2UXCM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxcM02
1Z59A 4JV5M 4X66M 3U6QA 4LFBM 4NXMM 4JI4M 1K82A 1Z5BA 4X62M 4DR2M 2XZFA 4LFCM 1FJGM 5ITYA 4PD2A 2UUBM 4LFAM 1N36M 4G4QA 4G4RA 4DR3M 3T1HM 4LF6M 5ITQA 2F5PA 1PJJA 2VQFM 4JI6M 4DR4M 5ITXE 3U6MA 4DV3M 1HNZM 2UUAM 3GP1A 1J5EM 3U6OA 4B3RM 4JI1M 4JI0M 4B3TM 2VQEM 3TWMA 4DV1M 2ZBKB 4B3SM 4LF4M 3A45A 5ITTA 1XNRM 1L2BA 3U6PA 3T1YM 1Z5CA 4K0KM 1PM5A 1N33M 1TDHA 5BR8M 4ITQA 1Z5AA 1I94M 1N32M 4DR7M 1MX0A 1N34M 3U6DA 2OQ4A 2OPFA 4G4NA 4JI3M 4PDGA 2E5LM 4JI5M 3GQ3A 3GPPA 2F5NA 2HHHM 4GKKM 4JI2M 4DV4M 4JYAM 5FLXS 3SAVA 3GPYA 5IWAM 3U6SA 4LF8M 1KFVA 1K3WA 4DR5M 4NRWA 2Q2EB 1XC8A 2F5QA 3GQ4A 1NNJA 3J81S 3U6LA 4G4OA 1XMQM 4PCZA 3SASA 4DV7M 3VK8A 4DV0M 2ZM6M 1PJIA 2UXDM 1IBLM 3A46A 3JR4A 4JI8M 1IBMM 4PDIA 5ITXA 3GQ5A 3SBJA 4NXNM 1R2YA 3A42A 3SAWA 2XZUA 5LMUM 4LF9M 3SARA 4DV6M 5A2QS 4JI7M 5LMNM 4LF7M 4NRVA 4DV2M 4YY3M 3JR5A 4GKJM 1HNWM 1Q39A 3SAUA 3J7AS 2UXBM 2UU9M 3DOAA 1TDZA 1XNQM 4X65M 1L2CA 3TWKA 1XMOM 4KHPM 4DUYM 4B3MM 5IT9S 3J80S 3OTOM 1L2DA 3GO8A 4AQYM 3SATA 4DR6M 1Q3CA 1L1ZA 1K3XA 3U6CA 2F4VM 4DR1M 1HR0M 4DUZM 4OX9M 3VK7A 4YHHM 5ITUA 3C58A 2F5SA 4CISA 1IBKM 2UXCM 3TWLA 1Q3BA 2HKJA 4DV5M 3U6EA 3GPXA 2EA0A 1HNXM 5ITRA 4X64M 3GPUA 3W0FA 2F5OA 2UUCM 4LF5M 3JAMS 1R2ZA 1MU5A 1EE8A 4MB7A 1L1TA
chains in the Genus database with same CATH superfamily
1R5LA 2Z4SA 1DGHA 3T38A 2V1UA 1XXHA 3U6QA 3ZCBB 5FTNA 3TE6A 3CTWB 1C7YA 2DVWB 2JZ1A 2KRKA 4AG6A 1OTRA 1K82A 2M5ZA 4NXMM 4LFCM 2LVQD 1IM2A 5KPZA 4G4QA 4QOSA 3FUVA 1A5TA 3SFZA 2EO2A 4GHLA 2ERCA 2QBYA 4LGMA 5ITXE 3L29A 5FTKA 3I4VA 4L8RC 1RU3A 4MGZE 4JXJA 3FYDA 2DHYA 3LQRA 3UGJA 1D0LA 1XHBA 1NNUC 4QNMA 4JI0M 2ZAOA 2VQEM 1WGLA 2QQ8A 2ZBKB 3FTDA 4LF4M 5ITTA 3Q8XA 3ZC7B 1L2BA 1PM5A 1I94M 1HT1E 1VDDA 2LNHC 2Z4RA 2CUZA 1HJPA 5IREB 2JZ0A 3AOGA 1VDLA 4R7GA 3FUTA 1N34M 3U6DA 1JQJC 1OJLA 2DI0A 2KW0A 3KP0E 1KYIA 3RGSA 1G3IA 1NJFA 4JI5M 2E5LM 3GQ3A 1IY1A 3AJIB 1R6BX 4EIWA 2WSCF 1E9SA 3AL0C 1JR3E 4JI2M 2JY8A 1IXZA 2HL7A 5FLXS 2FOIC 2VF7A 3FUUA 3K2LA 4LF8M 3HHYA 2Y21A 2LHCA 1G41A 4DR5M 4NOOB 4D82A 4TUWA 1C1KA 1N75A 3T15A 2CV2A 2F5QA 1PJTA 2K47A 2QPAA 1XMQM 4FCWA 1OKSA 3UMMA 3GLFB 3FTCA 4DV7M 2DAIA 1WXQA 3A46A 2R62A 1S3SA 3ZH9B 4B7HA 1IBMM 2JP7A 4JI8M 4IBDA 2CFOA 2AHMA 1OIPA 3KOZE 4RNAA 4KT0F 3J2PB 3THGA 3SARA 5A2QS 4JI7M 2RRUA 4LF7M 4Q7JA 3DA1A 2L2DA 4IBGA 4NRVA 5E26A 5DFLA 2DXIA 2R0IA 3KP1E 3JR5A 1AUAA 1Q39A 4RF0A 4F1IA 2UU9M 3RGPA 1D0KA 2YNMD 2ZTCA 4G6ZA 3TWKA 1NV8A 4DUYM 4B3MM 3UJNA 3DFZA 2BWBA 3FD9A 2YFQA 4LJ4A 3BXWA 4MM3B 4B7GA 1HQCA 3MK6A 4OVZB 3GLFE 3GO8A 3SATA 3EIEA 3LVVA 2G3QA 4JN6A 1L1ZA 1K3XA 2F4VM 1H6UA 2B3TA 3GLGB 2J7NA 4DR1M 5FTMA 3M0EA 1DO2A 1TGUA 2EUCA 3HU2A 4YHHM 1MJGM 4GH9A 3DZDA 5EXSA 3L28A 4LJ8A 2LVPC 4CISA 1NHWC 2FNAA 3KFUG 4GC9A 2L7IA 3VKGA 4MGYE 4FCVA 1HNXM 5ITRA 3W0FA 4FCTA 2UUCM 1V92A 4IBKA 4LJAA 4R71A 3J7BA 2QSFX 3JAMS 4R3DA 2LVOC 4OU7A 3AOEC 3FKEA 3GLHA 3VK7A 3C3DA 3QYEA 3BBZA 1L1TA 2CHQA 1IN7A 1OQYA 1Z59A 2LXEA 1N78A 4AKHA 2JY5A 4XBOA 4X66M 2C5RA 4JV5M 3MJ5A 1QZEA 2MH8A 5EP1A 3C3EA 3K92A 1Z5BA 5GKNA 5DYIA 1VEGA 2UUBM 2X8AA 3QWLA 1IQPA 4G4RA 3T1HM 4AI6A 5ITQA 3WHKA 3M7GA 1AIPC 2KZUA 3IECA 3KSXA 4BLCA 3FUXA 4FW9A 3CF6E 2BJWA 4GITA 4DV3M 2XF3A 1TH2A 4Z8XA 3U6MA 2UUAM 3B7QA 4CHTB 1J5EM 3AFHA 5KO3A 3GRUA 1ZV1A 3TWMA 1X37A 4KO8A 3PNYA 1XNRM 2OOBA 1Z5CA 2CHGA 1TDHA 2WSFF 4CIZA 2JNHA 1SXJC 4MGKE 3L27A 2X4AA 1MX0A 3SYLA 2WZJA 1SXJB 2DKLA 3T6PA 1TTEA 4L16A 1QVRA 1GJSA 2Y0QA 5KQDA 3GLIA 4AW4A 2DWNA 2OQ4A 2OPFA 4G4NA 4JI3M 4PDGA 2VDBB 1Q02A 3U5ZA 3GPPA 3UK6A 3PNVA 2APLA 3NBIA 3W68A 4DV4M 4Z6YA 4D81A 5C1BA 2M60A 5EXXA 5IWAM 1MN3A 2K0BX 4B7FA 1L2CA 1KFVA 2I7NA 2O25A 3I4YA 3R9XB 1D0MA 4HLQA 3U60A 2L09A 4LCBA 2Q2EB 1BVSA 4KODA 1XC8A 3TPZA 1NNJA 3VLFB 3MMPA 3J81S 3U6LA 2MJ5B 2KNVA 4IBBA 4PCZA 4UN2B 3SASA 1GABA 1G4AE 4DV0M 2ZM6M 2UXDM 2DZLA 3KVWA 1HT2E 3FTFA 2KZSA 1V34A 3L2AA 3W67A 2KXEA 3SBJA 1SXJE 4MH0E 1XXHE 2JA2A 1R2YA 3SAWA 1TH3A 1VEKA 1ZAEA 2XEPA 4REZA 1E32A 5KPRA 3PFIA 2LWXA 2HAKA 5LMNM 3L25A 4LZZA 3B9PA 2KDLA 1NV9A 4YY3M 4I5SA 1N77A 5DNYA 1HQYE 1WGNA 2LTUA 3SC3A 3SAUA 2RGHA 3J7AS 3FUWA 1GJTA 2UXBM 1R7RA 3CF2A 3DOAA 1IN6A 2DHRA 3HZJA 3KSJA 1TDZA 3TQSA 1XNQM 4KHPM 1OFIA 2C99A 2JY7A 5E6JA 1GL6A 2L7HA 3MHVC 5H37D 3CF0A 2YQZA 3FRHA 2MGWA 4W5WA 1IN4A 2DAKA 3B74A 1F4IA 1FNNA 3HJ8A 1YUBA 5EP3A 5ITUA 4MGIE 1NHGC 2OO9A 2F5SA 3HU3A 1XB2B 4I4LA 1PRBA 1Q3BA 4DV5M 3U6EA 2QHOB 4BB9A 4IBJA 5FTJA 3B7NA 1WR1B 3K9OA 2F5OA 1QAOA 3GPUA 4HEOA 2H1RA 4AZFA 2Z3XA 1MU5A 1NY6A 4XGIA 4MB7A 1QANA 2XGNA 4PT5A 1DGGA 5KQ8A 4M0WA 4WW0A 2Z7JA 1ZMVA 4LFBM 4WP2A 4JI4M 4GRIA 4LRTA 4X62M 1G8PA 1TR8A 4DR2M 5ITYA 2KRUA 4LFAM 1NY5A 1V33A 1OIZA 3PVSA 1T6OA 4M9SA 1N36M 3SYKA 4LF6M 1GO5A 2QENA 2FE8A 2W82A 2F5PA 2CWBA 3QAUA 1KSFX 1HNZM 4M0DA 3GP1A 4L6V6 3D8BA 2MROB 3QYBA 4B3RM 3GRRA 1QDTA 1QAQA 2KNZA 1P3QQ 4B3SM 2O5RA 2V1CA 2XLJA 1N33M 1JB0F 2KHHA 4OVZA 8CATA 5KPTA 2VF8A 3T1YM 5F3WA 1NSFA 3GRYA 3M6AA 4ITQA 1J09A 2CV1A 1Z5AA 5IZ7D 4L78A 3GLGA 1DO0A 3H4JA 3I51A 4DR7M 1VG5A 1WJ7A 3FTEA 3VKHA 4IBEA 3W0LB 4OW0A 1IXRC 1SXJD 5FTLA 5EP4A 3HU1A 1TF0B 2A5YB 4IBIA 1QUSA 2HHHM 1IN8A 1DGBA 2CEAA 3U61B 2R4EA 2K6BA 1ZMUA 4JYAM 2EKKA 4B08A 1JR3D 3SAVA 1UM8A 2ZAMA 3E46A 3U6SA 4I81A 1IXSB 2DAEA 3K9PA 1SG9A 2FH0A 3CGWA 1K3WA 2C96A 2XH9A 2N35A 4AKIA 3AOEA 2JXNA 5EQTA 4IIWA 1E9RA 1Y8GA 2I7PA 4G4OA 4S12A 1QDRA 1QQWA 2JY6B 3JR4A 4CJ6A 4PDIA 1YSYA 5ITXA 3GQ5A 1DGHB 1YE9A 1XXHB 4NXNM 3LQQA 4M9ZA 3A42A 1L8QA 4LF9M 3D8LA 3RFWA 4FWDA 2KEBA 1OFHA 3J27B 4DBGB 3GLIB 2L4FA 4LRSA 4DV6M 3AKZA 3K1JA 1GVNA 1DV0A 5BPVA 2Y0TA 2JUJA 4RF1A 1NJGA 3PXGA 3IG5A 3KOYE 4QHTA 2DZNB 2R65A 3SMPA 4DV2M 4NSOB 3WHLA 1HNWM 3LMMA 2MR9A 3VDUA 3KDSE 2QBYB 1ORYB 4F2LA 2R44A 4XK8F 1UFZA 2D7GA 5EP2A 4NC6A 3C9PA 2KA6B 4LGYA 4LJ9A 4LG2A 1SXJA 2NQ8C 4ZPXA 3U60B 1XMOM 1GL7A 2WSEF 2XFSA 4L4UA 2FFJA 3KS8A 4BBAA 2GQFA 3V76A 1IN5A 2V6ZM 1WIVA 3J80S 1L2DA 3KOXE 4AG5A 1DGFA 2P5TA 2R45A 5JI2E 4DR6M 1Q3CA 4ANRA 1JR3A 1QUTA 2J7OA 3LCVB 3F92A 4QNRA 2XSZD 1PJQA 2GNOA 1HR0M 2DNAA 4OX9M 2CRUA 3IG8A 1NO1A 3C58A 3K8ZA 1E94E 1VEJA 2L4EA 3HKPA 1WHCA 3HHZA 1LV7A 3GLIE 1IBKM 1EIJA 4GEWA 3GPXA 3I01M 5EXTA 2FS1A 4LJ7A 4GMQA 2C9CA 2D7EA 2LHGA 2QCUA 3BOSA 3KOWE 4NSRA 3HHXA 1R2ZA 2RGOA 1I4WA 1QAMA 5IT9S 1EFUB 3L26A 3IHPA 4QHSA 2CHVA 2CP8A 2DZOB 2QZ4A 4LJ5A 2C98A 2DAGA 2XZFA 1FJGM 2LVAA 3HY5A 4PD2A 2K9DA 2BWEA 4DR3M 4WURA 3HGIA 1IFYA 3HJQA 2QNJA 4D80A 3EIHA 1PJJA 2VQFM 4B3TM 4JI6M 2Y20A 4DR4M 2CE7A 1IY0A 2H5XA 2G8LA 4GC5A 2RKOA 5C18A 3U6OA 1G71A 2LBCA 2DWMA 5EJCA 4JI1M 2XFTA 3HHWA 4DV1M 2DWLA 1D2NA 1OAOC 3KXEC 3ZQJA 3GLFA 3A45A 2QP9X 4Y28F 3U6PA 1IY2A 4K0KM 3E9SA 5FSWA 2XSZA 5BR8M 3UZUA 2L6OA 3HWSA 4II7A 4P16A 3LW5F 1N32M 2KNAA 4LY6A 1YLAA 3KW6A 5JI3E 3LCUA 4MGHA 3VFDA 1W5TA 3E21A 4KLNA 3HX3A 2EKFA 5L8RF 2X49A 4LJ6A 1J7KA 1ZQ9A 2F5NA 3AV0A 3TL4X 4GKKM 7CATA 2HWJA 2R46A 2R4JA 3GPYA 2HCBA 3I04M 3SHFA 3FE3A 3H4MA 1LTMA 2DENA 2YR0A 4RKUF 4L15A 1NVMA 4NRWA 5EXPA 1QZMA 1XWIA 2JWSA 3GQ4A 3GRVA 4I8OA 1T43A 2CV0A 4QOZC 3HJSA 2J5YA 3VK8A 1PGYA 1PJIA 2VIIA 1IBLM 3FYCA 3GLHB 3KS4A 3E4RA 2EJSA 4CGYB 3NBXX 4LZJA 4P17A 2XZUA 4IJEA 5LMUM 3ILKA 2OOAA 2O01F 2DWZB 2R6FA 2DAMA 3Q8GA 1OAIA 4FWHA 1R4GA 3B89A 4GKJM 3R8FA 2BNKA 4NL4H 1ZMWA 4FVMA 4GHAA 1QYRA 1W5SA 3SHGB 4X65M 2LVNC 3B7ZA 5DYGA 1GKIA 3VDPA 4FD2A 4G3OA 3LVWA 1CUKA 3OTOM 4AQYM 3SMSA 1GLNA 4IBFA 2LH0A 3U6CA 3GLHE 4M9XA 2Z8YM 3NWLA 3A98B 3U61A 1T3TA 4DUZM 3GLGE 4AKGA 2ZTDA 2G5GX 2R18A 3FRIA 1IXSA 4FWGA 2BJVA 4GIPA 2UXCM 3TWLA 2HKJA 1PJSA 1Z6TA 4IBCA 1VQ1A 2ZANA 4IJFA 3U5ZB 3RE8A 2EA0A 4X64M 1G59A 4LF5M 4HL4A 2D7HA 4A3VB 1TH4A 1EE8A 2C9OA
chains in the Genus database with same CATH topology
2Z4SA 1DGHA 3T38A 2V1UA 1XXHA 3U6QA 3ZCBB 5FTNA 3TE6A 3CTWB 2DVWB 2KRKA 4AG6A 4NXMM 1K82A 2M5ZA 4LFCM 1IM2A 5KPZA 4G4QA 4QOSA 3FUVA 3SFZA 2EO2A 4GHLA 2ERCA 2QBYA 4LGMA 5ITXE 3L29A 5FTKA 3I4VA 4L8RC 4MGZE 4JXJA 3FYDA 3LQRA 3UGJA 1XHBA 4QNMA 1NNUC 4JI0M 2VQEM 2ZAOA 4B3TM 2ZBKB 3FTDA 4LF4M 5ITTA 3Q8XA 3ZC7B 1L2BA 1PM5A 1I94M 1HT1E 1VDDA 2LNHC 2Z4RA 2CUZA 5IREB 3AOGA 4R7GA 3FUTA 1N34M 3U6DA 1JQJC 1OJLA 2KW0A 3KP0E 1KYIA 3RGSA 1G3IA 1NJFA 4JI5M 2E5LM 3GQ3A 1IY1A 3AJIB 1R6BX 4EIWA 1E9SA 3AL0C 4JI2M 1IXZA 2HL7A 5FLXS 2FOIC 3FUUA 3K2LA 4LF8M 3HHYA 2Y21A 1G41A 4DR5M 4NOOB 4D82A 4TUWA 1C1KA 1N75A 3T15A 2CV2A 2F5QA 2K47A 2QPAA 1XMQM 4FCWA 3UMMA 3GLFB 3FTCA 4DV7M 1WXQA 3A46A 2R62A 1S3SA 3ZH9B 4B7HA 1IBMM 4JI8M 4IBDA 2CFOA 2AHMA 3KOZE 4RNAA 3J2PB 3THGA 3SARA 5A2QS 4JI7M 4LF7M 3DA1A 4NRVA 4IBGA 5E26A 2DXIA 3KP1E 3JR5A 1Q39A 4RF0A 2UU9M 3RGPA 2YNMD 4G6ZA 3TWKA 4DUYM 4B3MM 3UJNA 3DFZA 3FD9A 2YFQA 4LJ4A 4MM3B 4B7GA 1HQCA 3MK6A 4OVZB 3GO8A 3SATA 3EIEA 3LVVA 4JN6A 1L1ZA 1K3XA 2F4VM 1H6UA 3GLGB 4DR1M 2J7NA 5FTMA 3M0EA 1DO2A 1TGUA 2EUCA 3HU2A 4YHHM 5EXSA 4GH9A 3DZDA 3L28A 4LJ8A 4CISA 1NHWC 2FNAA 3KFUG 4GC9A 2L7IA 3VKGA 4MGYE 4FCVA 1HNXM 5ITRA 3W0FA 4FCTA 2UUCM 4LJAA 4IBKA 3JAMS 3J7BA 4R3DA 4OU7A 3AOEC 3GLHA 3FKEA 3VK7A 1L1TA 2CHQA 1IN7A 4AKHA 1Z59A 2LXEA 1N78A 4XBOA 4X66M 2C5RA 4JV5M 3MJ5A 5EP1A 3K92A 1Z5BA 5GKNA 5DYIA 2UUBM 2X8AA 3QWLA 1IQPA 4G4RA 3T1HM 4AI6A 5ITQA 3WHKA 3M7GA 2KZUA 3KSXA 4BLCA 3FUXA 4FW9A 3CF6E 2BJWA 4GITA 4DV3M 2XF3A 1TH2A 4Z8XA 3U6MA 2UUAM 4CHTB 1J5EM 3AFHA 5KO3A 3GRUA 3TWMA 1X37A 4KO8A 3PNYA 1XNRM 1Z5CA 2CHGA 1TDHA 1SXJC 4MGKE 3L27A 2X4AA 1MX0A 3SYLA 1SXJB 4L16A 1QVRA 2Y0QA 5KQDA 3GLIA 4AW4A 2DWNA 2OQ4A 2OPFA 4G4NA 4JI3M 4PDGA 3U5ZA 3GPPA 3UK6A 3PNVA 3NBIA 4DV4M 4Z6YA 4D81A 5C1BA 2M60A 5EXXA 5IWAM 4B7FA 1KFVA 2I7NA 3I4YA 3R9XB 4HLQA 3U60A 2L09A 4LCBA 2Q2EB 4KODA 1XC8A 3TPZA 1NNJA 3VLFB 3J81S 3U6LA 4IBBA 4PCZA 3SASA 1G4AE 4DV0M 2ZM6M 2UXDM 3KVWA 1HT2E 3FTFA 2KZSA 3L2AA 2KXEA 3SBJA 1SXJE 4MH0E 2JA2A 1R2YA 3SAWA 1TH3A 1ZAEA 2XEPA 4REZA 1E32A 5KPRA 3PFIA 2LWXA 5LMNM 3L25A 4LZZA 3B9PA 4YY3M 4I5SA 1N77A 5DNYA 1HQYE 3SC3A 3SAUA 2RGHA 3J7AS 3FUWA 2UXBM 1R7RA 3CF2A 3DOAA 1IN6A 2DHRA 3KSJA 1TDZA 3TQSA 1XNQM 4KHPM 1OFIA 2C99A 5E6JA 1GL6A 2L7HA 3MHVC 5H37D 3CF0A 2YQZA 4W5WA 1IN4A 1FNNA 3HJ8A 1YUBA 5EP3A 5ITUA 4MGIE 1NHGC 2F5SA 3HU3A 4I4LA 1Q3BA 4DV5M 3U6EA 4BB9A 4IBJA 5FTJA 2F5OA 1QAOA 3GPUA 2H1RA 4AZFA 2Z3XA 1MU5A 1NY6A 4XGIA 4MB7A 1QANA 2XGNA 4PT5A 1DGGA 5KQ8A 4M0WA 4WW0A 2Z7JA 4LFBM 4JI4M 4GRIA 4LRTA 4X62M 1G8PA 4DR2M 5ITYA 2KRUA 4LFAM 1NY5A 1N36M 3PVSA 4M9SA 4LF6M 3SYKA 2QENA 2FE8A 2W82A 2F5PA 3QAUA 1KSFX 1HNZM 4M0DA 3GP1A 3D8BA 4B3RM 3GRRA 1QAQA 4B3SM 2O5RA 2V1CA 2XLJA 1N33M 4OVZA 3T1YM 5KPTA 8CATA 5F3WA 4ITQA 1NSFA 3GRYA 3M6AA 1J09A 2CV1A 1Z5AA 5IZ7D 4L78A 3GLGA 1DO0A 3I51A 4DR7M 3FTEA 3VKHA 4IBEA 3W0LB 4OW0A 1IXRC 1SXJD 5FTLA 5EP4A 3HU1A 2A5YB 4IBIA 2HHHM 1IN8A 1DGBA 2CEAA 3U61B 2R4EA 4JYAM 4B08A 3SAVA 1JR3D 1UM8A 2ZAMA 3U6SA 4I81A 1IXSB 1K3WA 2C96A 2XH9A 4AKIA 3AOEA 5EQTA 4IIWA 1E9RA 2I7PA 4G4OA 4S12A 1QQWA 3JR4A 4PDIA 1YSYA 5ITXA 3GQ5A 1DGHB 1YE9A 1XXHB 4NXNM 3LQQA 4M9ZA 3A42A 1L8QA 4LF9M 3D8LA 3RFWA 4FWDA 2KEBA 1OFHA 3J27B 3GLIB 4DV6M 4LRSA 3AKZA 3K1JA 1GVNA 5BPVA 2Y0TA 4RF1A 3PXGA 1NJGA 4DV2M 3IG5A 3KOYE 4QHTA 2DZNB 2R65A 3SMPA 4NSOB 3WHLA 1HNWM 3LMMA 3VDUA 2QBYB 3KDSE 1ORYB 5EP2A 2D7GA 2KA6B 4LGYA 4LJ9A 4LG2A 1SXJA 2NQ8C 4ZPXA 3U60B 1XMOM 1GL7A 2XFSA 4L4UA 1L2CA 2FFJA 3KS8A 4BBAA 1IN5A 2V6ZM 3J80S 1L2DA 3KOXE 4AG5A 1DGFA 2P5TA 2R45A 5JI2E 4DR6M 1Q3CA 1JR3A 2J7OA 4QNRA 2XSZD 1HR0M 4OX9M 3IG8A 3C58A 3K8ZA 1E94E 3HKPA 3HHZA 1IBKM 1LV7A 3GPXA 5EXTA 4LJ7A 4GMQA 2C9CA 2D7EA 3BOSA 2QCUA 3KOWE 4NSRA 1R2ZA 3HHXA 2RGOA 1I4WA 1QAMA 5IT9S 3L26A 4QHSA 2CHVA 2DZOB 2QZ4A 4LJ5A 2C98A 2XZFA 1FJGM 4PD2A 4DR3M 4WURA 3HGIA 3HJQA 4D80A 3EIHA 1PJJA 2VQFM 4JI6M 4DR4M 2Y20A 2CE7A 1IY0A 4GC5A 2G8LA 2RKOA 5C18A 3U6OA 2DWMA 5EJCA 4JI1M 2XFTA 3HHWA 4DV1M 2DWLA 1D2NA 3KXEC 3GLFA 3A45A 2QP9X 3U6PA 1IY2A 4K0KM 3E9SA 5FSWA 2XSZA 5BR8M 3UZUA 2L6OA 3HWSA 4II7A 4P16A 1N32M 4LY6A 3KW6A 5JI3E 4MGHA 3VFDA 1W5TA 4KLNA 2X49A 4LJ6A 1J7KA 1ZQ9A 2F5NA 3AV0A 3TL4X 4GKKM 7CATA 2R46A 2R4JA 3GPYA 2HCBA 3SHFA 3H4MA 2YR0A 4L15A 1NVMA 4NRWA 5EXPA 1QZMA 1XWIA 3GQ4A 3GRVA 4I8OA 2CV0A 4QOZC 3HJSA 3VK8A 1PJIA 2VIIA 1IBLM 3FYCA 3GLHB 3KS4A 3E4RA 4CGYB 4LZJA 2XZUA 4IJEA 5LMUM 3ILKA 2DWZB 4FWHA 4GKJM 3R8FA 2BNKA 4NL4H 4GHAA 4FVMA 1QYRA 1W5SA 3SHGB 4X65M 5DYGA 1GKIA 3VDPA 4FD2A 3LVWA 3OTOM 4AQYM 3SMSA 1GLNA 4IBFA 2LH0A 3U6CA 4M9XA 3NWLA 3A98B 3U61A 1T3TA 4DUZM 4AKGA 2G5GX 2R18A 4FWGA 2BJVA 4GIPA 2UXCM 3TWLA 2HKJA 1Z6TA 4IBCA 2ZANA 4IJFA 3U5ZB 3RE8A 2EA0A 4X64M 1G59A 4LF5M 4HL4A 2D7HA 4A3VB 1TH4A 1EE8A 2C9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z59 A;  4JV5 M;  4X66 M;  3U6Q A;  4LFB M;  4NXM M;  4JI4 M;  1K82 A;  1Z5B A;  4X62 M;  4DR2 M;  2XZF A;  4LFC M;  1FJG M;  5ITY A;  4PD2 A;  2UUB M;  4LFA M;  1N36 M;  4G4Q A;  4G4R A;  4DR3 M;  3T1H M;  4LF6 M;  5ITQ A;  2F5P A;  1PJJ A;  2VQF M;  4JI6 M;  4DR4 M;  5ITX E;  3U6M A;  4DV3 M;  1HNZ M;  2UUA M;  3GP1 A;  1J5E M;  3U6O A;  4B3R M;  4JI1 M;  4JI0 M;  4B3T M;  2VQE M;  3TWM A;  4DV1 M;  2ZBK B;  4B3S M;  4LF4 M;  3A45 A;  5ITT A;  1XNR M;  1L2B A;  3U6P A;  3T1Y M;  1Z5C A;  4K0K M;  1PM5 A;  1N33 M;  1TDH A;  5BR8 M;  4ITQ A;  1Z5A A;  1I94 M;  1N32 M;  4DR7 M;  1MX0 A;  1N34 M;  3U6D A;  2OQ4 A;  2OPF A;  4G4N A;  4JI3 M;  4PDG A;  2E5L M;  4JI5 M;  3GQ3 A;  3GPP A;  2F5N A;  2HHH M;  4GKK M;  4JI2 M;  4DV4 M;  4JYA M;  5FLX S;  3SAV A;  3GPY A;  5IWA M;  3U6S A;  4LF8 M;  1KFV A;  1K3W A;  4DR5 M;  4NRW A;  2Q2E B;  1XC8 A;  2F5Q A;  3GQ4 A;  1NNJ A;  3J81 S;  3U6L A;  4G4O A;  1XMQ M;  4PCZ A;  3SAS A;  4DV7 M;  3VK8 A;  4DV0 M;  2ZM6 M;  1PJI A;  2UXD M;  1IBL M;  3A46 A;  3JR4 A;  4JI8 M;  1IBM M;  4PDI A;  5ITX A;  3GQ5 A;  3SBJ A;  4NXN M;  1R2Y A;  3A42 A;  3SAW A;  2XZU A;  5LMU M;  4LF9 M;  3SAR A;  4DV6 M;  5A2Q S;  4JI7 M;  5LMN M;  4LF7 M;  4NRV A;  4DV2 M;  4YY3 M;  3JR5 A;  4GKJ M;  1HNW M;  1Q39 A;  3SAU A;  3J7A S;  2UXB M;  2UU9 M;  3DOA A;  1TDZ A;  1XNQ M;  4X65 M;  1L2C A;  3TWK A;  1XMO M;  4KHP M;  4DUY M;  4B3M M;  5IT9 S;  3J80 S;  3OTO M;  1L2D A;  3GO8 A;  4AQY M;  3SAT A;  4DR6 M;  1Q3C A;  1L1Z A;  1K3X A;  3U6C A;  2F4V M;  4DR1 M;  1HR0 M;  4DUZ M;  4OX9 M;  3VK7 A;  4YHH M;  5ITU A;  3C58 A;  2F5S A;  4CIS A;  1IBK M;  2UXC M;  3TWL A;  1Q3B A;  2HKJ A;  4DV5 M;  3U6E A;  3GPX A;  2EA0 A;  1HNX M;  5ITR A;  4X64 M;  3GPU A;  3W0F A;  2F5O A;  2UUC M;  4LF5 M;  3JAM S;  1R2Z A;  1MU5 A;  1EE8 A;  4MB7 A;  1L1T A; 
#chains in the Genus database with same CATH topology
 1R5L A;  2Z4S A;  1DGH A;  3T38 A;  2V1U A;  1XXH A;  3U6Q A;  3ZCB B;  5FTN A;  3TE6 A;  3CTW B;  1C7Y A;  2DVW B;  2JZ1 A;  2KRK A;  4AG6 A;  1OTR A;  1K82 A;  2M5Z A;  4NXM M;  4LFC M;  2LVQ D;  1IM2 A;  5KPZ A;  4G4Q A;  4QOS A;  3FUV A;  1A5T A;  3SFZ A;  2EO2 A;  4GHL A;  2ERC A;  2QBY A;  4LGM A;  5ITX E;  3L29 A;  5FTK A;  3I4V A;  4L8R C;  1RU3 A;  4MGZ E;  4JXJ A;  3FYD A;  2DHY A;  3LQR A;  3UGJ A;  1D0L A;  1XHB A;  1NNU C;  4QNM A;  4JI0 M;  2ZAO A;  2VQE M;  1WGL A;  2QQ8 A;  2ZBK B;  3FTD A;  4LF4 M;  5ITT A;  3Q8X A;  3ZC7 B;  1L2B A;  1PM5 A;  1I94 M;  1HT1 E;  1VDD A;  2LNH C;  2Z4R A;  2CUZ A;  1HJP A;  5IRE B;  2JZ0 A;  3AOG A;  1VDL A;  4R7G A;  3FUT A;  1N34 M;  3U6D A;  1JQJ C;  1OJL A;  2DI0 A;  2KW0 A;  3KP0 E;  1KYI A;  3RGS A;  1G3I A;  1NJF A;  4JI5 M;  2E5L M;  3GQ3 A;  1IY1 A;  3AJI B;  1R6B X;  4EIW A;  2WSC F;  1E9S A;  3AL0 C;  1JR3 E;  4JI2 M;  2JY8 A;  1IXZ A;  2HL7 A;  5FLX S;  2FOI C;  2VF7 A;  3FUU A;  3K2L A;  4LF8 M;  3HHY A;  2Y21 A;  2LHC A;  1G41 A;  4DR5 M;  4NOO B;  4D82 A;  4TUW A;  1C1K A;  1N75 A;  3T15 A;  2CV2 A;  2F5Q A;  1PJT A;  2K47 A;  2QPA A;  1XMQ M;  4FCW A;  1OKS A;  3UMM A;  3GLF B;  3FTC A;  4DV7 M;  2DAI A;  1WXQ A;  3A46 A;  2R62 A;  1S3S A;  3ZH9 B;  4B7H A;  1IBM M;  2JP7 A;  4JI8 M;  4IBD A;  2CFO A;  2AHM A;  1OIP A;  3KOZ E;  4RNA A;  4KT0 F;  3J2P B;  3THG A;  3SAR A;  5A2Q S;  4JI7 M;  2RRU A;  4LF7 M;  4Q7J A;  3DA1 A;  2L2D A;  4IBG A;  4NRV A;  5E26 A;  5DFL A;  2DXI A;  2R0I A;  3KP1 E;  3JR5 A;  1AUA A;  1Q39 A;  4RF0 A;  4F1I A;  2UU9 M;  3RGP A;  1D0K A;  2YNM D;  2ZTC A;  4G6Z A;  3TWK A;  1NV8 A;  4DUY M;  4B3M M;  3UJN A;  3DFZ A;  2BWB A;  3FD9 A;  2YFQ A;  4LJ4 A;  3BXW A;  4MM3 B;  4B7G A;  1HQC A;  3MK6 A;  4OVZ B;  3GLF E;  3GO8 A;  3SAT A;  3EIE A;  3LVV A;  2G3Q A;  4JN6 A;  1L1Z A;  1K3X A;  2F4V M;  1H6U A;  2B3T A;  3GLG B;  2J7N A;  4DR1 M;  5FTM A;  3M0E A;  1DO2 A;  1TGU A;  2EUC A;  3HU2 A;  4YHH M;  1MJG M;  4GH9 A;  3DZD A;  5EXS A;  3L28 A;  4LJ8 A;  2LVP C;  4CIS A;  1NHW C;  2FNA A;  3KFU G;  4GC9 A;  2L7I A;  3VKG A;  4MGY E;  4FCV A;  1HNX M;  5ITR A;  3W0F A;  4FCT A;  2UUC M;  1V92 A;  4IBK A;  4LJA A;  4R71 A;  3J7B A;  2QSF X;  3JAM S;  4R3D A;  2LVO C;  4OU7 A;  3AOE C;  3FKE A;  3GLH A;  3VK7 A;  3C3D A;  3QYE A;  3BBZ A;  1L1T A;  2CHQ A;  1IN7 A;  1OQY A;  1Z59 A;  2LXE A;  1N78 A;  4AKH A;  2JY5 A;  4XBO A;  4X66 M;  2C5R A;  4JV5 M;  3MJ5 A;  1QZE A;  2MH8 A;  5EP1 A;  3C3E A;  3K92 A;  1Z5B A;  5GKN A;  5DYI A;  1VEG A;  2UUB M;  2X8A A;  3QWL A;  1IQP A;  4G4R A;  3T1H M;  4AI6 A;  5ITQ A;  3WHK A;  3M7G A;  1AIP C;  2KZU A;  3IEC A;  3KSX A;  4BLC A;  3FUX A;  4FW9 A;  3CF6 E;  2BJW A;  4GIT A;  4DV3 M;  2XF3 A;  1TH2 A;  4Z8X A;  3U6M A;  2UUA M;  3B7Q A;  4CHT B;  1J5E M;  3AFH A;  5KO3 A;  3GRU A;  1ZV1 A;  3TWM A;  1X37 A;  4KO8 A;  3PNY A;  1XNR M;  2OOB A;  1Z5C A;  2CHG A;  1TDH A;  2WSF F;  4CIZ A;  2JNH A;  1SXJ C;  4MGK E;  3L27 A;  2X4A A;  1MX0 A;  3SYL A;  2WZJ A;  1SXJ B;  2DKL A;  3T6P A;  1TTE A;  4L16 A;  1QVR A;  1GJS A;  2Y0Q A;  5KQD A;  3GLI A;  4AW4 A;  2DWN A;  2OQ4 A;  2OPF A;  4G4N A;  4JI3 M;  4PDG A;  2VDB B;  1Q02 A;  3U5Z A;  3GPP A;  3UK6 A;  3PNV A;  2APL A;  3NBI A;  3W68 A;  4DV4 M;  4Z6Y A;  4D81 A;  5C1B A;  2M60 A;  5EXX A;  5IWA M;  1MN3 A;  2K0B X;  4B7F A;  1L2C A;  1KFV A;  2I7N A;  2O25 A;  3I4Y A;  3R9X B;  1D0M A;  4HLQ A;  3U60 A;  2L09 A;  4LCB A;  2Q2E B;  1BVS A;  4KOD A;  1XC8 A;  3TPZ A;  1NNJ A;  3VLF B;  3MMP A;  3J81 S;  3U6L A;  2MJ5 B;  2KNV A;  4IBB A;  4PCZ A;  4UN2 B;  3SAS A;  1GAB A;  1G4A E;  4DV0 M;  2ZM6 M;  2UXD M;  2DZL A;  3KVW A;  1HT2 E;  3FTF A;  2KZS A;  1V34 A;  3L2A A;  3W67 A;  2KXE A;  3SBJ A;  1SXJ E;  4MH0 E;  1XXH E;  2JA2 A;  1R2Y A;  3SAW A;  1TH3 A;  1VEK A;  1ZAE A;  2XEP A;  4REZ A;  1E32 A;  5KPR A;  3PFI A;  2LWX A;  2HAK A;  5LMN M;  3L25 A;  4LZZ A;  3B9P A;  2KDL A;  1NV9 A;  4YY3 M;  4I5S A;  1N77 A;  5DNY A;  1HQY E;  1WGN A;  2LTU A;  3SC3 A;  3SAU A;  2RGH A;  3J7A S;  3FUW A;  1GJT A;  2UXB M;  1R7R A;  3CF2 A;  3DOA A;  1IN6 A;  2DHR A;  3HZJ A;  3KSJ A;  1TDZ A;  3TQS A;  1XNQ M;  4KHP M;  1OFI A;  2C99 A;  2JY7 A;  5E6J A;  1GL6 A;  2L7H A;  3MHV C;  5H37 D;  3CF0 A;  2YQZ A;  3FRH A;  2MGW A;  4W5W A;  1IN4 A;  2DAK A;  3B74 A;  1F4I A;  1FNN A;  3HJ8 A;  1YUB A;  5EP3 A;  5ITU A;  4MGI E;  1NHG C;  2OO9 A;  2F5S A;  3HU3 A;  1XB2 B;  4I4L A;  1PRB A;  1Q3B A;  4DV5 M;  3U6E A;  2QHO B;  4BB9 A;  4IBJ A;  5FTJ A;  3B7N A;  1WR1 B;  3K9O A;  2F5O A;  1QAO A;  3GPU A;  4HEO A;  2H1R A;  4AZF A;  2Z3X A;  1MU5 A;  1NY6 A;  4XGI A;  4MB7 A;  1QAN A;  2XGN A;  4PT5 A;  1DGG A;  5KQ8 A;  4M0W A;  4WW0 A;  2Z7J A;  1ZMV A;  4LFB M;  4WP2 A;  4JI4 M;  4GRI A;  4LRT A;  4X62 M;  1G8P A;  1TR8 A;  4DR2 M;  5ITY A;  2KRU A;  4LFA M;  1NY5 A;  1V33 A;  1OIZ A;  3PVS A;  1T6O A;  4M9S A;  1N36 M;  3SYK A;  4LF6 M;  1GO5 A;  2QEN A;  2FE8 A;  2W82 A;  2F5P A;  2CWB A;  3QAU A;  1KSF X;  1HNZ M;  4M0D A;  3GP1 A;  4L6V 6;  3D8B A;  2MRO B;  3QYB A;  4B3R M;  3GRR A;  1QDT A;  1QAQ A;  2KNZ A;  1P3Q Q;  4B3S M;  2O5R A;  2V1C A;  2XLJ A;  1N33 M;  1JB0 F;  2KHH A;  4OVZ A;  8CAT A;  5KPT A;  2VF8 A;  3T1Y M;  5F3W A;  1NSF A;  3GRY A;  3M6A A;  4ITQ A;  1J09 A;  2CV1 A;  1Z5A A;  5IZ7 D;  4L78 A;  3GLG A;  1DO0 A;  3H4J A;  3I51 A;  4DR7 M;  1VG5 A;  1WJ7 A;  3FTE A;  3VKH A;  4IBE A;  3W0L B;  4OW0 A;  1IXR C;  1SXJ D;  5FTL A;  5EP4 A;  3HU1 A;  1TF0 B;  2A5Y B;  4IBI A;  1QUS A;  2HHH M;  1IN8 A;  1DGB A;  2CEA A;  3U61 B;  2R4E A;  2K6B A;  1ZMU A;  4JYA M;  2EKK A;  4B08 A;  1JR3 D;  3SAV A;  1UM8 A;  2ZAM A;  3E46 A;  3U6S A;  4I81 A;  1IXS B;  2DAE A;  3K9P A;  1SG9 A;  2FH0 A;  3CGW A;  1K3W A;  2C96 A;  2XH9 A;  2N35 A;  4AKI A;  3AOE A;  2JXN A;  5EQT A;  4IIW A;  1E9R A;  1Y8G A;  2I7P A;  4G4O A;  4S12 A;  1QDR A;  1QQW A;  2JY6 B;  3JR4 A;  4CJ6 A;  4PDI A;  1YSY A;  5ITX A;  3GQ5 A;  1DGH B;  1YE9 A;  1XXH B;  4NXN M;  3LQQ A;  4M9Z A;  3A42 A;  1L8Q A;  4LF9 M;  3D8L A;  3RFW A;  4FWD A;  2KEB A;  1OFH A;  3J27 B;  4DBG B;  3GLI B;  2L4F A;  4LRS A;  4DV6 M;  3AKZ A;  3K1J A;  1GVN A;  1DV0 A;  5BPV A;  2Y0T A;  2JUJ A;  4RF1 A;  1NJG A;  3PXG A;  3IG5 A;  3KOY E;  4QHT A;  2DZN B;  2R65 A;  3SMP A;  4DV2 M;  4NSO B;  3WHL A;  1HNW M;  3LMM A;  2MR9 A;  3VDU A;  3KDS E;  2QBY B;  1ORY B;  4F2L A;  2R44 A;  4XK8 F;  1UFZ A;  2D7G A;  5EP2 A;  4NC6 A;  3C9P A;  2KA6 B;  4LGY A;  4LJ9 A;  4LG2 A;  1SXJ A;  2NQ8 C;  4ZPX A;  3U60 B;  1XMO M;  1GL7 A;  2WSE F;  2XFS A;  4L4U A;  2FFJ A;  3KS8 A;  4BBA A;  2GQF A;  3V76 A;  1IN5 A;  2V6Z M;  1WIV A;  3J80 S;  1L2D A;  3KOX E;  4AG5 A;  1DGF A;  2P5T A;  2R45 A;  5JI2 E;  4DR6 M;  1Q3C A;  4ANR A;  1JR3 A;  1QUT A;  2J7O A;  3LCV B;  3F92 A;  4QNR A;  2XSZ D;  1PJQ A;  2GNO A;  1HR0 M;  2DNA A;  4OX9 M;  2CRU A;  3IG8 A;  1NO1 A;  3C58 A;  3K8Z A;  1E94 E;  1VEJ A;  2L4E A;  3HKP A;  1WHC A;  3HHZ A;  1LV7 A;  3GLI E;  1IBK M;  1EIJ A;  4GEW A;  3GPX A;  3I01 M;  5EXT A;  2FS1 A;  4LJ7 A;  4GMQ A;  2C9C A;  2D7E A;  2LHG A;  2QCU A;  3BOS A;  3KOW E;  4NSR A;  3HHX A;  1R2Z A;  2RGO A;  1I4W A;  1QAM A;  5IT9 S;  1EFU B;  3L26 A;  3IHP A;  4QHS A;  2CHV A;  2CP8 A;  2DZO B;  2QZ4 A;  4LJ5 A;  2C98 A;  2DAG A;  2XZF A;  1FJG M;  2LVA A;  3HY5 A;  4PD2 A;  2K9D A;  2BWE A;  4DR3 M;  4WUR A;  3HGI A;  1IFY A;  3HJQ A;  2QNJ A;  4D80 A;  3EIH A;  1PJJ A;  2VQF M;  4B3T M;  4JI6 M;  2Y20 A;  4DR4 M;  2CE7 A;  1IY0 A;  2H5X A;  2G8L A;  4GC5 A;  2RKO A;  5C18 A;  3U6O A;  1G71 A;  2LBC A;  2DWM A;  5EJC A;  4JI1 M;  2XFT A;  3HHW A;  4DV1 M;  2DWL A;  1D2N A;  1OAO C;  3KXE C;  3ZQJ A;  3GLF A;  3A45 A;  2QP9 X;  4Y28 F;  3U6P A;  1IY2 A;  4K0K M;  3E9S A;  5FSW A;  2XSZ A;  5BR8 M;  3UZU A;  2L6O A;  3HWS A;  4II7 A;  4P16 A;  3LW5 F;  1N32 M;  2KNA A;  4LY6 A;  1YLA A;  3KW6 A;  5JI3 E;  3LCU A;  4MGH A;  3VFD A;  1W5T A;  3E21 A;  4KLN A;  3HX3 A;  2EKF A;  5L8R F;  2X49 A;  4LJ6 A;  1J7K A;  1ZQ9 A;  2F5N A;  3AV0 A;  3TL4 X;  4GKK M;  7CAT A;  2HWJ A;  2R46 A;  2R4J A;  3GPY A;  2HCB A;  3I04 M;  3SHF A;  3FE3 A;  3H4M A;  1LTM A;  2DEN A;  2YR0 A;  4RKU F;  4L15 A;  1NVM A;  4NRW A;  5EXP A;  1QZM A;  1XWI A;  2JWS A;  3GQ4 A;  3GRV A;  4I8O A;  1T43 A;  2CV0 A;  4QOZ C;  3HJS A;  2J5Y A;  3VK8 A;  1PGY A;  1PJI A;  2VII A;  1IBL M;  3FYC A;  3GLH B;  3KS4 A;  3E4R A;  2EJS A;  4CGY B;  3NBX X;  4LZJ A;  4P17 A;  2XZU A;  4IJE A;  5LMU M;  3ILK A;  2OOA A;  2O01 F;  2DWZ B;  2R6F A;  2DAM A;  3Q8G A;  1OAI A;  4FWH A;  1R4G A;  3B89 A;  4GKJ M;  3R8F A;  2BNK A;  4NL4 H;  1ZMW A;  4FVM A;  4GHA A;  1QYR A;  1W5S A;  3SHG B;  4X65 M;  2LVN C;  3B7Z A;  5DYG A;  1GKI A;  3VDP A;  4FD2 A;  4G3O A;  3LVW A;  1CUK A;  3OTO M;  4AQY M;  3SMS A;  1GLN A;  4IBF A;  2LH0 A;  3U6C A;  3GLH E;  4M9X A;  2Z8Y M;  3NWL A;  3A98 B;  3U61 A;  1T3T A;  4DUZ M;  3GLG E;  4AKG A;  2ZTD A;  2G5G X;  2R18 A;  3FRI A;  1IXS A;  4FWG A;  2BJV A;  4GIP A;  2UXC M;  3TWL A;  2HKJ A;  1PJS A;  1Z6T A;  4IBC A;  1VQ1 A;  2ZAN A;  4IJF A;  3U5Z B;  3RE8 A;  2EA0 A;  4X64 M;  1G59 A;  4LF5 M;  4HL4 A;  2D7H A;  4A3V B;  1TH4 A;  1EE8 A;  2C9O A; 
#chains in the Genus database with same CATH homology
 2Z4S A;  1DGH A;  3T38 A;  2V1U A;  1XXH A;  3U6Q A;  3ZCB B;  5FTN A;  3TE6 A;  3CTW B;  2DVW B;  2KRK A;  4AG6 A;  4NXM M;  1K82 A;  2M5Z A;  4LFC M;  1IM2 A;  5KPZ A;  4G4Q A;  4QOS A;  3FUV A;  3SFZ A;  2EO2 A;  4GHL A;  2ERC A;  2QBY A;  4LGM A;  5ITX E;  3L29 A;  5FTK A;  3I4V A;  4L8R C;  4MGZ E;  4JXJ A;  3FYD A;  3LQR A;  3UGJ A;  1XHB A;  4QNM A;  1NNU C;  4JI0 M;  2VQE M;  2ZAO A;  4B3T M;  2ZBK B;  3FTD A;  4LF4 M;  5ITT A;  3Q8X A;  3ZC7 B;  1L2B A;  1PM5 A;  1I94 M;  1HT1 E;  1VDD A;  2LNH C;  2Z4R A;  2CUZ A;  5IRE B;  3AOG A;  4R7G A;  3FUT A;  1N34 M;  3U6D A;  1JQJ C;  1OJL A;  2KW0 A;  3KP0 E;  1KYI A;  3RGS A;  1G3I A;  1NJF A;  4JI5 M;  2E5L M;  3GQ3 A;  1IY1 A;  3AJI B;  1R6B X;  4EIW A;  1E9S A;  3AL0 C;  4JI2 M;  1IXZ A;  2HL7 A;  5FLX S;  2FOI C;  3FUU A;  3K2L A;  4LF8 M;  3HHY A;  2Y21 A;  1G41 A;  4DR5 M;  4NOO B;  4D82 A;  4TUW A;  1C1K A;  1N75 A;  3T15 A;  2CV2 A;  2F5Q A;  2K47 A;  2QPA A;  1XMQ M;  4FCW A;  3UMM A;  3GLF B;  3FTC A;  4DV7 M;  1WXQ A;  3A46 A;  2R62 A;  1S3S A;  3ZH9 B;  4B7H A;  1IBM M;  4JI8 M;  4IBD A;  2CFO A;  2AHM A;  3KOZ E;  4RNA A;  3J2P B;  3THG A;  3SAR A;  5A2Q S;  4JI7 M;  4LF7 M;  3DA1 A;  4NRV A;  4IBG A;  5E26 A;  2DXI A;  3KP1 E;  3JR5 A;  1Q39 A;  4RF0 A;  2UU9 M;  3RGP A;  2YNM D;  4G6Z A;  3TWK A;  4DUY M;  4B3M M;  3UJN A;  3DFZ A;  3FD9 A;  2YFQ A;  4LJ4 A;  4MM3 B;  4B7G A;  1HQC A;  3MK6 A;  4OVZ B;  3GO8 A;  3SAT A;  3EIE A;  3LVV A;  4JN6 A;  1L1Z A;  1K3X A;  2F4V M;  1H6U A;  3GLG B;  4DR1 M;  2J7N A;  5FTM A;  3M0E A;  1DO2 A;  1TGU A;  2EUC A;  3HU2 A;  4YHH M;  5EXS A;  4GH9 A;  3DZD A;  3L28 A;  4LJ8 A;  4CIS A;  1NHW C;  2FNA A;  3KFU G;  4GC9 A;  2L7I A;  3VKG A;  4MGY E;  4FCV A;  1HNX M;  5ITR A;  3W0F A;  4FCT A;  2UUC M;  4LJA A;  4IBK A;  3JAM S;  3J7B A;  4R3D A;  4OU7 A;  3AOE C;  3GLH A;  3FKE A;  3VK7 A;  1L1T A;  2CHQ A;  1IN7 A;  4AKH A;  1Z59 A;  2LXE A;  1N78 A;  4XBO A;  4X66 M;  2C5R A;  4JV5 M;  3MJ5 A;  5EP1 A;  3K92 A;  1Z5B A;  5GKN A;  5DYI A;  2UUB M;  2X8A A;  3QWL A;  1IQP A;  4G4R A;  3T1H M;  4AI6 A;  5ITQ A;  3WHK A;  3M7G A;  2KZU A;  3KSX A;  4BLC A;  3FUX A;  4FW9 A;  3CF6 E;  2BJW A;  4GIT A;  4DV3 M;  2XF3 A;  1TH2 A;  4Z8X A;  3U6M A;  2UUA M;  4CHT B;  1J5E M;  3AFH A;  5KO3 A;  3GRU A;  3TWM A;  1X37 A;  4KO8 A;  3PNY A;  1XNR M;  1Z5C A;  2CHG A;  1TDH A;  1SXJ C;  4MGK E;  3L27 A;  2X4A A;  1MX0 A;  3SYL A;  1SXJ B;  4L16 A;  1QVR A;  2Y0Q A;  5KQD A;  3GLI A;  4AW4 A;  2DWN A;  2OQ4 A;  2OPF A;  4G4N A;  4JI3 M;  4PDG A;  3U5Z A;  3GPP A;  3UK6 A;  3PNV A;  3NBI A;  4DV4 M;  4Z6Y A;  4D81 A;  5C1B A;  2M60 A;  5EXX A;  5IWA M;  4B7F A;  1KFV A;  2I7N A;  3I4Y A;  3R9X B;  4HLQ A;  3U60 A;  2L09 A;  4LCB A;  2Q2E B;  4KOD A;  1XC8 A;  3TPZ A;  1NNJ A;  3VLF B;  3J81 S;  3U6L A;  4IBB A;  4PCZ A;  3SAS A;  1G4A E;  4DV0 M;  2ZM6 M;  2UXD M;  3KVW A;  1HT2 E;  3FTF A;  2KZS A;  3L2A A;  2KXE A;  3SBJ A;  1SXJ E;  4MH0 E;  2JA2 A;  1R2Y A;  3SAW A;  1TH3 A;  1ZAE A;  2XEP A;  4REZ A;  1E32 A;  5KPR A;  3PFI A;  2LWX A;  5LMN M;  3L25 A;  4LZZ A;  3B9P A;  4YY3 M;  4I5S A;  1N77 A;  5DNY A;  1HQY E;  3SC3 A;  3SAU A;  2RGH A;  3J7A S;  3FUW A;  2UXB M;  1R7R A;  3CF2 A;  3DOA A;  1IN6 A;  2DHR A;  3KSJ A;  1TDZ A;  3TQS A;  1XNQ M;  4KHP M;  1OFI A;  2C99 A;  5E6J A;  1GL6 A;  2L7H A;  3MHV C;  5H37 D;  3CF0 A;  2YQZ A;  4W5W A;  1IN4 A;  1FNN A;  3HJ8 A;  1YUB A;  5EP3 A;  5ITU A;  4MGI E;  1NHG C;  2F5S A;  3HU3 A;  4I4L A;  1Q3B A;  4DV5 M;  3U6E A;  4BB9 A;  4IBJ A;  5FTJ A;  2F5O A;  1QAO A;  3GPU A;  2H1R A;  4AZF A;  2Z3X A;  1MU5 A;  1NY6 A;  4XGI A;  4MB7 A;  1QAN A;  2XGN A;  4PT5 A;  1DGG A;  5KQ8 A;  4M0W A;  4WW0 A;  2Z7J A;  4LFB M;  4JI4 M;  4GRI A;  4LRT A;  4X62 M;  1G8P A;  4DR2 M;  5ITY A;  2KRU A;  4LFA M;  1NY5 A;  1N36 M;  3PVS A;  4M9S A;  4LF6 M;  3SYK A;  2QEN A;  2FE8 A;  2W82 A;  2F5P A;  3QAU A;  1KSF X;  1HNZ M;  4M0D A;  3GP1 A;  3D8B A;  4B3R M;  3GRR A;  1QAQ A;  4B3S M;  2O5R A;  2V1C A;  2XLJ A;  1N33 M;  4OVZ A;  3T1Y M;  5KPT A;  8CAT A;  5F3W A;  4ITQ A;  1NSF A;  3GRY A;  3M6A A;  1J09 A;  2CV1 A;  1Z5A A;  5IZ7 D;  4L78 A;  3GLG A;  1DO0 A;  3I51 A;  4DR7 M;  3FTE A;  3VKH A;  4IBE A;  3W0L B;  4OW0 A;  1IXR C;  1SXJ D;  5FTL A;  5EP4 A;  3HU1 A;  2A5Y B;  4IBI A;  2HHH M;  1IN8 A;  1DGB A;  2CEA A;  3U61 B;  2R4E A;  4JYA M;  4B08 A;  3SAV A;  1JR3 D;  1UM8 A;  2ZAM A;  3U6S A;  4I81 A;  1IXS B;  1K3W A;  2C96 A;  2XH9 A;  4AKI A;  3AOE A;  5EQT A;  4IIW A;  1E9R A;  2I7P A;  4G4O A;  4S12 A;  1QQW A;  3JR4 A;  4PDI A;  1YSY A;  5ITX A;  3GQ5 A;  1DGH B;  1YE9 A;  1XXH B;  4NXN M;  3LQQ A;  4M9Z A;  3A42 A;  1L8Q A;  4LF9 M;  3D8L A;  3RFW A;  4FWD A;  2KEB A;  1OFH A;  3J27 B;  3GLI B;  4DV6 M;  4LRS A;  3AKZ A;  3K1J A;  1GVN A;  5BPV A;  2Y0T A;  4RF1 A;  3PXG A;  1NJG A;  4DV2 M;  3IG5 A;  3KOY E;  4QHT A;  2DZN B;  2R65 A;  3SMP A;  4NSO B;  3WHL A;  1HNW M;  3LMM A;  3VDU A;  2QBY B;  3KDS E;  1ORY B;  5EP2 A;  2D7G A;  2KA6 B;  4LGY A;  4LJ9 A;  4LG2 A;  1SXJ A;  2NQ8 C;  4ZPX A;  3U60 B;  1XMO M;  1GL7 A;  2XFS A;  4L4U A;  1L2C A;  2FFJ A;  3KS8 A;  4BBA A;  1IN5 A;  2V6Z M;  3J80 S;  1L2D A;  3KOX E;  4AG5 A;  1DGF A;  2P5T A;  2R45 A;  5JI2 E;  4DR6 M;  1Q3C A;  1JR3 A;  2J7O A;  4QNR A;  2XSZ D;  1HR0 M;  4OX9 M;  3IG8 A;  3C58 A;  3K8Z A;  1E94 E;  3HKP A;  3HHZ A;  1IBK M;  1LV7 A;  3GPX A;  5EXT A;  4LJ7 A;  4GMQ A;  2C9C A;  2D7E A;  3BOS A;  2QCU A;  3KOW E;  4NSR A;  1R2Z A;  3HHX A;  2RGO A;  1I4W A;  1QAM A;  5IT9 S;  3L26 A;  4QHS A;  2CHV A;  2DZO B;  2QZ4 A;  4LJ5 A;  2C98 A;  2XZF A;  1FJG M;  4PD2 A;  4DR3 M;  4WUR A;  3HGI A;  3HJQ A;  4D80 A;  3EIH A;  1PJJ A;  2VQF M;  4JI6 M;  4DR4 M;  2Y20 A;  2CE7 A;  1IY0 A;  4GC5 A;  2G8L A;  2RKO A;  5C18 A;  3U6O A;  2DWM A;  5EJC A;  4JI1 M;  2XFT A;  3HHW A;  4DV1 M;  2DWL A;  1D2N A;  3KXE C;  3GLF A;  3A45 A;  2QP9 X;  3U6P A;  1IY2 A;  4K0K M;  3E9S A;  5FSW A;  2XSZ A;  5BR8 M;  3UZU A;  2L6O A;  3HWS A;  4II7 A;  4P16 A;  1N32 M;  4LY6 A;  3KW6 A;  5JI3 E;  4MGH A;  3VFD A;  1W5T A;  4KLN A;  2X49 A;  4LJ6 A;  1J7K A;  1ZQ9 A;  2F5N A;  3AV0 A;  3TL4 X;  4GKK M;  7CAT A;  2R46 A;  2R4J A;  3GPY A;  2HCB A;  3SHF A;  3H4M A;  2YR0 A;  4L15 A;  1NVM A;  4NRW A;  5EXP A;  1QZM A;  1XWI A;  3GQ4 A;  3GRV A;  4I8O A;  2CV0 A;  4QOZ C;  3HJS A;  3VK8 A;  1PJI A;  2VII A;  1IBL M;  3FYC A;  3GLH B;  3KS4 A;  3E4R A;  4CGY B;  4LZJ A;  2XZU A;  4IJE A;  5LMU M;  3ILK A;  2DWZ B;  4FWH A;  4GKJ M;  3R8F A;  2BNK A;  4NL4 H;  4GHA A;  4FVM A;  1QYR A;  1W5S A;  3SHG B;  4X65 M;  5DYG A;  1GKI A;  3VDP A;  4FD2 A;  3LVW A;  3OTO M;  4AQY M;  3SMS A;  1GLN A;  4IBF A;  2LH0 A;  3U6C A;  4M9X A;  3NWL A;  3A98 B;  3U61 A;  1T3T A;  4DUZ M;  4AKG A;  2G5G X;  2R18 A;  4FWG A;  2BJV A;  4GIP A;  2UXC M;  3TWL A;  2HKJ A;  1Z6T A;  4IBC A;  2ZAN A;  4IJF A;  3U5Z B;  3RE8 A;  2EA0 A;  4X64 M;  1G59 A;  4LF5 M;  4HL4 A;  2D7H A;  4A3V B;  1TH4 A;  1EE8 A;  2C9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...