2JY6B

Solution structure of the complex of ubiquitin and ubiquilin 1 uba domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
b'GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin protein
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy6B00
1ZMVA 2DNAA 2JY7A 1PGYA 2ZTDA 3LCUA 2DKLA 1TTEA 2G3QA 2JY5A 2LVQD 2QNJA 3GLFE 2RRUA 2BWEA 3IHPA 4G3OA 2QHOB 2ZTCA 2R0IA 2MJ5B 4UN2B 1BVSA 1P3QQ 3E21A 1YLAA 2BWBA 3FE3A 2CWBA 2L4EA 1G3IA 1VG5A 2HWJA 1HQYE 1JR3E 1Y8GA 1WGLA 2CP8A 1VEJA 1T6OA 3GLIE 3GLGE 2DAIA 2DAGA 2DAKA 2K9DA 1UFZA 1DO2A 2LBCA 2O25A 1C7YA 1TR8A 1XXHE 4GEWA 1IXSA 2LVAA 2QSFX 2JZ1A 1OAIA 1ZMUA 4Q7JA 2WZJA 2JUJA 1ZMWA 1ZV1A 1HJPA 2JP7A 2OO9A 2DI0A 3K9PA 3B89A 3F92A 4R71A 1WIVA 1WHCA 2JZ0A 1EFUB 3H4JA 2MGWA 2DAEA 1GO5A 2MROB 2JNHA 1MN3A 1NV8A 3LCVB 2HAKA 4WP2A 1A5TA 2KNAA 2OOBA 1WJ7A 1WGNA 1E94E 2KNVA 3MMPA 1VQ1A 3E46A 2DHYA 3BBZA 2L2DA 1CUKA 1SG9A 2LTUA 1G4AE 1OQYA 3FRIA 2H5XA 1F4IA 2DAMA 4DBGB 1XB2B 1G41A 1OKSA 1NV9A 2JY6B 1T43A 1WR1B 1R4GA 3T6PA 2LVNC 2DZLA 2EKFA 3GLHE 1KYIA 2KNZA 5JI2E 1IFYA 2LVPC 1HT2E 1VDLA 1HT1E 2B3TA 2MR9A 2JY8A 1Q02A 3IECA 1AIPC 1V92A 2KHHA 1DO0A 2L4FA 2OOAA 2LVOC 2DENA 1IM2A 1VEGA 1VEKA 4F2LA 1DV0A 4F1IA 3K9OA 2K0BX 2EJSA 1OTRA 5DFLA 2EKKA 4HEOA 3FRHA 1QZEA
chains in the Genus database with same CATH superfamily
1IXRC 2DNAA 1JB0F 1VDDA 1D0KA 4LF4M 4JI7M 1PJIA 1OJLA 2DKLA 3HU3A 4KO8A 4JI2M 1KFVA 3GLFE 3FKEA 1IN8A 2BWEA 3A42A 3GLHA 4G3OA 2XZUA 4AG5A 3GRUA 2QHOB 3HJQA 4AKIA 2MJ5B 2R44A 4UN2B 3U60B 3AOEA 1BVSA 3M6AA 3KP0E 3FE3A 3KOZE 2CWBA 4NXMM 4DR7M 1VG5A 1G71A 2X8AA 3U6QA 3CGWA 1H6UA 3I4VA 3KSXA 5FTLA 4DV3M 1XMQM 1E9RA 2EUCA 4IBJA 2A5YB 1N75A 3KS8A 4PDGA 5KO3A 3WHKA 4GH9A 1PJJA 4KT0F 2DWLA 4IJEA 3ZCBB 4LRTA 2J7OA 3SATA 2DAIA 2WSEF 4XK8F 3FTDA 1NJFA 4NRVA 2DAGA 2K9DA 1V33A 3GLIB 3HJSA 1IY1A 1PJQA 1TR8A 2Q2EB 2C96A 4JI3M 4GEWA 5IWAM 3TL4X 1XXHB 3SYKA 2XH9A 3KSJA 5IREB 1WXQA 2QZ4A 2QSFX 4DV6M 1OAIA 1ZMUA 3L26A 4KHPM 2OPFA 2JP7A 2DWZB 2DI0A 3K9PA 3R9XB 2R45A 2LWXA 1QYRA 1J5EM 4X66M 1WHCA 3U61A 2UUBM 2GNOA 3A45A 4LCBA 3VK7A 2HL7A 2HAKA 4WP2A 2KNAA 4LJ6A 4CISA 1QUSA 1WJ7A 1FJGM 2FFJA 4FCWA 1GABA 4X64M 1IBLM 2UXCM 1PJTA 2QPAA 8CATA 2HCBA 3E46A 3HGIA 2DHYA 2V6ZM 3BBZA 2KA6B 4I81A 3AV0A 3AFHA 3HJ8A 2VF8A 4IBBA 1G4AE 4GMQA 2N35A 1AUAA 3FRIA 3D8LA 1F4IA 2J7NA 1TDHA 2DAMA 4DBGB 1SXJC 1G41A 3A98B 3GPYA 1T43A 3U6MA 1WR1B 3QAUA 3W0LB 1R4GA 3U6LA 2R65A 3KFUG 4FWGA 3TWKA 2DZLA 4CJ6A 1R6BX 3H4MA 1HNZM 1KYIA 3SAWA 3GP1A 3AL0C 1HT2E 3AOGA 4QHSA 4AQYM 4BB9A 5BPVA 1DGFA 3TQSA 1IN7A 3IG5A 3UJNA 1HT1E 3TPZA 4JV5M 1QDTA 1NJGA 2L09A 2R6FA 2MR9A 2XF3A 2JY8A 1QZMA 3ILKA 1I4WA 1Q02A 3L27A 3IECA 1JR3A 1AIPC 2DZOB 3EIHA 3VKHA 2KW0A 2L4FA 4LFBM 4OVZB 3M7GA 1C1KA 2G8LA 2X4AA 1EE8A 3VK8A 1GJTA 4IBIA 4AKGA 2QCUA 3LVVA 3FTFA 1OAOC 3RE8A 1JR3D 4R7GA 5DYGA 2YNMD 4CHTB 3FYCA 4M9SA 3DZDA 4D81A 5A2QS 4FD2A 5IT9S 1NY5A 2EJSA 1UM8A 1L2CA 5FSWA 2QP9X 3AOEC 4FWDA 1ORYB 3TWLA 2RKOA 4RKUF 4BBAA 1L1TA 4IBDA 3TWMA 5LMUM 3U6EA 4LY6A 1PGYA 2ZTDA 4MGKE 4MGIE 4NSRA 3HHZA 2G3QA 1PRBA 1GLNA 4X65M 4G4OA 2DHRA 3J2PB 4G6ZA 3UGJA 2HKJA 4R3DA 1ZAEA 4NC6A 1K3XA 2M60A 4GKKM 2JWSA 4OU7A 4DR3M 3U6DA 2C9CA 4LG2A 1RU3A 2O01F 1IN6A 1G3IA 4GC9A 5EXXA 3K1JA 2CV0A 4L15A 2HWJA 1JR3E 4G4QA 1IBKM 1TH2A 4GKJM 4LJAA 3SFZA 3NBXX 4REZA 2WSFF 4OVZA 5GKNA 3KOXE 1X37A 2L6OA 3FTEA 2I7PA 3VKGA 1D0MA 5JI3E 5BR8M 2QENA 4LJ7A 4JN6A 2DAKA 3GLGB 3GRVA 2D7HA 4JXJA 3HHYA 3UMMA 3VLFB 3FUWA 3B9PA 4LF8M 2G5GX 1QAOA 3V76A 3DA1A 4LJ8A 2KEBA 3PVSA 2FNAA 1HNWM 2ZAOA 1NY6A 4M9XA 3PXGA 2XFSA 1SXJE 1ZV1A 1HJPA 1J09A 4GRIA 5DYIA 3T38A 3J7AS 4JI8M 4R71A 3MHVC 2JZ0A 4HL4A 4GIPA 2MGWA 2DAEA 1GO5A 1LTMA 1MN3A 1XHBA 4YY3M 1NHWC 3LMMA 1GVNA 2OOBA 3W68A 3KOYE 4ANRA 3J81S 2LHGA 4B3RM 1WGNA 1E94E 3NWLA 4FCVA 3JR4A 1VQ1A 4LF5M 2F4VM 1XNRM 1NHGC 3HKPA 4Z6YA 1CUKA 3PFIA 4NRWA 2LTUA 1DGHB 2V1UA 1R5LA 3RGSA 4PD2A 3U6OA 4MB7A 2CHQA 3CF0A 1QQWA 2CRUA 2ZANA 3L25A 3K2LA 3M0EA 1XB2B 1L8QA 4DR5M 1QUTA 1YE9A 2JY6B 4JI0M 4B3SM 3T6PA 2C98A 2VQFM 4MH0E 4RF1A 4WW0A 3GLHE 1IXSB 1L2BA 4FVMA 1EIJA 2Y0QA 5EP4A 3VFDA 3U60A 2VF7A 1JQJC 1I94M 3T1HM 3SARA 4LF6M 2K6BA 2YR0A 3A46A 2UXDM 3J80S 4Z8XA 2F5QA 4EIWA 2DWMA 4JI5M 3HZJA 1PM5A 4MGHA 3E4RA 1MU5A 3C9PA 2VDBB 2KHHA 3QYEA 3QYBA 2LVOC 5EQTA 1OFIA 1E9SA 3GPPA 4B08A 2BJVA 3GLIA 3K92A 3SHFA 3GQ5A 3FUXA 1VEKA 4DV0M 4F2LA 2CEAA 1DV0A 1DGHA 4NOOB 2R4JA 3K9OA 2XLJA 1XXHA 2LH0A 2KZSA 1NVMA 3I01M 4L6V6 2KXEA 5DNYA 1L1ZA 1OTRA 4QOZC 4ZPXA 3PNVA 3THGA 4D80A 4I4LA 4HEOA 2DVWB 4LZZA 1N32M 3FRHA 2H1RA 1ZMVA 4RNAA 4ITQA 1GJSA 2JY7A 1GL7A 3HU2A 3UK6A 2LVQD 5FTKA 4QOSA 2QNJA 5C1BA 2RRUA 3SMSA 7CATA 5H37D 2EO2A 2LXEA 3C3DA 4B7GA 4D82A 5ITTA 3GLFB 5KPRA 1DGBA 4DR6M 2R46A 3OTOM 1YLAA 4L78A 2BWBA 2UUAM 2R18A 1SXJB 2DXIA 3W67A 1HQYE 3BXWA 4IIWA 4LF7M 3K8ZA 1IY2A 4AW4A 2XFTA 4B3TM 4L4UA 2AHMA 3C3EA 3J7BA 1WGLA 5EXTA 2CP8A 4G4RA 1TF0B 2FH0A 4IJFA 3VDUA 3U6PA 2UU9M 2YQZA 1T6OA 4GHLA 3GLIE 4FCTA 4B7HA 1IN4A 1QDRA 3RGPA 4II7A 3ZQJA 4M9ZA 1UFZA 1DO2A 2LBCA 2Y0TA 2O25A 4DV7M 1C7YA 2Z4SA 1XXHE 4MGZE 4CIZA 3T1YM 3MJ5A 4K0KM 3ZC7B 2JZ1A 4Q7JA 4G4NA 2QBYB 2L7IA 2WZJA 2JUJA 4DV4M 2X49A 2KZUA 1W5TA 1DGGA 4IBCA 1K3WA 4OX9M 1N34M 2XZFA 1WIVA 5EJCA 5FTMA 1EFUB 1R7RA 4IBEA 2MROB 2JNHA 1NV8A 3GLHB 3I4YA 3LCVB 1A5TA 2CE7A 3GRYA 4AZFA 3KP1E 4TUWA 2NQ8C 3B7QA 3ZH9B 5L8RF 3AKZA 2XEPA 1V34A 4IBFA 4XGIA 2ZAMA 4AKHA 4LGMA 3CF2A 4YHHM 3NBIA 2CHVA 3GQ3A 3Q8XA 4M0DA 2DWNA 3FUTA 2UUCM 3LQRA 1D0LA 1SG9A 3DFZA 4QNRA 1IQPA 3D8BA 3HX3A 3LW5F 2H5XA 3B7NA 4IBKA 5EXPA 1OIZA 1HNXM 1OFHA 4A3VB 5FLXS 4AI6A 1LV7A 1OKSA 2QQ8A 1NV9A 1Q39A 3SASA 2VIIA 1QAMA 3KS4A 1KSFX 2LVNC 4GC5A 4B3MM 2EKFA 3FTCA 1HQCA 1Z6TA 4DV5M 1N78A 1T3TA 2KNZA 3JAMS 5JI2E 5EP3A 4JYAM 2LVPC 3KW6A 1IFYA 1VDLA 3LQQA 1QANA 3R8FA 1L2DA 2Z7JA 1D2NA 3GRRA 2B3TA 3U5ZB 5E26A 2MH8A 1IXZA 3SBJA 3KVWA 3B74A 3U61B 3B7ZA 1DO0A 4LJ4A 1NNJA 4PDIA 1Z59A 4GITA 2LNHC 1VEGA 1IN5A 4WURA 5ITQA 3GLGA 3L29A 4BLCA 4PCZA 2C99A 3BOSA 3SAVA 1TDZA 5FTJA 2J5YA 2YFQA 4F1IA 2K47A 3W0FA 1R2ZA 3HHWA 3GO8A 4I8OA 5DFLA 5EP1A 3J27B 4JI4M 4NSOB 4QHTA 2EKKA 3CTWB 3HU1A 1E32A 5EP2A 2F5PA 5IZ7D 4LF9M 1QZEA 2JXNA 1J7KA 4GHAA 1N33M 2CHGA 4FW9A 4DR2M 1IY0A 4NL4H 3LCUA 1TTEA 2JY5A 4L8RC 2M5ZA 2BNKA 4HLQA 5C18A 4B7FA 3IHPA 2UXBM 1PJSA 2XGNA 1N77A 2ZTCA 2R0IA 3L2AA 4KODA 2Y21A 3C58A 1P3QQ 2D7EA 3E21A 3DOAA 3LVWA 3U5ZA 1G8PA 3CF6E 2F5OA 2L4EA 2KRKA 1G59A 4KLNA 4LFAM 3JR5A 5LMNM 1OIPA 2P5TA 4X62M 3KDSE 3GPXA 1Y8GA 1FNNA 2OQ4A 5EXSA 1TH4A 1VEJA 3I51A 3I04M 3HY5A 1XWIA 1IBMM 2XSZA 3GLGE 3WHLA 4FWHA 2BJWA 3GQ4A 2Y20A 4LGYA 1Q3BA 2KRUA 5ITXA 2ZM6M 2W82A 3SAUA 2D7GA 1Z5BA 2HHHM 1IXSA 3U6CA 2LVAA 2R4EA 2XSZD 3GPUA 2WSCF 2F5SA 4Y28F 3UZUA 1ZMWA 2OO9A 4LZJA 3HHXA 5ITRA 3B89A 3F92A 1W5SA 2CFOA 1R2YA 1Z5CA 3H4JA 4OW0A 1GKIA 3L28A 3SYLA 4DV2M 4P16A 4XBOA 2C5RA 2FE8A 4S12A 2R62A 3FUUA 2Z4RA 2ZBKB 2KDLA 3AJIB 4LFCM 3FYDA 5FTNA 2KNVA 2APLA 3MMPA 4P17A 4JI6M 1XNQM 2EA0A 2L2DA 2ERCA 5E6JA 3SHGB 5KPZA 1NO1A 3MK6A 1Z5AA 1OQYA 3E9SA 3FUVA 4IBGA 3KXEC 4I5SA 2VQEM 2I7NA 4NXNM 2DZNB 5F3WA 5ITXE 5KPTA 4DUZM 2F5NA 1YSYA 3IG8A 2LHCA 4W5WA 4PT5A 5KQDA 2E5LM 4CGYB 4M0WA 2V1CA 1TGUA 4L16A 2JA2A 1QVRA 3GLFA 1Q3CA 4LJ9A 1XMOM 1K82A 2L7HA 4DV1M 1MJGM 1SXJA 1GL6A 2FS1A 5ITYA 5KQ8A 1HR0M 4LRSA 4RF0A 2Z8YM 5ITUA 3QWLA 2O5RA 1XC8A 1QAQA 3FD9A 3Q8GA 3SMPA 1V92A 4MGYE 3VDPA 2OOAA 2RGOA 3T15A 2GQFA 1ZQ9A 1SXJD 2DENA 1IM2A 1TH3A 2RGHA 4MM3B 2CUZA 3SC3A 4JI1M 3TE6A 4LJ5A 1S3SA 2CV2A 1NSFA 4DR4M 3HWSA 2FOIC 4QNMA 4DR1M 3KOWE 1N36M 2K0BX 4DUYM 3U6SA 2CV1A 2Z3XA 1MX0A 2QBYA 3RFWA 3EIEA 3PNYA 1YUBA 1NNUC 2C9OA 4AG6A
chains in the Genus database with same CATH topology
1ZMVA 2DNAA 2JY7A 1PGYA 2ZTDA 3LCUA 2DKLA 1TTEA 2G3QA 2JY5A 2LVQD 2QNJA 3GLFE 2RRUA 2BWEA 3IHPA 4G3OA 2QHOB 2ZTCA 2R0IA 2MJ5B 4UN2B 1BVSA 1P3QQ 3E21A 1YLAA 2BWBA 3FE3A 2CWBA 2L4EA 1G3IA 1VG5A 2HWJA 1HQYE 1JR3E 1Y8GA 1WGLA 2CP8A 1VEJA 1T6OA 3GLIE 3GLGE 2DAIA 2DAGA 2DAKA 2K9DA 1UFZA 1DO2A 2LBCA 2O25A 1C7YA 1TR8A 1XXHE 4GEWA 1IXSA 2LVAA 2QSFX 2JZ1A 1OAIA 1ZMUA 4Q7JA 2WZJA 2JUJA 1ZMWA 1ZV1A 1HJPA 2JP7A 2OO9A 2DI0A 3K9PA 3B89A 3F92A 4R71A 1WIVA 1WHCA 2JZ0A 1EFUB 3H4JA 2MGWA 2DAEA 1GO5A 2MROB 2JNHA 1MN3A 1NV8A 3LCVB 2HAKA 4WP2A 1A5TA 2KNAA 2OOBA 1WJ7A 1WGNA 1E94E 2KNVA 3MMPA 1VQ1A 3E46A 2DHYA 3BBZA 2L2DA 1CUKA 1SG9A 2LTUA 1G4AE 1OQYA 3FRIA 2H5XA 1F4IA 2DAMA 4DBGB 1XB2B 1G41A 1OKSA 1NV9A 2JY6B 1T43A 1WR1B 1R4GA 3T6PA 2LVNC 2DZLA 2EKFA 3GLHE 1KYIA 2KNZA 5JI2E 1IFYA 2LVPC 1HT2E 1VDLA 1HT1E 2B3TA 2MR9A 2JY8A 1Q02A 3IECA 1AIPC 1V92A 2KHHA 1DO0A 2L4FA 2OOAA 2LVOC 2DENA 1IM2A 1VEGA 1VEKA 4F2LA 1DV0A 4F1IA 3K9OA 2K0BX 2EJSA 1OTRA 5DFLA 2EKKA 4HEOA 3FRHA 1QZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMV A;  2DNA A;  2JY7 A;  1PGY A;  2ZTD A;  3LCU A;  2DKL A;  1TTE A;  2G3Q A;  2JY5 A;  2LVQ D;  2QNJ A;  3GLF E;  2RRU A;  2BWE A;  3IHP A;  4G3O A;  2QHO B;  2ZTC A;  2R0I A;  2MJ5 B;  4UN2 B;  1BVS A;  1P3Q Q;  3E21 A;  1YLA A;  2BWB A;  3FE3 A;  2CWB A;  2L4E A;  1G3I A;  1VG5 A;  2HWJ A;  1HQY E;  1JR3 E;  1Y8G A;  1WGL A;  2CP8 A;  1VEJ A;  1T6O A;  3GLI E;  3GLG E;  2DAI A;  2DAG A;  2DAK A;  2K9D A;  1UFZ A;  1DO2 A;  2LBC A;  2O25 A;  1C7Y A;  1TR8 A;  1XXH E;  4GEW A;  1IXS A;  2LVA A;  2QSF X;  2JZ1 A;  1OAI A;  1ZMU A;  4Q7J A;  2WZJ A;  2JUJ A;  1ZMW A;  1ZV1 A;  1HJP A;  2JP7 A;  2OO9 A;  2DI0 A;  3K9P A;  3B89 A;  3F92 A;  4R71 A;  1WIV A;  1WHC A;  2JZ0 A;  1EFU B;  3H4J A;  2MGW A;  2DAE A;  1GO5 A;  2MRO B;  2JNH A;  1MN3 A;  1NV8 A;  3LCV B;  2HAK A;  4WP2 A;  1A5T A;  2KNA A;  2OOB A;  1WJ7 A;  1WGN A;  1E94 E;  2KNV A;  3MMP A;  1VQ1 A;  3E46 A;  2DHY A;  3BBZ A;  2L2D A;  1CUK A;  1SG9 A;  2LTU A;  1G4A E;  1OQY A;  3FRI A;  2H5X A;  1F4I A;  2DAM A;  4DBG B;  1XB2 B;  1G41 A;  1OKS A;  1NV9 A;  2JY6 B;  1T43 A;  1WR1 B;  1R4G A;  3T6P A;  2LVN C;  2DZL A;  2EKF A;  3GLH E;  1KYI A;  2KNZ A;  5JI2 E;  1IFY A;  2LVP C;  1HT2 E;  1VDL A;  1HT1 E;  2B3T A;  2MR9 A;  2JY8 A;  1Q02 A;  3IEC A;  1AIP C;  1V92 A;  2KHH A;  1DO0 A;  2L4F A;  2OOA A;  2LVO C;  2DEN A;  1IM2 A;  1VEG A;  1VEK A;  4F2L A;  1DV0 A;  4F1I A;  3K9O A;  2K0B X;  2EJS A;  1OTR A;  5DFL A;  2EKK A;  4HEO A;  3FRH A;  1QZE A; 
#chains in the Genus database with same CATH topology
 1IXR C;  2DNA A;  1JB0 F;  1VDD A;  1D0K A;  4LF4 M;  4JI7 M;  1PJI A;  1OJL A;  2DKL A;  3HU3 A;  4KO8 A;  4JI2 M;  1KFV A;  3GLF E;  3FKE A;  1IN8 A;  2BWE A;  3A42 A;  3GLH A;  4G3O A;  2XZU A;  4AG5 A;  3GRU A;  2QHO B;  3HJQ A;  4AKI A;  2MJ5 B;  2R44 A;  4UN2 B;  3U60 B;  3AOE A;  1BVS A;  3M6A A;  3KP0 E;  3FE3 A;  3KOZ E;  2CWB A;  4NXM M;  4DR7 M;  1VG5 A;  1G71 A;  2X8A A;  3U6Q A;  3CGW A;  1H6U A;  3I4V A;  3KSX A;  5FTL A;  4DV3 M;  1XMQ M;  1E9R A;  2EUC A;  4IBJ A;  2A5Y B;  1N75 A;  3KS8 A;  4PDG A;  5KO3 A;  3WHK A;  4GH9 A;  1PJJ A;  4KT0 F;  2DWL A;  4IJE A;  3ZCB B;  4LRT A;  2J7O A;  3SAT A;  2DAI A;  2WSE F;  4XK8 F;  3FTD A;  1NJF A;  4NRV A;  2DAG A;  2K9D A;  1V33 A;  3GLI B;  3HJS A;  1IY1 A;  1PJQ A;  1TR8 A;  2Q2E B;  2C96 A;  4JI3 M;  4GEW A;  5IWA M;  3TL4 X;  1XXH B;  3SYK A;  2XH9 A;  3KSJ A;  5IRE B;  1WXQ A;  2QZ4 A;  2QSF X;  4DV6 M;  1OAI A;  1ZMU A;  3L26 A;  4KHP M;  2OPF A;  2JP7 A;  2DWZ B;  2DI0 A;  3K9P A;  3R9X B;  2R45 A;  2LWX A;  1QYR A;  1J5E M;  4X66 M;  1WHC A;  3U61 A;  2UUB M;  2GNO A;  3A45 A;  4LCB A;  3VK7 A;  2HL7 A;  2HAK A;  4WP2 A;  2KNA A;  4LJ6 A;  4CIS A;  1QUS A;  1WJ7 A;  1FJG M;  2FFJ A;  4FCW A;  1GAB A;  4X64 M;  1IBL M;  2UXC M;  1PJT A;  2QPA A;  8CAT A;  2HCB A;  3E46 A;  3HGI A;  2DHY A;  2V6Z M;  3BBZ A;  2KA6 B;  4I81 A;  3AV0 A;  3AFH A;  3HJ8 A;  2VF8 A;  4IBB A;  1G4A E;  4GMQ A;  2N35 A;  1AUA A;  3FRI A;  3D8L A;  1F4I A;  2J7N A;  1TDH A;  2DAM A;  4DBG B;  1SXJ C;  1G41 A;  3A98 B;  3GPY A;  1T43 A;  3U6M A;  1WR1 B;  3QAU A;  3W0L B;  1R4G A;  3U6L A;  2R65 A;  3KFU G;  4FWG A;  3TWK A;  2DZL A;  4CJ6 A;  1R6B X;  3H4M A;  1HNZ M;  1KYI A;  3SAW A;  3GP1 A;  3AL0 C;  1HT2 E;  3AOG A;  4QHS A;  4AQY M;  4BB9 A;  5BPV A;  1DGF A;  3TQS A;  1IN7 A;  3IG5 A;  3UJN A;  1HT1 E;  3TPZ A;  4JV5 M;  1QDT A;  1NJG A;  2L09 A;  2R6F A;  2MR9 A;  2XF3 A;  2JY8 A;  1QZM A;  3ILK A;  1I4W A;  1Q02 A;  3L27 A;  3IEC A;  1JR3 A;  1AIP C;  2DZO B;  3EIH A;  3VKH A;  2KW0 A;  2L4F A;  4LFB M;  4OVZ B;  3M7G A;  1C1K A;  2G8L A;  2X4A A;  1EE8 A;  3VK8 A;  1GJT A;  4IBI A;  4AKG A;  2QCU A;  3LVV A;  3FTF A;  1OAO C;  3RE8 A;  1JR3 D;  4R7G A;  5DYG A;  2YNM D;  4CHT B;  3FYC A;  4M9S A;  3DZD A;  4D81 A;  5A2Q S;  4FD2 A;  5IT9 S;  1NY5 A;  2EJS A;  1UM8 A;  1L2C A;  5FSW A;  2QP9 X;  3AOE C;  4FWD A;  1ORY B;  3TWL A;  2RKO A;  4RKU F;  4BBA A;  1L1T A;  4IBD A;  3TWM A;  5LMU M;  3U6E A;  4LY6 A;  1PGY A;  2ZTD A;  4MGK E;  4MGI E;  4NSR A;  3HHZ A;  2G3Q A;  1PRB A;  1GLN A;  4X65 M;  4G4O A;  2DHR A;  3J2P B;  4G6Z A;  3UGJ A;  2HKJ A;  4R3D A;  1ZAE A;  4NC6 A;  1K3X A;  2M60 A;  4GKK M;  2JWS A;  4OU7 A;  4DR3 M;  3U6D A;  2C9C A;  4LG2 A;  1RU3 A;  2O01 F;  1IN6 A;  1G3I A;  4GC9 A;  5EXX A;  3K1J A;  2CV0 A;  4L15 A;  2HWJ A;  1JR3 E;  4G4Q A;  1IBK M;  1TH2 A;  4GKJ M;  4LJA A;  3SFZ A;  3NBX X;  4REZ A;  2WSF F;  4OVZ A;  5GKN A;  3KOX E;  1X37 A;  2L6O A;  3FTE A;  2I7P A;  3VKG A;  1D0M A;  5JI3 E;  5BR8 M;  2QEN A;  4LJ7 A;  4JN6 A;  2DAK A;  3GLG B;  3GRV A;  2D7H A;  4JXJ A;  3HHY A;  3UMM A;  3VLF B;  3FUW A;  3B9P A;  4LF8 M;  2G5G X;  1QAO A;  3V76 A;  3DA1 A;  4LJ8 A;  2KEB A;  3PVS A;  2FNA A;  1HNW M;  2ZAO A;  1NY6 A;  4M9X A;  3PXG A;  2XFS A;  1SXJ E;  1ZV1 A;  1HJP A;  1J09 A;  4GRI A;  5DYI A;  3T38 A;  3J7A S;  4JI8 M;  4R71 A;  3MHV C;  2JZ0 A;  4HL4 A;  4GIP A;  2MGW A;  2DAE A;  1GO5 A;  1LTM A;  1MN3 A;  1XHB A;  4YY3 M;  1NHW C;  3LMM A;  1GVN A;  2OOB A;  3W68 A;  3KOY E;  4ANR A;  3J81 S;  2LHG A;  4B3R M;  1WGN A;  1E94 E;  3NWL A;  4FCV A;  3JR4 A;  1VQ1 A;  4LF5 M;  2F4V M;  1XNR M;  1NHG C;  3HKP A;  4Z6Y A;  1CUK A;  3PFI A;  4NRW A;  2LTU A;  1DGH B;  2V1U A;  1R5L A;  3RGS A;  4PD2 A;  3U6O A;  4MB7 A;  2CHQ A;  3CF0 A;  1QQW A;  2CRU A;  2ZAN A;  3L25 A;  3K2L A;  3M0E A;  1XB2 B;  1L8Q A;  4DR5 M;  1QUT A;  1YE9 A;  2JY6 B;  4JI0 M;  4B3S M;  3T6P A;  2C98 A;  2VQF M;  4MH0 E;  4RF1 A;  4WW0 A;  3GLH E;  1IXS B;  1L2B A;  4FVM A;  1EIJ A;  2Y0Q A;  5EP4 A;  3VFD A;  3U60 A;  2VF7 A;  1JQJ C;  1I94 M;  3T1H M;  3SAR A;  4LF6 M;  2K6B A;  2YR0 A;  3A46 A;  2UXD M;  3J80 S;  4Z8X A;  2F5Q A;  4EIW A;  2DWM A;  4JI5 M;  3HZJ A;  1PM5 A;  4MGH A;  3E4R A;  1MU5 A;  3C9P A;  2VDB B;  2KHH A;  3QYE A;  3QYB A;  2LVO C;  5EQT A;  1OFI A;  1E9S A;  3GPP A;  4B08 A;  2BJV A;  3GLI A;  3K92 A;  3SHF A;  3GQ5 A;  3FUX A;  1VEK A;  4DV0 M;  4F2L A;  2CEA A;  1DV0 A;  1DGH A;  4NOO B;  2R4J A;  3K9O A;  2XLJ A;  1XXH A;  2LH0 A;  2KZS A;  1NVM A;  3I01 M;  4L6V 6;  2KXE A;  5DNY A;  1L1Z A;  1OTR A;  4QOZ C;  4ZPX A;  3PNV A;  3THG A;  4D80 A;  4I4L A;  4HEO A;  2DVW B;  4LZZ A;  1N32 M;  3FRH A;  2H1R A;  1ZMV A;  4RNA A;  4ITQ A;  1GJS A;  2JY7 A;  1GL7 A;  3HU2 A;  3UK6 A;  2LVQ D;  5FTK A;  4QOS A;  2QNJ A;  5C1B A;  2RRU A;  3SMS A;  7CAT A;  5H37 D;  2EO2 A;  2LXE A;  3C3D A;  4B7G A;  4D82 A;  5ITT A;  3GLF B;  5KPR A;  1DGB A;  4DR6 M;  2R46 A;  3OTO M;  1YLA A;  4L78 A;  2BWB A;  2UUA M;  2R18 A;  1SXJ B;  2DXI A;  3W67 A;  1HQY E;  3BXW A;  4IIW A;  4LF7 M;  3K8Z A;  1IY2 A;  4AW4 A;  2XFT A;  4B3T M;  4L4U A;  2AHM A;  3C3E A;  3J7B A;  1WGL A;  5EXT A;  2CP8 A;  4G4R A;  1TF0 B;  2FH0 A;  4IJF A;  3VDU A;  3U6P A;  2UU9 M;  2YQZ A;  1T6O A;  4GHL A;  3GLI E;  4FCT A;  4B7H A;  1IN4 A;  1QDR A;  3RGP A;  4II7 A;  3ZQJ A;  4M9Z A;  1UFZ A;  1DO2 A;  2LBC A;  2Y0T A;  2O25 A;  4DV7 M;  1C7Y A;  2Z4S A;  1XXH E;  4MGZ E;  4CIZ A;  3T1Y M;  3MJ5 A;  4K0K M;  3ZC7 B;  2JZ1 A;  4Q7J A;  4G4N A;  2QBY B;  2L7I A;  2WZJ A;  2JUJ A;  4DV4 M;  2X49 A;  2KZU A;  1W5T A;  1DGG A;  4IBC A;  1K3W A;  4OX9 M;  1N34 M;  2XZF A;  1WIV A;  5EJC A;  5FTM A;  1EFU B;  1R7R A;  4IBE A;  2MRO B;  2JNH A;  1NV8 A;  3GLH B;  3I4Y A;  3LCV B;  1A5T A;  2CE7 A;  3GRY A;  4AZF A;  3KP1 E;  4TUW A;  2NQ8 C;  3B7Q A;  3ZH9 B;  5L8R F;  3AKZ A;  2XEP A;  1V34 A;  4IBF A;  4XGI A;  2ZAM A;  4AKH A;  4LGM A;  3CF2 A;  4YHH M;  3NBI A;  2CHV A;  3GQ3 A;  3Q8X A;  4M0D A;  2DWN A;  3FUT A;  2UUC M;  3LQR A;  1D0L A;  1SG9 A;  3DFZ A;  4QNR A;  1IQP A;  3D8B A;  3HX3 A;  3LW5 F;  2H5X A;  3B7N A;  4IBK A;  5EXP A;  1OIZ A;  1HNX M;  1OFH A;  4A3V B;  5FLX S;  4AI6 A;  1LV7 A;  1OKS A;  2QQ8 A;  1NV9 A;  1Q39 A;  3SAS A;  2VII A;  1QAM A;  3KS4 A;  1KSF X;  2LVN C;  4GC5 A;  4B3M M;  2EKF A;  3FTC A;  1HQC A;  1Z6T A;  4DV5 M;  1N78 A;  1T3T A;  2KNZ A;  3JAM S;  5JI2 E;  5EP3 A;  4JYA M;  2LVP C;  3KW6 A;  1IFY A;  1VDL A;  3LQQ A;  1QAN A;  3R8F A;  1L2D A;  2Z7J A;  1D2N A;  3GRR A;  2B3T A;  3U5Z B;  5E26 A;  2MH8 A;  1IXZ A;  3SBJ A;  3KVW A;  3B74 A;  3U61 B;  3B7Z A;  1DO0 A;  4LJ4 A;  1NNJ A;  4PDI A;  1Z59 A;  4GIT A;  2LNH C;  1VEG A;  1IN5 A;  4WUR A;  5ITQ A;  3GLG A;  3L29 A;  4BLC A;  4PCZ A;  2C99 A;  3BOS A;  3SAV A;  1TDZ A;  5FTJ A;  2J5Y A;  2YFQ A;  4F1I A;  2K47 A;  3W0F A;  1R2Z A;  3HHW A;  3GO8 A;  4I8O A;  5DFL A;  5EP1 A;  3J27 B;  4JI4 M;  4NSO B;  4QHT A;  2EKK A;  3CTW B;  3HU1 A;  1E32 A;  5EP2 A;  2F5P A;  5IZ7 D;  4LF9 M;  1QZE A;  2JXN A;  1J7K A;  4GHA A;  1N33 M;  2CHG A;  4FW9 A;  4DR2 M;  1IY0 A;  4NL4 H;  3LCU A;  1TTE A;  2JY5 A;  4L8R C;  2M5Z A;  2BNK A;  4HLQ A;  5C18 A;  4B7F A;  3IHP A;  2UXB M;  1PJS A;  2XGN A;  1N77 A;  2ZTC A;  2R0I A;  3L2A A;  4KOD A;  2Y21 A;  3C58 A;  1P3Q Q;  2D7E A;  3E21 A;  3DOA A;  3LVW A;  3U5Z A;  1G8P A;  3CF6 E;  2F5O A;  2L4E A;  2KRK A;  1G59 A;  4KLN A;  4LFA M;  3JR5 A;  5LMN M;  1OIP A;  2P5T A;  4X62 M;  3KDS E;  3GPX A;  1Y8G A;  1FNN A;  2OQ4 A;  5EXS A;  1TH4 A;  1VEJ A;  3I51 A;  3I04 M;  3HY5 A;  1XWI A;  1IBM M;  2XSZ A;  3GLG E;  3WHL A;  4FWH A;  2BJW A;  3GQ4 A;  2Y20 A;  4LGY A;  1Q3B A;  2KRU A;  5ITX A;  2ZM6 M;  2W82 A;  3SAU A;  2D7G A;  1Z5B A;  2HHH M;  1IXS A;  3U6C A;  2LVA A;  2R4E A;  2XSZ D;  3GPU A;  2WSC F;  2F5S A;  4Y28 F;  3UZU A;  1ZMW A;  2OO9 A;  4LZJ A;  3HHX A;  5ITR A;  3B89 A;  3F92 A;  1W5S A;  2CFO A;  1R2Y A;  1Z5C A;  3H4J A;  4OW0 A;  1GKI A;  3L28 A;  3SYL A;  4DV2 M;  4P16 A;  4XBO A;  2C5R A;  2FE8 A;  4S12 A;  2R62 A;  3FUU A;  2Z4R A;  2ZBK B;  2KDL A;  3AJI B;  4LFC M;  3FYD A;  5FTN A;  2KNV A;  2APL A;  3MMP A;  4P17 A;  4JI6 M;  1XNQ M;  2EA0 A;  2L2D A;  2ERC A;  5E6J A;  3SHG B;  5KPZ A;  1NO1 A;  3MK6 A;  1Z5A A;  1OQY A;  3E9S A;  3FUV A;  4IBG A;  3KXE C;  4I5S A;  2VQE M;  2I7N A;  4NXN M;  2DZN B;  5F3W A;  5ITX E;  5KPT A;  4DUZ M;  2F5N A;  1YSY A;  3IG8 A;  2LHC A;  4W5W A;  4PT5 A;  5KQD A;  2E5L M;  4CGY B;  4M0W A;  2V1C A;  1TGU A;  4L16 A;  2JA2 A;  1QVR A;  3GLF A;  1Q3C A;  4LJ9 A;  1XMO M;  1K82 A;  2L7H A;  4DV1 M;  1MJG M;  1SXJ A;  1GL6 A;  2FS1 A;  5ITY A;  5KQ8 A;  1HR0 M;  4LRS A;  4RF0 A;  2Z8Y M;  5ITU A;  3QWL A;  2O5R A;  1XC8 A;  1QAQ A;  3FD9 A;  3Q8G A;  3SMP A;  1V92 A;  4MGY E;  3VDP A;  2OOA A;  2RGO A;  3T15 A;  2GQF A;  1ZQ9 A;  1SXJ D;  2DEN A;  1IM2 A;  1TH3 A;  2RGH A;  4MM3 B;  2CUZ A;  3SC3 A;  4JI1 M;  3TE6 A;  4LJ5 A;  1S3S A;  2CV2 A;  1NSF A;  4DR4 M;  3HWS A;  2FOI C;  4QNM A;  4DR1 M;  3KOW E;  1N36 M;  2K0B X;  4DUY M;  3U6S A;  2CV1 A;  2Z3X A;  1MX0 A;  2QBY A;  3RFW A;  3EIE A;  3PNY A;  1YUB A;  1NNU C;  2C9O A;  4AG6 A; 
#chains in the Genus database with same CATH homology
 1ZMV A;  2DNA A;  2JY7 A;  1PGY A;  2ZTD A;  3LCU A;  2DKL A;  1TTE A;  2G3Q A;  2JY5 A;  2LVQ D;  2QNJ A;  3GLF E;  2RRU A;  2BWE A;  3IHP A;  4G3O A;  2QHO B;  2ZTC A;  2R0I A;  2MJ5 B;  4UN2 B;  1BVS A;  1P3Q Q;  3E21 A;  1YLA A;  2BWB A;  3FE3 A;  2CWB A;  2L4E A;  1G3I A;  1VG5 A;  2HWJ A;  1HQY E;  1JR3 E;  1Y8G A;  1WGL A;  2CP8 A;  1VEJ A;  1T6O A;  3GLI E;  3GLG E;  2DAI A;  2DAG A;  2DAK A;  2K9D A;  1UFZ A;  1DO2 A;  2LBC A;  2O25 A;  1C7Y A;  1TR8 A;  1XXH E;  4GEW A;  1IXS A;  2LVA A;  2QSF X;  2JZ1 A;  1OAI A;  1ZMU A;  4Q7J A;  2WZJ A;  2JUJ A;  1ZMW A;  1ZV1 A;  1HJP A;  2JP7 A;  2OO9 A;  2DI0 A;  3K9P A;  3B89 A;  3F92 A;  4R71 A;  1WIV A;  1WHC A;  2JZ0 A;  1EFU B;  3H4J A;  2MGW A;  2DAE A;  1GO5 A;  2MRO B;  2JNH A;  1MN3 A;  1NV8 A;  3LCV B;  2HAK A;  4WP2 A;  1A5T A;  2KNA A;  2OOB A;  1WJ7 A;  1WGN A;  1E94 E;  2KNV A;  3MMP A;  1VQ1 A;  3E46 A;  2DHY A;  3BBZ A;  2L2D A;  1CUK A;  1SG9 A;  2LTU A;  1G4A E;  1OQY A;  3FRI A;  2H5X A;  1F4I A;  2DAM A;  4DBG B;  1XB2 B;  1G41 A;  1OKS A;  1NV9 A;  2JY6 B;  1T43 A;  1WR1 B;  1R4G A;  3T6P A;  2LVN C;  2DZL A;  2EKF A;  3GLH E;  1KYI A;  2KNZ A;  5JI2 E;  1IFY A;  2LVP C;  1HT2 E;  1VDL A;  1HT1 E;  2B3T A;  2MR9 A;  2JY8 A;  1Q02 A;  3IEC A;  1AIP C;  1V92 A;  2KHH A;  1DO0 A;  2L4F A;  2OOA A;  2LVO C;  2DEN A;  1IM2 A;  1VEG A;  1VEK A;  4F2L A;  1DV0 A;  4F1I A;  3K9O A;  2K0B X;  2EJS A;  1OTR A;  5DFL A;  2EKK A;  4HEO A;  3FRH A;  1QZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...