2JY6B

Solution structure of the complex of ubiquitin and ubiquilin 1 uba domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Ubiquitin protein
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy6B00
1T6OA 2DAEA 3H4JA 2DI0A 3IECA 2B3TA 1CUKA 1OQYA 2BWBA 2KNVA 1Y8GA 1VG5A 1VQ1A 2DAMA 2CP8A 1BVSA 1VEJA 2MJ5B 2K9DA 1KYIA 3IHPA 3K9PA 1XB2B 3E46A 1OTRA 2KNZA 2MR9A 3GLHE 2ZTDA 1EFUB 1Q02A 2DAIA 2MGWA 4DBGB 2JZ0A 2KNAA 4F2LA 2CWBA 1WJ7A 2WZJA 1IM2A 2LVAA 2LVQD 2JZ1A 1SG9A 2OOAA 2LBCA 2L4FA 1TR8A 1WR1B 2OO9A 1ZMVA 2QSFX 2ZTCA 1TTEA 2R0IA 2HWJA 4HEOA 1HJPA 1DO2A 1UFZA 1AIPC 1WIVA 2LTUA 1C7YA 2MROB 1DO0A 1V92A 1PGYA 2L2DA 2DZLA 2JY5A 1OAIA 1VDLA 2JY6B 3F92A 2JY8A 2O25A 2EKFA 2HAKA 4GEWA 2H5XA 1IFYA 2EKKA 1WGLA 1VEGA 2DNAA 3K9OA 2JUJA 1VEKA 3FRIA 1XXHE 1ZV1A 1HT2E 2JP7A 4R71A 5JI2E 1G4AE 1G3IA 3MMPA 4UN2B 5DFLA 1G41A 3E21A 3FE3A 1ZMWA 1A5TA 3FRHA 2BWEA 2JY7A 1F4IA 3GLIE 2DENA 2JNHA 2LVNC 1WGNA 2L4EA 3GLGE 1IXSA 1ZMUA 1MN3A 3T6PA 2K0BX 4WP2A 1QZEA 2OOBA 1NV8A 2RRUA 3GLFE 4Q7JA 3BBZA 1OKSA 2EJSA 1YLAA 2DAGA 2DKLA 4G3OA 3LCVB 2DAKA 3B89A 2KHHA 1HT1E 1P3QQ 2LVOC 2DHYA 1T43A 1WHCA 2QNJA 1HQYE 3LCUA 1NV9A 1GO5A 1R4GA 1JR3E 2LVPC 2QHOB 2G3QA 1DV0A 4F1IA 1E94E
chains in the Genus database with same CATH superfamily
2F5OA 2N35A 3H4JA 3U6OA 2Z3XA 4Y28F 3GRUA 2F5SA 2DZNB 4L16A 4DV4M 3KSJA 1K82A 2FS1A 2P5TA 4RKUF 3GQ3A 4WURA 1MJGM 4LY6A 4LF9M 2UXBM 2C98A 3VLFB 2GQFA 2CP8A 1TH2A 2Z4SA 1IY2A 1LTMA 1XHBA 3ILKA 5FTKA 3W68A 3K9PA 1J7KA 2M5ZA 2QBYB 3HU2A 3J2PB 2QENA 1IN7A 1QYRA 4FCTA 5ITUA 3GLHE 4KO8A 3RE8A 1QUSA 5EP4A 2L09A 2LNHC 1QZMA 5ITXA 4DBGB 4AKGA 2FE8A 4L15A 2CUZA 2R4EA 1WXQA 1Q39A 2CV2A 1S3SA 4MH0E 3I01M 2LVAA 4DR5M 4IJEA 2QBYA 2KRKA 2QQ8A 3GP1A 3GLIB 3VKGA 1EE8A 1SG9A 2YNMD 2FH0A 3I4VA 3MJ5A 1E32A 2O01F 1KSFX 4MB7A 2QSFX 4BB9A 4HEOA 1FJGM 5EXTA 1NY5A 4YY3M 4L4UA 3GLIA 2D7GA 4G4NA 2LTUA 3VK8A 3JR4A 3KOYE 1MX0A 4MGIE 3SC3A 1C7YA 1N78A 5KPRA 3UGJA 3WHKA 3FYDA 4OVZB 1QDTA 3GPXA 5EXPA 1VDLA 1IN6A 4RF1A 3GO8A 3HHZA 1MU5A 2JY6B 4PT5A 1R2YA 3F92A 1Z5CA 3J7BA 2CHGA 3PNVA 3ZC7B 3FUUA 5FTNA 2O25A 4P17A 4JI5M 2EKFA 4FWGA 1Z5AA 2HAKA 3AL0C 3GLGB 2WSEF 2Z8YM 3BXWA 4IBFA 1X37A 1ORYB 4IBKA 4OVZA 3GPYA 4G4QA 2VF7A 5FTJA 4PDGA 4R3DA 3LQRA 3L25A 1D0MA 1VEKA 1NJGA 3C3DA 4X65M 1HT2E 4IBGA 3HZJA 1IQPA 4QOSA 4UN2B 1N32M 5IWAM 2Z7JA 1GJSA 5E6JA 3GQ4A 4DR2M 3GLGA 1ZMWA 4M9XA 2XFTA 1F4IA 2R46A 2Y0QA 2ZAOA 4JI3M 2J5YA 3KVWA 2UXCM 1WGNA 3GLHB 1ZMUA 3AOEA 4I5SA 2FFJA 3OTOM 4DR1M 3QWLA 1GABA 1QZEA 4IBBA 4M0DA 4KLNA 1R5LA 2RGOA 3LW5F 1IBKM 2I7NA 1G8PA 3QAUA 3NBXX 1XNQM 2EUCA 2J7OA 4HL4A 3LCVB 3GLHA 4JN6A 2C5RA 2DAKA 4K0KM 2KHHA 4DV3M 2LVOC 2XF3A 3FTEA 2DHYA 1XNRM 1NNUC 2QNJA 3LCUA 1XMQM 1L2CA 3C58A 1NV9A 3KDSE 4FW9A 1XMOM 1GO5A 3KOWE 2LVPC 2DZOB 2ERCA 3ZQJA 4I8OA 1L8QA 2G3QA 4D81A 5FLXS 1PM5A 1DV0A 4M9ZA 4ITQA 1D0LA 1NHWC 4IIWA 1T6OA 5EQTA 2DI0A 2R65A 3IECA 4LRSA 4G4OA 2CE7A 1ZAEA 3QYBA 1D0KA 4S12A 3J7AS 2M60A 1TH3A 3PVSA 2XZUA 1TH4A 1W5TA 1Y8GA 3ZH9B 2DAMA 2R6FA 4OU7A 1VEJA 4DV7M 4LZJA 3A42A 4PCZA 1GLNA 2RGHA 3C3EA 3DZDA 1OFIA 4OX9M 2ZTDA 2C9CA 1Q02A 3VK7A 4IBDA 5A2QS 3HKPA 1N34M 1IN5A 3D8BA 3CF0A 2UUAM 2FOIC 2JZ0A 3HJ8A 1NY6A 2OQ4A 2CWBA 4GIPA 2F5PA 4DR7M 2XGNA 2DHRA 2F5NA 2WZJA 4KODA 2UU9M 4TUWA 2K47A 2DWMA 2HKJA 4NXMM 4QNRA 1IBLM 3K92A 1GVNA 3DOAA 2DWNA 2JXNA 1QQWA 1TR8A 1ZMVA 4P16A 3AKZA 4JI1M 3A45A 1TTEA 2CFOA 4JYAM 3FKEA 2RKOA 2BNKA 2ZM6M 2L7IA 1UFZA 4M0WA 3FTFA 3GQ5A 1OFHA 4DV6M 2W82A 2QPAA 3UMMA 1RU3A 3SAUA 1K3WA 1VDDA 1DO0A 4AQYM 2Q2EB 4W5WA 3B7ZA 4QHTA 4AZFA 2LWXA 1XWIA 3FTDA 2X8AA 3VKHA 2R4JA 4LG2A 2KDLA 1W5SA 1QAOA 2R44A 1GJTA 2JY8A 1QAQA 3L28A 4DR4M 3B74A 4QNMA 4B3SM 3AOGA 3LVWA 3TE6A 2DNAA 3K9OA 2Z4RA 4B3MM 4REZA 4LJ5A 3SHFA 1OAOC 3FRIA 1XXHE 5EXSA 3HX3A 1IXSB 2JP7A 4R71A 1R2ZA 5JI2E 4LF6M 3MMPA 2WSCF 2QP9X 1IXZA 3KS4A 3TWLA 5DFLA 4Z6YA 1G41A 3E21A 3U61B 1A5TA 3CF2A 2BWEA 3FRHA 3IG8A 2VF8A 5ITYA 2OPFA 2JY7A 2CV1A 2VQFM 5IZ7D 3SHGB 4LRTA 1IXSA 1DGGA 2KXEA 3T6PA 2K0BX 4WP2A 4AG6A 4DV5M 3SARA 3DFZA 3U61A 4A3VB 1IY0A 1QVRA 1IBMM 4GC9A 2VIIA 1PJSA 4I81A 3TWMA 2K6BA 1I94M 2QZ4A 2EJSA 1YLAA 2V1UA 3U6LA 3RGSA 3GRRA 2KEBA 4LGYA 2DKLA 4G3OA 5E26A 7CATA 4LF7M 3KXEC 4FD2A 2C99A 3TQSA 3J81S 2KA6B 1P3QQ 3WHLA 3HHYA 2WSFF 1WHCA 4GC5A 4IBCA 2CEAA 2KRUA 2FNAA 1R4GA 2JWSA 1V34A 5ITQA 4JI2M 4BBAA 5KPZA 4F1IA 4PD2A 4B3TM 5DNYA 3U6MA 4LFAM 2G8LA 2DAEA 3VDPA 1TF0B 2B3TA 4MGHA 4QHSA 2XZFA 1CUKA 3KFUG 1IN8A 4NSOB 3FYCA 4WW0A 3A46A 2ZBKB 1OQYA 4FVMA 4ZPXA 2F4VM 5BR8M 2BWBA 4B7FA 1DGHB 4XBOA 2D7EA 3HHWA 1VQ1A 2ZAMA 4MGKE 1Z59A 4JI7M 2R62A 1PJTA 3C9PA 1L2BA 1I4WA 1E9SA 2A5YB 3IHPA 2L6OA 3U5ZB 4B08A 3E46A 4FWHA 1IXRC 2APLA 2KNZA 2MR9A 4AG5A 4NC6A 4LGMA 1DGHA 1JB0F 1XXHB 2H1RA 3KW6A 5EJCA 1TGUA 4NXNM 5GKNA 3SATA 1EFUB 2Y21A 1PRBA 4B3RM 1SXJD 2DAIA 1TDHA 2KW0A 3I04M 3PNYA 3AOEC 4ANRA 5ITTA 4DV2M 3W0LB 4X66M 3IG5A 3U5ZA 4LF4M 1IM2A 1NSFA 2LVQD 2YR0A 3KS8A 2JZ1A 2DVWB 1XXHA 5IREB 3U6DA 3FUXA 3LVVA 1N75A 3RGPA 1WR1B 1ZQ9A 2CRUA 2C96A 4IBIA 2HL7A 3NWLA 2R0IA 2HWJA 2J7NA 2Y20A 4LJ7A 1G71A 4B7HA 1HJPA 1DO2A 1LV7A 5FTLA 1YUBA 3KOZE 4XK8F 3EIEA 1AIPC 3CF6E 2X49A 4GHAA 4DR3M 3RFWA 3U6QA 2XFSA 1YE9A 2MH8A 4RF0A 2C9OA 1V92A 1V33A 4X62M 4LJ8A 1PGYA 4PDIA 3L26A 4FCWA 1OAIA 2JA2A 2G5GX 4R7GA 5LMNM 3HJQA 1HNWM 4LJ9A 3PXGA 2Y0TA 4D80A 1NVMA 1D2NA 2H5XA 2EKKA 1WGLA 4DV0M 4DUZM 1GL7A 1DGBA 4LJ4A 1HR0M 2D7HA 2YQZA 3E9SA 4AKHA 1ZV1A 4OW0A 3UK6A 4EIWA 2HHHM 3MHVC 1G3IA 3EIHA 4L6V6 4GH9A 4JI8M 3R8FA 3FE3A 1FNNA 4GKKM 1L1ZA 3T38A 4FWDA 4KT0F 4LJAA 2UUCM 2EO2A 1HNXM 4Z8XA 2DENA 2LXEA 5JI3E 3GLGE 2L4EA 2BJWA 1SXJE 2XSZA 3UZUA 3ZCBB 2OOBA 1NV8A 4X64M 4L8RC 2RRUA 1OIPA 3DA1A 1NJFA 3JR5A 3GLFE 4II7A 1N36M 1GKIA 3M0EA 5EP3A 1NNJA 4LJ6A 4GHLA 2XSZD 3K1JA 1OKSA 3Q8XA 5L8RF 3E4RA 3HJSA 2VQEM 1HT1E 4LCBA 2CHVA 2YFQA 5BPVA 2AHMA 2XEPA 1NHGC 1JR3E 2QHOB 1AUAA 3AFHA 3I51A 1PJIA 3JAMS 4NRWA 2DWZB 2X4AA 3HGIA 2R18A 3SFZA 3H4MA 3GPUA 1XC8A 3W0FA 1N33M 3M7GA 3L29A 5FSWA 2KNVA 1K3XA 3SBJA 1VG5A 3GRVA 3Q8GA 4NRVA 1G59A 1GL6A 1BVSA 2VDBB 5EXXA 2MJ5B 4DV1M 5DYIA 2K9DA 1KYIA 2KZUA 2V6ZM 1OJLA 3W67A 5KQ8A 4DUYM 5KQDA 1XB2B 1Z6TA 2R45A 3U60B 1QANA 1QDRA 3LQQA 5F3WA 1UM8A 2QCUA 3VDUA 4CISA 1OTRA 4GKJM 2O5RA 3HU3A 1IY1A 3CTWB 5FTMA 4CGYB 2EA0A 3T1HM 4QOZC 3PFIA 2MGWA 3SYLA 3SAWA 3GRYA 2KNAA 4JXJA 1IN4A 4F2LA 1PJJA 4JI4M 1Z5BA 3TWKA 1EIJA 3U60A 5C1BA 3U6EA 3U6CA 1WJ7A 4GMQA 3U6SA 2UUBM 4LF8M 1QUTA 1R6BX 3L2AA 2OOAA 1SXJB 3SMSA 4D82A 2LBCA 3CGWA 1DGFA 4JI0M 2L4FA 4G6ZA 2OO9A 3KOXE 3GLFB 4CHTB 1PJQA 2ZTCA 4BLCA 3GPPA 4MGZE 3T1YM 3FUVA 3SMPA 1WIVA 1YSYA 4LZZA 1SXJA 4AI6A 3R9XB 4I4LA 4AW4A 3SASA 2MROB 3THGA 2CV0A 3D8LA 4MM3B 3LMMA 4NOOB 3TPZA 4IBEA 3SYKA 4GRIA 3GLFA 3HY5A 2L2DA 2DZLA 2JY5A 4LF5M 1N77A 3AJIB 3KP0E 2V1CA 3NBIA 3L27A 5IT9S 3M6AA 4JI6M 2DXIA 5ITRA 4GITA 2KZSA 4GEWA 3FUTA 4IJFA 3A98B 5ITXE 5LMUM 1IFYA 2HCBA 2NQ8C 1KFVA 3MK6A 4DR6M 4IBJA 5H37D 1VEGA 4LFBM 1JR3A 1R7RA 5KPTA 1C1KA 2JUJA 4FCVA 1L2DA 3QYEA 4NSRA 3HHXA 1NO1A 2UXDM 3HWSA 3AV0A 3U6PA 1G4AE 1SXJC 4KHPM 3UJNA 1Q3BA 2I7PA 1JR3D 3J27B 3FTCA 4L78A 3KSXA 4G4RA 1J09A 4JV5M 3T15A 2LHCA 2E5LM 5KO3A 1T3TA 2XLJA 3HU1A 2L7HA 8CATA 3GLIE 3K2LA 5EP2A 2JNHA 1OIZA 2LVNC 2GNOA 1MN3A 4RNAA 2DWLA 3BOSA 4NL4H 5EP1A 1J5EM 2CHQA 3KP1E 1TDZA 3TL4X 4Q7JA 3V76A 3BBZA 4HLQA 4M9SA 1L1TA 4LFCM 2DAGA 3B9PA 1HNZM 4XGIA 3K8ZA 3FD9A 1E9RA 2XH9A 1QAMA 3FUWA 4MGYE 3B89A 4CJ6A 1H6UA 1Q3CA 1T43A 1HQYE 2ZANA 3VFDA 5C18A 1HQCA 2LHGA 4CIZA 4B7GA 2F5QA 3I4YA 3B7NA 3SAVA 2BJVA 4AKIA 1JQJC 3J80S 3B7QA 1E94E 5DYGA 4YHHM 2LH0A
chains in the Genus database with same CATH topology
1T6OA 2DAEA 3H4JA 2DI0A 3IECA 2B3TA 1CUKA 1OQYA 2BWBA 2KNVA 1Y8GA 1VG5A 1VQ1A 2DAMA 2CP8A 1BVSA 1VEJA 2MJ5B 2K9DA 1KYIA 3IHPA 3K9PA 1XB2B 3E46A 1OTRA 2KNZA 2MR9A 3GLHE 2ZTDA 1EFUB 1Q02A 2DAIA 2MGWA 4DBGB 2JZ0A 2KNAA 4F2LA 2CWBA 1WJ7A 2WZJA 1IM2A 2LVAA 2LVQD 2JZ1A 1SG9A 2OOAA 2LBCA 2L4FA 1TR8A 1WR1B 2OO9A 1ZMVA 2QSFX 2ZTCA 1TTEA 2R0IA 2HWJA 4HEOA 1HJPA 1DO2A 1UFZA 1AIPC 1WIVA 2LTUA 1C7YA 2MROB 1DO0A 1V92A 1PGYA 2L2DA 2DZLA 2JY5A 1OAIA 1VDLA 2JY6B 3F92A 2JY8A 2O25A 2EKFA 2HAKA 4GEWA 2H5XA 1IFYA 2EKKA 1WGLA 1VEGA 2DNAA 3K9OA 2JUJA 1VEKA 3FRIA 1XXHE 1ZV1A 1HT2E 2JP7A 4R71A 5JI2E 1G4AE 1G3IA 3MMPA 4UN2B 5DFLA 1G41A 3E21A 3FE3A 1ZMWA 1A5TA 3FRHA 2BWEA 2JY7A 1F4IA 3GLIE 2DENA 2JNHA 2LVNC 1WGNA 2L4EA 3GLGE 1IXSA 1ZMUA 1MN3A 3T6PA 2K0BX 4WP2A 1QZEA 2OOBA 1NV8A 2RRUA 3GLFE 4Q7JA 3BBZA 1OKSA 2EJSA 1YLAA 2DAGA 2DKLA 4G3OA 3LCVB 2DAKA 3B89A 2KHHA 1HT1E 1P3QQ 2LVOC 2DHYA 1T43A 1WHCA 2QNJA 1HQYE 3LCUA 1NV9A 1GO5A 1R4GA 1JR3E 2LVPC 2QHOB 2G3QA 1DV0A 4F1IA 1E94E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6O A;  2DAE A;  3H4J A;  2DI0 A;  3IEC A;  2B3T A;  1CUK A;  1OQY A;  2BWB A;  2KNV A;  1Y8G A;  1VG5 A;  1VQ1 A;  2DAM A;  2CP8 A;  1BVS A;  1VEJ A;  2MJ5 B;  2K9D A;  1KYI A;  3IHP A;  3K9P A;  1XB2 B;  3E46 A;  1OTR A;  2KNZ A;  2MR9 A;  3GLH E;  2ZTD A;  1EFU B;  1Q02 A;  2DAI A;  2MGW A;  4DBG B;  2JZ0 A;  2KNA A;  4F2L A;  2CWB A;  1WJ7 A;  2WZJ A;  1IM2 A;  2LVA A;  2LVQ D;  2JZ1 A;  1SG9 A;  2OOA A;  2LBC A;  2L4F A;  1TR8 A;  1WR1 B;  2OO9 A;  1ZMV A;  2QSF X;  2ZTC A;  1TTE A;  2R0I A;  2HWJ A;  4HEO A;  1HJP A;  1DO2 A;  1UFZ A;  1AIP C;  1WIV A;  2LTU A;  1C7Y A;  2MRO B;  1DO0 A;  1V92 A;  1PGY A;  2L2D A;  2DZL A;  2JY5 A;  1OAI A;  1VDL A;  2JY6 B;  3F92 A;  2JY8 A;  2O25 A;  2EKF A;  2HAK A;  4GEW A;  2H5X A;  1IFY A;  2EKK A;  1WGL A;  1VEG A;  2DNA A;  3K9O A;  2JUJ A;  1VEK A;  3FRI A;  1XXH E;  1ZV1 A;  1HT2 E;  2JP7 A;  4R71 A;  5JI2 E;  1G4A E;  1G3I A;  3MMP A;  4UN2 B;  5DFL A;  1G41 A;  3E21 A;  3FE3 A;  1ZMW A;  1A5T A;  3FRH A;  2BWE A;  2JY7 A;  1F4I A;  3GLI E;  2DEN A;  2JNH A;  2LVN C;  1WGN A;  2L4E A;  3GLG E;  1IXS A;  1ZMU A;  1MN3 A;  3T6P A;  2K0B X;  4WP2 A;  1QZE A;  2OOB A;  1NV8 A;  2RRU A;  3GLF E;  4Q7J A;  3BBZ A;  1OKS A;  2EJS A;  1YLA A;  2DAG A;  2DKL A;  4G3O A;  3LCV B;  2DAK A;  3B89 A;  2KHH A;  1HT1 E;  1P3Q Q;  2LVO C;  2DHY A;  1T43 A;  1WHC A;  2QNJ A;  1HQY E;  3LCU A;  1NV9 A;  1GO5 A;  1R4G A;  1JR3 E;  2LVP C;  2QHO B;  2G3Q A;  1DV0 A;  4F1I A;  1E94 E; 
#chains in the Genus database with same CATH topology
 2F5O A;  2N35 A;  3H4J A;  3U6O A;  2Z3X A;  4Y28 F;  3GRU A;  2F5S A;  2DZN B;  4L16 A;  4DV4 M;  3KSJ A;  1K82 A;  2FS1 A;  2P5T A;  4RKU F;  3GQ3 A;  4WUR A;  1MJG M;  4LY6 A;  4LF9 M;  2UXB M;  2C98 A;  3VLF B;  2GQF A;  2CP8 A;  1TH2 A;  2Z4S A;  1IY2 A;  1LTM A;  1XHB A;  3ILK A;  5FTK A;  3W68 A;  3K9P A;  1J7K A;  2M5Z A;  2QBY B;  3HU2 A;  3J2P B;  2QEN A;  1IN7 A;  1QYR A;  4FCT A;  5ITU A;  3GLH E;  4KO8 A;  3RE8 A;  1QUS A;  5EP4 A;  2L09 A;  2LNH C;  1QZM A;  5ITX A;  4DBG B;  4AKG A;  2FE8 A;  4L15 A;  2CUZ A;  2R4E A;  1WXQ A;  1Q39 A;  2CV2 A;  1S3S A;  4MH0 E;  3I01 M;  2LVA A;  4DR5 M;  4IJE A;  2QBY A;  2KRK A;  2QQ8 A;  3GP1 A;  3GLI B;  3VKG A;  1EE8 A;  1SG9 A;  2YNM D;  2FH0 A;  3I4V A;  3MJ5 A;  1E32 A;  2O01 F;  1KSF X;  4MB7 A;  2QSF X;  4BB9 A;  4HEO A;  1FJG M;  5EXT A;  1NY5 A;  4YY3 M;  4L4U A;  3GLI A;  2D7G A;  4G4N A;  2LTU A;  3VK8 A;  3JR4 A;  3KOY E;  1MX0 A;  4MGI E;  3SC3 A;  1C7Y A;  1N78 A;  5KPR A;  3UGJ A;  3WHK A;  3FYD A;  4OVZ B;  1QDT A;  3GPX A;  5EXP A;  1VDL A;  1IN6 A;  4RF1 A;  3GO8 A;  3HHZ A;  1MU5 A;  2JY6 B;  4PT5 A;  1R2Y A;  3F92 A;  1Z5C A;  3J7B A;  2CHG A;  3PNV A;  3ZC7 B;  3FUU A;  5FTN A;  2O25 A;  4P17 A;  4JI5 M;  2EKF A;  4FWG A;  1Z5A A;  2HAK A;  3AL0 C;  3GLG B;  2WSE F;  2Z8Y M;  3BXW A;  4IBF A;  1X37 A;  1ORY B;  4IBK A;  4OVZ A;  3GPY A;  4G4Q A;  2VF7 A;  5FTJ A;  4PDG A;  4R3D A;  3LQR A;  3L25 A;  1D0M A;  1VEK A;  1NJG A;  3C3D A;  4X65 M;  1HT2 E;  4IBG A;  3HZJ A;  1IQP A;  4QOS A;  4UN2 B;  1N32 M;  5IWA M;  2Z7J A;  1GJS A;  5E6J A;  3GQ4 A;  4DR2 M;  3GLG A;  1ZMW A;  4M9X A;  2XFT A;  1F4I A;  2R46 A;  2Y0Q A;  2ZAO A;  4JI3 M;  2J5Y A;  3KVW A;  2UXC M;  1WGN A;  3GLH B;  1ZMU A;  3AOE A;  4I5S A;  2FFJ A;  3OTO M;  4DR1 M;  3QWL A;  1GAB A;  1QZE A;  4IBB A;  4M0D A;  4KLN A;  1R5L A;  2RGO A;  3LW5 F;  1IBK M;  2I7N A;  1G8P A;  3QAU A;  3NBX X;  1XNQ M;  2EUC A;  2J7O A;  4HL4 A;  3LCV B;  3GLH A;  4JN6 A;  2C5R A;  2DAK A;  4K0K M;  2KHH A;  4DV3 M;  2LVO C;  2XF3 A;  3FTE A;  2DHY A;  1XNR M;  1NNU C;  2QNJ A;  3LCU A;  1XMQ M;  1L2C A;  3C58 A;  1NV9 A;  3KDS E;  4FW9 A;  1XMO M;  1GO5 A;  3KOW E;  2LVP C;  2DZO B;  2ERC A;  3ZQJ A;  4I8O A;  1L8Q A;  2G3Q A;  4D81 A;  5FLX S;  1PM5 A;  1DV0 A;  4M9Z A;  4ITQ A;  1D0L A;  1NHW C;  4IIW A;  1T6O A;  5EQT A;  2DI0 A;  2R65 A;  3IEC A;  4LRS A;  4G4O A;  2CE7 A;  1ZAE A;  3QYB A;  1D0K A;  4S12 A;  3J7A S;  2M60 A;  1TH3 A;  3PVS A;  2XZU A;  1TH4 A;  1W5T A;  1Y8G A;  3ZH9 B;  2DAM A;  2R6F A;  4OU7 A;  1VEJ A;  4DV7 M;  4LZJ A;  3A42 A;  4PCZ A;  1GLN A;  2RGH A;  3C3E A;  3DZD A;  1OFI A;  4OX9 M;  2ZTD A;  2C9C A;  1Q02 A;  3VK7 A;  4IBD A;  5A2Q S;  3HKP A;  1N34 M;  1IN5 A;  3D8B A;  3CF0 A;  2UUA M;  2FOI C;  2JZ0 A;  3HJ8 A;  1NY6 A;  2OQ4 A;  2CWB A;  4GIP A;  2F5P A;  4DR7 M;  2XGN A;  2DHR A;  2F5N A;  2WZJ A;  4KOD A;  2UU9 M;  4TUW A;  2K47 A;  2DWM A;  2HKJ A;  4NXM M;  4QNR A;  1IBL M;  3K92 A;  1GVN A;  3DOA A;  2DWN A;  2JXN A;  1QQW A;  1TR8 A;  1ZMV A;  4P16 A;  3AKZ A;  4JI1 M;  3A45 A;  1TTE A;  2CFO A;  4JYA M;  3FKE A;  2RKO A;  2BNK A;  2ZM6 M;  2L7I A;  1UFZ A;  4M0W A;  3FTF A;  3GQ5 A;  1OFH A;  4DV6 M;  2W82 A;  2QPA A;  3UMM A;  1RU3 A;  3SAU A;  1K3W A;  1VDD A;  1DO0 A;  4AQY M;  2Q2E B;  4W5W A;  3B7Z A;  4QHT A;  4AZF A;  2LWX A;  1XWI A;  3FTD A;  2X8A A;  3VKH A;  2R4J A;  4LG2 A;  2KDL A;  1W5S A;  1QAO A;  2R44 A;  1GJT A;  2JY8 A;  1QAQ A;  3L28 A;  4DR4 M;  3B74 A;  4QNM A;  4B3S M;  3AOG A;  3LVW A;  3TE6 A;  2DNA A;  3K9O A;  2Z4R A;  4B3M M;  4REZ A;  4LJ5 A;  3SHF A;  1OAO C;  3FRI A;  1XXH E;  5EXS A;  3HX3 A;  1IXS B;  2JP7 A;  4R71 A;  1R2Z A;  5JI2 E;  4LF6 M;  3MMP A;  2WSC F;  2QP9 X;  1IXZ A;  3KS4 A;  3TWL A;  5DFL A;  4Z6Y A;  1G41 A;  3E21 A;  3U61 B;  1A5T A;  3CF2 A;  2BWE A;  3FRH A;  3IG8 A;  2VF8 A;  5ITY A;  2OPF A;  2JY7 A;  2CV1 A;  2VQF M;  5IZ7 D;  3SHG B;  4LRT A;  1IXS A;  1DGG A;  2KXE A;  3T6P A;  2K0B X;  4WP2 A;  4AG6 A;  4DV5 M;  3SAR A;  3DFZ A;  3U61 A;  4A3V B;  1IY0 A;  1QVR A;  1IBM M;  4GC9 A;  2VII A;  1PJS A;  4I81 A;  3TWM A;  2K6B A;  1I94 M;  2QZ4 A;  2EJS A;  1YLA A;  2V1U A;  3U6L A;  3RGS A;  3GRR A;  2KEB A;  4LGY A;  2DKL A;  4G3O A;  5E26 A;  7CAT A;  4LF7 M;  3KXE C;  4FD2 A;  2C99 A;  3TQS A;  3J81 S;  2KA6 B;  1P3Q Q;  3WHL A;  3HHY A;  2WSF F;  1WHC A;  4GC5 A;  4IBC A;  2CEA A;  2KRU A;  2FNA A;  1R4G A;  2JWS A;  1V34 A;  5ITQ A;  4JI2 M;  4BBA A;  5KPZ A;  4F1I A;  4PD2 A;  4B3T M;  5DNY A;  3U6M A;  4LFA M;  2G8L A;  2DAE A;  3VDP A;  1TF0 B;  2B3T A;  4MGH A;  4QHS A;  2XZF A;  1CUK A;  3KFU G;  1IN8 A;  4NSO B;  3FYC A;  4WW0 A;  3A46 A;  2ZBK B;  1OQY A;  4FVM A;  4ZPX A;  2F4V M;  5BR8 M;  2BWB A;  4B7F A;  1DGH B;  4XBO A;  2D7E A;  3HHW A;  1VQ1 A;  2ZAM A;  4MGK E;  1Z59 A;  4JI7 M;  2R62 A;  1PJT A;  3C9P A;  1L2B A;  1I4W A;  1E9S A;  2A5Y B;  3IHP A;  2L6O A;  3U5Z B;  4B08 A;  3E46 A;  4FWH A;  1IXR C;  2APL A;  2KNZ A;  2MR9 A;  4AG5 A;  4NC6 A;  4LGM A;  1DGH A;  1JB0 F;  1XXH B;  2H1R A;  3KW6 A;  5EJC A;  1TGU A;  4NXN M;  5GKN A;  3SAT A;  1EFU B;  2Y21 A;  1PRB A;  4B3R M;  1SXJ D;  2DAI A;  1TDH A;  2KW0 A;  3I04 M;  3PNY A;  3AOE C;  4ANR A;  5ITT A;  4DV2 M;  3W0L B;  4X66 M;  3IG5 A;  3U5Z A;  4LF4 M;  1IM2 A;  1NSF A;  2LVQ D;  2YR0 A;  3KS8 A;  2JZ1 A;  2DVW B;  1XXH A;  5IRE B;  3U6D A;  3FUX A;  3LVV A;  1N75 A;  3RGP A;  1WR1 B;  1ZQ9 A;  2CRU A;  2C96 A;  4IBI A;  2HL7 A;  3NWL A;  2R0I A;  2HWJ A;  2J7N A;  2Y20 A;  4LJ7 A;  1G71 A;  4B7H A;  1HJP A;  1DO2 A;  1LV7 A;  5FTL A;  1YUB A;  3KOZ E;  4XK8 F;  3EIE A;  1AIP C;  3CF6 E;  2X49 A;  4GHA A;  4DR3 M;  3RFW A;  3U6Q A;  2XFS A;  1YE9 A;  2MH8 A;  4RF0 A;  2C9O A;  1V92 A;  1V33 A;  4X62 M;  4LJ8 A;  1PGY A;  4PDI A;  3L26 A;  4FCW A;  1OAI A;  2JA2 A;  2G5G X;  4R7G A;  5LMN M;  3HJQ A;  1HNW M;  4LJ9 A;  3PXG A;  2Y0T A;  4D80 A;  1NVM A;  1D2N A;  2H5X A;  2EKK A;  1WGL A;  4DV0 M;  4DUZ M;  1GL7 A;  1DGB A;  4LJ4 A;  1HR0 M;  2D7H A;  2YQZ A;  3E9S A;  4AKH A;  1ZV1 A;  4OW0 A;  3UK6 A;  4EIW A;  2HHH M;  3MHV C;  1G3I A;  3EIH A;  4L6V 6;  4GH9 A;  4JI8 M;  3R8F A;  3FE3 A;  1FNN A;  4GKK M;  1L1Z A;  3T38 A;  4FWD A;  4KT0 F;  4LJA A;  2UUC M;  2EO2 A;  1HNX M;  4Z8X A;  2DEN A;  2LXE A;  5JI3 E;  3GLG E;  2L4E A;  2BJW A;  1SXJ E;  2XSZ A;  3UZU A;  3ZCB B;  2OOB A;  1NV8 A;  4X64 M;  4L8R C;  2RRU A;  1OIP A;  3DA1 A;  1NJF A;  3JR5 A;  3GLF E;  4II7 A;  1N36 M;  1GKI A;  3M0E A;  5EP3 A;  1NNJ A;  4LJ6 A;  4GHL A;  2XSZ D;  3K1J A;  1OKS A;  3Q8X A;  5L8R F;  3E4R A;  3HJS A;  2VQE M;  1HT1 E;  4LCB A;  2CHV A;  2YFQ A;  5BPV A;  2AHM A;  2XEP A;  1NHG C;  1JR3 E;  2QHO B;  1AUA A;  3AFH A;  3I51 A;  1PJI A;  3JAM S;  4NRW A;  2DWZ B;  2X4A A;  3HGI A;  2R18 A;  3SFZ A;  3H4M A;  3GPU A;  1XC8 A;  3W0F A;  1N33 M;  3M7G A;  3L29 A;  5FSW A;  2KNV A;  1K3X A;  3SBJ A;  1VG5 A;  3GRV A;  3Q8G A;  4NRV A;  1G59 A;  1GL6 A;  1BVS A;  2VDB B;  5EXX A;  2MJ5 B;  4DV1 M;  5DYI A;  2K9D A;  1KYI A;  2KZU A;  2V6Z M;  1OJL A;  3W67 A;  5KQ8 A;  4DUY M;  5KQD A;  1XB2 B;  1Z6T A;  2R45 A;  3U60 B;  1QAN A;  1QDR A;  3LQQ A;  5F3W A;  1UM8 A;  2QCU A;  3VDU A;  4CIS A;  1OTR A;  4GKJ M;  2O5R A;  3HU3 A;  1IY1 A;  3CTW B;  5FTM A;  4CGY B;  2EA0 A;  3T1H M;  4QOZ C;  3PFI A;  2MGW A;  3SYL A;  3SAW A;  3GRY A;  2KNA A;  4JXJ A;  1IN4 A;  4F2L A;  1PJJ A;  4JI4 M;  1Z5B A;  3TWK A;  1EIJ A;  3U60 A;  5C1B A;  3U6E A;  3U6C A;  1WJ7 A;  4GMQ A;  3U6S A;  2UUB M;  4LF8 M;  1QUT A;  1R6B X;  3L2A A;  2OOA A;  1SXJ B;  3SMS A;  4D82 A;  2LBC A;  3CGW A;  1DGF A;  4JI0 M;  2L4F A;  4G6Z A;  2OO9 A;  3KOX E;  3GLF B;  4CHT B;  1PJQ A;  2ZTC A;  4BLC A;  3GPP A;  4MGZ E;  3T1Y M;  3FUV A;  3SMP A;  1WIV A;  1YSY A;  4LZZ A;  1SXJ A;  4AI6 A;  3R9X B;  4I4L A;  4AW4 A;  3SAS A;  2MRO B;  3THG A;  2CV0 A;  3D8L A;  4MM3 B;  3LMM A;  4NOO B;  3TPZ A;  4IBE A;  3SYK A;  4GRI A;  3GLF A;  3HY5 A;  2L2D A;  2DZL A;  2JY5 A;  4LF5 M;  1N77 A;  3AJI B;  3KP0 E;  2V1C A;  3NBI A;  3L27 A;  5IT9 S;  3M6A A;  4JI6 M;  2DXI A;  5ITR A;  4GIT A;  2KZS A;  4GEW A;  3FUT A;  4IJF A;  3A98 B;  5ITX E;  5LMU M;  1IFY A;  2HCB A;  2NQ8 C;  1KFV A;  3MK6 A;  4DR6 M;  4IBJ A;  5H37 D;  1VEG A;  4LFB M;  1JR3 A;  1R7R A;  5KPT A;  1C1K A;  2JUJ A;  4FCV A;  1L2D A;  3QYE A;  4NSR A;  3HHX A;  1NO1 A;  2UXD M;  3HWS A;  3AV0 A;  3U6P A;  1G4A E;  1SXJ C;  4KHP M;  3UJN A;  1Q3B A;  2I7P A;  1JR3 D;  3J27 B;  3FTC A;  4L78 A;  3KSX A;  4G4R A;  1J09 A;  4JV5 M;  3T15 A;  2LHC A;  2E5L M;  5KO3 A;  1T3T A;  2XLJ A;  3HU1 A;  2L7H A;  8CAT A;  3GLI E;  3K2L A;  5EP2 A;  2JNH A;  1OIZ A;  2LVN C;  2GNO A;  1MN3 A;  4RNA A;  2DWL A;  3BOS A;  4NL4 H;  5EP1 A;  1J5E M;  2CHQ A;  3KP1 E;  1TDZ A;  3TL4 X;  4Q7J A;  3V76 A;  3BBZ A;  4HLQ A;  4M9S A;  1L1T A;  4LFC M;  2DAG A;  3B9P A;  1HNZ M;  4XGI A;  3K8Z A;  3FD9 A;  1E9R A;  2XH9 A;  1QAM A;  3FUW A;  4MGY E;  3B89 A;  4CJ6 A;  1H6U A;  1Q3C A;  1T43 A;  1HQY E;  2ZAN A;  3VFD A;  5C18 A;  1HQC A;  2LHG A;  4CIZ A;  4B7G A;  2F5Q A;  3I4Y A;  3B7N A;  3SAV A;  2BJV A;  4AKI A;  1JQJ C;  3J80 S;  3B7Q A;  1E94 E;  5DYG A;  4YHH M;  2LH0 A; 
#chains in the Genus database with same CATH homology
 1T6O A;  2DAE A;  3H4J A;  2DI0 A;  3IEC A;  2B3T A;  1CUK A;  1OQY A;  2BWB A;  2KNV A;  1Y8G A;  1VG5 A;  1VQ1 A;  2DAM A;  2CP8 A;  1BVS A;  1VEJ A;  2MJ5 B;  2K9D A;  1KYI A;  3IHP A;  3K9P A;  1XB2 B;  3E46 A;  1OTR A;  2KNZ A;  2MR9 A;  3GLH E;  2ZTD A;  1EFU B;  1Q02 A;  2DAI A;  2MGW A;  4DBG B;  2JZ0 A;  2KNA A;  4F2L A;  2CWB A;  1WJ7 A;  2WZJ A;  1IM2 A;  2LVA A;  2LVQ D;  2JZ1 A;  1SG9 A;  2OOA A;  2LBC A;  2L4F A;  1TR8 A;  1WR1 B;  2OO9 A;  1ZMV A;  2QSF X;  2ZTC A;  1TTE A;  2R0I A;  2HWJ A;  4HEO A;  1HJP A;  1DO2 A;  1UFZ A;  1AIP C;  1WIV A;  2LTU A;  1C7Y A;  2MRO B;  1DO0 A;  1V92 A;  1PGY A;  2L2D A;  2DZL A;  2JY5 A;  1OAI A;  1VDL A;  2JY6 B;  3F92 A;  2JY8 A;  2O25 A;  2EKF A;  2HAK A;  4GEW A;  2H5X A;  1IFY A;  2EKK A;  1WGL A;  1VEG A;  2DNA A;  3K9O A;  2JUJ A;  1VEK A;  3FRI A;  1XXH E;  1ZV1 A;  1HT2 E;  2JP7 A;  4R71 A;  5JI2 E;  1G4A E;  1G3I A;  3MMP A;  4UN2 B;  5DFL A;  1G41 A;  3E21 A;  3FE3 A;  1ZMW A;  1A5T A;  3FRH A;  2BWE A;  2JY7 A;  1F4I A;  3GLI E;  2DEN A;  2JNH A;  2LVN C;  1WGN A;  2L4E A;  3GLG E;  1IXS A;  1ZMU A;  1MN3 A;  3T6P A;  2K0B X;  4WP2 A;  1QZE A;  2OOB A;  1NV8 A;  2RRU A;  3GLF E;  4Q7J A;  3BBZ A;  1OKS A;  2EJS A;  1YLA A;  2DAG A;  2DKL A;  4G3O A;  3LCV B;  2DAK A;  3B89 A;  2KHH A;  1HT1 E;  1P3Q Q;  2LVO C;  2DHY A;  1T43 A;  1WHC A;  2QNJ A;  1HQY E;  3LCU A;  1NV9 A;  1GO5 A;  1R4G A;  1JR3 E;  2LVP C;  2QHO B;  2G3Q A;  1DV0 A;  4F1I A;  1E94 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...