3UZUA

The structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRFGQNFLVDHGVIDAIVAAIRPERGERMVEIGPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIARPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAFSQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA small subunit methyltransferase A
publication title The structure of the Ribosomal RNA small subunit methyltransferase A from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 77
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uzuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3uzuA01
3GRYA 1JG4A 2ERCA 2ADMA 1RJGA 4GBED 5GINE 5K8VA 3EVEA 3ID6C 5CVVA 3JWGA 4YUXA 3G2MA 5FHQA 3UA3A 2PT6A 1RI4A 3FYDA 4RVGA 2G70A 3TR6A 4ZTBA 3M4XA 3RW9A 2C7PA 4KRGA 1SKMA 3UFBA 3AWIA 1ZKDA 3V8VA 3ER9A 1VIDA 5F2KA 4HH4A 4DQ0A 1HMYA 1P1CA 2P40A 2XVMA 3BKWA 4PYOA 3G2PA 3NDJA 1P39A 2DPMA 3I64A 3BGVA 3B5IA 4RTQA 1SVUA 5FTWA 1ZQ9A 1VLMA 2GS9A 1BOOA 3Q87B 2P41A 2FPOA 2BM9A 2PV0A 3TKYA 3MTEA 5BP7A 2PX2A 2KW5A 2WA1A 2ZBPA 4A6EA 4PGGA 1N2XA 3FTDA 2ZIFA 3CVOA 3PFGA 4F86A 2ZZNA 4PIMA 1XJ5A 4YV0A 2GH1A 3T7TA 2AOUB 3OE4A 3LDFA 3FUWA 3BWYA 2JHPA 2WA2A 2UYCA 3UWPA 1Z3CA 1QZZA 3EGEA 1F3LA 5K0EA 2FK8A 1YFJA 1H1DA 3MHTA 3EVAA 1EQAA 4GEKA 4ISCA 3L8DA 4MTLA 5MHTA 1R74A 5E1DA 2VP3A 3HA3A 1R18A 3MGGA 3UJ9A 5LQRA 2GAFA 2OB2A 4QQNA 2O0LA 3D2LA 3FPHA 1JSXA 1QAMA 2HTEA 2AN5A 4FT4A 3CKKA 2QRVA 3UJ6A 1I9GA 2IPXA 3EMBA 3M6VA 1KPGA 2Q41A 2AN3A 3DR5A 3IHTA 3LKDA 5K09A 2PXXA 5FWDA 3AXTA 3P71T 3GRVA 4PWYA 3UJAA 2G8NA 3HCAA 1FJXA 1YFLA 2PY6A 5FUBA 3O31A 2PWPA 4WVLA 4O29A 5EKXA 3SX0A 4RTKA 2GLUA 5K05A 1UWVA 3FTCA 1R6AA 3NW9A 1L9KA 5DXAA 3R3HA 3IYLW 2B78A 3KPJA 2VDWA 5K0NA 2H1RA 1ORIA 1QAQA 3UZUA 2YVLA 2IH2A 2JG3A 4YUZA 2NP7A 3DMGA 5HEKA 2UYQA 3SGLA 5E1OA 1QYRA 5FQOA 1JQ3A 1ZG3A 5CVUA 2OXTA 3TM5A 1MHTA 4P7KA 3ANXA 2PXCA 3MB5A 1JG1A 1YZ3A 3LX6A 3EVBA 3OFJA 2IIPA 2BZGA 3JWHA 4PYMA 2XVAA 3OZTA 4OA5A 1QANA 1YZHA 2ZLBA 1L3CA 1G8SA 3H2BA 1AQJA 4MHTA 3OPNA 2OYRA 1TPYA 2NXJA 5E9JA 4F85A 5HIMA 1WXXA 5CVEA 5B1SA 3UJ7A 5EEHA 5ICGA 1R8XA 2FHPA 3FYCA 2EJUA 5CVJA 5C1IA 1JTEA 3I58A 5EKUA 3HEMA 2Z6QA 2C7QA 3GRUA 3A27A 5DLYA 5T64A 5CCXA 3ELYA 2Y1XA 3GCZA 2AZTA 1SUSA 2P7IA 2ZW9A 1RJEA 4DF3A 3X0DA 1X19A 2V74B 3BGDA 2IP2A 1P1BA 3O7WA 4X1OA 3S68A 4AZSA 5EPEA 2OB1A 5EIWA 4C08A 4MIKA 3C0KA 2G72A 5K0GA 3DOUA 2CWWA 4F84A 3FRHA 2QRVB 5C9ZA 4H0NA 3DLIA 3P9NA 3NVKI 3VC2A 5K0BA 2H11A 4GOND 1RJDA 5KS2A 3FPFA 3LSTA 1SQFA 3MAGA 4FZVA 2JHAA 2ZIEA 3M6UA 3M6XA 2LD4A 3R24A 3PT9A 4R8RA 3FTEA 2FCAA 3GDHA 2GB4A 3DXZA 1SUIA 5DRYA 5FCDA 3G5TA 2ZWVA 1XDZA 3FRIA 3THSA 4AZWA 2G1PA 4R6WA 4RTPA 1OR8A 2E5WA 1DUSA 1FPQA 2IGTA 2P1DA 1G55A 3C3YA 3OE5A 3TLJA 4M38A 5E9QA 4KIFA 3TFWA 3BWCA 5CCBA 4E70A 2ZFUA 2AOVA 5DRTA 2PJDA 5DM1A 5JUWA 3NDIA 3LBYA 3ME5A 3EVGA 1PRYA 4DCMA 4OBWA 3KQYA 1KP9A 1INLA 3LECA 4PINA 5FHRA 3SVZA 3EEYA 2PWYA 5K0CA 3CCFA 2P7HA 3M6WA 3ELUA 2R3SA 2QE6A 2CMHA 3E7PA 2IBTA 5DSTA 1HNNA 1JQEA 4QVKA 3HCEA 2OBFA 1EJ0A 2I9KA 4CTKA 5E9WA 3LDGA 3MTIA 4LG1A 3BZBA 3G8AA 5E8RA 5FULA 4KDRA 3NVMB 1U2ZA 3HVKA 2AOWA 1RI1A 4X60A 5EMMA 5CIYA 5GOZA 2N47A 3BXOA 3SSOA 5FADA 3PTAA 1X1DA 3VSEA 1FP1D 2YXEA 2BR5A 4FSDA 1JTFA 3BUSA 5LSAA 4PIPA 3R9XB 2IFTA 3QOXA 3FUUA 1RI2A 1XXLA 2G71A 2H00A 3B3GA 3HM2A 5CM2Z 3FPGA 1G6Q1 5GM1A 4E2WA 1KXZA 2OKCA 3QV2A 3IV6A 5EQJB 5DPMA 2PX5A 3P9CA 2PT9A 2P3OA 4OQEA 5HIIA 2ZWAA 1NW7A 3KQVA 4CWAA 3P2KA 2HV9A 3B7PA 4RTLA 3CC8A 4RVHA 1P91A 3GXOA 4PCLA 4X61A 4XUEA 4CKCA 1G38A 2NNWB 3E05A 1I1NA 3R0QA 2VDVE 4C4AA 4M36A 3HTXA 3KPVA 3KQMA 3MCZA 2AVDA 4FSXA 1NV8A 3CGGA 1EG2A 3HCCA 2AOTA 3FUTA 4U7TB 4GOLD 5K0JA 4HGYA 3FTFA 1PJZA 4YV1A 3EVCA 3REOA 3P8ZA 4IV0A 3K6RA 2BM8A 1X1CA 2PBFA 3NWBA 3PFHA 4IV8A 5E2BA 2O06A 5EMJA 5FWAA 4DA4A 2AOXA 1XVAA 2O57A 4GOMD 1M6YA 1NBIA 3BWBA 3GRZA 4GF5A 4E2ZA 1NV9A 2R6ZA 4DMGA 1NW3A 4GOOD 4QTTB 4FGZA 5GWXA 5ICEA 4PYNA 2HMYB 3P2IA 3OZRA 4QDKA 4C04A 5EZSA 3CJTA 2PSSA 1JQDA 4HG2A 5HIJA 3M70A 3TQSA 3RIEA 3WSTA 4RTNA 3EEOA 3DTNA 3GRRA 2ZIGA 4FT2A 4BY9E 2V7EA 4QPNA 3DXXA 5KYGA 3ER8A 4PGHA 5E1BA 5CD1A 5CVDA 3LDUA 1KPIA 1UIRA 4EQZA 4PNEA 9MHTA 1WZNA 4DCGA 3C6KA 2FYTA 5BW5A 5M5BA 3BWMA 2Z6UA 3AY0A 4OQDA 2B3TA 2C7RA 3TMAA 2AVNA 4BLUA 3I53A 4CKBA 5U4XA 4PCAA 1SG9A 2UZ4A 2BH2A 1EJ6A 4X63A 3DULA 4C05A 2PGXA 3GJYA 3SSMA 2FK7A 3TPZA 2ESRA 3B3JA 4DM3A 1IXKA 3KKZA 1T43A 3P97A 5DX1A 3CJQA 5D1NA 3EVFA 3HCBA 3KR2A 3LGAA 5LQAA 5DM4A 1BKYA 5EVJA 2AR0A 8MHTA 3E23A 2ZSUA 3G89A 5EZQA 1RI3A 5E2AA 3KPWA 5EHGA 3UBTA 3JWIA 4JXJA 1FBNA 2NXEA 2OO3A 3ORHA 2F8LA 4U7PB 1TW3A 2CL5A 5DXJA 5FQNA 4C03A 3TM4A 5EMLA 1B42A 1Q0SA 2ZBQA 2AOTB 2K4MA 3HP7A 3HVIA 4LWPA 3SSNA 3TKAA 3I5UA 3LHDA 2ZCJA 5DX0A 3AXSA 5GIPE 3KPYA 3LCVB 3P9IA 2YR0A 2YTZA 3GWZA 2PKWA 2P3QA 2ZBRA 3FZGA 4Y30A 4KIGA 1VP9A 3KQQA 4Z2YA 3G88A 5EMKA 1JG2A 3KR1A 3KU1A 4YV2A 2IH5A 4P7FA 1VL5A 4RSRA 5EOVA 1IY9A 1KYWA 3E8SA 10MHA 3LKZA 4FS8A 1XCLA 4GQBA 1G60A 3DLCA 4MWZA 3P9KA 1D2HA 1G8AA 4EK9A 2O07A 3FUVA 1AQIA 3BGIA 3LBFA 1V39A 3OCJA 4HC4A 4GUAA 4Y2HA 4MQ4A 4CXMA 4AZTA 5HIKA 3OZSA 4QPPA 4ER0A 5DWQA 4OA8A 4DZRA 5EHIA 2BR4A 4YMHA 1YF3A 3LCUA 3A7EA 3PLAE 2CKDA 4E2YA 5LQKA 4HSGA 1RI5A 1VQ1A 5LQJA 2ZZMA 4E2XA 2PX4A 4M37A 7MHTA 5LQCA 3VYWA 5KQSA 1EAMA 5E8JA 4ER3A 4XUDA 3EGIA 2A14A 5BXYA 2XYVA 2EG5A 3OU7A 3R6TA 4M7RA 1VE3A 2EJTA 3CJRA 2UYHA 4FP9A 5DSXA 2Z6AA 2VZ9A 3FPEA 1D2GA 2HNKA 2B2CA 4R8SA 4C06A 4RVFA 3UJCA 1M6EX 5DM2A 4P58A 5DTRA 5G02A 3T7SA 3AJDA 1JG3A 4L7VA 4ER7A 2OY0A 4K6MA 3SMQA 3T7RA 5DM0A 1YB2A 3ELWA 5F2NA 2AS0A 2P35A 4YUYA 3KQTA 4YUWA 2GPYA 3PVCA 3GNLA 4V0QA 3C3PA 3I9FA 4KDCA 2YQZA 3G2QA 3HCDA 3Q7EA 4AZVA 1BHJA 1NT2A 4XUCA 1L3IA 2NXNA 5KVAA 1UFKA 3NWEA 2XYRA 2JJQA 1ORHA 2I7CA 2ORED 5EIFA 3KHKA 2GA9A 3K0BA 1NKVA 4AUKA 4NECA 4PYJA 2ZVJA 4P7GA 4RVDA 1KHHA 1ZGJA 3DH0A 1WXWA 4R6XA 3THRA 4RTSA 3PX3A 1KPHA 3G2OA 3KQPA 4AX8A 3SXJA 4CTJA 4HTFA 3TRKA 5K01A 1VBFA 4WXHA 1Y8CA 5H02A 2PVCA 3MQ2A 3T0IA 5K03A 3A26A 3EPPA 3UJBA 4PYIA 5IH3A 2IH4A 2BR3A 4HGZA 2VS1A 3OU2A 2YXLA 4FR0A 3NMUF 5ERGB 2WK1A 2PXAA 2YUIA 4LECA 2XBMA 1AF7A 3PX2A 4QTUB 2DULA 1O54A 3EVZA 3LL7A 5D1HA 5EEGA 1Q0TA 3NTVA 3C6MA 1SQGA 1NW8A 3EGVA 2C7OA 2I62A 3B3FA 3G5LA 3IEIA 4KW7A 5HILA 4ATNA 4CKEA 2NXCA 2P3LA 4RTRA 4QQKA 4ER6A 3TOSA 2HR1A 5JR3A 5GM2A 3UJ8A 3DP7A 4BLWA 2B9EA 2ZTHA 3UJDA 4DKJA 5GIOE 4RTOA 4PONA 1WG8A 3A7DA 2QY6A 4RV9A 4LWOA 4POOA 3HVHA 4C07A 3FPJA 1D2CA 1FP2A 1NBHA 3JWJA 4RTMA 3KR0A 5HFJA 3DXYA 4A6DA 3ERCA 5DT2A 3HA7A 4P7JA 4PYKA 1L3BA 3A25A 4BP3A 2EX4A 3MERA 2ZULA 2CMGA 5ICCA 4X41A 4KWCA 1ZGAA 4ER5A 1WS6A 1XDUA 4V0RA 4EKGA 3GO4A 5K0LA 2B25A 2Y1WA 2IBSA 5E1MA 4HRAA 3HNRA 4EKIA 1QAOA 1JSZA 3SM3A 2VDUE 4YUVA 4OX9Y 3HVJA 1RJFA 1I4WA 5HZMA 4HTFB 4KVZA 4E30A 1JR4A 3EMDA 1N7IA 5FA5A 4B17A 1VP3A 2OZVA 2P8JA 4IWNA 5BW4A 1M0EA 5EGSA 1WY7A 1NW6A 2YXDA 3ELDA 1IM8A 3B89A 2QM3A 5LQNA 3EVDA 3KQOA 5LR6A 3FUXA 3BT7A 1ZHFA 3OU6A 2PLWA 3G8BA 3GIWA 3GU3A 5F2OA 1F38A 3V97A 3KR9A 4E31A 4RYLA 5T67A 5KQRA 3M33A 3PB3A 1EIZA 4PYLA 4PYQA 1AV6A 1VPTA 3QOWA 1XTPA 3MCTA 3HA5A 1L1EA 4IKPA 4RX1A 4EMSA 5HOQA 2UYOA 5GP1A 2ZZKA 4EVIA 5K0FA 4RWZA 5EG5A 2JH9A 3LPMA 3LCCA 3OFKA 2PX8A 1DCTA 1O9GA 3GGDA 3KQWA 5ICFA 1TW2A 1R00A 2ONZA 4QVGA 3G7UA 5CUQA 3UA4A 2OPBA 3KPUA 3O4FA 2FRXA 3VC1A 1KYZA 3CBGA 5C0OE 5FA8A 2NP6A 1DL5A 3DMFA 3SR4A 2NYUA 5DX8A 2QYOA 3RODA 3U81A 1YUBA 1X1AA 4XCXA 5IKMA 2AOUA 3DUWA 4R05A 4GC9A 2ONYA 3PS9A 5LQUA 1NW5A 1X1BA 3HCFA 5EC8A 1NE2A 1N7JA 4GC5A 1XCJA 4G56A 5DTMA 1R8YA 4E33A 4OBXA 2O05A 1KR5A 3DMHA 3P2EA 5DTQA 4BP1A 3A4TA 5P8WA 4RTJA 5T6BA 4YMGA 1O9HA 2JHCA 4BLVA 1BC5A 3F4KA 1KIAA 1XDSA 2AN4A 2I6GA 2JH8A 1MJFA 2YX1A 3NJRA 2EFJA 4E32A 4UOEA 2IDJA 3KQSA 3BKXA 2IDKA 4QDJA 2XYQA 2HWKA
chains in the Genus database with same CATH superfamily
3HJGA 4TRJA 2W82A 3IVXA 4FGKA 3HL4A 2Y0EA 4IJFA 4D92A 4ESEA 1WLSA 1K8YB 1T6BY 5M29A 4ENSA 2QQEA 4ND8B 5COAA 2BFBA 3AL0C 1I6MA 3RFVA 4GBJA 2O9JA 3O2NA 3IP6A 1WZUA 4UEKA 2G9VA 3DXFA 1X13A 3UMSA 1R74A 4FOOA 4TXJA 4EECA 3RYCB 4PHTA 2GAFA 4UJ3A 4BO6A 1RE1A 1HE3A 2AN5A 5AW5A 3U4QA 4MVJG 4CM4B 1I9GA 4FHFA 3LKDA 4BWFB 1ODSA 1CQWA 1XQVA 3AGQA 1UFZA 1J5EB 4OREX 1JNYA 3JPYA 1NVKA 4PVCA 3W8NA 3H7AA 4D9JA 2IU3A 1P2BA 3ZXYA 2C9DA 5ERXA 2JFYA 4WVFA 4RM2A 2BFBB 2ZB8A 3ZZ1A 4WNAA 2H8KA 1GSOA 3LY8A 3R7NA 4MITA 4KHPM 2ZW9A 2HWXA 1YDHA 3W77A 4G5YA 4F4CA 2WAAA 4RENA 2IHBA 5AOVA 3VZRA 1ZK4A 4BMVA 1CZRA 3DDCA 5CX1B 4YP5A 3ZHOA 4JLMA 1FP7A 2WHRA 4ZJYA 5G4KB 5A04A 4WNAB 3PQEA 1PWYE 5CNIA 5FULA 1ADCA 5BQ3A 3JQAD 5IXJA 4HWOA 4Z0HO 4H4CA 4XB6B 3CVYA 1BJKA 2PX5A 4XQEA 3RSZA 3MXOA 3T9DA 1NUSA 1PD0A 1SBIA 3ROKA 1G8FA 5CXUA 4GOLD 2BM8A 2D8AA 1KE1A 2Y2VA 1NUUA 4Y6QA 1P7WA 4AMZA 4PFQA 1WGNA 2R6AA 4OU7A 2QJRA 5AVQA 2ZROA 4Q66C 4WJLA 3W6OA 4HHEA 2ZE6A 4IJUA 2IWRA 3R23A 4GVLA 3EDQA 4IZHA 1A8HA 2P6UA 4B3FX 4BO7A 2FAXA 4JSTA 3IERA 3KJHA 4MJLA 2BDTA 1WMFA 4RACA 3S29A 1H3FA 3OTQA 1KK3A 4XPZA 4P3PA 3LHDA 2IYAA 3IT2A 1N1EA 4IUBS 4WZBA 3ZHUA 1PQUA 2BZ1A 3OTOB 1U0JA 2YDXA 1N8NA 1NMSA 1MH1A 2VRBA 2P91A 4BVFA 3RADC 3L79A 2OOKA 4KG7A 2QD2A 4WQMA 2J3HA 4N3GA 5B1HA 1T9HA 1VE3A 2EJTA 5F21A 1TA0A 3WIBA 1G66A 5E6JA 3FIUA 1FDTA 3ITNA 4R1MA 5C37A 4E88A 3GLIA 3VH1A 4CKWB 3SMQA 4OFXA 4K0KM 2ZRJA 4CEHA 4BEWA 2YIJA 1BCRA 2ZYWX 3AJEA 4QTXA 2OM6A 4WZBB 5E7IA 4BNFA 2YJ4A 2GKSA 3G0HA 2PLRA 1I3NA 1Z82A 4NEGA 4QEZA 3C8ZA 4RESA 5F7ZA 4J1NA 1Z3IX 2DAMA 5D1HA 1GTL1 4U3JB 4C0AC 1B14A 4ER6A 2FN8A 3T4PA 2QX4A 4B9EA 2CZQA 1KAEA 1RZVA 5AK6A 4XIIA 4BTVA 1I36A 2C0PA 1G16A 5IABA 1MGOA 4F04A 2W7TA 5J4YA 4AY3A 4X3OA 4JU9A 2CNOA 2NV0A 4N7JA 1CG6A 4EFDA 4L5AA 1BFDA 4TT3D 5JQGA 1MJHA 2QTGA 1H2YA 2GFHA 1Q1QA 4EDFA 1OHHA 4RGBA 1RXUA 2PX8A 2H17A 1KVUA 4HGOA 2DQKA 2I66A 1FXWF 4TQ9A 5D5PA 4F2LA 4F06A 1KDTA 3O3NB 4JC0A 1E0DA 3F5MA 5EZYB 1G8KA 2JC3A 5ALLA 4G56A 5DTMA 3OP4A 1NQVA 4E33A 2ODQA 5DTQA 4QSHA 3I6IA 4EITA 2WSSD 1CUAA 1D09A 1OZFA 2Y0BA 4Y2YA 4ZANA 5AXCA 4RVCA 5IVKA 2G63A 3AHCA 4L0CA 2FOIC 4AQYM 1DOZA 3W2IA 2O50A 2VWHA 1VIDA 5IAOA 2QM8A 1DZ3A 4F6RB 2Z56A 2WF8A 1W75A 3C70A 2CDBA 5CNJA 1K63A 2R8OA 4PQYA 2QTCA 2IYFA 5K0SA 2R7NA 1QHYA 4UBIA 2LVNC 4OYHA 1SC4A 3WMGA 3S5JA 1U6JA 2HLNA 4FDVA 4GYWA 4FIDA 4RTKA 3WB2A 4QASA 3T7IA 1YBVA 1GZ4A 3WBJA 3HKEA 1CRPA 4KIJA 2ZJYA 2FG7C 3RWOA 1TC1A 3W68A 4JT8A 1Y1QA 1QYXA 4TTRA 2P4UA 2Q4DA 3FSGD 2J8ZA 4O4LF 3LWNA 2XA1A 3BYZA 5K51A 2C59A 1BRMA 3A2LA 1AA6A 3TZCA 2GRJA 4X54A 2FRDC 4KXNA 4D96A 4TUWA 3AF5A 4QHYA 2D59A 4CUKA 1BX0A 3CZRA 4UBJA 4A0RA 5SYMA 2B5VA 3O4HA 1KS2A 4C2AA 4PRKA 1XMJA 1VE7A 2JAHA 3HKEB 1NVGA 3DT6A 5CA1F 3C24A 2I65A 1LTHR 3H87A 2RH9B 4IJVA 4FEGA 2PQ0A 3OFNA 5JVDA 3ACDA 4GPAA 1GV1A 1AC5A 4E07A 3JVDA 1U0HC 3D6FA 1G6Q1 2CBGA 3LT4A 3JZMA 5E4FA 3AUSA 3GPUA 5KNCD 3B7PA 4IBJA 2D00A 3VNBA 3TOVA 1LW6E 2DQSA 3EZYA 3WDMA 4MWCA 4XEHA 5I7SA 2WF9A 1GNQA 3PGJA 3PNQA 4BFXA 4D4KA 3FAKA 4JC5A 2Y6UA 4E4RA 4JXXA 4NEQA 3ZCPA 1U0LA 2D62A 3C5HA 1FX1A 1WZNA 3IAHA 3KVYA 1P9LA 4JJFA 3THWA 2YIVX 1DKUA 1CLUA 3T5PA 3D2CA 3W2TA 3TPZA 2DY1A 1D0LA 5GZ3A 5AJVB 4S1VA 5FBWB 3KQKA 5E9AA 4RD6A 2CHGA 3FWPA 3Q3VA 4LY0A 1XLUA 3PBKA 4E94A 3PUYA 4JLKA 1JHRA 2GEVA 2KLBA 3S2YA 3A36A 3JZAA 3MEQA 2P35A 4Y7DA 5F9MA 3B1KA 4QNRA 3CIFA 1A98A 1ZUNB 2E5LB 4N7MA 3PCTA 1UFKA 4I14A 3H9BA 4UM9B 5JAUA 4HAZA 2W8BB 3THRA 5JADA 1ZXXA 4RJJA 2EX0A 4Y2GA 2IJGX 4RVUA 2PRJA 1M8FA 4HX9A 3CEAA 4BRSA 4HPJB 1RTKA 2YWHA 5GJVC 4MEAA 1MTOA 1E6WA 1W0JD 1G9XA 1X1RA 4C14A 2O2EA 1C4KA 4B4VA 1CX9B 1YQXA 3MERA 4YI3A 1P9RA 4FDUA 4Q9KA 4YV7A 4WI1A 2OZKA 3FTPA 4A7PA 5KYUA 2HQ1A 4PXAA 3KOWA 1EFDN 4ZN6A 3HUDA 3O84A 1DRKA 2YXDA 5E7MA 4RKFA 2H1FA 1K68A 2JLRA 1TGYA 2WIDA 1KZ7B 1GV0A 2AXPA 4NQRA 2Z8YA 4JUIA 1BFUA 3DMFA 1QR6A 1K3FA 4UHFA 4JLSA 2EEPA 5T8KC 4X44A 5LZ9A 3RK0A 3K53A 3PEEA 1N92A 2JH8A 3CKYA 3DFZA 2KJQA 4Q19A 3D1LA 1Q2XA 3I01M 4BASA 1ZK2A 2VH2A 1T9KA 2CEAA 4GLJA 1FJGB 1H5QA 1GUYA 2WSBA 1MD9A 1VZ2A 3I64A 4OUKX 4I50B 4FHGA 2OILA 5MF6A 5A4IS 5HVNA 3LXRA 3ND9A 3PC8C 3OA0A 2D1SA 5B37A 3NUZA 2KW5A 3SN6A 1UKZA 3RUDA 1WOYA 4YFVA 1U8AA 2FK8A 1EQAA 5DNEA 3ZN2A 3RS8A 4DR3M 2ILVA 4LRUA 4IKEA 3SJUA 1U5AA 3VAAA 4LJ4A 3A8TA 3ZWOA 2XQKA 3R4VA 2EKFA 3KPJA 4JLNA 3QOYA 4IVNA 2AXEA 3U7HB 3NONA 1W9MA 1UBTS 1J8YF 5AOBA 2UXDB 3T12A 1WKCA 1VE6A 2EQ5A 3RS7A 2ZYTX 4G8JA 4ZOLA 1UR5A 1BYUA 5FO1A 5ICGA 1QTRA 2C7QA 3ZU5A 4ZYXA 1HWYA 3O1HB 5BW8A 3A0UA 4PLFA 3QXGA 3R5FA 2QSZA 3L6BA 3QVOA 5BPHA 1NVTA 2YL2A 1VYVA 1YFZA 3VC2A 1RJDA 3LSTA 4AUEA 1ZWLA 3SZGA 3RSSA 1SIOA 3E3NA 4CM8B 4MKXA 2MSWA 2IGTA 3NJ8A 5CW1A 2LBPA 3NKLA 3SF8A 1INLA 3HDHA 1JA9A 2IXAA 4ZOLB 4PFSA 4EJ6A 1MX9A 5K0CA 5TQ2A 3E7PA 1YZYA 4NOLA 2NUTA 4NFLA 2R4TA 1EB9A 3FPGA 2Q1WA 3IC5A 2OGSA 4BNDB 4B6JA 1J0DA 2HSWA 4ZDIA 2YC4C 4EI7A 1F3OA 1Q16A 3AR3A 4M0KA 4JJ4A 3JQBA 4N9WA 1GQFA 3IX7A 4QTTB 3F3SA 3KDSE 4L5YA 4WZAA 5FH9A 2ZIGA 5TQ2B 5CVDA 1GTZA 1SCBA 4Z0TA 3RO7A 4CKZA 2ODTX 1YDWA 2FYTA 3U2QA 1EYZA 3AY0A 2KB0A 2NUTB 3NGXA 4FEYA 4K6GA 3GLSA 1TK9A 1FEZA 2LW7A 4OMDA 5DX1A 1E77A 4BMZA 1UAAA 1RVDA 4KR7A 1GRCA 4LWPA 1EK6A 3EC7A 2DPHA 2QD1A 2PKWA 1FS4A 2BTQA 2E48A 5TS2A 4CIZA 4XIFA 5F2EA 4WZAB 4BHTA 4F4FA 1R4ZA 5KNBH 3VNVA 1KI9A 2CF6A 1P0CA 3M7IA 2OP0A 2BR4A 2Y76A 3OESA 4ER3A 2ZJ8A 3QTLA 1N25A 5G0SA 3UAOA 1RYHA 2WE7A 1YONA 4FOSA 5KOHB 4RVFA 5FLXA 1USIA 4L7VA 2A33A 1FVFA 2J7PA 3SKVA 4LF8M 4DUPA 2QLBA 2IPOA 3CB4A 1MQ8B 4AW4A 3DV9A 2PWBA 4DR2B 1P72A 4MYDA 4KXVA 1PE0A 1IBRA 2ZI9A 1XWFA 3SX4A 2P5SA 3VU0A 2VCHA 2I80A 4B4KA 3H5LA 4OBBA 1U3VA 4FZ3A 4RA9B 2ZCVA 1S2GA 4DLUA 1NP6A 4OB7A 3RG8A 3F73A 3ZBQA 2B9EA 2GHRA 5BN5B 1T36A 1JRLA 2J9FB 2X9GA 1KO7A 1NXTA 2PGJA 5DM60 2F00A 4ARCA 3GHYA 3JD4A 4YRLA 2MR6A 1QQTA 3WOHA 3SS9X 2GERA 3OJXA 4P7BA 3VX4A 2K2QB 2ONJA 3TWLA 4CU2A 3ZGZA 4UOQA 5FR2A 2O0JA 1W47A 3QLUC 1YIOA 1TTTA 4GZ3A 1T36B 2CYAA 2XGOA 2AUMA 5DP1A 3S70A 4GMHA 5JD4A 2N42A 3PPIA 5IC5A 3W7BA 2I3AA 2P77A 3GYGA 3DEIA 4ENQA 1NF3A 2GAIA 2XYQA 4QYIA 2RG7A 3H17A 3U6QA 1J2TA 1F06A 4NVRA 1RQGA 1P62B 4Q7EA 3WIOA 3KKKA 1H2RS 4N0QA 1KRXA 1NJ6A 3RJ5A 4DQKA 4RE5A 3U17A 3DHVA 3THOA 5JDCA 3TG2A 1ZOSA 3OCZA 5HQJA 3PWSA 1V6AA 3KJQA 2LNDA 2C4TA 1U9IA 4QPZA 1DJLA 3SVTA 3R3UA 3EWAA 4I1YA 4G4GA 1GITA 1ZJWA 4GLBA 4QYIB 1Y8GA 1FUIA 1EWKA 3NW9A 5FRDA 2I6SA 3UPUA 3WGHA 2YVLA 1RRKA 2JLSA 3CH4B 1YZ3A 2BZGA 3A6JA 1J0AA 2AF3C 3F6PA 4UC0A 1R8XA 3UM9A 1SK9A 2YVQA 3UVEA 4XGKA 3USZA 2NOAA 5ILQA 4RDIA 2EFGA 1QLHA 3BE8A 4XRGA 2JH3A 2O3QA 4L76A 3ONWA 4DCJA 4AYWA 4YN3A 1NXQA 2G28A 2ZUWA 4HPWA 1QNFA 4C4PA 4HF7A 1UBOS 2DHQA 3FRIA 3DNPA 2V54A 4GECA 3I2YX 2QTLA 3V1KA 2Q5OA 3THGA 2Y8EA 2NQTA 3LDAA 4BMNA 1SHZA 1QG2A 1XTSA 1UZAA 1U7OA 1U0NA 3IV6A 1OI7A 4DJTA 1PCXA 4EW6A 4BQOA 1WGLA 1IEWA 1UJ4A 3DOHA 1Y7IA 2XT6A 2YVKA 3PUZA 5LUAA 2ZSAA 5BNZA 3AT1A 4ZDKA 2NWQA 5HUHA 5GWXA 2QORA 1Z7BA 3ASZA 3EUWA 3SHVA 3FF4A 1YAHA 4JY7A 1N6OA 2BKVA 4ZT6A 3PTLA 4EF4A 4XGQA 1C80A 4EH1A 2D3WA 2WKPA 4LQDA 2Z4SA 3OQIA 3S44A 3UC9A 1QQ5A 4GT1A 5KYYA 5CHEA 3GPBA 1VC2A 3EFBA 3AVPA 3M7GA 4DILA 1U8FO 1TU0A 3ETGA 2UXCB 5EHIA 5AUQA 4ON9A 2O8FB 4M1QA 4XPIA 1F6WA 1XQ1A 3FPEA 3EGDA 3BXGA 1EP3B 2ID9A 2ZQYA 2Z1MA 5AVWA 4XVRA 2QL6A 3AUYA 1QK3A 5JPCA 2VCEA 2X8WA 3GNLA 1XWIA 1D0SA 5KYYB 3TNYA 3ZZMA 2ZYRA 2XT9A 3SQDA 2PD4A 4WOJA 3H1FA 1I9CA 3PA6A 3I6YA 2G82A 4JK3A 1ZICA 5ERGB 3DTTA 4QGAA 5ITXE 2NZ8A 4ZYWA 1Z62A 2JHFA 4AG3A 4LJ5A 4Z6YA 5HILA 4EA6A 2VJLA 3Q5GA 1T15A 1T0BA 2GSDA 3AC0A 3OCXA 5JRZA 3JQ9A 2FEOA 3ILYA 4U7WA 2C88A 1ZHHA 2Z4RA 5ED0A 2B5OA 4ZJUA 3KYCA 4ENPA 4CFSA 1Z63A 2BKXA 3D8HA 5F5XA 4LF5B 2PPLA 1P6XA 1JR2A 4N49A 3QY0A 1K7EB 2ILTA 2AEEA 2PMCA 5SICE 1AHPA 2W2PA 3WBBA 4NMHA 3SJZA 4WEQA 4YI5A 4IINA 2FHSA 2PVPA 4BEJA 1EU1A 3IVAA 4HNUA 4ACBA 4TLBA 3LXMA 4BB9A 5JW6A 3Q8XA 3D4NA 3PUIA 1RYEA 1GD1O 4LGVA 4MV7A 4RF3A 1FMJA 4BNXA 2AI3A 1RP7A 3ANYB 1FTNA 1GKUB 3FFXA 4JLDA 3UTDA 3HDTA 1OLSA 5JXWA 3GCWA 5K5EA 1RQLA 1IIBA 1EFKA 5EQFA 2FPOA 3X3HA 3SHGB 4G65A 3L28A 4PIMA 3SAVA 9LDBA 3LDFA 5BN1A 4EHFA 3LXXA 2CLCX 2PZFA 2JFPA 4XXHA 4FT4A 3TL4X 1R4MA 3GRVA 2Q5EA 1YE5A 1OLSB 2AK3A 4BUCA 2ZDQA 5JS8A 1JAHA 1J0CA 4RPHA 5K0NA 1TMYA 1EFRD 2UUCM 1WJGA 1SVOA 1NMQA 2FMKA 5KX5F 4YJKA 3KT3A 2ZLBA 4KFRA 2CXHA 1EWVA 4XWGA 4XIJA 2WIAA 5DLYA 3LK7A 2JJ1D 1R12A 1SUSA 1RBYA 4L9SA 3PKJA 4JBLA 3P2MA 1SKUA 2AJLI 1SOUA 2GBPA 5EE5B 1N2JA 1UK8A 4J0JA 2VJAA 4YYEA 3CLHA 1JI0A 4PCVA 3SR3A 3C7TA 5L3VA 5KDDA 4WK4B 4HAVA 1FXSA 3O26A 3V7WA 3D59A 3SHQA 2IT1A 5EQDA 1Y8ZA 1XD8A 2IKSA 3GMSA 1J8MF 3NO4A 3N2KA 5F35A 3DAPA 1TOAA 4B17A 2BEUB 2JW5A 5GOZA 2B7CA 2F3TA 3I92A 4Q03A 5IXYA 1DOAA 1YDEA 1YT5A 4DE5A 4D81A 2Z4TA 1RRPA 5DNAA 3UJNA 4QAJA 3T0GA 4UCWA 3UTCA 2WSYB 5ECWA 3A6DA 3K0FA 4P0PB 2JIBA 4TXHA 5FSWA 2XTNA 3BF8A 1W4AA 2NZVG 5B58T 3BIJA 3UMRA 3HXLA 1MBZA 3B48A 2HL7A 5MN4A 5AWFC 4NNJA 4B3MM 1S3GA 3REQA 2HJSA 2JI6A 1YRWA 4LTDA 4W5WA 4F45A 4GLLA 2A9JA 4DVJA 1TF2A 4O2BB 4AY6A 1Y3BE 3SYRA 1V8DA 3GFTA 3OKAA 5D87A 5EWJA 4CE6A 1W5EA 3HA2A 3SMPA 3EQZA 3IP1A 2QZJA 3IPAA 4CMIB 2P3QA 5BYJA 1DQPA 3LPLA 5GV8A 2GZDA 4NBTA 2FWNA 1S6YA 3AO0B 1UAYA 3N5KA 3AY6A 4XSHA 3REQB 3C5CA 4PZLA 4A73A 5D51S 3RJMA 4MMZB 4RH1A 4M8LA 2J33A 2RGOA 4JHLA 4M7RA 4G5XA 5G0WA 4A3SA 1DGHA 2XB6A 3LUCA 4IRUB 1ZM3A 3KJXA 4WY2A 5EWJB 2AS0A 1BD4A 4E03A 3C3PA 1UKCA 1IU9A 2IYTA 1JEAA 3O9VA 1HFKA 2PKEA 4QEDA 2AEJA 2DC1A 2Q6OA 2IIVA 1WMSA 1PZEA 3MQ2A 4AJIA 4AROA 3TOXA 3BE4A 1BKSB 1GG5A 4FQ8A 1G5IA 1M1ZA 3IKMB 2I62A 4B3XA 2WJVA 1DGHB 1VDMA 4DB2A 3WYEA 1EGAA 3A4VA 3K2LA 3DD1A 3OM0A 1ZGAA 3QWBA 2O8VA 5CURA 2OV8A 5KU7A 4E30A 4KHPB 1VP3A 2GNAA 2IIBA 3UPTA 1WW3A 3QPWA 4Q9JA 4EB8A 2OC4A 3WQQA 3V34A 4MVYA 4PYQA 2CJYA 4OB8A 3ZH9B 5F9FA 1FSGA 2FR1A 4AKSA 2QNRA 5ICFA 1QGED 1JILA 1KMHA 4K03A 3UMCA 5H4HA 5AKXA 4PTYA 1LBTA 4D6YA 5C7YA 3OTHA 5CLHA 4N0PA 1UKAA 5KNBA 2H2HA 3DF7A 2GNOA 1Q0QA 3ZCQA 1FMLA 2WTMA 1VHQA 4ZYTA 5F4BA 5KSOA 1PAUA 4NATA 1RM0A 1QIHA 1FW6A 5AVSA 4PLZA 2Q3HA 4RA6B 3O31A 3AY3A 2HSEA 3KOYA 3Q1LA 3Q7QA 2Z3XA 4H35A 1IDOA 1R88A 2OBYA 1ZI9A 3HYCA 1H69A 2W2OA 2J5XA 2XVMA 4KDFA 4NOOB 2EARA 3CG4A 1UBCA 3WJ2A 4BN4A 1ZNWA 1ZZEA 2RHTA 3I3OA 4UVHA 4B35A 2PMWB 3RUEA 4B83A 3OHPA 2XUGA 1H0KA 3EVAA 3QUBA 4MWDA 1QDUA 1K7XB 2C7VA 4JB8A 3ZBUA 3TLGB 1Y8RA 2DUWA 1G21A 3GI1A 3JASB 1OLOA 1NR1A 2CDCA 3P52A 1EI9A 3N8KA 5L95A 4CBVA 3TM5A 5EIOA 1A50B 2XECA 3LFHA 2OGZA 3ZLBA 5TMBA 4WL0A 4UMEA 1C9EA 1WUTA 1FSPA 2A3NA 1PLKA 2VPZA 5JANA 2QX6A 4HDSA 4IJMA 1QTQA 1D0KA 1Y8RB 2F64A 3BD6A 2VHUA 4K0KB 5LQSA 3PI7A 1GUZA 1DUSA 3WB1A 4KNVA 1ZEJA 3BULA 3OF2A 2FPWA 3HJ8A 1A4XA 3HNPA 4LVNA 3CPHA 3LAWA 1EUYA 3LVFO 4PPYA 1QRDA 4NBNA 4HDSB 1X1DA 4GICA 2V6FA 2O2HA 3TEJA 5JRJA 1NNI1 1ZRHA 3OUUA 5J5VA 1BVYF 3N76A 3CVXA 3I2KA 1WABA 1KGDA 2YNMD 4WBNF 2A1IA 5AICA 3FNGA 1MXFA 3K6JA 5FLXS 4EYOA 3M3DA 3PNSA 3UOAB 5E2BA 5IBQA 2VEDA 4DA4A 1CVRA 3DCYA 4O2LA 2I34A 1J0EA 1QZEA 3M70A 5DBIA 2M6RA 4FHZA 2V7EA 4MS4B 4L4UA 2CLDX 1O87A 3G79A 2P75A 3LZ6A 4FJ0A 3TJRA 3SIRA 5ECYA 4F1JA 4AN1A 2QN9A 5EE3A 2ZSUA 2C2KA 3UBTA 1O57A 1J42A 4ZTZB 3DHYA 1II0A 3E4DA 1V9CA 5DHUA 5JNSA 1DO8A 1W36C 5LOVF 1CJSA 1HY3A 1KFBB 5JECA 4LFBM 1I1HA 4FC6A 5A05A 3T9BA 1YQUA 3R44A 1GTG1 1P7VA 3BGIA 3W6NA 4QBHA 5B2ZA 5TJ9A 4YMHA 3GH1A 2EKDA 2ZM6B 4J1TC 3A6KA 2WYWA 3GW8A 4AQYB 2R8ZA 1KORA 3H2HA 2HNKA 3QV1A 1BXGB 4PHHA 3SHTA 2RBGA 1EVQA 4K9SA 3JVEA 4RF4A 1PGJA 2ZBDA 1W6RA 1BHJA 4GVXA 1P9NA 4IIYA 1ST3A 5J23A 3IUEA 4LSGA 1DPGA 4UDYX 3SQLA 1IPFA 1Y98A 1U2EA 4QUGA 4LJYA 5FJJA 3SS8A 4W5OA 2WK1A 1RPTA 3H9JA 4TZKA 3LQRA 2VRCA 3RSQA 2SKCA 4NARA 2P3LA 3OIDA 1IHPA 5F9HA 4V38A 3L4BC 1HOTA 1GFWA 4NOJA 1PBNA 3ERCA 3U16A 3OJFA 3JSAA 1DINA 3ZV6A 4AF7A 5LIPA 2YVAA 3K72B 4EKIA 4OI0A 2PKYX 2FPMA 3DWIA 3H83A 4QUIA 2H52A 5BN4B 3ZX5A 1R0SA 1PN3A 1IBCA 4W9MC 4LF5M 4U4AA 3MWYW 1BDHA 1VMDA 3OPMA 5GP1A 4CVNA 3CEMA 1O9GA 2A7XA 2P79A 4N12A 2ODNA 2FUEA 2FU5C 1M5RA 4OHYA 2E87A 2VK8A 2CMFA 2V7QD 3SEAA 1K92A 4KVAA 5FTNA 3U9LA 3WK6A 5T6BA 2Y1KA 2EFJA 3DMPA 1NI4A 3HKCA 3KEQA 2R4JA 4OH1A 3PXBA 4ZWNA 2X77A 3F9CA 1A76A 4GXTA 1BS9A 4X8LA 3U40A 1BVSA 1KZYC 4DMHA 4WMLA 1IVNA 2DWLA 4UCFA 2BSQA 2WA1A 1TFRA 4YT8A 2AZ4A 2Z58A 1I2DA 3M6FA 2BWEA 2UVPB 1KU6A 2HFJA 1JI3A 1XVUA 2EBFX 1H2AS 2FFRA 2B83A 4L8LA 1NI4B 1D6NA 4I1IA 1QIMA 2Y99A 3K2EA 4C2BA 3FR8A 4GITA 2OD7A 4D82A 3ULKA 3VKGA 2VDWA 1GZ7A 1T13A 4FXOA 3NOOA 1C2TA 4E5KA 1EFHA 2TMKA 3JWHA 2OESA 3NDPA 1PSDA 3ONVA 1N2OA 5IAAA 4H08A 2QRQA 4A23A 2P78A 4XKJA 3RSHA 3HWSA 4P81A 2AI1A 4P8RA 1U4OA 3OJEA 3FI9A 3I5XA 4UU7A 2OPHA 4FILA 1WF6A 5KQ8A 1NULA 4C7BA 4EARA 4XQCA 3N5CA 1YUMA 4X6XA 2FCAA 2GETA 2L18A 3TXAA 2OG1A 3WP0A 4B3RM 1BCSA 2QPLA 2O7NA 1L2DA 3CGWA 2RAFA 2M60A 4ZT7A 2Z2JA 2W6OA 3NTOA 3NVMB 4MYSA 1V5IA 2PEZA 3M9XA 3VDXA 2G71A 2X3UA 3B7GA 2ZP1A 4QREA 3FKSA 5T4BA 5CU7A 3IH5A 3K6RA 5G0VA 4B5LA 1SJ9A 1I4TD 2WT9A 3ZV5A 1QGUA 1Z4MA 2XW6A 3Q2IA 1DFHA 2BKEA 1Y7HA 5AKYA 3WXMA 1M7BA 5GAJA 2C5EA 4A0QA 3IOYA 4B84A 3R8XA 1E3QA 3FR7A 2HPZA 1QHIA 3KFUG 4P32A 1S9HA 3S55A 2O7QA 3BE6A 4TQGA 2CJWB 2BMVA 3RFUA 2IEBA 5IFKA 1UCFA 2CNWD 1QGUB 5GVRA 3VR4H 1PL8A 4G23A 2HK9A 2BM0A 1L4UA 1TKCA 3AHDA 2JVKA 1TZ2A 3GBPA 4ND8A 2A4MA 1NYQA 4KSCA 3NHZA 2HA5A 1U7WA 1MNAA 3MJVA 1ZW1A 1Q50A 3QY9A 3VR2A 3RYCA 4CDGA 1P19A 3GGOA 2J4CA 3SC3A 2HBYA 4QPCA 3KUCA 4DSOA 2O2SA 2DFTA 4QUKA 4WRRA 4BX0A 5F1OA 1C7EA 3G23A 4DR3B 5DV9A 4B3IA 4ZU6X 4TKMA 2GCEA 1JDSA 4W5RA 5DGCA 1TJ3A 1KS9A 3FPJA 5AVZA 3Q98A 1OXVA 3K6KA 3BCHA 2F3UA 2IOHA 2CUKA 5K0LA 1AZWA 1L4NA 3T7JA 1R5LA 2XUKA 3WDSA 1N77A 4NYJR 5CX1A 3BF7A 3Q1KA 7REQA 3B1FA 2L19A 5G4KA 4MRSA 1JQBA 3G1UA 4Q1EA 3QM1A 3ONFA 1W9HA 2HM7A 4RPGA 4B85A 3KYDB 2R7AA 1Z4NA 2CB9A 3O4JA 3PGXA 4EY7A 5EKSA 2DAEA 1HR0M 4GE0A 5GZ1A 3WQSB 3NP9A 4I9GA 2P2CA 2VAXA 3F5SA 2HQRA 4HXEB 1AUVA 4FFBB 4KO2S 4B6FA 4BQEA 7REQB 3FLBA 2MYPA 2QDKA 2ZBKB 3HCRA 3K8QA 2B4TO 3LKVA 3AEYA 5FTJA 5K8CA 1GGFA 1NXOA 3QEKA 2R6JA 3HDJA 1YR7A 4TTSA 4CG2A 2I0FA 3RF6A 1GXSA 4N76A 1N6KA 4CDMA 1G4AE 3WLTA 1Z4IA 1TQ8A 1XVVA 4Q7MB 2XA2A 2HB6A 1B43A 3IQHX 1W94A 1YC5A 4B34A 1SVNA 1U8UA 1R37A 2VUTA 1ZIYA 5GGXA 1S89A 1L9KA 1G8GA 1ZD1A 4WURA 2QMYA 5I9NA 3PNVA 4WFIA 4J2OA 4GQIA 4Y3UA 4EHBA 2G1KA 2FZKA 2QTTA 3EF1A 5AKKA 4QNNA 4ESOA 1WCWA 1PZMA 3UJ7A 3IUNA 4KSYA 1GXSB 1X39A 1RXSA 1Q0LA 4CKWA 3GRUA 2BUAA 3IVCA 1K6IA 1WV0A 2WJ6A 3ICVA 3AL3A 2G7MC 2F1RA 5PGMA 2ZUEA 3VPAA 4F84A 1C7YA 4JITA 1SQ6A 3HN6A 3MWJA 2QA5A 2E4VA 4LF8B 3RTGA 1WVMA 4B3DA 4U3JA 5BR8M 4JC4A 2ANBA 4TX1A 4MGYE 3UW1A 4MWGA 5HJ5A 1TNDA 5LB4A 3H5NA 2X8AA 1U3DA 5BSWA 3BXOA 4C2TA 2XFSA 1Z5NA 4FINA 3AEZA 5HBGA 1O4VA 1UZLA 1RC1A 3ESXA 2QVLA 3HS3A 4HGYA 4PX9A 1C8VB 5AHXA 3LVQE 5J2UA 1YQEA 1XPUA 1TH4A 4GOOD 4F11A 4BJ1A 4RTNA 2JD1A 2H4JA 3L8GA 4XM2A 4B45A 2UUOA 2VG8A 1E20A 2Q5QA 2RGBA 2H65A 4JUDX 2DLDA 2QDXA 2C92A 1QQWA 2Y1CA 5EZYA 4JA0A 2VUSA 4F56A 2VYVA 2GVNA 5SYAA 1NVFA 1ZA2A 2YH2A 4ZEXA 2CL5A 3IFSA 1OGJA 5J2UB 3LZDA 1S7CA 2CBZA 2V7PA 4FLFA 1EP1B 3IA2A 4AYTA 3GLTA 4LMBA 5F52A 5DLQC 4P31A 2ZTSA 5E6UA 3WIDA 2WUGA 2LVPC 3C3WA 4F6RA 3NP7A 5ITRA 1MB2A 1VG9B 1F60A 2J08A 1OTYA 4EVQA 4LXYA 5AKHA 3X1DA 3F6RA 3JQEA 4UUBA 4BGEA 1QLJA 1IMJA 1KMNA 4KE8A 2RGNC 1SD1A 3HO8A 2YMPA 2ZM6M 2M9MA 5JJKA 4EJMA 5CFLA 4MP6A 4RE6A 3CY6A 5KTMA 5CT6A 5E6UB 2FXVA 7YASA 4FDTA 5KOYA 5ER9A 4B31A 3NMUF 1K6EA 4IG9A 1X9GA 4GX1A 3NHUA 1KRWA 4MUNA 1JQLB 1JECA 1G7CA 4JDPA 4RMGA 1Q20A 2WSFF 3C4JA 1ESZA 1RZRA 2OCKA 3NAQA 4MRRA 3DSRA 3LVVA 1D4ZA 3KOUA 2RI6A 5WRFA 4NCKA 5LBTA 2P9TA 3D0RA 1H2FA 5CDUA 1KYTA 5G0TA 1G7SA 1UFVA 4YO7A 4NPAA 2IOFK 4TKVB 3HHEA 4AS2A 1PUXA 3ZY6A 3K8ZA 1K08A 4O0LA 1DMSA 1PNTA 2QYSA 4QX6A 1TYAE 2D2EA 3T3HA 5FUMA 3ESYA 2C97A 4MIOA 5JLJA 3NANA 1KIAA 2NZWA 2YMMA 4WINA 4S1OA 2G70A 1OILA 4XRRA 1SUBA 3OICA 5K45A 3TSAA 1E60A 1XOIA 2BRUC 3HBAA 3AZOA 1L8LA 3TW8B 3BWYA 4GHWA 1H1DA 2WWHA 2W2VA 2L09A 3MVEA 2GZAA 3FPHA 1R0LA 3ZIDA 1M2EA 2C61A 4N5LA 4Z99A 1OZGA 3P9ZA 1H5NA 2H2FA 2AKYA 2J0EA 4YRAA 1AQJA 4JI1M 1KOGA 2VNSA 5IAGA 1X0XA 4N5NA 4CRWB 2W58A 3D7NA 1SZDA 3NTQA 1ZUNA 2GUGA 4PNHA 4DL9A 3RKRA 1V45E 4HAUA 1K06A 1MN3A 2W8BA 1T3TA 4M9SA 4RELA 1UJ5A 5EJ2A 2X4AA 2F2TA 4KGDA 1VBNA 5ALQA 2ONKA 5I7HA 1OIXA 4TMVA 2AFRA 2FFQA 3O4IA 3ME5A 3Q8LA 3EFOB 4CLOB 2Y4OA 4YMVA 3M6WA 4HOYA 3I5AA 1JUDA 1QV9A 1Q1ZA 4H3HB 4KI7A 4XTCS 4MPRA 3PTAA 3U44B 1K98A 1OAKA 5A3RA 1X0VA 3ZCBB 1DELA 3V1TC 3EPRA 1PL7A 4X61A 3O2JA 3FNRA 4KX3A 4QARA 5K3CA 2GD1O 3L0CA 4GOMD 1MXHA 1K5PA 4C04A 1IB6A 4PANA 5EZSA 5IN5A 1E6LA 1SUEA 9MHTA 2BUBA 3ANSA 2JGNA 1R6DA 3I53A 2Y0TA 1EZ4A 2WAXA 4X63A 4KREA 2F17A 3KTDA 2DVMA 4LRXA 3JD3A 2CP8A 4Z5XA 1V7ZA 1LGYA 5AVXA 3DKVA 1RI3A 1XDWA 1LQ2A 3QNUA 3AJAA 2ZBQA 1YZTA 4EO9A 4P7FA 1KOFA 4D4HA 5LP6F 1RQPA 4JI6M 2ZWMA 2DLNA 3TFOA 3ZE2B 3DE5X 4I50A 1H2BA 1YMQA 2HF7A 5ECGC 4TROA 3MLBA 2R5FA 2Q8PA 1JLMA 3U37A 2ARKA 1DBSA 1T2VA 1TPZA 3FNBA 4O02B 3Q9LA 4CTMA 4LNHA 3TB4A 2WUFA 3EK2A 3QWAA 2I7CA 1AG9A 4NNOA 4NONA 2P67A 1JFVA 3PICA 3CNNA 3V6MA 2O8DB 2DBQA 4PYIA 2FUG1 3LIIA 3D8RA 1CYDA 3GN1A 5F23A 3I6MA 3NTVA 2J09A 2J0SA 2RONA 1JE1A 3HYLA 4OI4A 2PH3A 3DBIA 1E79A 1M1UA 2UUCB 1IPHA 1U2DA 1K27A 4GSLA 3VDUA 5KSPA 3W04A 3D3EA 4JVNA 1BVUA 2PH7A 1NY6A 2OEPA 2I7DA 5IW8A 2C8KA 3EZ2A 1YCHA 4OMFG 4EHKA 1WR8A 4CM8A 2C5BA 3OZIA 1EE9A 5DYNA 3O0DA 4LOIA 1DC5A 3P2OA 1KBQA 1ZZGA 1U8YA 4WK2B 5KTPA 3ZCSA 1LW7A 3ORQA 3FPAA 1XTJA 4DZTA 4QT0A 1FSSA 1JG7A 5BSKA 4FJ2A 1XP8A 1HQDA 2RB4A 5IDQA 3GZJA 1QS0B 3IEXA 4BNDA 3VR4A 4YWJA 3C5VA 4J76A 1U3TA 1GZVA 4C0BA 3EZ7A 4YJ3F 3GQBA 4RPKA 4UNNA 2XWPA 5JY6A 4I3GA 3W9BA 4PTZA 5DCWA 1X38A 3VU8A 1SBTA 1DC6A 3BKWA 4L0QA 1KEVA 4UNIA 4YT2A 5EWMB 1V41E 3N2GB 3WSVA 4YWHA 1U2GA 3ZQ6A 1D0IA 5A9SB 4IX9A 3HDQA 4EJSA 2W22A 1A5TA 2AX3A 3CVOA 4F86A 3PIIA 4B3MB 1C7ZA 4Q02A 5JEDA 1TH2A 2O0LA 3GQBB 1HYHA 2QMHA 2EJWA 1RACA 3KSDO 1GUFA 3SJAA 4Z49A 2VXCA 1KHTA 4F3YA 2HBZA 1RD4A 1GU7A 2HNBA 4YAOA 1L4KA 2HHLA 3B82A 4RPCA 4CFYA 5FUQA 3TF5A 2EHDA 5KOHA 4EJSB 3MLAA 3D31A 5HFNA 1YRBA 5B3JA 3NHSA 4CFZA 2NU8B 4B32A 3L4JA 2ZPTX 3W3ZB 1T5DX 4AJKA 3FWKA 1GRNA 2REOA 1UC5B 2FDRA 1JAZA 4JYMA 1OXMA 3M6UA 4D0GA 5FCDA 2JXNA 3LFUA 3MG9A 4RA9A 2QROA 3I6ZA 1PKEA 3TW0A 4NF2A 1MAHA 3N2IA 3JQRA 3E2MA 1F4LA 1VKOA 5BN5A 3PJDA 5EJGA 4MDFA 2LCFA 3A1FA 2J9FA 3T3MB 4DN6A 5LSAA 3STWA 4DLXA 4ZI3A 2VHWA 4CQMD 3KQVA 3RGGA 2BHLA 2O59A 4KR6A 4C4AA 1KO4A 4D4MA 3FTFA 4MP3A 2DAPA 2GPTA 2O57A 3CE9A 2QVCA 4D9BA 1GTVA 3EQ9A 4MA0A 4HLCA 1VFNA 1XIVA 4U0JA 2PQMA 4PGHA 3RAPR 3ZEIA 4ZCTA 3WNVA 3KIPA 3HDGA 4JD5A 1TDHA 3VR1A 4YRRA 1T2UA 3ZV7A 4UPVA 5D6OA 5C2JB 3HP4A 3GT7A 3KXDA 4DV1B 1F8FA 4L9AA 3MS2A 3ZY2A 3RYFA 4LZWA 1FLVA 4EGJA 3FGZA 4RVNA 4FGSA 1KOLA 4YV2A 1W76A 3WZ2A 4MWZA 2ZAIA 5KPRA 1M67A 3U26A 4AZTA 5KHLB 4EA9A 2BI7A 4ALKA 2FPLA 1NLMA 3L0BA 4M8SA 1D2GA 3ABSB 1VSTA 3PD0A 1W4LA 4YUAA 1XZ8A 4IF4A 4HGRA 1ONOA 4DT1B 3ZU6A 1SEPA 1U9YA 4IDAA 4ASUD 5SY6A 3RYFB 4UULA 4AZVA 4E08A 5T5QA 2ORED 4EJ2A 2GTIA 1TU4A 2ECKA 3DEKA 3K71B 2JRCA 3F7OA 5IJ9B 3DV0A 2Q5IA 3M5PA 2QL7A 4MQLA 1Y63A 1TQHA 4UUAA 3RC9A 2JIOA 2HJVA 2BHSA 1FUUA 5DIFA 2F67A 2ZTHA 1F51E 3GPLA 4MAFA 5BNIA 4J0KA 1BRTA 1Y80A 5KNDD 3FCAA 2QP9X 2PUEA 1T8RA 4IDHA 4G4NA 1E1QA 3A25A 5AVVA 3CZ9A 4RH0A 5C8ZA 1Z5AA 2V6ZM 3PFCA 2QNJA 1USUA 3L01A 5CG2A 1M0EA 3DV0B 4HEJA 3PQ3A 1TZCA 1M75A 3V97A 2KNZA 1E7QA 1QX4A 2D5AA 3NHJA 3UCEA 1OX5A 2PUHA 4PGAA 1U3UA 5AW8A 3EXIB 3WGTA 4G1EB 2WU1A 5HK9A 1XA0A 1T26A 4UHJA 4E32A 4R2HA 1TF0B 1XMQB 3IT1A 3DC2A 1GR0A 4AIRA 4KH1A 4JLBA 1GM5A 3UGQA 1JXAA 2OLEA 1U2PA 2G9UA 4NICA 2C98A 2J87A 3G5AA 4MV8A 4HH4A 1XB2B 2DPMA 1W93A 4RTQA 2GS9A 2R18A 1U2QA 5B2FA 4ZVKA 2I8CA 1YJAA 2EATA 2XMBA 4R54A 4MRVA 1KR2A 2GH1A 3N53A 5DWVA 1P2SA 2GZ1A 3LLSA 3PR2B 2HKJA 3BQ9A 3UJPA 3HA3A 1EM6A 3UMYA 4EZIA 1OW3B 1NSFA 1AXEA 4RMJA 2E1PA 4S0XA 3AP2A 4RNCA 3HFGA 5JDIC 1NPTO 4B75A 4W5JA 2OORC 2FPUA 5EKXA 2VPXA 1GTJ1 1LY1A 2LVQD 3BILA 2FX2A 2O8FA 1QOZA 4XZ3A 3I2IA 4UTRA 1KSJA 4LFBB 3PXCX 4EAQA 3A3YA 3RG2A 2AJBA 3QRWA 5KYWA 3KWLA 5C8VA 2BF4A 1M72A 3AOEC 4I6EA 1UOOA 1BSVA 4IIEA 3WRVA 4C08A 3GXBA 4XIYA 1ZWKA 5HOEA 1NZJA 5HTOA 1X7WA 1UDCA 2ZATA 1XPJA 4LXQA 4PC1A 1UJNA 3ESZA 3AB8A 1EE2A 4QUAA 3G7SA 3A1WA 5JQGF 1G55A 1WUJS 2EYUA 1O97D 1XK7A 4EG1A 4K9LA 4YCLA 3ESDA 3VJLA 5KYWB 5IRCD 2H4XA 4QUJA 4P3OA 1M5TA 3OQOA 1JR3A 1NTOA 3QLJA 1P3Y1 1IHDA 2GEKA 1ZMVA 1YZVA 1CD5A 4CTOA 1P0IA 1X7WB 3GXOA 1I2ZA 5EXXA 1Z5OA 1VJDA 4DANA 5IHXA 1VCOA 3H4MA 1BH6A 3BAZA 3H0CA 5FUVA 4PC7A 2XVXA 5IFLA 4KKVA 4J03A 3RIEA 5FOSA 4GYJA 3LUKA 4M86A 1AE1A 2EF0A 4Q12A 4Q16A 1P44A 3E35A 2VF5X 4AMGA 3DFUA 1YBHA 6REQA 1YV9A 1M6NA 2NQ8A 4B4DA 3RIHA 5CXSA 1EVIA 5I7EA 2ZCJA 1ECFA 3LMMA 2FJ0A 3DT8A 3A45A 3OCJA 2GXUA 4M1SA 4Y2HA 4I5FA 5FPHA 5H9VA 1DV2A 2Z83A 4L8FA 4ZO6A 4LMAA 4AN0A 1SHLA 6REQB 3SFZA 1T5OA 1MC1A 3M3PA 5K8UA 4WE3A 4IIJB 1Y89A 2LZ0A 3U6BA 2JJQA 4ZQIA 1G4UR 1Z7EA 1I7PA 2COKA 1SD5A 3R0IA 4NECA 2PUGA 4RTSA 4QECA 4YIHA 4IGKA 4PX2A 5I5EA 3CG0A 2QT0A 4WH0A 4JLAA 1K7SN 2VDBB 1F1JA 4MVJI 1WW2A 4HWKA 5JVDF 1VECA 1GO5A 1BGWA 5GIOE 4YCAA 4RV9A 1YVPA 4U5XA 4IXDA 3NHBA 1HEIA 3Q7TA 1YB1A 3BTOA 2Y1WA 3IAS1 1G6OA 2F1OA 5KWIA 4ITQA 2YHUA 2E4ZA 3R3ZA 4UQLA 3UK2A 4LPKA 4F4HA 3LLVA 4QG7A 2XFTA 5EGSA 4EPVA 3W79A 1TCVA 3G8BA 1HC7A 2C9CA 3DT9A 1FFAA 2V6MA 4KWTA 2BEUA 2Q1XA 4V0MA 3AHIA 4ZREA 5CM9C 3TDMA 4KN8A 4UEOA 2AB0A 2XQJA 3D2AA 4B3RB 3RRMA 2X0IA 3GNTA 1F2DA 4WTOA 4UMFA 5BMVA 4GG1A 3TSOA 1L5VA 1QFMA 2BEKA 3WGUA 1O9HA 3G0BA 4OAPA 4GM0A 4L3OA 1Z29A 4AB1A 2WJWA 2PZGA 4KTVE 4WOKA 3MOIA 1VI6A 1NFFA 1I3CA 1BXZA 2TRSB 4YMLA 4X6LA 3EA0A 2WV9A 1OKSA 3T1HM 1CK4A 3A70A 2QTBA 3K70C 4YEDA 3KJFA 4O2BA 5D3MB 4IDBA 5BMVB 4TWZA 2ZJFA 4JP2A 4NJMB 1E5TA 4HL4A 2H1OA 4CMIA 2ZPAA 2QQ0A 4DNOA 1CTQA 2IZ6A 3ADCA 4B9AA 3LNCA 2P9GA 2F8TA 1YD7A 3OH8A 3KD2A 5HEKA 4F3RA 2FE4A 2PH1A 3CW2A 1ZSYA 1TI7A 4JR2A 2RHHA 1QR2A 4TN1A 4X8MA 5B1SA 3QYEA 1I5OA 3BSFA 1S3FA 3S0JA 3VYTB 1RJEA 4W63A 1X19A 3DTVB 2PS1A 4TV8A 4NS1A 1QGDA 5BWLA 4I9HA 1XZDA 1EP2B 3GG9A 1JDBC 1L5HB 1ORYB 3EMKA 4GX5A 1DAFA 3H18A 3TLZA 4ZD6A 2BF7A 3BBPA 1N9GA 1XRNA 1Y4UA 4IYRA 2JFOA 2YWRA 1FQJA 2YV1A 2N47A 4P38A 4NK5A 5G41A 1XYVA 2I6QA 4U9IS 1AKWA 4TV8B 3P9CA 4H1WA 3P2KA 3T7DA 1X3LA 1P91A 3NRBA 2LVAA 1DIHA 2HCFA 3H8JA 1XCPA 1Z0DA 5HGJA 1A1SA 3GQ3A 4WN9B 5D5QA 4GXRA 2OHFA 4MRAA 1E6UA 3TLEA 2OFFA 1HE1C 3TQSA 3RUFA 5EXDA 1CW2B 1N9GB 1UEIA 2YW2A 2UVQA 3DDHA 3ZV4A 4IL5A 1UBKS 1COWA 4OJTA 2VWGA 1H8EA 4M0FA 1FYXA 1HA3A 1GQQA 1R5BA 3MZ0A 3NBAA 1VIVA 4K1XA 1XNQM 2DHEA 4RETA 5I01A 3HXTA 4RF2A 3ORHA 4MDHA 1Q0SA 2K4MA 3UCFA 4RA6A 5EXSA 1HR0B 5JTTA 3IP3A 1VP9A 3TLYA 1UBFA 1JG2A 2B99A 2OXEA 4J1SA 3GUUA 4DV1M 5EA2A 4A2WA 4DZRA 2VK1A 2C07A 3GFOA 3DTYA 1F4PA 1FQWA 1X1QA 4F60A 5DSXA 1SC9A 5C7LO 1GTMA 2B2CA 3ZDRA 3PJEA 1XCMA 1HQKA 2AIRA 2A6PA 2XJ9A 3I23A 3UUEA 3FMFA 2O19A 4TTQA 1W34A 3VPFA 2QUAA 3QPBA 1YRAA 4MARA 3TLGA 2FPPA 4QFDA 4R3DA 5CW2A 3JASA 3I09A 2RGEA 5I9BA 3TNJA 2YZNA 3OZVA 3E9EA 3PPVA 1N2SA 3HY3A 4QO7A 5A9TA 4EHNA 1X7ZA 2HHAA 5AUNB 2ZS9A 4A0SA 5JC1A 3OC0A 2YINC 1E2QA 2YHIB 3JWEA 2X5OA 4HUTA 2HXSA 1ULUA 3O1LA 1CUIA 3G2HA 4C21A 4YASA 2FPPB 4FYHA 3IMGA 3ZI7A 1QAOA 4NS4A 1IHUA 5HUQA 4IJQA 5C46F 2X8JB 2EW2A 3UK1A 2FSVA 1KP2A 3EF3A 2QAGC 1NVMB 1X7ZB 2FOLA 4KXXA 1KEKA 3L6CA 1DKRA 1E3WB 2NV2B 3LCCA 4U1RA 1R00A 3DM9B 4WCFC 1NL3A 1UMDA 4PT5A 5BR8B 2WF5A 4X8OA 2QVYX 2ZBVA 1W5SA 3K9PA 2JGMA 4GFDA 3LRTA 3BB3A 4PZYA 5LQUA 2VPYA 3BIOA 4GE3A 4D41A 1U6KA 1C4WA 2BWJA 3GC6A 1ECLA 4M9RA 4P0TA 1YR1A 3CR3C 2EW8A 4MJ3A 5CFRA 4Z4IA 1TA9A 2PKXA 3WLLA 5DM70 4HXYA 4MS4A 4DS3A 3GLFA 1F8XA 1QUFA 1P0FA 3D4BA 3U19A 1UMDB 3EQ2A 4RAQA 1XMQM 4UPEA 3PFGA 5F3RA 1YS9A 2JHPA 2EF1A 4HXGA 4G5GA 1Z13A 1OKKA 3A4YA 1OROA 5EQTA 3QA3E 3KEOA 4X90A 1Y4DE 5JPIA 4B3BA 3GLFB 1RKBA 5NLLA 4QOSA 1NYLA 4HMOA 3PUWA 3S8MA 2PSEA 4RV5A 3IQDB 1Z33A 5TDHA 4Y2VA 4C0WA 2CCGA 2VYQA 1BXGA 4GPIB 4HJXA 1A8UA 1QQ6A 1Q57A 2G04A 1AQ6A 4LEIA 4DLPA 1JBKA 3IOCA 2PG3A 3R3XA 1Y5IA 4FR5A 1Z38A 1UP6A 1F20A 5C9ZA 3J7AC 2HW8A 3AY7A 4H7JA 4KWHA 5KCMA 3ELBA 3LTEA 2YJ6A 3H05A 5JAMA 3GLGA 4PRYA 3DVSX 2GN8A 1E1CA 3F71A 3QW2A 1FDSA 1XVLA 4UE6A 2IYQA 5KAMA 4JJAA 4R2XA 3V7YA 4N7BA 3FCEA 1XTUA 5IM4A 4YRJA 3UT5B 3PE3A 2GBCA 1SMKA 3UGJA 5LQMA 1H0RA 4KODA 2BEVA 5DPMA 4B3CA 2H9YA 1XEXB 3FG9A 1Y5NA 4EW1A 5JSZB 3OTWA 3PR1A 4RD2A 4HDQB 1C1YA 3T7CA 4NZ9A 3GLGB 5BN4A 2OO5A 3K5WA 1E1CB 4DMGA 3RM3A 3GAFA 3COJA 1QH1B 3BFPA 4HG2A 2V8OA 1CIPA 2PZJA 3LY5A 2BGTA 4BC0A 3HYSA 2FQQA 3UB4A 3JZDA 3A6FA 3KVOA 1Y3IA 4MPPA 4EELA 3KBBA 5M34A 2BEVB 3KKZA 3P97A 4BX8A 3LGAA 2IYRA 2GJ9A 3AYXB 3AYZB 4ENRA 3QBTA 4IQ4A 4R68A 1E94E 1P7CA 1ADFA 2N9UA 3ZNOA 4G4RA 3P9IA 3TBHA 3G13A 5IP5A 3WLOA 4X1KB 4X7BA 1RIIA 2ECOA 3DLCA 1IN6A 1NNEA 2OHOA 3H1EA 3GP8A 4JZYA 3PLAE 4HSGA 5L8VA 1C81A 4YRZA 3UOWA 3AERB 3IP9A 4ZDJA 4TRNA 5SZKB 2JGRA 4C7VA 2OV4A 2UVPA 1Z2EA 1C14A 4ZHQB 4XR4A 3O47A 4RF0A 1T2EA 4UTVA 3M34A 4LMRA 1MIOB 4IUCS 1IIRA 2XUOA 1YH3A 3EHEA 2IUFA 4NYIR 2IYNA 3SP1A 1WPXA 3EPJA 1BMFD 2YRWA 1Q2UA 3IOMA 5JS2A 4MH0E 1SQGA 2WBLC 2Z5LA 4CR7A 5KOJB 1QU2A 3WBFA 2YIMA 4KL8S 1Z7YA 3HN2A 3Q40A 1XHFA 2KS6A 2Y3IA 5BV2P 5TC4A 4PRLA 1M83A 2GKGA 2FG5A 2IZ0A 3X1WA 4ZOEA 4BV3A 4JC8A 4RY8A 4LVOA 3KKQA 4JI1B 5FPPA 3L0IB 1C1KA 1SG6A 4EI9A 1UXKA 3FZYA 3IP5A 1A7KA 4JX9A 1ABBA 3QLVC 2GEDA 3HLKA 2VHXA 3J7BA 3SOPA 3ZDDA 3LYAA 3OPYA 4QDUA 2H0RA 5CH3A 5LC1A 4FKZA 1KJNA 2PZEA 4POAA 3PXUA 3EDMA 1B3BA 3E8MA 1OFHA 3RIXA 3VNQA 1UUFA 2RI0A 1KYZA 5C0OE 1DOHA 1QUEA 4EM6A 1JDUA 3FGOA 3RR2A 3W7AA 4CF7A 2QYOA 2BD0A 1LU9A 2HKIA 2YRFA 5B1YA 3U9SA 3WRWA 1PW5A 1TZJA 5IG2A 1MW9X 4TXLA 2OBXA 2H7VA 2CXXA 2FP3A 1VCNA 2B82A 5L7TA 2O14A 5IM5A 3OPYB 2F1JA 1U1DA 4DPLA 4TN5A 4HQRA 2I03A 2J5KA 5AVKA 4IRXA 5L3QA 4AQ7A 1MT0A 2WQ6A 4JH0A 5HUJA 2GD6A 1N8TA 1FE8A 1WX1A 1V0JA 1XQXA 1E96A 1LDGA 4OHPA 5CFZA 1JLHA 1FNMA 3SZMA 2KE5A 3PX7A 4OQQA 2CJWA 2VK4A 3EUAA 3U3XA 3RRXA 5EZ6B 3AVYA 5AW2A 3KOZA 1VZ3A 1BHQ1 4F0JA 4GPZA 1QDLB 1L7RA 2AX4A 5L3QB 3FCUB 3I01A 2OM2A 4DMKA 2YOFA 4JI6B 3E5HA 2WC1A 3OMWA 3LNTA 4FWDA 3JD0A 2ZUFA 1ZNXA 5KU1A 3OCYA 2MYNA 4OCZA 1IZZA 4PSDA 4HFMA 4ZJPA 1E2NA 1DT3A 4BKUA 3CRW1 3K5PA 2B5WA 3QWIA 3KO8A 4INOA 3ASUA 5DRYA 1MVOA 2VLBA 2P1DA 2ID8A 1X92A 1QKIA 2BCJQ 4KX5A 4OHZA 1IQRA 3LECA 4Z4HA 4YMWA 3VVBA 2Y1LA 4ECAA 1YIAA 3VKWA 2G4VA 4C29A 3FRJA 3COZA 2PH5A 1G3IA 3DFFA 4LAFA 4XR9A 5GQSA 5C3MA 3QBDA 3ESQA 2B4RO 2H2AA 4KRFA 1YE9A 3T1YM 2VTKA 4K6HA 4LUCA 5AUOB 1GYPA 2G07A 3PDHA 2OHGA 4RHXA 5A4JA 1OI2A 4TT8A 1GSHA 3HFJA 2DWUA 3VOSA 5ENZA 3FOCA 3Q9UA 3L8HA 1WSBA 1EWRA 3E3MA 3W8EA 3BD7A 4UU1A 4BY9E 2PFGA 3F67A 2J67A 3KYDA 1JT2A 3HLTA 2SHKA 1XQ6A 3G02A 1L8OA 2ZS8A 1Y6FA 2GEJA 4JJ6A 4UD6A 2C7RA 3CX3A 1M2WA 3OQJA 3TPCA 4S24A 2D0DA 4FFBA 3A42A 3DC7A 1D7OA 2SCUB 4XLTA 1V92A 3OLCX 3KR1A 3RLIA 1WY5A 1TYCA 1UKVY 4HEOA 2NYRA 1ORDA 2HTFA 4BVBA 3COVA 1KEWA 4OA8A 3Q3GE 2XEXA 2II6A 2ODEA 3W0LB 1N3BA 3CB2A 2CKDA 2B35A 1G63A 4H6VA 2L0XA 4UM5A 1THMA 6GPBA 3RSLA 5DYGA 2O2IA 4H7DA 3CJRA 1WXGA 1NBME 1RYNA 2XKJE 3UJCA 3AFIA 5G02A 3S8EA 4TKZA 3GGCA 4EHHA 3PT5A 4AD8A 1RLTA 3LQ2A 3PPYA 3KNZA 1JPUA 1JDZA 3V3KA 4MR9B 4PYJA 1JLLB 2HIGA 3FVQA 5BQPA 1KDYA 1YK0A 2LKDA 4G89A 3P1JA 1Z4PX 1T1RA 4GO1A 3JQGB 5KPTA 3NTXA 1G3MA 1VMAA 3LHFA 1JX6A 1WF3A 2BTOA 3CEHA 1KQFA 1U3WA 5DHPA 1WO8A 3KWMA 1J56A 3WXBA 2DAKA 2BGRA 5KVCA 2GD2A 5BRAA 1NA5A 2R8BA 3VR3A 3K0AA 5CYOA 1K1EA 1ZI8A 5JHGB 1V5WA 1L7AA 1Q7BA 1NRWA 3CF6E 3KZKA 5T57A 1DADA 6CHYA 2YHSA 5KVSA 2IUEA 4JYCA 3SMVA 4PPGA 4QBTA 2B37A 2P8SA 1D2AA 1O6CA 4OQMA 1IN4A 1TGUA 4B5KA 5TQJA 3A4MA 4JODA 3T5BA 3AONB 1N7JA 3K0AB 2IYVA 3VAYA 3IVGA 1P4SA 2AG6A 1GO2A 1RQXA 3HHXA 1MEOA 3QXXA 3MBKA 1GGMA 3P0FA 1ZDMA 5LMNM 3EFHA 3M5WA 4QATA 5ES4B 5TY0A 4PN3A 3IJRA 4KAXA 5GV7A 2FQWA 5AHOA 4H7KA 2PX2A 1X1SA 2RHJA 2E5FA 4II7A 2WJZB 3CA8A 1DGQA 1X7GA 2IKQA 3KXEC 2HCJB 3QKIA 3KG2A 3L7BA 3OWOA 1S4MA 1ADYA 1RJ9B 5F4ZA 1X1EA 2Q28A 1WHTB 2DKOA 5FIUA 1M8GA 4KYIB 4DMFA 2ZRAA 3ENNA 3L43A 3Q15C 2H1RA 4QNMA 4YGYA 3OY7A 1O77A 8GPBA 5JBIA 3ZHRA 2NAFA 1L7PA 3FNQA 1E4OA 4QXAA 2OCDA 5LU9A 1AHNA 4G0QA 2FW9A 2FW6A 2QF7A 4Z3DA 2VWQA 2NSLA 5H0IA 3B20A 1CB0A 4JYZA 3N0TA 1VRVA 2AXQA 3X0DA 4DV7M 3P9SA 3AFGA 4EG6A 4G5FA 1QHSA 4FGJA 2B69A 3DLIA 1HT3A 5FAXA 3CF0A 1HKHA 1RNLA 3BDAA 3CTMA 4KQIA 1OQAA 2ZXEA 3IURA 1AXRA 1O7JA 5IAJA 4N01A 1PJ3A 4EBBA 5E4YA 5HMMA 1IL0A 3O83A 1P77A 2ZIWB 3PUJA 1GT6A 3NATA 5HJEA 3VJMA 1DAIA 5TMPA 3FPCA 1STOA 1LI5A 4DV5M 2GZRA 1DDGA 1QB7A 2GZ3A 5EI5A 3VPHA 4IHQA 3GAAA 3IO5A 5ESRA 1MEEA 4FZ5A 4QUDA 3I73A 2JLVA 3HCCA 1Z6XA 2O8NA 5DLPA 4ZARA 3O9ZA 2VF4X 5EMJA 2PZ8A 3DBVO 3KP0E 4ND6A 3EZNA 3KYIB 4QT4A 1SA0A 1YBAA 2HEGA 2BFDB 3EH1A 4ABTA 4TKVA 1Z36A 4V24A 3B2QA 3UAVA 2DWPA 3BCRA 2OVBA 1QG0A 1BTOA 4LJ9A 1THTA 5CTAA 3IEUA 3AEUB 3QUTA 1G5RA 4Q21A 1H2XA 2V0CA 5ITZB 1WXIA 4EHIA 4C03A 3D7RA 3O2QB 4QD3A 5DX0A 4QO8A 4C3UA 4Y30A 2OOBA 1SA0B 2IX9A 2C5AA 1VG8A 3T7EA 4W9NA 4K6KA 5LYJA 5FV4A 2P2YA 3LBFA 2KYRA 2Q6KA 3QJ5A 3UO8B 4CG0A 2VPIA 5D3QA 3OKFA 4MVJP 4Z9FA 1M0TA 3M89A 3R7AA 4FP9A 3TW8A 3F4LA 1EFUA 7CATA 1XEAA 2CNKA 4LOJA 4KV7A 1YNOA 4QGFA 2D3TA 1L3IA 2WF7A 2XCLA 4IVPA 4MHOA 2XNHA 2VTBB 5LYJB 4CTJA 2JAWA 2J5YA 4WKGA 1TKBA 3C6MA 3PXXA 1T2DA 3AH8A 1EFUB 3CEPB 3S5UA 1WG8A 3CINA 3CZ4A 3K0KA 5MGNA 3GROA 3ZIAD 6NULA 2E7ZA 3ON5A 3GBVA 4EPRA 1ZK3A 3CLUD 5A5VA 3VPSA 3G49A 1UOPA 4RZIA 4B74A 3PPXA 1HDGO 3AK4A 1TAGA 2DJ5A 3ED1A 1WKVA 5BVHA 1PJLA 1XTBA 2FLWA 4Q3OA 4B2YA 1ZR2A 3EFOA 4CLOA 4PG6A 5ALYA 1VB3A 4EFNA 1NAIA 1OXSC 2EWMA 3U44A 4ADSG 1XZFA 4XGRA 3UHOA 1Z17A 1HDCA 1SKAA 3ILKA 4B2PA 2CUZA 3MYRA 2ONYA 2XCIA 4FFVA 4JKOA 3QVGB 2O52A 5BVHB 4MWBA 4FHCA 3RU3A 4B40A 3QF4B 4DC9A 4II3A 1Z5UA 2H18A 1JGTA 3ZX4A 1E3DA 3L0DA 5FHQA 4UQPA 4AICA 3COSA 2QTHA 2R60A 4Q1DA 1QIKA 1UEJA 1CULC 2PM8A 5JRDS 4ZYYA 3DL4A 2K87A 4DDUA 2I2CA 4KRYA 1ZX1A 4B6QA 1KA9H 3WMFA 3BRWD 3ETDA 4OM7A 1N5OX 4HNAB 1AH2A 3PZBA 2HQSA 1CS0A 1XZBA 2JCYA 2C9MA 1D1TA 1QAMA 1FA9A 5IZCC 4PD2A 5H4GA 3GVHA 1V9LA 2EFEB 2XGNA 2MMCA 1BS1A 4MV4A 3K9FC 5KQPA 2JLBA 4B7XA 5IARA 5FAKA 4YUZA 2OXTA 3PQFA 4OSPA 2LHGA 4OA5A 1Y33E 4IIBA 1E1RD 3S3TA 3FBTA 2EJUA 3Q3JB 1VI5A 3HCOA 3A0RB 4HUJA 4MI1A 1Y9JA 4IW3B 3NGMA 4H27A 1DS6A 1CS0B 5FPTA 5GKNA 2G72A 4BQFA 3HY4A 3FRHA 2ASVA 4WT7A 2O8DA 5JH7A 4TKUA 5JO9A 2HSGA 3TNFA 1YVEI 5HZHA 2AQ8A 2XDWA 3O6VA 3OZWA 2AOVA 3GVCA 2B6NA 1AUAA 1H6DA 3A9SA 3V46A 5KYXB 2Z2IA 4H3KB 3I6QA 5CX4A 2XLBA 4D46A 2ORWA 2PWYA 5IS2A 1U9CA 2V5UA 3EDOA 3OZFA 4RZ3A 3P2YA 1NQTA 2GXSA 1E1YA 4N65A 2BN4A 4I55B 1JBQA 3C7DB 3OIYA 4A03A 3P45A 3QFCA 3CWQA 2NXWA 5IT5A 5JH7B 4TKUB 3EUEA 3OD5A 3NWBA 2ZYVX 3QKRA 2Q99A 3VKUA 4IH4A 1LLFA 1T9GR 1DWUA 1IB0A 3KW6A 1JFTA 4ID9A 1QS0A 1UXOA 2F3RA 2ST1A 4DPKA 3PE4A 2IC5A 4I8OA 1E9RA 5JJLA 2JFZA 4KXFB 2A9KA 4OKNA 1DJPA 4Y6OA 3D8BA 2BFWA 3IAEA 5AMXA 3B7WA 3S2ZA 3G6KA 3K0SA 1CS4C 3QKRB 1UP4A 5IK2D 1N36M 4UPDA 2COUA 1EFAA 2IS2A 3WFIA 5EWMA 2HMSA 3N2GA 3L0ZA 4DDWA 2AFHE 5A3SA 2O2ZA 3WL4A 4KGZA 5A9SA 3H4VA 1E5LA 2IQIA 2V58A 3H9UA 4MGEA 3UG7A 5BUZA 2X9NA 1UWLA 2YHBA 3UH0A 4QXQA 1PWXA 4U2EA 2I2XB 5G4LA 5JTUA 1DBIA 4P82A 2XVZA 5DM0A 3HHZA 1T2AA 4F2PA 3NIDB 1ND5A 1AKTA 3T1HB 4O8ZA 1UBGA 4JI0M 1ZD4A 1Z0AA 1NKVA 1FU4A 1KHHA 1SCUA 1AQNA 4R6XA 2R8XA 4NPHA 4KE6A 3I2HA 5DTJA 2ID7A 1AK1A 1OBOA 2POQX 3T54A 1ZL2A 1I7SB 5SZHB 3M6AA 5KTNA 2HGZA 4O4HA 5DISB 4Q47A 2OSVA 3TOSA 2APLA 2NU8A 3C16C 1VM6A 4RQTA 3C85A 3DAYA 2VHTA 1MJNA 2DT8A 3JAKB 1KZHA 1JLRA 3R9KA 4DIEA 2J5QA 2FCRA 2HA4A 3OEHD 2P3SA 1JIUA 1FVXA 1SCUB 2DG2A 4I4IA 3AMVA 1GGHA 5LA6A 4P5DA 4EYQA 3KQOA 1A77A 3WK5A 1K86A 1KY5A 1YRHA 4O4HB 3VAZA 3ROXA 2LHCA 1R4GA 1ZK0A 4ANFA 1UBRS 3DFIA 3I62A 2DKNA 2A9OA 2NYUA 4IVRA 1LXCA 2EDAA 4L5JA 2Z1DA 1E2EA 1C3VA 2ENWA 1L4YA 4KAFA 1L4GA 4F7WA 3P2EA 3WWYA 3KX2A 5LA6B 1J24A 1TD1A 5AKJA 4OW0A 1E3TA 3Q12A 1T91A 5CDFE 1HXHA 1ZD5A 1QRSA 2B2XA 3NNDA 2E49A 2C2GA 4S1PA 5DFAA 4B3SM 3MTBA 4OK3A 1J97A 4TYNA 3DLPX 1SKYB 3QFHA 3TEFA 5D00A 1JAXA 2F1HA 1TC2A 4MINA 1QC5B 3BMXA 1RWXA 2HD4A 1YFJA 2WAMA 4KQ6A 2QX9A 3YASA 2FNAA 3M1YA 1R18A 2KZUA 3DR5A 5AVTA 1XNQB 1WAMA 1K5DA 2GLUA 2BEWA 5HCIA 3O90A 5IUKC 4LHZA 1ZMUA 3I05A 3SC6A 4JOCA 2P6OA 3M3HA 1Q0RA 3PUXA 1U0FA 1H8HA 2I2BA 2VYFA 3NFRA 2VNJA 4DT1A 4YREA 3DE0X 1C1HA 4REQB 2H4ZA 3CNBA 4DF3A 4R40A 5ILGA 2PBZA 3L7OA 3KP1A 4DIMA 3VZQA 3I1IA 5M3BA 1CVLA 1R9GA 2ZIAA 2LVOC 1NDUA 3AM5A 1A3CA 2TECE 2BEWB 1IBMM 4UVGA 5IJ9A 1VGQA 3AHFA 4NSRA 1E7RA 4BMDA 4JQZA 4B3TM 4UAGA 3TLJA 4XWAA 2HRRA 4YLGA 3U56A 3DCNA 1ZUWA 2B4KA 3G0OA 4PR3A 1XQYA 4AI6A 3MGCA 2CD9A 4OQNA 3TINA 3EW9A 4JI4M 5JNWA 3AX6A 5KTYA 4ENUA 3PWKA 1AHIA 5FNVA 1EESA 4M8NE 1UXIA 2EJBA 4RTLA 2DTXA 2P2DA 3M1AA 3MJCA 3AF6A 3C48A 3UAZA 2RGWA 3KE9A 1X1CA 4MVJD 1K3XA 3W9YA 1Y7TA 4LVCA 2C04A 4IBBA 2BHRA 2E85A 4FWGA 3I0ZA 2O6LA 1W36B 4ARAA 3RHFA 5DTEA 1OREA 1YBFA 4Z0PA 2PGXA 3EXIA 3EULA 3W0FA 5LPNA 2FQXA 2CFIA 2GESA 5FNVB 1HRKA 1Z6PA 2QRGA 1YL7A 1ELOA 2W2TA 4JI3M 5AQEA 4OHFA 3VR6H 2KX7A 4YCNA 1N4DA 3DZKA 1AY0A 3UT0A 1IUPA 1J4AA 1HJPA 1XB2A 4FBMA 2GARA 3DR3A 3BH6A 3BQNB 2I78A 4TL8A 4G86A 3QWHA 2ZREA 1NRXA 2NYAA 4UM8B 4ER7A 2VQDA 4MSUA 1D8AA 1TYEB 4MW0A