2JY6B

Solution structure of the complex of ubiquitin and ubiquilin 1 uba domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin protein
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy6B00
1G3IA 2LBCA 2DHYA 1MN3A 4F1IA 1NV9A 2DKLA 2OOBA 1UFZA 2BWBA 2MROB 1YLAA 2JP7A 2L4FA 3GLGE 1HT2E 1OQYA 3H4JA 4DBGB 2JZ1A 1A5TA 2DZLA 3LCVB 1NV8A 1ZMWA 2DAEA 2JY5A 1TTEA 2MR9A 1WGLA 1G4AE 4G3OA 5DFLA 2EJSA 2KNVA 1KYIA 1ZV1A 1BVSA 3GLFE 2DAIA 2KNZA 2R0IA 3MMPA 2JNHA 2DENA 3T6PA 1F4IA 2EKFA 2CWBA 2LVOC 1OAIA 1IFYA 2OOAA 3GLHE 3BBZA 3LCUA 1V92A 3FE3A 1VQ1A 1GO5A 3K9OA 2OO9A 2QHOB 1T43A 1DO2A 1DO0A 2DAKA 1E94E 1VEGA 4R71A 2JUJA 1HQYE 3IHPA 1P3QQ 1TR8A 2L2DA 1T6OA 2H5XA 3F92A 1WIVA 4UN2B 2DAMA 1ZMVA 4WP2A 1HT1E 1QZEA 1OTRA 1WJ7A 1WR1B 1CUKA 2JZ0A 2DI0A 2KHHA 3FRIA 4HEOA 2LVPC 2ZTDA 1SG9A 2L4EA 4Q7JA 1VEJA 2HAKA 2RRUA 1DV0A 1AIPC 2G3QA 1Y8GA 1IXSA 1XXHE 2DNAA 2LTUA 2QSFX 1HJPA 2JY8A 2JY6B 2QNJA 4GEWA 1ZMUA 1PGYA 3E21A 2KNAA 1WHCA 2DAGA 3E46A 1EFUB 1VDLA 1XB2B 2EKKA 2LVAA 1R4GA 1Q02A 4F2LA 3FRHA 2K9DA 2ZTCA 3IECA 2WZJA 1C7YA 2BWEA 1VG5A 3K9PA 1JR3E 2MGWA 3GLIE 3B89A 5JI2E 1IM2A 2B3TA 2K0BX 2HWJA 1VEKA 1G41A 1WGNA 2MJ5B 2CP8A 2O25A 2LVNC 2JY7A 2LVQD 1OKSA
chains in the Genus database with same CATH superfamily
5E26A 1G59A 4L4UA 3VLFB 3WHLA 2F5NA 2DHYA 1ORYB 4F1IA 2L6OA 1DGGA 2Y0QA 1Q3CA 2OOBA 2XEPA 3NBIA 2LNHC 4GRIA 5EP3A 3KOZE 1HT2E 4NRWA 1L2BA 5FSWA 3J27B 2KXEA 4JXJA 2R44A 4LF5M 2M5ZA 4G6ZA 2CV0A 2QBYB 4G4NA 3HU1A 2X49A 3LCVB 3SAWA 1IN6A 4OVZB 1GVNA 2DAEA 2XF3A 4L16A 4JI1M 3D8BA 4LZJA 1JR3D 5DNYA 1G4AE 1HNXM 4IBGA 5E6JA 4AG6A 2KW0A 4PDGA 4KHPM 1QDTA 3DZDA 1OIZA 3J2PB 3SMPA 3GLFE 2R0IA 2OQ4A 1KFVA 5ITRA 2HCBA 1PJIA 2VQEM 2DENA 4QOSA 3T6PA 2EKFA 1N36M 1N77A 3PXGA 4EIWA 1NHGC 3TWLA 1IFYA 3U61A 4FWGA 3NBXX 3GLHE 3BBZA 4JI0M 3IG5A 3GPYA 4OX9M 2WSFF 1OJLA 1MX0A 1PJSA 3GLFA 2OPFA 4YHHM 2DHRA 3FE3A 3BOSA 3TWKA 1GL7A 4GHLA 1VQ1A 1E9RA 2RGHA 3HHWA 3GLHA 4AKGA 1W5SA 4IBJA 2LXEA 4R71A 4QNMA 2Z8YM 4GMQA 5DYGA 4PD2A 3GLFB 1TH2A 4I81A 3GP1A 3IHPA 4DR7M 1TR8A 1TF0B 2Q2EB 2F5OA 2A5YB 3KS8A 2RGOA 3NWLA 1GJTA 3I04M 3F92A 4MGIE 1WIVA 4D80A 3SHFA 1ZMVA 4MB7A 4DV6M 3SBJA 4WP2A 1TDZA 1R2ZA 2UU9M 2CFOA 1GABA 3QYBA 2KHHA 3FRIA 3HHXA 3L27A 4FCTA 4HEOA 2LVPC 4NSRA 3UMMA 3LVVA 3ZQJA 4Q7JA 3A46A 2C96A 3J7AS 3LQRA 1L2DA 2VIIA 1DGHB 4FW9A 2AHMA 4AZFA 4AKIA 1YUBA 2GNOA 3W67A 4LF8M 1IXSA 4L8RC 2KDLA 4DV1M 1NNUC 1XXHE 2Y20A 2XLJA 2G5GX 2QSFX 4AI6A 4Y28F 4I5SA 3TPZA 1AUAA 3KDSE 1XNRM 4LCBA 3C3EA 1SXJD 5EQTA 3GPXA 1Z5BA 1ZMUA 3KW6A 2DAGA 3UZUA 2N35A 2Y21A 3KP0E 1XMOM 4JI8M 4GITA 1XXHA 4BLCA 1Z5CA 3TE6A 1IXSB 4F2LA 4GKJM 5BR8M 4JV5M 1KSFX 3PNYA 1R7RA 2C9CA 3L29A 2DWLA 3FYDA 1JR3E 2MGWA 4X66M 1IM2A 3CGWA 4KODA 3J7BA 3W0FA 3AKZA 3SMSA 4IBFA 1OFIA 4II7A 1WGNA 2BNKA 1TH4A 2LVNC 2R65A 2Z3XA 1XXHB 1OAOC 2X8AA 3GQ4A 2UXBM 3SAVA 4IBEA 4MH0E 1QDRA 4B08A 1IY0A 1JR3A 5C18A 4NSOB 4Z6YA 3FTEA 2LBCA 2D7HA 3GPPA 1MN3A 2I7PA 4IBCA 1NV9A 5FTMA 5FLXS 4QOZC 1N33M 2JP7A 2L4FA 1R6BX 4M0DA 5FTNA 1OQYA 3H4JA 4DBGB 5EXSA 4QHTA 1Z6TA 5LMNM 1XNQM 5KPZA 4XK8F 1V34A 4QNRA 1IN8A 1E32A 1ZMWA 2JY5A 3C3DA 4LF9M 1HNZM 1TTEA 1WGLA 1S3SA 4M0WA 1T3TA 3OTOM 1QYRA 3GRUA 1KYIA 3A98B 4DV0M 3U5ZB 1ZV1A 2LHCA 5EXPA 2CV2A 3V76A 2QBYA 3MMPA 1PJTA 3CF6E 1X37A 4LJAA 5A2QS 3L25A 2Z4RA 2KEBA 1F4IA 1E9SA 1XWIA 2NQ8C 4OVZA 1N32M 2R6FA 3PVSA 3U6SA 1RU3A 3GQ5A 3M6AA 2R4JA 3JR4A 2C99A 4B3MM 3U6DA 2KRKA 4AQYM 2UUBM 1YSYA 2APLA 1DGFA 3ZH9B 3HHZA 1GO5A 3K9OA 1ZQ9A 4GC9A 1Q3BA 2ERCA 2OO9A 3MJ5A 2J5YA 3LW5F 2YR0A 2FH0A 2ZBKB 2G8LA 4LJ9A 3TWMA 4DR2M 3LQQA 4LF4M 1JB0F 2L7HA 4RF0A 3J80S 5FTLA 2QQ8A 1HQYE 1L1ZA 1SXJE 1PRBA 1P3QQ 4MGKE 1UM8A 1T6OA 2L2DA 4DUYM 1N34M 1WXQA 4LJ8A 2CV1A 4FCWA 5EP1A 3K92A 4DV5M 4IJFA 3AOGA 4QHSA 1XMQM 2LHGA 2FOIC 4DR3M 2DAMA 3JR5A 3EIEA 2XFTA 2O01F 2QPAA 3HJQA 5ITUA 1HT1E 3GPUA 2C5RA 5F3WA 4B3RM 2XGNA 4AW4A 5IWAM 3MHVC 1WR1B 3KSJA 2DI0A 2I7NA 3ZCBB 1NSFA 2KRUA 5ITXE 1SG9A 4KLNA 4DV3M 4M9SA 1NVMA 4ITQA 2CHVA 1HR0M 2Z7JA 4LRSA 2RRUA 4P16A 1ZAEA 2D7EA 1FJGM 5EXXA 2LWXA 4DR4M 4CHTB 1NY5A 2R46A 1SXJB 5ITXA 2V1CA 4JI6M 4AKHA 1Z59A 2JY6B 4PCZA 4JI7M 3FTCA 1C1KA 2FE8A 4DUZM 2JXNA 1DGHA 4HL4A 2KZUA 2CEAA 3FUWA 4LJ4A 1IXZA 1GLNA 2VDBB 4R7GA 3HGIA 5KQ8A 4HLQA 1QAOA 1D0LA 2ZTCA 3IECA 4L6V6 2BJVA 4LJ7A 1Q39A 5IT9S 2DZNB 3SYKA 3GLIE 3W68A 4S12A 3MK6A 2K0BX 1VEKA 2X4AA 1IXRC 4P17A 4LGMA 1OKSA 4GKKM 3IG8A 2XSZD 1TGUA 3M0EA 1OFHA 1N75A 3GLIA 4XGIA 1G3IA 2YQZA 3U6MA 4B7GA 3QWLA 3GLGB 1QUSA 1J7KA 2MROB 2VF7A 4IBBA 2QP9X 3ILKA 3TQSA 3KOXE 3KVWA 4I8OA 5ITTA 3FUVA 3C58A 1EIJA 3K8ZA 2DZLA 3GLIB 3VFDA 4M9ZA 2EO2A 3K1JA 3HY5A 1NHWC 4LF6M 2EUCA 3L2AA 3KFUG 4CJ6A 1MU5A 1QANA 3L26A 5DFLA 4B3TM 4RKUF 4D81A 1R5LA 1XHBA 3FTFA 3AL0C 3U60A 2W82A 3L28A 3HU3A 2JWSA 2Z4SA 2DAIA 2KNZA 4RNAA 3SASA 4NXMM 2JNHA 3QYEA 4WURA 5KPTA 2CWBA 4B3SM 4JI4M 1OAIA 3Q8GA 4G4RA 1G71A 3A42A 3K2LA 4REZA 1SXJC 3EIHA 4NC6A 4DV4M 2UXCM 4L15A 2CE7A 2F5SA 4X64M 5KO3A 3U5ZA 4BBAA 1HQCA 4X62M 3U60B 2C98A 1EE8A 3VDPA 1HNWM 4FWHA 4MGHA 2K6BA 2WSCF 2DWNA 3A45A 2UXDM 4XBOA 2K47A 1DO2A 1DO0A 2R62A 3HJ8A 3KS4A 3GO8A 2F5QA 1PJQA 3B7QA 4LJ6A 4Z8XA 3Q8XA 4DV2M 2UUAM 4BB9A 3GQ3A 1IY1A 1QQWA 1Z5AA 1H6UA 4GHAA 1NJGA 3E4RA 3THGA 4G4OA 1I94M 2WSEF 1OTRA 2P5TA 2R4EA 3FUXA 2DVWB 2QZ4A 4RF1A 2DWMA 2JZ0A 3BXWA 5KPRA 1K82A 3VK8A 3SATA 4PDIA 2J7OA 2ZTDA 2XZUA 4OU7A 5LMUM 2FS1A 1QAQA 2CHQA 2EA0A 1VDDA 2M60A 3KXEC 1VEJA 1DV0A 4LJ5A 5EP4A 1FNNA 3GRRA 1AIPC 4NL4H 1Y8GA 1QZMA 1J09A 7CATA 2MH8A 4DR5M 2DXIA 3AFHA 2CRUA 2JY8A 2FNAA 4LRTA 3U6QA 5FTJA 3B74A 3VKHA 3E21A 4B7HA 2XSZA 4I4LA 4DV7M 3AOEC 3FYCA 1VDLA 2EKKA 2LVAA 5EP2A 1J5EM 1R4GA 1Q02A 2CHGA 1NJFA 1SXJA 8CATA 3UGJA 2HKJA 3FRHA 3VK7A 2L09A 2ZAOA 3HKPA 1GL6A 3E9SA 2BWEA 1VG5A 2VF8A 3K9PA 1NY6A 3B89A 5JI2E 3CTWB 4DR1M 4M9XA 2HHHM 2B3TA 3SHGB 4D82A 2HWJA 2XZFA 2LH0A 2RKOA 2MJ5B 2CP8A 4WW0A 1G8PA 3U6OA 3KOWE 2JY7A 4IIWA 4FWDA 2LVQD 3W0LB 1LV7A 3CF2A 4A3VB 4X65M 2F5PA 4AG5A 4LG2A 2UUCM 1IN7A 4LGYA 4KT0F 3PFIA 3U6PA 2E5LM 4FCVA 3HHYA 2DKLA 1L8QA 3B7NA 1UFZA 2BWBA 2GQFA 1YLAA 5KQDA 4GIPA 3GLGE 4L78A 3R8FA 3TL4X 4KO8A 4MM3B 1IY2A 4ZPXA 1I4WA 3I4VA 2JZ1A 2DWZB 3D8LA 3KOYE 2VQFM 1A5TA 2XFSA 5EXTA 1L1TA 4NRVA 2O5RA 3RE8A 1D0KA 1NV8A 1QUTA 3HX3A 3GLGA 3U61B 2MR9A 2V1UA 3SARA 4G3OA 2Y0TA 2FFJA 1IQPA 3T1YM 3RFWA 4ANRA 2EJSA 3VDUA 2KNVA 1IBLM 3RGSA 1QAMA 3I4YA 1BVSA 2JA2A 4IBIA 3PNVA 3QAUA 3WHKA 1TDHA 2KA6B 2LVOC 4B7FA 3GLHB 2V6ZM 3FKEA 4MGZE 2OOAA 3AV0A 3T38A 1IBKM 2J7NA 3LCUA 3VKGA 2R18A 2BJWA 1V92A 3UJNA 3FUUA 2QENA 4LFAM 1JQJC 5FTKA 5GKNA 1YE9A 3AOEA 4GH9A 3H4MA 2R45A 3T15A 1DGBA 2QHOB 4CISA 1NO1A 4LY6A 1L2CA 1T43A 2DAKA 2C9OA 4YY3M 4IBDA 1E94E 1VEGA 1GKIA 3GRVA 1NNJA 4CIZA 1GJSA 2JUJA 4W5WA 4LZZA 4OW0A 2ZANA 3ZC7B 1W5TA 5ITQA 2DZOB 5JI3E 3HZJA 4FD2A 3GRYA 5L8RF 1OIPA 4R3DA 2H5XA 3T1HM 3U6CA 1PM5A 3JAMS 1PJJA 4UN2B 4JI5M 3I51A 1QZEA 3J81S 4JI2M 3RGPA 3KP1E 1WJ7A 4IJEA 4NXNM 1CUKA 1MJGM 3HWSA 3I01M 4IBKA 1D2NA 2HL7A 3CF0A 3M7GA 1K3WA 1IN5A 2KZSA 2L4EA 4JN6A 1K3XA 5BPVA 1LTMA 2CUZA 3AJIB 1XC8A 2HAKA 3R9XB 2XH9A 2F4VM 4DR6M 2G3QA 5EJCA 4MGYE 2YFQA 3C9PA 1V33A 5H37D 3FUTA 2DNAA 2LTUA 1D0MA 3LMMA 4K0KM 4LFBM 1HJPA 4CGYB 3HJSA 2L7IA 5IZ7D 2H1RA 2QNJA 5DYIA 4JI3M 4GEWA 1R2YA 2QCUA 4NOOB 1PGYA 2KNAA 1WHCA 3HU2A 3E46A 3B9PA 4PT5A 1N78A 3DA1A 3LVWA 3KSXA 1EFUB 5ITYA 1XB2B 1IBMM 4G4QA 3FTDA 1IN4A 3UK6A 2D7GA 3B7ZA 5IREB 2ZM6M 4JYAM 1TH3A 2ZAMA 3U6EA 2K9DA 1C7YA 2WZJA 3U6LA 3SAUA 1QVRA 3SC3A 5C1BA 4TUWA 2YNMD 4LF7M 1G41A 4LFCM 3FD9A 3DOAA 3SYLA 3DFZA 4GC5A 3SFZA 2O25A 4FVMA
chains in the Genus database with same CATH topology
1G3IA 2LBCA 2DHYA 1MN3A 4F1IA 1NV9A 2DKLA 2OOBA 1UFZA 2BWBA 2MROB 1YLAA 2JP7A 2L4FA 3GLGE 1HT2E 1OQYA 3H4JA 4DBGB 2JZ1A 1A5TA 2DZLA 3LCVB 1NV8A 1ZMWA 2DAEA 2JY5A 1TTEA 2MR9A 1WGLA 1G4AE 4G3OA 5DFLA 2EJSA 2KNVA 1KYIA 1ZV1A 1BVSA 3GLFE 2DAIA 2KNZA 2R0IA 3MMPA 2JNHA 2DENA 3T6PA 1F4IA 2EKFA 2CWBA 2LVOC 1OAIA 1IFYA 2OOAA 3GLHE 3BBZA 3LCUA 1V92A 3FE3A 1VQ1A 1GO5A 3K9OA 2OO9A 2QHOB 1T43A 1DO2A 1DO0A 2DAKA 1E94E 1VEGA 4R71A 2JUJA 1HQYE 3IHPA 1P3QQ 1TR8A 2L2DA 1T6OA 2H5XA 3F92A 1WIVA 4UN2B 2DAMA 1ZMVA 4WP2A 1HT1E 1QZEA 1OTRA 1WJ7A 1WR1B 1CUKA 2JZ0A 2DI0A 2KHHA 3FRIA 4HEOA 2LVPC 2ZTDA 1SG9A 2L4EA 4Q7JA 1VEJA 2HAKA 2RRUA 1DV0A 1AIPC 2G3QA 1Y8GA 1IXSA 1XXHE 2DNAA 2LTUA 2QSFX 1HJPA 2JY8A 2JY6B 2QNJA 4GEWA 1ZMUA 1PGYA 3E21A 2KNAA 1WHCA 2DAGA 3E46A 1EFUB 1VDLA 1XB2B 2EKKA 2LVAA 1R4GA 1Q02A 4F2LA 3FRHA 2K9DA 2ZTCA 3IECA 2WZJA 1C7YA 2BWEA 1VG5A 3K9PA 1JR3E 2MGWA 3GLIE 3B89A 5JI2E 1IM2A 2B3TA 2K0BX 2HWJA 1VEKA 1G41A 1WGNA 2MJ5B 2CP8A 2O25A 2LVNC 2JY7A 2LVQD 1OKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3I A;  2LBC A;  2DHY A;  1MN3 A;  4F1I A;  1NV9 A;  2DKL A;  2OOB A;  1UFZ A;  2BWB A;  2MRO B;  1YLA A;  2JP7 A;  2L4F A;  3GLG E;  1HT2 E;  1OQY A;  3H4J A;  4DBG B;  2JZ1 A;  1A5T A;  2DZL A;  3LCV B;  1NV8 A;  1ZMW A;  2DAE A;  2JY5 A;  1TTE A;  2MR9 A;  1WGL A;  1G4A E;  4G3O A;  5DFL A;  2EJS A;  2KNV A;  1KYI A;  1ZV1 A;  1BVS A;  3GLF E;  2DAI A;  2KNZ A;  2R0I A;  3MMP A;  2JNH A;  2DEN A;  3T6P A;  1F4I A;  2EKF A;  2CWB A;  2LVO C;  1OAI A;  1IFY A;  2OOA A;  3GLH E;  3BBZ A;  3LCU A;  1V92 A;  3FE3 A;  1VQ1 A;  1GO5 A;  3K9O A;  2OO9 A;  2QHO B;  1T43 A;  1DO2 A;  1DO0 A;  2DAK A;  1E94 E;  1VEG A;  4R71 A;  2JUJ A;  1HQY E;  3IHP A;  1P3Q Q;  1TR8 A;  2L2D A;  1T6O A;  2H5X A;  3F92 A;  1WIV A;  4UN2 B;  2DAM A;  1ZMV A;  4WP2 A;  1HT1 E;  1QZE A;  1OTR A;  1WJ7 A;  1WR1 B;  1CUK A;  2JZ0 A;  2DI0 A;  2KHH A;  3FRI A;  4HEO A;  2LVP C;  2ZTD A;  1SG9 A;  2L4E A;  4Q7J A;  1VEJ A;  2HAK A;  2RRU A;  1DV0 A;  1AIP C;  2G3Q A;  1Y8G A;  1IXS A;  1XXH E;  2DNA A;  2LTU A;  2QSF X;  1HJP A;  2JY8 A;  2JY6 B;  2QNJ A;  4GEW A;  1ZMU A;  1PGY A;  3E21 A;  2KNA A;  1WHC A;  2DAG A;  3E46 A;  1EFU B;  1VDL A;  1XB2 B;  2EKK A;  2LVA A;  1R4G A;  1Q02 A;  4F2L A;  3FRH A;  2K9D A;  2ZTC A;  3IEC A;  2WZJ A;  1C7Y A;  2BWE A;  1VG5 A;  3K9P A;  1JR3 E;  2MGW A;  3GLI E;  3B89 A;  5JI2 E;  1IM2 A;  2B3T A;  2K0B X;  2HWJ A;  1VEK A;  1G41 A;  1WGN A;  2MJ5 B;  2CP8 A;  2O25 A;  2LVN C;  2JY7 A;  2LVQ D;  1OKS A; 
#chains in the Genus database with same CATH topology
 5E26 A;  1G59 A;  4L4U A;  3VLF B;  3WHL A;  2F5N A;  2DHY A;  1ORY B;  4F1I A;  2L6O A;  1DGG A;  2Y0Q A;  1Q3C A;  2OOB A;  2XEP A;  3NBI A;  2LNH C;  4GRI A;  5EP3 A;  3KOZ E;  1HT2 E;  4NRW A;  1L2B A;  5FSW A;  3J27 B;  2KXE A;  4JXJ A;  2R44 A;  4LF5 M;  2M5Z A;  4G6Z A;  2CV0 A;  2QBY B;  4G4N A;  3HU1 A;  2X49 A;  3LCV B;  3SAW A;  1IN6 A;  4OVZ B;  1GVN A;  2DAE A;  2XF3 A;  4L16 A;  4JI1 M;  3D8B A;  4LZJ A;  1JR3 D;  5DNY A;  1G4A E;  1HNX M;  4IBG A;  5E6J A;  4AG6 A;  2KW0 A;  4PDG A;  4KHP M;  1QDT A;  3DZD A;  1OIZ A;  3J2P B;  3SMP A;  3GLF E;  2R0I A;  2OQ4 A;  1KFV A;  5ITR A;  2HCB A;  1PJI A;  2VQE M;  2DEN A;  4QOS A;  3T6P A;  2EKF A;  1N36 M;  1N77 A;  3PXG A;  4EIW A;  1NHG C;  3TWL A;  1IFY A;  3U61 A;  4FWG A;  3NBX X;  3GLH E;  3BBZ A;  4JI0 M;  3IG5 A;  3GPY A;  4OX9 M;  2WSF F;  1OJL A;  1MX0 A;  1PJS A;  3GLF A;  2OPF A;  4YHH M;  2DHR A;  3FE3 A;  3BOS A;  3TWK A;  1GL7 A;  4GHL A;  1VQ1 A;  1E9R A;  2RGH A;  3HHW A;  3GLH A;  4AKG A;  1W5S A;  4IBJ A;  2LXE A;  4R71 A;  4QNM A;  2Z8Y M;  4GMQ A;  5DYG A;  4PD2 A;  3GLF B;  1TH2 A;  4I81 A;  3GP1 A;  3IHP A;  4DR7 M;  1TR8 A;  1TF0 B;  2Q2E B;  2F5O A;  2A5Y B;  3KS8 A;  2RGO A;  3NWL A;  1GJT A;  3I04 M;  3F92 A;  4MGI E;  1WIV A;  4D80 A;  3SHF A;  1ZMV A;  4MB7 A;  4DV6 M;  3SBJ A;  4WP2 A;  1TDZ A;  1R2Z A;  2UU9 M;  2CFO A;  1GAB A;  3QYB A;  2KHH A;  3FRI A;  3HHX A;  3L27 A;  4FCT A;  4HEO A;  2LVP C;  4NSR A;  3UMM A;  3LVV A;  3ZQJ A;  4Q7J A;  3A46 A;  2C96 A;  3J7A S;  3LQR A;  1L2D A;  2VII A;  1DGH B;  4FW9 A;  2AHM A;  4AZF A;  4AKI A;  1YUB A;  2GNO A;  3W67 A;  4LF8 M;  1IXS A;  4L8R C;  2KDL A;  4DV1 M;  1NNU C;  1XXH E;  2Y20 A;  2XLJ A;  2G5G X;  2QSF X;  4AI6 A;  4Y28 F;  4I5S A;  3TPZ A;  1AUA A;  3KDS E;  1XNR M;  4LCB A;  3C3E A;  1SXJ D;  5EQT A;  3GPX A;  1Z5B A;  1ZMU A;  3KW6 A;  2DAG A;  3UZU A;  2N35 A;  2Y21 A;  3KP0 E;  1XMO M;  4JI8 M;  4GIT A;  1XXH A;  4BLC A;  1Z5C A;  3TE6 A;  1IXS B;  4F2L A;  4GKJ M;  5BR8 M;  4JV5 M;  1KSF X;  3PNY A;  1R7R A;  2C9C A;  3L29 A;  2DWL A;  3FYD A;  1JR3 E;  2MGW A;  4X66 M;  1IM2 A;  3CGW A;  4KOD A;  3J7B A;  3W0F A;  3AKZ A;  3SMS A;  4IBF A;  1OFI A;  4II7 A;  1WGN A;  2BNK A;  1TH4 A;  2LVN C;  2R65 A;  2Z3X A;  1XXH B;  1OAO C;  2X8A A;  3GQ4 A;  2UXB M;  3SAV A;  4IBE A;  4MH0 E;  1QDR A;  4B08 A;  1IY0 A;  1JR3 A;  5C18 A;  4NSO B;  4Z6Y A;  3FTE A;  2LBC A;  2D7H A;  3GPP A;  1MN3 A;  2I7P A;  4IBC A;  1NV9 A;  5FTM A;  5FLX S;  4QOZ C;  1N33 M;  2JP7 A;  2L4F A;  1R6B X;  4M0D A;  5FTN A;  1OQY A;  3H4J A;  4DBG B;  5EXS A;  4QHT A;  1Z6T A;  5LMN M;  1XNQ M;  5KPZ A;  4XK8 F;  1V34 A;  4QNR A;  1IN8 A;  1E32 A;  1ZMW A;  2JY5 A;  3C3D A;  4LF9 M;  1HNZ M;  1TTE A;  1WGL A;  1S3S A;  4M0W A;  1T3T A;  3OTO M;  1QYR A;  3GRU A;  1KYI A;  3A98 B;  4DV0 M;  3U5Z B;  1ZV1 A;  2LHC A;  5EXP A;  2CV2 A;  3V76 A;  2QBY A;  3MMP A;  1PJT A;  3CF6 E;  1X37 A;  4LJA A;  5A2Q S;  3L25 A;  2Z4R A;  2KEB A;  1F4I A;  1E9S A;  1XWI A;  2NQ8 C;  4OVZ A;  1N32 M;  2R6F A;  3PVS A;  3U6S A;  1RU3 A;  3GQ5 A;  3M6A A;  2R4J A;  3JR4 A;  2C99 A;  4B3M M;  3U6D A;  2KRK A;  4AQY M;  2UUB M;  1YSY A;  2APL A;  1DGF A;  3ZH9 B;  3HHZ A;  1GO5 A;  3K9O A;  1ZQ9 A;  4GC9 A;  1Q3B A;  2ERC A;  2OO9 A;  3MJ5 A;  2J5Y A;  3LW5 F;  2YR0 A;  2FH0 A;  2ZBK B;  2G8L A;  4LJ9 A;  3TWM A;  4DR2 M;  3LQQ A;  4LF4 M;  1JB0 F;  2L7H A;  4RF0 A;  3J80 S;  5FTL A;  2QQ8 A;  1HQY E;  1L1Z A;  1SXJ E;  1PRB A;  1P3Q Q;  4MGK E;  1UM8 A;  1T6O A;  2L2D A;  4DUY M;  1N34 M;  1WXQ A;  4LJ8 A;  2CV1 A;  4FCW A;  5EP1 A;  3K92 A;  4DV5 M;  4IJF A;  3AOG A;  4QHS A;  1XMQ M;  2LHG A;  2FOI C;  4DR3 M;  2DAM A;  3JR5 A;  3EIE A;  2XFT A;  2O01 F;  2QPA A;  3HJQ A;  5ITU A;  1HT1 E;  3GPU A;  2C5R A;  5F3W A;  4B3R M;  2XGN A;  4AW4 A;  5IWA M;  3MHV C;  1WR1 B;  3KSJ A;  2DI0 A;  2I7N A;  3ZCB B;  1NSF A;  2KRU A;  5ITX E;  1SG9 A;  4KLN A;  4DV3 M;  4M9S A;  1NVM A;  4ITQ A;  2CHV A;  1HR0 M;  2Z7J A;  4LRS A;  2RRU A;  4P16 A;  1ZAE A;  2D7E A;  1FJG M;  5EXX A;  2LWX A;  4DR4 M;  4CHT B;  1NY5 A;  2R46 A;  1SXJ B;  5ITX A;  2V1C A;  4JI6 M;  4AKH A;  1Z59 A;  2JY6 B;  4PCZ A;  4JI7 M;  3FTC A;  1C1K A;  2FE8 A;  4DUZ M;  2JXN A;  1DGH A;  4HL4 A;  2KZU A;  2CEA A;  3FUW A;  4LJ4 A;  1IXZ A;  1GLN A;  2VDB B;  4R7G A;  3HGI A;  5KQ8 A;  4HLQ A;  1QAO A;  1D0L A;  2ZTC A;  3IEC A;  4L6V 6;  2BJV A;  4LJ7 A;  1Q39 A;  5IT9 S;  2DZN B;  3SYK A;  3GLI E;  3W68 A;  4S12 A;  3MK6 A;  2K0B X;  1VEK A;  2X4A A;  1IXR C;  4P17 A;  4LGM A;  1OKS A;  4GKK M;  3IG8 A;  2XSZ D;  1TGU A;  3M0E A;  1OFH A;  1N75 A;  3GLI A;  4XGI A;  1G3I A;  2YQZ A;  3U6M A;  4B7G A;  3QWL A;  3GLG B;  1QUS A;  1J7K A;  2MRO B;  2VF7 A;  4IBB A;  2QP9 X;  3ILK A;  3TQS A;  3KOX E;  3KVW A;  4I8O A;  5ITT A;  3FUV A;  3C58 A;  1EIJ A;  3K8Z A;  2DZL A;  3GLI B;  3VFD A;  4M9Z A;  2EO2 A;  3K1J A;  3HY5 A;  1NHW C;  4LF6 M;  2EUC A;  3L2A A;  3KFU G;  4CJ6 A;  1MU5 A;  1QAN A;  3L26 A;  5DFL A;  4B3T M;  4RKU F;  4D81 A;  1R5L A;  1XHB A;  3FTF A;  3AL0 C;  3U60 A;  2W82 A;  3L28 A;  3HU3 A;  2JWS A;  2Z4S A;  2DAI A;  2KNZ A;  4RNA A;  3SAS A;  4NXM M;  2JNH A;  3QYE A;  4WUR A;  5KPT A;  2CWB A;  4B3S M;  4JI4 M;  1OAI A;  3Q8G A;  4G4R A;  1G71 A;  3A42 A;  3K2L A;  4REZ A;  1SXJ C;  3EIH A;  4NC6 A;  4DV4 M;  2UXC M;  4L15 A;  2CE7 A;  2F5S A;  4X64 M;  5KO3 A;  3U5Z A;  4BBA A;  1HQC A;  4X62 M;  3U60 B;  2C98 A;  1EE8 A;  3VDP A;  1HNW M;  4FWH A;  4MGH A;  2K6B A;  2WSC F;  2DWN A;  3A45 A;  2UXD M;  4XBO A;  2K47 A;  1DO2 A;  1DO0 A;  2R62 A;  3HJ8 A;  3KS4 A;  3GO8 A;  2F5Q A;  1PJQ A;  3B7Q A;  4LJ6 A;  4Z8X A;  3Q8X A;  4DV2 M;  2UUA M;  4BB9 A;  3GQ3 A;  1IY1 A;  1QQW A;  1Z5A A;  1H6U A;  4GHA A;  1NJG A;  3E4R A;  3THG A;  4G4O A;  1I94 M;  2WSE F;  1OTR A;  2P5T A;  2R4E A;  3FUX A;  2DVW B;  2QZ4 A;  4RF1 A;  2DWM A;  2JZ0 A;  3BXW A;  5KPR A;  1K82 A;  3VK8 A;  3SAT A;  4PDI A;  2J7O A;  2ZTD A;  2XZU A;  4OU7 A;  5LMU M;  2FS1 A;  1QAQ A;  2CHQ A;  2EA0 A;  1VDD A;  2M60 A;  3KXE C;  1VEJ A;  1DV0 A;  4LJ5 A;  5EP4 A;  1FNN A;  3GRR A;  1AIP C;  4NL4 H;  1Y8G A;  1QZM A;  1J09 A;  7CAT A;  2MH8 A;  4DR5 M;  2DXI A;  3AFH A;  2CRU A;  2JY8 A;  2FNA A;  4LRT A;  3U6Q A;  5FTJ A;  3B74 A;  3VKH A;  3E21 A;  4B7H A;  2XSZ A;  4I4L A;  4DV7 M;  3AOE C;  3FYC A;  1VDL A;  2EKK A;  2LVA A;  5EP2 A;  1J5E M;  1R4G A;  1Q02 A;  2CHG A;  1NJF A;  1SXJ A;  8CAT A;  3UGJ A;  2HKJ A;  3FRH A;  3VK7 A;  2L09 A;  2ZAO A;  3HKP A;  1GL6 A;  3E9S A;  2BWE A;  1VG5 A;  2VF8 A;  3K9P A;  1NY6 A;  3B89 A;  5JI2 E;  3CTW B;  4DR1 M;  4M9X A;  2HHH M;  2B3T A;  3SHG B;  4D82 A;  2HWJ A;  2XZF A;  2LH0 A;  2RKO A;  2MJ5 B;  2CP8 A;  4WW0 A;  1G8P A;  3U6O A;  3KOW E;  2JY7 A;  4IIW A;  4FWD A;  2LVQ D;  3W0L B;  1LV7 A;  3CF2 A;  4A3V B;  4X65 M;  2F5P A;  4AG5 A;  4LG2 A;  2UUC M;  1IN7 A;  4LGY A;  4KT0 F;  3PFI A;  3U6P A;  2E5L M;  4FCV A;  3HHY A;  2DKL A;  1L8Q A;  3B7N A;  1UFZ A;  2BWB A;  2GQF A;  1YLA A;  5KQD A;  4GIP A;  3GLG E;  4L78 A;  3R8F A;  3TL4 X;  4KO8 A;  4MM3 B;  1IY2 A;  4ZPX A;  1I4W A;  3I4V A;  2JZ1 A;  2DWZ B;  3D8L A;  3KOY E;  2VQF M;  1A5T A;  2XFS A;  5EXT A;  1L1T A;  4NRV A;  2O5R A;  3RE8 A;  1D0K A;  1NV8 A;  1QUT A;  3HX3 A;  3GLG A;  3U61 B;  2MR9 A;  2V1U A;  3SAR A;  4G3O A;  2Y0T A;  2FFJ A;  1IQP A;  3T1Y M;  3RFW A;  4ANR A;  2EJS A;  3VDU A;  2KNV A;  1IBL M;  3RGS A;  1QAM A;  3I4Y A;  1BVS A;  2JA2 A;  4IBI A;  3PNV A;  3QAU A;  3WHK A;  1TDH A;  2KA6 B;  2LVO C;  4B7F A;  3GLH B;  2V6Z M;  3FKE A;  4MGZ E;  2OOA A;  3AV0 A;  3T38 A;  1IBK M;  2J7N A;  3LCU A;  3VKG A;  2R18 A;  2BJW A;  1V92 A;  3UJN A;  3FUU A;  2QEN A;  4LFA M;  1JQJ C;  5FTK A;  5GKN A;  1YE9 A;  3AOE A;  4GH9 A;  3H4M A;  2R45 A;  3T15 A;  1DGB A;  2QHO B;  4CIS A;  1NO1 A;  4LY6 A;  1L2C A;  1T43 A;  2DAK A;  2C9O A;  4YY3 M;  4IBD A;  1E94 E;  1VEG A;  1GKI A;  3GRV A;  1NNJ A;  4CIZ A;  1GJS A;  2JUJ A;  4W5W A;  4LZZ A;  4OW0 A;  2ZAN A;  3ZC7 B;  1W5T A;  5ITQ A;  2DZO B;  5JI3 E;  3HZJ A;  4FD2 A;  3GRY A;  5L8R F;  1OIP A;  4R3D A;  2H5X A;  3T1H M;  3U6C A;  1PM5 A;  3JAM S;  1PJJ A;  4UN2 B;  4JI5 M;  3I51 A;  1QZE A;  3J81 S;  4JI2 M;  3RGP A;  3KP1 E;  1WJ7 A;  4IJE A;  4NXN M;  1CUK A;  1MJG M;  3HWS A;  3I01 M;  4IBK A;  1D2N A;  2HL7 A;  3CF0 A;  3M7G A;  1K3W A;  1IN5 A;  2KZS A;  2L4E A;  4JN6 A;  1K3X A;  5BPV A;  1LTM A;  2CUZ A;  3AJI B;  1XC8 A;  2HAK A;  3R9X B;  2XH9 A;  2F4V M;  4DR6 M;  2G3Q A;  5EJC A;  4MGY E;  2YFQ A;  3C9P A;  1V33 A;  5H37 D;  3FUT A;  2DNA A;  2LTU A;  1D0M A;  3LMM A;  4K0K M;  4LFB M;  1HJP A;  4CGY B;  3HJS A;  2L7I A;  5IZ7 D;  2H1R A;  2QNJ A;  5DYI A;  4JI3 M;  4GEW A;  1R2Y A;  2QCU A;  4NOO B;  1PGY A;  2KNA A;  1WHC A;  3HU2 A;  3E46 A;  3B9P A;  4PT5 A;  1N78 A;  3DA1 A;  3LVW A;  3KSX A;  1EFU B;  5ITY A;  1XB2 B;  1IBM M;  4G4Q A;  3FTD A;  1IN4 A;  3UK6 A;  2D7G A;  3B7Z A;  5IRE B;  2ZM6 M;  4JYA M;  1TH3 A;  2ZAM A;  3U6E A;  2K9D A;  1C7Y A;  2WZJ A;  3U6L A;  3SAU A;  1QVR A;  3SC3 A;  5C1B A;  4TUW A;  2YNM D;  4LF7 M;  1G41 A;  4LFC M;  3FD9 A;  3DOA A;  3SYL A;  3DFZ A;  4GC5 A;  3SFZ A;  2O25 A;  4FVM A; 
#chains in the Genus database with same CATH homology
 1G3I A;  2LBC A;  2DHY A;  1MN3 A;  4F1I A;  1NV9 A;  2DKL A;  2OOB A;  1UFZ A;  2BWB A;  2MRO B;  1YLA A;  2JP7 A;  2L4F A;  3GLG E;  1HT2 E;  1OQY A;  3H4J A;  4DBG B;  2JZ1 A;  1A5T A;  2DZL A;  3LCV B;  1NV8 A;  1ZMW A;  2DAE A;  2JY5 A;  1TTE A;  2MR9 A;  1WGL A;  1G4A E;  4G3O A;  5DFL A;  2EJS A;  2KNV A;  1KYI A;  1ZV1 A;  1BVS A;  3GLF E;  2DAI A;  2KNZ A;  2R0I A;  3MMP A;  2JNH A;  2DEN A;  3T6P A;  1F4I A;  2EKF A;  2CWB A;  2LVO C;  1OAI A;  1IFY A;  2OOA A;  3GLH E;  3BBZ A;  3LCU A;  1V92 A;  3FE3 A;  1VQ1 A;  1GO5 A;  3K9O A;  2OO9 A;  2QHO B;  1T43 A;  1DO2 A;  1DO0 A;  2DAK A;  1E94 E;  1VEG A;  4R71 A;  2JUJ A;  1HQY E;  3IHP A;  1P3Q Q;  1TR8 A;  2L2D A;  1T6O A;  2H5X A;  3F92 A;  1WIV A;  4UN2 B;  2DAM A;  1ZMV A;  4WP2 A;  1HT1 E;  1QZE A;  1OTR A;  1WJ7 A;  1WR1 B;  1CUK A;  2JZ0 A;  2DI0 A;  2KHH A;  3FRI A;  4HEO A;  2LVP C;  2ZTD A;  1SG9 A;  2L4E A;  4Q7J A;  1VEJ A;  2HAK A;  2RRU A;  1DV0 A;  1AIP C;  2G3Q A;  1Y8G A;  1IXS A;  1XXH E;  2DNA A;  2LTU A;  2QSF X;  1HJP A;  2JY8 A;  2JY6 B;  2QNJ A;  4GEW A;  1ZMU A;  1PGY A;  3E21 A;  2KNA A;  1WHC A;  2DAG A;  3E46 A;  1EFU B;  1VDL A;  1XB2 B;  2EKK A;  2LVA A;  1R4G A;  1Q02 A;  4F2L A;  3FRH A;  2K9D A;  2ZTC A;  3IEC A;  2WZJ A;  1C7Y A;  2BWE A;  1VG5 A;  3K9P A;  1JR3 E;  2MGW A;  3GLI E;  3B89 A;  5JI2 E;  1IM2 A;  2B3T A;  2K0B X;  2HWJ A;  1VEK A;  1G41 A;  1WGN A;  2MJ5 B;  2CP8 A;  2O25 A;  2LVN C;  2JY7 A;  2LVQ D;  1OKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...