KDLA 3BXWA 5ITYA 2UUAM 3T6PA 1IQPA 2MR9A 1VEJA 2H5XA 1HNWM 4TUWA 5F3WA 5EXSA 3W0LB 5IT9S 2DAIA 2H1RA 1YLAA 4M9XA 3TE6A 2KXEA 2DWNA 2WSFF 3MMPA 4DBGB 2JZ0A 1FNNA 2EO2A 2DENA 4JI4M 4LF6M 4GKJM 3GRRA 4LJ6A 3L28A 2Y0QA 3K1JA 2HKJA 2V1CA 1XXHB 3D8LA 2MH8A 1ZAEA 2DHYA 4R71A 3UGJA 4DR3M 2LVNC 1JR3D 5C18A 1PJTA 2L2DA 2MROB 4CJ6A 2HL7A 1TGUA 1PGYA 1XXHE 2R46A 2R45A 3KOXE 3GLFB 3SAUA 1ZMUA 1KFVA 5ITRA 3FYCA 1QQWA 1HT2E 5FTNA 3GLGA 1IN8A 3K92A 1OAOC 3NBXX 4DV6M 1IXZA 3AL0C 2YNMD 3SBJA 3MHVC 2LHCA 2ZAMA 4HLQA 1R4GA 2B3TA 2DAEA 5BPVA 2DKLA 4L78A 1DO0A 4JI0M 2K6BA 3I01M 2V6ZM 4B08A 2XZUA 3FTFA 3ILKA 3IHPA 4IBBA 2BJVA 2KEBA 1C7YA 1IXSB 3F92A 3E21A 3KXEC 1N75A 4LJ9A 1DGFA 2I7PA 4JN6A 3Q8GA 4LJ4A 3M7GA 3SAVA 3L29A 3LVVA 4AW4A 3CTWB 4NRVA 1E9SA 3GP1A 4DR5M 1OKSA 5KPZA 5A2QS 2Y20A 3T1YM 3PVSA 2EKKA 5GKNA 5KPRA 1VQ1A 1NSFA 4LF9M 3HJQA 3UZUA 2ZM6M 4LZZA 2XF3A 4GC9A 1GVNA 3FKEA 4GEWA 4LZJA 1JB0F 3A46A 2DXIA 1SXJB 2R4EA 4PD2A 4OX9M 4NL4H 2JY6B 2KNZA 2YFQA 3J7BA 4L15A 4M9ZA 2Z4RA 4CHTB 4X65M 3SATA 1HT1E 1PJQA 1WGNA 5EP1A 4IBGA 4G4NA 3J2PB 4IIWA 2UUCM 4LRSA 2V1UA 1N32M 2QQ8A 4D82A 1TTEA 1HNXM 1DGHB 3FUXA 1ORYB 1Q02A 2UXCM 4AI6A 1QAOA 3TL4X 3U6QA 1D0LA 4NRWA 2R4JA 4HEOA 3U6EA 1KSFX 2L09A 5KO3A 1J5EM 2EA0A 1QVRA 1IFYA 1G4AE 2QCUA 4PDIA 4FCVA 3HU2A 4L6V6 3SAWA 4LF7M 2K47A 4X62M 4B3SM 4AKIA 2FS1A 1OIZA 1SG9A 5KQDA 2GNOA 4PT5A 2KZUA 4XBOA 2KNAA 3QAUA 1ZMWA 4X66M 3GQ4A 3AFHA 1H6UA 1XC8A 3Q8XA 3LQRA 1HQYE 8CATA 1V92A 3FUTA 2JUJA 4DV3M 2J7OA 3UMMA 3K8ZA 1K3XA 2F5OA 2X49A 1PJIA 2QPAA 3TWMA 2XH9A 3D8BA 5ITXA 4BBAA 3SYKA 1HQCA 4DV1M 4IBFA 3KP0E 4XK8F 3KP1E 4QNMA 4B3RM 4FD2A 2QZ4A 1OJLA 3EIHA 4W5WA 4NXNM 3GLIA 3U6OA 1OFIA 2AHMA 2C99A 5EJCA 1TH3A 1WJ7A 2W82A 4HL4A 4ITQA 2L4EA 4OVZA 4DR4M 2C98A 1IXRC 3BOSA 1JQJC 2DZLA 4LCBA 3SMPA 5ITXE 3H4MA 2CUZA 3GRYA 4KO8A 5DFLA 4IBEA 3R8FA 2NQ8C 3VK8A 3UJNA 5FTLA 1N36M 5E26A 3GLIE 4D81A 3A45A 1YSYA 4B7FA 3CF2A 4LFAM 3HGIA 3GQ5A 2BWEA 3U5ZA 2DWZB 3E4RA 1D0MA 3LMMA 2OOAA 5LMUM 2JWSA 1ZQ9A 3GLHB 2EJSA 1UFZA 3ZQJA 1L2DA 3BBZA 4LFCM 1L1ZA 3U6LA 4NOOB 5EP3A 2KNVA 4WP2A 4MGHA 1XXHA 2E5LM 2C5RA 4JI6M 2F5NA 4AKHA 4YHHM 2XLJA 1HNZM 2UXDM 4RKUF 4DV0M 4G3OA 4NSRA 4LJ5A 2DVWB 1WIVA 1Z59A 2Z8YM 4X64M 2BNKA 3GLFA 3C58A 2CWBA 2KZSA 3J27B 1DGGA 3GPUA 2FOIC 4JI5M 4KODA 3VDUA 1ZMVA 4F2LA 1IBMM 1N34M 3B7QA 2X4AA 3TWLA 3U6CA 2EUCA 1GO5A 2RRUA 5IZ7D 3FRIA 4GHAA 3JR4A 1G41A 4OU7A 1AIPC 1Q3BA 2DAMA 5FTKA 1P3QQ 3VLFB 5JI2E 5IREB 4B7GA 4GIPA 1J09A 2KA6B 3GLFE 1EIJA 4IBDA 1WR1B 3GRUA 1IXSA 3W67A 3JAMS 2O5RA 4DR2M 1EE8A 2LTUA 3E9SA 5E6JA 1GJTA 1N78A 2JY5A 2QHOB 3RGPA 4Y28F 1LV7A 2CV2A 4JI8M 2YR0A 1DGBA 2X8AA 4DUZM 1XHBA 2L6OA 3HJ8A 3SHGB 4G4QA 3TWKA 2VQFM 2OPFA 2F5QA 1XMQM 1QDRA 1VDLA 4FVMA 4I5SA 1KYIA 1GKIA 1SXJC 4IJEA 4WURA 2N35A 1OIPA 2Z7JA 2XFTA 3FUWA 4FWHA 4BB9A 2OQ4A 1EFUB 2QBYB 4LG2A 3LQQA 5EXXA 1SXJA 2ZTDA 2C96A 1IY2A 1VDDA 3VKGA 2JZ1A 5EXPA 1QUTA 3KSJA 1IN7A 3U6PA 1MJGM 3U60B 2BWBA 1WGLA 3HX3A 1J7KA 1I4WA 2O01F 5IWAM 1DGHA 3GPXA 2R18A 1AUAA 2YQZA 4GHLA 2R0IA
chains in the Genus database with same CATH topology
1SXJE 3FYDA 1QAQA 3RE8A 3AKZA 1TH2A 1E32A 7CATA 3HWSA 1R2ZA 3MK6A 4JI3M 3AJIB 3FTDA 4JYAM 4M0DA 2KW0A 4B7HA 1IN5A 1XMOM 4MGKE 3U61B 1NVMA 4IBJA 3NWLA 5DYGA 1S3SA 4NXMM 3KOZE 4QOZC 3KVWA 2BJWA 4M0WA 3PXGA 3QWLA 3I4VA 1Q3CA 3KFUG 4AKGA 4G4OA 2DWMA 5EP2A 3L27A 3RGSA 4AQYM 1N77A 1QANA 2HCBA 1Q39A 1NHWC 5BR8M 1E94E 2JA2A 4L4UA 4CISA 3J80S 3KS8A 1QZMA 1K82A 4A3VB 3GO8A 2G8LA 3RFWA 2Y21A 3FD9A 2VQEM 3M0EA 2CHGA 4LGYA 4CGYB 3KSXA 1I94M 4NSOB 3THGA 3DOAA 2RGHA 4GRIA 3KDSE 3SASA 2QENA 3SFZA 1TDHA 2QP9X 2Q2EB 2XGNA 5C1BA 4KHPM 3I51A 2CHVA 3HHYA 5ITQA 4GMQA 2F5PA 4IBIA 1NY6A 1N33M 4KLNA 2ZANA 2RGOA 3JR5A 1QAMA 3GLHA 2UXBM 1G8PA 3I4YA 3SHFA 3WHKA 3M6AA 5FLXS 2XZFA 2R62A 2RKOA 3WHLA 3MJ5A 3U6MA 1GL6A 3L2AA 3B9PA 5FTJA 4LF4M 1D2NA 1C1KA 2C9OA 3CF0A 4DUYM 2D7HA 4QNRA 4YY3M 5JI3E 4OW0A 5LMNM 3GRVA 1IBLM 2M60A 3KOYE 3PFIA 3FTCA 4FWDA 2ZAOA 4MB7A 4AG5A 4XGIA 1OFHA 2LXEA 1NY5A 2HHHM 3FTEA 3W0FA 4I8OA 3U6SA 1SXJD 2FE8A 3J81S 4JI2M 1GLNA 1YUBA 1IBKM 4RNAA 2Z3XA 3SYLA 4IBKA 4BLCA 4FWGA 3HU1A 4LGMA 1R2YA 1G59A 4DR7M 4DV5M 3GQ3A 1MU5A 3AOEC 2G5GX 4ZPXA 3TPZA 3U5ZB 4D80A 1NNJA 5DNYA 3AOEA 3HJSA 4AZFA 1PM5A 1T3TA 3NBIA 2QBYA 4DR6M 1R6BX 1W5SA 4DR1M 2DWLA 4B3TM 4LF8M 2XSZA 3A42A 3IG8A 4DV4M 4REZA 2CEAA 4JI7M 3J7AS 3U60A 2F5SA 2L7HA 1G3IA 1NJGA 2CHQA 2D7EA 4LJ8A 3DA1A 4R3DA 3A98B 2D7GA 2LH0A 4QOSA 3DZDA 4Z8XA 1L1TA 4JXJA 4FCWA 4GH9A 3GLGB 4MM3B 2J7NA 3FUUA 1NHGC 3K2LA 1UM8A 2CV1A 1X37A 3ZH9B 4IBCA 3U61A 4PCZA 4JV5M 1HR0M 5EXTA 1XNRM 1DO2A 4DV2M 1GL7A 1Z5AA 2FFJA 3T1HM 2XFSA 3HHXA 1XWIA 2F4VM 1PJJA 2C9CA 4FW9A 4M9SA 4L8RC 4PDGA 1MX0A 3KOWE 4MGIE 4DV7M 3U6DA 4IJFA 4LFBM 3LVWA 3L26A 1JR3A 4I4LA 3HKPA 4B3MM 2KRKA 3GPYA 5EQTA 1W5TA 1TDZA 4LJAA 5DYIA 3DFZA 3VDPA 5FTMA 1XNQM 2Z4SA 3PNYA 2UU9M 3ZC7B 4Z6YA 2XEPA 5KPTA 2R65A 2Y0TA 4RF1A 3T38A 4LF5M 2DZOB 4MGYE 2UUBM 5ITUA 3VFDA 3SMSA 5FSWA 1L2CA 2KRUA 2LWXA 3SC3A 1Z5BA 1IY0A 3SARA 1R7RA 3KW6A 1QYRA 4G6ZA 2CFOA 2L7IA 2LNHC 4GC5A 4EIWA 3TQSA 4R7GA 3VK7A 5H37D 4S12A 1IN4A 2DZNB 4AG6A 1Z5CA 1L2BA 4JI1M 2ZBKB 2FNAA 3HHWA 5EP4A 2P5TA 4MGZE 1K3WA 1NJFA 4K0KM 4II7A 3AV0A 1TH4A 4LJ7A 3KS4A 3ZCBB 1YE9A 1WXQA 4WW0A 4I81A 4MH0E 3AOGA 2I7NA 4QHTA 1IM2A 1Z6TA 4LY6A 3GPPA 3HHZA 3UK6A 4DV1M 4P16A 4GKKM 4GITA 2VIIA 4FCTA 5KQ8A 3VKHA 3FUVA 3CF6E 1IY1A 3EIEA 2ERCA 2DHRA 2XSZD 5ITTA 4L16A 4G4RA 3L25A 3OTOM 3GLIB 3HU3A 3IG5A 4LRTA 4RF0A 4OVZB 2CV0A 2A5YB 2M5ZA 3PNVA 4QHSA 1IN6A 2CE7A 1E9RA 3T15A 1NNUC 1FJGM 3R9XB 1L8QA 5ITYA 2UUAM 1IQPA 1HNWM 4TUWA 5F3WA 5EXSA 3W0LB 5IT9S 2H1RA 4M9XA 3TE6A 2KXEA 2DWNA 1FNNA 2EO2A 4JI4M 4GKJM 4LF6M 3GRRA 4LJ6A 3L28A 2Y0QA 3K1JA 2HKJA 2V1CA 1XXHB 3D8LA 1ZAEA 3UGJA 4DR3M 1JR3D 5C18A 2HL7A 1TGUA 2R46A 3KOXE 2R45A 3GLFB 3SAUA 1KFVA 5ITRA 3FYCA 1QQWA 1HT2E 5FTNA 3GLGA 1IN8A 3K92A 4DV6M 1IXZA 3AL0C 2YNMD 3SBJA 3MHVC 2ZAMA 4HLQA 5BPVA 4L78A 1DO0A 4JI0M 2V6ZM 4B08A 2XZUA 3FTFA 3ILKA 4IBBA 2BJVA 2KEBA 1IXSB 3KXEC 4LJ9A 1N75A 1DGFA 2I7PA 4JN6A 4LJ4A 3SAVA 3M7GA 3L29A 3LVVA 4AW4A 3CTWB 4NRVA 1E9SA 3GP1A 4DR5M 5KPZA 5A2QS 2Y20A 3T1YM 3PVSA 5KPRA 5GKNA 1NSFA 4LF9M 3HJQA 3UZUA 2ZM6M 4LZZA 2XF3A 4GC9A 1GVNA 3FKEA 4LZJA 3A46A 2DXIA 1SXJB 2R4EA 4PD2A 4OX9M 4NL4H 2YFQA 3J7BA 4L15A 4M9ZA 2Z4RA 4CHTB 4X65M 3SATA 1HT1E 5EP1A 4IBGA 4G4NA 3J2PB 4IIWA 2UUCM 4LRSA 2V1UA 1N32M 4D82A 1HNXM 1DGHB 3FUXA 1ORYB 2UXCM 4AI6A 1QAOA 3TL4X 3U6QA 4NRWA 2R4JA 3U6EA 1KSFX 2L09A 5KO3A 1J5EM 2EA0A 1QVRA 1G4AE 2QCUA 4PDIA 4FCVA 3HU2A 3SAWA 4LF7M 2K47A 4X62M 4B3SM 4AKIA 5KQDA 4PT5A 2KZUA 4XBOA 3QAUA 4X66M 3GQ4A 3AFHA 1H6UA 1XC8A 3Q8XA 3LQRA 1HQYE 8CATA 3FUTA 4DV3M 2J7OA 3UMMA 3K8ZA 1K3XA 2F5OA 2X49A 1PJIA 2QPAA 3TWMA 2XH9A 3D8BA 5ITXA 4BBAA 3SYKA 1HQCA 4IBFA 3KP0E 3KP1E 4QNMA 4B3RM 4FD2A 2QZ4A 1OJLA 3EIHA 4W5WA 4NXNM 3GLIA 3U6OA 1OFIA 2AHMA 2C99A 5EJCA 1TH3A 2W82A 4HL4A 4ITQA 4OVZA 4DR4M 2C98A 1IXRC 3BOSA 1JQJC 4LCBA 3SMPA 5ITXE 3H4MA 2CUZA 3GRYA 4KO8A 4IBEA 3R8FA 2NQ8C 3VK8A 3UJNA 5FTLA 1N36M 5E26A 4D81A 3A45A 1YSYA 4B7FA 3CF2A 4LFAM 3HGIA 3GQ5A 3U5ZA 2DWZB 3E4RA 3LMMA 5LMUM 1ZQ9A 3GLHB 4LFCM 1L2DA 1L1ZA 3U6LA 4NOOB 5EP3A 4MGHA 1XXHA 2E5LM 2C5RA 4JI6M 2F5NA 4AKHA 4YHHM 2XLJA 1HNZM 2UXDM 4DV0M 4NSRA 4LJ5A 2DVWB 1Z59A 4X64M 2BNKA 3GLFA 3C58A 2KZSA 3J27B 1DGGA 3GPUA 2FOIC 4JI5M 4KODA 3VDUA 1IBMM 1N34M 2X4AA 3TWLA 3U6CA 2EUCA 5IZ7D 4GHAA 3JR4A 1G41A 4OU7A 1Q3BA 5FTKA 3VLFB 5JI2E 5IREB 4B7GA 4GIPA 1J09A 2KA6B 4IBDA 3GRUA 3JAMS 4DR2M 2O5RA 1EE8A 3E9SA 5E6JA 1N78A 3RGPA 1LV7A 2CV2A 4JI8M 2YR0A 1DGBA 2X8AA 4DUZM 1XHBA 2L6OA 3HJ8A 3SHGB 4G4QA 3TWKA 2VQFM 2OPFA 2F5QA 1XMQM 4FVMA 4I5SA 1KYIA 1GKIA 1SXJC 4IJEA 4WURA 3FUWA 2Z7JA 2XFTA 4FWHA 4BB9A 2OQ4A 2QBYB 4LG2A 3LQQA 5EXXA 1SXJA 2C96A 1IY2A 1VDDA 3VKGA 5EXPA 3KSJA 1IN7A 3U6PA 3U60B 1J7KA 1I4WA 5IWAM 1DGHA 3GPXA 2R18A 2YQZA 4GHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC8 A;  4DR1 M;  4DV3 M;  4B3T M;  1R2Z A;  4LF8 M;  4JI3 M;  4JYA M;  1K3X A;  3A42 A;  2F5O A;  4DV4 M;  1PJI A;  3TWM A;  1XMO M;  1FJG M;  4JI7 M;  3J7A S;  5ITY A;  2F5S A;  2UUA M;  5ITX A;  4NXM M;  4B3R M;  3U6O A;  4NXN M;  1HNW M;  5IT9 S;  1Q3C A;  1L1T A;  4ITQ A;  4G4O A;  4DR4 M;  4JI4 M;  4GKJ M;  5ITX E;  4PCZ A;  4AQY M;  1HR0 M;  4LF6 M;  4JV5 M;  1Q39 A;  5BR8 M;  2HKJ A;  1XNR M;  3VK8 A;  4DV2 M;  4CIS A;  1Z5A A;  3J80 S;  4DR3 M;  3T1H M;  1N36 M;  1K82 A;  3A45 A;  3GO8 A;  2F4V M;  1PJJ A;  4LFA M;  3GQ5 A;  4PDG A;  2VQE M;  1MX0 A;  3SAU A;  1KFV A;  5ITR A;  4DV7 M;  3U6D A;  4DV6 M;  1I94 M;  4LFB M;  5LMU M;  3SBJ A;  4LFC M;  3DOA A;  1L2D A;  4B3M M;  1L1Z A;  3GPY A;  3U6L A;  3SAS A;  1TDH A;  1TDZ A;  2E5L M;  2Q2E B;  4JI6 M;  2F5N A;  4KHP M;  4JI0 M;  4YHH M;  5ITQ A;  1HNZ M;  2UXD M;  1XNQ M;  2XZU A;  4DV0 M;  2F5P A;  4X64 M;  2UU9 M;  1Z59 A;  1N33 M;  3C58 A;  4LF5 M;  3JR5 A;  2UUB M;  5ITU A;  3GPU A;  3SAV A;  4JI5 M;  2UXB M;  4NRV A;  3GP1 A;  1L2C A;  1Z5B A;  4DR5 M;  5FLX S;  5A2Q S;  2XZF A;  1N34 M;  3T1Y M;  3TWL A;  3U6C A;  1IBM M;  3SAR A;  3U6M A;  3JR4 A;  4LF9 M;  1Q3B A;  4LF4 M;  2ZM6 M;  4DUY M;  3JAM S;  4YY3 M;  4DR2 M;  3A46 A;  3VK7 A;  1EE8 A;  4PD2 A;  5LMN M;  1IBL M;  4OX9 M;  1Z5C A;  1L2B A;  4JI1 M;  2ZBK B;  4X65 M;  4JI8 M;  4MB7 A;  1K3W A;  3SAT A;  4K0K M;  4DUZ M;  2HHH M;  4G4N A;  2UUC M;  3W0F A;  4G4Q A;  1N32 M;  3U6S A;  3TWK A;  2VQF M;  2OPF A;  3J81 S;  1XMQ M;  2F5Q A;  4JI2 M;  1HNX M;  1IBK M;  2UXC M;  3U6Q A;  2OQ4 A;  3GPP A;  4DV1 M;  4NRW A;  4GKK M;  1R2Y A;  3U6E A;  1J5E M;  4DR7 M;  2EA0 A;  4DV5 M;  3GQ3 A;  1MU5 A;  3U6P A;  4PDI A;  3SAW A;  4LF7 M;  4B3S M;  4X62 M;  5IWA M;  3GPX A;  1NNJ A;  5ITT A;  4G4R A;  1PM5 A;  3OTO M;  4X66 M;  3GQ4 A;  4DR6 M; 
#chains in the Genus database with same CATH topology
 2FH0 A;  1SXJ E;  3FYD A;  1QAQ A;  3RE8 A;  3AKZ A;  1TH2 A;  1V34 A;  1E32 A;  7CAT A;  3HWS A;  1R2Z A;  3MK6 A;  4UN2 B;  3AJI B;  3FTD A;  4JI3 M;  4M0D A;  4JYA M;  2KW0 A;  4B7H A;  1IN5 A;  1DV0 A;  1XMO M;  4MGK E;  3U61 B;  1NVM A;  4IBJ A;  3NWL A;  5DYG A;  1S3S A;  4NXM M;  2WSC F;  3KOZ E;  3C9P A;  4QOZ C;  3KVW A;  2BJW A;  2OOB A;  3K9O A;  1ZV1 A;  4M0W A;  3PXG A;  3QWL A;  3HZJ A;  3I4V A;  1Q3C A;  5L8R F;  3KFU G;  4AKG A;  4G4O A;  2DWM A;  5EP2 A;  1PRB A;  3IEC A;  3L27 A;  4P17 A;  3RGS A;  1A5T A;  4AQY M;  1BVS A;  2WZJ A;  1N77 A;  1QAN A;  2HCB A;  1Q39 A;  1NHW C;  1Y8G A;  3H4J A;  5BR8 M;  1E94 E;  2JA2 A;  4L4U A;  4CIS A;  3J80 S;  3KS8 A;  1QZM A;  1K82 A;  4A3V B;  2JP7 A;  3GO8 A;  2G8L A;  3RFW A;  2Y21 A;  3FD9 A;  2VQE M;  3M0E A;  2CHG A;  3LCU A;  4LGY A;  4CGY B;  3KSX A;  1I94 M;  4NSO B;  3THG A;  3DOA A;  2RGH A;  2MJ5 B;  1OAI A;  4GRI A;  3KDS E;  3SAS A;  3LW5 F;  2QEN A;  3FRH A;  1QUS A;  3SFZ A;  1TDH A;  2QP9 X;  2Q2E B;  2XGN A;  5C1B A;  4KHP M;  3I51 A;  2CHV A;  2VF7 A;  3HHY A;  5ITQ A;  4GMQ A;  2F5P A;  4IBI A;  1NY6 A;  1VEK A;  1GJS A;  1N33 M;  4KLN A;  2ZAN A;  2RGO A;  3JR5 A;  1QAM A;  3GLH A;  3V76 A;  2UXB M;  1G8P A;  3I4Y A;  3SHF A;  3WHK A;  3M6A A;  5FLX S;  2XZF A;  2R62 A;  2RKO A;  3WHL A;  3MJ5 A;  3U6M A;  1GL6 A;  3L2A A;  3B9P A;  5FTJ A;  4LF4 M;  1D2N A;  1C1K A;  1T6O A;  1RU3 A;  2C9O A;  3CF0 A;  3I04 M;  2LVO C;  2D7H A;  4DUY M;  4QNR A;  4YY3 M;  5JI3 E;  4OW0 A;  1G71 A;  5LMN M;  3GRV A;  1IBL M;  2M60 A;  2K9D A;  3GLH E;  2VF8 A;  3KOY E;  3FTC A;  3PFI A;  1NO1 A;  4FWD A;  2ZAO A;  4MB7 A;  4AG5 A;  4XGI A;  1OFH A;  2KHH A;  1NY5 A;  2LXE A;  2HHH M;  3W0F A;  3FTE A;  4I8O A;  3B89 A;  1SXJ D;  3U6S A;  2FE8 A;  2QNJ A;  2JXN A;  3J81 S;  1GLN A;  4JI2 M;  1YUB A;  1IBK M;  2JY8 A;  4RNA A;  2Z3X A;  3SYL A;  4IBK A;  4BLC A;  3B7N A;  3B7Z A;  2ZTC A;  3HU1 A;  4FWG A;  4LGM A;  1R2Y A;  1G59 A;  1CUK A;  4DR7 M;  2DAG A;  4DV5 M;  1PJS A;  3GQ3 A;  1MU5 A;  1MN3 A;  3AOE C;  2G5G X;  4ZPX A;  3TPZ A;  3U5Z B;  4D80 A;  1HJP A;  1R5L A;  1NNJ A;  5DNY A;  1NV9 A;  3AOE A;  2J5Y A;  3HJS A;  4AZF A;  2JY7 A;  1PM5 A;  2LBC A;  1T3T A;  1VEG A;  3NBI A;  2QBY A;  4DR6 M;  1R6B X;  1W5S A;  4DR1 M;  2O25 A;  1V33 A;  2DWL A;  4B3T M;  4LF8 M;  2XSZ A;  4CIZ A;  3A42 A;  3IG8 A;  4DV4 M;  1VG5 A;  4REZ A;  1F4I A;  2CEA A;  4JI7 M;  3J7A S;  3U60 A;  2F5S A;  2L7H A;  1G3I A;  1NJG A;  2G3Q A;  3HY5 A;  2CHQ A;  2D7E A;  4LJ8 A;  2L4F A;  2R44 A;  3DA1 A;  3LCV B;  4R3D A;  1T43 A;  2LVQ D;  2D7G A;  2LH0 A;  3A98 B;  4NC6 A;  4QOS A;  3DZD A;  1TF0 B;  4Z8X A;  1OQY A;  1L1T A;  4JXJ A;  4FCW A;  4GH9 A;  3GLG B;  1TR8 A;  4MM3 B;  2J7N A;  3FUU A;  1NHG C;  3K2L A;  1UM8 A;  2CV1 A;  1X37 A;  3ZH9 B;  4IBC A;  3U61 A;  4PCZ A;  4JV5 M;  1HR0 M;  3CGW A;  5EXT A;  3C3D A;  3GLG E;  3QYE A;  1XNR M;  2MGW A;  3E46 A;  1DO2 A;  4DV2 M;  1XB2 B;  1GL7 A;  1Z5A A;  2FFJ A;  3T1H M;  2XFS A;  3HHX A;  1XWI A;  2F4V M;  1PJJ A;  2C9C A;  4FW9 A;  4M9S A;  4L8R C;  4PDG A;  1MX0 A;  3KOW E;  4MGI E;  4DV7 M;  3U6D A;  4IJF A;  2OO9 A;  4LFB M;  3LVW A;  3L26 A;  1JR3 A;  4I4L A;  3HKP A;  4B3M M;  2LHG A;  2KRK A;  3GPY A;  5EQT A;  1W5T A;  1TDZ A;  4LJA A;  5DYI A;  1NV8 A;  3DFZ A;  5FTM A;  3VDP A;  1XNQ M;  4KT0 F;  2Z4S A;  3PNY A;  2UU9 M;  3ZC7 B;  4Z6Y A;  2XEP A;  5KPT A;  2R65 A;  2Y0T A;  4RF1 A;  3T38 A;  4LF5 M;  2DZO B;  4MGY E;  2UUB M;  5ITU A;  1LTM A;  1WHC A;  3VFD A;  1JR3 E;  3SMS A;  1QZE A;  5FSW A;  1L2C A;  2KRU A;  2LWX A;  3SC3 A;  1Z5B A;  1IY0 A;  3SAR A;  1R7R A;  3KW6 A;  3B74 A;  4F1I A;  2WSE F;  1QYR A;  2LVP C;  4G6Z A;  2CFO A;  2L7I A;  2LNH C;  4GC5 A;  1OTR A;  2K0B X;  4EIW A;  3TQS A;  4R7G A;  2GQF A;  3VK7 A;  5H37 D;  2CP8 A;  1IN4 A;  2R6F A;  2DZN B;  4S12 A;  4AG6 A;  1Z5C A;  1L2B A;  4JI1 M;  1QDT A;  2ZBK B;  2QSF X;  2FNA A;  3HHW A;  5EP4 A;  2P5T A;  4MGZ E;  1K3W A;  1NJF A;  4K0K M;  4II7 A;  1GAB A;  3AV0 A;  1TH4 A;  3C3E A;  4LJ7 A;  3KS4 A;  3ZCB B;  1YE9 A;  2JNH A;  1WXQ A;  4WW0 A;  4I81 A;  3FE3 A;  2DAK A;  4MH0 E;  2EKF A;  3AOG A;  2I7N A;  4QHT A;  1IM2 A;  1Z6T A;  4LY6 A;  3GPP A;  3HHZ A;  3K9P A;  3UK6 A;  4P16 A;  4GKK M;  4Q7J A;  4GIT A;  2VII A;  4FCT A;  2VDB B;  5KQ8 A;  4ANR A;  3VKH A;  3FUV A;  3W68 A;  2DI0 A;  3CF6 E;  1D0K A;  2HAK A;  1IY1 A;  3EIE A;  2ERC A;  2CRU A;  2DHR A;  2XSZ D;  5ITT A;  4L16 A;  2LVA A;  4G4R A;  3L25 A;  3OTO M;  3GLI B;  3HU3 A;  3IG5 A;  4LRT A;  4RF0 A;  4OVZ B;  2CV0 A;  2A5Y B;  2HWJ A;  2M5Z A;  2APL A;  3PNV A;  4QHS A;  1IN6 A;  3QYB A;  2CE7 A;  2DNA A;  1E9R A;  3T15 A;  1NNU C;  1FJG M;  3R9X B;  1L8Q A;  2KDL A;  3BXW A;  5ITY A;  2UUA M;  3T6P A;  1IQP A;  2MR9 A;  1VEJ A;  2H5X A;  1HNW M;  4TUW A;  5F3W A;  5EXS A;  3W0L B;  5IT9 S;  2DAI A;  2H1R A;  1YLA A;  4M9X A;  3TE6 A;  2KXE A;  2DWN A;  2WSF F;  3MMP A;  4DBG B;  2JZ0 A;  1FNN A;  2EO2 A;  2DEN A;  4JI4 M;  4LF6 M;  4GKJ M;  3GRR A;  4LJ6 A;  3L28 A;  2Y0Q A;  3K1J A;  2HKJ A;  2V1C A;  1XXH B;  3D8L A;  2MH8 A;  1ZAE A;  2DHY A;  4R71 A;  3UGJ A;  4DR3 M;  2LVN C;  1JR3 D;  5C18 A;  1PJT A;  2L2D A;  2MRO B;  4CJ6 A;  2HL7 A;  1TGU A;  1PGY A;  1XXH E;  2R46 A;  2R45 A;  3KOX E;  3GLF B;  3SAU A;  1ZMU A;  1KFV A;  5ITR A;  3FYC A;  1QQW A;  1HT2 E;  5FTN A;  3GLG A;  1IN8 A;  3K92 A;  1OAO C;  3NBX X;  4DV6 M;  1IXZ A;  3AL0 C;  2YNM D;  3SBJ A;  3MHV C;  2LHC A;  2ZAM A;  4HLQ A;  1R4G A;  2B3T A;  2DAE A;  5BPV A;  2DKL A;  4L78 A;  1DO0 A;  4JI0 M;  2K6B A;  3I01 M;  2V6Z M;  4B08 A;  2XZU A;  3FTF A;  3ILK A;  3IHP A;  4IBB A;  2BJV A;  2KEB A;  1C7Y A;  1IXS B;  3F92 A;  3E21 A;  3KXE C;  1N75 A;  4LJ9 A;  1DGF A;  2I7P A;  4JN6 A;  3Q8G A;  4LJ4 A;  3M7G A;  3SAV A;  3L29 A;  3LVV A;  4AW4 A;  3CTW B;  4NRV A;  1E9S A;  3GP1 A;  4DR5 M;  1OKS A;  5KPZ A;  5A2Q S;  2Y20 A;  3T1Y M;  3PVS A;  2EKK A;  5GKN A;  5KPR A;  1VQ1 A;  1NSF A;  4LF9 M;  3HJQ A;  3UZU A;  2ZM6 M;  4LZZ A;  2XF3 A;  4GC9 A;  1GVN A;  3FKE A;  4GEW A;  4LZJ A;  1JB0 F;  3A46 A;  2DXI A;  1SXJ B;  2R4E A;  4PD2 A;  4OX9 M;  4NL4 H;  2JY6 B;  2KNZ A;  2YFQ A;  3J7B A;  4L15 A;  4M9Z A;  2Z4R A;  4CHT B;  4X65 M;  3SAT A;  1HT1 E;  1PJQ A;  1WGN A;  5EP1 A;  4IBG A;  4G4N A;  3J2P B;  4IIW A;  2UUC M;  4LRS A;  2V1U A;  1N32 M;  2QQ8 A;  4D82 A;  1TTE A;  1HNX M;  1DGH B;  3FUX A;  1ORY B;  1Q02 A;  2UXC M;  4AI6 A;  1QAO A;  3TL4 X;  3U6Q A;  1D0L A;  4NRW A;  2R4J A;  4HEO A;  3U6E A;  1KSF X;  2L09 A;  5KO3 A;  1J5E M;  2EA0 A;  1QVR A;  1IFY A;  1G4A E;  2QCU A;  4PDI A;  4FCV A;  3HU2 A;  4L6V 6;  3SAW A;  4LF7 M;  2K47 A;  4X62 M;  4B3S M;  4AKI A;  2FS1 A;  1OIZ A;  1SG9 A;  5KQD A;  2GNO A;  4PT5 A;  2KZU A;  4XBO A;  2KNA A;  3QAU A;  1ZMW A;  4X66 M;  3GQ4 A;  3AFH A;  1H6U A;  1XC8 A;  3Q8X A;  3LQR A;  1HQY E;  8CAT A;  1V92 A;  3FUT A;  2JUJ A;  4DV3 M;  2J7O A;  3UMM A;  3K8Z A;  1K3X A;  2F5O A;  2X49 A;  1PJI A;  2QPA A;  3TWM A;  2XH9 A;  3D8B A;  5ITX A;  4BBA A;  3SYK A;  1HQC A;  4DV1 M;  4IBF A;  3KP0 E;  4XK8 F;  3KP1 E;  4QNM A;  4B3R M;  4FD2 A;  2QZ4 A;  1OJL A;  3EIH A;  4W5W A;  4NXN M;  3GLI A;  3U6O A;  1OFI A;  2AHM A;  2C99 A;  5EJC A;  1TH3 A;  1WJ7 A;  2W82 A;  4HL4 A;  4ITQ A;  2L4E A;  4OVZ A;  4DR4 M;  2C98 A;  1IXR C;  3BOS A;  1JQJ C;  2DZL A;  4LCB A;  3SMP A;  5ITX E;  3H4M A;  2CUZ A;  3GRY A;  4KO8 A;  5DFL A;  4IBE A;  3R8F A;  2NQ8 C;  3VK8 A;  3UJN A;  5FTL A;  1N36 M;  5E26 A;  3GLI E;  4D81 A;  3A45 A;  1YSY A;  4B7F A;  3CF2 A;  4LFA M;  3HGI A;  3GQ5 A;  2BWE A;  3U5Z A;  2DWZ B;  3E4R A;  1D0M A;  3LMM A;  2OOA A;  5LMU M;  2JWS A;  1ZQ9 A;  3GLH B;  2EJS A;  1UFZ A;  3ZQJ A;  1L2D A;  3BBZ A;  4LFC M;  1L1Z A;  3U6L A;  4NOO B;  5EP3 A;  2KNV A;  4WP2 A;  4MGH A;  1XXH A;  2E5L M;  2C5R A;  4JI6 M;  2F5N A;  4AKH A;  4YHH M;  2XLJ A;  1HNZ M;  2UXD M;  4RKU F;  4DV0 M;  4G3O A;  4NSR A;  4LJ5 A;  2DVW B;  1WIV A;  1Z59 A;  2Z8Y M;  4X64 M;  2BNK A;  3GLF A;  3C58 A;  2CWB A;  2KZS A;  3J27 B;  1DGG A;  3GPU A;  2FOI C;  4JI5 M;  4KOD A;  3VDU A;  1ZMV A;  4F2L A;  1IBM M;  1N34 M;  3B7Q A;  2X4A A;  3TWL A;  3U6C A;  2EUC A;  1GO5 A;  2RRU A;  5IZ7 D;  3FRI A;  4GHA A;  3JR4 A;  1G41 A;  4OU7 A;  1AIP C;  1Q3B A;  2DAM A;  5FTK A;  1P3Q Q;  3VLF B;  5JI2 E;  5IRE B;  4B7G A;  4GIP A;  1J09 A;  2KA6 B;  3GLF E;  1EIJ A;  4IBD A;  1WR1 B;  3GRU A;  1IXS A;  3W67 A;  3JAM S;  2O5R A;  4DR2 M;  1EE8 A;  2LTU A;  3E9S A;  5E6J A;  1GJT A;  1N78 A;  2JY5 A;  2QHO B;  3RGP A;  4Y28 F;  1LV7 A;  2CV2 A;  4JI8 M;  2YR0 A;  1DGB A;  2X8A A;  4DUZ M;  1XHB A;  2L6O A;  3HJ8 A;  3SHG B;  4G4Q A;  3TWK A;  2VQF M;  2OPF A;  2F5Q A;  1XMQ M;  1QDR A;  1VDL A;  4FVM A;  4I5S A;  1KYI A;  1GKI A;  1SXJ C;  4IJE A;  4WUR A;  2N35 A;  1OIP A;  2Z7J A;  2XFT A;  3FUW A;  4FWH A;  4BB9 A;  2OQ4 A;  1EFU B;  2QBY B;  4LG2 A;  3LQQ A;  5EXX A;  1SXJ A;  2ZTD A;  2C96 A;  1IY2 A;  1VDD A;  3VKG A;  2JZ1 A;  5EXP A;  1QUT A;  3KSJ A;  1IN7 A;  3U6P A;  1MJG M;  3U60 B;  2BWB A;  1WGL A;  3HX3 A;  1J7K A;  1I4W A;  2O01 F;  5IWA M;  1DGH A;  3GPX A;  2R18 A;  1AUA A;  2YQZ A;  4GHL A;  2R0I A; 
#chains in the Genus database with same CATH homology
 1SXJ E;  3FYD A;  1QAQ A;  3RE8 A;  3AKZ A;  1TH2 A;  1E32 A;  7CAT A;  3HWS A;  1R2Z A;  3MK6 A;  4JI3 M;  3AJI B;  3FTD A;  4JYA M;  4M0D A;  2KW0 A;  4B7H A;  1IN5 A;  1XMO M;  4MGK E;  3U61 B;  1NVM A;  4IBJ A;  3NWL A;  5DYG A;  1S3S A;  4NXM M;  3KOZ E;  4QOZ C;  3KVW A;  2BJW A;  4M0W A;  3PXG A;  3QWL A;  3I4V A;  1Q3C A;  3KFU G;  4AKG A;  4G4O A;  2DWM A;  5EP2 A;  3L27 A;  3RGS A;  4AQY M;  1N77 A;  1QAN A;  2HCB A;  1Q39 A;  1NHW C;  5BR8 M;  1E94 E;  2JA2 A;  4L4U A;  4CIS A;  3J80 S;  3KS8 A;  1QZM A;  1K82 A;  4A3V B;  3GO8 A;  2G8L A;  3RFW A;  2Y21 A;  3FD9 A;  2VQE M;  3M0E A;  2CHG A;  4LGY A;  4CGY B;  3KSX A;  1I94 M;  4NSO B;  3THG A;  3DOA A;  2RGH A;  4GRI A;  3KDS E;  3SAS A;  2QEN A;  3SFZ A;  1TDH A;  2QP9 X;  2Q2E B;  2XGN A;  5C1B A;  4KHP M;  3I51 A;  2CHV A;  3HHY A;  5ITQ A;  4GMQ A;  2F5P A;  4IBI A;  1NY6 A;  1N33 M;  4KLN A;  2ZAN A;  2RGO A;  3JR5 A;  1QAM A;  3GLH A;  2UXB M;  1G8P A;  3I4Y A;  3SHF A;  3WHK A;  3M6A A;  5FLX S;  2XZF A;  2R62 A;  2RKO A;  3WHL A;  3MJ5 A;  3U6M A;  1GL6 A;  3L2A A;  3B9P A;  5FTJ A;  4LF4 M;  1D2N A;  1C1K A;  2C9O A;  3CF0 A;  4DUY M;  2D7H A;  4QNR A;  4YY3 M;  5JI3 E;  4OW0 A;  5LMN M;  3GRV A;  1IBL M;  2M60 A;  3KOY E;  3PFI A;  3FTC A;  4FWD A;  2ZAO A;  4MB7 A;  4AG5 A;  4XGI A;  1OFH A;  2LXE A;  1NY5 A;  2HHH M;  3FTE A;  3W0F A;  4I8O A;  3U6S A;  1SXJ D;  2FE8 A;  3J81 S;  4JI2 M;  1GLN A;  1YUB A;  1IBK M;  4RNA A;  2Z3X A;  3SYL A;  4IBK A;  4BLC A;  4FWG A;  3HU1 A;  4LGM A;  1R2Y A;  1G59 A;  4DR7 M;  4DV5 M;  3GQ3 A;  1MU5 A;  3AOE C;  2G5G X;  4ZPX A;  3TPZ A;  3U5Z B;  4D80 A;  1NNJ A;  5DNY A;  3AOE A;  3HJS A;  4AZF A;  1PM5 A;  1T3T A;  3NBI A;  2QBY A;  4DR6 M;  1R6B X;  1W5S A;  4DR1 M;  2DWL A;  4B3T M;  4LF8 M;  2XSZ A;  3A42 A;  3IG8 A;  4DV4 M;  4REZ A;  2CEA A;  4JI7 M;  3J7A S;  3U60 A;  2F5S A;  2L7H A;  1G3I A;  1NJG A;  2CHQ A;  2D7E A;  4LJ8 A;  3DA1 A;  4R3D A;  3A98 B;  2D7G A;  2LH0 A;  4QOS A;  3DZD A;  4Z8X A;  1L1T A;  4JXJ A;  4FCW A;  4GH9 A;  3GLG B;  4MM3 B;  2J7N A;  3FUU A;  1NHG C;  3K2L A;  1UM8 A;  2CV1 A;  1X37 A;  3ZH9 B;  4IBC A;  3U61 A;  4PCZ A;  4JV5 M;  1HR0 M;  5EXT A;  1XNR M;  1DO2 A;  4DV2 M;  1GL7 A;  1Z5A A;  2FFJ A;  3T1H M;  2XFS A;  3HHX A;  1XWI A;  2F4V M;  1PJJ A;  2C9C A;  4FW9 A;  4M9S A;  4L8R C;  4PDG A;  1MX0 A;  3KOW E;  4MGI E;  4DV7 M;  3U6D A;  4IJF A;  4LFB M;  3LVW A;  3L26 A;  1JR3 A;  4I4L A;  3HKP A;  4B3M M;  2KRK A;  3GPY A;  5EQT A;  1W5T A;  1TDZ A;  4LJA A;  5DYI A;  3DFZ A;  3VDP A;  5FTM A;  1XNQ M;  2Z4S A;  3PNY A;  2UU9 M;  3ZC7 B;  4Z6Y A;  2XEP A;  5KPT A;  2R65 A;  2Y0T A;  4RF1 A;  3T38 A;  4LF5 M;  2DZO B;  4MGY E;  2UUB M;  5ITU A;  3VFD A;  3SMS A;  5FSW A;  1L2C A;  2KRU A;  2LWX A;  3SC3 A;  1Z5B A;  1IY0 A;  3SAR A;  1R7R A;  3KW6 A;  1QYR A;  4G6Z A;  2CFO A;  2L7I A;  2LNH C;  4GC5 A;  4EIW A;  3TQS A;  4R7G A;  3VK7 A;  5H37 D;  4S12 A;  1IN4 A;  2DZN B;  4AG6 A;  1Z5C A;  1L2B A;  4JI1 M;  2ZBK B;  2FNA A;  3HHW A;  5EP4 A;  2P5T A;  4MGZ E;  1K3W A;  1NJF A;  4K0K M;  4II7 A;  3AV0 A;  1TH4 A;  4LJ7 A;  3KS4 A;  3ZCB B;  1YE9 A;  1WXQ A;  4WW0 A;  4I81 A;  4MH0 E;  3AOG A;  2I7N A;  4QHT A;  1IM2 A;  1Z6T A;  4LY6 A;  3GPP A;  3HHZ A;  3UK6 A;  4DV1 M;  4P16 A;  4GKK M;  4GIT A;  2VII A;  4FCT A;  5KQ8 A;  3VKH A;  3FUV A;  3CF6 E;  1IY1 A;  3EIE A;  2ERC A;  2DHR A;  2XSZ D;  5ITT A;  4L16 A;  4G4R A;  3L25 A;  3OTO M;  3GLI B;  3HU3 A;  3IG5 A;  4LRT A;  4RF0 A;  4OVZ B;  2CV0 A;  2A5Y B;  2M5Z A;  3PNV A;  4QHS A;  1IN6 A;  2CE7 A;  1E9R A;  3T15 A;  1NNU C;  1FJG M;  3R9X B;  1L8Q A;  5ITY A;  2UUA M;  1IQP A;  1HNW M;  4TUW A;  5F3W A;  5EXS A;  3W0L B;  5IT9 S;  2H1R A;  4M9X A;  3TE6 A;  2KXE A;  2DWN A;  1FNN A;  2EO2 A;  4JI4 M;  4GKJ M;  4LF6 M;  3GRR A;  4LJ6 A;  3L28 A;  2Y0Q A;  3K1J A;  2HKJ A;  2V1C A;  1XXH B;  3D8L A;  1ZAE A;  3UGJ A;  4DR3 M;  1JR3 D;  5C18 A;  2HL7 A;  1TGU A;  2R46 A;  3KOX E;  2R45 A;  3GLF B;  3SAU A;  1KFV A;  5ITR A;  3FYC A;  1QQW A;  1HT2 E;  5FTN A;  3GLG A;  1IN8 A;  3K92 A;  4DV6 M;  1IXZ A;  3AL0 C;  2YNM D;  3SBJ A;  3MHV C;  2ZAM A;  4HLQ A;  5BPV A;  4L78 A;  1DO0 A;  4JI0 M;  2V6Z M;  4B08 A;  2XZU A;  3FTF A;  3ILK A;  4IBB A;  2BJV A;  2KEB A;  1IXS B;  3KXE C;  4LJ9 A;  1N75 A;  1DGF A;  2I7P A;  4JN6 A;  4LJ4 A;  3SAV A;  3M7G A;  3L29 A;  3LVV A;  4AW4 A;  3CTW B;  4NRV A;  1E9S A;  3GP1 A;  4DR5 M;  5KPZ A;  5A2Q S;  2Y20 A;  3T1Y M;  3PVS A;  5KPR A;  5GKN A;  1NSF A;  4LF9 M;  3HJQ A;  3UZU A;  2ZM6 M;  4LZZ A;  2XF3 A;  4GC9 A;  1GVN A;  3FKE A;  4LZJ A;  3A46 A;  2DXI A;  1SXJ B;  2R4E A;  4PD2 A;  4OX9 M;  4NL4 H;  2YFQ A;  3J7B A;  4L15 A;  4M9Z A;  2Z4R A;  4CHT B;  4X65 M;  3SAT A;  1HT1 E;  5EP1 A;  4IBG A;  4G4N A;  3J2P B;  4IIW A;  2UUC M;  4LRS A;  2V1U A;  1N32 M;  4D82 A;  1HNX M;  1DGH B;  3FUX A;  1ORY B;  2UXC M;  4AI6 A;  1QAO A;  3TL4 X;  3U6Q A;  4NRW A;  2R4J A;  3U6E A;  1KSF X;  2L09 A;  5KO3 A;  1J5E M;  2EA0 A;  1QVR A;  1G4A E;  2QCU A;  4PDI A;  4FCV A;  3HU2 A;  3SAW A;  4LF7 M;  2K47 A;  4X62 M;  4B3S M;  4AKI A;  5KQD A;  4PT5 A;  2KZU A;  4XBO A;  3QAU A;  4X66 M;  3GQ4 A;  3AFH A;  1H6U A;  1XC8 A;  3Q8X A;  3LQR A;  1HQY E;  8CAT A;  3FUT A;  4DV3 M;  2J7O A;  3UMM A;  3K8Z A;  1K3X A;  2F5O A;  2X49 A;  1PJI A;  2QPA A;  3TWM A;  2XH9 A;  3D8B A;  5ITX A;  4BBA A;  3SYK A;  1HQC A;  4IBF A;  3KP0 E;  3KP1 E;  4QNM A;  4B3R M;  4FD2 A;  2QZ4 A;  1OJL A;  3EIH A;  4W5W A;  4NXN M;  3GLI A;  3U6O A;  1OFI A;  2AHM A;  2C99 A;  5EJC A;  1TH3 A;  2W82 A;  4HL4 A;  4ITQ A;  4OVZ A;  4DR4 M;  2C98 A;  1IXR C;  3BOS A;  1JQJ C;  4LCB A;  3SMP A;  5ITX E;  3H4M A;  2CUZ A;  3GRY A;  4KO8 A;  4IBE A;  3R8F A;  2NQ8 C;  3VK8 A;  3UJN A;  5FTL A;  1N36 M;  5E26 A;  4D81 A;  3A45 A;  1YSY A;  4B7F A;  3CF2 A;  4LFA M;  3HGI A;  3GQ5 A;  3U5Z A;  2DWZ B;  3E4R A;  3LMM A;  5LMU M;  1ZQ9 A;  3GLH B;  4LFC M;  1L2D A;  1L1Z A;  3U6L A;  4NOO B;  5EP3 A;  4MGH A;  1XXH A;  2E5L M;  2C5R A;  4JI6 M;  2F5N A;  4AKH A;  4YHH M;  2XLJ A;  1HNZ M;  2UXD M;  4DV0 M;  4NSR A;  4LJ5 A;  2DVW B;  1Z59 A;  4X64 M;  2BNK A;  3GLF A;  3C58 A;  2KZS A;  3J27 B;  1DGG A;  3GPU A;  2FOI C;  4JI5 M;  4KOD A;  3VDU A;  1IBM M;  1N34 M;  2X4A A;  3TWL A;  3U6C A;  2EUC A;  5IZ7 D;  4GHA A;  3JR4 A;  1G41 A;  4OU7 A;  1Q3B A;  5FTK A;  3VLF B;  5JI2 E;  5IRE B;  4B7G A;  4GIP A;  1J09 A;  2KA6 B;  4IBD A;  3GRU A;  3JAM S;  4DR2 M;  2O5R A;  1EE8 A;  3E9S A;  5E6J A;  1N78 A;  3RGP A;  1LV7 A;  2CV2 A;  4JI8 M;  2YR0 A;  1DGB A;  2X8A A;  4DUZ M;  1XHB A;  2L6O A;  3HJ8 A;  3SHG B;  4G4Q A;  3TWK A;  2VQF M;  2OPF A;  2F5Q A;  1XMQ M;  4FVM A;  4I5S A;  1KYI A;  1GKI A;  1SXJ C;  4IJE A;  4WUR A;  3FUW A;  2Z7J A;  2XFT A;  4FWH A;  4BB9 A;  2OQ4 A;  2QBY B;  4LG2 A;  3LQQ A;  5EXX A;  1SXJ A;  2C96 A;  1IY2 A;  1VDD A;  3VKG A;  5EXP A;  3KSJ A;  1IN7 A;  3U6P A;  3U60 B;  1J7K A;  1I4W A;  5IWA M;  1DGH A;  3GPX A;  2R18 A;  2YQZ A;  4GHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...