3UZUA

The structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
b'KRFGQNFLVDHGVIDAIVAAIRPERGERMVEIGPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIARPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAFSQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA small subunit methyltransferase A
molecule tags Transferase
source organism Burkholderia pseudomallei
publication title The structure of the Ribosomal RNA small subunit methyltransferase A from Burkholderia pseudomallei
rcsb
total genus 77
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uzuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3uzuA01
3REOA 2P7HA 5C1IA 2C7RA 3JWHA 4R8SA 2QE6A 3KPYA 2I9KA 1L3BA 2BR3A 4CKCA 3GDHA 5HFJA 1H1DA 2WA1A 3EVAA 3PX3A 5ERGB 3U81A 4U7PB 3T7TA 2JH9A 3O7WA 4E32A 3V97A 3HCAA 5GINE 1DCTA 5DX1A 3P9NA 4HGYA 2G72A 1KPHA 1Y8CA 3B5IA 3LDFA 5E9QA 2P8JA 4P7JA 2XBMA 3CVOA 4KDCA 3FTDA 1R18A 2AR0A 1G60A 5E1DA 5FADA 1ORIA 1ZGAA 1NT2A 3PB3A 3PFGA 5CCBA 3BGIA 2BH2A 2FK8A 1KYWA 2I62A 2P3LA 3EPPA 3KPUA 4QQNA 5CUQA 4PYQA 5DXJA 1RJGA 3GRVA 5EKXA 3SX0A 4BLVA 5DM4A 2G8NA 3HA5A 3FPHA 1NW5A 4FT4A 4XUEA 5K0CA 4RTNA 5GWXA 3MCTA 2QY6A 4HH4A 5FQOA 3PVCA 4RTMA 2ZBQA 1RI1A 1IM8A 2B2CA 2PBFA 2AOUA 2VP3A 3BWMA 3KR2A 5E2AA 1XVAA 5EHIA 4OBXA 1G38A 3KQSA 5DRTA 5EGSA 4PCAA 2PX8A 1JG2A 2N47A 2BR5A 5LQAA 4EVIA 2E5WA 2VDWA 3HCFA 2Q41A 5MHTA 1Q0TA 1QAOA 1ZHFA 1BOOA 1DL5A 1NKVA 2AS0A 3I9FA 3NJRA 3SSNA 3VYWA 3KPWA 5K0BA 5K05A 3OZRA 3P2KA 3T7SA 4EMSA 4CXMA 1HMYA 1X1BA 3AXTA 4OA5A 4PGGA 1KP9A 5K0NA 3TOSA 5BP7A 3TQSA 2YVLA 5EG5A 4Y2HA 1G8AA 2O0LA 2OPBA 2NXNA 1RJEA 2ESRA 5FTWA 1NW3A 4GBED 4RTJA 5U4XA 1KHHA 3I53A 3HTXA 2B9EA 4QQKA 3LKDA 1L3IA 2ZIGA 4LWPA 2O06A 3EEYA 3P97A 4ER6A 3OU2A 4GF5A 2PSSA 5LQNA 4G56A 1NW6A 1VBFA 3PLAE 4KRGA 3KQPA 3AXSA 2HMYB 3HVKA 3MB5A 3UJ9A 1EIZA 1SQGA 3M4XA 3UJ8A 2Y1XA 5JR3A 5FQNA 3P2IA 1X1AA 3E7PA 5EMMA 3A25A 2XVMA 3Q87B 2FYTA 4V0QA 2PLWA 3H2BA 2CL5A 5G02A 1UIRA 5HIJA 5K0GA 5IKMA 2NXEA 1JR4A 3UBTA 2H1RA 1NBHA 2FK7A 3DH0A 3CCFA 3HA3A 4RVDA 5EC8A 2PX5A 4F86A 5EEHA 1YUBA 4RVFA 5GIOE 3MAGA 1P1CA 3A4TA 3FPGA 4FSXA 3DLIA 1M6YA 3F4KA 2BM8A 4YUWA 2PGXA 3DP7A 2PT6A 4K6MA 2C7QA 1FP1D 2PV0A 3FUVA 4O29A 3CC8A 3FTEA 3M6XA 3PS9A 4RTRA 4XUDA 3DMFA 1RI5A 5LQUA 3G8AA 3OPNA 4YUYA 2CMGA 3DULA 2QM3A 3FPEA 1SKMA 3KR1A 3FUTA 2NXJA 2PXCA 5FULA 3THRA 4GOLD 2PWPA 5IH3A 1KPGA 2IDKA 4R05A 3LBYA 2YUIA 3O31A 4FS8A 1EJ6A 4RVGA 4WVLA 1JG1A 5EVJA 5P8WA 4BP1A 4A6EA 4POOA 4FP9A 3SR4A 3P9IA 4CKBA 2VDUE 2DULA 4RSRA 3UA3A 4DA4A 3A26A 4WXHA 1RJDA 1VIDA 3ID6C 3M6UA 1NBIA 4RV9A 3ELUA 4AZVA 4ZTBA 3BGDA 5D1NA 4AZSA 4EK9A 3GCZA 3R0QA 1AQIA 5FHRA 3PFHA 2C7OA 1VE3A 2ZZKA 1XXLA 3HNRA 3SM3A 3EEOA 3NVKI 1WXXA 5DSXA 2IFTA 3KU1A 3C6KA 1L9KA 3NW9A 1NV9A 2CMHA 1I1NA 1JQ3A 3JWGA 3KQOA 1SUIA 4X1OA 2OYRA 3LHDA 1JSXA 1RI4A 4GQBA 3HVHA 2YXEA 3SXJA 4RTSA 3EVBA 3DTNA 2GS9A 3G88A 5HOQA 2VZ9A 3OCJA 4YMGA 5K8VA 1P91A 3KQTA 3B3GA 2EX4A 5K0LA 1IY9A 2P3QA 3AY0A 3DUWA 4HRAA 4GEKA 4OBWA 4X61A 5DM2A 5EZQA 2JG3A 2XYRA 5LQRA 4F84A 4FZVA 3EMBA 4F85A 4DF3A 1TW2A 5GIPE 4JXJA 3LX6A 1QANA 3JWIA 4XCXA 5LSAA 4QDKA 3QV2A 4X63A 2EJTA 1EQAA 1WZNA 4RTOA 4A6DA 4RTQA 2ADMA 4RYLA 2CWWA 2FCAA 5EMJA 2YXLA 2HTEA 5HIMA 2AOUB 4KDRA 2P7IA 2VDVE 1R8YA 1O9GA 2ZFUA 4LWOA 3OU6A 2YXDA 4RX1A 2OXTA 2ZBPA 2OKCA 3GO4A 3OZSA 1NE2A 5DTMA 5DM0A 3FUUA 5EEGA 2IIPA 3TKYA 4KW7A 2O05A 2YR0A 3L8DA 2DPMA 5LQCA 2OB2A 2ORED 5CM2Z 3EGVA 4UOEA 1XDZA 5EOVA 3G7UA 1AV6A 3R9XB 3GJYA 3HA7A 3M6WA 2WK1A 4QPPA 4QTUB 3BXOA 4RTLA 3ORHA 3CJTA 3MTIA 3KKZA 5GM1A 4DQ0A 3TRKA 2AN5A 1V39A 3IYLW 4IKPA 4PYNA 4M38A 3JWJA 4QPNA 3GXOA 3I58A 4HC4A 3P9KA 2B25A 3TR6A 2JHPA 2IBSA 3M6VA 1B42A 1VP9A 3HCBA 1WG8A 3E8SA 3P2EA 3SSMA 2PXXA 5BXYA 5FWAA 3MHTA 3C6MA 3B3FA 3E05A 5E1MA 2PX2A 2AOVA 4R8RA 4PYOA 4P58A 2XYQA 4HGZA 1XCJA 4MIKA 3EVDA 3TM5A 5KYGA 2O57A 3GIWA 3NDIA 4ER3A 1R00A 5HZMA 3BGVA 2I7CA 5GP1A 1N7JA 2UYCA 2K4MA 2LD4A 2PKWA 5EKUA 2G71A 4MWZA 3GRRA 2GH1A 3TLJA 4C03A 4E2ZA 5EMLA 4C05A 5ICEA 3HP7A 2AN3A 5E2BA 4RWZA 2QRVA 1QYRA 5KS2A 1YZ3A 3I5UA 3BZBA 3MTEA 3NTVA 4KIFA 3P9CA 3R6TA 4MQ4A 3B89A 1R74A 5H02A 3RIEA 3UJ6A 3KR9A 4DMGA 1I4WA 2JJQA 3UFBA 3NWEA 1ORHA 4MHTA 2Z6QA 3ELWA 4U7TB 2HWKA 3LCVB 3GNLA 4RVHA 4HTFB 2PJDA 9MHTA 2VS1A 4LECA 3LL7A 3UJDA 2UYHA 5T67A 1SG9A 1KXZA 4PIPA 1YFLA 2XVAA 4ISCA 3KR0A 1KR5A 1JTEA 1L1EA 4QVGA 2PXAA 5DM1A 1MJFA 4PYLA 1WXWA 1JSZA 1O54A 1X19A 3E23A 5E8JA 2PWYA 7MHTA 3G5TA 5DXAA 3MGGA 3CGGA 1INLA 4EQZA 2YTZA 1UWVA 3HCCA 1JQDA 3K6RA 4KVZA 5B1SA 4QTTB 2ZVJA 3PX2A 3B3JA 3ANXA 2NXCA 1KYZA 4GOND 1X1DA 4GOMD 4V0RA 1XDUA 3CJQA 2JHAA 4L7VA 3VC2A 4C08A 4RTPA 1M0EA 5LQJA 5DWQA 2P41A 1WY7A 3BUSA 5F2KA 3EVEA 3QOXA 3TFWA 4CTKA 5CCXA 1F3LA 2FHPA 3FPFA 3KQQA 5FHQA 3FPJA 2XYVA 5EMKA 3X0DA 3SGLA 3VC1A 4CKEA 4KIGA 1RI2A 1YB2A 3CKKA 2B78A 3UJCA 1JQEA 3LPMA 3OE5A 4OA8A 4PYJA 2IPXA 1D2CA 2AVDA 3KPVA 3C0KA 1M6EX 3LBFA 4PONA 4EKGA 5K0JA 3GGDA 2G70A 2I6GA 3EGEA 5DTQA 5GOZA 1AQJA 4E70A 2P3OA 2YX1A 5E9JA 4B17A 4P7FA 3QOWA 1P39A 10MHA 2GAFA 3BWYA 3FUWA 2BR4A 5KVAA 5FA8A 3A27A 4YV2A 3PT9A 5FUBA 2FRXA 3HM2A 4HTFA 4HG2A 4M7RA 1Q0SA 1VP3A 3NWBA 3R24A 1R6AA 1SUSA 4BLUA 1KIAA 4E31A 4E2YA 4ER0A 1EJ0A 3HVIA 1QAMA 1F38A 2EJUA 2HNKA 3ME5A 4GOOD 4OQDA 1R8XA 1OR8A 3C3YA 5K03A 3LGAA 2ZW9A 2EG5A 1RJFA 3T0IA 3LKZA 5JUWA 2GB4A 4E2WA 3M33A 2P1DA 4HSGA 1FJXA 3KQWA 4AZWA 3BT7A 4YMHA 4GC5A 3FUXA 3OZTA 3EVGA 3DXYA 3K0BA 3KHKA 5GM2A 3UWPA 4YUXA 4OQEA 1D2GA 2R3SA 1TW3A 3IEIA 3MCZA 4C4AA 3G89A 5HEKA 4RTKA 4C06A 5EIFA 3HEMA 3GRYA 3P8ZA 4ER5A 5LR6A 3VSEA 2ZCJA 3Q7EA 1NV8A 3G2QA 1PJZA 1PRYA 3BWBA 3NDJA 4BY9E 3NMUF 3ER8A 2AOWA 3EGIA 3KPJA 3LCUA 4YUZA 2OO3A 2BZGA 1D2HA 1BKYA 1SVUA 1VQ1A 5EIWA 2ZTHA 4PCLA 5ICGA 2OB1A 3OFJA 1YZHA 3DMGA 2F8LA 3ELDA 5DTRA 4E2XA 2UZ4A 1ZQ9A 1O9HA 2QRVB 2AZTA 2YQZA 3LDUA 2IH4A 1XDSA 5CVVA 1EAMA 2BM9A 4DCGA 1P1BA 4P7KA 2HR1A 3GRUA 5DLYA 4DKJA 1VLMA 3C3PA 4P7GA 2HV9A 2PVCA 4YV0A 3FYCA 5EQJB 4Z2YA 2JH8A 4NECA 5BW4A 3DXZA 1MHTA 5T64A 2Y1WA 4XUCA 2AN4A 2H11A 3D2LA 2IP2A 3NVMB 4E30A 5FA5A 4CWAA 5ICFA 3FYDA 4FGZA 2NP7A 3HCEA 2QYOA 3EVFA 5DRYA 4QVKA 5LQKA 1FBNA 1NW7A 3EVCA 3HVJA 3UJ7A 1DUSA 3TKAA 3P71T 4PINA 4PIMA 4H0NA 3BWCA 1BC5A 3THSA 2UYOA 3UZUA 3UA4A 1QZZA 2NNWB 2WA2A 3BKWA 4LG1A 1G55A 4FT2A 1ZG3A 2ZWAA 2AVNA 3FZGA 2Z6AA 4X60A 2GPYA 2ZZNA 3UJAA 2R6ZA 3MERA 3EVZA 2IH2A 4PYKA 1HNNA 3A7EA 4R6XA 2P40A 4AZTA 5FCDA 2IH5A 1VL5A 3GU3A 2GLUA 3CBGA 5CVUA 3RODA 4DZRA 1SQFA 3A7DA 5CIYA 4PYMA 5ICCA 1NW8A 2AOTB 8MHTA 2ERCA 2ZBRA 2ZIFA 3O4FA 2ZULA 4GUAA 1JTFA 3G2PA 5EPEA 3SSOA 3HCDA 5CD1A 1N7IA 5DPMA 5DX0A 2Z6UA 3I64A 5CVEA 4AX8A 4BP3A 4DCMA 3ER9A 4YV1A 3LCCA 5E1BA 4AUKA 1BHJA 3KQVA 3KQYA 3TPZA 2PT9A 4FR0A 5EHGA 4IV8A 3CJRA 5K01A 5K0FA 4PGHA 1Z3CA 2V74B 3DXXA 3KQMA 3FTFA 2ZIEA 1FPQA 1N2XA 3GWZA 3UJBA 3DLCA 2O07A 3T7RA 2GA9A 3LSTA 3WSTA 4CTJA 3DOUA 1EG2A 1JG3A 2ZZMA 2OY0A 3AWIA 4X41A 5DT2A 2JHCA 2C7PA 2H00A 1ZGJA 1IXKA 5CVJA 1VPTA 2PY6A 5T6BA 4C04A 2IBTA 4BLWA 2V7EA 1YFJA 2P35A 3IHTA 4PWYA 3FTCA 2NP6A 3FRIA 3GRZA 4DM3A 1T43A 3PTAA 1XJ5A 1U2ZA 2ONYA 2B3TA 2ZWVA 3B7PA 4GC9A 1WS6A 3G8BA 1ZKDA 3R3HA 3BKXA 4FSDA 5C0OE 3FRHA 1JG4A 2EFJA 4ATNA 4C07A 4Y30A 5D1HA 1AF7A 3G5LA 2KW5A 5DSTA 3M70A 5F2NA 2IGTA 5K0EA 2ONZA 2IDJA 3SVZA 3LECA 5HIKA 5M5BA 4MTLA 4PYIA 3TMAA 1I9GA 3OE4A 4M36A 3IV6A 2PX4A 5E1OA 5KQSA 5K09A 1TPYA 1G8SA 3DR5A 3MQ2A 2A14A 3RW9A 1YF3A 3EMDA 3AJDA 3G2MA 5HIIA 3ELYA 1KPIA 2UYQA 4M37A 2ZSUA 2ZLBA 3OU7A 5DX8A 5BW5A 1FP2A 4IWNA 5KQRA 2G1PA 5FWDA 1XCLA 5HILA 3V8VA 4PNEA 1G6Q1 1UFKA 5EZSA 4IV0A 3G2OA 4YUVA 1XTPA 2OZVA 3DMHA 5F2OA 3SMQA 3TM4A 1L3CA 4EKIA 2CKDA 3LDGA 3ERCA 2OBFA 3OFKA 1RI3A 1QAQA 2FPOA 4OX9Y 4E33A 4QDJA 4KWCA 5C9ZA 2AOTA 2NYUA 2AOXA 4R6WA 1X1CA 5E9WA 3S68A 4ER7A 5CVDA 5E8RA
chains in the Genus database with same CATH superfamily
2IXDA 5J5VA 3HBJA 3AP2A 3GUUA 1QLJA 4G41A 2FHSA 3UTDA 1GUBA 2QBYB 2P69A 1MEJA 2RGCA 3PX3A 3CVJA 1RLMA 3NIWA 4FIDA 3ZQUA 4BQFA 5DCYA 2X3YA 3TB6A 4ZMRA 4ZCMA 2QJRA 1P6QA 3WFIA 1IY1A 3ZNQA 1C9EA 1Q0RA 4YMSA 3B5IA 1RQGA 4AF8A 4ZAZA 1SPBS 1J0EA 5HCNA 4F71A 2GCEA 1Y98A 3LS2A 2Z4SA 4X7PA 4XB1A 3D2BA 4ARZA 4ZXFA 4FDUA 3HXKA 5F21A 2GN8A 4OUDB 3T3HA 1VHWA 4MS1B 1DLJA 4E1BA 3DV0A 2XFSA 4LYHA 1MHPA 1PGOA 3FNEA 4UASA 4Y2JA 5DM4A 3UEOA 5GGXA 5ITTA 3FY4A 3HB9A 3NASA 1TT5A 3A6JA 1KFKB 2N46A 2OQIA 3LAWA 2ZBQA 4DMKA 4QNNA 3HZOA 2XQFA 1XVAA 2DF8A 4U0JA 1ZL2A 1Q1QA 2NQ8A 1ESMA 3C3KA 1MO6A 2ZBKB 1DAFA 4G4OA 5J23A 4KQHA 4DEYA 2WABA 2C2MA 4AJJA 1F3OA 4ZZIA 2N47A 5FWYA 4AI6A 4AJEA 2OD9A 3OSUA 5BURA 4YPOA 3HKEA 2RG7A 4DA8A 5JQGA 3VYWA 2Z43A 4BNDA 2A0WA 4BO2A 1E2BA 3AEQB 2EWMA 2QRHA 3G6WA 3UHOA 3VPGA 3K5PA 4C29A 3JRNA 3TQOA 1JHPA 1SC1A 2P67A 3LLVA 4UXJA 2IZ1A 1Z2EA 1DRVA 2R5FA 5J5CA 3CX3A 4GKKB 1HL3A 3MUEA 4HBZA 4NENB 2JI6A 4REMA 1NGSA 3ZE9A 5CU7A 4JEHA 5CFOA 3TXYA 3UJNA 2KW0A 3RIHA 4G86A 2FMTA 1VL1A 1B0ZA 3CVXA 1V7PC 2XTAA 2ZIGA 3QI7A 1EP2B 5E0OA 3R76A 4EKDA 1VG0B 2OL4A 4AC9A 1Y8ZA 2H5EA 3HU1A 3G0BA 4YDQA 1DIBA 5FPTA 4IS3A 1J56A 3EZ6A 4QU9A 1QGUA 4RIHA 4DN6A 1QDUA 4HQKA 2AEMA 2HIAA 3AXSA 3HVKA 3I1IA 3IO3A 2RDMA 3KQPA 4ML3A 4UMFA 2OC9A 2AI1A 3F5SA 3U4HA 2F90A 2KEBA 2I87A 1R5BA 3KJEA 3IB3A 1QGUB 2YNMC 5KWSA 1E1LA 1EXNA 4JBLA 9LDBA 1X8LA 3AEQA 3GUCA 1OAOC 4G81A 1J23A 3W5CA 2BFBB 2PUTA 3AHCA 1ML3A 3GLVA 4IRUB 2PH1A 1M8KA 2Y3IA 3WLTA 3DCNA 4QNRA 3O92A 3THWB 1TYBE 2VEOA 4FSXA 5L51A 3LTNC 3F4KA 4GRIA 2ORYA 3DP7A 3PDJA 4OJYA 2FEOA 4KXLA 3DV9A 1J09A 4R2WA 3VKWA 4BNDB 3IG8A 4NCHA 2HLHA 2HD4A 2XNKA 1OF1A 5JU6A 1WABA 5ERXA 4INJA 1D2NA 3CWZA 2PAAA 3IBFA 4GM0A 5HUJA 3GPXA 4AIRA 2ZIXA 5FO1A 5HFAA 2BRUC 4DVJA 3TJMA 2ECFA 2VWQA 3RBVA 3KR1A 1LI7A 5HBRA 4F3KA 1KORA 3OG9A 2OZLA 4DV5B 2FFHA 3C4QA 2AZ4A 1S1MA 3T3OA 4B3FX 2LTAA 1QCYA 3LD9A 2WZJA 1CUKA 1H05A 1V8DA 4UMVA 4LG2A 2Q4BA 3CF0A 5KNLA 4NXNB 1RJDA 2QPOA 5SZJA 4XX1A 3MTGA 3VYSB 5A5DA 3MILA 1W0KD 4FGSA 2MMGA 1WW3A 1NBIA 4TMYA 1S2LA 3KL2A 4RV5A 3BGDA 4OHPA 4HSEA 5G2OA 4KN5A 1D09A 3WE7A 1T0IA 5A4DA 1IHUA 1VE3A 2JFUA 3B1ZA 4OQFA 3ZDFA 1YS6A 4NZZA 3TH5A 4BVJA 3CSDA 4MGZE 4PQYA 4RD4A 1H42A 1QORA 4YMTA 2YWDA 5SYNA 5JDCA 1K2WA 3PHGA 3GEMA 1R9JA 4ZOLF 4C4PA 2WKSA 4S1OA 4X1OA 2CHQA 3DMPA 3F4LA 2K7FA 4A10A 4C89A 5ITZB 3F6CA 2WSSD 3L0BA 1BS2A 3LWDA 3PDUA 1V5EA 3CEAA 3J2PB 2OV3A 2RHOA 4KXQA 2PMKA 4P1ZA 1RZRA 2B2NA 2IE8A 4Z4IA 1SCUA 1OH8A 2OESA 1V3VA 4LQLA 1KMMA 5FTKA 4F7WA 1HYGA 1HL7A 5EIAA 1KJ8A 4M1OA 2AKYA 3BGWA 5JFTA 4Q4LA 1E20A 2XF3A 2E1PA 1SNYA 1L7OA 3REQB 1XVTA 2WUWE 1TLFA 1EUZA 4UBKA 2OYCA 3KKKA 2ADMA 4EYEA 4C6HA 2NSJA 1B14A 3VVLA 1MR3F 2REBA 1DWQA 1SBNE 3HJRA 3IIMA 3INNA 3WKCA 4PC7A 1OC2A 3OPYA 1C7IA 5KPZA 3D5QA 4C2BA 5IJ9B 5C32A 4ZQIA 4LY9A 1R8YA 1D04A 2OBLA 3UGKA 1EZZA 2YQ5A 1KI1A 2ZBPA 2PUHA 4OKSA 3ZVRA 4M7PA 1D07A 3CBQA 3DBIA 4DJJA 1KI6A 1U8ZA 2Q4RA 2XW6A 2JGRA 1R88A 2Q3LA 4MA5A 2YR0A 1B6SA 4DQDA 1ZNZA 2FSUA 3GJ6A 5FBRB 1M2HA 1JXOA 3W67A 2O2IA 3HLTA 5JATA 2F3TA 4LZPA 4FWTA 1NRWA 5HM6A 2HQBA 1T5BA 2J3JA 4QTUB 2ZZMA 1PWHA 1XMVA 5T41A 4AZFA 4BE7B 4O3MA 5JPCA 4CIXA 1K27A 4KR2A 1UPUA 1FY2A 3NEYA 3A2KA 1N77A 2J7PA 3ADPA 1RAFA 1AKUA 1CFZA 2IUEA 1IN6A 1UXIA 1JQLB 3KZOA 1VIAA 3PDIA 3PC3A 2FWAA 2X1LA 3P2EA 3RSQA 1N34M 5AVZA 2JFOA 2I22A 1T1RA 4KAXA 4PQEA 1T5IA 3HBFA 4RGQA 1DXQA 1Y8GA 3AOEA 1JAHA 1E2QA 2BMEA 1X86B 2X8WA 3TM5A 1TQ4A 4ON9A 1E8DA 3J7BA 2O57A 2I33A 2FOIA 3HXLA 1U63A 1F2DA 2RBEA 3MS4A 4M1QA 4PZLA 5EJCA 2WWVD 3RBZA 3UANA 4G0WA 3AOEC 1JLHA 1LDYA 4NHOA 2PGIA 1JECA 1WHSA 2R86A 1SG0A 3GLGB 2AD5A 4U7WA 5T4HA 3U6PA 1H2WA 2AN3A 4KFRA 1FXWF 1DEHA 3D43A 3O5AA 1RWWA 2D2IA 1U28A 4M54A 4U2KA 1FMTA 1HYHA 2GPNA 5KS2A 4LFAB 1U11A 3I83A 4Q02A 2B92A 2FSVC 2UDPA 5TXGA 4AYTA 3ONWA 4PHFA 4DTIA 3NWEA 1LTMA 2HJ9A 4BVBA 2JLZA 3CVWA 2JS7A 2R00C 2VT2A 1OI7A 2J3QA 2D6FA 1QUFA 2FFJA 4BECA 2Z56A 3SJZA 5E4FA 4JSYA 3EJWA 3H9EO 1G8MA 5K3BA 4WIAA 2O8CB 3LL7A 1OWOA 3HY4A 4C7BA 2JFQA 3DBLA 1WSAA 2E82A 2GZ3A 1U8AA 3W04A 3SF8B 3DZDA 4XFKA 2PGDA 2Z5LA 2BKLA 5GONB 4BCCA 2QUBA 3NXKA 1EK6A 3G0CA 3MUOA 2Y2VA 1NI4A 1RLJA 3M3DA 3DMTA 3VHQA 3MOSA 2FEXA 3QNMA 3AM1A 3F4BA 2HOQA 4Z99A 4DREA 4FFDA 5KQPA 4GECA 2W58A 4FFLA 3UT6A 2G9NA 4MQ5A 1CBUA 4M0KA 7MHTA 3ES9A 4JUDX 2AFHA 2OP0A 2OMKA 2Q2EB 1RSZA 3I8SA 3MC1A 3MHPA 5K3CA 2LBPA 3S0JA 3EC2A 3E8XA 1XLUA 2L82A 4HDOB 2CFCA 2II6A 4GHAA 4HWOA 4NYMQ 1OJ7A 3OE7A 1JH8A 2FWNA 4N5HX 4DUGA 4WY2A 1UC9A 1FVOA 1YR9A 5HQ3A 1H2HA 5E6SA 4CI9A 1JEAA 3KQQA 1OKSA 2O7RA 2ONKA 4FBGA 2ZB8A 2ZTLA 1Q7CA 3VUEA 1QMPA 4UHBA 3FMOB 4RM3A 3U4QA 2JLAA 1OWPA 2CY0A 4H4EA 5A05A 3THYB 2FF5A 3A4IA 4PAGA 5G1NA 4I36A 5K0JA 3GGDA 3U1VA 1C2YA 2HLDA 1QFJA 1K89A 3EZ7A 4B2YA 3TO5A 1VMEA 4FNOA 2RGEA 3KUXA 3VISA 3KZCA 4I4TA 4XQCA 2QW1A 4QLAA 3HGIA 3WB2A 3SC2A 4XYMA 5GOTA 4W5RA 4I55A 4WBXC 4XAQA 4YV2A 1E4VA 3E9QA 3BHNA 4EGCB 2YOHA 5J43A 3ECSA 4R1LA 4DIFA 2OT3B 5K8IA 2HHAA 1FQKA 4FIZA 3OIVA 3ZHRA 5ITXE 1RJ9A 4OU7A 1SUSA 1T9GS 1K5PA 3B7GA 2GN0A 3EMKA 1AV7A 3KSZO 4I8IA 4CM8B 3EISA 2ERYA 4X6UA 2IYFA 2GEJA 2ZSKA 4KWTA 4Q00A 4EA6A 3WNZA 2GHQA 1XC8A 2LDBA 1RPZA 4CISA 2B83A 4FTWA 4LHXA 3N59A 2Q45A 3H4TA 1YCGA 2WIDA 3AVXA 2L2DA 4FFOA 1R66A 1XEAA 1FJXA 4HSGA 2PKCA 4A4DA 1A9XA 3BT7A 1IB0A 2FSPA 2PCJA 5EYPB 2VLBA 3K0BA 1HEYA 1ZEJA 2QSYA 4AJ4A 1O94D 2VT7A 4EG3A 4TT8A 5JT1A 1RM3A 2HA6A 3CX4A 3FROA 5EGNA 3TBFA 2V1XA 1CNEA 1UOPA 4Q1DA 3TB4A 1J0BA 4BKRA 1KO1A 4YCCA 3Q7EA 4M6WA 2QRKA 1ONOA 2PRKA 1IZ9A 1PT7A 2GCPA 4U3JA 1OQYA 1TKBA 3GC6A 1RACA 1TH3A 3VNBA 5EXXA 1UDCA 3U31A 4LRTB 1JLRA 2Y6VA 4QG7A 3HUUA 2QCUA 1VKJA 5MFPA 2Q3FA 2AFIA 4Y3UA 1XDSA 3WFJA 4E08A 2XUFA 1LRLA 1QYDA 4D0RA 1XQWA 1P4AA 2EFHB 5BY2A 1IZ7A 621PA 1FSSA 2WMYA 2JLUA 2OGUA 3K1JA 1GV0A 5I7WA 2PVCA 4MITA 5KVQA 2F5QA 3NHYA 4EG5A 4HB3A 2Y0PA 5BW4A 3WWEA 1D1PA 3GRCA 4ZU1X 2QMEA 1ZO8A 3PIRA 3MG9A 2BKEA 3ASYA 1IUPA 1EUCB 3NP9A 1CUZA 3HBAA 4FPXA 4MRRA 2XXBA 1DRKA 1JAYA 4BBZA 3STUA 4O4JF 4LUCA 3KOWA 5FP0A 4TROA 3UZUA 3EOZA 1RS0A 4DMUB 1YHYA 1SB9A 5FAXA 5BNZA 3TR5A 2CUTA 4PCVA 2CF5A 3EEFA 3EBOA 4R8MA 4M0DA 1VCMA 1YL6A 3WL4A 3UJAA 2PX3A 1EEXB 3KB8A 1ADCA 3UIEA 2GBLA 3RFUA 1GNVA 5EPUA 2ENUA 5C5DA 4MVXA 1Q15A 1KP2A 4PYMA 5EE3A 1MDFA 3WGKA 4IDNA 4ND3A 3BMXA 4FEEA 2JBWA 2NV6A 1CXZA 3N5KA 4BMSA 4QM6A 3MWJA 3M4JA 1R27A 3DOEA 4RKYA 4TXNA 3TINA 2VNKA 2XX3A 3I64A 4DLVA 4BP3A 1UFRA 3I09A 3NC1C 1IMJA 2AXPA 5AW1A 1ZICA 4LA4A 4NULA 3TPZA 5F73A 1P8AA 5ESRA 5D5PA 2R8OA 4DLBA 3FAKA 5FI5A 4BQIA 4EO7A 4TRJA 3FTFA 1V2HE 5K1ZA 2TRSB 4EKNB 2WT8A 2JK0A 5J4VA 1NUAA 1Q77A 4G5GA 2D5LA 4UU1A 2HYIC 1TPZA 1GRQA 4KN9S 3ORQA 3PQDA 4V0KA 2JF0A 3LP6A 3SHVA 3D64A 1Y3FE 1C3EA 2AMJA 2OOBA 4M8SA 5LP6F 5FLYA 2ZUBA 2H00A 3A0UA 1PGYA 2HREA 1CUBA 3PXUA 1HQDA 4WLEA 1Z8DA 4G0QA 1LTKA 1TA0A 3VTFA 3FBGA 3K8OE 3DEHA 4URZR 2OVFA 3T61A 4CNQA 1MX5A 4K9LA 3GO8A 1XJ5A 3B7PA 3GGPA 5DK4A 1THZA 3KC2A 3O2SB 4U8HA 3VBCA 4PSCA 1JG4A 2VJQA 5KSWB 3ONEA 1X39A 3W77A 4X85A 4LXGA 1QHEA 1QIMA 2C7BA 3M70A 3ZUGA 1UBRS 5F2NA 2JFPA 1QFYA 1Z4MA 5C7IO 5ENDA 3NM5A 4MTLA 2LVPC 1JIXA 1B6RA 2GN9A 4V3CA 1I9GA 2QMQA 1WF3A 3TSZA 3AINA 3EXEB 4G4IA 4B48A 3BSSA 3BWEA 1JEDA 3ILYA 4LWQA 3GA0A 3O03A 2G07A 1UFQA 4CR7A 3BB4A 3OZCA 2DLCX 1NR1A 3KQUA 2XRYA 2AA3A 3EGDB 2P2ZA 2WR8A 4C5CA 2ZSUA 3AHEA 2G1PA 3F92A 3AETA 3V8VA 1F6DA 1MZPA 4LI0A 3C6BA 4BDTA 3TNLA 6NULA 3ZC7B 1C3XA 1JW9B 3OFNA 4V3BA 2VP0A 4KEAA 3H9UA 4OXXA 3IDOA 2BWJA 4ZV9A 3EIFA 4QT4A 4OFZA 1T8PA 3ONNA 2KHHA 4NXNM 2X49A 8OHMA 3V2HA 1PBTA 2BZ1A 3L41A 3PEUA 2F1JA 1GPH1 3ECAA 4DTCA 1GGNA 2HGZA 1XMOB 1IG0A 3HWRA 3AIOA 2B34A 1ND6A 3L40A 1WEKA 3OLWA 1Q1AA 2J5QA 3EVAA 3TWKA 1I0ZA 3T7TA 2JH9A 2ZT8A 4UVDA 3F0TA 1K6EA 2VT6A 3LBNA 1OBFO 2QTCA 3LT4A 1U90A 5L3RA 3F6RA 3M7GA 1UJMA 3PTZA 3ROQA 3RU2A 4DCNA 3SAWA 2X0RA 3O8NA 4JJFA 1QOPB 3B60A 4HMQA 4PAOA 2A30A 5FADA 1OIWA 5KQDA 1E60A 4WLNA 3NS7A 2RI0A 1KHTA 3G8CA 1Y6RA 4AZVA 1ZZGA 5B37A 3VRHA 1XXHE 2JCYA 3RUCA 4C4ZA 2VXOA 5K0CA 2WIFA 4JDUA 5BMVA 2B8JA 2J0QA 4LOKA 4EPYA 4II2A 2UXCM 3QEKA 5JAPA 5ITZA 2FR1A 4JI0B 1VJ1A 5TQ0B 1ICEA 3O9VA 5TGDA 1TVKB 3AR3A 2Z6VA 4C7OB 1JG2A 1M0WA 1NVUQ 4Q05A 4UJ5A 4YCDA 4ACAA 2UUOA 3K2IA 4TLBA 5HQ3B 2O2HA 4QEDA 4XM0A 3ROTA 1F8GA 1F8FA 1MB4A 3W8DA 3KPWA 5L45A 4TS1A 1LVHA 4XK8F 3LQ1A 4I99A 1I14A 1C2TA 3QXXA 1LDEA 3WI7A 1M6VB 4P0PB 1TMOA 3ESYA 3GRFA 3K0HA 3D3QA 3UW1A 5TJ9A 2G0TA 4NU8X 4I1OA 4CMIA 1OBOA 5HPYB 1FYVA 2Q1UA 4GPBA 5EINA 2QAGB 4D26A 1EX6A 2RHBA 4C0JA 2Y1GA 4I1SA 1F7UA 3TX2A 1DC8A 4QQKA 1JB9A 1CS4C 3L01A 4ZVTA 4OOFA 4DMMA 1P0FA 3D7LA 4RANA 5HNKA 1CRLA 2A3RA 4IS2A 1EVJA 5BN5A 4HXGA 4G56A 1F5SA 3SVTA 1A27A 3K9PA 1JEYB 1ZSNA 1HQCA 4WOCA 3OQVA 2VAMA 3P9YA 3QVGB 4FN5A 4RD6A 3SDBA 1R0SA 4W5OA 1KI4A 1MO2A 1AG9A 2R6HA 2XVMA 1R4AA 2HHLA 3OD1A 2IOHA 3ZC3A 1ZQ1A 1YR1A 1C9NA 1UK8A 2F3QA 4ZT2A 2ADFA 3KOZA 5K0GA 1QPZA 4TYMA 3MJ5A 4NZPA 1JR4A 1FW8A 5AKKA 3SAVA 1QF7A 1UWLA 3QMWA 3JQDA 5IN4A 1NBHA 3ESRA 1VSUA 2OMEA 1R0YA 1Z7BA 2JDIA 4H7JA 2YMMA 5EC8A 3VU0A 2Z3XA 4FR5A 5IG2A 1MU5A 4I7EA 3L4BC 5CA1A 4ZAFA 1GXSB 4PU0A 1J5PA 3VYUB 4CLRB 4DANA 3EXG1 3AP1A 1SC6A 3AR6A 3ABZA 4L8YA 2QN6A 1UBUS 2QX8A 5KHAA 5F33A 2XBUA 4BAUA 4Q6WA 4RTRA 4JI2M 3H2ZA 3E5HA 4JC8A 4BNUA 3HBLA 2UYGA 4YALA 3QMPA 5SV2A 1QCCA 3P9PA 3BAFA 3UXEA 1XWFA 4KGXA 1YB7A 2P78A 4INPA 2YFQA 1T6YA 4OHYA 1ONNA 3KK0A 3PEFA 3IKLA 4GH9A 3N9IA 5KNBD 2VYFA 2H31A 4MARA 1A9TA 5CRIA 4YRRA 1CB7A 4OD0A 1UDRA 1QHSA 2WVGA 4RVGA 2E1RA 7AT1A 2CLKB 3SJCA 4GPEA 2YYAA 4CQJA 1FNDA 4ZOCA 5U4QA 1N6KA 1QGOA 2QU7A 3LUHA 4JWTA 1VL6A 1NUHA 1QE0A 2IRWA 1U0GA 4IDOA 4BQSA 5A4MS 1HDYA 1RFGE 2QR3A 3LK6A 4IFEA 2PMEA 4QPZA 4R2KA 2D8AA 5KNCH 3UOGA 3RWBA 1JBQA 1PI3A 1HNXM 4J76A 4IWXA 1P0PA 4JJZA 4ZARA 3LY8A 3NVKI 1HKHA 2XH8A 1NASA 2F1OA 2Z1DA 8GPBA 2Q9CA 3CLUD 4LOHA 3RAPR 3JWGA 3GUYA 1NJGA 1JSXA 1XQXA 2G63A 1RP7A 2I1QA 2YXEA 4PFQA 2Y27A 4LZAA 4CJXA 2H52A 4BNWA 2WG0A 3AH8A 3L4SO 4TTTS 3ZY6A 4GMHA 2H9YA 1L4YA 1WPQA 4NMWA 4Z1OA 1FFXA 2G5GX 1Q50A 2GETA 3GEBA 1W1WA 5AXCA 4MW6A 5AI0A 4C01A 5C53B 1KVQA 1YKSA 2IXEA 3ASZA 3EMBA 3I92A 5DKFA 5JWRA 4DF3A 3A11A 4D41A 3D0QA 1SUPA 2XBLA 3LQYA 2QL5A 4KGDA 3VK8A 4X63A 1E2PA 5A3VA 1Q20A 4B7ZA 4EY8A 1N8TA 3B1JA 4JQSA 5CJ2A 4B6GA 4RETA 4FLEA 1KKLA 1O7JA 2VDRB 1QUSA 1RAIA 2BH9A 2V7UA 3U4MA 1X7GA 2LP4Y 2C0PA 5FI0B 2V96A 1F5NA 4YTEA 4U2FA 4IGIA 5ALKA 5DW3A 3FWNA 2I4MA 1YIOA 3W05A 2I54A 2VYCA 4UE6A 5JADA 2HA5A 1NE2A 2FZCA 3KU4A 3H8WA 3LG2A 1FSPA 2WC1A 3FETA 3KE8A 4Y6RA 3I05A 4JB8A 2QMYA 1YR8A 3WL5A 2WSIA 3MWGA 2F5PA 3EEQA 4DBVO 3VR5D 1XDZA 1TIPA 1XZ8A 4KMSA 1SU8A 3ZY4A 5KCZA 2R6DA 1JLMA 4EVSA 1S4QA 1BROA 1QFXA 1USKA 2E4ZA 2QX7A 2AXNA 2Y76A 4HEOA 3N0VA 4YJKA 3RF7A 4EI9A 3T7CA 4HZUB 1LPSA 3E4DA 4NMMA 4O4IB 1AB6A 1AD2A 4PC2A 4W9RA 4JL5A 4B3TB 1B2RA 1QDEA 2WWGA 5KNBH 2G9QA 4YXWD 2BSQA 3N74A 1N0VC 1DC4A 2W8BB 4IVPA 1Z5UA 2XTZA 1SU7A 3D8SA 2DFDA 4FFBB 2CNLA 3RVQA 4BKUA 2AR7A 4EDFA 4R8RA 1I1OA 1PJ4A 2CLLB 2OHXA 4P2BA 3WIOA 3ZU6A 3D2CA 3FSRA 4KTVE 2XIJA 1U0FA 3IP7A 4CM7A 8AT1A 1O87A 3ZJ5A 2K4MA 4ZWNA 1VDDA 5HGJA 3ZWCA 5AW4A 2NSDA 1UBHS 3KUDA 3WLKX 1JBEA 2FS1A 4DGSA 4HLUA 3CW9A 2GBIA 1GQOA 1CY7A 1SUEA 4OHWA 3QKTA 1KOFA 3VX3A 3W9UA 1VRWA 2I67A 1MA3A 2DKFA 3R6TA 4MAAA 1ZD8A 4GM4A 4NCXA 3HUTA 3V4ZA 4RHFA 5CVCA 2I2BA 5EP1A 3TDKA 4W6QA 3CF4G 3VR2A 5JCOC 3U49A 4CVNA 4D3SA 3DE7X 3KEMA 1IUKA 2J0SA 3I3OA 2XMPA 4IIEA 3FCEA 3M4ZA 1H5NA 1JQKA 1FJGB 4ZCIA 4WKGA 5T67A 1OAKA 1HT1E 5HFNA 5BSRA 3GLGA 2HDNB 1BCRA 5L7WA 1WQ4A 4JT8A 3W6PA 5TSDA 4D42A 2SKDA 3QYPA 1YL7A 3NCHA 1Z5CA 1BE8A 1JTEA 3AFNA 3VZPA 3I04M 3SJAA 2XUAA 3VH4A 2IS2A 4YR7A 1V2GA 1X0XA 1JKXA 3KNZA 5JS7A 1OXTA 1ZN8A 3UBMA 5KTNA 3H99A 3FYSA 2RHRA 4NDNE 2Q6LA 3NG1A 2OHVA 3GMTA 1GZSA 2EFCB 1YC5A 3SVLA 2VLIA 1ETHA 2WJ4A 1OZ0A 3I1FA 4PRYA 2ZVJA 3V2UA 4CF7A 1TYDE 1XAIA 3ANXA 2X19A 2YWJA 3DEKA 4N7MA 2Z95A 1H8EA 3I30X 1EBBA 1GHTA 1LVUA 3O1IC 4L3WA 4MWOA 1QRUA 4RHCA 2PTGA 4F9FA 3IFSA 3COZA 3N28A 3UKOA 4BRZA 2PWAA 2MROB 1VEKA 1K3XA 3K0SA 3HVRA 4YRTA 1Z6GA 2XYVA 3PPVA 1WGNA 2YICA 4KK3A 1EFRA 1U2QA 1CRWG 4OIFA 1OH7A 2QP4A 4OQNA 4WP2A 3DE3X 2F5OA 4DR6M 1DBPA 3LPMA 1CQJB 5D87A 2IPXA 1ATZA 3KPVA 2QENA 1TQ8A 2FWRA 4ZQEA 3ZHVA 1P7VA 1JT9A 2P9HA 3F3MA 4PONA 4DCCA 1HLDA 2ZI5A 4R7TA 1JKFA 5CA0B 1SVMA 4E70A 1ZRHA 1I7PA 3L2OB 4ZIRA 2JLQA 4EGJA 1TEZA 4O25A 2FR8C 3JQCA 3KEOA 4HDKB 3AGQA 3JQ8A 2JGAA 4MW2A 4F06A 1M2OA 4X6YA 2YJ5A 2VYND 3HFRA 2DPYA 2GYUA 4GSKA 3PT9A 4DUZM 3K0EA 2BGKA 1GAQA 2JIZA 4QXPA 1XMQM 1JHRA 3R3JA 1ZOLA 2XGOA 4GPZA 4Q3DA 2Q6OA 2DPGA 1C4XA 2FQ1A 1LX6A 3DDOA 2HK9A 3CF4A 4JJKA 1L5HA 3X1JA 5AM3A 1XNQB 4O02B 1WSWA 3KLNA 1ZK3A 2RKBA 3C41J 4O63O 5BR8B 4BX2A 3STYA 3HY3A 4N6GA 4NESA 5ESWA 5KJCA 3P26A 1NLMA 3DDWA 2PQ2A 5K8JB 4E1AA 1NN0A 1SA0A 3QU9A 2QVXX 2ZR8A 3T0IA 3LKZA 4EHFA 1E5LA 3P4XA 1IWPB 4K26A 4J2TA 3R7FA 1GR0A 4IIHA 3H11B 2E18A 1P8JA 4EFKA 3KEQA 2XMRA 4OQYA 3W5IA 2UUPA 4QARA 2YFKA 2B98A 3MJVA 4YUXA 5JJBA 3E5NA 3K9FC 4J1NA 1OY1A 1D2GA 4LRSA 2ATCA 3MXTA 1K6MA 1N1EA 1UZNA 1TW3A 4FMCF 2ODBA 2A5LA 4RADA 3NHUA 2YJGA 4RD0A 2QOEA 1CB0A 3SBDA 3BXPA 4BV2A 4KBGA 1Q3HA 1J90A 1RLUA 2P9EA 5JEDA 5E38A 3DPIA 2KXEA 1Y37A 4P9NA 4BZWA 1E6WA 1OBVA 3FOAA 4DIDA 1SOVA 1DE0A 4KR3A 2DP4E 4IJVA 5DHUA 2OGZA 3OM9A 3VQTA 3WZ2A 1ENOA 4LJRA 1KZ1A 5ECDA 2ZTHA 2L42A 1P9WA 4JLWA 2PNFA 4HUQA 2PS1A 3WYFA 4WKPA 5I9BA 2GD1O 3KG2A 1V5GA 2WTBA 2O5RA 1UMDA 4GKJM 3IPYA 1CG6A 4FFRA 4PGFA 1EAMA 3FDJA 3Q0TA 2FRVA 4WA7A 1GGHA 4CKXA 2XMBA 2WIGA 4LF4B 2F17A 1E4EB 1BMFD 1DRWA 3WYCA 1PVVA 1V9CA 3H0KA 3LYUA 3O7MA 5K5EA 3K6KA 4YV0A 1W85A 1G66A 2AYZA 4LVNA 4J03A 1R50A 4NECA 1YRYE 1V96A 1MAHA 2EOAA 4LBVA 4U5XA 4FW9A 3OLZA 4RA6B 4BWFB 3DSRA 2H11A 5ITVA 2LIPA 2X8JB 1ZMWA 3GD7A 3L8GA 4B3RM 1FX0A 3OO0A 2I7TA 4KB5A 4WGGA 3SKXA 5AVVA 1M2FA 2VEDA 4L4XA 1TJPB 2XHZA 1NW7A 2I7DA 2JFHA 5FBZA 2V97A 1BOFA 2A0KA 2W6MA 3THGA 3HY6A 3R77A 4B6EA 4EFMA 1V1MB 2IHJA 3VR3D 4RWEA 1V41E 2BEJA 5JBQA 3ZCSA 1DQNA 1PUJA 3FHOA 3IDAA 1VC2A 1Z4NA 4QPJC 2Z6AA 1A72A 2B2XA 3T3GA 2H85A 2ZBDA 2EKLA 5F1KA 4ZAVA 2CJXA 2ZZNA 4ZEVA 4DIBA 4DR4B 1T25A 3W4KA 3VZDA 4AZTA 3OQPA 1N3BA 4L95C 4W63A 2HA2A 3QQ5A 4W6ZA 2HA7A 4CGYA 3K15A 3QRWA 1NW8A 3N2LA 4BVAA 2Y21A 5A1TA 1ODIA 3EZYA 3TPFA 5AUPB 5HKKD 4HFMA 5EPEA 5JANA 3AR4A 4RHTA 4DS3A 1L8QA 1F2UB 3IMEA 1SCAA 4BV9A 1A8QA 2ABWA 2MYPA 4L51A 3PI7A 2XEXA 1D0MA 1MJNA 1YMUA 4JOBA 1JU3A 3P0IA 2A33A 3RSFA 3WLQA 1SKYE 2QX4A 4JI4M 2ZJ0A 4BVEA 2V74B 5THXA 4Y0VA 2O7SA 3RGPA 1BQEA 3MLEA 3WZLA 2DBVO 2J3HA 4J0IA 4DQVA 3QW4B 2H7YA 4Z8YA 4YRKA 2DEUA 3C8UA 1ODSA 2SBTA 3HDYA 3LA8A 4NTZA 4GU5A 1G5FA 2NUPA 1ZOPA 3MK6A 1JDZA 3PP8A 4BRSA 4TRMA 3WIUA 1M9NA 2PWZA 4V1CI 2JFNA 3JD2A 2A1UA 4G0XA 5AJWA 1XTQA 2X9LA 4RAOA 2DQYA 3AB3A 3DZHA 5JY6A 1W5AA 2HBQA 5DYGA 4O8ZA 4RPIA 2BFFB 2VH1A 3HP4A 1XA0A 1GGFA 1MO5A 3D3NA 3UT5B 5B6PA 2NP6A 1G41A 4LOAA 1QIEA 2GN4A 2QUAA 3T5BA 3ZIAD 5H68A 5LFAA 2BT4A 4S24A 1JN0A 3TGLA 3IAFA 1ZYUA 5EWMB 3ICOA 4YRMA 3GGOA 2QLTA 3SIXA 1JDJA 3HABA 4ATNA 2P9JA 3GLFA 1QRAA 2D5AA 2WNSA 3SU8A 2BGJA 3B9QA 1ZIYA 4DL9A 3WLRA 3QOFA 5J1SB 1E2EA 5AHOA 2QLNA 3MMZA 1N6OA 3CX6A 2Q7OE 1XQ9A 3KJGA 3F49S 2QXTA 2C54A 3KP1E 4CMIB 1YJQA 2Y0EA 4RMJA 1MC1A 4D98A 1G42A 5K09A 3A4VA 1TPYA 5CW2A 4LJKA 4QAJA 1I51A 3H75A 2G17A 3ZXIA 2PUCA 5K3SA 2HAKA 1VBMA 3B5JA 3FLAA 3RNOA 4XPZA 4CKBB 3MPOA 4LJ6A 2I76A 4ESHA 2YV5A 1IH8A 3MF4A 4LNHA 3L0SA 3QPAA 5HMMA 1CEXA 1XCLA 4YCJA 5LD2B 4MDFA 2PEYA 1DS6A 2YWFA 3QLVC 3MWFA 4IV0A 5CYPA 4Z0PA 2QVGA 1KI7A 5IH7A 1UBOS 4LNAA 4ARSA 2ZBGA 4DBLC 4DSTA 2WTUA 2FV8A 4LC9A 1QTNA 3LP8A 5GZ6A 4LHZA 3U39A 4E33A 4PTLA 3FBWA 1CZLA 2IYRA 2HBRA 1PGQA 3GLTA 3RSZA 4DDMA 2W2MA 5C1DA 4AYWA 1XA4A 1A2KC 2RHGB 4FYYA 3G13A 5SZHB 5C81A 4TKVB 4NX2A 1DT5A 3BJZA 3KPYA 2Y99A 3L1HA 3T1VA 4ASUA 1COWD 5AR1A 4M7WA 5EA2A 1ADFA 1R5JA 4RVUA 4D44A 3ZHOA 4KKXB 1WXEA 3HCAA 3M6FA 1LK5A 1E32A 1ATIA 5J2TF 5TT1A 2JP7A 4G4NA 5ESDA 3RWMB 1IK6A 3TECE 1TM3E 1KPHA 1JVBA 1YZFA 5E9QA 4Z3OA 3M6AA 2D7JA 4EFNA 5LZ7A 1Q3KA 3THOA 4AFNA 4L15A 1DV2A 4LJYA 3D6MA 3VSDA 3DJFA 3CE9A 3R0XA 5IJWA 3BD8A 3KUUA 5AKHA 3IPAA 1JJ7A 3H9JA 5TVKA 4B3JA 5D3MB 3V5NA 4JLSA 3J81k 1W88A 3HA5A 4ESEA 2HDWA 1Z6YA 3E27A 1W0CA 5BV8A 2ZYSA 5JISA 3FBTA 1JYSA 2ON6A 3USZA 2VP3A 4CLDA 2IKSA 3IUNA 4GWKA 1UFOA 2J9YB 5CM9C 2AE1A 2GVZC 3VDPA 3UPTA 1HXHA 4AJKA 1GPAA 3TNFA 1O97C 5ALLA 1A2BA 2GYWA 3N0TA 4B8ZA 3A1WA 1WKCA 2XDYA 2BR5A 4EQ6A 2CYCA 1KJNA 4YRBA 1L7EA 2VUUA 2VDWA 3REQA 5BQ3A 4QVIA 4L8VA 5BYAA 4PG6A 1QAOA 2JZ1A 2WF7A 4JQZA 2PSHA 1RKUA 4OUDA 5F98A 5I7RA 5TMPA 4EG8A 1X1BA 4BE9A 2REXB 3Q8XA 3VO9A 4Q82A 4OIMA 4Y2HA 1MC4A 1N2EA 2GMWA 2O0LA 2ZI7A 1I13A 2WICA 3GFTA 4B4VA 2EBFX 4B6SA 5K3OA 2PL5A 5IK2A 4B3MM 1ZUWA 3GGGA 1NI3A 1X2EA 2VHYA 4CU5A 3LKDA 4BGEA 3MJDA 3WL3A 3I5XA 2YCLA 3EEYA 2L7IA 1GG9A 1JDBC 4J0CA 3K09A 2ATVA 2ZYGA 4UHDA 5ALUA 4BLTA 3LT1A 2CD7A 3BK7A 3ISJA 4H9GA 5JPDA 3CPSA 4EVQA 1QVWA 3C70A 4KRGA 1DCKA 1ZK4A 3AZPA 1FQOA 4A36A 2HMYB 2OXIA 2AW3A 1X15A 1SQGA 1Y3IA 2CHFA 4BO6A 4Y2GA 4EKEA 1VM6A 5DMHA 2BGLA 1WUKS 5ILGA 1P9NA 4V0QA 3DBRA 2J7OA 1LV7A 1NBOA 2BC9A 3FGPA 3WWOA 4A6PA 4FB5A 3ZWPA 3IAAA 3PA6A 2XXJA 2VFAA 1CDEA 3PK0A 3K31A 1E6MA 4O2AB 4R68A 4E3ZA 3OTOB 1ZINA 3DQPA 4GXNA 2E37A 1HDGO 2G83A 3SHWA 2GNAA 3FVQA 4KH1A 4XGIA 2CZCA 2PMDA 4H0FA 4LS3A 3IMGA 4NPHA 4F86A 3RNLA 5GIOE 2PFKA 1FJHA 1EA7A 1M34B 4V0OA 5E7JA 4RHYA 3ZGYA 4CEJA 2CL7X 1J8MF 3HNPA 4LCEA 3BSYA 3AYZB 4M1SA 3L07A 1XIVA 2YV1A 2IXTA 4HH3C 4KJXA 2A86A 1QMGA 3IPLA 4F56A 2QT9A 5KYWA 3JAMA 1L5MA 3PS9A 1H3NA 1COZA 4J3FA 2LR0A 3V7YA 2NZVG 3BF7A 4NJEB 3NGLA 1KSGA 2CMGA 2QG9A 2J5KA 3LW5F 4EYQA 3FSEA 1C7FA 2VF7A 2ZRLA 1S89A 3THRA 4HLNA 1E9SA 1ARZA 5DO9A 4ABTA 1G5IA 3PTLA 4M9QA 4R05A 1KU6A 3VPXA 2WFLA 3M9WA 1JG1A 3AJIB 1JWAB 1UKEA 2XOXA 1R0ZA 2BEUA 3S99A 4BFXA 1OXBB 2MSNA 3KXIA 821PA 1VHLA 3FSGA 1R1DA 2A59A 5FT9A 4INOA 1KE1A 2COEA 1ZVQA 1GVNB 2V55B 4ANFA 2VJCA 4BNHA 4DCOA 3KLBA 5J40A 1SBQA 2GWHA 4P93A 3DCIA 3GCZA 3P0RA 4HVCA 3O4RA 3R0QA 4ZYUA 2C7OA 1VLLA 3V6LA 3RIGA 1XA3A 1THTA 1Z0IA 3HQ4O 3I42A 1TYZA 1XL0A 2FA9A 1JLLB 2Y1OA 5DNEA 4BNZA 3FMVA 4G1EB 1CZUA 4PY2A 2O14A 4UATA 2CK3D 4NF2A 5CX1A 2R84A 2HMWA 2JEZA 4O2RA 1X2BA 4Z4HA 1YACA 1OKKD 5BV0A 2IUFA 4E6PA 4JFAA 1EFPB 2C8LA 4U6QA 2G0NA 3UN1A 4BFTA 3NGMA 4EAAA 3T9CA 4I9GA 3C5HA 2P2YA 4BASA 3CT6A 4RF0A 1PLLA 3CH5A 1KSHA 3CZPA 3DE5X 5AW8A 3RUHA 3ANNA 1SXIA 5DM2A 5AW0A 1MRSA 1USVA 4G0ZA 4WK6A 1IONA 1YUNA 4LY6A 1K8QA 1ZONA 3HP1A 4PRLA 4QDUA 3PQ7A 1F4VA 5D84A 3RSSA 1I36A 3NBMA 1U8UA 3O8DA 2GKOA 4K5QA 5KWVA 2JGEA 521PA 1N36M 1YCDA 1XKXA 4RYLA 5IAJA 5JSHA 2COKA 4KPUA 1C7JA 2J4FA 1KP3A 4F2HA 4M2LA 4FYMA 2YXLA 1X77A 3UMGA 2QYTA 2Q4EA 3M8KA 2YYYA 2H5IA 3KTAB 2W98A 3IXLA 1YDHA 1ONPA 1XPJA 2Q62A 1KRWA 1OXUA 1QPBA 2Q9BA 2HRRA 3NHWA 1O4WA 5DTMA 2EX1A 4ZOQI 5AESA 3ER6A 1V9SA 2DJ5A 4WEOA 3HCRA 4IHAA 3TI9A 1SK9A 1E1CA 4DRXA 4ZHQF 3U6EA 4RK7A 4P54A 2VP5A 3OT1A 1N32B 2OO9A 1MD9A 1GPBA 2PVPA 4RKWA 3OM1A 4RZ3A 4AJNA 2DWZB 1Z4JA 1WXHA 2AK2A 2DAIA 4Q4DA 3SC2B 1UM8A 3X2SA 4EABA 4F4FA 5CG1A 3VO8A 3Q7SA 1EHCA 4RD1A 1UK9A 1YBAA 3PC2A 1TM2A 2CUNA 1MNQA 3T5TA 4XDZA 4X84A 1J49A 5BUQA 1FYWA 1O0CA 4DQLA 1D7AA 2Q3DA 2W6QA 2POCA 3AW9A 1YR6A 4H7KA 1QFZA 5CT8A 2KRUA 1MOPA 1HF3A 1XMJA 3EVDA 1SUFA 2I8CA 3MWEB 421PA 2Q2WA 4K2AA 1L4BA 3CRVA 1B74A 5IKXA 4H17A 4L27A 1J2EA 5T8KC 1A97A 3RU7A 1WEHA 1QJCA 2PUJA 4C0AC 4C05A 3B1XA 4N5IX 2Z9BA 4C87A 4KPGA 1X13A 1XZMA 2QTTA 2GQFA 4RZUA 2AEJA 3B89A 1R74A 3UJ6A 3SAJA 1JR2A 1P74A 3G9XA 4RACA 2GF0A 1WW8A 1P77A 2O8NA 1U0EA 3GNLA 3I04A 2XD4A 3LYAA 4MP3A 1QOZA 2VS1A 2ZIAA 3KFLA 1KMCA 1O77A 4CV2A 5AFSA 1YTUA 2NLOA 2I4IA 3M1LA 4Z49A 3D8RA 1KK3A 2WBLC 1VKHA 5CDFE 1YQDA 1LS1A 1PVDA 2QD1A 3KR0A 3QV1A 1SEVA 3MS2A 4W5HA 3F9IA 4B7XA 3BCUA 1W76A 1UIMA 1NM5C 1ZZEA 3GLGE 3LI2A 4UKDA 6REQA 3WQQA 4YFYA 1X19A 3IDQA 3TOVA 4M53A 2A6PA 3M34A 4UFNA 4LRUA 2EJSA 2ZUFA 4UUMA 2IYZA 3BXZA 3EAFA 4M98A 4YPFA 2P5YA 1QK3A 1W36C 2YZNA 4M0FA 4IIUA 2G08A 1XB2A 1NN1A 2UVPA 3KKLA 1FYDA 4HWKA 4KXUA 3GRAA 1KEZA 4MZDA 4A8HA 1YJ5A 4L4UA 1SELA 1PS0A 1Q22A 4JI7B 1NX6A 4GI7A 4IFTA 5E6JA 2PD4A 3CTMA 3VC2A 4BN4A 3ZDCA 4OJQA 4TTSA 1H93A 3R0VA 5F2KA 2IYQA 4RXMA 2Z5FA 3W5UA 2I2FA 4ZFNA 1S8NA 3WXBA 1V6CA 1E1NA 4K88A 2ZUTA 4CMCA 3DB1A 5EQDA 3PGVA 5EJGA 2OKGA 1ZVVA 1RI2A 3KZMA 3K0CA 1YJCA 3GFOA 5IARA 4RNAA 4WZBE 2UXBB 4OQMA 2Y1KA 3RI3A 4JI5M 2I8LA 3M9XA 1M6EX 5JNSA 3BB3A 3L6EA 2XB2A 1NYTA 1HRDA 4JUCA 2XDAA 2I6GA 4ZDWA 3NBZC 1KL7A 4IBGA 3BG5A 4HAZA 4GPAA 5IASA 4MV9A 3T0GA 1L6IA 1V6SA 2GAFA 2ZROA 5ITSA 1GXSA 2BR4A 5JTTA 2KJQA 2HM7A 2NZXA 4ZO4A 1V7CA 2Z30A 4PSKA 2QTMA 4ZT6A 4CI0B 3U56A 1UAAA 1IQUA 2A3NA 2OUKA 2XAAA 1KC1A 2CXQA 3OKFA 2CJYA 3DMDA 3FLEA 4MQLA 1WIVA 4J0QA 1M8PA 1UQTA 3I12A 1CZRA 5I51A 1OAOA 2L7HA 3R23A 4AS2A 4CKCB 4DQXA 1NNSA 3CUVA 2EJUA 5J2UA 2IL1A 2PUEA 2EF1A 3ZG6A 3OQJA 4LZJA 4X90A 4LXUA 1W0JA 2J30A 3FD8A 2VNHA 3TMYA 4HDNA 1G98A 5IXYA 4ENTA 4KBYA 1MW9X 4W1RA 3E22B 4B3SB 3NALA 4JB0A 4PSDA 4ZQBA 3OX2A 4EX6A 1CYEA 1IEXA 3PJEA 3C3XA 1N5MA 3IXQA 2X7XA 1NFFA 3OZTA 5L4NA 3MJCA 2Z1NA 2D4AA 3AGPA 3GH1A 2J8ZA 2W6PA 1M2JA 1KMHA 3FPKA 2ZRFA 1RRGA 1DAKA 4GSLA 5AOVA 4C7KA 1LNQA 2X3UA 1Z33A 3GN2A 1JDSA 1PJZA 5G4KB 5TEWA 3HK2A 4OY3A 3VVBA 4EY7A 4TL6A 4RH3A 1GRNA 4BP9A 1SVIA 2ZR7A 1XJQA 3N3AC 1MF7A 3SARA 1BKYA 1PJIA 1PTKA 2F67A 3RTBA 3DHWC 5FOVA 4WFQA 3VNQA 4F5EA 1QM5A 1NHGA 2EKKA 2YN2A 2XB4A 4N47A 3S8MA 2ZATA 4WZBA 4M9RA 3M1AA 1SUWA 4ER0A 1R9MA 4MDEA 5HYVA 2Q7XA 1FDWA 1ZGCA 1CNMA 2AE2A 3ODGA 1KJQA 2IZ5A 2Z04A 4H1HA 3WMRA 1YRQA 3UV3A 5DGCA 2HR1A 1M5RA 3BEOA 1VJ0A 4UN2B 4Z4GA 2DAGA 3VV2A 1ZMVA 1G8FA 3ETGA 2AN4A 1F9AA 2CV0A 1IWOA 1HEUA 4E30A 2NADA 1UPFA 2JKVA 4IHJB 1JEQB 2J33A 4OGGA 2WZCA 5JD3A 4KT0F 1J5XA 1XZLA 4X7BA 5JYEA 2OGWA 3EVCA 1Z37A 4NKRA 1RCTE 4CJ6A 1RRFA 3QPUA 5EMHA 3SD7A 2OQRA 5KREA 1VCNA 1J1UA 2AFIB 2QZZA 3BJMA 3L7DA 3T6KA 4LG1A 2Z5GA 2BKUA 5J2UF 4PXSA 2VJNA 4JLMA 3AERB 2PPVA 2H3HA 5MN5A 1JV2B 3BULA 3WHKA 3NH6A 2GPYA 7ABPA 4OG2A 5ITYA 1HNWM 1VXRA 2CXOA 3EVZA 3QW2A 3QX8A 2AZXA 3EUWA 4QOJA 1STOA 3N8GA 3RQIA 4Q5IA 5FCDA 4Z7OB 1UADA 1UPBA 5CVUA 1V4BA 3G2KA 2FG6C 4LF6M 3U48A 3IVMA 3KUKA 4P34A 4DDWA 4ZCLA 1I9CA 2ZULA 3IBYA 2VNIA 2ZJ2A 4EGAA 3SSOA 1EFUA 1GRVA 1EWKA 2G80A 4R01A 4Z9YA 1QHXA 2FQQA 2LUOA 2IYUA 3NIGB 3K30A 4PDIA 4AX8A 5A4JA 3WNQA 5KVVA 1TIBA 1XI2A 2QSFX 3G7NA 4PNZA 4C2TA 4FR0A 2E6UX 3CKYA 5K0FA 3AETB 1UT5A 1XNGA 2PA0A 4M1MA 1QZTA 3B7WA 3L4BA 1DC6A 2NN3C 3T1QA 3TYXA 2W00A 3R40A 2CKMA 3PPXA 4J90A 4O3FA 4HDCA 3PHCA 1RHUA 3QHPA 4DM4A 2EF0A 5C8YA 2J3IA 4CV3A 3VBEA 4NQZA 2JHCA 2OHOA 4D57A 4JR0A 1FU7A 4WBNB 2PVSA 3RVDA 4EOGA 5JW6A 1AKEA 3COJA 4JGGA 5MN6A 5BNFA 1OLSB 1ZIDA 2AWOA 2X8LA 4XLLA 4U7DA 1II8A 5T4FA 1T43A 4MKFA 1A7JA 4P38A 3UCXA 4N41A 3KSJA 2ZYAA 1Q5PA 4X3CA 3F73A 1KQNA 1ZKDA 1XQYA 1XKLA 4OOEA 1O6BA 4A5SA 3AF1A 2TMGA 1AKMA 1AUQA 1X80B 3BIWA 3E53A 3G5LA 3JWPA 3M6LA 5AM1A 4BUZA 4I1VA 3TGPA 5IUKC 2NO4A 2R4EA 3WK8A 2DHQA 1L5NA 2QLMA 2OFFA 4YMLA 3CUSA 4QJ3A 1Z0SA 2QTVA 4IMPA 1XCMA 1RAAA 4YQFA 1P5HA 2C4WA 3SXUA 2Y66A 2DPLA 3IMKA 4AP6A 5F3WA 1D0VA 1ULTA 4KO4S 4IZOA 4XSGA 3JQ9A 1VJGA 4AJ2A 2JZCA 1L7RA 1VPEA 4D8TA 1A5AB 4OVZA 3IJRA 1C9DB 1KDOA 1P73A 1V8BA 1D9ZA 2J48A 2MDTA 4PX5A 4Z9XA 5FR2A 2G0AA 3WK4A 4EJ2A 2F00A 3GZTB 4JV5B 2IXFA 5HZMA 4EKIA 1CSEE 2O8BB 2VPQA 1CHNA 1FNBA 2CNBA 9GPBA 3T38A 3OQIB 4RJIA 3PE3A 3ZKWA 3OQOA 1PNRA 1R0BA 5HKBA 1EWVA 4PLFA 5I5EA 3LX8A 3CF2A 4Z8XA 1NZJA 3KKQA 3SE0A 4OX9Y 3NHLA 3NBKA 1IHOA 2IWRA 3DV0B 2AKAB 1M6HA 1FBTA 4KQGA 4LOJA 3RE1A 3VPCA 2VSXA 1KDPA 1P0QA 2LNHC 2P7HA 4JS0A 4XD7D 5C1IA 4TSFA 4F60A 1GGEA 1SIUA 3U81A 5EJ8A 1VDLA 4I5DA 3RHSA 4BGDA 3RQSA 4UM7A 4MRMA 4YRFA 2O2JA 3JZIA 4UZEA 1Z45A 5DH9A 5C35A 3P9NA 3ESQA 4YO8A 4KE7A 1ZRMA 3OO1A 1POXA 1MT0A 3GT4A 3QYFA 4RZXA 4ZU3A 4F4IA 2RHWA 1DHRA 5AVYA 1PFWA 4BO1A 1YZKA 2AR0A 2LZ0A 3L2AA 1ZK2A 4JJEA 1ZGBA 4NFYA 3VSAA 1NP3A 4K86A 4OREX 4U5QA 2QNIA 1HPLA 4UCFA 3KPUA 5DXJA 5AQEA 5KYYA 2QZ9A 4PYQA 4Q3AA 2WIBA 4I08A 1CVLA 2DZLA 4PLZA 3SHTA 5AW2A 4OK3A 1R6VA 2Z2IA 4YJFA 2DPXA 4RTMA 2IY8A 3F6SA 3T7JA 1UPTA 2AOUA 2GJSA 3JARB 2Q5QA 3NRCA 1GD1O 3MXOA 1IVSA 4L8LA 5CB0A 1MXHA 1T6ZA 1AXEA 2H2HA 4WKCA 5L3ZA 2DETA 3IPRA 2HFKA 5CA1F 3EWIA 4X62B 3GPUA 3PUHA 2JKZA 4G8DA 3RYIA 1Q0TA 3D31A 2IOFA 1NKVA 4I5EA 4R2JA 4R81A 4CIBA 1UDBA 4BYMA 4OU4A 1CQWA 2F5NA 1MVLA 3ASVA 5AKGA 4QOGA 1BO6A 4XX0B 3ZWYA 4CFYA 3Q5EA 4CM9D 1MGOA 3E2IA 1Y7PA 4V03A 5BP7A 4NBSA 4P4GA 5MGNA 1PFGA 1L4UA 3JRXA 3QMMA 2WLTA 2YJTD 1C80A 2NXNA 1G4UR 1W30A 3PITA 4FB4A 2R11A 3LC1O 4XIIA 4BN0A 3HTXA 2RC5A 3FR8A 2B9EA 3Q3IA 4IHQA 4JI2B 1L8OA 4LWPA 3LPAA 5AP9A 3EW9A 4DA9A 1XNJA 5ILOA 2DQ4A 3HHYA 2D74A 1GLVA 3NONA 5HMLA 3BFKA 3VM6A 1NUUA 1KAQA 1NW6A 2OFXA 2YXNA 3QK7A 3OLQA 4P4SA 1IN5A 1F0PA 3WV5A 1ABFA 3RFCA 4KQEA 3ULKA 3GZNB 3V8EA 4DZRA 2CW5A 5ALVA 3M4XA 3CEMA 3LZ6A 2W5UA 4NBVA 3P2IA 2IV2X 1EMDA 1NMEA 1NBAA 2CMKA 5IAAA 2BL4A 3VTZA 5LUAA 2FXVA 4RIGA 3EXFB 2Y0BA 1A5SB 3ZWDA 1CUAA 5HRAA 1J2RA 4N6NA 1HBJA 4E5MA 5IKMA 2O2EA 3GEGA 3OH8A 2FUCA 3IOCA 5H59A 1PQPA 4J43A 4BEJA 2IODA 1QH9A 3BXHA 3KJQA 2AXQA 2G8LA 4TSRA 4HAOA 1K0UA 1QX3A 2YS6A 5ARDA 4Z53A 2NNLD 4NMXB 2GHRA 2EERA 3GT0A 1OGIA 4BJ1A 1TK3A 2FPXA 3IE2A 4IJEA 4XCVA 3FUVA 4JI8B 2QRNA 3INGA 4DSNA 4GMDA 3WYGA 1VLQA 4ED9A 1J4AA 1RM5A 3R5XA 4J0HA 1EM8B 1BNCA 4C7OA 3DULA 4YRGA 1TUBA 1CR1A 2FP4A 2UZIR 4C5AA 3GT3A 1MOZA 1W6RA 2BISA 3CUKA 4JX8A 4JYAM 2LRHA 4WK2B 1U3UA 2DTEA 1AHHA 2PWPA 4GOLD 4GR4A 1N33M 5HE8A 4JKIA 5DMXA 1Y1TA 3IKVA 3GHYA 4KIJA 1Y3HA 2PEZA 4WVLA 4RHUA 3U60A 3VZCA 1GIAA 5AK5A 2C3MA 1U3GA 3LT2A 3P4UA 1QGDA 2FN8A 1IFXA 2QUHA 3GP5A 1OYYA 1E79A 1C9KA 1VIDA 5DI3A 3HJNA 4MUJA 3OM8A 4URXR 1OLXB 1YASA 1TH4A 1UPCA 1YQ9A 2HLPA 2ZB2A 3DZGA 2WJJA 4HQ6A 3T35A 5AQ1A 1N36B 1M1YA 4AULA 1USUA 4K03A 2PUBA 1M74A 2LVBA 2Q5IA 2VQDA 2HXYA 3Q2IA 4D9MA 1BGWA 2PR2A 3C3CA 3VR5H 1XDGA 1PHPA 3H18A 2GTPA 2D4HA 4JT9A 2NTVA 3H0EA 1W93A 1I1NA 1Y6ZA 2I71A 4Q1FA 4C3VA 4AQ7A 1NU8A 2XUPA 3PPIA 1KZHA 1GPJA 3GARA 3IBSA 3Q7RA 3V4FA 1Q1EA 3ROMA 3T9AA 3DOAA 2R7KA 2ASVA 4HPJB 4J4HA 4TXHA 2QMZA 2FEMA 4ZV4A 1DJOA 4ZJUA 3KQTA 1JFTA 1XLTC 2X0IA 2WYIA 3EZXA 3OTHA 3RVJA 3KCQA 3UICA 1AUOA 1XZGA 2V3WA 2D1YA 3SXUB 2Y77A 4KQXA 4C1BA 1P44A 2PO7A 3RS3A 4I3FA 2V3CC 2IS4A 1QANA 3PQEA 2JZ0A 4FCWA 4L08A 1N8KA 4QGGA 1BVYF 1YB6A 1JUDA 1I3MA 2I65A 3DBHA 1CY6A 4Y6GB 3IQGX 3PHBE 2F5SA 1V4NA 2UXDB 4TOIA 2I3AA 3FPLA 3GF4A 3QE0A 2K0BX 1ZEMA 2Q6KA 4ZI7A 3ACBA 1HNXB 2JEOA 2D1FA 3DZFA 5F12A 3IUYA 3VKFA 4JVMA 3FOFC 2ZS7A 4Y9RA 3RF6A 2OAP1 4PBRA 2W71A 1H85A 3ZHXA 2OCAA 1AS0A 1R4MB 5IDXA 1RXVA 1Z2CA 2CJPA 3MD0A 1NJ2A 3OU6A 1B2LA 3RARA 1H6UA 3OZGA 2ZYWX 3Q9NA 1IBKM 3OQMA 3F1KA 4JLDA 1EFPA 2I4NA 3KBBA 2IYTA 1WZUA 4HH1A 3SZOA 3TKYA 3UC5A 3PF8A 5DN6D 1H4QA 1OXVA 2VC2B 1B8VA 1T1GA 1U7DA 3A70A 3UWMA 2IWHA 3D0RA 1YQEA 1XZNA 4BNLA 5A6SA 1BCRB 2D62A 2OCYC 4KZKA 2OE2A 2ZB4A 4Q03A 1BJTA 2J0VA 5B7PA 4RTLA 4JI6B 2V5VA 3BEDA 2JAHA 5JCOA 1L5KA 1ESDA 3VR6A 1BWSA 1QG0A 2Q3MA 3IYLW 3AUSA 3OTQA 4MXDA 1FFCA 5KWIA 2P30A 3DNPA 1Z2AA 1N57A 2FFBA 2K2QB 4OBWA 4E21A 3AKZA 3FG9A 3VH1A 1XEWY 1D7OA 1I3OA 1NDUA 3BHMA 4KO1S 4KMRA 4XA8A 2IBSA 2HK8A 1UKYA 3F98A 1TEXA 2NU6A 3WYAA 1NRXA 2HEIA 2VH5R 1T8RA 1QOQB 3P5SA 3T41A 3PQFA 3FFAA 4MV5A 4PVCA 2C3PA 1CZKA 3GIWA 3HGQA 2EJVA 4M0CA 4ER3A 1CY1A 1KTIA 4XDHA 1W2HA 5CURA 3W5BA 3JV7A 3HKBB 3M2PA 5REQB 1I24A 4Q01A 1RQ2A 2QVLA 3MT9A 1GFWA 1WIWA 2G6TA 5EMLA 3UK0A 4CKWA 2PM8A 4RWZA 1Q7EA 3KKMA 4HDSA 3L28A 1OHHD 2AQIA 1RXEA 4L22A 4RL4A 4UZFA 4WKBA 5F7JA 3W5AA 1W5SA 3HLKA 5CA0A 1HE8B 3BREA 1FRFS 1D4ZA 4AZ3A 3VTKA 5HJ7A 1ORHA 4K81B 3PEVA 2ZAYA 1XMPA 1FS4A 1R9NA 3CONA 3KWJA 5IVIA 1JDBB 2XE7A 3GDWA 4Z4QA 5HF9A 1NJ8A 4E09A 1TA4A 3AY6A 2ID7A 1IVYA 4HDRB 4X8MA 3WK5A 4ERXA 1KXZA 3HJFA 1RQRA 4PIPA 2EW8A 2ZDGA 3EIHA 3GJ7A 2I91A 2JL1A 4OGWA 5BR7A 3AVPA 4JSTA 2BZSA 4L1KA 4EWLA 2YINC 1TEVA 5DM1A 1RMYA 2WUVA 5IP5A 1WXWA 4HNAA 1NNEA 3VOAA 2NG1A 4DA4A 1O54A 4BIIA 1CR2A 1K3FA 4N03A 4IVQA 3BICA 3IP6A 3WNVA 2WG2A 4CCAA 4FEAA 3EXG2 1GU1A 4UQOA 7REQA 3FJYA 1KYYA 2I03A 1ZD9A 2RH4A 4FUTA 4EHIA 3CEPB 4Q9KA 1E61A 4KFCA 3BTVA 4KVZA 4X1KB 5ED0A 2FE8A 1OTXA 1MX0A 4GOND 4BQNA 5LBUA 1HSZA 3U44B 4BEVA 4ZVUA 5ER9A 1KBZA 3WLAA 1VTKA 3SFVA 1RQ7A 5LQJA 4JU9A 4UVHA 1L4LA 4AXBA 3BUSA 3BOSA 1B93A 5DDIP 2LDXA 1TM4E 2YRWA 2H2WA 2Y9PB 3TFWA 4BV8A 5AVTA 4WRRA 4DYVA 4ZJZA 5I01A 3S8EA 1QHIA 5IJXA 1IWBB 1XDDA 2IEDA 1E2UA 1PDVA 3C6XA 3TIIA 1N5LA 3RSGA 3Q3HA 3H5WA 2H63A 3RR2A 1DTWB 3V7NA 2WD7B 3I6IA 5JLAA 3ICQB 1Q02A 1SN7A 4G3XA 3MINA 4U2BA 4G1BA 1GNQA 3ZBPA 3GMDA 1JTVA 2BDTA 5MGBA 3I2JA 5DTQA 4CEIA 5C5CA 1T26A 2VPZA 2Z3VA 2A9RA 1AXGA 2PYIA 1X3LA 2YX1A 3A9TA 3CRQA 1P39A 3R3VA 2A8YA 1ZY2A 1YI8A 3AQ4A 3FCYA 1QZMA 3H2KA 3QXJA 4J29A 2C83A 2V59A 1P6UA 4TMTA 3TOXA 3MEQA 1NJ1A 1K7EB 3H05A 3WWCA 2BY4A 4F6CA 1FEZA 4HTFA 1U2GC 1PX2A 1Q92A 2BMJA 2Z9DA 3BMQB 2A5GA 3BD7A 3R24A 3OLXA 1IULA 4U2DA 3WDKA 2QDXA 3ZWKA 4B1FA 5ED4A 1QS0A 3EPHA 4IMRA 4HNSA 4HNVA 1KNQA 4NOKA 4LRYA 2ZS9A 1Z6XA 1O95D 3C58A 1PJ2A 2ES4A 3ABSB 1DAIA 2M6LA 1LBEA 1JEEA 3UY4A 2YJ4A 1Q14A 1N34B 5AJYA 1ECGA 4LRWA 3PSHA 1AUPA 4IQ0A 2YHUA 2EWWA 3NIBA 4PPYA 5IYZA 1A8HA 1L5ZA 5J9FA 4CDGA 3U19A 4W7HA 4YMHA 1NL3A 1CF2O 5EJ5A 3EVGA 3KHKA 4G9EA 3SZUA 3DPSA 3M3PA 2QJTA 5FOWA 5DNYA 3DHYA 4ND1A 3LT0A 1K92A 1NZFA 4P7BA 2AG1A 5AK0A 4PQRA 5IW8A 4M83A 2KLBA 1M1ZA 3C5VA 2GXUA 4U00A 4C21A 7ADHA 5LOVA 4JJ7A 1PRYA 1K86A 3JD4A 3VHXA 1RBZA 1I5EA 2VQ3A 2Y93A 3L26A 3LQFA 2XCRB 3LGSA 5KMGB 6ADHA 2VPTA 1XB2B 2ANCA 2UVPB 3B6EA 3BDIA 3JASB 3DHEA 2O3TA 3QU7A 5A5GA 2O01F 1YZHA 3DMGA 2WJZB 3U09A 1E94E 4L6AA 2QPLA 1WLSA 3TTSA 1FXWA 1XNQM 1VGVA 2HF7A 4EF5A 3PGMA 3IL2A 1E3WA 3U3OA 4JYCA 2CFTA 1K9SA 1BXRB 5ELLA 3R20A 4YROA 2GVDC 3W7VA 4LGCA 4FJ1A 4RFLA 1WHTA 5DLEA 2HV9A 3DTVA 5CDYA 2JH8A 4FMBB 2WUDA 5TF0A 3P4YA 1WNTA 3IOMA 4HNHA 3ILHA 1GL3A 2C5FA 1NI4B 2E9SA 5FA5A 5T6MA 3ZX4A 2ISQA 2OD2A 4G85A 5HA5A 5KEIA 2JD1A 4UZSA 3ZVMA 3S44A 2MSKA 2P79A 2CXUA 2X1MA 3STHA 4QYXA 3GH3A 1BJKA 4O2BF 5BWOA 1KY4A 4DFDA 5L40A 3W68A 2IVFA 1SVSA 1XE3A 3G9ZA 4Q9JA 1W9MA 3AEZA 4FT2A 1PT6A 2Q6TA 1SPXA 1EVIA 2HA3A 4G4SP 4N6OA 2GARA 4J0DA 2PZKA 1DG9A 3WQSB 1PZMA 2OO5C 3WV4A 1Q3CA 2AX3A 3PUWA 4YJHA 5DGIA 3JQQA 4EY5A 3MUNA 1B41A 4R8VA 2ATEA 1MVOA 1VL5A 1JEQA 2GZRA 2L17A 4RF3A 4PG8A 2HMAA 1Q91A 3LCMA 4FX5A 3HKCB 1Y7IA 1K3TA 4U7FA 1YULA 5DYNA 4D9BA 4FSHA 1DOAA 3L8CA 3I9JA 5DPMA 1CHDA 4O4HB 3AKDA 4D8UA 5BMVF 1EFVB 2Z6UA 2HF8A 3T7DA 1HMPA 3FDZA 1LPMA 5ALQA 4B3RB 3V9PA 2D5CA 1YFKA 1UBMS 2LCFA 3AJAA 3OIWA 4IMIB 1Z3CA 4Y1FA 4YCAA 3F2VA 4B2IA 4DBZA 4LF5M 2QNRA 3DZCA 1A1VA 5LLTA 1O5IA 1XTSA 4KBFA 3VR4A 2C4NA 2X4DA 2IYVA 2YWGA 1OZFA 4CTJA 1EG2A 3HUFA 2ZI9A 1ZD1A 4AYXA 5EE1A 2BFWA 3L7IA 4WLOA 1KI2A 1QK5A 4X41A 1K8RA 4UTRA 5ALTA 5KOIA 3OIUA 4G4GA 1UQUA 4KDFA 1SCIA 3EF3A 2GGSA 1ZK0A 3H87A 2FX5A 4H1VA 1NFRA 4QDZA 1YFJA 1XK6A 3PKJA 1ZH0A 3PWKA 1SWVA 4UAVA 3TQHA 4TV9F 3H86A 4BPRA 3RHFA 3OEHD 4OL0A 1F1JA 2PPLA 3BDAA 4E4TA 1F0NA 2VHEA 2A58A 3ETDA 1BA2A 5D1HA 3REGA 4LWZA 5ADWA 5KTRA 5A0VA 1YKFA 2WUEA 4L3OA 5BO5A 1C1DB 5JDIC 5LQMA 3KB6A 2HCFA 3L0DA 4FGWA 3TLXA 2QMUA 5EJ2A 2W6CX 4K0KM 2Q9UA 1LDGA 1YIAA 4XR9A 3IV6A 3R0ZA 2O59A 1ZM4A 3B9PA 1E0DA 2J6HA 1ZSYA 4OQZA 1K82A 4JBXA 5K9ZA 4MUEA 3ZI7A 2QLFA 3E3MA 4YJ3A 3RYCA 1VCHA 1O5OA 1B0PA 1U80A 5KOHA 3B2NA 4RPGA 5JH7F 3IHPA 4FWHA 4MW1A 4PG4A 4Q4HB 3IE0A 2AG8A 1SHKA 5FWDA 1Y1KE 3TNJA 4BZPA 1Q12A 1JKJA 2W2KA 2P2NA 4PNEA 3SMQA 3G2OA 2JI8A 3U6DA 4AG5A 3IGFA 3AHJA 3PCTA 3U3KA 3DKRA 3PRJA 3PGA1 4OYRA 1W4CA 2QQ0A 4C22A 3FCOA 1CPYA 3O6VA 1XCBA 3EDRA 3WB9A 5EKDA 4IJFA 2NYUA 2UUAM 4QUDA 3DT9A 2BEWA 2QN1A 2YY7A 5KDLA 1YS2X 3DG9A 4WW0A 1O6FA 1Q6YA 4R8SA 5J4KA 1Z5VA 4NJMB 2GUWA 2RJ3A 4HQNA 4JBGA 5IJ0A 3I1JA 4E32A 5GINE 2CUZA 4U4AA 3A6EA 4JSRA 2QVBA 4N0PA 4DV1M 1C3LA 2IUTA 3IT0A 2B1QA 2FGJA 2QGFA 4Y1RB 4TT3A 4BGUA 4D4MA 3BXXA 5BSHA 1ZD3A 3A9SA 2BI7A 2Y1LA 5KPDA 1U9IA 2VNSA 4PCZA 2C82A 1OX4B 2G09A 2WU3A 1LH0A 3TE6A 4DLAA 4EEKA 5KYUB 5JFOA 2EKBA 3LY5A 3PFGA 2REQA 5JE8A 3BGIA 4DC9A 2WZDA 3NO4A 1KI9A 2IX3A 1LW6E 4XUGB 4BLVA 1PL7A 3T1TA 3KVWA 1CRQA 2P9GA 1G20E 2V9PA 2H2IA 3B6MA 4OHFA 3MCTA 3OESA 4ZAYA 5EJ4A 2PTHA 4NDZA 1ID1A 1O58A 4G23A 2R60A 1ZXBA 2MINA 3GPIA 3O8BA 4ZIRB 2G5TA 3HDQA 3JAWA 3N87A 1FYEA 3I45A 1WBBA 5BUSA 1G9XA 1T1IA 2W9XA 3NWJA 5COQA 4Y9TA 2BI8A 1U2EA 1DGHB 2B0CA 4BVGA 1SXQA 4YIKA 1ZUNB 2TMKA 4KFTA 4XQEA 5CB4B 3HCFA 4WXPA 1AX9A 1CQJA 1T8SA 3O94A 1U9IC 5ADUS 5MHTA 1BOOA 1H94A 2V4UA 3PC7A 5HDQA 1NY5A 1L4EA 5EFOA 3P9RA 2C5HA 4J91A 1T36B 3NZEA 1KP9A 4TWIA 4W1PA 1ADGA 1GDHA 5L7YA 1V8PA 3UUFA 1M34A 2RIPA 4D45A 9ABPA 1VYUA 1FJGM 1REQB 2DB3A 1RJEA 3N7AA 3PL1A 4X0EA 4I6GA 1E1DA 5M34A 4O4LB 3LUDA 2HY7A 2FUG6 3S7ZA 1MAAA 1R4ZA 4D9KA 5JZBA 2IS6A 5HF8A 2PSSA 3B20A 5IXSA 1QE5A 5K0TA 2H16A 5AW9A 2I7XA 2RB5A 3QFCA 1QTRA 2BKXA 3VDQA 4BL5A 1KC3A 2QU8A 3W1WA 2YWRA 3E7PA 1TO2E 3L4EA 3UHFA 4ENRA 1U0NA 2JHGA 2OHHA 5FO0A 3RRYA 3R3UA 4ETIA 3M81A 4WXMA 1GCIA 2CT8A 4Y7CA 4UJ3A 2H07A 4ZZ1A 4AY2A 1WHCA 1E9CA 2HB6A 2A57A 1J8YF 1CJUC 2IGBA 4OPMA 5JIBA