2JY6B

Solution structure of the complex of ubiquitin and ubiquilin 1 uba domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin protein
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy6B00
2HWJA 3FE3A 2QHOB 1XB2B 1DO2A 3BBZA 1YLAA 3F92A 2LBCA 1OQYA 4GEWA 2DI0A 1JR3E 4DBGB 1G41A 1QZEA 3IECA 2DZLA 1ZMVA 1T43A 4R71A 1DO0A 1IFYA 2EKFA 1G3IA 2OO9A 2MGWA 2LVAA 2ZTDA 1V92A 1WGLA 1NV9A 2JY5A 3E21A 3FRIA 1G4AE 3GLFE 2CWBA 2JNHA 1F4IA 2OOAA 1ZV1A 2KNVA 5JI2E 2B3TA 4HEOA 2BWBA 1OTRA 1MN3A 1P3QQ 1IXSA 1SG9A 1AIPC 1VQ1A 2JUJA 2JZ1A 2K0BX 5DFLA 1KYIA 1VEJA 2KNZA 1WHCA 2L4FA 3T6PA 2DAMA 2CP8A 1VEKA 1OKSA 2H5XA 2DAKA 2DENA 1IM2A 1R4GA 1WJ7A 2JP7A 2HAKA 2OOBA 1HT2E 1HJPA 2DNAA 2L2DA 2O25A 2KNAA 1C7YA 3FRHA 1PGYA 2BWEA 2EKKA 2JY6B 4WP2A 3GLGE 1Q02A 1HQYE 2MJ5B 3LCUA 1NV8A 4Q7JA 3K9PA 3GLHE 2G3QA 2ZTCA 4F1IA 1VDLA 1ZMUA 2JY7A 2MROB 1A5TA 1OAIA 1T6OA 3GLIE 2QNJA 3H4JA 1CUKA 1VG5A 1GO5A 1WR1B 1TTEA 3LCVB 2KHHA 3IHPA 1XXHE 2RRUA 3B89A 2DAEA 3K9OA 1BVSA 2WZJA 2JZ0A 4G3OA 2R0IA 2LVPC 4F2LA 1EFUB 2DHYA 2LVNC 1DV0A 1VEGA 2MR9A 1TR8A 1UFZA 2DAGA 2QSFX 2JY8A 4UN2B 1E94E 3MMPA 1HT1E 2DAIA 2L4EA 1ZMWA 2EJSA 1Y8GA 2DKLA 2K9DA 3E46A 1WIVA 1WGNA 2LTUA 2LVQD 2LVOC
chains in the Genus database with same CATH superfamily
2UUCM 2HWJA 2KRKA 2BJVA 1R2ZA 5EXTA 5C1BA 3CGWA 4LRSA 3EIEA 1NNUC 3BBZA 1NNJA 2Z4SA 4DR5M 3GQ4A 3AOGA 3SHGB 3SFZA 2VQEM 2DI0A 4I8OA 1L1ZA 3U61B 1QZEA 5DYIA 2DZLA 1ZMVA 4JYAM 4JI1M 4M0WA 4MGHA 1DO0A 4R71A 1TH4A 1PJIA 1OAOC 3M7GA 4LRTA 3DOAA 4A3VB 5ITXA 5FSWA 2EKFA 3K8ZA 3GLFB 5EQTA 4HL4A 4KO8A 4KT0F 1IN4A 1QDTA 5FTKA 2V6ZM 2ERCA 3VK7A 1NHGC 2ZTDA 2EO2A 3RGSA 2CE7A 1NV9A 4G4OA 4L78A 2DXIA 4NXMM 1IN5A 3HX3A 2Y0TA 3FRIA 1G4AE 5IT9S 1I4WA 3AL0C 1PJQA 1F4IA 4FCTA 5ITUA 3TQSA 4HEOA 3GRVA 1V33A 2BWBA 1OTRA 2F5NA 1MN3A 3TWMA 2HL7A 5ITQA 4AI6A 2QZ4A 1GVNA 5DFLA 2LNHC 2R4JA 3HY5A 2DWLA 4GKJM 2KNZA 1OIPA 2L4FA 3J27B 3A42A 2GQFA 2R18A 3HU3A 3U6EA 1SXJE 3D8LA 1QAOA 3C9PA 4IIWA 3J7AS 2XLJA 2VF7A 2CEAA 2Y20A 4GITA 4JI8M 2HAKA 2UU9M 4IBEA 2CHQA 3FUTA 4LJ7A 3C58A 4OW0A 3B9PA 7CATA 4G4NA 3KSXA 1OJLA 2DNAA 2ZAOA 1D0LA 3SC3A 3HHWA 3ZH9B 2O5RA 3GLHB 3HWSA 1UM8A 4L8RC 3GPXA 2F5QA 2BWEA 2QBYB 2JY6B 2DZNB 3PFIA 3SYLA 4OU7A 3GLGE 4JI3M 1GJTA 4XK8F 1Q02A 4MGKE 3VDPA 4PCZA 1R6BX 3GLIB 2XFSA 3ZCBB 1NJFA 1JB0F 3L29A 4IJEA 1AUAA 5E26A 4BB9A 2DZOB 2DHRA 2L7IA 4DR3M 5ITYA 1ZMUA 4LF6M 3FUUA 1OAIA 1T6OA 4ITQA 2QNJA 3FUWA 3I01M 3NBXX 4NRWA 4M9XA 4S12A 1Z6TA 5EP2A 3LCVB 2C5RA 1TDZA 2KHHA 3IHPA 1XXHE 4IBCA 3B89A 3KOXE 3GPUA 2RKOA 3I4VA 4JI6M 4MH0E 3FTEA 1FNNA 3B7ZA 4GKKM 2VF8A 2ZAMA 3HJQA 3I4YA 4G3OA 2LVPC 2M60A 4F2LA 1NO1A 2LVNC 2X8AA 3HZJA 1DV0A 1R5LA 1VEGA 4XGIA 1UFZA 5L8RF 1EE8A 3TL4X 5KQDA 1E9SA 3MMPA 2X4AA 5IREB 2DWNA 4IBJA 2J7NA 4GH9A 3GQ5A 2H1RA 1ZQ9A 1Z5CA 3NBIA 1ZMWA 1S3SA 4OX9M 2DKLA 3UZUA 4LFCM 3SHFA 1K3XA 1WIVA 1SXJD 2J7OA 2RGOA 3GRYA 2R6FA 2ZBKB 3QYEA 3ZQJA 4L6V6 2KZUA 2XZFA 3FE3A 2QHOB 3T15A 4X64M 1DO2A 2AHMA 1QAQA 1G71A 4DV2M 1YLAA 3F92A 2MH8A 3WHKA 1OQYA 2VDBB 3TWKA 4WURA 4DV0M 4GEWA 4IBDA 3L26A 4JXJA 4G4RA 2BNKA 1JR3E 4W5WA 4JI4M 3PNYA 2KW0A 4MGZE 2EUCA 3AJIB 1T43A 1MX0A 5DYGA 3UMMA 2O01F 4B3TM 1Q3BA 3C3DA 3WHLA 1PJSA 4FCWA 2J5YA 4FW9A 3R9XB 1LV7A 2LVAA 2OPFA 1J5EM 3SYKA 2JY5A 3NWLA 2KA6B 3E21A 4LZZA 1QZMA 5JI3E 4FWDA 2FOIC 3QYBA 3GLFE 1VDDA 2KEBA 2CWBA 1N75A 4BLCA 4DR4M 2XEPA 2YR0A 4JI7M 1ZV1A 2QP9X 5JI2E 5FLXS 1TGUA 2BJWA 3M0EA 3J81S 2HHHM 2HKJA 3AOEA 1GKIA 1OIZA 1P3QQ 1PRBA 1SG9A 1AIPC 1ZAEA 2X49A 2XFTA 2JUJA 1D0MA 2K0BX 3CF6E 1IN7A 5BR8M 5FTNA 3T1HM 3HHYA 1IXSB 3T6PA 2DAMA 5EXXA 2CP8A 1OKSA 2C99A 3SAUA 2DAKA 2DENA 3U60B 2XF3A 3KDSE 4TUWA 1IM2A 1R4GA 5KO3A 2JP7A 4LZJA 1L2DA 4GIPA 5FTMA 3FD9A 1IBKM 4WW0A 2A5YB 1N34M 3SASA 2FH0A 2L09A 3PNVA 4IJFA 5EXPA 4JI2M 2L6OA 1NVMA 2O25A 3VKHA 5IWAM 2KNAA 2CHVA 5H37D 1XMQM 3DA1A 1PGYA 2APLA 2EKKA 4DR1M 4WP2A 2DWMA 3GP1A 2XSZD 5LMUM 3LQRA 4ANRA 1ORYB 1NV8A 1GL7A 4Q7JA 2L7HA 2WSFF 3KOZE 4L16A 1EIJA 3GLHE 3JAMS 3UJNA 2ZTCA 3VKGA 3L28A 1VDLA 1HNZM 1IY2A 4X66M 3U6DA 1N77A 3GLIE 4NC6A 1YE9A 1J7KA 1CUKA 1GO5A 4LJ5A 4DV1M 3B74A 3QWLA 1KFVA 1TTEA 4X62M 4GHAA 3VLFB 3A45A 2KXEA 2D7HA 4DR6M 2DAEA 2FNAA 3K9OA 4XBOA 3SATA 4LF8M 3DFZA 4LGYA 3KP0E 4M0DA 3LMMA 5A2QS 2FFJA 1L2BA 1FJGM 4AKGA 4M9ZA 1EFUB 1TDHA 2C9OA 2R65A 3KP1E 2V1CA 4OVZA 2XSZA 3KW6A 2LWXA 1NY5A 1QANA 2QQ8A 2QSFX 2W82A 3DZDA 2FE8A 3A98B 3FKEA 3IG5A 5KPTA 1E94E 2UXBM 4L4UA 4II7A 5F3WA 2JXNA 4LF5M 2KZSA 5C18A 1Y8GA 1V34A 3E46A 1K3WA 1HNWM 4JI0M 1WGNA 2D7EA 4RF1A 1W5SA 3LVWA 1QUTA 3J2PB 4LG2A 4PDGA 5EP4A 5GKNA 4JI5M 3Q8GA 4AZFA 2CUZA 5ITXE 5E6JA 5DNYA 4FCVA 5IZ7D 1N78A 3J80S 4LFAM 3U6QA 3FYDA 1N32M 3RE8A 5ITTA 2E5LM 3GLFA 4YY3M 3T1YM 1XHBA 4K0KM 4PD2A 2D7GA 4LJ4A 5EP3A 1IFYA 2LH0A 1Z59A 3W67A 4FWHA 3HHXA 1G3IA 2G5GX 1TF0B 5KQ8A 4GHLA 1IXZA 4DUZM 3K92A 3HU2A 3J7BA 4I81A 4LCBA 3VFDA 1WGLA 3FTFA 2K6BA 4NL4H 4LF4M 2Y0QA 4NRVA 1IQPA 3T38A 2JNHA 4MGIE 2OOAA 3CF0A 2Z8YM 3K2LA 1XMOM 2C9CA 2UUBM 1GJSA 1MU5A 4QHTA 4D82A 1IY0A 3GO8A 3GPPA 4AKHA 1VQ1A 4DV6M 2JZ1A 4HLQA 4IBFA 3E9SA 4DV7M 4NSRA 1WHCA 3OTOM 3AKZA 4KHPM 2P5TA 2JWSA 2EA0A 4LF7M 5FTLA 3UK6A 1QYRA 2H5XA 2R62A 4R7GA 3THGA 1PJJA 2UXDM 2F5PA 2YFQA 4MGYE 3QAUA 2QPAA 2F4VM 4YHHM 1HJPA 1KSFX 4FWGA 3TWLA 2I7PA 1DGGA 1E9RA 2L2DA 4FVMA 3MK6A 4REZA 1SXJA 3FRHA 4NXNM 3TE6A 1C7YA 4QOSA 2CV0A 2Q2EB 1NHWC 4B08A 1GLNA 1D0KA 3GPYA 3KVWA 1K82A 4B3MM 2ZM6M 2XGNA 2KDLA 4KODA 4MB7A 2JY7A 4RF0A 3GLGA 3RFWA 4I4LA 1PM5A 2OQ4A 1L8QA 3FTDA 1VG5A 4PDIA 2R45A 4D80A 2RGHA 4LJ9A 3KSJA 4DUYM 3HU1A 4P17A 3SAWA 2F5OA 2QENA 4CHTB 4CIZA 1NJGA 4AG5A 2CV2A 2RRUA 5EP1A 3U6SA 3U5ZA 2GNOA 1BVSA 1JQJC 4DV4M 2R46A 3PXGA 1W5TA 4R3DA 2JZ0A 3M6AA 1HR0M 3I04M 2DHYA 2MR9A 3CF2A 8CATA 4G4QA 1XXHA 2HCBA 4LJ8A 2JY8A 4UN2B 3SMPA 3RGPA 1IBMM 3L2AA 4QNRA 1HT1E 3KFUG 1JR3D 1DGFA 3ILKA 1PJTA 1R2YA 4JN6A 2V1UA 2DAIA 1E32A 2VQFM 2UUAM 4LJ6A 4RKUF 2LHGA 2K9DA 3SARA 1C1KA 1IY1A 4B7HA 2LTUA 2LVQD 5KPRA 1L2CA 1R7RA 2JA2A 1XB2B 4L15A 1WXQA 4B7GA 2YQZA 4NSOB 3U6OA 3HJSA 2NQ8C 2LBCA 1X37A 1DGHA 4CJ6A 3BXWA 4AW4A 2FS1A 5LMNM 3L27A 2XZUA 2K47A 3D8BA 4DBGB 1G41A 4NOOB 3IECA 1NY6A 2CV1A 3GQ3A 4JV5M 1Q3CA 1IN8A 4LJAA 2LXEA 1LTMA 3AFHA 1GABA 3GRRA 1TH3A 4GC9A 4IBIA 1TH2A 4P16A 3VK8A 1N33M 3SMSA 2OO9A 4DV3M 1JR3A 2MGWA 4B3SM 2CFOA 3Q8XA 4LGMA 4MM3B 1V92A 1IBLM 4QHSA 3HJ8A 3KS4A 4I5SA 3W0LB 4LY6A 1YUBA 5FTJA 2KNVA 1SXJC 1Z5BA 2B3TA 3LQQA 4PT5A 1SXJB 3U61A 1IXSA 2DWZB 3EIHA 2R44A 4EIWA 2M5ZA 1KYIA 1QQWA 1J09A 1VEJA 2QCUA 2Y21A 3AOEC 3BOSA 3E4RA 2Z3XA 4AQYM 3FUVA 3U60A 3U6LA 1VEKA 2C96A 2CHGA 3W68A 3KOYE 4QOZC 4AG6A 1HQCA 3K1JA 3FTCA 2N35A 3MJ5A 4LF9M 1WJ7A 1QAMA 2OOBA 3H4MA 3GLGB 4KLNA 5KPZA 1HT2E 4D81A 3HHZA 3PVSA 3CTWB 3A46A 3C3EA 5BPVA 3B7QA 3MHVC 4FD2A 4GC5A 1NSFA 4Y28F 4IBGA 2F5SA 2WSEF 1XC8A 1XNQM 1XNRM 2DVWB 2Z7JA 3ZC7B 2Z4RA 3U5ZB 3AV0A 2I7NA 3V76A 4IBBA 3U6PA 4Z8XA 1G59A 1HQYE 2MJ5B 3LCUA 5EJCA 1D2NA 3W0FA 2KRUA 2UXCM 3K9PA 1IN6A 4X65M 1MJGM 1QVRA 5EXSA 4AKIA 2G3QA 4IBKA 3GRUA 2LHCA 2R4EA 4G6ZA 4F1IA 3B7NA 4Z6YA 3JR4A 1N36M 4LFBM 1Q39A 1XXHB 2MROB 1A5TA 1Z5AA 3FUXA 3U6MA 3SAVA 1GL6A 3HGIA 3H4JA 4CISA 4DR2M 1QDRA 1DGBA 1WR1B 3LVVA 4B7FA 3GLHA 2CRUA 1T3TA 3KXEC 3TPZA 3UGJA 4DR7M 2VIIA 3KOWE 2QBYA 3VDUA 4M9SA 1QUSA 2WSCF 3LW5F 5ITRA 2WZJA 4GRIA 3U6CA 1OFHA 3GLIA 2XH9A 1G8PA 2R0IA 3R8FA 1RU3A 3KS8A 1DGHB 4DV5M 2YNMD 3FYCA 1HNXM 3SBJA 4RNAA 2ZANA 1TR8A 2DAGA 2C98A 1OFIA 3I51A 4OVZB 1IXRC 2G8LA 4GMQA 3IG8A 1L1TA 2L4EA 4ZPXA 1I94M 2EJSA 1XWIA 4CGYB 1H6UA 1YSYA 4B3RM 3HKPA 4BBAA 3JR5A 3L25A 2LVOC 4QNMA
chains in the Genus database with same CATH topology
2HWJA 3FE3A 2QHOB 1XB2B 1DO2A 3BBZA 1YLAA 3F92A 2LBCA 1OQYA 4GEWA 2DI0A 1JR3E 4DBGB 1G41A 1QZEA 3IECA 2DZLA 1ZMVA 1T43A 4R71A 1DO0A 1IFYA 2EKFA 1G3IA 2OO9A 2MGWA 2LVAA 2ZTDA 1V92A 1WGLA 1NV9A 2JY5A 3E21A 3FRIA 1G4AE 3GLFE 2CWBA 2JNHA 1F4IA 2OOAA 1ZV1A 2KNVA 5JI2E 2B3TA 4HEOA 2BWBA 1OTRA 1MN3A 1P3QQ 1IXSA 1SG9A 1AIPC 1VQ1A 2JUJA 2JZ1A 2K0BX 5DFLA 1KYIA 1VEJA 2KNZA 1WHCA 2L4FA 3T6PA 2DAMA 2CP8A 1VEKA 1OKSA 2H5XA 2DAKA 2DENA 1IM2A 1R4GA 1WJ7A 2JP7A 2HAKA 2OOBA 1HT2E 1HJPA 2DNAA 2L2DA 2O25A 2KNAA 1C7YA 3FRHA 1PGYA 2BWEA 2EKKA 2JY6B 4WP2A 3GLGE 1Q02A 1HQYE 2MJ5B 3LCUA 1NV8A 4Q7JA 3K9PA 3GLHE 2G3QA 2ZTCA 4F1IA 1VDLA 1ZMUA 2JY7A 2MROB 1A5TA 1OAIA 1T6OA 3GLIE 2QNJA 3H4JA 1CUKA 1VG5A 1GO5A 1WR1B 1TTEA 3LCVB 2KHHA 3IHPA 1XXHE 2RRUA 3B89A 2DAEA 3K9OA 1BVSA 2WZJA 2JZ0A 4G3OA 2R0IA 2LVPC 4F2LA 1EFUB 2DHYA 2LVNC 1DV0A 1VEGA 2MR9A 1TR8A 1UFZA 2DAGA 2QSFX 2JY8A 4UN2B 1E94E 3MMPA 1HT1E 2DAIA 2L4EA 1ZMWA 2EJSA 1Y8GA 2DKLA 2K9DA 3E46A 1WIVA 1WGNA 2LTUA 2LVQD 2LVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HWJ A;  3FE3 A;  2QHO B;  1XB2 B;  1DO2 A;  3BBZ A;  1YLA A;  3F92 A;  2LBC A;  1OQY A;  4GEW A;  2DI0 A;  1JR3 E;  4DBG B;  1G41 A;  1QZE A;  3IEC A;  2DZL A;  1ZMV A;  1T43 A;  4R71 A;  1DO0 A;  1IFY A;  2EKF A;  1G3I A;  2OO9 A;  2MGW A;  2LVA A;  2ZTD A;  1V92 A;  1WGL A;  1NV9 A;  2JY5 A;  3E21 A;  3FRI A;  1G4A E;  3GLF E;  2CWB A;  2JNH A;  1F4I A;  2OOA A;  1ZV1 A;  2KNV A;  5JI2 E;  2B3T A;  4HEO A;  2BWB A;  1OTR A;  1MN3 A;  1P3Q Q;  1IXS A;  1SG9 A;  1AIP C;  1VQ1 A;  2JUJ A;  2JZ1 A;  2K0B X;  5DFL A;  1KYI A;  1VEJ A;  2KNZ A;  1WHC A;  2L4F A;  3T6P A;  2DAM A;  2CP8 A;  1VEK A;  1OKS A;  2H5X A;  2DAK A;  2DEN A;  1IM2 A;  1R4G A;  1WJ7 A;  2JP7 A;  2HAK A;  2OOB A;  1HT2 E;  1HJP A;  2DNA A;  2L2D A;  2O25 A;  2KNA A;  1C7Y A;  3FRH A;  1PGY A;  2BWE A;  2EKK A;  2JY6 B;  4WP2 A;  3GLG E;  1Q02 A;  1HQY E;  2MJ5 B;  3LCU A;  1NV8 A;  4Q7J A;  3K9P A;  3GLH E;  2G3Q A;  2ZTC A;  4F1I A;  1VDL A;  1ZMU A;  2JY7 A;  2MRO B;  1A5T A;  1OAI A;  1T6O A;  3GLI E;  2QNJ A;  3H4J A;  1CUK A;  1VG5 A;  1GO5 A;  1WR1 B;  1TTE A;  3LCV B;  2KHH A;  3IHP A;  1XXH E;  2RRU A;  3B89 A;  2DAE A;  3K9O A;  1BVS A;  2WZJ A;  2JZ0 A;  4G3O A;  2R0I A;  2LVP C;  4F2L A;  1EFU B;  2DHY A;  2LVN C;  1DV0 A;  1VEG A;  2MR9 A;  1TR8 A;  1UFZ A;  2DAG A;  2QSF X;  2JY8 A;  4UN2 B;  1E94 E;  3MMP A;  1HT1 E;  2DAI A;  2L4E A;  1ZMW A;  2EJS A;  1Y8G A;  2DKL A;  2K9D A;  3E46 A;  1WIV A;  1WGN A;  2LTU A;  2LVQ D;  2LVO C; 
#chains in the Genus database with same CATH topology
 2UUC M;  2HWJ A;  2KRK A;  2BJV A;  1R2Z A;  5EXT A;  5C1B A;  3CGW A;  4LRS A;  3EIE A;  1NNU C;  3BBZ A;  1NNJ A;  2Z4S A;  4DR5 M;  3GQ4 A;  3AOG A;  3SHG B;  3SFZ A;  2VQE M;  2DI0 A;  4I8O A;  1L1Z A;  3U61 B;  1QZE A;  5DYI A;  2DZL A;  1ZMV A;  4JYA M;  4JI1 M;  4M0W A;  4MGH A;  1DO0 A;  4R71 A;  1TH4 A;  1PJI A;  1OAO C;  3M7G A;  4LRT A;  3DOA A;  4A3V B;  5ITX A;  5FSW A;  2EKF A;  3K8Z A;  3GLF B;  5EQT A;  4HL4 A;  4KO8 A;  4KT0 F;  1IN4 A;  1QDT A;  5FTK A;  2V6Z M;  2ERC A;  3VK7 A;  1NHG C;  2ZTD A;  2EO2 A;  3RGS A;  2CE7 A;  1NV9 A;  4G4O A;  4L78 A;  2DXI A;  4NXM M;  1IN5 A;  3HX3 A;  2Y0T A;  3FRI A;  1G4A E;  5IT9 S;  1I4W A;  3AL0 C;  1PJQ A;  1F4I A;  4FCT A;  5ITU A;  3TQS A;  4HEO A;  3GRV A;  1V33 A;  2BWB A;  1OTR A;  2F5N A;  1MN3 A;  3TWM A;  2HL7 A;  5ITQ A;  4AI6 A;  2QZ4 A;  1GVN A;  5DFL A;  2LNH C;  2R4J A;  3HY5 A;  2DWL A;  4GKJ M;  2KNZ A;  1OIP A;  2L4F A;  3J27 B;  3A42 A;  2GQF A;  2R18 A;  3HU3 A;  3U6E A;  1SXJ E;  3D8L A;  1QAO A;  3C9P A;  4IIW A;  3J7A S;  2XLJ A;  2VF7 A;  2CEA A;  2Y20 A;  4GIT A;  4JI8 M;  2HAK A;  2UU9 M;  4IBE A;  2CHQ A;  3FUT A;  4LJ7 A;  3C58 A;  4OW0 A;  3B9P A;  7CAT A;  4G4N A;  3KSX A;  1OJL A;  2DNA A;  2ZAO A;  1D0L A;  3SC3 A;  3HHW A;  3ZH9 B;  2O5R A;  3GLH B;  3HWS A;  1UM8 A;  4L8R C;  3GPX A;  2F5Q A;  2BWE A;  2QBY B;  2JY6 B;  2DZN B;  3PFI A;  3SYL A;  4OU7 A;  3GLG E;  4JI3 M;  1GJT A;  4XK8 F;  1Q02 A;  4MGK E;  3VDP A;  4PCZ A;  1R6B X;  3GLI B;  2XFS A;  3ZCB B;  1NJF A;  1JB0 F;  3L29 A;  4IJE A;  1AUA A;  5E26 A;  4BB9 A;  2DZO B;  2DHR A;  2L7I A;  4DR3 M;  5ITY A;  1ZMU A;  4LF6 M;  3FUU A;  1OAI A;  1T6O A;  4ITQ A;  2QNJ A;  3FUW A;  3I01 M;  3NBX X;  4NRW A;  4M9X A;  4S12 A;  1Z6T A;  5EP2 A;  3LCV B;  2C5R A;  1TDZ A;  2KHH A;  3IHP A;  1XXH E;  4IBC A;  3B89 A;  3KOX E;  3GPU A;  2RKO A;  3I4V A;  4JI6 M;  4MH0 E;  3FTE A;  1FNN A;  3B7Z A;  4GKK M;  2VF8 A;  2ZAM A;  3HJQ A;  3I4Y A;  4G3O A;  2LVP C;  2M60 A;  4F2L A;  1NO1 A;  2LVN C;  2X8A A;  3HZJ A;  1DV0 A;  1R5L A;  1VEG A;  4XGI A;  1UFZ A;  5L8R F;  1EE8 A;  3TL4 X;  5KQD A;  1E9S A;  3MMP A;  2X4A A;  5IRE B;  2DWN A;  4IBJ A;  2J7N A;  4GH9 A;  3GQ5 A;  2H1R A;  1ZQ9 A;  1Z5C A;  3NBI A;  1ZMW A;  1S3S A;  4OX9 M;  2DKL A;  3UZU A;  4LFC M;  3SHF A;  1K3X A;  1WIV A;  1SXJ D;  2J7O A;  2RGO A;  3GRY A;  2R6F A;  2ZBK B;  3QYE A;  3ZQJ A;  4L6V 6;  2KZU A;  2XZF A;  3FE3 A;  2QHO B;  3T15 A;  4X64 M;  1DO2 A;  2AHM A;  1QAQ A;  1G71 A;  4DV2 M;  1YLA A;  3F92 A;  2MH8 A;  3WHK A;  1OQY A;  2VDB B;  3TWK A;  4WUR A;  4DV0 M;  4GEW A;  4IBD A;  3L26 A;  4JXJ A;  4G4R A;  2BNK A;  1JR3 E;  4W5W A;  4JI4 M;  3PNY A;  2KW0 A;  4MGZ E;  2EUC A;  3AJI B;  1T43 A;  1MX0 A;  5DYG A;  3UMM A;  2O01 F;  4B3T M;  1Q3B A;  3C3D A;  3WHL A;  1PJS A;  4FCW A;  2J5Y A;  4FW9 A;  3R9X B;  1LV7 A;  2LVA A;  2OPF A;  1J5E M;  3SYK A;  2JY5 A;  3NWL A;  2KA6 B;  3E21 A;  4LZZ A;  1QZM A;  5JI3 E;  4FWD A;  2FOI C;  3QYB A;  3GLF E;  1VDD A;  2KEB A;  2CWB A;  1N75 A;  4BLC A;  4DR4 M;  2XEP A;  2YR0 A;  4JI7 M;  1ZV1 A;  2QP9 X;  5JI2 E;  5FLX S;  1TGU A;  2BJW A;  3M0E A;  3J81 S;  2HHH M;  2HKJ A;  3AOE A;  1GKI A;  1OIZ A;  1P3Q Q;  1PRB A;  1SG9 A;  1AIP C;  1ZAE A;  2X49 A;  2XFT A;  2JUJ A;  1D0M A;  2K0B X;  3CF6 E;  1IN7 A;  5BR8 M;  5FTN A;  3T1H M;  3HHY A;  1IXS B;  3T6P A;  2DAM A;  5EXX A;  2CP8 A;  1OKS A;  2C99 A;  3SAU A;  2DAK A;  2DEN A;  3U60 B;  2XF3 A;  3KDS E;  4TUW A;  1IM2 A;  1R4G A;  5KO3 A;  2JP7 A;  4LZJ A;  1L2D A;  4GIP A;  5FTM A;  3FD9 A;  1IBK M;  4WW0 A;  2A5Y B;  1N34 M;  3SAS A;  2FH0 A;  2L09 A;  3PNV A;  4IJF A;  5EXP A;  4JI2 M;  2L6O A;  1NVM A;  2O25 A;  3VKH A;  5IWA M;  2KNA A;  2CHV A;  5H37 D;  1XMQ M;  3DA1 A;  1PGY A;  2APL A;  2EKK A;  4DR1 M;  4WP2 A;  2DWM A;  3GP1 A;  2XSZ D;  5LMU M;  3LQR A;  4ANR A;  1ORY B;  1NV8 A;  1GL7 A;  4Q7J A;  2L7H A;  2WSF F;  3KOZ E;  4L16 A;  1EIJ A;  3GLH E;  3JAM S;  3UJN A;  2ZTC A;  3VKG A;  3L28 A;  1VDL A;  1HNZ M;  1IY2 A;  4X66 M;  3U6D A;  1N77 A;  3GLI E;  4NC6 A;  1YE9 A;  1J7K A;  1CUK A;  1GO5 A;  4LJ5 A;  4DV1 M;  3B74 A;  3QWL A;  1KFV A;  1TTE A;  4X62 M;  4GHA A;  3VLF B;  3A45 A;  2KXE A;  2D7H A;  4DR6 M;  2DAE A;  2FNA A;  3K9O A;  4XBO A;  3SAT A;  4LF8 M;  3DFZ A;  4LGY A;  3KP0 E;  4M0D A;  3LMM A;  5A2Q S;  2FFJ A;  1L2B A;  1FJG M;  4AKG A;  4M9Z A;  1EFU B;  1TDH A;  2C9O A;  2R65 A;  3KP1 E;  2V1C A;  4OVZ A;  2XSZ A;  3KW6 A;  2LWX A;  1NY5 A;  1QAN A;  2QQ8 A;  2QSF X;  2W82 A;  3DZD A;  2FE8 A;  3A98 B;  3FKE A;  3IG5 A;  5KPT A;  1E94 E;  2UXB M;  4L4U A;  4II7 A;  5F3W A;  2JXN A;  4LF5 M;  2KZS A;  5C18 A;  1Y8G A;  1V34 A;  3E46 A;  1K3W A;  1HNW M;  4JI0 M;  1WGN A;  2D7E A;  4RF1 A;  1W5S A;  3LVW A;  1QUT A;  3J2P B;  4LG2 A;  4PDG A;  5EP4 A;  5GKN A;  4JI5 M;  3Q8G A;  4AZF A;  2CUZ A;  5ITX E;  5E6J A;  5DNY A;  4FCV A;  5IZ7 D;  1N78 A;  3J80 S;  4LFA M;  3U6Q A;  3FYD A;  1N32 M;  3RE8 A;  5ITT A;  2E5L M;  3GLF A;  4YY3 M;  3T1Y M;  1XHB A;  4K0K M;  4PD2 A;  2D7G A;  4LJ4 A;  5EP3 A;  1IFY A;  2LH0 A;  1Z59 A;  3W67 A;  4FWH A;  3HHX A;  1G3I A;  2G5G X;  1TF0 B;  5KQ8 A;  4GHL A;  1IXZ A;  4DUZ M;  3K92 A;  3HU2 A;  3J7B A;  4I81 A;  4LCB A;  3VFD A;  1WGL A;  3FTF A;  2K6B A;  4NL4 H;  4LF4 M;  2Y0Q A;  4NRV A;  1IQP A;  3T38 A;  2JNH A;  4MGI E;  2OOA A;  3CF0 A;  2Z8Y M;  3K2L A;  1XMO M;  2C9C A;  2UUB M;  1GJS A;  1MU5 A;  4QHT A;  4D82 A;  1IY0 A;  3GO8 A;  3GPP A;  4AKH A;  1VQ1 A;  4DV6 M;  2JZ1 A;  4HLQ A;  4IBF A;  3E9S A;  4DV7 M;  4NSR A;  1WHC A;  3OTO M;  3AKZ A;  4KHP M;  2P5T A;  2JWS A;  2EA0 A;  4LF7 M;  5FTL A;  3UK6 A;  1QYR A;  2H5X A;  2R62 A;  4R7G A;  3THG A;  1PJJ A;  2UXD M;  2F5P A;  2YFQ A;  4MGY E;  3QAU A;  2QPA A;  2F4V M;  4YHH M;  1HJP A;  1KSF X;  4FWG A;  3TWL A;  2I7P A;  1DGG A;  1E9R A;  2L2D A;  4FVM A;  3MK6 A;  4REZ A;  1SXJ A;  3FRH A;  4NXN M;  3TE6 A;  1C7Y A;  4QOS A;  2CV0 A;  2Q2E B;  1NHW C;  4B08 A;  1GLN A;  1D0K A;  3GPY A;  3KVW A;  1K82 A;  4B3M M;  2ZM6 M;  2XGN A;  2KDL A;  4KOD A;  4MB7 A;  2JY7 A;  4RF0 A;  3GLG A;  3RFW A;  4I4L A;  1PM5 A;  2OQ4 A;  1L8Q A;  3FTD A;  1VG5 A;  4PDI A;  2R45 A;  4D80 A;  2RGH A;  4LJ9 A;  3KSJ A;  4DUY M;  3HU1 A;  4P17 A;  3SAW A;  2F5O A;  2QEN A;  4CHT B;  4CIZ A;  1NJG A;  4AG5 A;  2CV2 A;  2RRU A;  5EP1 A;  3U6S A;  3U5Z A;  2GNO A;  1BVS A;  1JQJ C;  4DV4 M;  2R46 A;  3PXG A;  1W5T A;  4R3D A;  2JZ0 A;  3M6A A;  1HR0 M;  3I04 M;  2DHY A;  2MR9 A;  3CF2 A;  8CAT A;  4G4Q A;  1XXH A;  2HCB A;  4LJ8 A;  2JY8 A;  4UN2 B;  3SMP A;  3RGP A;  1IBM M;  3L2A A;  4QNR A;  1HT1 E;  3KFU G;  1JR3 D;  1DGF A;  3ILK A;  1PJT A;  1R2Y A;  4JN6 A;  2V1U A;  2DAI A;  1E32 A;  2VQF M;  2UUA M;  4LJ6 A;  4RKU F;  2LHG A;  2K9D A;  3SAR A;  1C1K A;  1IY1 A;  4B7H A;  2LTU A;  2LVQ D;  5KPR A;  1L2C A;  1R7R A;  2JA2 A;  1XB2 B;  4L15 A;  1WXQ A;  4B7G A;  2YQZ A;  4NSO B;  3U6O A;  3HJS A;  2NQ8 C;  2LBC A;  1X37 A;  1DGH A;  4CJ6 A;  3BXW A;  4AW4 A;  2FS1 A;  5LMN M;  3L27 A;  2XZU A;  2K47 A;  3D8B A;  4DBG B;  1G41 A;  4NOO B;  3IEC A;  1NY6 A;  2CV1 A;  3GQ3 A;  4JV5 M;  1Q3C A;  1IN8 A;  4LJA A;  2LXE A;  1LTM A;  3AFH A;  1GAB A;  3GRR A;  1TH3 A;  4GC9 A;  4IBI A;  1TH2 A;  4P16 A;  3VK8 A;  1N33 M;  3SMS A;  2OO9 A;  4DV3 M;  1JR3 A;  2MGW A;  4B3S M;  2CFO A;  3Q8X A;  4LGM A;  4MM3 B;  1V92 A;  1IBL M;  4QHS A;  3HJ8 A;  3KS4 A;  4I5S A;  3W0L B;  4LY6 A;  1YUB A;  5FTJ A;  2KNV A;  1SXJ C;  1Z5B A;  2B3T A;  3LQQ A;  4PT5 A;  1SXJ B;  3U61 A;  1IXS A;  2DWZ B;  3EIH A;  2R44 A;  4EIW A;  2M5Z A;  1KYI A;  1QQW A;  1J09 A;  1VEJ A;  2QCU A;  2Y21 A;  3AOE C;  3BOS A;  3E4R A;  2Z3X A;  4AQY M;  3FUV A;  3U60 A;  3U6L A;  1VEK A;  2C96 A;  2CHG A;  3W68 A;  3KOY E;  4QOZ C;  4AG6 A;  1HQC A;  3K1J A;  3FTC A;  2N35 A;  3MJ5 A;  4LF9 M;  1WJ7 A;  1QAM A;  2OOB A;  3H4M A;  3GLG B;  4KLN A;  5KPZ A;  1HT2 E;  4D81 A;  3HHZ A;  3PVS A;  3CTW B;  3A46 A;  3C3E A;  5BPV A;  3B7Q A;  3MHV C;  4FD2 A;  4GC5 A;  1NSF A;  4Y28 F;  4IBG A;  2F5S A;  2WSE F;  1XC8 A;  1XNQ M;  1XNR M;  2DVW B;  2Z7J A;  3ZC7 B;  2Z4R A;  3U5Z B;  3AV0 A;  2I7N A;  3V76 A;  4IBB A;  3U6P A;  4Z8X A;  1G59 A;  1HQY E;  2MJ5 B;  3LCU A;  5EJC A;  1D2N A;  3W0F A;  2KRU A;  2UXC M;  3K9P A;  1IN6 A;  4X65 M;  1MJG M;  1QVR A;  5EXS A;  4AKI A;  2G3Q A;  4IBK A;  3GRU A;  2LHC A;  2R4E A;  4G6Z A;  4F1I A;  3B7N A;  4Z6Y A;  3JR4 A;  1N36 M;  4LFB M;  1Q39 A;  1XXH B;  2MRO B;  1A5T A;  1Z5A A;  3FUX A;  3U6M A;  3SAV A;  1GL6 A;  3HGI A;  3H4J A;  4CIS A;  4DR2 M;  1QDR A;  1DGB A;  1WR1 B;  3LVV A;  4B7F A;  3GLH A;  2CRU A;  1T3T A;  3KXE C;  3TPZ A;  3UGJ A;  4DR7 M;  2VII A;  3KOW E;  2QBY A;  3VDU A;  4M9S A;  1QUS A;  2WSC F;  3LW5 F;  5ITR A;  2WZJ A;  4GRI A;  3U6C A;  1OFH A;  3GLI A;  2XH9 A;  1G8P A;  2R0I A;  3R8F A;  1RU3 A;  3KS8 A;  1DGH B;  4DV5 M;  2YNM D;  3FYC A;  1HNX M;  3SBJ A;  4RNA A;  2ZAN A;  1TR8 A;  2DAG A;  2C98 A;  1OFI A;  3I51 A;  4OVZ B;  1IXR C;  2G8L A;  4GMQ A;  3IG8 A;  1L1T A;  2L4E A;  4ZPX A;  1I94 M;  2EJS A;  1XWI A;  4CGY B;  1H6U A;  1YSY A;  4B3R M;  3HKP A;  4BBA A;  3JR5 A;  3L25 A;  2LVO C;  4QNM A; 
#chains in the Genus database with same CATH homology
 2HWJ A;  3FE3 A;  2QHO B;  1XB2 B;  1DO2 A;  3BBZ A;  1YLA A;  3F92 A;  2LBC A;  1OQY A;  4GEW A;  2DI0 A;  1JR3 E;  4DBG B;  1G41 A;  1QZE A;  3IEC A;  2DZL A;  1ZMV A;  1T43 A;  4R71 A;  1DO0 A;  1IFY A;  2EKF A;  1G3I A;  2OO9 A;  2MGW A;  2LVA A;  2ZTD A;  1V92 A;  1WGL A;  1NV9 A;  2JY5 A;  3E21 A;  3FRI A;  1G4A E;  3GLF E;  2CWB A;  2JNH A;  1F4I A;  2OOA A;  1ZV1 A;  2KNV A;  5JI2 E;  2B3T A;  4HEO A;  2BWB A;  1OTR A;  1MN3 A;  1P3Q Q;  1IXS A;  1SG9 A;  1AIP C;  1VQ1 A;  2JUJ A;  2JZ1 A;  2K0B X;  5DFL A;  1KYI A;  1VEJ A;  2KNZ A;  1WHC A;  2L4F A;  3T6P A;  2DAM A;  2CP8 A;  1VEK A;  1OKS A;  2H5X A;  2DAK A;  2DEN A;  1IM2 A;  1R4G A;  1WJ7 A;  2JP7 A;  2HAK A;  2OOB A;  1HT2 E;  1HJP A;  2DNA A;  2L2D A;  2O25 A;  2KNA A;  1C7Y A;  3FRH A;  1PGY A;  2BWE A;  2EKK A;  2JY6 B;  4WP2 A;  3GLG E;  1Q02 A;  1HQY E;  2MJ5 B;  3LCU A;  1NV8 A;  4Q7J A;  3K9P A;  3GLH E;  2G3Q A;  2ZTC A;  4F1I A;  1VDL A;  1ZMU A;  2JY7 A;  2MRO B;  1A5T A;  1OAI A;  1T6O A;  3GLI E;  2QNJ A;  3H4J A;  1CUK A;  1VG5 A;  1GO5 A;  1WR1 B;  1TTE A;  3LCV B;  2KHH A;  3IHP A;  1XXH E;  2RRU A;  3B89 A;  2DAE A;  3K9O A;  1BVS A;  2WZJ A;  2JZ0 A;  4G3O A;  2R0I A;  2LVP C;  4F2L A;  1EFU B;  2DHY A;  2LVN C;  1DV0 A;  1VEG A;  2MR9 A;  1TR8 A;  1UFZ A;  2DAG A;  2QSF X;  2JY8 A;  4UN2 B;  1E94 E;  3MMP A;  1HT1 E;  2DAI A;  2L4E A;  1ZMW A;  2EJS A;  1Y8G A;  2DKL A;  2K9D A;  3E46 A;  1WIV A;  1WGN A;  2LTU A;  2LVQ D;  2LVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...