4JI6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji6M02
1Q3CA 4DUYM 2XZUA 4DR4M 4B3TM 3TWLA 3U6QA 1PJJA 4CISA 4DV1M 4DV7M 2F5QA 3U6SA 3VK8A 4LF8M 5LMNM 3A42A 2XZFA 5IWAM 1XMOM 2E5LM 4JYAM 1IBLM 3GQ5A 3T1HM 4LF4M 4AQYM 3W0FA 1HNZM 4G4OA 4JI1M 4DR2M 3GO8A 1XMQM 1IBMM 4JI3M 4JI2M 3GQ4A 2UUAM 3A45A 3GQ3A 4X64M 2EA0A 1TDZA 4LF9M 4DR6M 1N33M 4X62M 1N36M 3SBJA 2ZM6M 4JI0M 3C58A 4JI5M 4G4NA 3SARA 4JI7M 4NXNM 4DR3M 1K3XA 4DR5M 1HNXM 2ZBKB 3U6MA 1TDHA 3SAVA 4NXMM 1HR0M 1J5EM 2OPFA 2UXBM 3U6CA 3OTOM 1I94M 4PDIA 1L1ZA 3JR4A 4OX9M 4DUZM 3T1YM 1K82A 4JV5M 3U6LA 1Z5AA 1MU5A 5BR8M 1L1TA 4LF6M 1MX0A 4LFBM 3SATA 4G4QA 4JI4M 4DR7M 4G4RA 3GPPA 5ITRA 2VQFM 4B3RM 1NNJA 5ITXA 4LFCM 4B3MM 1L2BA 2Q2EB 2UUBM 2F5SA 1Z5CA 2HHHM 1Q39A 4YY3M 4PD2A 1L2CA 4X65M 3U6EA 1Z5BA 4DV5M 4GKKM 5A2QS 4GKJM 3GPXA 4NRVA 4X66M 4LF5M 4MB7A 3JR5A 3U6DA 1XNRM 5ITXE 2HKJA 2F5OA 1HNWM 5ITQA 4ITQA 3SAUA 1Q3BA 3J81S 2F4VM 4JI6M 5IT9S 3A46A 1K3WA 2UU9M 3DOAA 1FJGM 3J80S 4B3SM 1R2YA 5ITUA 3U6OA 1KFVA 3VK7A 1N34M 1IBKM 3TWMA 3GP1A 5FLXS 1PJIA 5ITTA 4KHPM 4LFAM 1R2ZA 4DV2M 4YHHM 4DV3M 4PDGA 1PM5A 4DV6M 4K0KM 2F5PA 3JAMS 4DV0M 2VQEM 4LF7M 1L2DA 1XC8A 3SASA 1N32M 3TWKA 2UXDM 3SAWA 5LMUM 4JI8M 3U6PA 3J7AS 1XNQM 2F5NA 2UXCM 3GPYA 1Z59A 1EE8A 2OQ4A 4DV4M 4PCZA 2UUCM 4DR1M 4NRWA 5ITYA 3GPUA
chains in the Genus database with same CATH superfamily
4UN2B 2M60A 2KRKA 3SHFA 2RKOA 3BXWA 2XEPA 4HL4A 2CWBA 1GL7A 2CRUA 2K9DA 2L6OA 2DXIA 3U6SA 1NY6A 4FCWA 1UM8A 3FE3A 3VK8A 2BWBA 3VKGA 2J7NA 1R7RA 1N78A 1XMOM 2XF3A 4WURA 3T1HM 4NC6A 1VEJA 3LMMA 1QDTA 1HNZM 3SYKA 3SYLA 2YQZA 4PT5A 1IY1A 3AV0A 3W67A 3Q8GA 2B3TA 3AJIB 4X64M 2EA0A 2D7EA 3PNYA 1X37A 2CHVA 3CF0A 1XXHB 4X62M 2JP7A 5KQ8A 1D0MA 2W82A 1QVRA 2KEBA 3DA1A 4JI7M 1S3SA 4NXNM 3CGWA 2HCBA 2MJ5B 1DGGA 4B08A 1VEGA 4F2LA 2JY6B 2VF7A 1HNXM 4FCVA 4NXMM 1XWIA 1Z6TA 5FTKA 4OU7A 2EUCA 3KDSE 1JB0F 5KO3A 2R0IA 3JR4A 4Z8XA 5C18A 4JV5M 3B7NA 1QANA 1Z5AA 4QOSA 2QBYA 2JA2A 1IN4A 2XSZD 3C3EA 1IN7A 4FWGA 4AKIA 1MX0A 1D0KA 2DAGA 4G4QA 4JI4M 4KODA 3GPPA 4D82A 4G4RA 2MGWA 4RNAA 2UUBM 2Q2EB 4GHAA 4L6V6 1Z5CA 1QAQA 4D81A 4OVZA 4YY3M 2R4JA 5DYGA 3MJ5A 4PD2A 1L2CA 2O25A 3AFHA 1QAOA 2L7HA 4AKHA 4DV5M 5KPTA 2CEAA 4GKJM 4B7HA 3GLGA 2R45A 1EIJA 4R7GA 1P3QQ 1QUSA 4MB7A 3U6DA 1V34A 2DWLA 3KOZE 2AHMA 4LRTA 4XBOA 5ITQA 3EIEA 3ILKA 3SAUA 3UK6A 4MGKE 4QNRA 3E21A 5EP4A 3C3DA 3KP1E 5FTMA 4R3DA 3QYEA 2UU9M 5IZ7D 2Z7JA 2DHRA 3FUVA 1FJGM 2DAEA 3W0LB 4KLNA 1ZAEA 3GLGE 3VK7A 3HHXA 3E46A 5EJCA 4LJ8A 3QYBA 3KOYE 2LBCA 2MROB 2R46A 4JN6A 3HHYA 4GITA 4WW0A 1J09A 2DAMA 3RE8A 1IQPA 4K0KM 3JAMS 1R6BX 1G3IA 3HJQA 3J2PB 3K2LA 1XC8A 2RGHA 4LJ9A 1OKSA 4II7A 3SAWA 1PJQA 3I01M 4IBFA 1AUAA 1DGHB 1N77A 4JXJA 3J7AS 4IBJA 1GJSA 3HU2A 1SXJA 3M7GA 3FD9A 3B74A 4DV4M 1TTEA 4XGIA 2UUCM 4DR1M 2JY8A 1JR3A 5BPVA 3W68A 1NHGC 2DNAA 2K47A 1Q3CA 4DUYM 2XZUA 3LW5F 4GC9A 4QHSA 4LGMA 3I4YA 3TWLA 3U6QA 1QUTA 4AG6A 5EQTA 4CISA 4DV1M 5E26A 1C7YA 2F5QA 3PXGA 4R71A 4D80A 2DZNB 2R4EA 5H37D 2XZFA 4FWHA 1SXJE 4MH0E 2E5LM 1IBLM 2L4EA 4CHTB 1JR3E 2VIIA 4L8RC 2FFJA 4G4OA 2V6ZM 2QP9X 3SHGB 3UJNA 1PRBA 4LJ7A 1WXQA 1IN8A 1DGHA 1NO1A 3GO8A 3KSJA 4DR2M 4DR6M 4LF9M 4LJ4A 4A3VB 3KFUG 1RU3A 3GRVA 1LV7A 1SXJC 1N36M 3SBJA 1ZQ9A 2ZAOA 3HY5A 4IIWA 2DI0A 3C58A 4JI5M 4FVMA 1NJGA 2KZSA 2LXEA 1SG9A 4P17A 2KRUA 4LJ6A 3A98B 2ZBKB 2ZTCA 1HR0M 4M9XA 4OW0A 2L09A 1ZMVA 2UXBM 1OFIA 1OQYA 1ZMWA 3KP0E 3D8BA 3L29A 3U6CA 2JNHA 3OTOM 1I94M 4LCBA 3VDUA 2LNHC 1VDLA 1TH2A 4NOOB 5EP3A 2LTUA 2R18A 3U6LA 3B89A 3E9SA 4CIZA 2QBYB 3SMPA 1IN5A 5KQDA 1UFZA 2OOBA 4LG2A 5FTNA 2KNAA 3HJ8A 3T38A 2A5YB 1QDRA 4AZFA 3SATA 5ITRA 2DVWB 1PJTA 3QAUA 4IBBA 4Y28F 3U60A 2VF8A 3HWSA 5ITXA 2LVOC 3SC3A 2QCUA 2KW0A 2OOAA 2WZJA 2JXNA 3GRRA 4B7GA 4L78A 3FUXA 1L8QA 2Y21A 4OVZB 4ANRA 5FSWA 1W5SA 2V1CA 2GNOA 3BBZA 1E32A 3GLHA 1HQCA 4QHTA 4GIPA 2XSZA 4IJEA 1G71A 2O5RA 3GLFA 3GLGB 4NRVA 3TPZA 1IM2A 4LF5M 2QQ8A 2YNMD 3JR5A 2XFTA 2KA6B 5ITXE 2HKJA 2QHOB 2F5OA 3B7QA 4I8OA 3KXEC 1IY0A 1GVNA 1QAMA 3L2AA 4QNMA 2C5RA 4FD2A 4ITQA 4DBGB 4KO8A 2H1RA 3BOSA 1PGYA 1NY5A 2J7OA 2XH9A 2CP8A 5IT9S 3GLHE 4L15A 2DKLA 2WSCF 2Z8YM 3U6OA 3GLFE 2BJVA 1DV0A 1QZEA 3PNVA 1N34M 4GMQA 3CF6E 3TWMA 3GP1A 2EO2A 3WHLA 2G8LA 1R2ZA 1WGNA 4G3OA 4DV3M 2C9CA 4L4UA 1PM5A 1WIVA 1T3TA 4WP2A 1F4IA 1KYIA 3AOEA 3TWKA 2FS1A 1GKIA 5LMUM 3FUUA 4JI8M 2JZ1A 4P16A 4Z6YA 2CHQA 2DWMA 4HEOA 1JQJC 5JI2E 3T6PA 1Z59A 3HX3A 1SXJB 2HL7A 1QZMA 2OQ4A 4PCZA 1HJPA 3LQQA 1IXZA 4LZZA 4MGHA 4XK8F 5ITYA 1K3XA 3FTEA 4LGYA 3CF2A 3U5ZB 2EKKA 3K92A 4M0WA 3THGA 2YFQA 3ZC7B 4CJ6A 4FW9A 2L7IA 3LVWA 3K9PA 4LF8M 4BB9A 2CV1A 1VEKA 3VKHA 1DO0A 5LMNM 3A42A 5IWAM 1W5TA 3F92A 3HGIA 3Q8XA 1V33A 2R44A 3FYCA 3KS4A 2JY7A 4IJFA 3AOEC 1OAIA 3MK6A 5GKNA 1XMQM 2GQFA 2JZ0A 4M0DA 2KDLA 3GQ4A 2UUAM 3GQ3A 1E94E 4MGZE 1TDZA 3AL0C 2KHHA 1HQYE 4MGIE 1N33M 5EP2A 1D2NA 2L4FA 1CUKA 4GC5A 5C1BA 2CFOA 3NWLA 3HHWA 2R65A 3TE6A 2LWXA 1R4GA 3U5ZA 1EFUB 1R5LA 2JUJA 3I4VA 2D7GA 4FWDA 1TF0B 1OTRA 1OIZA 1TDHA 3UGJA 2QZ4A 5DNYA 3U6MA 2KXEA 1J5EM 4M9SA 2Z3XA 4AI6A 3RGSA 4PDIA 1Y8GA 2DZLA 8CATA 1NSFA 2XGNA 2KNVA 4OX9M 4DUZM 4I81A 3ZH9B 1NVMA 3KSXA 4RF0A 3M0EA 4QOZC 3KOWE 1XB2B 3ZQJA 4LY6A 1V92A 1MU5A 4LZJA 5BR8M 2M5ZA 4LF6M 2NQ8C 3U61A 4DR7M 2DZOB 2EKFA 2VQFM 2G3QA 3U60B 4B3RM 4B3MM 3EIHA 1L2BA 2LVNC 2D7HA 2DHYA 3DFZA 1NHWC 2HHHM 4IBCA 2FE8A 2G5GX 3GRUA 2MR9A 3NBXX 2HAKA 4REZA 4S12A 3PFIA 3U6EA 1QQWA 3GLHB 2X8AA 2EJSA 4Q7JA 5EXXA 1YLAA 2XLJA 3GLFB 4GHLA 5A2QS 1G8PA 3GPXA 3H4MA 4X66M 2Z4SA 3I04M 1OAOC 2Y20A 1LTMA 1XNRM 3LVVA 2CV0A 3TQSA 4CGYB 2R6FA 1HNWM 2QPAA 5KPZA 3H4JA 3LCUA 3TL4X 5DFLA 1Q3BA 3L25A 3FYDA 3QWLA 2RRUA 3J81S 3FTCA 3KVWA 3KOXE 2F4VM 1IXSA 1WR1B 3A46A 1K3WA 1E9SA 2DWZB 3DOAA 3J80S 1KFVA 1D0LA 2K6BA 4HLQA 4NSOB 4M9ZA 1G4AE 1IBKM 3IECA 2Z4RA 3C9PA 2LVPC 4LJAA 1OIPA 5FLXS 1PJIA 4LFAM 4B7FA 3T15A 3GLIA 4YHHM 3PVSA 4DV6M 1VDDA 2F5PA 1A5TA 4DV0M 4RF1A 2VQEM 4LF7M 1L2DA 1WJ7A 3LCVB 3HKPA 3U6PA 5E6JA 1TGUA 2C9OA 2F5NA 2LHCA 4GRIA 1WHCA 2R62A 1DGFA 3IG8A 5F3WA 3GPYA 4NL4H 1EE8A 2L2DA 3HU1A 2N35A 1T6OA 1XNQM 3K1JA 2O01F 2OO9A 3VFDA 3GLIE 3B9PA 4IBDA 4DR4M 3HJSA 1I4WA 2KZUA 2CUZA 4ZPXA 1E9RA 2C99A 4G6ZA 4BLCA 4B3TM 1PJJA 4I5SA 3L27A 4F1IA 3WHKA 5DYIA 4DV7M 1YUBA 2WSEF 2ZAMA 3HHZA 1GABA 1KSFX 1IXRC 2BWEA 2V1UA 2QENA 1DO2A 4EIWA 2ZANA 3DZDA 3UMMA 2C96A 4JYAM 2WSFF 3KW6A 3GQ5A 4LF4M 2DENA 3LQRA 2LH0A 4AQYM 3W0FA 3VDPA 3FRIA 1GL6A 3V76A 4JI1M 2QNJA 1NV9A 3E4RA 3K8ZA 1IBMM 4JI3M 4JI2M 3A45A 2APLA 2J5YA 2BJWA 3L28A 2H5XA 2Y0TA 1XXHA 4GEWA 4IBGA 1ORYB 5KPRA 1FNNA 2LHGA 3IHPA 2ZM6M 4JI0M 4G4NA 4W5WA 3L26A 3SARA 3MMPA 1H6UA 4IBEA 3FTDA 4DR3M 4IBIA 1T43A 4DR5M 2XFSA 4GH9A 1IFYA 1OFHA 1ZV1A 2QSFX 3SAVA 5FTJA 2OPFA 2CHGA 2HWJA 1NV8A 1OJLA 3FTFA 2ERCA 1MN3A 1IY2A 1HT1E 4AW4A 2KNZA 3R8FA 1L1ZA 4IBKA 3VLFB 1MJGM 1QYRA 1XXHE 3T1YM 1K82A 3K9OA 3B7ZA 2BNKA 2FH0A 5L8RF 2JWSA 4RKUF 2DWNA 1L1TA 4LFBM 1BVSA 2JY5A 1VQ1A 3U61B 3GRYA 5IREB 1HT2E 1NNJA 3I51A 1TR8A 3FUWA 3AKZA 4LFCM 2X4AA 5JI3E 4NSRA 2X49A 2CV2A 5EP1A 1TH4A 4LRSA 2F5SA 5EXPA 2LVAA 1Q39A 1PJSA 5EXSA 1NNUC 2LVQD 3KS8A 3MHVC 3R9XB 4X65M 7CATA 5FTLA 1GO5A 4MGYE 1NJFA 1WGLA 1YSYA 1Z5BA 3SMSA 4GKKM 1DGBA 2MH8A 2VDBB 2C98A 1GLNA 3SFZA 4MM3B 3NBIA 1N75A 3AOGA 3RFWA 2I7NA 3RGPA 2YR0A 4I4LA 4LJ5A 3HZJA 2ZTDA 1ZMUA 1IXSB 4JI6M 3HU3A 3CTWB 2DAIA 4B3SM 2K0BX 1R2YA 5ITUA 1G41A 2FNAA 3IG5A 2CE7A 4KT0F 1SXJD 3J27B 3FKEA 2DAKA 3FRHA 1VG5A 1GJTA 1JR3D 2Y0QA 4AKGA 1AIPC 1XHBA 5ITTA 3GLIB 4KHPM 4DV2M 1IN6A 4PDGA 2I7PA 3D8LA 1C1KA 2RGOA 1Q02A 4TUWA 3SASA 1N32M 4BBAA 3J7BA 2UXDM 1J7KA 3UZUA 4FCTA 1G59A 2FOIC 2UXCM 1YE9A 3ZCBB 1TH3A 3M6AA 3FUTA 4AG5A 5EXTA 4NRWA 2P5TA 4L16A 3GPUA
chains in the Genus database with same CATH topology
2M60A 2KRKA 3SHFA 2RKOA 2XEPA 4HL4A 2DXIA 1GL7A 2L6OA 3U6SA 1NY6A 4FCWA 1UM8A 3VK8A 3VKGA 2J7NA 1R7RA 1N78A 1XMOM 2XF3A 4WURA 3T1HM 3LMMA 1HNZM 3SYKA 3SYLA 2YQZA 4PT5A 1IY1A 3AV0A 3AJIB 4X64M 2EA0A 2D7EA 3PNYA 1X37A 2CHVA 3CF0A 1XXHB 4X62M 5KQ8A 2W82A 1QVRA 2KEBA 3DA1A 4JI7M 1S3SA 4NXNM 2HCBA 1DGGA 4B08A 1HNXM 4FCVA 4NXMM 1XWIA 1Z6TA 5FTKA 4OU7A 2EUCA 3KDSE 5KO3A 3JR4A 4Z8XA 5C18A 4JV5M 1QANA 1Z5AA 4QOSA 2QBYA 2JA2A 1IN4A 2XSZD 1IN7A 4FWGA 4AKIA 1MX0A 4G4QA 4JI4M 4KODA 3GPPA 4D82A 4G4RA 4RNAA 2UUBM 2Q2EB 4GHAA 1Z5CA 1QAQA 4D81A 4OVZA 4YY3M 2R4JA 5DYGA 3MJ5A 4PD2A 1L2CA 3AFHA 1QAOA 2L7HA 4AKHA 4DV5M 5KPTA 2CEAA 4GKJM 4B7HA 3GLGA 2R45A 4R7GA 4MB7A 3U6DA 2DWLA 3KOZE 2AHMA 4LRTA 4XBOA 5ITQA 3EIEA 3ILKA 3SAUA 3UK6A 4MGKE 4QNRA 5EP4A 3KP1E 5FTMA 4R3DA 2UU9M 5IZ7D 2Z7JA 2DHRA 3FUVA 1FJGM 3W0LB 4KLNA 1ZAEA 3VK7A 3HHXA 5EJCA 4LJ8A 3KOYE 2R46A 3HHYA 4JN6A 4GITA 4WW0A 1J09A 3RE8A 1IQPA 4K0KM 3JAMS 1R6BX 1G3IA 3HJQA 3J2PB 3K2LA 1XC8A 2RGHA 4LJ9A 4II7A 3SAWA 4IBFA 3J7AS 1DGHB 1N77A 4JXJA 4IBJA 3HU2A 1SXJA 3M7GA 3FD9A 4DV4M 4XGIA 2UUCM 4DR1M 1JR3A 5BPVA 1NHGC 2K47A 1Q3CA 4DUYM 2XZUA 4GC9A 4QHSA 4LGMA 3I4YA 3TWLA 3U6QA 4AG6A 5EQTA 4CISA 4DV1M 5E26A 2F5QA 3PXGA 4D80A 2DZNB 2R4EA 5H37D 2XZFA 4FWHA 1SXJE 4MH0E 2E5LM 1IBLM 4CHTB 2VIIA 4L8RC 2FFJA 4G4OA 2V6ZM 2QP9X 3SHGB 3UJNA 4LJ7A 1WXQA 1IN8A 1DGHA 3GO8A 4DR2M 3KSJA 4DR6M 4LF9M 4LJ4A 4A3VB 3KFUG 3GRVA 1LV7A 1SXJC 1N36M 3SBJA 1ZQ9A 2ZAOA 4IIWA 3C58A 4JI5M 4FVMA 1NJGA 2KZSA 2LXEA 2KRUA 4LJ6A 3A98B 2ZBKB 1HR0M 4M9XA 4OW0A 2L09A 2UXBM 1OFIA 3L29A 3KP0E 3D8BA 3U6CA 3OTOM 1I94M 4LCBA 3VDUA 2LNHC 4NOOB 1TH2A 5EP3A 2R18A 3U6LA 3E9SA 2QBYB 3SMPA 1IN5A 5KQDA 4LG2A 5FTNA 3HJ8A 3T38A 2A5YB 4AZFA 3SATA 5ITRA 2DVWB 3QAUA 4IBBA 3U60A 3HWSA 5ITXA 3SC3A 2QCUA 2KW0A 3GRRA 4B7GA 4L78A 3FUXA 1L8QA 2Y21A 4OVZB 5FSWA 1W5SA 2V1CA 1E32A 3GLHA 1HQCA 4QHTA 4GIPA 2XSZA 4IJEA 2O5RA 3GLFA 3GLGB 4NRVA 3TPZA 1IM2A 4LF5M 2YNMD 3JR5A 2XFTA 2KA6B 5ITXE 2HKJA 2F5OA 4I8OA 3KXEC 1IY0A 1GVNA 1QAMA 3L2AA 4QNMA 2C5RA 4FD2A 4ITQA 4KO8A 2H1RA 3BOSA 1NY5A 2J7OA 2XH9A 5IT9S 4L15A 3U6OA 2BJVA 3PNVA 1N34M 4GMQA 3CF6E 3TWMA 3GP1A 2EO2A 3WHLA 2G8LA 1R2ZA 4DV3M 2C9CA 4L4UA 1PM5A 1T3TA 1KYIA 3AOEA 3TWKA 1GKIA 5LMUM 3FUUA 4JI8M 4P16A 4Z6YA 2CHQA 2DWMA 1JQJC 5JI2E 1Z59A 1SXJB 2HL7A 1QZMA 2OQ4A 4PCZA 3LQQA 1IXZA 4LZZA 4MGHA 5ITYA 3FTEA 1K3XA 4LGYA 3CF2A 3U5ZB 3K92A 4M0WA 3THGA 2YFQA 3ZC7B 4FW9A 2L7IA 3LVWA 4LF8M 4BB9A 2CV1A 3VKHA 1DO0A 5LMNM 3A42A 5IWAM 1W5TA 3HGIA 3Q8XA 3FYCA 3KS4A 4IJFA 5GKNA 3AOEC 3MK6A 1XMQM 4M0DA 3GQ4A 2UUAM 3GQ3A 1E94E 4MGZE 1TDZA 3AL0C 1HQYE 4MGIE 1N33M 5EP2A 1D2NA 4GC5A 5C1BA 2CFOA 3NWLA 3HHWA 2R65A 3TE6A 2LWXA 3U5ZA 3I4VA 2D7GA 4FWDA 3U6MA 1TDHA 3UGJA 2QZ4A 5DNYA 2KXEA 1J5EM 4M9SA 2Z3XA 4AI6A 3RGSA 4PDIA 8CATA 1NSFA 2XGNA 4OX9M 4DUZM 4I81A 3ZH9B 1NVMA 3KSXA 4RF0A 3M0EA 4QOZC 3KOWE 4LY6A 4LZJA 1MU5A 5BR8M 2M5ZA 4LF6M 2NQ8C 3U61A 4DR7M 2DZOB 2VQFM 4B3RM 3U60B 4B3MM 3EIHA 1L2BA 2D7HA 3DFZA 1NHWC 2HHHM 4IBCA 2FE8A 2G5GX 3GRUA 4REZA 4S12A 3PFIA 3U6EA 1QQWA 3GLHB 2X8AA 5EXXA 2XLJA 4GHLA 3GLFB 5A2QS 1G8PA 3GPXA 3H4MA 4X66M 2Z4SA 2Y20A 1XNRM 3LVVA 2CV0A 3TQSA 4CGYB 1HNWM 2QPAA 5KPZA 3TL4X 1Q3BA 3L25A 3FYDA 3QWLA 3J81S 3FTCA 3KVWA 3KOXE 2F4VM 3A46A 1K3WA 1E9SA 2DWZB 3DOAA 3J80S 1KFVA 4HLQA 4NSOB 4M9ZA 1G4AE 1IBKM 2Z4RA 4LJAA 5FLXS 1PJIA 4LFAM 4B7FA 3T15A 3GLIA 4YHHM 3PVSA 4DV6M 1VDDA 2F5PA 4DV0M 4RF1A 2VQEM 4LF7M 1L2DA 3HKPA 3U6PA 5E6JA 1TGUA 2C9OA 2F5NA 4GRIA 2R62A 1DGFA 3IG8A 5F3WA 3GPYA 4NL4H 1EE8A 3HU1A 1XNQM 3K1JA 3VFDA 3B9PA 4IBDA 4DR4M 3HJSA 1I4WA 2KZUA 2CUZA 4ZPXA 1E9RA 2C99A 4G6ZA 4BLCA 4B3TM 1PJJA 4I5SA 3L27A 3WHKA 5DYIA 4DV7M 1YUBA 2ZAMA 3HHZA 1KSFX 1IXRC 2V1UA 2QENA 1DO2A 4EIWA 2ZANA 3DZDA 3UMMA 2C96A 4JYAM 3KW6A 3GQ5A 4LF4M 3LQRA 2LH0A 4AQYM 3W0FA 3VDPA 1GL6A 4JI1M 3E4RA 3K8ZA 1IBMM 4JI3M 4JI2M 3A45A 2BJWA 3L28A 2Y0TA 1XXHA 4IBGA 5KPRA 1ORYB 1FNNA 2ZM6M 4JI0M 4G4NA 4W5WA 3L26A 3SARA 1H6UA 4IBEA 3FTDA 4DR3M 4IBIA 4DR5M 2XFSA 4GH9A 1OFHA 3SAVA 5FTJA 2OPFA 2CHGA 1OJLA 3FTFA 2ERCA 1IY2A 1HT1E 4AW4A 3R8FA 1L1ZA 4IBKA 3VLFB 1QYRA 3T1YM 1K82A 2BNKA 2DWNA 1L1TA 4LFBM 3U61B 3GRYA 5IREB 1HT2E 1NNJA 3I51A 3FUWA 3AKZA 4LFCM 2X4AA 5JI3E 4NSRA 2X49A 2CV2A 5EP1A 1TH4A 4LRSA 2F5SA 5EXPA 1Q39A 5EXSA 1NNUC 3KS8A 3MHVC 3R9XB 4X65M 7CATA 5FTLA 4MGYE 1NJFA 1YSYA 1Z5BA 3SMSA 4GKKM 1DGBA 2C98A 1GLNA 3SFZA 4MM3B 3NBIA 1N75A 3AOGA 3RFWA 2I7NA 3RGPA 2YR0A 4I4LA 4LJ5A 1IXSB 4JI6M 3HU3A 3CTWB 4B3SM 1R2YA 5ITUA 1G41A 2FNAA 3IG5A 2CE7A 1SXJD 3J27B 3FKEA 1JR3D 2Y0QA 4AKGA 1XHBA 5ITTA 3GLIB 4KHPM 4DV2M 1IN6A 4PDGA 2I7PA 3D8LA 1C1KA 2RGOA 4TUWA 3SASA 1N32M 4BBAA 3J7BA 2UXDM 1J7KA 3UZUA 4FCTA 1G59A 2FOIC 2UXCM 1YE9A 3ZCBB 1TH3A 3M6AA 3FUTA 4AG5A 5EXTA 4NRWA 2P5TA 4L16A 3GPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3C A;  4DUY M;  2XZU A;  4DR4 M;  4B3T M;  3TWL A;  3U6Q A;  1PJJ A;  4CIS A;  4DV1 M;  4DV7 M;  2F5Q A;  3U6S A;  3VK8 A;  4LF8 M;  5LMN M;  3A42 A;  2XZF A;  5IWA M;  1XMO M;  2E5L M;  4JYA M;  1IBL M;  3GQ5 A;  3T1H M;  4LF4 M;  4AQY M;  3W0F A;  1HNZ M;  4G4O A;  4JI1 M;  4DR2 M;  3GO8 A;  1XMQ M;  1IBM M;  4JI3 M;  4JI2 M;  3GQ4 A;  2UUA M;  3A45 A;  3GQ3 A;  4X64 M;  2EA0 A;  1TDZ A;  4LF9 M;  4DR6 M;  1N33 M;  4X62 M;  1N36 M;  3SBJ A;  2ZM6 M;  4JI0 M;  3C58 A;  4JI5 M;  4G4N A;  3SAR A;  4JI7 M;  4NXN M;  4DR3 M;  1K3X A;  4DR5 M;  1HNX M;  2ZBK B;  3U6M A;  1TDH A;  3SAV A;  4NXM M;  1HR0 M;  1J5E M;  2OPF A;  2UXB M;  3U6C A;  3OTO M;  1I94 M;  4PDI A;  1L1Z A;  3JR4 A;  4OX9 M;  4DUZ M;  3T1Y M;  1K82 A;  4JV5 M;  3U6L A;  1Z5A A;  1MU5 A;  5BR8 M;  1L1T A;  4LF6 M;  1MX0 A;  4LFB M;  3SAT A;  4G4Q A;  4JI4 M;  4DR7 M;  4G4R A;  3GPP A;  5ITR A;  2VQF M;  4B3R M;  1NNJ A;  5ITX A;  4LFC M;  4B3M M;  1L2B A;  2Q2E B;  2UUB M;  2F5S A;  1Z5C A;  2HHH M;  1Q39 A;  4YY3 M;  4PD2 A;  1L2C A;  4X65 M;  3U6E A;  1Z5B A;  4DV5 M;  4GKK M;  5A2Q S;  4GKJ M;  3GPX A;  4NRV A;  4X66 M;  4LF5 M;  4MB7 A;  3JR5 A;  3U6D A;  1XNR M;  5ITX E;  2HKJ A;  2F5O A;  1HNW M;  5ITQ A;  4ITQ A;  3SAU A;  1Q3B A;  3J81 S;  2F4V M;  4JI6 M;  5IT9 S;  3A46 A;  1K3W A;  2UU9 M;  3DOA A;  1FJG M;  3J80 S;  4B3S M;  1R2Y A;  5ITU A;  3U6O A;  1KFV A;  3VK7 A;  1N34 M;  1IBK M;  3TWM A;  3GP1 A;  5FLX S;  1PJI A;  5ITT A;  4KHP M;  4LFA M;  1R2Z A;  4DV2 M;  4YHH M;  4DV3 M;  4PDG A;  1PM5 A;  4DV6 M;  4K0K M;  2F5P A;  3JAM S;  4DV0 M;  2VQE M;  4LF7 M;  1L2D A;  1XC8 A;  3SAS A;  1N32 M;  3TWK A;  2UXD M;  3SAW A;  5LMU M;  4JI8 M;  3U6P A;  3J7A S;  1XNQ M;  2F5N A;  2UXC M;  3GPY A;  1Z59 A;  1EE8 A;  2OQ4 A;  4DV4 M;  4PCZ A;  2UUC M;  4DR1 M;  4NRW A;  5ITY A;  3GPU A; 
#chains in the Genus database with same CATH topology
 4UN2 B;  2M60 A;  2KRK A;  3SHF A;  2RKO A;  3BXW A;  2XEP A;  4HL4 A;  2CWB A;  1GL7 A;  2CRU A;  2K9D A;  2L6O A;  2DXI A;  3U6S A;  1NY6 A;  4FCW A;  1UM8 A;  3FE3 A;  3VK8 A;  2BWB A;  3VKG A;  2J7N A;  1R7R A;  1N78 A;  1XMO M;  2XF3 A;  4WUR A;  3T1H M;  4NC6 A;  1VEJ A;  3LMM A;  1QDT A;  1HNZ M;  3SYK A;  3SYL A;  2YQZ A;  4PT5 A;  1IY1 A;  3AV0 A;  3W67 A;  3Q8G A;  2B3T A;  3AJI B;  4X64 M;  2EA0 A;  2D7E A;  3PNY A;  1X37 A;  2CHV A;  3CF0 A;  1XXH B;  4X62 M;  2JP7 A;  5KQ8 A;  1D0M A;  2W82 A;  1QVR A;  2KEB A;  3DA1 A;  4JI7 M;  1S3S A;  4NXN M;  3CGW A;  2HCB A;  2MJ5 B;  1DGG A;  4B08 A;  1VEG A;  4F2L A;  2JY6 B;  2VF7 A;  1HNX M;  4FCV A;  4NXM M;  1XWI A;  1Z6T A;  5FTK A;  4OU7 A;  2EUC A;  3KDS E;  1JB0 F;  5KO3 A;  2R0I A;  3JR4 A;  4Z8X A;  5C18 A;  4JV5 M;  3B7N A;  1QAN A;  1Z5A A;  4QOS A;  2QBY A;  2JA2 A;  1IN4 A;  2XSZ D;  3C3E A;  1IN7 A;  4FWG A;  4AKI A;  1MX0 A;  1D0K A;  2DAG A;  4G4Q A;  4JI4 M;  4KOD A;  3GPP A;  4D82 A;  4G4R A;  2MGW A;  4RNA A;  2UUB M;  2Q2E B;  4GHA A;  4L6V 6;  1Z5C A;  1QAQ A;  4D81 A;  4OVZ A;  4YY3 M;  2R4J A;  5DYG A;  3MJ5 A;  4PD2 A;  1L2C A;  2O25 A;  3AFH A;  1QAO A;  2L7H A;  4AKH A;  4DV5 M;  5KPT A;  2CEA A;  4GKJ M;  4B7H A;  3GLG A;  2R45 A;  1EIJ A;  4R7G A;  1P3Q Q;  1QUS A;  4MB7 A;  3U6D A;  1V34 A;  2DWL A;  3KOZ E;  2AHM A;  4LRT A;  4XBO A;  5ITQ A;  3EIE A;  3ILK A;  3SAU A;  3UK6 A;  4MGK E;  4QNR A;  3E21 A;  5EP4 A;  3C3D A;  3KP1 E;  5FTM A;  4R3D A;  3QYE A;  2UU9 M;  5IZ7 D;  2Z7J A;  2DHR A;  3FUV A;  1FJG M;  2DAE A;  3W0L B;  4KLN A;  1ZAE A;  3GLG E;  3VK7 A;  3HHX A;  3E46 A;  5EJC A;  4LJ8 A;  3QYB A;  3KOY E;  2LBC A;  2MRO B;  2R46 A;  4JN6 A;  3HHY A;  4GIT A;  4WW0 A;  1J09 A;  2DAM A;  3RE8 A;  1IQP A;  4K0K M;  3JAM S;  1R6B X;  1G3I A;  3HJQ A;  3J2P B;  3K2L A;  1XC8 A;  2RGH A;  4LJ9 A;  1OKS A;  4II7 A;  3SAW A;  1PJQ A;  3I01 M;  4IBF A;  1AUA A;  1DGH B;  1N77 A;  4JXJ A;  3J7A S;  4IBJ A;  1GJS A;  3HU2 A;  1SXJ A;  3M7G A;  3FD9 A;  3B74 A;  4DV4 M;  1TTE A;  4XGI A;  2UUC M;  4DR1 M;  2JY8 A;  1JR3 A;  5BPV A;  3W68 A;  1NHG C;  2DNA A;  2K47 A;  1Q3C A;  4DUY M;  2XZU A;  3LW5 F;  4GC9 A;  4QHS A;  4LGM A;  3I4Y A;  3TWL A;  3U6Q A;  1QUT A;  4AG6 A;  5EQT A;  4CIS A;  4DV1 M;  5E26 A;  1C7Y A;  2F5Q A;  3PXG A;  4R71 A;  4D80 A;  2DZN B;  2R4E A;  5H37 D;  2XZF A;  4FWH A;  1SXJ E;  4MH0 E;  2E5L M;  1IBL M;  2L4E A;  4CHT B;  1JR3 E;  2VII A;  4L8R C;  2FFJ A;  4G4O A;  2V6Z M;  2QP9 X;  3SHG B;  3UJN A;  1PRB A;  4LJ7 A;  1WXQ A;  1IN8 A;  1DGH A;  1NO1 A;  3GO8 A;  3KSJ A;  4DR2 M;  4DR6 M;  4LF9 M;  4LJ4 A;  4A3V B;  3KFU G;  1RU3 A;  3GRV A;  1LV7 A;  1SXJ C;  1N36 M;  3SBJ A;  1ZQ9 A;  2ZAO A;  3HY5 A;  4IIW A;  2DI0 A;  3C58 A;  4JI5 M;  4FVM A;  1NJG A;  2KZS A;  2LXE A;  1SG9 A;  4P17 A;  2KRU A;  4LJ6 A;  3A98 B;  2ZBK B;  2ZTC A;  1HR0 M;  4M9X A;  4OW0 A;  2L09 A;  1ZMV A;  2UXB M;  1OFI A;  1OQY A;  1ZMW A;  3KP0 E;  3D8B A;  3L29 A;  3U6C A;  2JNH A;  3OTO M;  1I94 M;  4LCB A;  3VDU A;  2LNH C;  1VDL A;  1TH2 A;  4NOO B;  5EP3 A;  2LTU A;  2R18 A;  3U6L A;  3B89 A;  3E9S A;  4CIZ A;  2QBY B;  3SMP A;  1IN5 A;  5KQD A;  1UFZ A;  2OOB A;  4LG2 A;  5FTN A;  2KNA A;  3HJ8 A;  3T38 A;  2A5Y B;  1QDR A;  4AZF A;  3SAT A;  5ITR A;  2DVW B;  1PJT A;  3QAU A;  4IBB A;  4Y28 F;  3U60 A;  2VF8 A;  3HWS A;  5ITX A;  2LVO C;  3SC3 A;  2QCU A;  2KW0 A;  2OOA A;  2WZJ A;  2JXN A;  3GRR A;  4B7G A;  4L78 A;  3FUX A;  1L8Q A;  2Y21 A;  4OVZ B;  4ANR A;  5FSW A;  1W5S A;  2V1C A;  2GNO A;  3BBZ A;  1E32 A;  3GLH A;  1HQC A;  4QHT A;  4GIP A;  2XSZ A;  4IJE A;  1G71 A;  2O5R A;  3GLF A;  3GLG B;  4NRV A;  3TPZ A;  1IM2 A;  4LF5 M;  2QQ8 A;  2YNM D;  3JR5 A;  2XFT A;  2KA6 B;  5ITX E;  2HKJ A;  2QHO B;  2F5O A;  3B7Q A;  4I8O A;  3KXE C;  1IY0 A;  1GVN A;  1QAM A;  3L2A A;  4QNM A;  2C5R A;  4FD2 A;  4ITQ A;  4DBG B;  4KO8 A;  2H1R A;  3BOS A;  1PGY A;  1NY5 A;  2J7O A;  2XH9 A;  2CP8 A;  5IT9 S;  3GLH E;  4L15 A;  2DKL A;  2WSC F;  2Z8Y M;  3U6O A;  3GLF E;  2BJV A;  1DV0 A;  1QZE A;  3PNV A;  1N34 M;  4GMQ A;  3CF6 E;  3TWM A;  3GP1 A;  2EO2 A;  3WHL A;  2G8L A;  1R2Z A;  1WGN A;  4G3O A;  4DV3 M;  2C9C A;  4L4U A;  1PM5 A;  1WIV A;  1T3T A;  4WP2 A;  1F4I A;  1KYI A;  3AOE A;  3TWK A;  2FS1 A;  1GKI A;  5LMU M;  3FUU A;  4JI8 M;  2JZ1 A;  4P16 A;  4Z6Y A;  2CHQ A;  2DWM A;  4HEO A;  1JQJ C;  5JI2 E;  3T6P A;  1Z59 A;  3HX3 A;  1SXJ B;  2HL7 A;  1QZM A;  2OQ4 A;  4PCZ A;  1HJP A;  3LQQ A;  1IXZ A;  4LZZ A;  4MGH A;  4XK8 F;  5ITY A;  1K3X A;  3FTE A;  4LGY A;  3CF2 A;  3U5Z B;  2EKK A;  3K92 A;  4M0W A;  3THG A;  2YFQ A;  3ZC7 B;  4CJ6 A;  4FW9 A;  2L7I A;  3LVW A;  3K9P A;  4LF8 M;  4BB9 A;  2CV1 A;  1VEK A;  3VKH A;  1DO0 A;  5LMN M;  3A42 A;  5IWA M;  1W5T A;  3F92 A;  3HGI A;  3Q8X A;  1V33 A;  2R44 A;  3FYC A;  3KS4 A;  2JY7 A;  4IJF A;  3AOE C;  1OAI A;  3MK6 A;  5GKN A;  1XMQ M;  2GQF A;  2JZ0 A;  4M0D A;  2KDL A;  3GQ4 A;  2UUA M;  3GQ3 A;  1E94 E;  4MGZ E;  1TDZ A;  3AL0 C;  2KHH A;  1HQY E;  4MGI E;  1N33 M;  5EP2 A;  1D2N A;  2L4F A;  1CUK A;  4GC5 A;  5C1B A;  2CFO A;  3NWL A;  3HHW A;  2R65 A;  3TE6 A;  2LWX A;  1R4G A;  3U5Z A;  1EFU B;  1R5L A;  2JUJ A;  3I4V A;  2D7G A;  4FWD A;  1TF0 B;  1OTR A;  1OIZ A;  1TDH A;  3UGJ A;  2QZ4 A;  5DNY A;  3U6M A;  2KXE A;  1J5E M;  4M9S A;  2Z3X A;  4AI6 A;  3RGS A;  4PDI A;  1Y8G A;  2DZL A;  8CAT A;  1NSF A;  2XGN A;  2KNV A;  4OX9 M;  4DUZ M;  4I81 A;  3ZH9 B;  1NVM A;  3KSX A;  4RF0 A;  3M0E A;  4QOZ C;  3KOW E;  1XB2 B;  3ZQJ A;  4LY6 A;  1V92 A;  1MU5 A;  4LZJ A;  5BR8 M;  2M5Z A;  4LF6 M;  2NQ8 C;  3U61 A;  4DR7 M;  2DZO B;  2EKF A;  2VQF M;  2G3Q A;  3U60 B;  4B3R M;  4B3M M;  3EIH A;  1L2B A;  2LVN C;  2D7H A;  2DHY A;  3DFZ A;  1NHW C;  2HHH M;  4IBC A;  2FE8 A;  2G5G X;  3GRU A;  2MR9 A;  3NBX X;  2HAK A;  4REZ A;  4S12 A;  3PFI A;  3U6E A;  1QQW A;  3GLH B;  2X8A A;  2EJS A;  4Q7J A;  5EXX A;  1YLA A;  2XLJ A;  3GLF B;  4GHL A;  5A2Q S;  1G8P A;  3GPX A;  3H4M A;  4X66 M;  2Z4S A;  3I04 M;  1OAO C;  2Y20 A;  1LTM A;  1XNR M;  3LVV A;  2CV0 A;  3TQS A;  4CGY B;  2R6F A;  1HNW M;  2QPA A;  5KPZ A;  3H4J A;  3LCU A;  3TL4 X;  5DFL A;  1Q3B A;  3L25 A;  3FYD A;  3QWL A;  2RRU A;  3J81 S;  3FTC A;  3KVW A;  3KOX E;  2F4V M;  1IXS A;  1WR1 B;  3A46 A;  1K3W A;  1E9S A;  2DWZ B;  3DOA A;  3J80 S;  1KFV A;  1D0L A;  2K6B A;  4HLQ A;  4NSO B;  4M9Z A;  1G4A E;  1IBK M;  3IEC A;  2Z4R A;  3C9P A;  2LVP C;  4LJA A;  1OIP A;  5FLX S;  1PJI A;  4LFA M;  4B7F A;  3T15 A;  3GLI A;  4YHH M;  3PVS A;  4DV6 M;  1VDD A;  2F5P A;  1A5T A;  4DV0 M;  4RF1 A;  2VQE M;  4LF7 M;  1L2D A;  1WJ7 A;  3LCV B;  3HKP A;  3U6P A;  5E6J A;  1TGU A;  2C9O A;  2F5N A;  2LHC A;  4GRI A;  1WHC A;  2R62 A;  1DGF A;  3IG8 A;  5F3W A;  3GPY A;  4NL4 H;  1EE8 A;  2L2D A;  3HU1 A;  2N35 A;  1T6O A;  1XNQ M;  3K1J A;  2O01 F;  2OO9 A;  3VFD A;  3GLI E;  3B9P A;  4IBD A;  4DR4 M;  3HJS A;  1I4W A;  2KZU A;  2CUZ A;  4ZPX A;  1E9R A;  2C99 A;  4G6Z A;  4BLC A;  4B3T M;  1PJJ A;  4I5S A;  3L27 A;  4F1I A;  3WHK A;  5DYI A;  4DV7 M;  1YUB A;  2WSE F;  2ZAM A;  3HHZ A;  1GAB A;  1KSF X;  1IXR C;  2BWE A;  2V1U A;  2QEN A;  1DO2 A;  4EIW A;  2ZAN A;  3DZD A;  3UMM A;  2C96 A;  4JYA M;  2WSF F;  3KW6 A;  3GQ5 A;  4LF4 M;  2DEN A;  3LQR A;  2LH0 A;  4AQY M;  3W0F A;  3VDP A;  3FRI A;  1GL6 A;  3V76 A;  4JI1 M;  2QNJ A;  1NV9 A;  3E4R A;  3K8Z A;  1IBM M;  4JI3 M;  4JI2 M;  3A45 A;  2APL A;  2J5Y A;  2BJW A;  3L28 A;  2H5X A;  2Y0T A;  1XXH A;  4GEW A;  4IBG A;  1ORY B;  5KPR A;  1FNN A;  2LHG A;  3IHP A;  2ZM6 M;  4JI0 M;  4G4N A;  4W5W A;  3L26 A;  3SAR A;  3MMP A;  1H6U A;  4IBE A;  3FTD A;  4DR3 M;  4IBI A;  1T43 A;  4DR5 M;  2XFS A;  4GH9 A;  1IFY A;  1OFH A;  1ZV1 A;  2QSF X;  3SAV A;  5FTJ A;  2OPF A;  2CHG A;  2HWJ A;  1NV8 A;  1OJL A;  3FTF A;  2ERC A;  1MN3 A;  1IY2 A;  1HT1 E;  4AW4 A;  2KNZ A;  3R8F A;  1L1Z A;  4IBK A;  3VLF B;  1MJG M;  1QYR A;  1XXH E;  3T1Y M;  1K82 A;  3K9O A;  3B7Z A;  2BNK A;  2FH0 A;  5L8R F;  2JWS A;  4RKU F;  2DWN A;  1L1T A;  4LFB M;  1BVS A;  2JY5 A;  1VQ1 A;  3U61 B;  3GRY A;  5IRE B;  1HT2 E;  1NNJ A;  3I51 A;  1TR8 A;  3FUW A;  3AKZ A;  4LFC M;  2X4A A;  5JI3 E;  4NSR A;  2X49 A;  2CV2 A;  5EP1 A;  1TH4 A;  4LRS A;  2F5S A;  5EXP A;  2LVA A;  1Q39 A;  1PJS A;  5EXS A;  1NNU C;  2LVQ D;  3KS8 A;  3MHV C;  3R9X B;  4X65 M;  7CAT A;  5FTL A;  1GO5 A;  4MGY E;  1NJF A;  1WGL A;  1YSY A;  1Z5B A;  3SMS A;  4GKK M;  1DGB A;  2MH8 A;  2VDB B;  2C98 A;  1GLN A;  3SFZ A;  4MM3 B;  3NBI A;  1N75 A;  3AOG A;  3RFW A;  2I7N A;  3RGP A;  2YR0 A;  4I4L A;  4LJ5 A;  3HZJ A;  2ZTD A;  1ZMU A;  1IXS B;  4JI6 M;  3HU3 A;  3CTW B;  2DAI A;  4B3S M;  2K0B X;  1R2Y A;  5ITU A;  1G41 A;  2FNA A;  3IG5 A;  2CE7 A;  4KT0 F;  1SXJ D;  3J27 B;  3FKE A;  2DAK A;  3FRH A;  1VG5 A;  1GJT A;  1JR3 D;  2Y0Q A;  4AKG A;  1AIP C;  1XHB A;  5ITT A;  3GLI B;  4KHP M;  4DV2 M;  1IN6 A;  4PDG A;  2I7P A;  3D8L A;  1C1K A;  2RGO A;  1Q02 A;  4TUW A;  3SAS A;  1N32 M;  4BBA A;  3J7B A;  2UXD M;  1J7K A;  3UZU A;  4FCT A;  1G59 A;  2FOI C;  2UXC M;  1YE9 A;  3ZCB B;  1TH3 A;  3M6A A;  3FUT A;  4AG5 A;  5EXT A;  4NRW A;  2P5T A;  4L16 A;  3GPU A; 
#chains in the Genus database with same CATH homology
 2M60 A;  2KRK A;  3SHF A;  2RKO A;  2XEP A;  4HL4 A;  2DXI A;  1GL7 A;  2L6O A;  3U6S A;  1NY6 A;  4FCW A;  1UM8 A;  3VK8 A;  3VKG A;  2J7N A;  1R7R A;  1N78 A;  1XMO M;  2XF3 A;  4WUR A;  3T1H M;  3LMM A;  1HNZ M;  3SYK A;  3SYL A;  2YQZ A;  4PT5 A;  1IY1 A;  3AV0 A;  3AJI B;  4X64 M;  2EA0 A;  2D7E A;  3PNY A;  1X37 A;  2CHV A;  3CF0 A;  1XXH B;  4X62 M;  5KQ8 A;  2W82 A;  1QVR A;  2KEB A;  3DA1 A;  4JI7 M;  1S3S A;  4NXN M;  2HCB A;  1DGG A;  4B08 A;  1HNX M;  4FCV A;  4NXM M;  1XWI A;  1Z6T A;  5FTK A;  4OU7 A;  2EUC A;  3KDS E;  5KO3 A;  3JR4 A;  4Z8X A;  5C18 A;  4JV5 M;  1QAN A;  1Z5A A;  4QOS A;  2QBY A;  2JA2 A;  1IN4 A;  2XSZ D;  1IN7 A;  4FWG A;  4AKI A;  1MX0 A;  4G4Q A;  4JI4 M;  4KOD A;  3GPP A;  4D82 A;  4G4R A;  4RNA A;  2UUB M;  2Q2E B;  4GHA A;  1Z5C A;  1QAQ A;  4D81 A;  4OVZ A;  4YY3 M;  2R4J A;  5DYG A;  3MJ5 A;  4PD2 A;  1L2C A;  3AFH A;  1QAO A;  2L7H A;  4AKH A;  4DV5 M;  5KPT A;  2CEA A;  4GKJ M;  4B7H A;  3GLG A;  2R45 A;  4R7G A;  4MB7 A;  3U6D A;  2DWL A;  3KOZ E;  2AHM A;  4LRT A;  4XBO A;  5ITQ A;  3EIE A;  3ILK A;  3SAU A;  3UK6 A;  4MGK E;  4QNR A;  5EP4 A;  3KP1 E;  5FTM A;  4R3D A;  2UU9 M;  5IZ7 D;  2Z7J A;  2DHR A;  3FUV A;  1FJG M;  3W0L B;  4KLN A;  1ZAE A;  3VK7 A;  3HHX A;  5EJC A;  4LJ8 A;  3KOY E;  2R46 A;  3HHY A;  4JN6 A;  4GIT A;  4WW0 A;  1J09 A;  3RE8 A;  1IQP A;  4K0K M;  3JAM S;  1R6B X;  1G3I A;  3HJQ A;  3J2P B;  3K2L A;  1XC8 A;  2RGH A;  4LJ9 A;  4II7 A;  3SAW A;  4IBF A;  3J7A S;  1DGH B;  1N77 A;  4JXJ A;  4IBJ A;  3HU2 A;  1SXJ A;  3M7G A;  3FD9 A;  4DV4 M;  4XGI A;  2UUC M;  4DR1 M;  1JR3 A;  5BPV A;  1NHG C;  2K47 A;  1Q3C A;  4DUY M;  2XZU A;  4GC9 A;  4QHS A;  4LGM A;  3I4Y A;  3TWL A;  3U6Q A;  4AG6 A;  5EQT A;  4CIS A;  4DV1 M;  5E26 A;  2F5Q A;  3PXG A;  4D80 A;  2DZN B;  2R4E A;  5H37 D;  2XZF A;  4FWH A;  1SXJ E;  4MH0 E;  2E5L M;  1IBL M;  4CHT B;  2VII A;  4L8R C;  2FFJ A;  4G4O A;  2V6Z M;  2QP9 X;  3SHG B;  3UJN A;  4LJ7 A;  1WXQ A;  1IN8 A;  1DGH A;  3GO8 A;  4DR2 M;  3KSJ A;  4DR6 M;  4LF9 M;  4LJ4 A;  4A3V B;  3KFU G;  3GRV A;  1LV7 A;  1SXJ C;  1N36 M;  3SBJ A;  1ZQ9 A;  2ZAO A;  4IIW A;  3C58 A;  4JI5 M;  4FVM A;  1NJG A;  2KZS A;  2LXE A;  2KRU A;  4LJ6 A;  3A98 B;  2ZBK B;  1HR0 M;  4M9X A;  4OW0 A;  2L09 A;  2UXB M;  1OFI A;  3L29 A;  3KP0 E;  3D8B A;  3U6C A;  3OTO M;  1I94 M;  4LCB A;  3VDU A;  2LNH C;  4NOO B;  1TH2 A;  5EP3 A;  2R18 A;  3U6L A;  3E9S A;  2QBY B;  3SMP A;  1IN5 A;  5KQD A;  4LG2 A;  5FTN A;  3HJ8 A;  3T38 A;  2A5Y B;  4AZF A;  3SAT A;  5ITR A;  2DVW B;  3QAU A;  4IBB A;  3U60 A;  3HWS A;  5ITX A;  3SC3 A;  2QCU A;  2KW0 A;  3GRR A;  4B7G A;  4L78 A;  3FUX A;  1L8Q A;  2Y21 A;  4OVZ B;  5FSW A;  1W5S A;  2V1C A;  1E32 A;  3GLH A;  1HQC A;  4QHT A;  4GIP A;  2XSZ A;  4IJE A;  2O5R A;  3GLF A;  3GLG B;  4NRV A;  3TPZ A;  1IM2 A;  4LF5 M;  2YNM D;  3JR5 A;  2XFT A;  2KA6 B;  5ITX E;  2HKJ A;  2F5O A;  4I8O A;  3KXE C;  1IY0 A;  1GVN A;  1QAM A;  3L2A A;  4QNM A;  2C5R A;  4FD2 A;  4ITQ A;  4KO8 A;  2H1R A;  3BOS A;  1NY5 A;  2J7O A;  2XH9 A;  5IT9 S;  4L15 A;  3U6O A;  2BJV A;  3PNV A;  1N34 M;  4GMQ A;  3CF6 E;  3TWM A;  3GP1 A;  2EO2 A;  3WHL A;  2G8L A;  1R2Z A;  4DV3 M;  2C9C A;  4L4U A;  1PM5 A;  1T3T A;  1KYI A;  3AOE A;  3TWK A;  1GKI A;  5LMU M;  3FUU A;  4JI8 M;  4P16 A;  4Z6Y A;  2CHQ A;  2DWM A;  1JQJ C;  5JI2 E;  1Z59 A;  1SXJ B;  2HL7 A;  1QZM A;  2OQ4 A;  4PCZ A;  3LQQ A;  1IXZ A;  4LZZ A;  4MGH A;  5ITY A;  3FTE A;  1K3X A;  4LGY A;  3CF2 A;  3U5Z B;  3K92 A;  4M0W A;  3THG A;  2YFQ A;  3ZC7 B;  4FW9 A;  2L7I A;  3LVW A;  4LF8 M;  4BB9 A;  2CV1 A;  3VKH A;  1DO0 A;  5LMN M;  3A42 A;  5IWA M;  1W5T A;  3HGI A;  3Q8X A;  3FYC A;  3KS4 A;  4IJF A;  5GKN A;  3AOE C;  3MK6 A;  1XMQ M;  4M0D A;  3GQ4 A;  2UUA M;  3GQ3 A;  1E94 E;  4MGZ E;  1TDZ A;  3AL0 C;  1HQY E;  4MGI E;  1N33 M;  5EP2 A;  1D2N A;  4GC5 A;  5C1B A;  2CFO A;  3NWL A;  3HHW A;  2R65 A;  3TE6 A;  2LWX A;  3U5Z A;  3I4V A;  2D7G A;  4FWD A;  3U6M A;  1TDH A;  3UGJ A;  2QZ4 A;  5DNY A;  2KXE A;  1J5E M;  4M9S A;  2Z3X A;  4AI6 A;  3RGS A;  4PDI A;  8CAT A;  1NSF A;  2XGN A;  4OX9 M;  4DUZ M;  4I81 A;  3ZH9 B;  1NVM A;  3KSX A;  4RF0 A;  3M0E A;  4QOZ C;  3KOW E;  4LY6 A;  4LZJ A;  1MU5 A;  5BR8 M;  2M5Z A;  4LF6 M;  2NQ8 C;  3U61 A;  4DR7 M;  2DZO B;  2VQF M;  4B3R M;  3U60 B;  4B3M M;  3EIH A;  1L2B A;  2D7H A;  3DFZ A;  1NHW C;  2HHH M;  4IBC A;  2FE8 A;  2G5G X;  3GRU A;  4REZ A;  4S12 A;  3PFI A;  3U6E A;  1QQW A;  3GLH B;  2X8A A;  5EXX A;  2XLJ A;  4GHL A;  3GLF B;  5A2Q S;  1G8P A;  3GPX A;  3H4M A;  4X66 M;  2Z4S A;  2Y20 A;  1XNR M;  3LVV A;  2CV0 A;  3TQS A;  4CGY B;  1HNW M;  2QPA A;  5KPZ A;  3TL4 X;  1Q3B A;  3L25 A;  3FYD A;  3QWL A;  3J81 S;  3FTC A;  3KVW A;  3KOX E;  2F4V M;  3A46 A;  1K3W A;  1E9S A;  2DWZ B;  3DOA A;  3J80 S;  1KFV A;  4HLQ A;  4NSO B;  4M9Z A;  1G4A E;  1IBK M;  2Z4R A;  4LJA A;  5FLX S;  1PJI A;  4LFA M;  4B7F A;  3T15 A;  3GLI A;  4YHH M;  3PVS A;  4DV6 M;  1VDD A;  2F5P A;  4DV0 M;  4RF1 A;  2VQE M;  4LF7 M;  1L2D A;  3HKP A;  3U6P A;  5E6J A;  1TGU A;  2C9O A;  2F5N A;  4GRI A;  2R62 A;  1DGF A;  3IG8 A;  5F3W A;  3GPY A;  4NL4 H;  1EE8 A;  3HU1 A;  1XNQ M;  3K1J A;  3VFD A;  3B9P A;  4IBD A;  4DR4 M;  3HJS A;  1I4W A;  2KZU A;  2CUZ A;  4ZPX A;  1E9R A;  2C99 A;  4G6Z A;  4BLC A;  4B3T M;  1PJJ A;  4I5S A;  3L27 A;  3WHK A;  5DYI A;  4DV7 M;  1YUB A;  2ZAM A;  3HHZ A;  1KSF X;  1IXR C;  2V1U A;  2QEN A;  1DO2 A;  4EIW A;  2ZAN A;  3DZD A;  3UMM A;  2C96 A;  4JYA M;  3KW6 A;  3GQ5 A;  4LF4 M;  3LQR A;  2LH0 A;  4AQY M;  3W0F A;  3VDP A;  1GL6 A;  4JI1 M;  3E4R A;  3K8Z A;  1IBM M;  4JI3 M;  4JI2 M;  3A45 A;  2BJW A;  3L28 A;  2Y0T A;  1XXH A;  4IBG A;  5KPR A;  1ORY B;  1FNN A;  2ZM6 M;  4JI0 M;  4G4N A;  4W5W A;  3L26 A;  3SAR A;  1H6U A;  4IBE A;  3FTD A;  4DR3 M;  4IBI A;  4DR5 M;  2XFS A;  4GH9 A;  1OFH A;  3SAV A;  5FTJ A;  2OPF A;  2CHG A;  1OJL A;  3FTF A;  2ERC A;  1IY2 A;  1HT1 E;  4AW4 A;  3R8F A;  1L1Z A;  4IBK A;  3VLF B;  1QYR A;  3T1Y M;  1K82 A;  2BNK A;  2DWN A;  1L1T A;  4LFB M;  3U61 B;  3GRY A;  5IRE B;  1HT2 E;  1NNJ A;  3I51 A;  3FUW A;  3AKZ A;  4LFC M;  2X4A A;  5JI3 E;  4NSR A;  2X49 A;  2CV2 A;  5EP1 A;  1TH4 A;  4LRS A;  2F5S A;  5EXP A;  1Q39 A;  5EXS A;  1NNU C;  3KS8 A;  3MHV C;  3R9X B;  4X65 M;  7CAT A;  5FTL A;  4MGY E;  1NJF A;  1YSY A;  1Z5B A;  3SMS A;  4GKK M;  1DGB A;  2C98 A;  1GLN A;  3SFZ A;  4MM3 B;  3NBI A;  1N75 A;  3AOG A;  3RFW A;  2I7N A;  3RGP A;  2YR0 A;  4I4L A;  4LJ5 A;  1IXS B;  4JI6 M;  3HU3 A;  3CTW B;  4B3S M;  1R2Y A;  5ITU A;  1G41 A;  2FNA A;  3IG5 A;  2CE7 A;  1SXJ D;  3J27 B;  3FKE A;  1JR3 D;  2Y0Q A;  4AKG A;  1XHB A;  5ITT A;  3GLI B;  4KHP M;  4DV2 M;  1IN6 A;  4PDG A;  2I7P A;  3D8L A;  1C1K A;  2RGO A;  4TUW A;  3SAS A;  1N32 M;  4BBA A;  3J7B A;  2UXD M;  1J7K A;  3UZU A;  4FCT A;  1G59 A;  2FOI C;  2UXC M;  1YE9 A;  3ZCB B;  1TH3 A;  3M6A A;  3FUT A;  4AG5 A;  5EXT A;  4NRW A;  2P5T A;  4L16 A;  3GPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...