2UXCM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxcM02
4ITQA 5ITUA 4G4OA 3JAMS 2F5PA 4JI2M 1Z5BA 3TWLA 1MX0A 4JYAM 4NRVA 4DV3M 1Z59A 4JI4M 1XMOM 1IBKM 5LMNM 1IBMM 1XNQM 2ZBKB 4JI3M 1L1ZA 2OQ4A 4JI0M 1PM5A 1L1TA 4LF7M 4DV7M 3U6SA 4DUZM 5A2QS 4DV0M 4B3MM 3GP1A 3SATA 3GQ3A 4PDIA 4X64M 5BR8M 3U6PA 4JV5M 4DUYM 3A42A 1L2CA 3SAWA 5LMUM 4LF4M 4DR6M 3U6OA 4DV4M 1Q3CA 4JI6M 3VK7A 4JI5M 5ITYA 2VQFM 3DOAA 4LF8M 1K82A 1PJJA 3JR4A 3T1HM 4DV2M 4GKKM 1KFVA 1N32M 1K3XA 3VK8A 2UUBM 4B3RM 4DR5M 2HKJA 3W0FA 1MU5A 3A46A 2F5OA 4LFAM 2XZFA 5FLXS 4G4QA 1R2YA 1Q39A 1I94M 5IT9S 5ITQA 2F5NA 4JI7M 4NXMM 1Z5CA 3SAUA 4GKJM 5ITXA 1TDZA 3J81S 5ITRA 3A45A 3JR5A 4NXNM 4PD2A 2E5LM 3GPYA 2VQEM 2F5QA 4LFBM 5IWAM 1K3WA 4NRWA 4CISA 2UXDM 1HNWM 3U6MA 3T1YM 5ITTA 3TWKA 3U6DA 3SASA 4DR3M 5ITXE 3GQ5A 4DR1M 3J7AS 1J5EM 2ZM6M 1R2ZA 1L2DA 4LFCM 1XMQM 4YY3M 3GQ4A 2XZUA 3GPXA 3TWMA 1HNXM 3GPUA 3J80S 4B3SM 1N34M 2F5SA 4DR4M 3U6QA 4AQYM 4B3TM 2UXCM 1Z5AA 4DV5M 4DV1M 4DR2M 4G4NA 4PDGA 1N36M 2OPFA 1PJIA 4YHHM 1FJGM 1L2BA 2HHHM 1N33M 4X66M 4OX9M 3OTOM 4G4RA 1IBLM 1XC8A 4LF5M 2UUCM 2F4VM 1HR0M 2UXBM 4JI1M 1TDHA 3GO8A 3U6LA 4X65M 3U6EA 4LF9M 4PCZA 3GPPA 3C58A 4K0KM 3SAVA 1NNJA 4MB7A 1EE8A 1Q3BA 3SBJA 2UUAM 3SARA 4KHPM 1HNZM 2EA0A 2UU9M 4DV6M 4LF6M 2Q2EB 4X62M 4DR7M 3U6CA 1XNRM 4JI8M
chains in the Genus database with same CATH superfamily
2K6BA 2WSCF 3AFHA 3TL4X 2JA2A 4L16A 3L2AA 1Z5BA 5EXSA 3TWLA 4II7A 2LHGA 4MH0E 1XXHE 4JYAM 4Z8XA 2L7HA 1T3TA 1SXJC 5EQTA 1JQJC 1L1ZA 4JI3M 5EP1A 4QNRA 3B89A 3FUXA 2DNAA 4IBGA 4DV7M 5EP2A 4DUZM 1RU3A 2GQFA 2JWSA 4KODA 4G3OA 2HWJA 2B3TA 4FCWA 4X64M 4MGHA 5BR8M 3U5ZB 3VKHA 3F92A 3VLFB 1DGHB 3DFZA 2KRKA 2QP9X 3VDUA 1L2CA 1IXSB 2L7IA 1DGFA 2YNMD 3ZC7B 3U6OA 2QCUA 1NY5A 4DR6M 3HY5A 4QOSA 2EJSA 4RF1A 3CTWB 5C1BA 1HT2E 2LVOC 1L8QA 4KLNA 3HKPA 3PXGA 2JXNA 1IM2A 4LF8M 1E9RA 4GHAA 1WGNA 1K82A 3KVWA 3FUWA 2RRUA 4DV2M 2L4FA 1Z6TA 1WR1B 1VDLA 2D7GA 2MJ5B 1K3XA 2LTUA 2V1UA 4B3RM 1I4WA 4DR5M 1MU5A 3MJ5A 2XZFA 5JI3E 2APLA 3K8ZA 4G4QA 3E9SA 1IN4A 3AOGA 1R2YA 2OOBA 4MGYE 2J5YA 3AKZA 1TF0B 4OVZB 1PJSA 1E94E 5IZ7D 4M0WA 2R4EA 4FVMA 1XXHA 3QWLA 4R3DA 3B7QA 4PD2A 1GO5A 1TH4A 1E9SA 5F3WA 4D82A 5IWAM 1MJGM 3GLGB 3DA1A 2DVWB 3AOEA 3LVVA 2X8AA 2ZAMA 4JXJA 4L4UA 1QDRA 3U6DA 3Q8GA 4D80A 3GQ5A 4D81A 4PT5A 2XGNA 2G8LA 4AZFA 2ZM6M 1GKIA 3GLHB 3GRVA 2DKLA 4YY3M 1QDTA 2BWBA 2DI0A 1SXJA 2L4EA 2FNAA 1ZMVA 3CF6E 3J80S 2C9CA 2D7HA 4WW0A 1PJQA 4HLQA 4B3SM 1N34M 2HCBA 2CFOA 2Y0QA 1YLAA 4B7GA 2MROB 4IIWA 2CV0A 2QBYB 5FTKA 4DV5M 3RGSA 3SHGB 4G4NA 3PVSA 4YHHM 2J7OA 1FJGM 1WXQA 3ZH9B 5FTNA 2HHHM 1VEJA 4X66M 1LTMA 2KZSA 3OTOM 1G8PA 2JZ0A 4UN2B 2JP7A 4FCTA 2H1RA 2DWZB 3K9OA 2UUCM 3AV0A 3HU1A 4LG2A 1IY1A 1XXHB 3EIHA 1BVSA 3FUUA 4JI1M 2RKOA 1NO1A 1ZQ9A 3KFUG 2VF8A 2L09A 3HJQA 2LVNC 3KSXA 1EE8A 3WHLA 4BBAA 4Z6YA 5KPZA 2UU9M 3K9PA 1F4IA 2FFJA 2M60A 3GLGE 2GNOA 4X62M 4DR7M 2EUCA 3L25A 1JB0F 3TE6A 3SMPA 3IG5A 3UGJA 5ITUA 2JZ1A 4ITQA 2DXIA 4LF9M 4RNAA 2WSEF 4JI2M 2CHQA 5EP4A 2D7EA 5DFLA 2CHVA 2KW0A 3C3EA 1V92A 3FD9A 4L8RC 3GLHE 2CHGA 4G6ZA 1OFIA 1XNQM 2K0BX 2RGOA 2ZBKB 2X49A 5KPRA 4JI0M 4I81A 2DWMA 2DAMA 2OOAA 5KQDA 4LF7M 2K47A 5GKNA 5FTMA 1G71A 1GL7A 2CE7A 2CUZA 2DZOB 3J27B 5A2QS 4DV0M 3WHKA 3EIEA 1D2NA 2XEPA 4Q7JA 3B74A 1XB2B 5KQ8A 1VEKA 1YSYA 3K1JA 2KZUA 2DHRA 3A42A 3SAWA 1NY6A 3W0LB 4JI6M 1VEGA 1GVNA 1ZMUA 1VQ1A 3GLHA 3VKGA 2QNJA 2C98A 1PJJA 4NSOB 3JR4A 4CHTB 3T1HM 4GKKM 3R8FA 1IFYA 4FWHA 3V76A 2ZTCA 3RFWA 3A46A 1DGHA 2F5OA 4LFAM 3QYBA 4NC6A 1A5TA 1OIZA 3B7NA 1QZEA 1I94M 1QUSA 4LRTA 3AL0C 2KNZA 3Q8XA 1T43A 4GEWA 4GIPA 3QAUA 4CGYB 5ITQA 3RGPA 1V33A 1E32A 4REZA 4FWGA 1Z5CA 2DHYA 3SC3A 1G4AE 2R45A 1TH2A 2LWXA 5FTLA 2R0IA 3J81S 3ZCBB 3GPYA 1EIJA 5DYIA 2VQEM 2F5QA 4IBDA 3AOEC 3L29A 4B3MM 4OVZA 1PGYA 2Z7JA 2MH8A 2K9DA 1R7RA 3GRYA 2XSZA 3FTCA 2UXDM 2V6ZM 3U6MA 4FW9A 1QUTA 1OFHA 3SASA 2JUJA 4DR3M 1SXJD 1NV9A 1G59A 1L2DA 3I04M 2ERCA 3B7ZA 3I51A 3E4RA 1J7KA 2XZUA 3GPXA 1X37A 3TWMA 4HEOA 2G3QA 3LVWA 5BPVA 1IN5A 3CF2A 1IY2A 3A98B 3RE8A 3W68A 1HQCA 3CGWA 3I4VA 3IECA 1VDDA 2C9OA 3U6QA 3THGA 4AQYM 4TUWA 4R7GA 4L6V6 3PNYA 1N36M 2Z4SA 1PJIA 4F1IA 2QQ8A 4CIZA 2KXEA 1L2BA 1W5SA 4IBFA 3K2LA 1IN7A 2CP8A 4OX9M 2DAGA 4G4RA 2DZNB 4LJ6A 4WURA 2VF7A 4L78A 2R62A 3T6PA 4LGMA 4LJ8A 1NHWC 5FSWA 3UMMA 5L8RF 1TDHA 1Y8GA 1QQWA 2CV2A 1N78A 2FH0A 4MGIE 4X65M 1NJGA 4QOZC 3SYKA 3HZJA 3HU2A 2MGWA 3C58A 3KDSE 1OAIA 1JR3A 2AHMA 1WJ7A 2LVQD 3SBJA 2V1CA 5FTJA 1HNZM 2EA0A 2RGHA 1ZAEA 2L6OA 4DV6M 2C99A 3SMSA 5H37D 4LGYA 5E26A 3U6CA 3LW5F 4FD2A 5KPTA 1SXJE 2R46A 4P17A 3GRUA 4IJEA 1MX0A 4FWDA 4NRVA 4DV3M 1AIPC 4JI4M 3L28A 3GLFB 3K92A 5LMNM 1IBMM 3D8LA 3BBZA 1DGGA 4RF0A 2VIIA 3KOYE 1G3IA 2QSFX 2R18A 2LH0A 3ILKA 2WZJA 4KO8A 3U6SA 4LZZA 1GL6A 4LJ9A 4LRSA 4ANRA 3DZDA 1R6BX 4B08A 2KRUA 2I7PA 3VDPA 1KYIA 3NWLA 1DV0A 4DUYM 4QHTA 3I01M 2LVPC 2VDBB 3QYEA 3AJIB 5LMUM 4LF4M 1NVMA 2DAIA 2FE8A 4JI5M 1OQYA 1J09A 3KXEC 2Y20A 1IN6A 1P3QQ 2EO2A 5ITYA 7CATA 4M9ZA 3U5ZA 3BXWA 2L2DA 4IBKA 4I4LA 5EXXA 3KOXE 3BOSA 4I8OA 2DZLA 1N32M 2YQZA 4I5SA 3HHYA 2HKJA 3LCUA 1LV7A 4LY6A 4MGKE 4IJFA 4M9XA 4P16A 8CATA 5FLXS 4AKGA 5EXPA 1TGUA 3HWSA 4AKIA 3T15A 1N75A 4W5WA 3FRHA 4JI7M 1DGBA 4NXMM 2H5XA 3FYDA 2QZ4A 2XFSA 5ITXA 4XGIA 4DBGB 1TDZA 1NJFA 4GC9A 2C5RA 5ITRA 1TTEA 3A45A 3JR5A 2E5LM 1TR8A 3C3DA 3HJ8A 4LFBM 3HU3A 4NRWA 4XK8F 2ZAOA 3HJSA 4CISA 1Q02A 1W5TA 2HL7A 1OJLA 2N35A 4GRIA 2JY6B 2Y21A 2CRUA 3FUTA 1C1KA 1FNNA 3GLIE 4GITA 2O25A 3J7AS 2JY5A 4LZJA 1GABA 1J5EM 3M0EA 1T6OA 2R6FA 3KSJA 2KNVA 1HNXM 2XLJA 3D8BA 1QZMA 1ZMWA 4GH9A 5JI2E 1NSFA 2BJWA 1UM8A 4GMQA 2Z3XA 1C7YA 2F5SA 4B7FA 4HL4A 3W67A 2UXCM 3ZQJA 4BB9A 1R4GA 2O5RA 4DV1M 4DR2M 2OPFA 4L15A 3MMPA 1ZV1A 3LMMA 3M6AA 1SXJB 2OO9A 1IBLM 3GLIA 3IG8A 3TQSA 5EXTA 2WSFF 1XC8A 2DAEA 1HR0M 2UXBM 1IXRC 3HHXA 1NV8A 3GO8A 4JN6A 3GLFE 1IXSA 4F2LA 1QVRA 2FOIC 1GLNA 4PCZA 3E21A 4GHLA 3U61B 4OU7A 1NNJA 3KOWE 1KSFX 4WP2A 1Q3BA 3GLGA 2UUAM 3M7GA 1YUBA 1OKSA 2QENA 3HHZA 2Q2EB 3B9PA 4FCVA 1EFUB 1AUAA 2CWBA 1XNRM 4JI8M 4A3VB 1NNUC 2KEBA 4G4OA 3MK6A 3JAMS 2C96A 2I7NA 4MM3B 1GJSA 2F5PA 1OIPA 1UFZA 1DO0A 2MR9A 4XBOA 3TPZA 1QAOA 1Z59A 2KNAA 1XMOM 1IBKM 1R5LA 2OQ4A 2Y0TA 3KOZE 1PM5A 2XSZD 1L1TA 4MGZE 2ZANA 3GRRA 3NBIA 3L26A 3HGIA 1WGLA 4AI6A 1XHBA 3FTDA 1QAQA 3H4MA 3UK6A 3GP1A 2X4AA 4NL4H 2W82A 3SHFA 3GQ3A 4PDIA 3SATA 2HAKA 1D0LA 1WHCA 3C9PA 2LVAA 1SG9A 2ZTDA 3U6PA 4JV5M 3LQRA 4NOOB 3VFDA 4DV4M 1Q3CA 3VK7A 4IBJA 1MN3A 1IN8A 2XF3A 3KP0E 1D0MA 2LXEA 4AG5A 3DOAA 2VQFM 2O01F 1ORYB 4IBIA 4LJAA 3KW6A 4QHSA 3UZUA 3FKEA 3LQQA 4R71A 1KFVA 2DWNA 3VK8A 2UUBM 3U60A 2JY7A 3W0FA 2XH9A 3FYCA 3IHPA 3J2PB 2A5YB 4AKHA 4OW0A 4IBBA 1Q39A 3KS8A 5IT9S 2XFTA 2BJVA 3GLIB 2F5NA 1H6UA 3FTFA 4LJ4A 1NHGC 2YFQA 3FUVA 3SAUA 2CEAA 4GKJM 2P5TA 4GC5A 3L27A 1XWIA 1PRBA 1JR3D 2R4JA 3GLFA 3H4JA 4NXNM 3U60B 3FTEA 2EKKA 4M0DA 4EIWA 2QPAA 4IBCA 2R65A 2DENA 2Z8YM 3T38A 1K3WA 4LJ5A 2J7NA 3PNVA 4S12A 3U61A 3J7BA 2KDLA 1S3SA 1HNWM 2DWLA 2DAKA 4KT0F 1DO2A 1QANA 1YE9A 3T1YM 1TH3A 5ITTA 1IY0A 3TWKA 3R9XB 1GJTA 2NQ8C 3FE3A 2R44A 4AW4A 2G5GX 2KA6B 5ITXE 4DR1M 5E6JA 1IXZA 2LNHC 3CF0A 3I4YA 3PFIA 4ZPXA 4AG6A 1R2ZA 4LFCM 1XMQM 2QBYA 3NBXX 2Z4RA 3GQ4A 2QHOB 5EJCA 3E46A 3GPUA 2KHHA 1V34A 1PJTA 2JY8A 1G41A 5DYGA 2LBCA 2JNHA 2LHCA 2BNKA 1IQPA 1VG5A 2M5ZA 4DR4M 1HQYE 1OAOC 5C18A 4B3TM 1Z5AA 5DNYA 5IREB 2FS1A 4PDGA 3LCVB 2BWEA 1HJPA 1D0KA 3HHWA 1QYRA 1N33M 3KP1E 5EP3A 3KS4A 1JR3E 1CUKA 1QAMA 2YR0A 1HT1E 4M9SA 4Y28F 4CJ6A 5KO3A 1N77A 3SYLA 4B7HA 4LF5M 2F4VM 3FRIA 4QNMA 4IBEA 4LCBA 4BLCA 3U6LA 3U6EA 3GPPA 1OTRA 4RKUF 4K0KM 3SFZA 1WIVA 3SAVA 4MB7A 4KHPM 3SARA 3MHVC 3UJNA 3HX3A 4LF6M 2EKFA 4NSRA 4LJ7A 2CV1A
chains in the Genus database with same CATH topology
3AFHA 3TL4X 2JA2A 4L16A 3L2AA 1Z5BA 5EXSA 3TWLA 4II7A 4MH0E 4JYAM 4Z8XA 2L7HA 1T3TA 1SXJC 5EQTA 1JQJC 1L1ZA 4JI3M 5EP1A 4QNRA 4IBGA 3FUXA 4DV7M 5EP2A 4DUZM 4KODA 4FCWA 3VKHA 4X64M 4MGHA 5BR8M 3U5ZB 3VLFB 1DGHB 3DFZA 2KRKA 2QP9X 3VDUA 1L2CA 1IXSB 2L7IA 1DGFA 2YNMD 3ZC7B 3U6OA 2QCUA 1NY5A 4DR6M 4QOSA 4RF1A 3CTWB 5C1BA 1HT2E 1L8QA 4KLNA 3HKPA 3PXGA 1IM2A 4LF8M 1E9RA 4GHAA 1K82A 3KVWA 3FUWA 4DV2M 1Z6TA 1K3XA 2D7GA 2V1UA 4B3RM 1I4WA 4DR5M 1MU5A 3MJ5A 2XZFA 5JI3E 3K8ZA 4G4QA 3E9SA 1IN4A 3AOGA 1R2YA 4MGYE 3AKZA 4OVZB 1E94E 5IZ7D 4M0WA 2R4EA 4FVMA 1XXHA 3QWLA 4R3DA 4PD2A 1TH4A 1E9SA 5F3WA 4D82A 5IWAM 3GLGB 3DA1A 2DVWB 3AOEA 3LVVA 2X8AA 2ZAMA 4JXJA 4L4UA 3U6DA 4D80A 3GQ5A 4D81A 4PT5A 2XGNA 2G8LA 4AZFA 2ZM6M 1GKIA 3GLHB 3GRVA 4YY3M 1SXJA 2FNAA 3J80S 3CF6E 2C9CA 2D7HA 4WW0A 4HLQA 4B3SM 1N34M 2HCBA 2CFOA 2Y0QA 4B7GA 2QBYB 2CV0A 4IIWA 5FTKA 4DV5M 3RGSA 3SHGB 4G4NA 3PVSA 4YHHM 2J7OA 1FJGM 1WXQA 3ZH9B 5FTNA 2HHHM 4X66M 2KZSA 3OTOM 1G8PA 4FCTA 2H1RA 2DWZB 2UUCM 3AV0A 3HU1A 4LG2A 1IY1A 1XXHB 3EIHA 3FUUA 4JI1M 2RKOA 1ZQ9A 3KFUG 2L09A 3HJQA 3KSXA 1EE8A 3WHLA 4BBAA 4Z6YA 5KPZA 2UU9M 2FFJA 2M60A 3L25A 4X62M 4DR7M 2EUCA 3TE6A 3SMPA 3IG5A 3UGJA 5ITUA 4ITQA 4LF9M 2DXIA 4RNAA 4JI2M 2CHQA 5EP4A 2D7EA 2CHVA 2KW0A 3FD9A 4L8RC 2CHGA 4G6ZA 1OFIA 1XNQM 5KPRA 2RGOA 2ZBKB 2X49A 4JI0M 4I81A 2DWMA 5KQDA 4LF7M 2K47A 5GKNA 5FTMA 1GL7A 2CE7A 2CUZA 2DZOB 3J27B 5A2QS 4DV0M 3WHKA 3EIEA 1D2NA 2XEPA 5KQ8A 3K1JA 1YSYA 2KZUA 2DHRA 3A42A 3SAWA 1NY6A 3W0LB 4JI6M 1GVNA 3GLHA 3VKGA 2C98A 1PJJA 4NSOB 3JR4A 4CHTB 3T1HM 4GKKM 3R8FA 4FWHA 3RFWA 3A46A 1DGHA 2F5OA 4LFAM 1I94M 3AL0C 4LRTA 3Q8XA 4GIPA 5ITQA 3QAUA 4CGYB 3RGPA 1E32A 4REZA 4FWGA 1Z5CA 3SC3A 1G4AE 2R45A 1TH2A 2LWXA 5FTLA 3J81S 3ZCBB 3GPYA 5DYIA 2VQEM 2F5QA 4IBDA 3AOEC 3L29A 4B3MM 4OVZA 2Z7JA 3GRYA 1R7RA 2XSZA 3FTCA 2UXDM 2V6ZM 3U6MA 4FW9A 1OFHA 3SASA 4DR3M 1SXJD 1G59A 1L2DA 2ERCA 3I51A 3E4RA 1J7KA 2XZUA 3GPXA 1X37A 3TWMA 3LVWA 5BPVA 1IN5A 3CF2A 1IY2A 3A98B 3RE8A 1HQCA 3I4VA 1VDDA 2C9OA 3U6QA 3THGA 4AQYM 4TUWA 4R7GA 3PNYA 1N36M 2Z4SA 1PJIA 2KXEA 1L2BA 1W5SA 4IBFA 3K2LA 1IN7A 4OX9M 4G4RA 2DZNB 4LJ6A 4WURA 4L78A 2R62A 4LGMA 4LJ8A 1NHWC 5FSWA 3UMMA 2CV2A 1TDHA 1QQWA 1N78A 4MGIE 4X65M 1NJGA 4QOZC 3SYKA 3HU2A 3C58A 3KDSE 1JR3A 2AHMA 3SBJA 2V1CA 5FTJA 1HNZM 2EA0A 2RGHA 1ZAEA 2L6OA 4DV6M 2C99A 3SMSA 5H37D 4LGYA 5E26A 3U6CA 4FD2A 5KPTA 1SXJE 2R46A 3GRUA 4IJEA 1MX0A 4FWDA 4NRVA 4DV3M 4JI4M 3L28A 3GLFB 3K92A 5LMNM 1IBMM 3D8LA 1DGGA 4RF0A 2VIIA 3KOYE 1G3IA 2R18A 3ILKA 2LH0A 4KO8A 3U6SA 4LZZA 1GL6A 4LJ9A 4LRSA 3DZDA 1R6BX 4B08A 2KRUA 2I7PA 3VDPA 1KYIA 3NWLA 4DUYM 4QHTA 3AJIB 5LMUM 4LF4M 1NVMA 2FE8A 4JI5M 3KXEC 1J09A 2Y20A 1IN6A 2EO2A 5ITYA 7CATA 4M9ZA 3U5ZA 4IBKA 4I4LA 5EXXA 3KOXE 3BOSA 4I8OA 1N32M 2YQZA 4I5SA 3HHYA 2HKJA 4LY6A 1LV7A 4MGKE 4IJFA 4M9XA 4P16A 8CATA 5FLXS 4AKGA 5EXPA 1TGUA 3HWSA 4AKIA 3T15A 1N75A 4W5WA 4JI7M 1DGBA 4NXMM 3FYDA 2QZ4A 2XFSA 5ITXA 4XGIA 1TDZA 1NJFA 4GC9A 2C5RA 5ITRA 3A45A 3JR5A 2E5LM 3HJ8A 4LFBM 3HU3A 4NRWA 4CISA 2ZAOA 3HJSA 1W5TA 2HL7A 1OJLA 4GRIA 2Y21A 3FUTA 1C1KA 1FNNA 4GITA 3J7AS 4LZJA 1J5EM 3M0EA 3KSJA 1HNXM 2XLJA 3D8BA 1QZMA 4GH9A 5JI2E 1NSFA 2BJWA 1UM8A 4GMQA 2Z3XA 2F5SA 4B7FA 4HL4A 2UXCM 4DV1M 4BB9A 4DR2M 2O5RA 2OPFA 4L15A 3LMMA 3M6AA 1SXJB 1IBLM 3GLIA 3IG8A 3TQSA 5EXTA 1XC8A 1HR0M 2UXBM 1IXRC 3HHXA 3GO8A 4JN6A 1QVRA 2FOIC 1GLNA 4PCZA 4GHLA 3U61B 4OU7A 1NNJA 3KOWE 1KSFX 1Q3BA 3GLGA 2UUAM 3M7GA 1YUBA 2QENA 3HHZA 2Q2EB 3B9PA 4FCVA 1XNRM 4JI8M 4A3VB 1NNUC 2KEBA 4G4OA 3MK6A 3JAMS 2C96A 2I7NA 4MM3B 2F5PA 1DO0A 4XBOA 3TPZA 1QAOA 1Z59A 1XMOM 1IBKM 2OQ4A 2Y0TA 3KOZE 1PM5A 2XSZD 1L1TA 4MGZE 2ZANA 3GRRA 3NBIA 3L26A 3HGIA 4AI6A 1XHBA 3FTDA 1QAQA 3H4MA 3UK6A 3GP1A 2X4AA 4NL4H 2W82A 3SHFA 3GQ3A 4PDIA 3SATA 3U6PA 4JV5M 3LQRA 4NOOB 3VFDA 4DV4M 1Q3CA 3VK7A 4IBJA 1IN8A 2XF3A 3KP0E 2LXEA 4AG5A 3DOAA 2VQFM 1ORYB 4IBIA 4LJAA 3KW6A 4QHSA 3UZUA 3FKEA 3LQQA 1KFVA 2DWNA 3VK8A 2UUBM 3U60A 3W0FA 2XH9A 3FYCA 3J2PB 2A5YB 4AKHA 4OW0A 4IBBA 1Q39A 3KS8A 5IT9S 2XFTA 2BJVA 3GLIB 2F5NA 1H6UA 3FTFA 4LJ4A 1NHGC 2YFQA 3FUVA 3SAUA 2CEAA 4GKJM 2P5TA 4GC5A 3L27A 1XWIA 1JR3D 2R4JA 3GLFA 4NXNM 3U60B 3FTEA 4M0DA 4EIWA 2QPAA 4IBCA 2R65A 1K3WA 3T38A 4LJ5A 3PNVA 2J7NA 4S12A 3U61A 3J7BA 1S3SA 1HNWM 2DWLA 1DO2A 1QANA 1YE9A 3T1YM 1TH3A 5ITTA 1IY0A 3TWKA 3R9XB 2NQ8C 4AW4A 2G5GX 2KA6B 5ITXE 4DR1M 5E6JA 1IXZA 2LNHC 3CF0A 3I4YA 3PFIA 4ZPXA 4AG6A 1R2ZA 4LFCM 1XMQM 2QBYA 2Z4RA 3GQ4A 5EJCA 3GPUA 1G41A 5DYGA 2BNKA 1IQPA 2M5ZA 4DR4M 1HQYE 5C18A 4B3TM 1Z5AA 5DNYA 5IREB 4PDGA 3HHWA 1QYRA 1N33M 3KP1E 5EP3A 3KS4A 1QAMA 2YR0A 1HT1E 4M9SA 5KO3A 1N77A 4LF5M 2F4VM 3SYLA 4B7HA 4QNMA 4IBEA 4LCBA 4BLCA 3U6LA 3U6EA 3GPPA 4K0KM 3SFZA 3SAVA 4MB7A 4KHPM 3SARA 3MHVC 3UJNA 4LF6M 4NSRA 4LJ7A 2CV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITQ A;  5ITU A;  4G4O A;  3JAM S;  2F5P A;  4JI2 M;  1Z5B A;  3TWL A;  1MX0 A;  4JYA M;  4NRV A;  4DV3 M;  1Z59 A;  4JI4 M;  1XMO M;  1IBK M;  5LMN M;  1IBM M;  1XNQ M;  2ZBK B;  4JI3 M;  1L1Z A;  2OQ4 A;  4JI0 M;  1PM5 A;  1L1T A;  4LF7 M;  4DV7 M;  3U6S A;  4DUZ M;  5A2Q S;  4DV0 M;  4B3M M;  3GP1 A;  3SAT A;  3GQ3 A;  4PDI A;  4X64 M;  5BR8 M;  3U6P A;  4JV5 M;  4DUY M;  3A42 A;  1L2C A;  3SAW A;  5LMU M;  4LF4 M;  4DR6 M;  3U6O A;  4DV4 M;  1Q3C A;  4JI6 M;  3VK7 A;  4JI5 M;  5ITY A;  2VQF M;  3DOA A;  4LF8 M;  1K82 A;  1PJJ A;  3JR4 A;  3T1H M;  4DV2 M;  4GKK M;  1KFV A;  1N32 M;  1K3X A;  3VK8 A;  2UUB M;  4B3R M;  4DR5 M;  2HKJ A;  3W0F A;  1MU5 A;  3A46 A;  2F5O A;  4LFA M;  2XZF A;  5FLX S;  4G4Q A;  1R2Y A;  1Q39 A;  1I94 M;  5IT9 S;  5ITQ A;  2F5N A;  4JI7 M;  4NXM M;  1Z5C A;  3SAU A;  4GKJ M;  5ITX A;  1TDZ A;  3J81 S;  5ITR A;  3A45 A;  3JR5 A;  4NXN M;  4PD2 A;  2E5L M;  3GPY A;  2VQE M;  2F5Q A;  4LFB M;  5IWA M;  1K3W A;  4NRW A;  4CIS A;  2UXD M;  1HNW M;  3U6M A;  3T1Y M;  5ITT A;  3TWK A;  3U6D A;  3SAS A;  4DR3 M;  5ITX E;  3GQ5 A;  4DR1 M;  3J7A S;  1J5E M;  2ZM6 M;  1R2Z A;  1L2D A;  4LFC M;  1XMQ M;  4YY3 M;  3GQ4 A;  2XZU A;  3GPX A;  3TWM A;  1HNX M;  3GPU A;  3J80 S;  4B3S M;  1N34 M;  2F5S A;  4DR4 M;  3U6Q A;  4AQY M;  4B3T M;  2UXC M;  1Z5A A;  4DV5 M;  4DV1 M;  4DR2 M;  4G4N A;  4PDG A;  1N36 M;  2OPF A;  1PJI A;  4YHH M;  1FJG M;  1L2B A;  2HHH M;  1N33 M;  4X66 M;  4OX9 M;  3OTO M;  4G4R A;  1IBL M;  1XC8 A;  4LF5 M;  2UUC M;  2F4V M;  1HR0 M;  2UXB M;  4JI1 M;  1TDH A;  3GO8 A;  3U6L A;  4X65 M;  3U6E A;  4LF9 M;  4PCZ A;  3GPP A;  3C58 A;  4K0K M;  3SAV A;  1NNJ A;  4MB7 A;  1EE8 A;  1Q3B A;  3SBJ A;  2UUA M;  3SAR A;  4KHP M;  1HNZ M;  2EA0 A;  2UU9 M;  4DV6 M;  4LF6 M;  2Q2E B;  4X62 M;  4DR7 M;  3U6C A;  1XNR M;  4JI8 M; 
#chains in the Genus database with same CATH topology
 2K6B A;  2WSC F;  3AFH A;  3TL4 X;  2JA2 A;  4L16 A;  3L2A A;  1Z5B A;  5EXS A;  3TWL A;  4II7 A;  2LHG A;  4MH0 E;  1XXH E;  4JYA M;  4Z8X A;  2L7H A;  1T3T A;  1SXJ C;  5EQT A;  1JQJ C;  1L1Z A;  4JI3 M;  5EP1 A;  4QNR A;  3B89 A;  3FUX A;  2DNA A;  4IBG A;  4DV7 M;  5EP2 A;  4DUZ M;  1RU3 A;  2GQF A;  2JWS A;  4KOD A;  4G3O A;  2HWJ A;  2B3T A;  4FCW A;  4X64 M;  4MGH A;  5BR8 M;  3U5Z B;  3VKH A;  3F92 A;  3VLF B;  1DGH B;  3DFZ A;  2KRK A;  2QP9 X;  3VDU A;  1L2C A;  1IXS B;  2L7I A;  1DGF A;  2YNM D;  3ZC7 B;  3U6O A;  2QCU A;  1NY5 A;  4DR6 M;  3HY5 A;  4QOS A;  2EJS A;  4RF1 A;  3CTW B;  5C1B A;  1HT2 E;  2LVO C;  1L8Q A;  4KLN A;  3HKP A;  3PXG A;  2JXN A;  1IM2 A;  4LF8 M;  1E9R A;  4GHA A;  1WGN A;  1K82 A;  3KVW A;  3FUW A;  2RRU A;  4DV2 M;  2L4F A;  1Z6T A;  1WR1 B;  1VDL A;  2D7G A;  2MJ5 B;  1K3X A;  2LTU A;  2V1U A;  4B3R M;  1I4W A;  4DR5 M;  1MU5 A;  3MJ5 A;  2XZF A;  5JI3 E;  2APL A;  3K8Z A;  4G4Q A;  3E9S A;  1IN4 A;  3AOG A;  1R2Y A;  2OOB A;  4MGY E;  2J5Y A;  3AKZ A;  1TF0 B;  4OVZ B;  1PJS A;  1E94 E;  5IZ7 D;  4M0W A;  2R4E A;  4FVM A;  1XXH A;  3QWL A;  4R3D A;  3B7Q A;  4PD2 A;  1GO5 A;  1TH4 A;  1E9S A;  5F3W A;  4D82 A;  5IWA M;  1MJG M;  3GLG B;  3DA1 A;  2DVW B;  3AOE A;  3LVV A;  2X8A A;  2ZAM A;  4JXJ A;  4L4U A;  1QDR A;  3U6D A;  3Q8G A;  4D80 A;  3GQ5 A;  4D81 A;  4PT5 A;  2XGN A;  2G8L A;  4AZF A;  2ZM6 M;  1GKI A;  3GLH B;  3GRV A;  2DKL A;  4YY3 M;  1QDT A;  2BWB A;  2DI0 A;  1SXJ A;  2L4E A;  2FNA A;  1ZMV A;  3CF6 E;  3J80 S;  2C9C A;  2D7H A;  4WW0 A;  1PJQ A;  4HLQ A;  4B3S M;  1N34 M;  2HCB A;  2CFO A;  2Y0Q A;  1YLA A;  4B7G A;  2MRO B;  4IIW A;  2CV0 A;  2QBY B;  5FTK A;  4DV5 M;  3RGS A;  3SHG B;  4G4N A;  3PVS A;  4YHH M;  2J7O A;  1FJG M;  1WXQ A;  3ZH9 B;  5FTN A;  2HHH M;  1VEJ A;  4X66 M;  1LTM A;  2KZS A;  3OTO M;  1G8P A;  2JZ0 A;  4UN2 B;  2JP7 A;  4FCT A;  2H1R A;  2DWZ B;  3K9O A;  2UUC M;  3AV0 A;  3HU1 A;  4LG2 A;  1IY1 A;  1XXH B;  3EIH A;  1BVS A;  3FUU A;  4JI1 M;  2RKO A;  1NO1 A;  1ZQ9 A;  3KFU G;  2VF8 A;  2L09 A;  3HJQ A;  2LVN C;  3KSX A;  1EE8 A;  3WHL A;  4BBA A;  4Z6Y A;  5KPZ A;  2UU9 M;  3K9P A;  1F4I A;  2FFJ A;  2M60 A;  3GLG E;  2GNO A;  4X62 M;  4DR7 M;  2EUC A;  3L25 A;  1JB0 F;  3TE6 A;  3SMP A;  3IG5 A;  3UGJ A;  5ITU A;  2JZ1 A;  4ITQ A;  2DXI A;  4LF9 M;  4RNA A;  2WSE F;  4JI2 M;  2CHQ A;  5EP4 A;  2D7E A;  5DFL A;  2CHV A;  2KW0 A;  3C3E A;  1V92 A;  3FD9 A;  4L8R C;  3GLH E;  2CHG A;  4G6Z A;  1OFI A;  1XNQ M;  2K0B X;  2RGO A;  2ZBK B;  2X49 A;  5KPR A;  4JI0 M;  4I81 A;  2DWM A;  2DAM A;  2OOA A;  5KQD A;  4LF7 M;  2K47 A;  5GKN A;  5FTM A;  1G71 A;  1GL7 A;  2CE7 A;  2CUZ A;  2DZO B;  3J27 B;  5A2Q S;  4DV0 M;  3WHK A;  3EIE A;  1D2N A;  2XEP A;  4Q7J A;  3B74 A;  1XB2 B;  5KQ8 A;  1VEK A;  1YSY A;  3K1J A;  2KZU A;  2DHR A;  3A42 A;  3SAW A;  1NY6 A;  3W0L B;  4JI6 M;  1VEG A;  1GVN A;  1ZMU A;  1VQ1 A;  3GLH A;  3VKG A;  2QNJ A;  2C98 A;  1PJJ A;  4NSO B;  3JR4 A;  4CHT B;  3T1H M;  4GKK M;  3R8F A;  1IFY A;  4FWH A;  3V76 A;  2ZTC A;  3RFW A;  3A46 A;  1DGH A;  2F5O A;  4LFA M;  3QYB A;  4NC6 A;  1A5T A;  1OIZ A;  3B7N A;  1QZE A;  1I94 M;  1QUS A;  4LRT A;  3AL0 C;  2KNZ A;  3Q8X A;  1T43 A;  4GEW A;  4GIP A;  3QAU A;  4CGY B;  5ITQ A;  3RGP A;  1V33 A;  1E32 A;  4REZ A;  4FWG A;  1Z5C A;  2DHY A;  3SC3 A;  1G4A E;  2R45 A;  1TH2 A;  2LWX A;  5FTL A;  2R0I A;  3J81 S;  3ZCB B;  3GPY A;  1EIJ A;  5DYI A;  2VQE M;  2F5Q A;  4IBD A;  3AOE C;  3L29 A;  4B3M M;  4OVZ A;  1PGY A;  2Z7J A;  2MH8 A;  2K9D A;  1R7R A;  3GRY A;  2XSZ A;  3FTC A;  2UXD M;  2V6Z M;  3U6M A;  4FW9 A;  1QUT A;  1OFH A;  3SAS A;  2JUJ A;  4DR3 M;  1SXJ D;  1NV9 A;  1G59 A;  1L2D A;  3I04 M;  2ERC A;  3B7Z A;  3I51 A;  3E4R A;  1J7K A;  2XZU A;  3GPX A;  1X37 A;  3TWM A;  4HEO A;  2G3Q A;  3LVW A;  5BPV A;  1IN5 A;  3CF2 A;  1IY2 A;  3A98 B;  3RE8 A;  3W68 A;  1HQC A;  3CGW A;  3I4V A;  3IEC A;  1VDD A;  2C9O A;  3U6Q A;  3THG A;  4AQY M;  4TUW A;  4R7G A;  4L6V 6;  3PNY A;  1N36 M;  2Z4S A;  1PJI A;  4F1I A;  2QQ8 A;  4CIZ A;  2KXE A;  1L2B A;  1W5S A;  4IBF A;  3K2L A;  1IN7 A;  2CP8 A;  4OX9 M;  2DAG A;  4G4R A;  2DZN B;  4LJ6 A;  4WUR A;  2VF7 A;  4L78 A;  2R62 A;  3T6P A;  4LGM A;  4LJ8 A;  1NHW C;  5FSW A;  3UMM A;  5L8R F;  1TDH A;  1Y8G A;  1QQW A;  2CV2 A;  1N78 A;  2FH0 A;  4MGI E;  4X65 M;  1NJG A;  4QOZ C;  3SYK A;  3HZJ A;  3HU2 A;  2MGW A;  3C58 A;  3KDS E;  1OAI A;  1JR3 A;  2AHM A;  1WJ7 A;  2LVQ D;  3SBJ A;  2V1C A;  5FTJ A;  1HNZ M;  2EA0 A;  2RGH A;  1ZAE A;  2L6O A;  4DV6 M;  2C99 A;  3SMS A;  5H37 D;  4LGY A;  5E26 A;  3U6C A;  3LW5 F;  4FD2 A;  5KPT A;  1SXJ E;  2R46 A;  4P17 A;  3GRU A;  4IJE A;  1MX0 A;  4FWD A;  4NRV A;  4DV3 M;  1AIP C;  4JI4 M;  3L28 A;  3GLF B;  3K92 A;  5LMN M;  1IBM M;  3D8L A;  3BBZ A;  1DGG A;  4RF0 A;  2VII A;  3KOY E;  1G3I A;  2QSF X;  2R18 A;  2LH0 A;  3ILK A;  2WZJ A;  4KO8 A;  3U6S A;  4LZZ A;  1GL6 A;  4LJ9 A;  4LRS A;  4ANR A;  3DZD A;  1R6B X;  4B08 A;  2KRU A;  2I7P A;  3VDP A;  1KYI A;  3NWL A;  1DV0 A;  4DUY M;  4QHT A;  3I01 M;  2LVP C;  2VDB B;  3QYE A;  3AJI B;  5LMU M;  4LF4 M;  1NVM A;  2DAI A;  2FE8 A;  4JI5 M;  1OQY A;  1J09 A;  3KXE C;  2Y20 A;  1IN6 A;  1P3Q Q;  2EO2 A;  5ITY A;  7CAT A;  4M9Z A;  3U5Z A;  3BXW A;  2L2D A;  4IBK A;  4I4L A;  5EXX A;  3KOX E;  3BOS A;  4I8O A;  2DZL A;  1N32 M;  2YQZ A;  4I5S A;  3HHY A;  2HKJ A;  3LCU A;  1LV7 A;  4LY6 A;  4MGK E;  4IJF A;  4M9X A;  4P16 A;  8CAT A;  5FLX S;  4AKG A;  5EXP A;  1TGU A;  3HWS A;  4AKI A;  3T15 A;  1N75 A;  4W5W A;  3FRH A;  4JI7 M;  1DGB A;  4NXM M;  2H5X A;  3FYD A;  2QZ4 A;  2XFS A;  5ITX A;  4XGI A;  4DBG B;  1TDZ A;  1NJF A;  4GC9 A;  2C5R A;  5ITR A;  1TTE A;  3A45 A;  3JR5 A;  2E5L M;  1TR8 A;  3C3D A;  3HJ8 A;  4LFB M;  3HU3 A;  4NRW A;  4XK8 F;  2ZAO A;  3HJS A;  4CIS A;  1Q02 A;  1W5T A;  2HL7 A;  1OJL A;  2N35 A;  4GRI A;  2JY6 B;  2Y21 A;  2CRU A;  3FUT A;  1C1K A;  1FNN A;  3GLI E;  4GIT A;  2O25 A;  3J7A S;  2JY5 A;  4LZJ A;  1GAB A;  1J5E M;  3M0E A;  1T6O A;  2R6F A;  3KSJ A;  2KNV A;  1HNX M;  2XLJ A;  3D8B A;  1QZM A;  1ZMW A;  4GH9 A;  5JI2 E;  1NSF A;  2BJW A;  1UM8 A;  4GMQ A;  2Z3X A;  1C7Y A;  2F5S A;  4B7F A;  4HL4 A;  3W67 A;  2UXC M;  3ZQJ A;  4BB9 A;  1R4G A;  2O5R A;  4DV1 M;  4DR2 M;  2OPF A;  4L15 A;  3MMP A;  1ZV1 A;  3LMM A;  3M6A A;  1SXJ B;  2OO9 A;  1IBL M;  3GLI A;  3IG8 A;  3TQS A;  5EXT A;  2WSF F;  1XC8 A;  2DAE A;  1HR0 M;  2UXB M;  1IXR C;  3HHX A;  1NV8 A;  3GO8 A;  4JN6 A;  3GLF E;  1IXS A;  4F2L A;  1QVR A;  2FOI C;  1GLN A;  4PCZ A;  3E21 A;  4GHL A;  3U61 B;  4OU7 A;  1NNJ A;  3KOW E;  1KSF X;  4WP2 A;  1Q3B A;  3GLG A;  2UUA M;  3M7G A;  1YUB A;  1OKS A;  2QEN A;  3HHZ A;  2Q2E B;  3B9P A;  4FCV A;  1EFU B;  1AUA A;  2CWB A;  1XNR M;  4JI8 M;  4A3V B;  1NNU C;  2KEB A;  4G4O A;  3MK6 A;  3JAM S;  2C96 A;  2I7N A;  4MM3 B;  1GJS A;  2F5P A;  1OIP A;  1UFZ A;  1DO0 A;  2MR9 A;  4XBO A;  3TPZ A;  1QAO A;  1Z59 A;  2KNA A;  1XMO M;  1IBK M;  1R5L A;  2OQ4 A;  2Y0T A;  3KOZ E;  1PM5 A;  2XSZ D;  1L1T A;  4MGZ E;  2ZAN A;  3GRR A;  3NBI A;  3L26 A;  3HGI A;  1WGL A;  4AI6 A;  1XHB A;  3FTD A;  1QAQ A;  3H4M A;  3UK6 A;  3GP1 A;  2X4A A;  4NL4 H;  2W82 A;  3SHF A;  3GQ3 A;  4PDI A;  3SAT A;  2HAK A;  1D0L A;  1WHC A;  3C9P A;  2LVA A;  1SG9 A;  2ZTD A;  3U6P A;  4JV5 M;  3LQR A;  4NOO B;  3VFD A;  4DV4 M;  1Q3C A;  3VK7 A;  4IBJ A;  1MN3 A;  1IN8 A;  2XF3 A;  3KP0 E;  1D0M A;  2LXE A;  4AG5 A;  3DOA A;  2VQF M;  2O01 F;  1ORY B;  4IBI A;  4LJA A;  3KW6 A;  4QHS A;  3UZU A;  3FKE A;  3LQQ A;  4R71 A;  1KFV A;  2DWN A;  3VK8 A;  2UUB M;  3U60 A;  2JY7 A;  3W0F A;  2XH9 A;  3FYC A;  3IHP A;  3J2P B;  2A5Y B;  4AKH A;  4OW0 A;  4IBB A;  1Q39 A;  3KS8 A;  5IT9 S;  2XFT A;  2BJV A;  3GLI B;  2F5N A;  1H6U A;  3FTF A;  4LJ4 A;  1NHG C;  2YFQ A;  3FUV A;  3SAU A;  2CEA A;  4GKJ M;  2P5T A;  4GC5 A;  3L27 A;  1XWI A;  1PRB A;  1JR3 D;  2R4J A;  3GLF A;  3H4J A;  4NXN M;  3U60 B;  3FTE A;  2EKK A;  4M0D A;  4EIW A;  2QPA A;  4IBC A;  2R65 A;  2DEN A;  2Z8Y M;  3T38 A;  1K3W A;  4LJ5 A;  2J7N A;  3PNV A;  4S12 A;  3U61 A;  3J7B A;  2KDL A;  1S3S A;  1HNW M;  2DWL A;  2DAK A;  4KT0 F;  1DO2 A;  1QAN A;  1YE9 A;  3T1Y M;  1TH3 A;  5ITT A;  1IY0 A;  3TWK A;  3R9X B;  1GJT A;  2NQ8 C;  3FE3 A;  2R44 A;  4AW4 A;  2G5G X;  2KA6 B;  5ITX E;  4DR1 M;  5E6J A;  1IXZ A;  2LNH C;  3CF0 A;  3I4Y A;  3PFI A;  4ZPX A;  4AG6 A;  1R2Z A;  4LFC M;  1XMQ M;  2QBY A;  3NBX X;  2Z4R A;  3GQ4 A;  2QHO B;  5EJC A;  3E46 A;  3GPU A;  2KHH A;  1V34 A;  1PJT A;  2JY8 A;  1G41 A;  5DYG A;  2LBC A;  2JNH A;  2LHC A;  2BNK A;  1IQP A;  1VG5 A;  2M5Z A;  4DR4 M;  1HQY E;  1OAO C;  5C18 A;  4B3T M;  1Z5A A;  5DNY A;  5IRE B;  2FS1 A;  4PDG A;  3LCV B;  2BWE A;  1HJP A;  1D0K A;  3HHW A;  1QYR A;  1N33 M;  3KP1 E;  5EP3 A;  3KS4 A;  1JR3 E;  1CUK A;  1QAM A;  2YR0 A;  1HT1 E;  4M9S A;  4Y28 F;  4CJ6 A;  5KO3 A;  1N77 A;  3SYL A;  4B7H A;  4LF5 M;  2F4V M;  3FRI A;  4QNM A;  4IBE A;  4LCB A;  4BLC A;  3U6L A;  3U6E A;  3GPP A;  1OTR A;  4RKU F;  4K0K M;  3SFZ A;  1WIV A;  3SAV A;  4MB7 A;  4KHP M;  3SAR A;  3MHV C;  3UJN A;  3HX3 A;  4LF6 M;  2EKF A;  4NSR A;  4LJ7 A;  2CV1 A; 
#chains in the Genus database with same CATH homology
 3AFH A;  3TL4 X;  2JA2 A;  4L16 A;  3L2A A;  1Z5B A;  5EXS A;  3TWL A;  4II7 A;  4MH0 E;  4JYA M;  4Z8X A;  2L7H A;  1T3T A;  1SXJ C;  5EQT A;  1JQJ C;  1L1Z A;  4JI3 M;  5EP1 A;  4QNR A;  4IBG A;  3FUX A;  4DV7 M;  5EP2 A;  4DUZ M;  4KOD A;  4FCW A;  3VKH A;  4X64 M;  4MGH A;  5BR8 M;  3U5Z B;  3VLF B;  1DGH B;  3DFZ A;  2KRK A;  2QP9 X;  3VDU A;  1L2C A;  1IXS B;  2L7I A;  1DGF A;  2YNM D;  3ZC7 B;  3U6O A;  2QCU A;  1NY5 A;  4DR6 M;  4QOS A;  4RF1 A;  3CTW B;  5C1B A;  1HT2 E;  1L8Q A;  4KLN A;  3HKP A;  3PXG A;  1IM2 A;  4LF8 M;  1E9R A;  4GHA A;  1K82 A;  3KVW A;  3FUW A;  4DV2 M;  1Z6T A;  1K3X A;  2D7G A;  2V1U A;  4B3R M;  1I4W A;  4DR5 M;  1MU5 A;  3MJ5 A;  2XZF A;  5JI3 E;  3K8Z A;  4G4Q A;  3E9S A;  1IN4 A;  3AOG A;  1R2Y A;  4MGY E;  3AKZ A;  4OVZ B;  1E94 E;  5IZ7 D;  4M0W A;  2R4E A;  4FVM A;  1XXH A;  3QWL A;  4R3D A;  4PD2 A;  1TH4 A;  1E9S A;  5F3W A;  4D82 A;  5IWA M;  3GLG B;  3DA1 A;  2DVW B;  3AOE A;  3LVV A;  2X8A A;  2ZAM A;  4JXJ A;  4L4U A;  3U6D A;  4D80 A;  3GQ5 A;  4D81 A;  4PT5 A;  2XGN A;  2G8L A;  4AZF A;  2ZM6 M;  1GKI A;  3GLH B;  3GRV A;  4YY3 M;  1SXJ A;  2FNA A;  3J80 S;  3CF6 E;  2C9C A;  2D7H A;  4WW0 A;  4HLQ A;  4B3S M;  1N34 M;  2HCB A;  2CFO A;  2Y0Q A;  4B7G A;  2QBY B;  2CV0 A;  4IIW A;  5FTK A;  4DV5 M;  3RGS A;  3SHG B;  4G4N A;  3PVS A;  4YHH M;  2J7O A;  1FJG M;  1WXQ A;  3ZH9 B;  5FTN A;  2HHH M;  4X66 M;  2KZS A;  3OTO M;  1G8P A;  4FCT A;  2H1R A;  2DWZ B;  2UUC M;  3AV0 A;  3HU1 A;  4LG2 A;  1IY1 A;  1XXH B;  3EIH A;  3FUU A;  4JI1 M;  2RKO A;  1ZQ9 A;  3KFU G;  2L09 A;  3HJQ A;  3KSX A;  1EE8 A;  3WHL A;  4BBA A;  4Z6Y A;  5KPZ A;  2UU9 M;  2FFJ A;  2M60 A;  3L25 A;  4X62 M;  4DR7 M;  2EUC A;  3TE6 A;  3SMP A;  3IG5 A;  3UGJ A;  5ITU A;  4ITQ A;  4LF9 M;  2DXI A;  4RNA A;  4JI2 M;  2CHQ A;  5EP4 A;  2D7E A;  2CHV A;  2KW0 A;  3FD9 A;  4L8R C;  2CHG A;  4G6Z A;  1OFI A;  1XNQ M;  5KPR A;  2RGO A;  2ZBK B;  2X49 A;  4JI0 M;  4I81 A;  2DWM A;  5KQD A;  4LF7 M;  2K47 A;  5GKN A;  5FTM A;  1GL7 A;  2CE7 A;  2CUZ A;  2DZO B;  3J27 B;  5A2Q S;  4DV0 M;  3WHK A;  3EIE A;  1D2N A;  2XEP A;  5KQ8 A;  3K1J A;  1YSY A;  2KZU A;  2DHR A;  3A42 A;  3SAW A;  1NY6 A;  3W0L B;  4JI6 M;  1GVN A;  3GLH A;  3VKG A;  2C98 A;  1PJJ A;  4NSO B;  3JR4 A;  4CHT B;  3T1H M;  4GKK M;  3R8F A;  4FWH A;  3RFW A;  3A46 A;  1DGH A;  2F5O A;  4LFA M;  1I94 M;  3AL0 C;  4LRT A;  3Q8X A;  4GIP A;  5ITQ A;  3QAU A;  4CGY B;  3RGP A;  1E32 A;  4REZ A;  4FWG A;  1Z5C A;  3SC3 A;  1G4A E;  2R45 A;  1TH2 A;  2LWX A;  5FTL A;  3J81 S;  3ZCB B;  3GPY A;  5DYI A;  2VQE M;  2F5Q A;  4IBD A;  3AOE C;  3L29 A;  4B3M M;  4OVZ A;  2Z7J A;  3GRY A;  1R7R A;  2XSZ A;  3FTC A;  2UXD M;  2V6Z M;  3U6M A;  4FW9 A;  1OFH A;  3SAS A;  4DR3 M;  1SXJ D;  1G59 A;  1L2D A;  2ERC A;  3I51 A;  3E4R A;  1J7K A;  2XZU A;  3GPX A;  1X37 A;  3TWM A;  3LVW A;  5BPV A;  1IN5 A;  3CF2 A;  1IY2 A;  3A98 B;  3RE8 A;  1HQC A;  3I4V A;  1VDD A;  2C9O A;  3U6Q A;  3THG A;  4AQY M;  4TUW A;  4R7G A;  3PNY A;  1N36 M;  2Z4S A;  1PJI A;  2KXE A;  1L2B A;  1W5S A;  4IBF A;  3K2L A;  1IN7 A;  4OX9 M;  4G4R A;  2DZN B;  4LJ6 A;  4WUR A;  4L78 A;  2R62 A;  4LGM A;  4LJ8 A;  1NHW C;  5FSW A;  3UMM A;  2CV2 A;  1TDH A;  1QQW A;  1N78 A;  4MGI E;  4X65 M;  1NJG A;  4QOZ C;  3SYK A;  3HU2 A;  3C58 A;  3KDS E;  1JR3 A;  2AHM A;  3SBJ A;  2V1C A;  5FTJ A;  1HNZ M;  2EA0 A;  2RGH A;  1ZAE A;  2L6O A;  4DV6 M;  2C99 A;  3SMS A;  5H37 D;  4LGY A;  5E26 A;  3U6C A;  4FD2 A;  5KPT A;  1SXJ E;  2R46 A;  3GRU A;  4IJE A;  1MX0 A;  4FWD A;  4NRV A;  4DV3 M;  4JI4 M;  3L28 A;  3GLF B;  3K92 A;  5LMN M;  1IBM M;  3D8L A;  1DGG A;  4RF0 A;  2VII A;  3KOY E;  1G3I A;  2R18 A;  3ILK A;  2LH0 A;  4KO8 A;  3U6S A;  4LZZ A;  1GL6 A;  4LJ9 A;  4LRS A;  3DZD A;  1R6B X;  4B08 A;  2KRU A;  2I7P A;  3VDP A;  1KYI A;  3NWL A;  4DUY M;  4QHT A;  3AJI B;  5LMU M;  4LF4 M;  1NVM A;  2FE8 A;  4JI5 M;  3KXE C;  1J09 A;  2Y20 A;  1IN6 A;  2EO2 A;  5ITY A;  7CAT A;  4M9Z A;  3U5Z A;  4IBK A;  4I4L A;  5EXX A;  3KOX E;  3BOS A;  4I8O A;  1N32 M;  2YQZ A;  4I5S A;  3HHY A;  2HKJ A;  4LY6 A;  1LV7 A;  4MGK E;  4IJF A;  4M9X A;  4P16 A;  8CAT A;  5FLX S;  4AKG A;  5EXP A;  1TGU A;  3HWS A;  4AKI A;  3T15 A;  1N75 A;  4W5W A;  4JI7 M;  1DGB A;  4NXM M;  3FYD A;  2QZ4 A;  2XFS A;  5ITX A;  4XGI A;  1TDZ A;  1NJF A;  4GC9 A;  2C5R A;  5ITR A;  3A45 A;  3JR5 A;  2E5L M;  3HJ8 A;  4LFB M;  3HU3 A;  4NRW A;  4CIS A;  2ZAO A;  3HJS A;  1W5T A;  2HL7 A;  1OJL A;  4GRI A;  2Y21 A;  3FUT A;  1C1K A;  1FNN A;  4GIT A;  3J7A S;  4LZJ A;  1J5E M;  3M0E A;  3KSJ A;  1HNX M;  2XLJ A;  3D8B A;  1QZM A;  4GH9 A;  5JI2 E;  1NSF A;  2BJW A;  1UM8 A;  4GMQ A;  2Z3X A;  2F5S A;  4B7F A;  4HL4 A;  2UXC M;  4DV1 M;  4BB9 A;  4DR2 M;  2O5R A;  2OPF A;  4L15 A;  3LMM A;  3M6A A;  1SXJ B;  1IBL M;  3GLI A;  3IG8 A;  3TQS A;  5EXT A;  1XC8 A;  1HR0 M;  2UXB M;  1IXR C;  3HHX A;  3GO8 A;  4JN6 A;  1QVR A;  2FOI C;  1GLN A;  4PCZ A;  4GHL A;  3U61 B;  4OU7 A;  1NNJ A;  3KOW E;  1KSF X;  1Q3B A;  3GLG A;  2UUA M;  3M7G A;  1YUB A;  2QEN A;  3HHZ A;  2Q2E B;  3B9P A;  4FCV A;  1XNR M;  4JI8 M;  4A3V B;  1NNU C;  2KEB A;  4G4O A;  3MK6 A;  3JAM S;  2C96 A;  2I7N A;  4MM3 B;  2F5P A;  1DO0 A;  4XBO A;  3TPZ A;  1QAO A;  1Z59 A;  1XMO M;  1IBK M;  2OQ4 A;  2Y0T A;  3KOZ E;  1PM5 A;  2XSZ D;  1L1T A;  4MGZ E;  2ZAN A;  3GRR A;  3NBI A;  3L26 A;  3HGI A;  4AI6 A;  1XHB A;  3FTD A;  1QAQ A;  3H4M A;  3UK6 A;  3GP1 A;  2X4A A;  4NL4 H;  2W82 A;  3SHF A;  3GQ3 A;  4PDI A;  3SAT A;  3U6P A;  4JV5 M;  3LQR A;  4NOO B;  3VFD A;  4DV4 M;  1Q3C A;  3VK7 A;  4IBJ A;  1IN8 A;  2XF3 A;  3KP0 E;  2LXE A;  4AG5 A;  3DOA A;  2VQF M;  1ORY B;  4IBI A;  4LJA A;  3KW6 A;  4QHS A;  3UZU A;  3FKE A;  3LQQ A;  1KFV A;  2DWN A;  3VK8 A;  2UUB M;  3U60 A;  3W0F A;  2XH9 A;  3FYC A;  3J2P B;  2A5Y B;  4AKH A;  4OW0 A;  4IBB A;  1Q39 A;  3KS8 A;  5IT9 S;  2XFT A;  2BJV A;  3GLI B;  2F5N A;  1H6U A;  3FTF A;  4LJ4 A;  1NHG C;  2YFQ A;  3FUV A;  3SAU A;  2CEA A;  4GKJ M;  2P5T A;  4GC5 A;  3L27 A;  1XWI A;  1JR3 D;  2R4J A;  3GLF A;  4NXN M;  3U60 B;  3FTE A;  4M0D A;  4EIW A;  2QPA A;  4IBC A;  2R65 A;  1K3W A;  3T38 A;  4LJ5 A;  3PNV A;  2J7N A;  4S12 A;  3U61 A;  3J7B A;  1S3S A;  1HNW M;  2DWL A;  1DO2 A;  1QAN A;  1YE9 A;  3T1Y M;  1TH3 A;  5ITT A;  1IY0 A;  3TWK A;  3R9X B;  2NQ8 C;  4AW4 A;  2G5G X;  2KA6 B;  5ITX E;  4DR1 M;  5E6J A;  1IXZ A;  2LNH C;  3CF0 A;  3I4Y A;  3PFI A;  4ZPX A;  4AG6 A;  1R2Z A;  4LFC M;  1XMQ M;  2QBY A;  2Z4R A;  3GQ4 A;  5EJC A;  3GPU A;  1G41 A;  5DYG A;  2BNK A;  1IQP A;  2M5Z A;  4DR4 M;  1HQY E;  5C18 A;  4B3T M;  1Z5A A;  5DNY A;  5IRE B;  4PDG A;  3HHW A;  1QYR A;  1N33 M;  3KP1 E;  5EP3 A;  3KS4 A;  1QAM A;  2YR0 A;  1HT1 E;  4M9S A;  5KO3 A;  1N77 A;  4LF5 M;  2F4V M;  3SYL A;  4B7H A;  4QNM A;  4IBE A;  4LCB A;  4BLC A;  3U6L A;  3U6E A;  3GPP A;  4K0K M;  3SFZ A;  3SAV A;  4MB7 A;  4KHP M;  3SAR A;  3MHV C;  3UJN A;  4LF6 M;  4NSR A;  4LJ7 A;  2CV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...