4JI6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji6M02
1K3WA 3GPXA 1N32M 1HNWM 4LF8M 2UU9M 4DR7M 3TWMA 3U6EA 4PDGA 4DUZM 4LFAM 4JI4M 3VK8A 4OX9M 4YY3M 2UXBM 3T1HM 1XMOM 3GQ4A 1R2ZA 4G4NA 3U6DA 1Z5BA 1Z5CA 4JV5M 3DOAA 4NRWA 4LF7M 5ITUA 1HNZM 3GPUA 2UXDM 4JYAM 4DV1M 1NNJA 4X66M 4G4QA 3A42A 3U6CA 3T1YM 5A2QS 3GQ5A 2UUAM 4B3RM 4YHHM 5IT9S 5IWAM 5BR8M 3J81S 4PD2A 4DV3M 2VQEM 3SASA 3GQ3A 3VK7A 4JI8M 1R2YA 4G4RA 3JR5A 2UUCM 4DR1M 4B3TM 1N33M 5ITXE 4DV7M 1Q3CA 4NXMM 2ZM6M 3A46A 3GO8A 3A45A 2F5SA 4NRVA 4GKJM 1TDZA 4MB7A 4DUYM 4LF4M 1Z5AA 2F5QA 4DV5M 3SAWA 1K82A 2F5NA 2OPFA 2Q2EB 1Q3BA 3GP1A 3W0FA 4DV2M 2F5OA 4X62M 3SBJA 4LF6M 1IBKM 4JI3M 5FLXS 3U6QA 3GPYA 5LMUM 1XNQM 4JI1M 1Q39A 4DV0M 4KHPM 4JI7M 1L1ZA 2XZFA 1XNRM 1K3XA 3U6SA 4CISA 5ITXA 4GKKM 4LFBM 2UXCM 4DR2M 3J80S 1EE8A 5ITRA 1FJGM 4DR6M 2OQ4A 4PCZA 3J7AS 4LFCM 1IBMM 2XZUA 2VQFM 1L1TA 1L2CA 4DV4M 1XC8A 2F4VM 1PM5A 1HNXM 1L2DA 3U6PA 5ITQA 4K0KM 1PJIA 2F5PA 2E5LM 3OTOM 1MX0A 3TWLA 1L2BA 3U6LA 4DR4M 2UUBM 1IBLM 3SAUA 4JI0M 1N34M 1KFVA 4PDIA 1N36M 4DR3M 2HHHM 4ITQA 5ITTA 3C58A 3SATA 1J5EM 4NXNM 4G4OA 4DV6M 1I94M 4JI6M 4AQYM 3U6MA 4X64M 2ZBKB 4DR5M 5LMNM 4LF5M 4JI2M 3U6OA 4LF9M 2EA0A 3JR4A 1TDHA 3GPPA 4JI5M 4B3MM 5ITYA 2HKJA 3JAMS 3SARA 3TWKA 4X65M 4B3SM 1XMQM 1MU5A 1Z59A 1HR0M 3SAVA 1PJJA
chains in the Genus database with same CATH superfamily
1T43A 3GLHE 2HAKA 3FUTA 4JXJA 4WP2A 4A3VB 3PNVA 3QYEA 4LZZA 5DFLA 4LFAM 4JI4M 1I4WA 2I7PA 2DNAA 3KOZE 2EO2A 3T6PA 1V33A 2UXBM 1WGNA 2DWLA 1Q02A 3U60B 2HWJA 2K6BA 4FCVA 2JY7A 3BBZA 1Z5CA 4JV5M 1VEKA 5EXTA 1N75A 1F4IA 4AW4A 1DGHB 3GPUA 2WSCF 2XF3A 1GVNA 2JZ1A 1GO5A 1P3QQ 3GQ5A 1G4AE 3K2LA 3TL4X 2C98A 3M7GA 1Z6TA 2O25A 5IWAM 4PD2A 3KDSE 2VQEM 5IREB 3KS4A 4WW0A 1QZMA 3ILKA 1MN3A 3U61B 4JI8M 1RU3A 3FTEA 4LY6A 3SMSA 1D0MA 3K9PA 1S3SA 3B74A 3AL0C 1N33M 1IY2A 2G3QA 4TUWA 1IN6A 1QUSA 3MHVC 3A46A 2C9CA 3A45A 3QYBA 2F5SA 2LVAA 4NRVA 5IZ7D 4GKJM 4DUYM 1ZMUA 2DKLA 4LF4M 2R46A 1Z5AA 4AKGA 2F5QA 1K82A 2FS1A 2LVOC 3FYDA 2MJ5B 4Y28F 3W0LB 1N77A 3BOSA 3GLGE 1YE9A 3Q8XA 2CUZA 2LVQD 4LF6M 2A5YB 2YNMD 1NHGC 5LMUM 1ZQ9A 3E46A 4NL4H 4L78A 2QBYA 4JI1M 1XNQM 4KHPM 4JI7M 1L1ZA 1C1KA 2FFJA 1XNRM 3UK6A 3UJNA 3GRRA 2APLA 3LQRA 1IN4A 3CGWA 1DGBA 4GKKM 2UXCM 5C1BA 3I04M 2CHVA 4AI6A 5KPRA 5C18A 4LGYA 1NVMA 2JP7A 1IBMM 4DBGB 4AZFA 3E9SA 1L2CA 1HT2E 3KVWA 3FD9A 1XC8A 1PM5A 1JB0F 3LW5F 1HNXM 1L2DA 1R4GA 2ZAOA 2BJVA 5ITQA 3GLGA 3EIEA 3CTWB 5JI3E 1PRBA 4DR4M 3HHWA 4IBDA 5E6JA 4GC9A 4GHLA 3AV0A 3W67A 1OIPA 1IN5A 2FOIC 1TH4A 2KNAA 4AKIA 4QOSA 3ZQJA 4IBCA 3HHYA 4NXNM 3FUXA 1TH2A 4LZJA 2KNZA 1SXJA 2O5RA 4EIWA 3VKGA 4IBEA 1QYRA 1G41A 1PJTA 2JWSA 3DFZA 2B3TA 2XFTA 2Y20A 4RF1A 4I4LA 4LF5M 2CV2A 4M0WA 2WSEF 2DZOB 4LF8M 2EKFA 3B7NA 3CF0A 3GPPA 2Z8YM 4AG5A 4JI5M 2LVPC 5FTJA 2EJSA 2R18A 3GRUA 3KXEC 1IXSA 3J27B 5GKNA 4LCBA 2HL7A 3LCUA 3L25A 1A5TA 4MGZE 3DA1A 3FUUA 4QHSA 1MU5A 1Z59A 3KSXA 1HR0M 1OJLA 3HY5A 2XEPA 1LTMA 3GPXA 1K3WA 1HNWM 2ZANA 2R6FA 2G8LA 2VIIA 1EIJA 3MJ5A 3TWMA 4CGYB 1D0KA 2JA2A 2H5XA 3C9PA 3KP1E 2L7HA 3VK8A 3GRYA 4YY3M 3T1HM 1OKSA 1XHBA 3GQ4A 3U5ZB 4LG2A 1N78A 2MROB 2D7GA 2Y0QA 3FUWA 2RGHA 3PVSA 4F2LA 4R3DA 4S12A 3L27A 2KEBA 1VG5A 4I8OA 1UM8A 5EP2A 1HQYE 3B9PA 2P5TA 3HHZA 4KT0F 2UXDM 1OQYA 4X66M 2RGOA 1QZEA 2D7EA 3T38A 3U6CA 2Y21A 3MK6A 4B3RM 2LNHC 2V6ZM 5BR8M 4DV3M 1G59A 2FNAA 2FE8A 4GIPA 4LJ9A 1R2YA 3F92A 1GJTA 1HQCA 2QZ4A 3H4JA 2VF7A 3TE6A 4DR1M 4FCTA 2QQ8A 2ZM6M 3HHXA 4GITA 1TF0B 4IBBA 2L09A 1TDZA 2J7OA 4D80A 1QAMA 4OU7A 3HU2A 3SAWA 3U60A 1T3TA 2Q2EB 1DV0A 1GL7A 3W0FA 4X62M 1JQJC 4MGYE 1DGHA 1KSFX 1GABA 4L16A 3L2AA 4LRSA 3GPYA 3AFHA 1OFHA 2CHGA 2V1CA 3I01M 1Q39A 1GKIA 4II7A 2XFSA 2Z3XA 3R9XB 3U6SA 2DAGA 3FTDA 3I4VA 2VF8A 4B7GA 5E26A 5JI2E 4LFBM 1IXZA 3U61A 3K92A 4JN6A 3W68A 4OW0A 3VLFB 3IECA 2OQ4A 3KP0E 3J7AS 2XZUA 2KZUA 1T6OA 2CE7A 4ZPXA 3GLFB 2VQFM 1L1TA 4DV4M 1G3IA 1VEGA 2ZAMA 5H37D 5FTMA 1JR3A 2I7NA 1J09A 3AOGA 3T15A 2F5PA 1IY1A 1W5TA 2C99A 2JZ0A 3GLHB 2CHQA 1MX0A 3HU3A 2O01F 2UUBM 3LQQA 1E9RA 3MMPA 2L6OA 3PNYA 1SXJC 4Z8XA 2KXEA 3C3DA 4L15A 4JI0M 1J7KA 1KFVA 1N36M 4DR3M 2HHHM 4QNMA 3FYCA 4M0DA 3RE8A 3KOWE 5BPVA 3FTCA 1J5EM 1ZMWA 2OOAA 3CF2A 2XSZA 1NO1A 1OFIA 3SYKA 4JI6M 1BVSA 2H1RA 2MR9A 4MGKE 1IQPA 1SXJD 1SXJE 2JUJA 4X64M 1KYIA 4B08A 4AG6A 3TPZA 4WURA 2CV0A 1XWIA 4LF9M 4CJ6A 4OVZB 4FWGA 3JR4A 4LRTA 1XB2B 4QNRA 1GJSA 4D82A 4QOZC 2C5RA 3KOYE 2R62A 1VDDA 2R4EA 5ITYA 3SARA 3FTFA 1IN8A 1G71A 2CV1A 4M9SA 3AOEA 3TWKA 2DXIA 2W82A 1NSFA 2Z4RA 2EUCA 3HU1A 1XMQM 3V76A 3PXGA 1IN7A 2Y0TA 1PJJA 1N32M 4M9XA 2BWBA 1TH3A 2DAMA 2WSFF 4B7HA 4R7GA 3U6EA 3B7ZA 4PDGA 4DR7M 2QENA 4DUZM 2D7HA 2QPAA 3RGSA 3SMPA 2CFOA 3HX3A 4XK8F 5EP3A 4FWDA 2YQZA 1Z5BA 4G3OA 1TR8A 3U6DA 4NRWA 3HJQA 3H4MA 3KW6A 3VFDA 1NHWC 3EIHA 4GRIA 2BNKA 3ZCBB 2WZJA 4JYAM 1NNJA 4G4QA 3A42A 2QP9X 2RKOA 1WHCA 3T1YM 4HEOA 2G5GX 5A2QS 2L2DA 2C9OA 4HL4A 4RNAA 2R65A 3IHPA 4W5WA 5EXPA 3J81S 3GQ3A 2JXNA 2BJWA 2R0IA 3PFIA 2X8AA 3VK7A 4FW9A 1NNUC 1QQWA 2ZTCA 3E4RA 3JR5A 2VDBB 1IY0A 5KO3A 4B3TM 3HGIA 1DGFA 1WJ7A 1XXHB 4UN2B 4BB9A 4L6V6 1WIVA 1NY5A 2KRUA 4MB7A 3VDPA 1H6UA 1NJGA 4Z6YA 3U5ZA 2J5YA 2F5NA 4MM3B 5DNYA 2OPFA 1MJGM 1EFUB 1R6BX 2CWBA 5L8RF 4DV2M 2BWEA 4IJFA 4MGIE 8CATA 3SBJA 2HCBA 2CEAA 3LVVA 5FLXS 3U6QA 2KZSA 2V1UA 3SYLA 3A98B 3CF6E 1DO2A 3HWSA 1ZAEA 1K3XA 4CISA 2C96A 1SG9A 3J80S 4DR2M 2DENA 1EE8A 1TGUA 5ITRA 3GLIB 3SHFA 1OAOC 2LHGA 4P16A 4LGMA 2XH9A 1E9SA 1DGGA 3FE3A 1NV9A 1Y8GA 1PJQA 3J2PB 1YLAA 2DWZB 3FRIA 3KSJA 4RKUF 3U6PA 1JR3E 1JR3D 4KLNA 3SHGB 3B89A 1D0LA 2E5LM 3VKHA 2QNJA 2GQFA 3RGPA 3VDUA 1HT1E 1OAIA 3TWLA 4KODA 3IG5A 3U6LA 2DHRA 2X49A 4REZA 1L2BA 3NBXX 1GL6A 4FWHA 1QAOA 3HJSA 1PJSA 1N34M 3D8LA 1QANA 2K0BX 5EXSA 4ITQA 5ITTA 2L4FA 2LBCA 3C58A 3SATA 3QAUA 4DV6M 1I94M 4F1IA 1C7YA 3U6MA 2XSZD 1E94E 3UZUA 3HJ8A 3I51A 2ZBKB 4FCWA 7CATA 1NV8A 5LMNM 4JI2M 2LHCA 2LTUA 3AOEC 2LH0A 3QWLA 4XBOA 1QDTA 4LJ5A 3U6OA 4NC6A 3GLFA 2YR0A 2OO9A 4GHAA 2ZTDA 3UMMA 4IBFA 3HZJA 4LJ6A 2OOBA 4X65M 2R4JA 4KO8A 2F4VM 3GLHA 5FTNA 3K9OA 5F3WA 4I81A 2UU9M 2DHYA 2R44A 5EJCA 1WXQA 2JNHA 2J7NA 3WHKA 2N35A 4OX9M 3FKEA 3FUVA 1XMOM 3HKPA 4Q7JA 2LXEA 1L8QA 2JY8A 3NBIA 1R2ZA 4G4NA 3NWLA 1OIZA 3DOAA 4IJEA 4LF7M 3D8BA 5ITUA 1HNZM 2QHOB 3L29A 1W5SA 3ZC7B 1VQ1A 3SC3A 1IM2A 4DV1M 5DYGA 5EP4A 3C3EA 2QSFX 2QBYB 4D81A 4OVZA 3Q8GA 2UUAM 4YHHM 3B7QA 1VDLA 5IT9S 1AIPC 1R7RA 1V92A 2K9DA 3SASA 4GH9A 2XGNA 4B7FA 1NJFA 4HLQA 4G4RA 2UUCM 2NQ8C 1IXRC 5KPZA 1Q3CA 3THGA 5ITXE 4DV7M 2Z7JA 4CHTB 2KHHA 1OTRA 2DZLA 4NXMM 2LWXA 2AHMA 5FSWA 3GO8A 3DZDA 1FNNA 2FH0A 3LCVB 4MGHA 4LJ8A 4IBKA 3K1JA 3L28A 3FRHA 4R71A 2L7IA 1XXHE 1D2NA 1YSYA 3GLGB 4DV5M 2ERCA 1Q3BA 1WR1B 3GP1A 2YFQA 2F5OA 5FTLA 4L8RC 4QHTA 1QAQA 2X4AA 1VEJA 3WHLA 5EQTA 1IBKM 4JI3M 1QUTA 4RF0A 2QCUA 4P17A 2GNOA 2JY5A 1UFZA 3J7BA 4LJ4A 4DV0M 3KS8A 1HJPA 4MH0E 4BLCA 3GRVA 2XZFA 4IIWA 3KOXE 4CIZA 4PT5A 4FD2A 2MH8A 1SXJB 5ITXA 3R8FA 1YUBA 1ZMVA 2DWMA 1G8PA 4AKHA 1QVRA 4IBIA 1FJGM 4DR6M 2M5ZA 4PCZA 2KA6B 4LFCM 1ORYB 2DI0A 2DVWB 1XXHA 1TTEA 3BXWA 4L4UA 2DAKA 2M60A 2CRUA 4G6ZA 5KPTA 2R45A 3GLIE 1IFYA 1IXSB 2EKKA 3LVWA 4NOOB 3E21A 3I4YA 3AKZA 3M0EA 3ZH9B 2KW0A 4K0KM 2DAIA 1PJIA 1QDRA 4FVMA 2KRKA 1X37A 3OTOM 2CP8A 3LMMA 1IBLM 1WGLA 4LJAA 5KQDA 4NSOB 4LJ7A 3SAUA 1CUKA 1DO0A 3IG8A 4GMQA 3UGJA 2Z4SA 1V34A 4PDIA 3L26A 1AUAA 5EXXA 1ZV1A 2JY6B 2DZNB 4ANRA 3RFWA 4BBAA 4G4OA 2DWNA 3AJIB 5KQ8A 4NSRA 4AQYM 2L4EA 3SFZA 5FTKA 1NY6A 3TQSA 2MGWA 4IBGA 4GEWA 1GLNA 2K47A 4DR5M 3GLIA 3K8ZA 2KNVA 3M6AA 4GC5A 5EP1A 1LV7A 2DAEA 4M9ZA 2EA0A 4IBJA 1E32A 1TDHA 2LVNC 2KDLA 4B3MM 3GLFE 2HKJA 3JAMS 5DYIA 1R5LA 4B3SM 3KFUG 2RRUA 1PGYA 4I5SA 2XLJA 3SAVA 4XGIA
chains in the Genus database with same CATH topology
3FUTA 4JXJA 4A3VB 3PNVA 4LZZA 4LFAM 4JI4M 1I4WA 2I7PA 3KOZE 2UXBM 2EO2A 2DWLA 3U60B 4FCVA 1Z5CA 4JV5M 5EXTA 1N75A 4AW4A 1DGHB 3GPUA 2XF3A 1GVNA 3GQ5A 1G4AE 3K2LA 3TL4X 2C98A 3M7GA 1Z6TA 5IWAM 4PD2A 3KDSE 2VQEM 5IREB 3KS4A 4WW0A 1QZMA 3ILKA 3U61B 4JI8M 3FTEA 4LY6A 3SMSA 1N33M 1S3SA 3AL0C 1IY2A 4TUWA 1IN6A 3A46A 3MHVC 2C9CA 3A45A 2F5SA 4NRVA 5IZ7D 4GKJM 4DUYM 4LF4M 2R46A 1Z5AA 4AKGA 2F5QA 1K82A 3FYDA 3W0LB 1N77A 3BOSA 1YE9A 3Q8XA 2CUZA 4LF6M 2A5YB 2YNMD 1NHGC 5LMUM 1ZQ9A 4L78A 4NL4H 2QBYA 4JI1M 1XNQM 4KHPM 4JI7M 1L1ZA 1C1KA 2FFJA 1XNRM 3UK6A 3UJNA 3GRRA 3LQRA 1IN4A 1DGBA 4GKKM 2UXCM 5C1BA 2CHVA 4AI6A 5KPRA 5C18A 4LGYA 1NVMA 1IBMM 4AZFA 3E9SA 1L2CA 1HT2E 3KVWA 3FD9A 1XC8A 1PM5A 1HNXM 1L2DA 2ZAOA 2BJVA 5ITQA 3GLGA 3EIEA 3CTWB 5JI3E 4DR4M 3HHWA 4IBDA 5E6JA 4GC9A 4GHLA 3AV0A 2FOIC 1IN5A 1TH4A 4AKIA 4QOSA 4IBCA 3HHYA 4NXNM 3FUXA 1TH2A 4LZJA 1SXJA 2O5RA 4EIWA 3VKGA 4IBEA 1QYRA 1G41A 3DFZA 2XFTA 2Y20A 4RF1A 4I4LA 4LF5M 2CV2A 4M0WA 2DZOB 3CF0A 3GPPA 4AG5A 4JI5M 5FTJA 2R18A 3GRUA 3KXEC 3J27B 5GKNA 4LCBA 2HL7A 3L25A 4MGZE 3DA1A 3FUUA 4QHSA 1MU5A 1Z59A 3KSXA 1HR0M 1OJLA 2XEPA 3GPXA 1K3WA 1HNWM 2ZANA 2VIIA 2G8LA 3MJ5A 3TWMA 4CGYB 2JA2A 3KP1E 2L7HA 3VK8A 3GRYA 4YY3M 3T1HM 1XHBA 3GQ4A 3U5ZB 4LG2A 1N78A 2D7GA 2Y0QA 3FUWA 2RGHA 3PVSA 4R3DA 4S12A 3L27A 2KEBA 4I8OA 1UM8A 5EP2A 1HQYE 3B9PA 2P5TA 3HHZA 2UXDM 4X66M 2RGOA 3T38A 2D7EA 3U6CA 2Y21A 3MK6A 4B3RM 2LNHC 2V6ZM 5BR8M 4DV3M 1G59A 2FNAA 2FE8A 4GIPA 4LJ9A 1R2YA 1HQCA 2QZ4A 3TE6A 4DR1M 4FCTA 2ZM6M 3HHXA 4GITA 4IBBA 2L09A 1TDZA 2J7OA 4D80A 1QAMA 4OU7A 3HU2A 3SAWA 3U60A 1T3TA 2Q2EB 1GL7A 3W0FA 4X62M 1JQJC 4MGYE 1DGHA 1KSFX 4L16A 3L2AA 4LRSA 3GPYA 3AFHA 1OFHA 2CHGA 2V1CA 1Q39A 1GKIA 4II7A 2XFSA 2Z3XA 3R9XB 3U6SA 3FTDA 3I4VA 4B7GA 5E26A 5JI2E 4LFBM 1IXZA 3U61A 3K92A 4JN6A 4OW0A 3VLFB 2OQ4A 3KP0E 3J7AS 2XZUA 2KZUA 4ZPXA 2CE7A 3GLFB 2VQFM 1L1TA 4DV4M 1G3IA 2ZAMA 5H37D 5FTMA 1JR3A 2I7NA 1J09A 3AOGA 3T15A 2F5PA 1IY1A 1W5TA 2C99A 3GLHB 2CHQA 1MX0A 3HU3A 2UUBM 3LQQA 1E9RA 2L6OA 3PNYA 1SXJC 4Z8XA 2KXEA 4L15A 4JI0M 1J7KA 1KFVA 1N36M 4DR3M 2HHHM 4QNMA 3FYCA 4M0DA 3RE8A 3KOWE 5BPVA 3FTCA 1J5EM 3CF2A 2XSZA 1OFIA 3SYKA 4JI6M 2H1RA 4MGKE 1IQPA 1SXJD 1SXJE 4X64M 1KYIA 4B08A 4AG6A 3TPZA 4WURA 2CV0A 1XWIA 4LF9M 4OVZB 4FWGA 3JR4A 4LRTA 4QNRA 4D82A 4QOZC 2C5RA 3KOYE 2R62A 1VDDA 2R4EA 5ITYA 3SARA 3FTFA 1IN8A 2DXIA 2CV1A 4M9SA 3AOEA 3TWKA 2W82A 1NSFA 2Z4RA 2EUCA 3HU1A 1XMQM 3PXGA 1IN7A 2Y0TA 1PJJA 1N32M 4M9XA 4LF8M 1TH3A 4B7HA 4DR7M 3U6EA 4R7GA 4PDGA 2QENA 4DUZM 2D7HA 2QPAA 3RGSA 3SMPA 2CFOA 5EP3A 4FWDA 2YQZA 1Z5BA 3U6DA 4NRWA 3HJQA 3H4MA 3KW6A 3VFDA 1NHWC 3EIHA 4GRIA 2BNKA 3ZCBB 4JYAM 1NNJA 4G4QA 3A42A 2QP9X 2RKOA 3T1YM 2G5GX 5A2QS 4HL4A 2C9OA 4RNAA 2R65A 4W5WA 5EXPA 3J81S 3GQ3A 2BJWA 3VK7A 3PFIA 2X8AA 4FW9A 1QQWA 1NNUC 3E4RA 3JR5A 1IY0A 5KO3A 4B3TM 3HGIA 1DGFA 1XXHB 4BB9A 1NY5A 2KRUA 4MB7A 3VDPA 1H6UA 1NJGA 4Z6YA 3U5ZA 2F5NA 4MM3B 5DNYA 2OPFA 1R6BX 4DV2M 4IJFA 4MGIE 8CATA 3SBJA 2HCBA 2CEAA 3LVVA 5FLXS 3U6QA 2KZSA 2V1UA 3SYLA 3A98B 3CF6E 1DO2A 3HWSA 1ZAEA 1K3XA 4CISA 2C96A 4DR2M 3J80S 1EE8A 1TGUA 5ITRA 3GLIB 3SHFA 4P16A 4LGMA 2XH9A 1E9SA 1DGGA 3J2PB 2DWZB 3KSJA 3U6PA 1JR3D 4KLNA 3SHGB 2E5LM 3VKHA 3RGPA 3VDUA 1HT1E 3TWLA 1L2BA 4KODA 3IG5A 3U6LA 2DHRA 2X49A 4REZA 1GL6A 4FWHA 1QAOA 3HJSA 1N34M 3D8LA 1QANA 5EXSA 4ITQA 5ITTA 3C58A 3SATA 3QAUA 4DV6M 1I94M 3U6MA 2XSZD 1E94E 3UZUA 3HJ8A 3I51A 2ZBKB 4FCWA 7CATA 5LMNM 4JI2M 4XBOA 3AOEC 2LH0A 3QWLA 3U6OA 4LJ5A 3GLFA 2YR0A 4GHAA 3UMMA 4IBFA 4LJ6A 4X65M 2R4JA 4KO8A 2F4VM 3GLHA 5FTNA 5F3WA 4I81A 2UU9M 5EJCA 1WXQA 2J7NA 3WHKA 4OX9M 3FKEA 3FUVA 1XMOM 3HKPA 2LXEA 1L8QA 3NBIA 1R2ZA 4G4NA 3NWLA 3DOAA 4IJEA 4LF7M 3D8BA 5ITUA 1HNZM 3L29A 3ZC7B 1W5SA 3SC3A 1IM2A 4DV1M 5DYGA 5EP4A 2QBYB 4D81A 4OVZA 2UUAM 4YHHM 5IT9S 1R7RA 3SASA 4GH9A 2XGNA 4B7FA 1NJFA 4HLQA 4G4RA 2UUCM 2NQ8C 1IXRC 5KPZA 1Q3CA 3THGA 5ITXE 4DV7M 2Z7JA 4CHTB 4NXMM 2LWXA 2AHMA 5FSWA 3GO8A 3DZDA 1FNNA 4MGHA 4LJ8A 4IBKA 3K1JA 3L28A 2L7IA 1D2NA 1YSYA 3GLGB 4DV5M 2ERCA 1Q3BA 3GP1A 2YFQA 2F5OA 5FTLA 4L8RC 4QHTA 1QAQA 2X4AA 3WHLA 5EQTA 1IBKM 4JI3M 4RF0A 2QCUA 4LJ4A 3J7BA 4DV0M 3KS8A 4MH0E 4BLCA 3GRVA 2XZFA 4IIWA 3KOXE 4PT5A 4FD2A 1SXJB 5ITXA 3R8FA 1YUBA 2DWMA 1G8PA 4AKHA 1QVRA 4IBIA 1FJGM 4DR6M 2M5ZA 4PCZA 2KA6B 4LFCM 1ORYB 2DVWB 1XXHA 4L4UA 2M60A 4G6ZA 5KPTA 2R45A 1IXSB 3LVWA 4NOOB 3I4YA 3AKZA 3M0EA 3ZH9B 2KW0A 4K0KM 1PJIA 4FVMA 2KRKA 1X37A 3OTOM 3LMMA 1IBLM 4LJAA 5KQDA 4NSOB 4LJ7A 3SAUA 1DO0A 3IG8A 4GMQA 3UGJA 2Z4SA 4PDIA 3L26A 5EXXA 2DZNB 3RFWA 4BBAA 4G4OA 2DWNA 3AJIB 5KQ8A 4NSRA 4AQYM 3SFZA 5FTKA 1NY6A 3TQSA 4IBGA 4DR5M 1GLNA 2K47A 3GLIA 3K8ZA 3M6AA 4GC5A 5EP1A 1LV7A 4M9ZA 2EA0A 4IBJA 1E32A 1TDHA 4B3MM 2HKJA 3JAMS 5DYIA 4B3SM 3KFUG 4I5SA 2XLJA 3SAVA 4XGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3W A;  3GPX A;  1N32 M;  1HNW M;  4LF8 M;  2UU9 M;  4DR7 M;  3TWM A;  3U6E A;  4PDG A;  4DUZ M;  4LFA M;  4JI4 M;  3VK8 A;  4OX9 M;  4YY3 M;  2UXB M;  3T1H M;  1XMO M;  3GQ4 A;  1R2Z A;  4G4N A;  3U6D A;  1Z5B A;  1Z5C A;  4JV5 M;  3DOA A;  4NRW A;  4LF7 M;  5ITU A;  1HNZ M;  3GPU A;  2UXD M;  4JYA M;  4DV1 M;  1NNJ A;  4X66 M;  4G4Q A;  3A42 A;  3U6C A;  3T1Y M;  5A2Q S;  3GQ5 A;  2UUA M;  4B3R M;  4YHH M;  5IT9 S;  5IWA M;  5BR8 M;  3J81 S;  4PD2 A;  4DV3 M;  2VQE M;  3SAS A;  3GQ3 A;  3VK7 A;  4JI8 M;  1R2Y A;  4G4R A;  3JR5 A;  2UUC M;  4DR1 M;  4B3T M;  1N33 M;  5ITX E;  4DV7 M;  1Q3C A;  4NXM M;  2ZM6 M;  3A46 A;  3GO8 A;  3A45 A;  2F5S A;  4NRV A;  4GKJ M;  1TDZ A;  4MB7 A;  4DUY M;  4LF4 M;  1Z5A A;  2F5Q A;  4DV5 M;  3SAW A;  1K82 A;  2F5N A;  2OPF A;  2Q2E B;  1Q3B A;  3GP1 A;  3W0F A;  4DV2 M;  2F5O A;  4X62 M;  3SBJ A;  4LF6 M;  1IBK M;  4JI3 M;  5FLX S;  3U6Q A;  3GPY A;  5LMU M;  1XNQ M;  4JI1 M;  1Q39 A;  4DV0 M;  4KHP M;  4JI7 M;  1L1Z A;  2XZF A;  1XNR M;  1K3X A;  3U6S A;  4CIS A;  5ITX A;  4GKK M;  4LFB M;  2UXC M;  4DR2 M;  3J80 S;  1EE8 A;  5ITR A;  1FJG M;  4DR6 M;  2OQ4 A;  4PCZ A;  3J7A S;  4LFC M;  1IBM M;  2XZU A;  2VQF M;  1L1T A;  1L2C A;  4DV4 M;  1XC8 A;  2F4V M;  1PM5 A;  1HNX M;  1L2D A;  3U6P A;  5ITQ A;  4K0K M;  1PJI A;  2F5P A;  2E5L M;  3OTO M;  1MX0 A;  3TWL A;  1L2B A;  3U6L A;  4DR4 M;  2UUB M;  1IBL M;  3SAU A;  4JI0 M;  1N34 M;  1KFV A;  4PDI A;  1N36 M;  4DR3 M;  2HHH M;  4ITQ A;  5ITT A;  3C58 A;  3SAT A;  1J5E M;  4NXN M;  4G4O A;  4DV6 M;  1I94 M;  4JI6 M;  4AQY M;  3U6M A;  4X64 M;  2ZBK B;  4DR5 M;  5LMN M;  4LF5 M;  4JI2 M;  3U6O A;  4LF9 M;  2EA0 A;  3JR4 A;  1TDH A;  3GPP A;  4JI5 M;  4B3M M;  5ITY A;  2HKJ A;  3JAM S;  3SAR A;  3TWK A;  4X65 M;  4B3S M;  1XMQ M;  1MU5 A;  1Z59 A;  1HR0 M;  3SAV A;  1PJJ A; 
#chains in the Genus database with same CATH topology
 1T43 A;  3GLH E;  2HAK A;  3FUT A;  4JXJ A;  4WP2 A;  4A3V B;  3PNV A;  3QYE A;  4LZZ A;  5DFL A;  4LFA M;  4JI4 M;  1I4W A;  2I7P A;  2DNA A;  3KOZ E;  2EO2 A;  3T6P A;  1V33 A;  2UXB M;  1WGN A;  2DWL A;  1Q02 A;  3U60 B;  2HWJ A;  2K6B A;  4FCV A;  2JY7 A;  3BBZ A;  1Z5C A;  4JV5 M;  1VEK A;  5EXT A;  1N75 A;  1F4I A;  4AW4 A;  1DGH B;  3GPU A;  2WSC F;  2XF3 A;  1GVN A;  2JZ1 A;  1GO5 A;  1P3Q Q;  3GQ5 A;  1G4A E;  3K2L A;  3TL4 X;  2C98 A;  3M7G A;  1Z6T A;  2O25 A;  5IWA M;  4PD2 A;  3KDS E;  2VQE M;  5IRE B;  3KS4 A;  4WW0 A;  1QZM A;  3ILK A;  1MN3 A;  3U61 B;  4JI8 M;  1RU3 A;  3FTE A;  4LY6 A;  3SMS A;  1D0M A;  3K9P A;  1S3S A;  3B74 A;  3AL0 C;  1N33 M;  1IY2 A;  2G3Q A;  4TUW A;  1IN6 A;  1QUS A;  3MHV C;  3A46 A;  2C9C A;  3A45 A;  3QYB A;  2F5S A;  2LVA A;  4NRV A;  5IZ7 D;  4GKJ M;  4DUY M;  1ZMU A;  2DKL A;  4LF4 M;  2R46 A;  1Z5A A;  4AKG A;  2F5Q A;  1K82 A;  2FS1 A;  2LVO C;  3FYD A;  2MJ5 B;  4Y28 F;  3W0L B;  1N77 A;  3BOS A;  3GLG E;  1YE9 A;  3Q8X A;  2CUZ A;  2LVQ D;  4LF6 M;  2A5Y B;  2YNM D;  1NHG C;  5LMU M;  1ZQ9 A;  3E46 A;  4NL4 H;  4L78 A;  2QBY A;  4JI1 M;  1XNQ M;  4KHP M;  4JI7 M;  1L1Z A;  1C1K A;  2FFJ A;  1XNR M;  3UK6 A;  3UJN A;  3GRR A;  2APL A;  3LQR A;  1IN4 A;  3CGW A;  1DGB A;  4GKK M;  2UXC M;  5C1B A;  3I04 M;  2CHV A;  4AI6 A;  5KPR A;  5C18 A;  4LGY A;  1NVM A;  2JP7 A;  1IBM M;  4DBG B;  4AZF A;  3E9S A;  1L2C A;  1HT2 E;  3KVW A;  3FD9 A;  1XC8 A;  1PM5 A;  1JB0 F;  3LW5 F;  1HNX M;  1L2D A;  1R4G A;  2ZAO A;  2BJV A;  5ITQ A;  3GLG A;  3EIE A;  3CTW B;  5JI3 E;  1PRB A;  4DR4 M;  3HHW A;  4IBD A;  5E6J A;  4GC9 A;  4GHL A;  3AV0 A;  3W67 A;  1OIP A;  1IN5 A;  2FOI C;  1TH4 A;  2KNA A;  4AKI A;  4QOS A;  3ZQJ A;  4IBC A;  3HHY A;  4NXN M;  3FUX A;  1TH2 A;  4LZJ A;  2KNZ A;  1SXJ A;  2O5R A;  4EIW A;  3VKG A;  4IBE A;  1QYR A;  1G41 A;  1PJT A;  2JWS A;  3DFZ A;  2B3T A;  2XFT A;  2Y20 A;  4RF1 A;  4I4L A;  4LF5 M;  2CV2 A;  4M0W A;  2WSE F;  2DZO B;  4LF8 M;  2EKF A;  3B7N A;  3CF0 A;  3GPP A;  2Z8Y M;  4AG5 A;  4JI5 M;  2LVP C;  5FTJ A;  2EJS A;  2R18 A;  3GRU A;  3KXE C;  1IXS A;  3J27 B;  5GKN A;  4LCB A;  2HL7 A;  3LCU A;  3L25 A;  1A5T A;  4MGZ E;  3DA1 A;  3FUU A;  4QHS A;  1MU5 A;  1Z59 A;  3KSX A;  1HR0 M;  1OJL A;  3HY5 A;  2XEP A;  1LTM A;  3GPX A;  1K3W A;  1HNW M;  2ZAN A;  2R6F A;  2G8L A;  2VII A;  1EIJ A;  3MJ5 A;  3TWM A;  4CGY B;  1D0K A;  2JA2 A;  2H5X A;  3C9P A;  3KP1 E;  2L7H A;  3VK8 A;  3GRY A;  4YY3 M;  3T1H M;  1OKS A;  1XHB A;  3GQ4 A;  3U5Z B;  4LG2 A;  1N78 A;  2MRO B;  2D7G A;  2Y0Q A;  3FUW A;  2RGH A;  3PVS A;  4F2L A;  4R3D A;  4S12 A;  3L27 A;  2KEB A;  1VG5 A;  4I8O A;  1UM8 A;  5EP2 A;  1HQY E;  3B9P A;  2P5T A;  3HHZ A;  4KT0 F;  2UXD M;  1OQY A;  4X66 M;  2RGO A;  1QZE A;  2D7E A;  3T38 A;  3U6C A;  2Y21 A;  3MK6 A;  4B3R M;  2LNH C;  2V6Z M;  5BR8 M;  4DV3 M;  1G59 A;  2FNA A;  2FE8 A;  4GIP A;  4LJ9 A;  1R2Y A;  3F92 A;  1GJT A;  1HQC A;  2QZ4 A;  3H4J A;  2VF7 A;  3TE6 A;  4DR1 M;  4FCT A;  2QQ8 A;  2ZM6 M;  3HHX A;  4GIT A;  1TF0 B;  4IBB A;  2L09 A;  1TDZ A;  2J7O A;  4D80 A;  1QAM A;  4OU7 A;  3HU2 A;  3SAW A;  3U60 A;  1T3T A;  2Q2E B;  1DV0 A;  1GL7 A;  3W0F A;  4X62 M;  1JQJ C;  4MGY E;  1DGH A;  1KSF X;  1GAB A;  4L16 A;  3L2A A;  4LRS A;  3GPY A;  3AFH A;  1OFH A;  2CHG A;  2V1C A;  3I01 M;  1Q39 A;  1GKI A;  4II7 A;  2XFS A;  2Z3X A;  3R9X B;  3U6S A;  2DAG A;  3FTD A;  3I4V A;  2VF8 A;  4B7G A;  5E26 A;  5JI2 E;  4LFB M;  1IXZ A;  3U61 A;  3K92 A;  4JN6 A;  3W68 A;  4OW0 A;  3VLF B;  3IEC A;  2OQ4 A;  3KP0 E;  3J7A S;  2XZU A;  2KZU A;  1T6O A;  2CE7 A;  4ZPX A;  3GLF B;  2VQF M;  1L1T A;  4DV4 M;  1G3I A;  1VEG A;  2ZAM A;  5H37 D;  5FTM A;  1JR3 A;  2I7N A;  1J09 A;  3AOG A;  3T15 A;  2F5P A;  1IY1 A;  1W5T A;  2C99 A;  2JZ0 A;  3GLH B;  2CHQ A;  1MX0 A;  3HU3 A;  2O01 F;  2UUB M;  3LQQ A;  1E9R A;  3MMP A;  2L6O A;  3PNY A;  1SXJ C;  4Z8X A;  2KXE A;  3C3D A;  4L15 A;  4JI0 M;  1J7K A;  1KFV A;  1N36 M;  4DR3 M;  2HHH M;  4QNM A;  3FYC A;  4M0D A;  3RE8 A;  3KOW E;  5BPV A;  3FTC A;  1J5E M;  1ZMW A;  2OOA A;  3CF2 A;  2XSZ A;  1NO1 A;  1OFI A;  3SYK A;  4JI6 M;  1BVS A;  2H1R A;  2MR9 A;  4MGK E;  1IQP A;  1SXJ D;  1SXJ E;  2JUJ A;  4X64 M;  1KYI A;  4B08 A;  4AG6 A;  3TPZ A;  4WUR A;  2CV0 A;  1XWI A;  4LF9 M;  4CJ6 A;  4OVZ B;  4FWG A;  3JR4 A;  4LRT A;  1XB2 B;  4QNR A;  1GJS A;  4D82 A;  4QOZ C;  2C5R A;  3KOY E;  2R62 A;  1VDD A;  2R4E A;  5ITY A;  3SAR A;  3FTF A;  1IN8 A;  1G71 A;  2CV1 A;  4M9S A;  3AOE A;  3TWK A;  2DXI A;  2W82 A;  1NSF A;  2Z4R A;  2EUC A;  3HU1 A;  1XMQ M;  3V76 A;  3PXG A;  1IN7 A;  2Y0T A;  1PJJ A;  1N32 M;  4M9X A;  2BWB A;  1TH3 A;  2DAM A;  2WSF F;  4B7H A;  4R7G A;  3U6E A;  3B7Z A;  4PDG A;  4DR7 M;  2QEN A;  4DUZ M;  2D7H A;  2QPA A;  3RGS A;  3SMP A;  2CFO A;  3HX3 A;  4XK8 F;  5EP3 A;  4FWD A;  2YQZ A;  1Z5B A;  4G3O A;  1TR8 A;  3U6D A;  4NRW A;  3HJQ A;  3H4M A;  3KW6 A;  3VFD A;  1NHW C;  3EIH A;  4GRI A;  2BNK A;  3ZCB B;  2WZJ A;  4JYA M;  1NNJ A;  4G4Q A;  3A42 A;  2QP9 X;  2RKO A;  1WHC A;  3T1Y M;  4HEO A;  2G5G X;  5A2Q S;  2L2D A;  2C9O A;  4HL4 A;  4RNA A;  2R65 A;  3IHP A;  4W5W A;  5EXP A;  3J81 S;  3GQ3 A;  2JXN A;  2BJW A;  2R0I A;  3PFI A;  2X8A A;  3VK7 A;  4FW9 A;  1NNU C;  1QQW A;  2ZTC A;  3E4R A;  3JR5 A;  2VDB B;  1IY0 A;  5KO3 A;  4B3T M;  3HGI A;  1DGF A;  1WJ7 A;  1XXH B;  4UN2 B;  4BB9 A;  4L6V 6;  1WIV A;  1NY5 A;  2KRU A;  4MB7 A;  3VDP A;  1H6U A;  1NJG A;  4Z6Y A;  3U5Z A;  2J5Y A;  2F5N A;  4MM3 B;  5DNY A;  2OPF A;  1MJG M;  1EFU B;  1R6B X;  2CWB A;  5L8R F;  4DV2 M;  2BWE A;  4IJF A;  4MGI E;  8CAT A;  3SBJ A;  2HCB A;  2CEA A;  3LVV A;  5FLX S;  3U6Q A;  2KZS A;  2V1U A;  3SYL A;  3A98 B;  3CF6 E;  1DO2 A;  3HWS A;  1ZAE A;  1K3X A;  4CIS A;  2C96 A;  1SG9 A;  3J80 S;  4DR2 M;  2DEN A;  1EE8 A;  1TGU A;  5ITR A;  3GLI B;  3SHF A;  1OAO C;  2LHG A;  4P16 A;  4LGM A;  2XH9 A;  1E9S A;  1DGG A;  3FE3 A;  1NV9 A;  1Y8G A;  1PJQ A;  3J2P B;  1YLA A;  2DWZ B;  3FRI A;  3KSJ A;  4RKU F;  3U6P A;  1JR3 E;  1JR3 D;  4KLN A;  3SHG B;  3B89 A;  1D0L A;  2E5L M;  3VKH A;  2QNJ A;  2GQF A;  3RGP A;  3VDU A;  1HT1 E;  1OAI A;  3TWL A;  4KOD A;  3IG5 A;  3U6L A;  2DHR A;  2X49 A;  4REZ A;  1L2B A;  3NBX X;  1GL6 A;  4FWH A;  1QAO A;  3HJS A;  1PJS A;  1N34 M;  3D8L A;  1QAN A;  2K0B X;  5EXS A;  4ITQ A;  5ITT A;  2L4F A;  2LBC A;  3C58 A;  3SAT A;  3QAU A;  4DV6 M;  1I94 M;  4F1I A;  1C7Y A;  3U6M A;  2XSZ D;  1E94 E;  3UZU A;  3HJ8 A;  3I51 A;  2ZBK B;  4FCW A;  7CAT A;  1NV8 A;  5LMN M;  4JI2 M;  2LHC A;  2LTU A;  3AOE C;  2LH0 A;  3QWL A;  4XBO A;  1QDT A;  4LJ5 A;  3U6O A;  4NC6 A;  3GLF A;  2YR0 A;  2OO9 A;  4GHA A;  2ZTD A;  3UMM A;  4IBF A;  3HZJ A;  4LJ6 A;  2OOB A;  4X65 M;  2R4J A;  4KO8 A;  2F4V M;  3GLH A;  5FTN A;  3K9O A;  5F3W A;  4I81 A;  2UU9 M;  2DHY A;  2R44 A;  5EJC A;  1WXQ A;  2JNH A;  2J7N A;  3WHK A;  2N35 A;  4OX9 M;  3FKE A;  3FUV A;  1XMO M;  3HKP A;  4Q7J A;  2LXE A;  1L8Q A;  2JY8 A;  3NBI A;  1R2Z A;  4G4N A;  3NWL A;  1OIZ A;  3DOA A;  4IJE A;  4LF7 M;  3D8B A;  5ITU A;  1HNZ M;  2QHO B;  3L29 A;  1W5S A;  3ZC7 B;  1VQ1 A;  3SC3 A;  1IM2 A;  4DV1 M;  5DYG A;  5EP4 A;  3C3E A;  2QSF X;  2QBY B;  4D81 A;  4OVZ A;  3Q8G A;  2UUA M;  4YHH M;  3B7Q A;  1VDL A;  5IT9 S;  1AIP C;  1R7R A;  1V92 A;  2K9D A;  3SAS A;  4GH9 A;  2XGN A;  4B7F A;  1NJF A;  4HLQ A;  4G4R A;  2UUC M;  2NQ8 C;  1IXR C;  5KPZ A;  1Q3C A;  3THG A;  5ITX E;  4DV7 M;  2Z7J A;  4CHT B;  2KHH A;  1OTR A;  2DZL A;  4NXM M;  2LWX A;  2AHM A;  5FSW A;  3GO8 A;  3DZD A;  1FNN A;  2FH0 A;  3LCV B;  4MGH A;  4LJ8 A;  4IBK A;  3K1J A;  3L28 A;  3FRH A;  4R71 A;  2L7I A;  1XXH E;  1D2N A;  1YSY A;  3GLG B;  4DV5 M;  2ERC A;  1Q3B A;  1WR1 B;  3GP1 A;  2YFQ A;  2F5O A;  5FTL A;  4L8R C;  4QHT A;  1QAQ A;  2X4A A;  1VEJ A;  3WHL A;  5EQT A;  1IBK M;  4JI3 M;  1QUT A;  4RF0 A;  2QCU A;  4P17 A;  2GNO A;  2JY5 A;  1UFZ A;  3J7B A;  4LJ4 A;  4DV0 M;  3KS8 A;  1HJP A;  4MH0 E;  4BLC A;  3GRV A;  2XZF A;  4IIW A;  3KOX E;  4CIZ A;  4PT5 A;  4FD2 A;  2MH8 A;  1SXJ B;  5ITX A;  3R8F A;  1YUB A;  1ZMV A;  2DWM A;  1G8P A;  4AKH A;  1QVR A;  4IBI A;  1FJG M;  4DR6 M;  2M5Z A;  4PCZ A;  2KA6 B;  4LFC M;  1ORY B;  2DI0 A;  2DVW B;  1XXH A;  1TTE A;  3BXW A;  4L4U A;  2DAK A;  2M60 A;  2CRU A;  4G6Z A;  5KPT A;  2R45 A;  3GLI E;  1IFY A;  1IXS B;  2EKK A;  3LVW A;  4NOO B;  3E21 A;  3I4Y A;  3AKZ A;  3M0E A;  3ZH9 B;  2KW0 A;  4K0K M;  2DAI A;  1PJI A;  1QDR A;  4FVM A;  2KRK A;  1X37 A;  3OTO M;  2CP8 A;  3LMM A;  1IBL M;  1WGL A;  4LJA A;  5KQD A;  4NSO B;  4LJ7 A;  3SAU A;  1CUK A;  1DO0 A;  3IG8 A;  4GMQ A;  3UGJ A;  2Z4S A;  1V34 A;  4PDI A;  3L26 A;  1AUA A;  5EXX A;  1ZV1 A;  2JY6 B;  2DZN B;  4ANR A;  3RFW A;  4BBA A;  4G4O A;  2DWN A;  3AJI B;  5KQ8 A;  4NSR A;  4AQY M;  2L4E A;  3SFZ A;  5FTK A;  1NY6 A;  3TQS A;  2MGW A;  4IBG A;  4GEW A;  1GLN A;  2K47 A;  4DR5 M;  3GLI A;  3K8Z A;  2KNV A;  3M6A A;  4GC5 A;  5EP1 A;  1LV7 A;  2DAE A;  4M9Z A;  2EA0 A;  4IBJ A;  1E32 A;  1TDH A;  2LVN C;  2KDL A;  4B3M M;  3GLF E;  2HKJ A;  3JAM S;  5DYI A;  1R5L A;  4B3S M;  3KFU G;  2RRU A;  1PGY A;  4I5S A;  2XLJ A;  3SAV A;  4XGI A; 
#chains in the Genus database with same CATH homology
 3FUT A;  4JXJ A;  4A3V B;  3PNV A;  4LZZ A;  4LFA M;  4JI4 M;  1I4W A;  2I7P A;  3KOZ E;  2UXB M;  2EO2 A;  2DWL A;  3U60 B;  4FCV A;  1Z5C A;  4JV5 M;  5EXT A;  1N75 A;  4AW4 A;  1DGH B;  3GPU A;  2XF3 A;  1GVN A;  3GQ5 A;  1G4A E;  3K2L A;  3TL4 X;  2C98 A;  3M7G A;  1Z6T A;  5IWA M;  4PD2 A;  3KDS E;  2VQE M;  5IRE B;  3KS4 A;  4WW0 A;  1QZM A;  3ILK A;  3U61 B;  4JI8 M;  3FTE A;  4LY6 A;  3SMS A;  1N33 M;  1S3S A;  3AL0 C;  1IY2 A;  4TUW A;  1IN6 A;  3A46 A;  3MHV C;  2C9C A;  3A45 A;  2F5S A;  4NRV A;  5IZ7 D;  4GKJ M;  4DUY M;  4LF4 M;  2R46 A;  1Z5A A;  4AKG A;  2F5Q A;  1K82 A;  3FYD A;  3W0L B;  1N77 A;  3BOS A;  1YE9 A;  3Q8X A;  2CUZ A;  4LF6 M;  2A5Y B;  2YNM D;  1NHG C;  5LMU M;  1ZQ9 A;  4L78 A;  4NL4 H;  2QBY A;  4JI1 M;  1XNQ M;  4KHP M;  4JI7 M;  1L1Z A;  1C1K A;  2FFJ A;  1XNR M;  3UK6 A;  3UJN A;  3GRR A;  3LQR A;  1IN4 A;  1DGB A;  4GKK M;  2UXC M;  5C1B A;  2CHV A;  4AI6 A;  5KPR A;  5C18 A;  4LGY A;  1NVM A;  1IBM M;  4AZF A;  3E9S A;  1L2C A;  1HT2 E;  3KVW A;  3FD9 A;  1XC8 A;  1PM5 A;  1HNX M;  1L2D A;  2ZAO A;  2BJV A;  5ITQ A;  3GLG A;  3EIE A;  3CTW B;  5JI3 E;  4DR4 M;  3HHW A;  4IBD A;  5E6J A;  4GC9 A;  4GHL A;  3AV0 A;  2FOI C;  1IN5 A;  1TH4 A;  4AKI A;  4QOS A;  4IBC A;  3HHY A;  4NXN M;  3FUX A;  1TH2 A;  4LZJ A;  1SXJ A;  2O5R A;  4EIW A;  3VKG A;  4IBE A;  1QYR A;  1G41 A;  3DFZ A;  2XFT A;  2Y20 A;  4RF1 A;  4I4L A;  4LF5 M;  2CV2 A;  4M0W A;  2DZO B;  3CF0 A;  3GPP A;  4AG5 A;  4JI5 M;  5FTJ A;  2R18 A;  3GRU A;  3KXE C;  3J27 B;  5GKN A;  4LCB A;  2HL7 A;  3L25 A;  4MGZ E;  3DA1 A;  3FUU A;  4QHS A;  1MU5 A;  1Z59 A;  3KSX A;  1HR0 M;  1OJL A;  2XEP A;  3GPX A;  1K3W A;  1HNW M;  2ZAN A;  2VII A;  2G8L A;  3MJ5 A;  3TWM A;  4CGY B;  2JA2 A;  3KP1 E;  2L7H A;  3VK8 A;  3GRY A;  4YY3 M;  3T1H M;  1XHB A;  3GQ4 A;  3U5Z B;  4LG2 A;  1N78 A;  2D7G A;  2Y0Q A;  3FUW A;  2RGH A;  3PVS A;  4R3D A;  4S12 A;  3L27 A;  2KEB A;  4I8O A;  1UM8 A;  5EP2 A;  1HQY E;  3B9P A;  2P5T A;  3HHZ A;  2UXD M;  4X66 M;  2RGO A;  3T38 A;  2D7E A;  3U6C A;  2Y21 A;  3MK6 A;  4B3R M;  2LNH C;  2V6Z M;  5BR8 M;  4DV3 M;  1G59 A;  2FNA A;  2FE8 A;  4GIP A;  4LJ9 A;  1R2Y A;  1HQC A;  2QZ4 A;  3TE6 A;  4DR1 M;  4FCT A;  2ZM6 M;  3HHX A;  4GIT A;  4IBB A;  2L09 A;  1TDZ A;  2J7O A;  4D80 A;  1QAM A;  4OU7 A;  3HU2 A;  3SAW A;  3U60 A;  1T3T A;  2Q2E B;  1GL7 A;  3W0F A;  4X62 M;  1JQJ C;  4MGY E;  1DGH A;  1KSF X;  4L16 A;  3L2A A;  4LRS A;  3GPY A;  3AFH A;  1OFH A;  2CHG A;  2V1C A;  1Q39 A;  1GKI A;  4II7 A;  2XFS A;  2Z3X A;  3R9X B;  3U6S A;  3FTD A;  3I4V A;  4B7G A;  5E26 A;  5JI2 E;  4LFB M;  1IXZ A;  3U61 A;  3K92 A;  4JN6 A;  4OW0 A;  3VLF B;  2OQ4 A;  3KP0 E;  3J7A S;  2XZU A;  2KZU A;  4ZPX A;  2CE7 A;  3GLF B;  2VQF M;  1L1T A;  4DV4 M;  1G3I A;  2ZAM A;  5H37 D;  5FTM A;  1JR3 A;  2I7N A;  1J09 A;  3AOG A;  3T15 A;  2F5P A;  1IY1 A;  1W5T A;  2C99 A;  3GLH B;  2CHQ A;  1MX0 A;  3HU3 A;  2UUB M;  3LQQ A;  1E9R A;  2L6O A;  3PNY A;  1SXJ C;  4Z8X A;  2KXE A;  4L15 A;  4JI0 M;  1J7K A;  1KFV A;  1N36 M;  4DR3 M;  2HHH M;  4QNM A;  3FYC A;  4M0D A;  3RE8 A;  3KOW E;  5BPV A;  3FTC A;  1J5E M;  3CF2 A;  2XSZ A;  1OFI A;  3SYK A;  4JI6 M;  2H1R A;  4MGK E;  1IQP A;  1SXJ D;  1SXJ E;  4X64 M;  1KYI A;  4B08 A;  4AG6 A;  3TPZ A;  4WUR A;  2CV0 A;  1XWI A;  4LF9 M;  4OVZ B;  4FWG A;  3JR4 A;  4LRT A;  4QNR A;  4D82 A;  4QOZ C;  2C5R A;  3KOY E;  2R62 A;  1VDD A;  2R4E A;  5ITY A;  3SAR A;  3FTF A;  1IN8 A;  2DXI A;  2CV1 A;  4M9S A;  3AOE A;  3TWK A;  2W82 A;  1NSF A;  2Z4R A;  2EUC A;  3HU1 A;  1XMQ M;  3PXG A;  1IN7 A;  2Y0T A;  1PJJ A;  1N32 M;  4M9X A;  4LF8 M;  1TH3 A;  4B7H A;  4DR7 M;  3U6E A;  4R7G A;  4PDG A;  2QEN A;  4DUZ M;  2D7H A;  2QPA A;  3RGS A;  3SMP A;  2CFO A;  5EP3 A;  4FWD A;  2YQZ A;  1Z5B A;  3U6D A;  4NRW A;  3HJQ A;  3H4M A;  3KW6 A;  3VFD A;  1NHW C;  3EIH A;  4GRI A;  2BNK A;  3ZCB B;  4JYA M;  1NNJ A;  4G4Q A;  3A42 A;  2QP9 X;  2RKO A;  3T1Y M;  2G5G X;  5A2Q S;  4HL4 A;  2C9O A;  4RNA A;  2R65 A;  4W5W A;  5EXP A;  3J81 S;  3GQ3 A;  2BJW A;  3VK7 A;  3PFI A;  2X8A A;  4FW9 A;  1QQW A;  1NNU C;  3E4R A;  3JR5 A;  1IY0 A;  5KO3 A;  4B3T M;  3HGI A;  1DGF A;  1XXH B;  4BB9 A;  1NY5 A;  2KRU A;  4MB7 A;  3VDP A;  1H6U A;  1NJG A;  4Z6Y A;  3U5Z A;  2F5N A;  4MM3 B;  5DNY A;  2OPF A;  1R6B X;  4DV2 M;  4IJF A;  4MGI E;  8CAT A;  3SBJ A;  2HCB A;  2CEA A;  3LVV A;  5FLX S;  3U6Q A;  2KZS A;  2V1U A;  3SYL A;  3A98 B;  3CF6 E;  1DO2 A;  3HWS A;  1ZAE A;  1K3X A;  4CIS A;  2C96 A;  4DR2 M;  3J80 S;  1EE8 A;  1TGU A;  5ITR A;  3GLI B;  3SHF A;  4P16 A;  4LGM A;  2XH9 A;  1E9S A;  1DGG A;  3J2P B;  2DWZ B;  3KSJ A;  3U6P A;  1JR3 D;  4KLN A;  3SHG B;  2E5L M;  3VKH A;  3RGP A;  3VDU A;  1HT1 E;  3TWL A;  1L2B A;  4KOD A;  3IG5 A;  3U6L A;  2DHR A;  2X49 A;  4REZ A;  1GL6 A;  4FWH A;  1QAO A;  3HJS A;  1N34 M;  3D8L A;  1QAN A;  5EXS A;  4ITQ A;  5ITT A;  3C58 A;  3SAT A;  3QAU A;  4DV6 M;  1I94 M;  3U6M A;  2XSZ D;  1E94 E;  3UZU A;  3HJ8 A;  3I51 A;  2ZBK B;  4FCW A;  7CAT A;  5LMN M;  4JI2 M;  4XBO A;  3AOE C;  2LH0 A;  3QWL A;  3U6O A;  4LJ5 A;  3GLF A;  2YR0 A;  4GHA A;  3UMM A;  4IBF A;  4LJ6 A;  4X65 M;  2R4J A;  4KO8 A;  2F4V M;  3GLH A;  5FTN A;  5F3W A;  4I81 A;  2UU9 M;  5EJC A;  1WXQ A;  2J7N A;  3WHK A;  4OX9 M;  3FKE A;  3FUV A;  1XMO M;  3HKP A;  2LXE A;  1L8Q A;  3NBI A;  1R2Z A;  4G4N A;  3NWL A;  3DOA A;  4IJE A;  4LF7 M;  3D8B A;  5ITU A;  1HNZ M;  3L29 A;  3ZC7 B;  1W5S A;  3SC3 A;  1IM2 A;  4DV1 M;  5DYG A;  5EP4 A;  2QBY B;  4D81 A;  4OVZ A;  2UUA M;  4YHH M;  5IT9 S;  1R7R A;  3SAS A;  4GH9 A;  2XGN A;  4B7F A;  1NJF A;  4HLQ A;  4G4R A;  2UUC M;  2NQ8 C;  1IXR C;  5KPZ A;  1Q3C A;  3THG A;  5ITX E;  4DV7 M;  2Z7J A;  4CHT B;  4NXM M;  2LWX A;  2AHM A;  5FSW A;  3GO8 A;  3DZD A;  1FNN A;  4MGH A;  4LJ8 A;  4IBK A;  3K1J A;  3L28 A;  2L7I A;  1D2N A;  1YSY A;  3GLG B;  4DV5 M;  2ERC A;  1Q3B A;  3GP1 A;  2YFQ A;  2F5O A;  5FTL A;  4L8R C;  4QHT A;  1QAQ A;  2X4A A;  3WHL A;  5EQT A;  1IBK M;  4JI3 M;  4RF0 A;  2QCU A;  4LJ4 A;  3J7B A;  4DV0 M;  3KS8 A;  4MH0 E;  4BLC A;  3GRV A;  2XZF A;  4IIW A;  3KOX E;  4PT5 A;  4FD2 A;  1SXJ B;  5ITX A;  3R8F A;  1YUB A;  2DWM A;  1G8P A;  4AKH A;  1QVR A;  4IBI A;  1FJG M;  4DR6 M;  2M5Z A;  4PCZ A;  2KA6 B;  4LFC M;  1ORY B;  2DVW B;  1XXH A;  4L4U A;  2M60 A;  4G6Z A;  5KPT A;  2R45 A;  1IXS B;  3LVW A;  4NOO B;  3I4Y A;  3AKZ A;  3M0E A;  3ZH9 B;  2KW0 A;  4K0K M;  1PJI A;  4FVM A;  2KRK A;  1X37 A;  3OTO M;  3LMM A;  1IBL M;  4LJA A;  5KQD A;  4NSO B;  4LJ7 A;  3SAU A;  1DO0 A;  3IG8 A;  4GMQ A;  3UGJ A;  2Z4S A;  4PDI A;  3L26 A;  5EXX A;  2DZN B;  3RFW A;  4BBA A;  4G4O A;  2DWN A;  3AJI B;  5KQ8 A;  4NSR A;  4AQY M;  3SFZ A;  5FTK A;  1NY6 A;  3TQS A;  4IBG A;  4DR5 M;  1GLN A;  2K47 A;  3GLI A;  3K8Z A;  3M6A A;  4GC5 A;  5EP1 A;  1LV7 A;  4M9Z A;  2EA0 A;  4IBJ A;  1E32 A;  1TDH A;  4B3M M;  2HKJ A;  3JAM S;  5DYI A;  4B3S M;  3KFU G;  4I5S A;  2XLJ A;  3SAV A;  4XGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...