4JI6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji6M02
1HNXM 4B3SM 3TWKA 3U6OA 1I94M 1MU5A 4LF4M 4LF5M 4G4NA 4JI8M 4JV5M 1XC8A 4DR6M 3GO8A 3A45A 5IWAM 4YY3M 1N33M 4JYAM 1J5EM 2OQ4A 1Q3CA 5BR8M 2VQEM 3U6QA 1TDZA 4G4QA 4DR5M 5ITXE 5FLXS 1PJIA 1L1ZA 2F4VM 4JI4M 1K3WA 2HKJA 2UUAM 5ITQA 2XZFA 2UXCM 4G4OA 4GKKM 2ZBKB 4LF7M 1XNRM 3C58A 4X65M 5ITUA 4AQYM 3U6PA 3SARA 5ITTA 4CISA 4DR3M 1N32M 4JI6M 4PCZA 4DV7M 3GQ4A 3T1HM 1Z5BA 1Z5CA 3W0FA 1Q39A 4NRVA 2F5OA 2F5NA 4NRWA 1Z59A 1L2CA 4JI3M 3JR4A 4B3MM 2OPFA 4KHPM 1XNQM 5IT9S 1IBLM 3GPUA 2VQFM 5ITXA 3GQ5A 2UUCM 3GPXA 3U6MA 4DV2M 4DV1M 4JI5M 4B3RM 1HR0M 3U6CA 2UUBM 2Q2EB 3TWLA 3DOAA 3A42A 3GPPA 4JI7M 1K3XA 2UXDM 1NNJA 4B3TM 1XMOM 1XMQM 4NXNM 1PM5A 2HHHM 3TWMA 4LF8M 4DR7M 5ITYA 3SBJA 3OTOM 4MB7A 4X64M 1R2YA 1K82A 1HNZM 2F5PA 3GPYA 3VK8A 3SATA 2F5QA 1L1TA 4K0KM 4LFBM 1TDHA 3JR5A 2UXBM 4YHHM 4DUZM 2E5LM 5LMUM 4GKJM 4ITQA 1Z5AA 4JI0M 3J81S 3A46A 4G4RA 1MX0A 3U6EA 4PD2A 3SAVA 4DR1M 3GQ3A 4X66M 3GP1A 4DV5M 4PDGA 4DR4M 4DV0M 1KFVA 3JAMS 4DR2M 4LF9M 1IBKM 5ITRA 4DUYM 3SAWA 3SASA 4JI2M 3T1YM 4LFCM 4JI1M 1R2ZA 2F5SA 3U6LA 1HNWM 1Q3BA 4X62M 3VK7A 5LMNM 3U6DA 5A2QS 4DV6M 1PJJA 2XZUA 3SAUA 4DV4M 1L2DA 1L2BA 4OX9M 4LF6M 1N34M 4PDIA 3U6SA 1IBMM 4LFAM 4NXMM 2ZM6M 1EE8A 2UU9M 1FJGM 3J7AS 4DV3M 1N36M 3J80S 2EA0A
chains in the Genus database with same CATH superfamily
1T6OA 4QOZC 2KHHA 2L7HA 3D8BA 1I94M 4NC6A 5C1BA 4MGHA 1G3IA 1BVSA 1IXSA 1MU5A 1VQ1A 2YNMD 4G4NA 3VKGA 1WIVA 1C7YA 1XC8A 3FD9A 1N33M 5DFLA 4GH9A 3IG5A 3GLHB 4LZZA 1V33A 1TDZA 4G4QA 5ITXE 1CUKA 1L1ZA 1DV0A 5EXSA 3KDSE 1K3WA 2HKJA 3NWLA 2UXCM 4G4OA 4GKKM 4LJ7A 3C9PA 4LJ8A 4LF7M 1XNRM 2O5RA 4CGYB 1YSYA 4FWGA 3GQ4A 1GO5A 2JWSA 3SYKA 3CF6E 3W0FA 2QP9X 2WSEF 2KXEA 2R65A 1D0KA 1Z59A 1NVMA 4JI3M 2K0BX 2OPFA 3PNVA 4IBJA 2DWMA 1IBLM 3KOYE 4IBBA 3GLHE 5ITXA 4GHAA 4MGKE 3GPXA 1NV8A 2B3TA 4A3VB 3PXGA 2CP8A 3EIHA 1VEGA 3U60B 1QUTA 2UUBM 2Q2EB 3TWLA 4I81A 2UXDM 1HJPA 3HKPA 1NNJA 2C9OA 3AKZA 4OW0A 4IIWA 1XMQM 3TWMA 4LF8M 5C18A 4M0WA 5ITYA 3LCUA 3W67A 1IY1A 3HWSA 4MB7A 4X64M 4HEOA 4IJEA 4BB9A 1KSFX 3AV0A 2R0IA 4LF5M 2D7EA 4CJ6A 3UMMA 1L1TA 2QPAA 5EQTA 3FTCA 3GLHA 4MGYE 1SXJC 5EP3A 1DO0A 1JR3E 1NJFA 1ZMVA 2EA0A 2WSFF 4ITQA 2Z7JA 3LVWA 1Z5AA 4JI0M 3A46A 1NV9A 4LRTA 4CIZA 1E9SA 4G4RA 4AKGA 1OFHA 3B9PA 4PD2A 3KVWA 3SAVA 4S12A 2DI0A 1GJTA 3I01M 2GNOA 2J7NA 1OJLA 3J7BA 4LZJA 2BWBA 4G3OA 3KSJA 1YE9A 4DUYM 2KRKA 5E26A 5BPVA 3K2LA 4JI1M 5IZ7D 3GLGB 3U6LA 1IY2A 4OVZB 3FTEA 1ZMUA 3KFUG 1HNWM 4R3DA 1WGNA 4AW4A 2CHQA 2CE7A 5EXTA 3VK7A 3U6DA 1XXHA 5F3WA 5FTJA 3FRHA 2CHVA 2XGNA 1JR3A 1DGGA 3LMMA 2EUCA 4DV4M 3AOEC 1NHGC 3SAUA 1W5SA 1IY0A 2R45A 4WW0A 2X8AA 2CRUA 2F5OA 3FRIA 1C1KA 5EP4A 3VDPA 3ZH9B 4LF6M 2C5RA 2ZAOA 3GLIB 4NSRA 1IBMM 2EJSA 4LFAM 3GRVA 4R7GA 1NNUC 5JI3E 5KPTA 1TTEA 4LJAA 2R18A 5EJCA 1VEKA 2UU9M 4D81A 2Y21A 3GLGE 1N36M 3L28A 5E6JA 4DBGB 2ZANA 2J7OA 3HZJA 4Z8XA 2D7GA 4LF4M 1QAOA 4JI8M 3E9SA 4QNMA 1OTRA 1ZMWA 1WR1B 1SXJD 4F2LA 4YY3M 4OU7A 2HWJA 3LQRA 1IN8A 2OQ4A 2DZLA 1GABA 2KNAA 5BR8M 2VQEM 7CATA 5FLXS 1HT2E 1PJIA 2DAMA 2F4VM 2EO2A 4I5SA 1OFIA 3L29A 3GLIE 4LCBA 4Q7JA 3IHPA 3FE3A 5ITQA 2XZFA 1Y8GA 2ZBKB 3BXWA 5L8RF 2OO9A 3LQQA 2APLA 2LHGA 2LNHC 2WZJA 3M0EA 3RGPA 3FTFA 3GLGA 4NL4H 2H1RA 3B7ZA 3QYEA 2R46A 1Z5BA 3SHFA 3LCVB 4LGMA 5H37D 2KA6B 1H6UA 1Q39A 2DAGA 2HAKA 3ILKA 3K1JA 4PT5A 5EP1A 1UFZA 2XLJA 2DWZB 2D7HA 4LG2A 4GIPA 4B3MM 2JY8A 4KHPM 2K9DA 2ZTDA 2DVWB 3GRUA 2CV2A 1G8PA 3KS4A 2FE8A 3GQ5A 3GLIA 3HGIA 1TH4A 4DV2M 2Y0TA 4REZA 3U6MA 1NHWC 1I4WA 2L6OA 2R4JA 3HU2A 2KDLA 4MGZE 3U6CA 4JI7M 2C9CA 3FYDA 4MM3B 2XFSA 3A42A 4Z6YA 3KOWE 1GLNA 2EKFA 3H4MA 5FTMA 1D0MA 5KQDA 4KODA 3BOSA 4AG5A 3FUVA 5FTKA 2XSZD 1R2YA 1HNZM 2JP7A 2F5PA 2Z3XA 3L2AA 2L4EA 4FW9A 3WHLA 2R4EA 3HY5A 4RF1A 2DAEA 3SATA 4LFBM 4K0KM 3T15A 5FTNA 1TDHA 1NY6A 1G71A 3PNYA 3JR5A 3MMPA 4I8OA 3C3EA 5LMUM 1QYRA 2E5LM 4GKJM 4GHLA 3LW5F 1TH2A 3M7GA 1XXHB 3L26A 3RE8A 1V34A 4DR1M 4LY6A 4X66M 3HHWA 4DV5M 2CV1A 4DR4M 2JNHA 3JAMS 1HQYE 1GL6A 4LF9M 1GKIA 3SAWA 4M9SA 1SXJE 2VDBB 3SASA 4JI2M 2KRUA 2QZ4A 4LFCM 2Z4RA 1XWIA 2BNKA 2JY7A 4LJ6A 1IXRC 2LVOC 2R44A 2FS1A 2LVQD 4EIWA 4X62M 3KSXA 3B7NA 1OAIA 1EIJA 5LMNM 1GL7A 3F92A 3ZC7B 5A2QS 2QQ8A 3B7QA 2LTUA 1IN5A 3I04M 4B08A 2OOBA 2QCUA 4XBOA 3DA1A 3AFHA 3K9PA 1PJQA 1L2DA 1XXHE 1ORYB 3GLFB 2Y20A 2WSCF 1PJSA 2KEBA 2Y0QA 3U5ZA 4GC5A 4IBDA 1S3SA 4FCWA 2N35A 4NXMM 1AIPC 3T6PA 3W68A 2RRUA 3FUXA 4FVMA 2ZM6M 1SXJA 2LWXA 4HL4A 1EE8A 3KS8A 2V1UA 4L8RC 4DV3M 5KQ8A 4Y28F 3TWKA 4BBAA 1KYIA 3GRYA 3KP0E 2L09A 2OOAA 3EIEA 4P16A 1NJGA 2M60A 3A45A 3FYCA 1DGFA 3KXEC 4FD2A 4TUWA 2NQ8C 4GRIA 1J5EM 4JYAM 3GLFE 1XHBA 3LVVA 2J5YA 4WP2A 3U6QA 2DAIA 2XF3A 2X4AA 3SC3A 1QZEA 4GITA 1GJSA 4JI4M 4QOSA 1OIPA 4L15A 4D80A 2CUZA 3R8FA 3C58A 3L27A 2QNJA 4AQYM 3SFZA 3U6PA 3AOEA 3SARA 2X49A 2RKOA 3D8LA 1PJTA 4DR3M 5JI2E 2XEPA 4JI6M 1N32M 4DV7M 4B7GA 1R4GA 1HQCA 1Z5CA 5DYIA 3PFIA 1D0LA 4P17A 1E94E 3K92A 2M5ZA 4IBGA 4XGIA 2MROB 4M0DA 1G41A 1R5LA 3SYLA 1L2CA 3ZCBB 3E4RA 3GLFA 2BJWA 1UM8A 3FUWA 3R9XB 3RGSA 2MJ5B 3UZUA 2XSZA 4IBEA 1LTMA 1YLAA 4DV1M 2MGWA 4FWDA 3THGA 4B3RM 2KZUA 1HR0M 3AOGA 3VFDA 3L25A 2JY5A 2KNZA 1K3XA 1T3TA 1A5TA 2YQZA 4HLQA 2CFOA 4L78A 1XMOM 5FTLA 2QHOB 5KO3A 4B3TM 1PM5A 2QBYA 2Z8YM 4WURA 4AI6A 3HHXA 2DKLA 3OTOM 3AL0C 1GVNA 3J2PB 2HCBA 4KO8A 1K82A 3GPYA 2CWBA 1NO1A 1WJ7A 1QQWA 2EKKA 5IREB 1QANA 3CTWB 3VK8A 2QENA 3K8ZA 1IN4A 4AZFA 3Q8GA 1IFYA 1NSFA 2LH0A 4I4LA 3QWLA 3Q8XA 2JY6B 4GMQA 1X37A 2H5XA 2XFTA 3U6EA 1G4AE 1MX0A 2DHYA 1DGHB 3MK6A 4LJ4A 4AKHA 4IJFA 1YUBA 1JR3D 2L4FA 2DHRA 2DWNA 3U5ZB 2FH0A 3FUTA 1VEJA 4B7FA 4LJ5A 2A5YB 2LVAA 4AKIA 1R2ZA 3UJNA 2O25A 2ZTCA 1SXJB 4II7A 4RF0A 1IXZA 1ZQ9A 2DZNB 2KZSA 4MGIE 3PVSA 4LGYA 2Z4SA 4DV6M 1V92A 3IECA 3UK6A 3E21A 2L7IA 4XK8F 2JA2A 1MN3A 3KP1E 1DO2A 2ZAMA 3H4JA 4B7HA 1W5TA 4G6ZA 1OIZA 1WGLA 2R6FA 1TH3A 2KW0A 3W0LB 5KPZA 2LVNC 2LXEA 4L4UA 3I4VA 4FWHA 3U6SA 2DZOB 2LBCA 1IN6A 1N77A 4KT0F 3WHKA 2JZ0A 2CHGA 2QSFX 1P3QQ 3TPZA 3FUUA 1ZAEA 2DENA 1QAQA 2JUJA 1OAOC 2K6BA 5GKNA 3J80S 3TQSA 4KLNA 1PJJA 1HNXM 3VDUA 4B3SM 3U6OA 4JXJA 1PRBA 4IBKA 3E46A 3SMPA 4BLCA 4FCTA 2CV0A 3CF0A 3J27B 1ZV1A 2CEAA 3CGWA 4M9ZA 4R71A 1HT1E 2JXNA 4JV5M 2MH8A 3KW6A 4LRSA 3GO8A 4DR6M 5IWAM 2AHMA 3U61A 2FFJA 4GC9A 3NBIA 1Q3CA 1DGHA 4D82A 4RNAA 1VDLA 4DR5M 2RGHA 2FOIC 2V1CA 1JB0F 3I51A 5KPRA 2P5TA 1TR8A 1N75A 2HL7A 1QUSA 1E32A 3HU1A 2UUAM 1Z6TA 1IN7A 5DNYA 3HJQA 1JQJC 4X65M 5ITUA 1D2NA 5ITTA 4CISA 3MHVC 3V76A 4PCZA 4IBCA 3T1HM 3CF2A 4W5WA 2G8LA 1QDRA 1AUAA 4NRVA 3C3DA 3KOXE 2F5NA 1QZMA 2QBYB 1OKSA 3DFZA 4LJ9A 3T38A 4NRWA 5FSWA 2MR9A 3JR4A 3VLFB 1EFUB 1XNQM 5IT9S 3NBXX 5EP2A 5EXPA 1J09A 2LHCA 4ANRA 3GPUA 3BBZA 4AG6A 2VQFM 2C96A 2K47A 4L16A 2UUCM 3HHZA 4NOOB 1R6BX 4JI5M 1T43A 3IG8A 4L6V6 4IBFA 1J7KA 1PGYA 1G59A 4UN2B 2RGOA 2VF7A 3DOAA 3GPPA 2DAKA 4QHTA 4ZPXA 3TL4X 1L8QA 3I4YA 3KOZE 2C98A 1RU3A 3HJSA 4FCVA 3QYBA 2L2DA 2VF8A 2LVPC 4NXNM 1QVRA 2BWEA 2JZ1A 4JN6A 2HHHM 4DR7M 3SBJA 3FTDA 4NSOB 1VG5A 3B74A 1IQPA 1TF0B 1E9RA 1LV7A 4RKUF 2F5QA 3FKEA 8CATA 1IXSB 3A98B 1QAMA 1VDDA 1WXQA 3TE6A 4YHHM 2UXBM 4DUZM 1QDTA 2VIIA 3GRRA 3HJ8A 4GEWA 4QHSA 3U60A 2V6ZM 3HX3A 3J81S 3SMSA 2DWLA 1OQYA 2C99A 3GQ3A 2XH9A 3GP1A 4PDGA 3VKHA 4DV0M 1KFVA 4DR2M 2BJVA 2G3QA 1N78A 1Q02A 3MJ5A 4M9XA 1MJGM 4MH0E 1IBKM 3M6AA 1FNNA 3T1YM 1F4IA 3AJIB 2F5SA 2FNAA 5EXXA 2W82A 4QNRA 1Q3BA 1TGUA 4IBIA 3B89A 2DNAA 2O01F 3SHGB 1SG9A 1NY5A 3DZDA 2XZUA 2YFQA 2R62A 3HHYA 1L2BA 2G5GX 3QAUA 2YR0A 2I7NA 1IM2A 4OX9M 2GQFA 3RFWA 3U61B 1N34M 5DYGA 4PDIA 3UGJA 3HU3A 3ZQJA 2ERCA 2I7PA 4CHTB 4F1IA 1DGBA 2DXIA 4OVZA 1R7RA 1FJGM 3J7AS 3K9OA 1WHCA 2KNVA 5ITRA 1XB2B
chains in the Genus database with same CATH topology
4QOZC 2L7HA 3D8BA 1I94M 5C1BA 4MGHA 1G3IA 1MU5A 2YNMD 4G4NA 3VKGA 1XC8A 3FD9A 1N33M 4GH9A 3IG5A 3GLHB 4LZZA 1TDZA 4G4QA 5ITXE 1L1ZA 5EXSA 3KDSE 1K3WA 2HKJA 3NWLA 2UXCM 4G4OA 4GKKM 4LJ7A 4LJ8A 4LF7M 1XNRM 2O5RA 4CGYB 1YSYA 4FWGA 3GQ4A 3SYKA 3CF6E 3W0FA 2QP9X 2KXEA 2R65A 1Z59A 1NVMA 4JI3M 2OPFA 3PNVA 4IBJA 2DWMA 1IBLM 3KOYE 4IBBA 5ITXA 4GHAA 4MGKE 3GPXA 4A3VB 3PXGA 3EIHA 3U60B 2UUBM 2Q2EB 3TWLA 4I81A 2UXDM 3HKPA 1NNJA 2C9OA 3AKZA 4OW0A 4IIWA 1XMQM 3TWMA 4LF8M 5C18A 4M0WA 5ITYA 1IY1A 3HWSA 4MB7A 4X64M 4BB9A 4IJEA 1KSFX 3AV0A 2D7EA 3UMMA 1L1TA 2QPAA 5EQTA 3FTCA 3GLHA 4MGYE 1SXJC 5EP3A 1DO0A 1NJFA 2EA0A 4ITQA 2Z7JA 3LVWA 1Z5AA 4JI0M 3A46A 4G4RA 4LRTA 1E9SA 4AKGA 1OFHA 3B9PA 4PD2A 3KVWA 3SAVA 4S12A 2J7NA 1OJLA 3J7BA 4LZJA 3KSJA 1YE9A 4DUYM 2KRKA 5E26A 5BPVA 3K2LA 4JI1M 5IZ7D 3GLGB 3U6LA 1IY2A 4OVZB 3FTEA 3KFUG 1HNWM 4R3DA 4AW4A 2CHQA 2CE7A 5EXTA 3VK7A 3U6DA 1XXHA 5F3WA 5FTJA 2CHVA 2XGNA 1JR3A 1DGGA 3LMMA 2EUCA 4DV4M 3AOEC 1NHGC 3SAUA 1W5SA 1IY0A 2R45A 4WW0A 2X8AA 5EP4A 1C1KA 3VDPA 3ZH9B 4LF6M 2C5RA 2ZAOA 3GLIB 4NSRA 1IBMM 4LFAM 3GRVA 4R7GA 1NNUC 5JI3E 5KPTA 4LJAA 2R18A 5EJCA 2UU9M 4D81A 2Y21A 1N36M 3L28A 5E6JA 2ZANA 2J7OA 4Z8XA 2D7GA 4LF4M 1QAOA 4JI8M 3E9SA 4QNMA 1SXJD 4YY3M 4OU7A 3LQRA 1IN8A 2OQ4A 5BR8M 2VQEM 7CATA 5FLXS 1HT2E 1PJIA 2F4VM 2EO2A 4I5SA 1OFIA 3L29A 4LCBA 5ITQA 2XZFA 2ZBKB 3LQQA 2LNHC 3M0EA 3RGPA 3FTFA 3GLGA 4NL4H 2H1RA 2R46A 1Z5BA 3SHFA 4LGMA 5H37D 2KA6B 1H6UA 1Q39A 3ILKA 4PT5A 5EP1A 3K1JA 2F5OA 4LG2A 2XLJA 2DWZB 2D7HA 4GIPA 4B3MM 4KHPM 2DVWB 3GRUA 2CV2A 1G8PA 3KS4A 2FE8A 3GQ5A 3GLIA 3HGIA 1TH4A 4DV2M 2Y0TA 4REZA 3U6MA 1NHWC 1I4WA 2L6OA 2R4JA 3HU2A 4MGZE 3U6CA 4JI7M 2C9CA 3FYDA 4MM3B 2XFSA 3A42A 4Z6YA 3KOWE 1GLNA 3H4MA 5FTMA 5KQDA 4KODA 3BOSA 4AG5A 3FUVA 5FTKA 2XSZD 1R2YA 1HNZM 2F5PA 2Z3XA 3L2AA 4FW9A 3WHLA 2R4EA 4RF1A 3SATA 4LFBM 4K0KM 3T15A 5FTNA 1TDHA 1NY6A 3PNYA 3JR5A 4I8OA 2E5LM 5LMUM 1QYRA 4GKJM 4GHLA 1TH2A 3M7GA 1XXHB 3L26A 3RE8A 4DR1M 4LY6A 4X66M 3HHWA 4DV5M 2CV1A 4DR4M 3JAMS 1HQYE 1GL6A 4LF9M 1GKIA 3SAWA 4M9SA 1SXJE 3SASA 4JI2M 4LFCM 2KRUA 2QZ4A 2Z4RA 1XWIA 2BNKA 4LJ6A 1IXRC 4EIWA 4X62M 3KSXA 5LMNM 1GL7A 3ZC7B 5A2QS 1IN5A 4B08A 2QCUA 4XBOA 3DA1A 3AFHA 1L2DA 1ORYB 3GLFB 2Y20A 2KEBA 2Y0QA 3U5ZA 4GC5A 4IBDA 1S3SA 4FCWA 4NXMM 3FUXA 4FVMA 2ZM6M 1SXJA 2LWXA 4HL4A 1EE8A 3KS8A 2V1UA 4L8RC 4DV3M 5KQ8A 3TWKA 4BBAA 1KYIA 3GRYA 3KP0E 2L09A 3EIEA 4P16A 1NJGA 2M60A 3A45A 3FYCA 1DGFA 3KXEC 4FD2A 4TUWA 2NQ8C 4GRIA 1J5EM 4JYAM 1XHBA 3LVVA 3U6QA 2XF3A 2X4AA 3SC3A 4GITA 4JI4M 4QOSA 4L15A 4D80A 2CUZA 3R8FA 3C58A 3L27A 4AQYM 3SFZA 3U6PA 3AOEA 3SARA 2X49A 2RKOA 3D8LA 4DR3M 1N32M 5JI2E 2XEPA 4JI6M 4DV7M 4B7GA 1HQCA 1Z5CA 5DYIA 3PFIA 1E94E 3K92A 2M5ZA 4IBGA 4XGIA 4M0DA 1G41A 3SYLA 1L2CA 3ZCBB 3E4RA 3GLFA 2BJWA 1UM8A 3FUWA 3R9XB 3RGSA 3UZUA 2XSZA 4IBEA 4DV1M 4FWDA 3THGA 4B3RM 2KZUA 1HR0M 3AOGA 3VFDA 3L25A 1K3XA 1T3TA 2YQZA 4HLQA 4B3TM 2CFOA 4L78A 1XMOM 5FTLA 5KO3A 1PM5A 2QBYA 4WURA 4AI6A 3HHXA 3OTOM 3AL0C 1GVNA 3J2PB 2HCBA 4KO8A 1K82A 3GPYA 5IREB 1QQWA 1QANA 3CTWB 3VK8A 2QENA 3K8ZA 1IN4A 4AZFA 1NSFA 2LH0A 4I4LA 3QWLA 3Q8XA 4GMQA 1X37A 2XFTA 3U6EA 1G4AE 1MX0A 1DGHB 3MK6A 4LJ4A 4AKHA 4IJFA 1YUBA 1JR3D 2DHRA 2DWNA 3U5ZB 3FUTA 4B7FA 4LJ5A 2A5YB 4AKIA 1R2ZA 3UJNA 1SXJB 4II7A 4RF0A 1IXZA 1ZQ9A 2DZNB 2KZSA 4MGIE 3PVSA 4LGYA 2Z4SA 4DV6M 3UK6A 2L7IA 4B7HA 2JA2A 3KP1E 1DO2A 2ZAMA 1W5TA 4G6ZA 1TH3A 2KW0A 3W0LB 5KPZA 2LXEA 4L4UA 3I4VA 4FWHA 3U6SA 2DZOB 1IN6A 1N77A 3WHKA 2CHGA 3TPZA 3FUUA 1ZAEA 1QAQA 3TQSA 5GKNA 3J80S 4KLNA 1PJJA 1HNXM 3VDUA 4B3SM 3U6OA 4JXJA 4IBKA 3SMPA 4BLCA 2CV0A 4LF5M 4FCTA 3CF0A 3J27B 4M9ZA 2CEAA 4JV5M 1HT1E 4DR6M 3KW6A 4LRSA 3GO8A 5IWAM 2AHMA 3U61A 2FFJA 4GC9A 3NBIA 1Q3CA 1DGHA 4D82A 4RNAA 4DR5M 2RGHA 2FOIC 2V1CA 5KPRA 3I51A 2P5TA 1N75A 2HL7A 1E32A 3HU1A 2UUAM 1Z6TA 1IN7A 5DNYA 3HJQA 1JQJC 4X65M 5ITUA 1D2NA 5ITTA 4CISA 3MHVC 4PCZA 4IBCA 3T1HM 3CF2A 4W5WA 2G8LA 4NRVA 2F5NA 3KOXE 1QZMA 2QBYB 3DFZA 4LJ9A 3T38A 4NRWA 5FSWA 3JR4A 3VLFB 1XNQM 5IT9S 5EP2A 5EXPA 1J09A 3GPUA 4AG6A 2VQFM 2C96A 2K47A 4L16A 2UUCM 3HHZA 4NOOB 1R6BX 4JI5M 3IG8A 4IBFA 1J7KA 1G59A 2RGOA 3DOAA 3GPPA 4QHTA 4ZPXA 3TL4X 3KOZE 1L8QA 3I4YA 2C98A 3HJSA 4FCVA 4NXNM 1QVRA 2HHHM 4JN6A 4DR7M 3SBJA 3FTDA 4NSOB 1IQPA 1E9RA 1LV7A 2F5QA 3FKEA 8CATA 1IXSB 3A98B 1QAMA 1VDDA 1WXQA 3TE6A 4YHHM 2UXBM 4DUZM 2VIIA 3GRRA 3HJ8A 4QHSA 3U60A 2V6ZM 3J81S 3SMSA 2DWLA 2C99A 3GQ3A 2XH9A 3GP1A 4PDGA 3VKHA 4DV0M 1KFVA 4DR2M 2BJVA 1N78A 3MJ5A 4M9XA 1IBKM 4MH0E 3M6AA 1FNNA 3T1YM 3AJIB 2F5SA 2FNAA 5EXXA 2W82A 4QNRA 1Q3BA 1TGUA 4IBIA 3SHGB 1NY5A 3DZDA 2XZUA 2YFQA 2R62A 3HHYA 1L2BA 2G5GX 3QAUA 2YR0A 2I7NA 1IM2A 4OX9M 3RFWA 3U61B 1N34M 5DYGA 4PDIA 3UGJA 3HU3A 2ERCA 2I7PA 4CHTB 1DGBA 2DXIA 4OVZA 1R7RA 1FJGM 3J7AS 5ITRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX M;  4B3S M;  3TWK A;  3U6O A;  1I94 M;  1MU5 A;  4LF4 M;  4LF5 M;  4G4N A;  4JI8 M;  4JV5 M;  1XC8 A;  4DR6 M;  3GO8 A;  3A45 A;  5IWA M;  4YY3 M;  1N33 M;  4JYA M;  1J5E M;  2OQ4 A;  1Q3C A;  5BR8 M;  2VQE M;  3U6Q A;  1TDZ A;  4G4Q A;  4DR5 M;  5ITX E;  5FLX S;  1PJI A;  1L1Z A;  2F4V M;  4JI4 M;  1K3W A;  2HKJ A;  2UUA M;  5ITQ A;  2XZF A;  2UXC M;  4G4O A;  4GKK M;  2ZBK B;  4LF7 M;  1XNR M;  3C58 A;  4X65 M;  5ITU A;  4AQY M;  3U6P A;  3SAR A;  5ITT A;  4CIS A;  4DR3 M;  1N32 M;  4JI6 M;  4PCZ A;  4DV7 M;  3GQ4 A;  3T1H M;  1Z5B A;  1Z5C A;  3W0F A;  1Q39 A;  4NRV A;  2F5O A;  2F5N A;  4NRW A;  1Z59 A;  1L2C A;  4JI3 M;  3JR4 A;  4B3M M;  2OPF A;  4KHP M;  1XNQ M;  5IT9 S;  1IBL M;  3GPU A;  2VQF M;  5ITX A;  3GQ5 A;  2UUC M;  3GPX A;  3U6M A;  4DV2 M;  4DV1 M;  4JI5 M;  4B3R M;  1HR0 M;  3U6C A;  2UUB M;  2Q2E B;  3TWL A;  3DOA A;  3A42 A;  3GPP A;  4JI7 M;  1K3X A;  2UXD M;  1NNJ A;  4B3T M;  1XMO M;  1XMQ M;  4NXN M;  1PM5 A;  2HHH M;  3TWM A;  4LF8 M;  4DR7 M;  5ITY A;  3SBJ A;  3OTO M;  4MB7 A;  4X64 M;  1R2Y A;  1K82 A;  1HNZ M;  2F5P A;  3GPY A;  3VK8 A;  3SAT A;  2F5Q A;  1L1T A;  4K0K M;  4LFB M;  1TDH A;  3JR5 A;  2UXB M;  4YHH M;  4DUZ M;  2E5L M;  5LMU M;  4GKJ M;  4ITQ A;  1Z5A A;  4JI0 M;  3J81 S;  3A46 A;  4G4R A;  1MX0 A;  3U6E A;  4PD2 A;  3SAV A;  4DR1 M;  3GQ3 A;  4X66 M;  3GP1 A;  4DV5 M;  4PDG A;  4DR4 M;  4DV0 M;  1KFV A;  3JAM S;  4DR2 M;  4LF9 M;  1IBK M;  5ITR A;  4DUY M;  3SAW A;  3SAS A;  4JI2 M;  3T1Y M;  4LFC M;  4JI1 M;  1R2Z A;  2F5S A;  3U6L A;  1HNW M;  1Q3B A;  4X62 M;  3VK7 A;  5LMN M;  3U6D A;  5A2Q S;  4DV6 M;  1PJJ A;  2XZU A;  3SAU A;  4DV4 M;  1L2D A;  1L2B A;  4OX9 M;  4LF6 M;  1N34 M;  4PDI A;  3U6S A;  1IBM M;  4LFA M;  4NXM M;  2ZM6 M;  1EE8 A;  2UU9 M;  1FJG M;  3J7A S;  4DV3 M;  1N36 M;  3J80 S;  2EA0 A; 
#chains in the Genus database with same CATH topology
 1T6O A;  4QOZ C;  2KHH A;  2L7H A;  3D8B A;  1I94 M;  4NC6 A;  5C1B A;  4MGH A;  1G3I A;  1BVS A;  1IXS A;  1MU5 A;  1VQ1 A;  2YNM D;  4G4N A;  3VKG A;  1WIV A;  1C7Y A;  1XC8 A;  3FD9 A;  1N33 M;  5DFL A;  4GH9 A;  3IG5 A;  3GLH B;  4LZZ A;  1V33 A;  1TDZ A;  4G4Q A;  5ITX E;  1CUK A;  1L1Z A;  1DV0 A;  5EXS A;  3KDS E;  1K3W A;  2HKJ A;  3NWL A;  2UXC M;  4G4O A;  4GKK M;  4LJ7 A;  3C9P A;  4LJ8 A;  4LF7 M;  1XNR M;  2O5R A;  4CGY B;  1YSY A;  4FWG A;  3GQ4 A;  1GO5 A;  2JWS A;  3SYK A;  3CF6 E;  3W0F A;  2QP9 X;  2WSE F;  2KXE A;  2R65 A;  1D0K A;  1Z59 A;  1NVM A;  4JI3 M;  2K0B X;  2OPF A;  3PNV A;  4IBJ A;  2DWM A;  1IBL M;  3KOY E;  4IBB A;  3GLH E;  5ITX A;  4GHA A;  4MGK E;  3GPX A;  1NV8 A;  2B3T A;  4A3V B;  3PXG A;  2CP8 A;  3EIH A;  1VEG A;  3U60 B;  1QUT A;  2UUB M;  2Q2E B;  3TWL A;  4I81 A;  2UXD M;  1HJP A;  3HKP A;  1NNJ A;  2C9O A;  3AKZ A;  4OW0 A;  4IIW A;  1XMQ M;  3TWM A;  4LF8 M;  5C18 A;  4M0W A;  5ITY A;  3LCU A;  3W67 A;  1IY1 A;  3HWS A;  4MB7 A;  4X64 M;  4HEO A;  4IJE A;  4BB9 A;  1KSF X;  3AV0 A;  2R0I A;  4LF5 M;  2D7E A;  4CJ6 A;  3UMM A;  1L1T A;  2QPA A;  5EQT A;  3FTC A;  3GLH A;  4MGY E;  1SXJ C;  5EP3 A;  1DO0 A;  1JR3 E;  1NJF A;  1ZMV A;  2EA0 A;  2WSF F;  4ITQ A;  2Z7J A;  3LVW A;  1Z5A A;  4JI0 M;  3A46 A;  1NV9 A;  4LRT A;  4CIZ A;  1E9S A;  4G4R A;  4AKG A;  1OFH A;  3B9P A;  4PD2 A;  3KVW A;  3SAV A;  4S12 A;  2DI0 A;  1GJT A;  3I01 M;  2GNO A;  2J7N A;  1OJL A;  3J7B A;  4LZJ A;  2BWB A;  4G3O A;  3KSJ A;  1YE9 A;  4DUY M;  2KRK A;  5E26 A;  5BPV A;  3K2L A;  4JI1 M;  5IZ7 D;  3GLG B;  3U6L A;  1IY2 A;  4OVZ B;  3FTE A;  1ZMU A;  3KFU G;  1HNW M;  4R3D A;  1WGN A;  4AW4 A;  2CHQ A;  2CE7 A;  5EXT A;  3VK7 A;  3U6D A;  1XXH A;  5F3W A;  5FTJ A;  3FRH A;  2CHV A;  2XGN A;  1JR3 A;  1DGG A;  3LMM A;  2EUC A;  4DV4 M;  3AOE C;  1NHG C;  3SAU A;  1W5S A;  1IY0 A;  2R45 A;  4WW0 A;  2X8A A;  2CRU A;  2F5O A;  3FRI A;  1C1K A;  5EP4 A;  3VDP A;  3ZH9 B;  4LF6 M;  2C5R A;  2ZAO A;  3GLI B;  4NSR A;  1IBM M;  2EJS A;  4LFA M;  3GRV A;  4R7G A;  1NNU C;  5JI3 E;  5KPT A;  1TTE A;  4LJA A;  2R18 A;  5EJC A;  1VEK A;  2UU9 M;  4D81 A;  2Y21 A;  3GLG E;  1N36 M;  3L28 A;  5E6J A;  4DBG B;  2ZAN A;  2J7O A;  3HZJ A;  4Z8X A;  2D7G A;  4LF4 M;  1QAO A;  4JI8 M;  3E9S A;  4QNM A;  1OTR A;  1ZMW A;  1WR1 B;  1SXJ D;  4F2L A;  4YY3 M;  4OU7 A;  2HWJ A;  3LQR A;  1IN8 A;  2OQ4 A;  2DZL A;  1GAB A;  2KNA A;  5BR8 M;  2VQE M;  7CAT A;  5FLX S;  1HT2 E;  1PJI A;  2DAM A;  2F4V M;  2EO2 A;  4I5S A;  1OFI A;  3L29 A;  3GLI E;  4LCB A;  4Q7J A;  3IHP A;  3FE3 A;  5ITQ A;  2XZF A;  1Y8G A;  2ZBK B;  3BXW A;  5L8R F;  2OO9 A;  3LQQ A;  2APL A;  2LHG A;  2LNH C;  2WZJ A;  3M0E A;  3RGP A;  3FTF A;  3GLG A;  4NL4 H;  2H1R A;  3B7Z A;  3QYE A;  2R46 A;  1Z5B A;  3SHF A;  3LCV B;  4LGM A;  5H37 D;  2KA6 B;  1H6U A;  1Q39 A;  2DAG A;  2HAK A;  3ILK A;  3K1J A;  4PT5 A;  5EP1 A;  1UFZ A;  2XLJ A;  2DWZ B;  2D7H A;  4LG2 A;  4GIP A;  4B3M M;  2JY8 A;  4KHP M;  2K9D A;  2ZTD A;  2DVW B;  3GRU A;  2CV2 A;  1G8P A;  3KS4 A;  2FE8 A;  3GQ5 A;  3GLI A;  3HGI A;  1TH4 A;  4DV2 M;  2Y0T A;  4REZ A;  3U6M A;  1NHW C;  1I4W A;  2L6O A;  2R4J A;  3HU2 A;  2KDL A;  4MGZ E;  3U6C A;  4JI7 M;  2C9C A;  3FYD A;  4MM3 B;  2XFS A;  3A42 A;  4Z6Y A;  3KOW E;  1GLN A;  2EKF A;  3H4M A;  5FTM A;  1D0M A;  5KQD A;  4KOD A;  3BOS A;  4AG5 A;  3FUV A;  5FTK A;  2XSZ D;  1R2Y A;  1HNZ M;  2JP7 A;  2F5P A;  2Z3X A;  3L2A A;  2L4E A;  4FW9 A;  3WHL A;  2R4E A;  3HY5 A;  4RF1 A;  2DAE A;  3SAT A;  4LFB M;  4K0K M;  3T15 A;  5FTN A;  1TDH A;  1NY6 A;  1G71 A;  3PNY A;  3JR5 A;  3MMP A;  4I8O A;  3C3E A;  5LMU M;  1QYR A;  2E5L M;  4GKJ M;  4GHL A;  3LW5 F;  1TH2 A;  3M7G A;  1XXH B;  3L26 A;  3RE8 A;  1V34 A;  4DR1 M;  4LY6 A;  4X66 M;  3HHW A;  4DV5 M;  2CV1 A;  4DR4 M;  2JNH A;  3JAM S;  1HQY E;  1GL6 A;  4LF9 M;  1GKI A;  3SAW A;  4M9S A;  1SXJ E;  2VDB B;  3SAS A;  4JI2 M;  2KRU A;  2QZ4 A;  4LFC M;  2Z4R A;  1XWI A;  2BNK A;  2JY7 A;  4LJ6 A;  1IXR C;  2LVO C;  2R44 A;  2FS1 A;  2LVQ D;  4EIW A;  4X62 M;  3KSX A;  3B7N A;  1OAI A;  1EIJ A;  5LMN M;  1GL7 A;  3F92 A;  3ZC7 B;  5A2Q S;  2QQ8 A;  3B7Q A;  2LTU A;  1IN5 A;  3I04 M;  4B08 A;  2OOB A;  2QCU A;  4XBO A;  3DA1 A;  3AFH A;  3K9P A;  1PJQ A;  1L2D A;  1XXH E;  1ORY B;  3GLF B;  2Y20 A;  2WSC F;  1PJS A;  2KEB A;  2Y0Q A;  3U5Z A;  4GC5 A;  4IBD A;  1S3S A;  4FCW A;  2N35 A;  4NXM M;  1AIP C;  3T6P A;  3W68 A;  2RRU A;  3FUX A;  4FVM A;  2ZM6 M;  1SXJ A;  2LWX A;  4HL4 A;  1EE8 A;  3KS8 A;  2V1U A;  4L8R C;  4DV3 M;  5KQ8 A;  4Y28 F;  3TWK A;  4BBA A;  1KYI A;  3GRY A;  3KP0 E;  2L09 A;  2OOA A;  3EIE A;  4P16 A;  1NJG A;  2M60 A;  3A45 A;  3FYC A;  1DGF A;  3KXE C;  4FD2 A;  4TUW A;  2NQ8 C;  4GRI A;  1J5E M;  4JYA M;  3GLF E;  1XHB A;  3LVV A;  2J5Y A;  4WP2 A;  3U6Q A;  2DAI A;  2XF3 A;  2X4A A;  3SC3 A;  1QZE A;  4GIT A;  1GJS A;  4JI4 M;  4QOS A;  1OIP A;  4L15 A;  4D80 A;  2CUZ A;  3R8F A;  3C58 A;  3L27 A;  2QNJ A;  4AQY M;  3SFZ A;  3U6P A;  3AOE A;  3SAR A;  2X49 A;  2RKO A;  3D8L A;  1PJT A;  4DR3 M;  5JI2 E;  2XEP A;  4JI6 M;  1N32 M;  4DV7 M;  4B7G A;  1R4G A;  1HQC A;  1Z5C A;  5DYI A;  3PFI A;  1D0L A;  4P17 A;  1E94 E;  3K92 A;  2M5Z A;  4IBG A;  4XGI A;  2MRO B;  4M0D A;  1G41 A;  1R5L A;  3SYL A;  1L2C A;  3ZCB B;  3E4R A;  3GLF A;  2BJW A;  1UM8 A;  3FUW A;  3R9X B;  3RGS A;  2MJ5 B;  3UZU A;  2XSZ A;  4IBE A;  1LTM A;  1YLA A;  4DV1 M;  2MGW A;  4FWD A;  3THG A;  4B3R M;  2KZU A;  1HR0 M;  3AOG A;  3VFD A;  3L25 A;  2JY5 A;  2KNZ A;  1K3X A;  1T3T A;  1A5T A;  2YQZ A;  4HLQ A;  2CFO A;  4L78 A;  1XMO M;  5FTL A;  2QHO B;  5KO3 A;  4B3T M;  1PM5 A;  2QBY A;  2Z8Y M;  4WUR A;  4AI6 A;  3HHX A;  2DKL A;  3OTO M;  3AL0 C;  1GVN A;  3J2P B;  2HCB A;  4KO8 A;  1K82 A;  3GPY A;  2CWB A;  1NO1 A;  1WJ7 A;  1QQW A;  2EKK A;  5IRE B;  1QAN A;  3CTW B;  3VK8 A;  2QEN A;  3K8Z A;  1IN4 A;  4AZF A;  3Q8G A;  1IFY A;  1NSF A;  2LH0 A;  4I4L A;  3QWL A;  3Q8X A;  2JY6 B;  4GMQ A;  1X37 A;  2H5X A;  2XFT A;  3U6E A;  1G4A E;  1MX0 A;  2DHY A;  1DGH B;  3MK6 A;  4LJ4 A;  4AKH A;  4IJF A;  1YUB A;  1JR3 D;  2L4F A;  2DHR A;  2DWN A;  3U5Z B;  2FH0 A;  3FUT A;  1VEJ A;  4B7F A;  4LJ5 A;  2A5Y B;  2LVA A;  4AKI A;  1R2Z A;  3UJN A;  2O25 A;  2ZTC A;  1SXJ B;  4II7 A;  4RF0 A;  1IXZ A;  1ZQ9 A;  2DZN B;  2KZS A;  4MGI E;  3PVS A;  4LGY A;  2Z4S A;  4DV6 M;  1V92 A;  3IEC A;  3UK6 A;  3E21 A;  2L7I A;  4XK8 F;  2JA2 A;  1MN3 A;  3KP1 E;  1DO2 A;  2ZAM A;  3H4J A;  4B7H A;  1W5T A;  4G6Z A;  1OIZ A;  1WGL A;  2R6F A;  1TH3 A;  2KW0 A;  3W0L B;  5KPZ A;  2LVN C;  2LXE A;  4L4U A;  3I4V A;  4FWH A;  3U6S A;  2DZO B;  2LBC A;  1IN6 A;  1N77 A;  4KT0 F;  3WHK A;  2JZ0 A;  2CHG A;  2QSF X;  1P3Q Q;  3TPZ A;  3FUU A;  1ZAE A;  2DEN A;  1QAQ A;  2JUJ A;  1OAO C;  2K6B A;  5GKN A;  3J80 S;  3TQS A;  4KLN A;  1PJJ A;  1HNX M;  3VDU A;  4B3S M;  3U6O A;  4JXJ A;  1PRB A;  4IBK A;  3E46 A;  3SMP A;  4BLC A;  4FCT A;  2CV0 A;  3CF0 A;  3J27 B;  1ZV1 A;  2CEA A;  3CGW A;  4M9Z A;  4R71 A;  1HT1 E;  2JXN A;  4JV5 M;  2MH8 A;  3KW6 A;  4LRS A;  3GO8 A;  4DR6 M;  5IWA M;  2AHM A;  3U61 A;  2FFJ A;  4GC9 A;  3NBI A;  1Q3C A;  1DGH A;  4D82 A;  4RNA A;  1VDL A;  4DR5 M;  2RGH A;  2FOI C;  2V1C A;  1JB0 F;  3I51 A;  5KPR A;  2P5T A;  1TR8 A;  1N75 A;  2HL7 A;  1QUS A;  1E32 A;  3HU1 A;  2UUA M;  1Z6T A;  1IN7 A;  5DNY A;  3HJQ A;  1JQJ C;  4X65 M;  5ITU A;  1D2N A;  5ITT A;  4CIS A;  3MHV C;  3V76 A;  4PCZ A;  4IBC A;  3T1H M;  3CF2 A;  4W5W A;  2G8L A;  1QDR A;  1AUA A;  4NRV A;  3C3D A;  3KOX E;  2F5N A;  1QZM A;  2QBY B;  1OKS A;  3DFZ A;  4LJ9 A;  3T38 A;  4NRW A;  5FSW A;  2MR9 A;  3JR4 A;  3VLF B;  1EFU B;  1XNQ M;  5IT9 S;  3NBX X;  5EP2 A;  5EXP A;  1J09 A;  2LHC A;  4ANR A;  3GPU A;  3BBZ A;  4AG6 A;  2VQF M;  2C96 A;  2K47 A;  4L16 A;  2UUC M;  3HHZ A;  4NOO B;  1R6B X;  4JI5 M;  1T43 A;  3IG8 A;  4L6V 6;  4IBF A;  1J7K A;  1PGY A;  1G59 A;  4UN2 B;  2RGO A;  2VF7 A;  3DOA A;  3GPP A;  2DAK A;  4QHT A;  4ZPX A;  3TL4 X;  1L8Q A;  3I4Y A;  3KOZ E;  2C98 A;  1RU3 A;  3HJS A;  4FCV A;  3QYB A;  2L2D A;  2VF8 A;  2LVP C;  4NXN M;  1QVR A;  2BWE A;  2JZ1 A;  4JN6 A;  2HHH M;  4DR7 M;  3SBJ A;  3FTD A;  4NSO B;  1VG5 A;  3B74 A;  1IQP A;  1TF0 B;  1E9R A;  1LV7 A;  4RKU F;  2F5Q A;  3FKE A;  8CAT A;  1IXS B;  3A98 B;  1QAM A;  1VDD A;  1WXQ A;  3TE6 A;  4YHH M;  2UXB M;  4DUZ M;  1QDT A;  2VII A;  3GRR A;  3HJ8 A;  4GEW A;  4QHS A;  3U60 A;  2V6Z M;  3HX3 A;  3J81 S;  3SMS A;  2DWL A;  1OQY A;  2C99 A;  3GQ3 A;  2XH9 A;  3GP1 A;  4PDG A;  3VKH A;  4DV0 M;  1KFV A;  4DR2 M;  2BJV A;  2G3Q A;  1N78 A;  1Q02 A;  3MJ5 A;  4M9X A;  1MJG M;  4MH0 E;  1IBK M;  3M6A A;  1FNN A;  3T1Y M;  1F4I A;  3AJI B;  2F5S A;  2FNA A;  5EXX A;  2W82 A;  4QNR A;  1Q3B A;  1TGU A;  4IBI A;  3B89 A;  2DNA A;  2O01 F;  3SHG B;  1SG9 A;  1NY5 A;  3DZD A;  2XZU A;  2YFQ A;  2R62 A;  3HHY A;  1L2B A;  2G5G X;  3QAU A;  2YR0 A;  2I7N A;  1IM2 A;  4OX9 M;  2GQF A;  3RFW A;  3U61 B;  1N34 M;  5DYG A;  4PDI A;  3UGJ A;  3HU3 A;  3ZQJ A;  2ERC A;  2I7P A;  4CHT B;  4F1I A;  1DGB A;  2DXI A;  4OVZ A;  1R7R A;  1FJG M;  3J7A S;  3K9O A;  1WHC A;  2KNV A;  5ITR A;  1XB2 B; 
#chains in the Genus database with same CATH homology
 4QOZ C;  2L7H A;  3D8B A;  1I94 M;  5C1B A;  4MGH A;  1G3I A;  1MU5 A;  2YNM D;  4G4N A;  3VKG A;  1XC8 A;  3FD9 A;  1N33 M;  4GH9 A;  3IG5 A;  3GLH B;  4LZZ A;  1TDZ A;  4G4Q A;  5ITX E;  1L1Z A;  5EXS A;  3KDS E;  1K3W A;  2HKJ A;  3NWL A;  2UXC M;  4G4O A;  4GKK M;  4LJ7 A;  4LJ8 A;  4LF7 M;  1XNR M;  2O5R A;  4CGY B;  1YSY A;  4FWG A;  3GQ4 A;  3SYK A;  3CF6 E;  3W0F A;  2QP9 X;  2KXE A;  2R65 A;  1Z59 A;  1NVM A;  4JI3 M;  2OPF A;  3PNV A;  4IBJ A;  2DWM A;  1IBL M;  3KOY E;  4IBB A;  5ITX A;  4GHA A;  4MGK E;  3GPX A;  4A3V B;  3PXG A;  3EIH A;  3U60 B;  2UUB M;  2Q2E B;  3TWL A;  4I81 A;  2UXD M;  3HKP A;  1NNJ A;  2C9O A;  3AKZ A;  4OW0 A;  4IIW A;  1XMQ M;  3TWM A;  4LF8 M;  5C18 A;  4M0W A;  5ITY A;  1IY1 A;  3HWS A;  4MB7 A;  4X64 M;  4BB9 A;  4IJE A;  1KSF X;  3AV0 A;  2D7E A;  3UMM A;  1L1T A;  2QPA A;  5EQT A;  3FTC A;  3GLH A;  4MGY E;  1SXJ C;  5EP3 A;  1DO0 A;  1NJF A;  2EA0 A;  4ITQ A;  2Z7J A;  3LVW A;  1Z5A A;  4JI0 M;  3A46 A;  4G4R A;  4LRT A;  1E9S A;  4AKG A;  1OFH A;  3B9P A;  4PD2 A;  3KVW A;  3SAV A;  4S12 A;  2J7N A;  1OJL A;  3J7B A;  4LZJ A;  3KSJ A;  1YE9 A;  4DUY M;  2KRK A;  5E26 A;  5BPV A;  3K2L A;  4JI1 M;  5IZ7 D;  3GLG B;  3U6L A;  1IY2 A;  4OVZ B;  3FTE A;  3KFU G;  1HNW M;  4R3D A;  4AW4 A;  2CHQ A;  2CE7 A;  5EXT A;  3VK7 A;  3U6D A;  1XXH A;  5F3W A;  5FTJ A;  2CHV A;  2XGN A;  1JR3 A;  1DGG A;  3LMM A;  2EUC A;  4DV4 M;  3AOE C;  1NHG C;  3SAU A;  1W5S A;  1IY0 A;  2R45 A;  4WW0 A;  2X8A A;  5EP4 A;  1C1K A;  3VDP A;  3ZH9 B;  4LF6 M;  2C5R A;  2ZAO A;  3GLI B;  4NSR A;  1IBM M;  4LFA M;  3GRV A;  4R7G A;  1NNU C;  5JI3 E;  5KPT A;  4LJA A;  2R18 A;  5EJC A;  2UU9 M;  4D81 A;  2Y21 A;  1N36 M;  3L28 A;  5E6J A;  2ZAN A;  2J7O A;  4Z8X A;  2D7G A;  4LF4 M;  1QAO A;  4JI8 M;  3E9S A;  4QNM A;  1SXJ D;  4YY3 M;  4OU7 A;  3LQR A;  1IN8 A;  2OQ4 A;  5BR8 M;  2VQE M;  7CAT A;  5FLX S;  1HT2 E;  1PJI A;  2F4V M;  2EO2 A;  4I5S A;  1OFI A;  3L29 A;  4LCB A;  5ITQ A;  2XZF A;  2ZBK B;  3LQQ A;  2LNH C;  3M0E A;  3RGP A;  3FTF A;  3GLG A;  4NL4 H;  2H1R A;  2R46 A;  1Z5B A;  3SHF A;  4LGM A;  5H37 D;  2KA6 B;  1H6U A;  1Q39 A;  3ILK A;  4PT5 A;  5EP1 A;  3K1J A;  2F5O A;  4LG2 A;  2XLJ A;  2DWZ B;  2D7H A;  4GIP A;  4B3M M;  4KHP M;  2DVW B;  3GRU A;  2CV2 A;  1G8P A;  3KS4 A;  2FE8 A;  3GQ5 A;  3GLI A;  3HGI A;  1TH4 A;  4DV2 M;  2Y0T A;  4REZ A;  3U6M A;  1NHW C;  1I4W A;  2L6O A;  2R4J A;  3HU2 A;  4MGZ E;  3U6C A;  4JI7 M;  2C9C A;  3FYD A;  4MM3 B;  2XFS A;  3A42 A;  4Z6Y A;  3KOW E;  1GLN A;  3H4M A;  5FTM A;  5KQD A;  4KOD A;  3BOS A;  4AG5 A;  3FUV A;  5FTK A;  2XSZ D;  1R2Y A;  1HNZ M;  2F5P A;  2Z3X A;  3L2A A;  4FW9 A;  3WHL A;  2R4E A;  4RF1 A;  3SAT A;  4LFB M;  4K0K M;  3T15 A;  5FTN A;  1TDH A;  1NY6 A;  3PNY A;  3JR5 A;  4I8O A;  2E5L M;  5LMU M;  1QYR A;  4GKJ M;  4GHL A;  1TH2 A;  3M7G A;  1XXH B;  3L26 A;  3RE8 A;  4DR1 M;  4LY6 A;  4X66 M;  3HHW A;  4DV5 M;  2CV1 A;  4DR4 M;  3JAM S;  1HQY E;  1GL6 A;  4LF9 M;  1GKI A;  3SAW A;  4M9S A;  1SXJ E;  3SAS A;  4JI2 M;  4LFC M;  2KRU A;  2QZ4 A;  2Z4R A;  1XWI A;  2BNK A;  4LJ6 A;  1IXR C;  4EIW A;  4X62 M;  3KSX A;  5LMN M;  1GL7 A;  3ZC7 B;  5A2Q S;  1IN5 A;  4B08 A;  2QCU A;  4XBO A;  3DA1 A;  3AFH A;  1L2D A;  1ORY B;  3GLF B;  2Y20 A;  2KEB A;  2Y0Q A;  3U5Z A;  4GC5 A;  4IBD A;  1S3S A;  4FCW A;  4NXM M;  3FUX A;  4FVM A;  2ZM6 M;  1SXJ A;  2LWX A;  4HL4 A;  1EE8 A;  3KS8 A;  2V1U A;  4L8R C;  4DV3 M;  5KQ8 A;  3TWK A;  4BBA A;  1KYI A;  3GRY A;  3KP0 E;  2L09 A;  3EIE A;  4P16 A;  1NJG A;  2M60 A;  3A45 A;  3FYC A;  1DGF A;  3KXE C;  4FD2 A;  4TUW A;  2NQ8 C;  4GRI A;  1J5E M;  4JYA M;  1XHB A;  3LVV A;  3U6Q A;  2XF3 A;  2X4A A;  3SC3 A;  4GIT A;  4JI4 M;  4QOS A;  4L15 A;  4D80 A;  2CUZ A;  3R8F A;  3C58 A;  3L27 A;  4AQY M;  3SFZ A;  3U6P A;  3AOE A;  3SAR A;  2X49 A;  2RKO A;  3D8L A;  4DR3 M;  1N32 M;  5JI2 E;  2XEP A;  4JI6 M;  4DV7 M;  4B7G A;  1HQC A;  1Z5C A;  5DYI A;  3PFI A;  1E94 E;  3K92 A;  2M5Z A;  4IBG A;  4XGI A;  4M0D A;  1G41 A;  3SYL A;  1L2C A;  3ZCB B;  3E4R A;  3GLF A;  2BJW A;  1UM8 A;  3FUW A;  3R9X B;  3RGS A;  3UZU A;  2XSZ A;  4IBE A;  4DV1 M;  4FWD A;  3THG A;  4B3R M;  2KZU A;  1HR0 M;  3AOG A;  3VFD A;  3L25 A;  1K3X A;  1T3T A;  2YQZ A;  4HLQ A;  4B3T M;  2CFO A;  4L78 A;  1XMO M;  5FTL A;  5KO3 A;  1PM5 A;  2QBY A;  4WUR A;  4AI6 A;  3HHX A;  3OTO M;  3AL0 C;  1GVN A;  3J2P B;  2HCB A;  4KO8 A;  1K82 A;  3GPY A;  5IRE B;  1QQW A;  1QAN A;  3CTW B;  3VK8 A;  2QEN A;  3K8Z A;  1IN4 A;  4AZF A;  1NSF A;  2LH0 A;  4I4L A;  3QWL A;  3Q8X A;  4GMQ A;  1X37 A;  2XFT A;  3U6E A;  1G4A E;  1MX0 A;  1DGH B;  3MK6 A;  4LJ4 A;  4AKH A;  4IJF A;  1YUB A;  1JR3 D;  2DHR A;  2DWN A;  3U5Z B;  3FUT A;  4B7F A;  4LJ5 A;  2A5Y B;  4AKI A;  1R2Z A;  3UJN A;  1SXJ B;  4II7 A;  4RF0 A;  1IXZ A;  1ZQ9 A;  2DZN B;  2KZS A;  4MGI E;  3PVS A;  4LGY A;  2Z4S A;  4DV6 M;  3UK6 A;  2L7I A;  4B7H A;  2JA2 A;  3KP1 E;  1DO2 A;  2ZAM A;  1W5T A;  4G6Z A;  1TH3 A;  2KW0 A;  3W0L B;  5KPZ A;  2LXE A;  4L4U A;  3I4V A;  4FWH A;  3U6S A;  2DZO B;  1IN6 A;  1N77 A;  3WHK A;  2CHG A;  3TPZ A;  3FUU A;  1ZAE A;  1QAQ A;  3TQS A;  5GKN A;  3J80 S;  4KLN A;  1PJJ A;  1HNX M;  3VDU A;  4B3S M;  3U6O A;  4JXJ A;  4IBK A;  3SMP A;  4BLC A;  2CV0 A;  4LF5 M;  4FCT A;  3CF0 A;  3J27 B;  4M9Z A;  2CEA A;  4JV5 M;  1HT1 E;  4DR6 M;  3KW6 A;  4LRS A;  3GO8 A;  5IWA M;  2AHM A;  3U61 A;  2FFJ A;  4GC9 A;  3NBI A;  1Q3C A;  1DGH A;  4D82 A;  4RNA A;  4DR5 M;  2RGH A;  2FOI C;  2V1C A;  5KPR A;  3I51 A;  2P5T A;  1N75 A;  2HL7 A;  1E32 A;  3HU1 A;  2UUA M;  1Z6T A;  1IN7 A;  5DNY A;  3HJQ A;  1JQJ C;  4X65 M;  5ITU A;  1D2N A;  5ITT A;  4CIS A;  3MHV C;  4PCZ A;  4IBC A;  3T1H M;  3CF2 A;  4W5W A;  2G8L A;  4NRV A;  2F5N A;  3KOX E;  1QZM A;  2QBY B;  3DFZ A;  4LJ9 A;  3T38 A;  4NRW A;  5FSW A;  3JR4 A;  3VLF B;  1XNQ M;  5IT9 S;  5EP2 A;  5EXP A;  1J09 A;  3GPU A;  4AG6 A;  2VQF M;  2C96 A;  2K47 A;  4L16 A;  2UUC M;  3HHZ A;  4NOO B;  1R6B X;  4JI5 M;  3IG8 A;  4IBF A;  1J7K A;  1G59 A;  2RGO A;  3DOA A;  3GPP A;  4QHT A;  4ZPX A;  3TL4 X;  3KOZ E;  1L8Q A;  3I4Y A;  2C98 A;  3HJS A;  4FCV A;  4NXN M;  1QVR A;  2HHH M;  4JN6 A;  4DR7 M;  3SBJ A;  3FTD A;  4NSO B;  1IQP A;  1E9R A;  1LV7 A;  2F5Q A;  3FKE A;  8CAT A;  1IXS B;  3A98 B;  1QAM A;  1VDD A;  1WXQ A;  3TE6 A;  4YHH M;  2UXB M;  4DUZ M;  2VII A;  3GRR A;  3HJ8 A;  4QHS A;  3U60 A;  2V6Z M;  3J81 S;  3SMS A;  2DWL A;  2C99 A;  3GQ3 A;  2XH9 A;  3GP1 A;  4PDG A;  3VKH A;  4DV0 M;  1KFV A;  4DR2 M;  2BJV A;  1N78 A;  3MJ5 A;  4M9X A;  1IBK M;  4MH0 E;  3M6A A;  1FNN A;  3T1Y M;  3AJI B;  2F5S A;  2FNA A;  5EXX A;  2W82 A;  4QNR A;  1Q3B A;  1TGU A;  4IBI A;  3SHG B;  1NY5 A;  3DZD A;  2XZU A;  2YFQ A;  2R62 A;  3HHY A;  1L2B A;  2G5G X;  3QAU A;  2YR0 A;  2I7N A;  1IM2 A;  4OX9 M;  3RFW A;  3U61 B;  1N34 M;  5DYG A;  4PDI A;  3UGJ A;  3HU3 A;  2ERC A;  2I7P A;  4CHT B;  1DGB A;  2DXI A;  4OVZ A;  1R7R A;  1FJG M;  3J7A S;  5ITR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...