3UZUA

The structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRFGQNFLVDHGVIDAIVAAIRPERGERMVEIGPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIARPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAFSQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA small subunit methyltransferase A
publication title The structure of the Ribosomal RNA small subunit methyltransferase A from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 77
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uzuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3uzuA01
1Q0TA 2JHPA 1KHHA 5HFJA 3BT7A 3MCTA 5DM2A 2PVCA 4HGYA 5K0BA 1INLA 1BKYA 4R6XA 1KR5A 3A4TA 5DXJA 5GWXA 4AZTA 1NBIA 4PIMA 3BWMA 1M0EA 5GOZA 1QAQA 3G88A 5CCBA 2PT9A 4JXJA 4U7TB 3ELWA 1FPQA 3EGEA 1JG4A 4QVGA 4GOLD 5DWQA 3LCVB 4QPNA 1JG2A 3OE5A 1G8SA 5M5BA 4RTKA 2G1PA 1SG9A 2XVMA 5EEGA 3S68A 3C3YA 5LSAA 3OU7A 1NW8A 4QTTB 1G6Q1 2QRVA 5GINE 2EJUA 2V7EA 3G5LA 2OKCA 4PYIA 1UFKA 2N47A 5F2NA 3QV2A 5E2BA 3ORHA 4GC9A 5DT2A 1KIAA 1G8AA 4U7PB 4C05A 2OY0A 1XDUA 3BKXA 3ANXA 3VSEA 5BP7A 3FYDA 4RWZA 2C7RA 2ZULA 5DM1A 2ORED 3HCAA 4E31A 1VBFA 1VQ1A 1KPHA 3BWBA 5E1MA 3UJ7A 4RTPA 3R24A 2BR4A 3NWEA 3SVZA 3UJCA 3AXTA 4GOMD 4LG1A 3GRUA 3P9KA 1KPGA 1BOOA 2I6GA 2AN3A 2OPBA 5ICEA 2G8NA 1TW2A 3EMBA 5EOVA 4E2ZA 1XCLA 3UFBA 2IBSA 2FHPA 3IV6A 3DMHA 1YB2A 4X63A 2YTZA 1XVAA 4UOEA 2AOVA 1JTEA 2BM9A 3KQWA 4YUVA 1RJFA 3A7EA 4Z2YA 2OXTA 3GXOA 3DXYA 1YF3A 3KQPA 5DRYA 3G5TA 1RI3A 3EVCA 5LQAA 4FS8A 4CXMA 4CKBA 3MHTA 4A6DA 3LKZA 3G8BA 3P9CA 4PONA 5BXYA 3BKWA 3TLJA 4AZWA 2NP6A 3FYCA 4PYJA 2NXEA 2PWPA 3PLAE 5DSXA 3I64A 4PGHA 2PGXA 3P8ZA 3NMUF 5CVDA 2FRXA 5HOQA 2YX1A 1XJ5A 4PIPA 3P2EA 4DZRA 2QM3A 5FADA 2PX2A 4DQ0A 4AZVA 3B3GA 2NXCA 3TOSA 3DOUA 1EJ0A 3R0QA 4EK9A 4E2WA 1NW3A 3TRKA 2XYVA 5KQRA 3ELDA 3KQOA 4C08A 2ZFUA 2I7CA 4OBXA 5JUWA 4AX8A 2FCAA 2KW5A 3EGVA 3K6RA 1ZKDA 2EX4A 3NVMB 1TPYA 2QY6A 2ZBQA 4LECA 4K6MA 4V0RA 1RJGA 4YMGA 2DULA 2ZIGA 3BGIA 5DLYA 5C1IA 2ZWVA 1N7JA 3HA7A 3KU1A 2VDVE 3KR1A 2EFJA 1P1BA 2UYCA 3GDHA 5HIKA 5CD1A 3FTFA 5EHGA 2PX8A 3PTAA 5T64A 1D2HA 2AOXA 1NKVA 2YQZA 2YXEA 3EGIA 1ORHA 3B5IA 2P41A 1XTPA 2Y1WA 3EVEA 3PFGA 3KQMA 3M6WA 4DA4A 2JG3A 4MHTA 1FP2A 5KYGA 2CMHA 2ADMA 3HVJA 4KDCA 4RTRA 4HH4A 1I4WA 3QOWA 4GBED 3JWJA 4BY9E 2Z6AA 3FUTA 3G2OA 4C07A 1XXLA 2O0LA 4MQ4A 2PX4A 5CVJA 2GAFA 4YUYA 3ER9A 2OO3A 3R9XB 3SMQA 1PJZA 3ERCA 2QYOA 5EPEA 1KP9A 4OQEA 1JSXA 2IFTA 4CWAA 2YR0A 1WXWA 3AJDA 4BLUA 5LQRA 1I1NA 3LHDA 8MHTA 4C06A 3HVKA 1RI4A 1L3BA 3AY0A 3KHKA 4GQBA 1VIDA 1QANA 1BHJA 3AWIA 2PY6A 4R05A 3BZBA 5EVJA 4E32A 1I9GA 4BLWA 4KWCA 1UIRA 5K0EA 3NDIA 3OZSA 4NECA 3T7TA 2B25A 5FWDA 1XDSA 2VZ9A 4E33A 3DP7A 4ER5A 5DM4A 4HSGA 5DX0A 4PYKA 2PSSA 3P9NA 5EEHA 2ZIEA 5K0LA 5E1OA 3BWCA 3FUVA 1SQFA 3MAGA 5DTRA 3T0IA 1X1AA 1JG3A 3TQSA 3HA3A 1WG8A 4RVFA 3HCCA 2GLUA 2UYQA 4M37A 1NV9A 5DTQA 5F2KA 3UJAA 2P40A 4DCMA 3VYWA 5LQCA 1G55A 1R8YA 5LR6A 1U2ZA 5K01A 1TW3A 3DLCA 4RTJA 2IP2A 5CVUA 5DXAA 2P1DA 4GUAA 4ER7A 2ESRA 3TFWA 3UBTA 3EPPA 5CVVA 1VE3A 2B3TA 2HNKA 1ZG3A 1FBNA 3OZTA 4MWZA 2GS9A 3BWYA 1D2CA 3EVBA 3Q7EA 2H00A 4R6WA 4DF3A 4EKIA 2JH9A 4FT4A 1ORIA 4GF5A 4E30A 3NWBA 1G38A 1X19A 1NBHA 3KR0A 3LL7A 2Z6UA 2I9KA 2LD4A 3CJRA 3HCEA 4P7FA 3DULA 1YZHA 1DL5A 3P9IA 1N2XA 1KXZA 5DRTA 1SVUA 3MTEA 4OX9Y 1X1CA 2PLWA 1Q0SA 2VDWA 3DMFA 3F4KA 5E9WA 2GH1A 1R8XA 2C7OA 4F84A 5MHTA 2F8LA 2AZTA 3FUWA 1VP9A 2IDKA 4KVZA 4LWPA 2C7QA 1HNNA 3EMDA 1AF7A 2HV9A 3LDFA 4E2XA 4F85A 2OZVA 5BW4A 1MHTA 4QDJA 4C4AA 3PT9A 4OA5A 3VC1A 3LCUA 3PVCA 3P2KA 3SX0A 4M36A 4PYNA 1JTFA 3SSNA 4RTOA 1BC5A 3CGGA 2B78A 3M70A 3ID6C 4X1OA 3UWPA 5E9QA 3DXXA 4BP3A 1R00A 3FPEA 4PINA 1FJXA 3A7DA 3DR5A 1HMYA 5HIJA 5FULA 2CKDA 3BXOA 3SR4A 3BGDA 3O31A 2WA1A 4FGZA 4HGZA 3HVIA 3TM4A 3C0KA 5K0FA 5IKMA 3NVKI 3A25A 4DM3A 3FZGA 3KQSA 5E1DA 3LKDA 3A27A 3G89A 4DKJA 2IH4A 1QYRA 2GPYA 2GB4A 1VPTA 3G2QA 4YUXA 3OCJA 2PKWA 5F2OA 4A6EA 2IGTA 1UWVA 5EMJA 2V74B 1NW7A 4GOND 2P7IA 2FYTA 2VDUE 4PYOA 2BZGA 3BUSA 3FPHA 4MIKA 4AUKA 2IH2A 3IHTA 3OU2A 1X1DA 2ZBRA 3A26A 4ZTBA 3U81A 4F86A 4X60A 4GC5A 4PYMA 3UJ8A 4RTMA 2IDJA 1MJFA 4RVGA 4ER6A 5GIOE 4QQKA 4FSXA 3SSOA 3FTEA 3BGVA 4V0QA 4P7GA 3REOA 3PFHA 1XDZA 2E5WA 3DMGA 4GEKA 4PWYA 3ELYA 4WVLA 2IPXA 5HIIA 3CKKA 3HCBA 5C9ZA 4QPPA 5P8WA 1JQ3A 3UJ9A 4FZVA 4IKPA 3CJQA 3T7RA 3KQVA 3CC8A 2PT6A 4KIGA 4CKCA 2JH8A 5E2AA 4PNEA 3FPFA 2WA2A 4CKEA 1QZZA 1SQGA 1ZHFA 4C04A 5FHRA 1N7IA 3KR9A 3IEIA 1NW6A 3C6KA 3V8VA 3WSTA 1R18A 1R74A 3P2IA 3GRVA 3G2PA 3SGLA 3KPYA 3NTVA 5DX1A 2GA9A 2QE6A 2PV0A 3SM3A 3DXZA 4RVDA 3KR2A 3E8SA 3GRRA 1R6AA 3GRZA 3LPMA 1FP1D 2IBTA 3CVOA 2I62A 4DCGA 1YFLA 10MHA 3DTNA 1L3IA 3MQ2A 5FHQA 4YMHA 3EEYA 2AOWA 2ZSUA 4FT2A 3HTXA 3B7PA 3KPJA 3FTCA 1O9GA 1NE2A 3PX2A 3HM2A 2IH5A 2NYUA 2O05A 1NW5A 2ZWAA 4P7JA 3K0BA 5T6BA 2HWKA 2FPOA 5D1NA 5ERGB 4PCAA 5FQNA 2XVAA 3B89A 3THRA 4ER0A 4EQZA 2ZIFA 1WZNA 4WXHA 2ZZNA 1Z3CA 2ONYA 2ZW9A 5CCXA 5HIMA 4X61A 2XBMA 3I9FA 4Y30A 2BH2A 3V97A 2P7HA 1EJ6A 2EG5A 2P8JA 1B42A 4YV2A 2Y1XA 2XYQA 3EVFA 4IWNA 5DSTA 7MHTA 4RTSA 3DUWA 3GCZA 2BM8A 3GO4A 2OB1A 2PBFA 4IV8A 2K4MA 4HG2A 4ATNA 4YUZA 2NXNA 3RW9A 4YV0A 4RTLA 4EMSA 4OA8A 2CMGA 1YUBA 3FUUA 3KKZA 3MTIA 4HC4A 1RI5A 4R8RA 5DX8A 5HZMA 2PXAA 4XUCA 1WXXA 4GOOD 1L1EA 1IXKA 1DUSA 3FRHA 1OR8A 3DH0A 3I58A 5EQJB 3LGAA 5ICCA 5GIPE 9MHTA 4L7VA 4XUEA 5EMLA 2YUIA 5C0OE 2ZVJA 3M6VA 2O57A 4RSRA 4YV1A 2EJTA 4G56A 3CJTA 2ZZMA 3M4XA 5LQNA 1WY7A 2Q41A 2HMYB 4HTFA 4BLVA 2JHCA 1VLMA 2AR0A 3DLIA 2G72A 4KRGA 4EVIA 2ONZA 1P1CA 2VS1A 5GP1A 3NDJA 4E2YA 5LQKA 4XCXA 2CL5A 4C03A 2FK7A 3B3FA 3CCFA 3EVZA 1RI1A 3G8AA 3KQTA 5E8JA 3FPGA 3M33A 3MB5A 4RYLA 2PXCA 4QTUB 3T7SA 2YXLA 1WS6A 3D2LA 2B2CA 5EGSA 3MERA 5K0CA 5DTMA 5FA8A 1JG1A 1F38A 5EHIA 5EIFA 1RJDA 3TPZA 2B9EA 2H11A 3E7PA 3P71T 5EKUA 5FCDA 3SXJA 3THSA 2PX5A 1M6EX 3LX6A 3GGDA 4QDKA 1VL5A 2AVDA 3C6MA 4RV9A 4X41A 1XCJA 4RTQA 1ZGAA 5E1BA 3UJ6A 3UZUA 4H0NA 3ELUA 4KW7A 1PRYA 1M6YA 5G02A 1AQIA 3C3PA 2P35A 2NXJA 3ME5A 2R3SA 4FSDA 2UYOA 3LBYA 3R6TA 5CIYA 4PGGA 2O06A 1EIZA 1AV6A 4IV0A 2YXDA 5FUBA 3AXSA 3UA3A 5KS2A 3GNLA 4ISCA 5H02A 1KYWA 2DPMA 5T67A 5K0GA 1YZ3A 2WK1A 4R8SA 1O54A 3MCZA 4AZSA 3HEMA 4YUWA 2G71A 5CM2Z 4P58A 3KQYA 3LECA 4RTNA 2P3LA 4OQDA 3KPVA 1KYZA 5DM0A 3TMAA 3LCCA 4POOA 2OBFA 5K0NA 3TR6A 1L3CA 1NV8A 1YFJA 2XYRA 4B17A 3I5UA 3LSTA 1VP3A 2PWYA 3EVAA 5D1HA 3O7WA 2P3OA 4FR0A 3L8DA 2OYRA 1SKMA 1L9KA 4QQNA 3TKAA 3NW9A 5E9JA 5GM2A 5JR3A 3OFJA 2AOTB 3OZRA 2Z6QA 4HRAA 5K05A 5EMMA 1ZGJA 5CVEA 2UZ4A 3PB3A 3FTDA 1F3LA 4LWOA 4M7RA 4BP1A 3RIEA 4KDRA 3CBGA 2UYHA 4XUDA 5DPMA 3H2BA 5EKXA 5K8VA 4KIFA 3GU3A 1DCTA 5HILA 3NJRA 5FA5A 5U4XA 3JWIA 1X1BA 4MTLA 5EC8A 3UA4A 4EKGA 3EVGA 3OE4A 3JWGA 3PS9A 1QAMA 2HTEA 3VC2A 5KVAA 5FTWA 1V39A 3FUXA 2JJQA 5B1SA 2ZCJA 2G70A 3R3HA 5HEKA 5ICFA 3TM5A 4M38A 2AOUB 3P97A 2PXXA 1RI2A 2AS0A 3ER8A 3KPUA 3KQQA 3M6UA 5K09A 1EQAA 4RVHA 3X0DA 1P91A 3QOXA 4PCLA 5LQUA 2ZLBA 3OFKA 5GM1A 3KPWA 3OU6A 1NT2A 2JHAA 1EAMA 5EMKA 2VP3A 2YVLA 3HCFA 1IY9A 2ZZKA 1KPIA 1EG2A 2BR3A 1H1DA 1SUIA 1O9HA 2AOTA 1ZQ9A 3G7UA 1T43A 3HVHA 4RX1A 2HR1A 4P7KA 1JQDA 2O07A 2ERCA 4HTFB 2C7PA 3LDGA 1G60A 3HCDA 5EZSA 4CTKA 5ICGA 5FQOA 2AVNA 4ER3A 5K03A 5BW5A 3EVDA 3LDUA 2R6ZA 3G2MA 1IM8A 3IYLW 5LQJA 2BR5A 3PX3A 3HA5A 4FP9A 3FPJA 2NP7A 1P39A 5E8RA 4QVKA 2AN5A 2A14A 2OB2A 3RODA 3MGGA 5FWAA 2AOUA 3UJDA 1JR4A 3O4FA 2IIPA 3GWZA 1RJEA 3HNRA 3EEOA 1JQEA 4CTJA 2QRVB 3GRYA 1QAOA 3E05A 3E23A 2H1RA 5CUQA 1SUSA 2ZTHA 3GJYA 3I53A 3Q87B 5K0JA 4Y2HA 1AQJA 3SSMA 4E70A 1JSZA 5EG5A 4O29A 1D2GA 2PJDA 3FRIA 2CWWA 2FK8A 2ZBPA 3HP7A 3OPNA 2AN4A 4PYQA 5IH3A 3B3JA 3TKYA 5EIWA 3UJBA 3M6XA 4PYLA 5EZQA 1Y8CA 3GIWA 3JWHA 4DMGA 2P3QA 2NNWB 4OBWA 3LBFA 5KQSA
chains in the Genus database with same CATH superfamily
4TYWA 5HFJA 3N53A 2LWIA 2OCIA 4X62B 4M0UA 2BKAA 2QKYA 4S0ZA 4F46A 3EC2A 1FXWF 4RF3A 5EQDA 3FPSA 1IQ0A 4YMTA 5LSAA 4UTXA 4BEBA 1KSFX 3UHAA 4M53A 2I6FA 1HWYA 4ZPJA 1KERA 1O03A 1FYDA 3R7SA 1GFIA 3R3JA 3VSEA 3WRWA 5BP7A 3VK8A 5AJHA 1MX9A 2ORED 5F76A 1F0KA 2R00C 2CLMB 1OXMA 3KL2A 4EYSA 3K09C 2VTKA 3D4PA 3SASA 1UBMS 1UPTA 3DOAA 2OFPA 1EFVB 2V1UA 1SWWA 2Y93A 3NXKA 2FWJA 2XIJA 1QOPB 5HF9A 1IQUA 3PLAE 2CMKA 4CI0B 4YMVA 2G09A 2C0PA 2IJGX 5AXCA 3HPRA 2G9NA 3QITA 4ZVPA 2C61A 5AESA 2AL7A 3L84A 4QRIA 1HQCA 3KTAB 5DEIA 1NR5A 1FSZA 1TCUA 1QYDA 1S96A 1UPFA 1T2FA 1S2MA 4PLHA 4IX1A 4G5FA 3EZ6A 5AM1A 3L6UA 2RCYA 3FAKA 4GU5A 2FG5A 2ZAMA 2G1UA 5EHQA 5G4KA 5LZ8A 1YIDA 1G3QA 1JA0A 1NZDA 1KI4A 3NIGB 2DBRA 3OLYA 2IYOA 5KHOC 2F00A 3S8YA 3N7AA 4DLRA 4HQOA 1G66A 4PYKA 4KQIA 1FP4A 3RJZA 1KDYA 3SQWA 4HAWA 2BWBA 2O3SA 3DBIA 1QIKA 3I61A 4RM3A 2JAPA 3T52A 1PWEA 2B4AA 4AKHA 4F06A 3LF2A 4C1BA 2BCGY 4X1YB 5JC8A 3QU7A 3MWGA 2FGJA 1I14A 4AKIA 1R12A 1R7RA 4NXMM 5TVKA 2INGX 2IW1A 4NSOB 2IOYA 4URVR 1K8QA 4DXAA 3M6IA 4YRTA 1F2VA 3CGGA 2B78A 3R8CA 4PF1A 1R4ZA 421PA 2YIJA 3P52A 4LSMA 1WHSB 3R7FA 5CW1A 4FQ8A 1XB2A 4NFYA 4JLAA 3VDRA 1LPBB 3TLGB 3FBTA 3TUJC 3HKPA 5HE9A 5AJTA 1OT5A 1VLZA 4WVFA 1CQIA 5CMLA 2JCVA 3DTYA 4YONB 3F7OA 1FUKA 3O95A 1PDVA 2UVQA 1JIIA 2OGWA 5C80A 4IEFB 1DZ3A 3JALA 4V39A 3AF1A 5HR5A 2PKRA 1G6OA 2F3RA 4KPUB 4D45A 4Q4HA 3RVNA 2VWGA 2FPWA 2WNHA 3TWMA 1WCXA 3K7EA 3ANNA 1ZI6A 2AN1A 5IDQA 1XQWA 3JXEA 3TRIA 3QLTA 1IN6A 5IAAA 4LE2A 1A9OA 4RK4A 2BZ0A 1L5WA 1N32M 1KKUA 1KO1A 4JQCA 1CG6A 2ZOSA 1ZIOA 2Q8PA 2QVYX 1IY1A 4C5BA 4DC0A 2ZRCA 1BVUA 4R2XA 2FZWA 3KETA 3QY0A 4KW7A 3BXPA 1CBUA 1TIPA 1F5NA 1A77A 1KEEA 3DUFB 3GUCA 1VJGA 4BP9A 4PBSA 4EEKA 2RH8A 3T41A 5B12A 2CXNA 3OOYA 2G07A 1LBHA 4NOJA 5KC9A 1U3UA 2O2DA 3QVGA 3FLAA 5L8VA 3A46A 4D5GA 2GXQA 1FLDA 5EIHA 1U98A 1D6JA 1XT6A 4BQQA 1RWOA 2OCXA 1ODIA 4RPKA 5ADHA 2ZATA 4UOZA 4B6SA 5BV8A 1XWWA 4R69A 4IJ5A 3PV0A 2DETA 2QNIA 2IZ5A 2AR9A 4PC7A 3HVHA 5LKRA 4A6PA 3L7OA 3B7QA 4PO8A 4DR7B 2G3QA 1AQNA 2QVLA 3O4FA 1E79A 4JBGA 4TXJA 3Q7PA 3FJOA 4QGHA 4C30A 1XEFA 2P11A 3F6EX 3W67A 2KEBA 2WYWA 2FEKA 1ECLA 3PGJA 3RRYA 1CU1A 3CLSC 4KX5A 1T9HA 1ZWKA 2E48A 2LNHC 2EZ9A 3QV2A 3N0XA 2QE7A 5HVNA 4KN6A 1O0BA 1U02A 2V6ZM 3OAAD 4CM3A 3T9BA 4WP2A 4ERNA 1TAQA 3EX7C 1E1RA 1G5HA 4BFUA 1G3RA 1OBCA 1T2EA 2YTZA 3BFXA 4UM7A 1SC6A 1P7ZA 2XUJA 4DMKA 1ZMVA 2ZDHA 1N0HA 2RHDA 1UBUS 2W2MA 2VA9A 4FHDA 2QX9A 1UBCA 1EK6A 3CSDA 4G41A 1FSPA 4B46A 1EFLA 2XBLA 4EF4A 3NANA 2TMYA 4MQ4A 2PL3A 3W5HA 4O8CA 4LMPA 1WXIA 2O1EA 3Q2OA 3IVCA 4R7TA 5CDFE 4HPWA 2I71A 3ET4A 1FQKA 3CZPA 5B30A 1O94A 3I6IA 1CTQA 4JX9A 2WU0A 4JOBA 3PCTA 4UU8A 2ZB4A 3NHYA 1WMDA 3IS3A 1KTIA 4IBJA 2JGAA 3NETA 2IUEA 3FLMA 3RU7A 2AXEA 4I8IA 4MV1A 3TBHA 3VJRA 4Q00A 5CVVA 1Q1GA 1EX1A 3R5FA 2WKPA 3MJVA 2GETA 2I76A 1SVLA 5IW8A 1M7HA 4UCFA 5TQVA 1KXZA 2P2YA 1Q84A 2P2GA 3VNVA 2WB4A 1UAYA 1XGKA 4K3VA 2CSXA 4DCTA 2H7VA 4RWEA 3M1AA 5FULA 3O31A 5IKMA 1U2TA 4ASUD 2NSDA 2PKWA 5G4KB 1DMSA 1IAQA 1KGDA 2O5CA 3L28A 1U0GA 2FZVA 2QZPA 3G9QA 4RKQA 1P3Y1 4B0PA 1YDWA 4ZV7A 3W9YA 3Q7QA 3OKAA 1FQWA 4OREX 5IBQA 4JLDA 2VSOA 3PA6A 5JRJA 2JAXA 3AJ9A 4I9GA 5FUMA 3CLKA 2XMSA 2CHQA 1RHUA 2R7AA 2PUFA 1DJLA 3ZNPA 5CDHA 4ZTUB 4DR1M 2E4VA 2YN2A 1C1KA 2DXIA 1WXGA 1N3YA 4AL4A 3A10A 3ANLA 3F5FA 2ILTA 1M9NA 4L6V6 3C7KA 1DAIA 1RJDA 3SXJA 4RTQA 1E58A 5KJFA 4ICIA 5BWBA 4R98A 1HORA 4J4HA 3G0OA 6GPBA 1ABFA 3ASYA 1L5VA 1CQIB 5B6JA 1VRVA 3WWYA 2BFEB 1O8CA 1QFXA 4R7GA 1SZDA 3GAMA 3QA3E 4ZQCB 4AM8A 5CURA 4P6VF 3A98B 1K0FA 1L7OA 3DEYX 3JALB 5DFLA 3NYIA 1GQRA 3KXLA 1ZGJA 5DWVA 1ML4A 1DQSA 1HLDA 2FPGA 4W8OA 1BJTA 4B3GA 2Y05A 2F2TA 2Z1MA 1XR3A 1IY2A 2JGLA 2ZLBA 3B2QA 2IY9A 1EAMA 1GXSB 5EMKA 3ZWXA 3JVEA 5EESA 4R71A 2CLFB 4Q4CA 4ARIA 1JH8A 3E27A 4H0CA 1XNQM 3WADA 4B9EA 4I5EA 1AKQA 2HPVA 1E2BA 3PWSA 4G4SP 3OQVA 5ALMA 1JQBA 3MYRA 4B6QA 4YLEA 5BSUA 5LZ5A 1OA1A 1H3EA 3EEOA 3LDHA 1U2GA 5T8KC 2H2IA 1OE0A 3M3DA 4MAMA 1C1YA 4KOEC 3LWNA 2ZTHA 1BN6A 5CM9C 4HT3B 3EY9A 3NBUA 4FD2A 1INLA 1N0WA 1WQ1R 2YIMA 1NBIA 4UASA 5GOZA 1URPA 5KTTA 3EGEA 1AUOA 3LCVB 1XZFA 4QJ5A 1R8QA 2FFHA 3KZMA 5C4GB 3OEED 4QATA 3LE8A 4YRFA 3VYVA 2ISSD 3C1UA 2EWVA 2VK2A 3KWFA 4O4IF 4X7PA 4OFWA 1WBBA 4Z4CA 2FHPA 1LK5A 1P5JA 3WR5A 4R9NA 1GPDG 3IT1A 1VEGA 5AK3A 5A5DA 3AHHA 1Z29A 5AUQA 1XU7A 1OBVA 3BRWD 1B4DA 3RV4A 4B3XA 4XE5A 1UXHA 3L93A 4Z49A 3EGCA 3FVRA 5JD5A 4DMUB 4MZDA 1JR6A 1XTPA 1I2BA 1TDJA 3RUCA 4S04A 1SXQA 1G21E 1YC2A 2OO3A 1VG1A 5LUAA 3OZFA 4PAOA 2IYQA 1Z37A 3ROGA 1R6XA 3UOAB 1RIIA 1UJBA 4M0MA 4HWRA 3KYBA 3NHRA 4UEJA 3ZZTA 1UIRA 4E33A 2XZOA 1NMZA 1KK3A 3HDYA 3G8DA 2EG9A 4PICA 3SC4A 3TQSA 3DHEA 1EVKA 3K9CA 1GV1A 4C1NA 4EH1A 3I42A 4ZT3A 2HNKA 2J6IA 3VR2D 4EGSA 4QSMA 4C7VA 2YCBA 3LF1A 2A5FA 5EWLA 5EZYB 5F12A 5JNSA 1I7LA 4Y1EA 1GSHA 4C0KA 1X7XB 4LA4A 4M8KA 2BGMA 1QHNA 4RKUF 4DV7B 3L25A 4O4LF 1WP4A 4QDUA 1MV5A 3KJFA 4OHBA 1FQOA 5DI3A 4F3NA 1T3LA 2WV9A 1M2HA 2ZYGA 1N1EA 1Z5GA 3T7JA 3ZH9B 4V0OA 2XLBA 2GO7A 3QX9A 4DR4B 3PKZA 3V4SA 1U90A 1PJLA 1QRRA 3CLRD 2J7PD 3CXRA 3TX2A 3SATA 3FZEA 3W3AH 1GJRA 1LWOA 4MQMA 1L4MA 4KREA 3I5MA 1XA0A 4CMCA 3BXEA 4FNGA 4KDFA 1QKKA 4JMPA 3WL4A 1TEXA 1NJ2A 1FJGM 4F4CA 1JALA 3DTNA 1YR9A 4B2IA 1KDZA 4RO0A 3AV0A 3TZLA 5KMGA 1YZLA 3MUFA 4YDSA 2OHIA 2KHHA 621PA 3OCUA 3I9FA 3PYMA 2P7HA 4H18A 3LOUA 5J4LA 3OETA 4IV8A 4B0OA 4ZEVA 1BZYA 3ZJUA 3CLUD 3DH0A 3E2IA 3F98A 3I58A 3W5SA 3MTBA 5HYVA 5DMXA 2QTGA 3R3ZA 3KAQA 2AKAB 2VHUA 4BNGA 2DWNA 1NVDA 2YJGA 5EPOA 3T7SA 2H65A 1W0KA 5D3MB 4UVGA 3B6EA 2YS7A 5EA2A 2PRSA 2RGOA 5TRTA 1Y80A 4J90A 3U5TA 2X15A 2GBLA 3STHA 4GFDA 1QDEA 4MK4A 1W76A 3VO2A 1SXHA 4P58A 1IFYA 5ED4A 2LNDA 2FWMX 2NZ2A 1C9KA 4GMKA 4WW0A 3Q85A 2WM9B 3P94A 1L2CA 2J3EA 1G6KA 4ZFNA 4PGAA 1H8HD 5HJ7A 3BB1A 1LI4A 4UVDA 2QF7A 4KIFA 4RDIA 4X94A 1KZ6A 1C8LA 1ODFA 3PKJA 3S55A 1NDUA 2IEDA 5ICFA 2P68A 1I3NA 2XUPA 3EN0A 3U60B 1PFYA 4B44A 4KNYA 5DSZA 1KQOA 2VHVA 3PC7A 5K03A 3SPXA 5AMXA 5LQJA 4PAWA 3E6AA 4KKXB 4IOLA 4WZZA 4CIWA 4U02A 2C9YA 3IT2A 1QHGA 2HEIA 2MDTA 2BKVA 1CYDA 4TTTS 3AB8A 4KSYA 3ZHQA 4NZ9A 3Q5EA 4PM4A 2RHTA 1JWLA 2PKQP 1FPQA 3ILSA 2N0SA 3WOVA 4LDRA 4PZZA 4AT1A 3FKSA 4YO8A 2YC2C 1Y34E 3LZDA 1AXEA 3N2KB 4MCJA 4R3WA 2XRZA 2W6CX 5JNLA 2FPGB 5F73A 1Z0IA 2V9CA 3AFGA 2AOVA 2HKJA 4DM7A 2AFRA 3TZBA 4B83A 2CCKA 1KEPA 3BKWA 3NMUF 3HKEA 3HVRA 2J0UA 5SYAA 5BUZA 4W9NA 2HHHM 4PXYA 5U1PA 4EJSC 2B3DA 1SUFA 1K5DA 1OYWA 1KORA 3SMPA 2B61A 3K0FA 1YZTA 2OAQ1 4EKDA 4MHTA 1I4WA 2IODA 1KI7A 5JJBA 4LZOA 4I4TF 4C7XA 5H4GA 4DUZM 1IOWA 4ZODA 2D5LA 1U8UA 1XTIA 4KWCA 1P2VA 3E5HA 4LJ5A 4BO1A 4BVBA 2LHCA 4LF4M 3TQTA 2F55A 4BJHB 5HS6A 2DAIA 2PK3A 4LXQA 3VDQA 2QSZA 1KBQA 1DKNA 3T7CA 4NCXA 2AYZA 4UZEA 5CH3A 1PD0A 1N6PA 2GYUA 1ZAKA 4KE9A 4LNAA 1YR7A 3BG5A 5F9FA 1C3LA 2JGEA 1MB0A 4C01A 1NFFA 4OA5A 4RD1A 5MN4A 5TS2A 1YT5A 4Z7JA 1LWNA 4OB7A 4HDQB 1S8NA 3S5UA 3I28A 2BJWA 1WJ7A 2FRVA 3A27A 4BECA 4MW9A 2VJBA 1FA9A 2DBVO 2A0FA 1QX4A 1S8OA 1TRHA 3BGVA 3CUTA 3VR5A 2XTAA 4CR6A 2V54A 4QWMA 4W5TA 3L06A 4AMGA 3GJZA 4GLJA 1HDYA 2JH8A 2VXYA 2V6MA 2F9FA 2N35A 4IRXA 2JLAA 5B58T 1ZJJA 4PQYA 3SMVA 4XB1A 1MVNA 4YMHA 5F2EA 1NI4B 2D06A 3L9WA 3M5WA 2G7ZA 2HA3A 5DHUA 4ZCTA 4C7KA 1CUGA 4E2FA 4E46A 4TV8A 4HB3A 1DDGA 4UQOA 2Z98A 4YQFA 5EE3A 3WNZA 3MS2A 3LVRE 4MARA 3NHKA 3TQIA 4Q39A 3MTIA 4EPWA 4TZTA 4F3CA 4PGMA 4IF4A 1U94A 5KKCA 1DKRA 4FFMA 4ID3A 4KPEC 4LF9B 2QN7A 4HFJA 5HKKA 1YMQA 1YS1X 4ME6A 4ARSA 5LQKA 1X39A 3MLBA 3RYIA 2ES4A 3KDSE 1DO2A 3RKUA 1R8JA 3R7LA 4GBGA 5DI3B 5F35A 5LL6P 4IH9A 4C20A 1AKYA 3K1TA 3SARA 1YDFA 2QD4A 4YCDA 4ZI3A 5HHTA 1DIBA 4NAVA 1N25A 4K2HA 3C43A 2C2BA 3GLHB 2XRYA 4MPPA 3AXSA 2OHHA 1V1RA 1NXQA 2Q8NA 2GFHA 2CWDA 3VKWA 1O54A 4Q1VA 3L7CA 2F6RA 2C0QA 1L3CA 1YFJA 3HY3A 4EEXA 4A3VB 2P4HX 3SHWA 5KEIA 3AV0B 3EZXA 5HKLA 3PX7A 3LA8A 5KMGB 5JPIA 4RFVA 2N42A 4EA7A 3FOFC 5H0IA 1UM9A 4QYWA 4CGYA 4V0SA 1NM5C 4YAWA 4U39A 5JROA 1WW2A 1U3WA 1L7QA 3IE2A 6AT1A 4RF2A 1BS2A 2YWJA 1QSGA 1XTZA 2ZTUA 2C1EA 2CF6A 2Z3WA 4LKOA 1Y8CA 2NNWB 1DC3A 3TLXA 1D1SA 4YRMA 4NOLA 2W6ZA 1JVSA 2JJMA 4Q3AA 1CEYA 1TMKA 3R5XA 3CT4A 5CEEA 1P0CA 3K5PA 3IAS1 4RFLA 4LYGA 4WK2B 1UK9A 3HU3A 5IUNC 2UDPA 3AGQA 1TTTA 5AM3A 4Q5IA 3MTAA 3PR1A 4XRRA 4DG9A 3NXSA 5KYYA 4MUIA 4D8UA 5CLGA 4NS1A 3UWDA 1PT6A 1KQPA 2EL7A 1PUIA 2NU9B 4Q7JA 4YAKA 1EDZA 1GDDA 3TLYA 1JR3A 4A23A 3VPBA 3QEBZ 4X45A 4TQAA 2JEZA 1P17A 1KY2A 1UBEA 4BY9E 2NO9A 1PWYE 5CXSA 5AJZA 4WSOA 1T13A 2H1HA 4UNNA 1SHZA 3RC7A 3RQSA 1M34E 1Z88A 3CZRA 3GL9A 4F9TA 4N5IX 1PZMA 4K6HA 1IWBB 4FHFA 1YDHA 4EY7A 4U6SA 4RQBA 2KB0A 1WSAA 6REQB 3IO5A 3OO1A 2QLJA 3ROQA 3GRFA 1GN8A 4KIJA 1XTVA 3C3BA 2WG1A 3N5CA 3VH4A 3RR2A 1L5KA 1ONBA 2R1VA 2IF0A 4YAOA 4EECA 3HKEB 2J0UB 1WIWA 3K2EA 1CHNA 2W2TA 4M1TA 2SKEA 1YC5A 5IDWA 3HO6A 1R2QA 1TTQB 2FPUA 1W44A 3A6LA 4CMEA 1QPGA 3CWCA 3RD5A 1M2OB 4MYDA 2W48A 5ALTA 4BMXA 1AQLA 4BBZA 4JJZA 2DHQA 2XMCA 4Q21A 1VSUA 1Z2OX 4RVOA 1WXDA 3G5AA 3VM6A 4REZA 3VR6H 4LWZA 4DFDA 3GLSA 3CJQA 1JJFA 4DUGA 2NZXA 3TGLA 2IYLD 5E2AA 4GLFA 3KFVA 3ZWWA 4ZGGA 2ZWMA 2F62A 3CEPB 2WHXA 2B99A 3M2TA 4LQLA 3PXBA 1P2DA 4FPXA 1E2MA 3IMFA 4DV2M 3ICEA 1Z25A 2RJNA 1YK1A 4KR2A 1E9DA 3DOHA 5K3EA 3BAZA 1BDBA 5LXTF 4Z4FA 1J4AA 2BP7A 4AXXA 3ZCPA 1TH2A 2ODWA 4DR5M 2HA7A 2QCUA 2R87A 5LNK1 1VSBA 4JVMA 4D80A 1OR8A 2MYTA 4CKYA 2B9VA 5C1BA 5DIZA 3GBSA 4EFNA 4RJTA 4XYLA 2JZ1A 1W5EA 3AJRA 3QBJA 1I7PA 3S0JA 3OZBA 5K3FA 4P3PA 3H6HA 5KYKA 4ND3A 4K5QA 5KDOA 5AVZA 3SEFA 4L15A 4W8GA 4L9RA 4PU0A 5CG2A 1XN1A 4A2WA 1OV4A 3WO1A 5FPKA 1E9VA 5BQ3A 2XBUA 1ISGA 4F04A 5KWJA 4ZI7A 4A8TA 3A37A 2ECOA 2PH3A 4WKNA 1N9GB 3L8DA 4O2AA 5DHSA 2WIDA 3PHCA 5E9JA 1POXA 4Z1MA 2RAUA 4TV8B 2M9MA 2BTQA 2QUZA 1SRRA 2Z30A 4X44A 3M1IA 2ZR0A 1EGAA 1VZ2A 2VP5A 1UKAA 3EJ6A 3MUEA 1HMPA 4Y18A 1ORVA 3N59A 1T5BA 2HQ1A 2W9XA 3LT5A 3QKIA 1XCPA 4MLPA 2WPNA 3H0CA 4BLCA 3IVGA 2K47A 1M1ZA 4W6ZA 4MJLA 1OB5A 1JQDA 1MGOA 1OLSA 4F97A 2W6JA 3RPEA 1PYGA 4L0MA 2QTLA 1L4YA 3QXSA 4N7JA 1GZ5A 3KLMX 4W6QA 5FLXS 3GWZA 1OHHD 5JADA 3RIYA 4EBBA 3W5VA 4RCZA 4XLTA 3IVRA 1AVTA 2Z2JA 4OF4A 2XHZA 2PVCA 5CA0A 3DE5X 1ZD9A 2WQ7A 2IEIA 3DL7A 1LVGA 2C4TA 3OICA 3B6ZA 1SY7A 1F12A 3H2YA 4O1IA 3EIEA 3F9CA 1T6NA 4HPXB 4YHHB 4JJ8A 4A03A 2CHFA 1CUDA 2VF4X 3DG9A 2WVAA 2A1UA 1JE1A 1JHOA 2YNMA 4RVCA 4EJ2A 3RF7A 4CYMA 2F43B 2AX4A 3AG6A 1EE2A 5JH7F 3N6VA 1QG6A 2FUKA 3ZY2A 2CVPA 2QV0A 2X8BA 4LVNA 1IJEA 3ETDA 4CN8A 4I3FA 2BM0A 1UM9B 1CNMA 2KI5A 2SCUA 2UUPA 1V11A 2VF5X 4PHTA 4DL9A 2A3NA 2G9ZA 3WFJA 1N5RA 2ZTMA 2HF9A 4IIJF 1WB9A 3HXLA 4JGIA 1XQYA 1TZBA 1C80A 2Q0XA 4RU1A 4KWTA 1N5JA 4FUQA 4E5VA 4UUBA 1HBJA 3KEMA 4YFVA 4QHTA 4D6PA 3EASA 1MAUA 5DGCA 1O5IA 5AKJA 5BN4B 3L6RA 2ACEA 1ECBA 3UG7A 4IIVA 1YH3A 3H83A 4P86A 3ACDA 1ONPA 3T1TA 2ONJA 1PF7E 3T6PA 1U80A 1YVPA 4E32A 5EXEA 3R6GA 2N1MA 1Q77A 1OWLA 1Q0QA 4YMSA 4BYGA 1NL3A 2JEYA 4UEKA 4BWFB 2IP2A 1YVDA 3UXMA 4TWAA 2EBUA 1NXSA 3IE1A 4E30A 5KYYB 1OWOA 3LGSA 5MDHA 4GECA 4BCDA 1DQRA 3F4KA 4GIPA 3FHLA 1Y82A 4FBMA 1GZ3A 1B26A 4GD3Q 3ZJTA 3AM1A 2RK6A 4RXTA 1UJ5A 4MPJA 4EFMA 2GPYA 3MWKA 5FNVF 1T9KA 3LH5A 3OCJA 1NF2A 4ARVA 2I9PA 3I9KA 3FKJA 3EMKA 2AQHA 3V9PA 2IHVA 2A1IA 4X84A 3GH3A 4LOIA 3PDCA 4G0VA 3KJEA 1NW6A 4DLXA 2O7RA 1PL7A 4BVEA 5DTIA 1JG7A 3ZPXA 2OHGA 2ZS7A 2IYNA 4G3OA 3HM2A 7GPBA 2VRBA 2BMVA 2A7XA 2X7HA 1BA3A 1V7CA 1M2WA 4F6RA 4XR4A 1U2PA 1O6CA 2P62A 1X9IA 2QRUA 1RPNA 1T3ZA 2WJVA 3JW8A 5EMLA 1IJKA 4HLCA 1ZD3A 3GEGA 2J6BA 4LZZA 3KHSA 2JL1A 1HF3A 3EQ9A 1PAUA 4G2NA 4UDOA 4EPYA 4WXYB 2ICAA 1NONA 2XOXA 4RDHA 3O4GA 1A4UA 2B6HA 1UBNA 2HSZA 1TMGE 1YBHA 3FLBA 4P9NA 2JK0A 1B3RA 1PZHA 2ZE5A 3I39X 3LXXA 1D9ZA 3A3NA 1UPUA 3IOEA 4UQPA 3VPSA 5JSKA 2VLIA 3UAWA 4BWVA 3MJCA 2ORIA 3LSTA 1B0ZA 2AXQA 5DHAA 4F5EA 3GP3A 2NPFA 4ADSG 3W7AA 1IBMB 2VZLA 2W70A 3K96A 4A8JA 3MWDB 2DBQA 5BWNA 4B3BA 5LP6A 2JJQA 2XTNA 4FLFA 5HX7A 2GKGA 5EFZA 1S7GA 3LUGA 2AEJA 2ZYIA 4TTAA 3KEGA 2HA2A 4EENA 4A4DA 4BFWA 5CK5A 1ENOA 2FKNA 2HF8A 1WL8A 3JD0A 1QZTA 1A1SA 3FPJA 4GPAA 5K3FB 2REXB 4LDQA 5SV2A 5TB5A 3KYDB 4FOOA 3CUUA 1QG0A 3RS9A 2F59A 2Q46A 2HIHA 1T8UA 1BKYA 3A1SA 3BFPA 4GNRA 1U7OA 4V1CI 2UXBM 1ZU5A 3V2UA 3ZG6A 2P9EA 2YZKA 4O2AB 1XXHE 1BYUA 3U40A 1GNSA 1C3OA 1UDRA 3HH8A 1QU3A 2BTQB 1DUVG 2LRHA 3EMBA 5C8VA 2XYPA 4N3NA 1RKVA 4C2TA 1NHWC 4Z9BA 2WB2A 4XCVA 2ZRPA 5AJYA 3L4BC 5KHLB 3M5DA 4CIYA 3IT0A 5BXYA 5LQDA 2EDCA 4REMA 3UPTA 4RY8A 1AUAA 4AYTA 4HHEA 2P1RA 4DREA 5BWMA 2OPFA 3WYBA 2EYUA 4E2WA 1KC1A 2VVTA 3GT7A 3RC3A 2HBYA 3GLKA 3H5WA 2KW5A 4BWGA 3K6RA 1VE7A 3QNMA 1MENA 3TS1A 1FNCA 2Q9CA 1FP2A 2V98A 4DR2M 2V5UA 4KDCA 1ITZA 3FOCA 4QG7A 3P20A 5CA0B 2O4UX 1U8YA 1DNPA 2W2NA 3F3MA 3DQZA 5JHHB 3PZBA 2I3BA 4QXAA 4XJTA 2EHDA 2JNHA 4NECA 3RGWS 5TPZA 4E22A 2A1UB 2D13A 3KB2A 1TEZA 3K9BA 2IHUA 4JOCA 3UJAA 1DV0A 4HWKA 2X58A 1T6XA 3RS3A 4JUBA 3JVVA 1E63A 3ZK9A 1E3LA 3R41A 1DCMA 3HXOA 4MV3A 1NBHA 4EF6A 2LD4A 3HCEA 4TMZA 4UAUA 1YIOA 3BD7A 3FYHA 1G6HA 3OQ6A 1Q1NA 1PDOA 3BA6A 1ZN8A 3S8MA 4CDMA 4JT8A 4Y2SA 2A30A 4EHLA 4P54A 4CN9A 5DN6D 4MA4A 1PS9A 4XVUA 3KQSA 3MZ0A 3G89A 1PW7A 2A1TR 5TMEA 2GZSA 2UUAB 1YRLA 1ZRNA 3D0RA 4CW7A 4X60A 3R3YA 3DFKA 1ULZA 1KOJA 3R7WA 3ZWYA 4TVOA 3CC8A 2YXBA 1DX9A 5IZCA 5IT9S 5LLDA 2DYKA 1R18A 1F2TB 1YFLA 4ZWNA 2ENWA 3I04M 5EJGA 2XE6A 1EB8A 4OYHA 3V8BA 4BRUA 2DSNA 2ZIFA 2ONYA 5IWAM 3WGLA 4YMUA 2XKKA 4F96A 4RD2A 3U48A 4C9BA 4K28A 5KVVA 1MNQA 3RRXA 1H2FA 3G8CA 2J0QA 1G5FA 4AY4A 4E09A 1NXWA 3H11A 1VSVA 3QE0A 5CD9A 1BS1A 3VUFA 1XAIA 5LQNA 3L4EA 3G1TA 2VP6A 1N6KA 3AHEA 1W6RA 1Z4KA 3BXHA 3FKQA 2QLMA 2RAFA 5JSHA 1G59A 2ZRMA 3C24A 1EUQA 4F6CA 3GELA 2OECA 5HOEA 1GCOA 4FSDA 2C2MA 4X20A 2FAXA 1J2JA 4QEDA 4I9NA 4FGKA 4GL4A 4XYEA 1P45A 3CISA 3A45A 1OF1A 1Z15A 2PO5A 1HE5A 4BRSA 1CZOA 4PN7A 2IZ7A 5CXXA 2IOQA 3D5QA 3HN7A 4HRAA 3U56A 2XDYA 1Q0LA 2DPLA 2AFVA 1V7QA 3AESB 3GPCA 3UA4A 3V8QA 1KZ7B 3AR3A 2Y1CA 2HYIC 4F6RB 3DSRA 2QROA 4TKUA 5HXAA 5C34B 2FUG1 2JHAA 1FNMA 2IPMA 2W6NA 1CX9B 1NF3A 1ZGBA 2NTVA 4DXDA 4J0GA 4HNVA 1CY4A 3CZ9A 4GZMA 4U8HA 3BAFA 3V1NA 4P4NA 4BVHA 4TRRA 2GZRA 4EHIA 1NY5A 1GSAA 5ITZA 1HQDA 4BZPA 4OJNA 1FRVA 2EAUA 2KS6A 5BV2P 3KVRA 1Q0TA 3OPYA 3SFZA 2FWRA 3E0XA 3GLGE 1JG4A 2XSZA 1XNGA 1MW8X 3X2SA 3S1LA 5IAJA 1CUKA 3VMFA 2J5BA 1JHVA 3S70A 4R0VA 3G23A 4BO2A 3IIKA 5FXMA 5HW0A 4DWJA 3K6KA 4D8XA 5F23A 1QF7A 4A8JB 3MEQA 2J6HA 3ACCA 5LP6B 2JEOA 1KDTA 2DUJA 3F2VA 4JBIA 3F7TA 5CJPA 1E9EA 3CW8X 1PV2A 3OTWA 3FAZA 2JANA 3HCOA 3AINA 3OQIA 2NXCA 4FFLA 2WZDA 1SC9A 1RYMA 3BGIA 1NQUA 2PUWA 3K0AA 4R31A 5FNZA 3K0KA 2QD1A 3MT9A 3FD8A 1E3WA 3IV7A 1DDOA 5I4CA 3WK4A 3B78A 2HPHA 1POWA 4E94A 3KE9A 1QO0A 1QX3A 3M7IA 5IT9A 3DZDA 4JUAA 5AW4A 3V6LA 2IHNA 3F49S 3GVHA 4YYEA 2VDNB 4RHCA 2AC4A 1OZFA 4DTIA 3PEUA 5FDFA 1GZ4A 4F92B 1RTKA 1NVAA 1VKHA 5LQCA 1RFLA 4INJA 2G5CA 5LMNB 3FM9A 1NATA 4L4YA 4LHZA 4UEWA 4B7XA 4WI1A 1V9CA 4XPIA 1ENZA 1PE0A 4CU2A 1BKSB 1JJVA 3CJRA 5L7TA 1OC2A 3DBLA 4FCVA 3DEIA 5C8DA 1HYGA 2ECPA 3H4VA 4H6VA 4KVZA 2NM0A 3PI6A 1KWGA 4YHBA 1Q6YA 1AZTA 3IURA 2EWMA 4Q4JA 3MWFA 1TD1A 4XB6B 3TNDA 2FSUA 4DHEA 3OBIA 2CKDA 4E1AA 3RAPR 2W2QA 3HVIA 3V34A 3ZZUA 1XZCA 4GRDA 2HXYA 2AWNA 1LA2A 2IGTA 5CH5A 1OFGA 1V6CA 4PBRA 1GPJA 3NIWA 2QT1A 5IM5A 2GN8A 5DNDA 2GEVA 1M54A 3U44A 3W4IA 3T7RA 1PWHA 3I2GA 3TRHA 2AEEA 4DCPA 1ISIA 2JLQA 1W2WB 2R4UA 3OP4A 3B7PA 3DZCA 3QI2A 2IS6A 2PGIA 2VSQA 3B89A 2Q6KA 2VO1A 2GCEA 2C2HA 2VTDA 5DYTA 1U6IA 3OHPA 1Z7EA 3KAPA 2FW1A 3LV8A 5DX8A 3L5OA 1DUSA 1MFPA 5IJZA 5CX4A 3L4JA 1MW9X 2XWBF 1U9JA 3WGUA 3ZI7A 4W1RA 1EFKA 1KFEB 2Y0CA 1OVGA 3QKRA 1DINA 1IOZA 5EIAA 2L2DA 4CMGA 1P6XA 2ZSIA 2VDMB 3I1YA 3PYXA 3CVYA 3O4RA 3N58A 3MTGA 4OSEA 3T15A 4JIMA 2V1XA 1N8SA 2J09A 1R6TA 2J3QA 2YXDA 7YASA 2R2GA 1B15A 1M76A 3P9RA 4I14A 2AX3A 3RO7A 4M8LA 3N74A 3AC0A 1TQDA 4AO7A 1KR2A 4MW0A 5AKGA 3TLZA 1R5LA 1T0UA 3MOIA 3TEFA 5LMZA 3CFYA 3TLEA 2VQ3A 2B69A 2PMCA 2WYIA 4UU0A 5K5EA 4TS1A 3ZIAD 3A9CA 2GPTA 2G04A 2N75A 3VKVA 4LMBA 2RD2A 4PHHA 3AUFA 1RKUA 3H11B 1E7WA 1O95A 3GQBA 3ASZA 3A6GA 2DKOA 2FR8A 4MROA 1QFSA 2A7QA 3CNQS 4UVHA 3O1HB 3CB2A 1XMQB 2AK3A 2F90A 3V4RA 3CXUA 1K1EA 2R79A 3CPSA 4D42A 3SICE 1I0LA 2COUA 5BV1A 3H19A 1ZBQA 1JV2B 3RTEA 1QJCA 5JVDF 3FF1A 4X20B 4KR6A 2HPAA 1XP8A 4IM7A 4A91A 3RK0A 3Q8MA 4DY6A 4RKRA 2HHLA 3IJEB 2XUQA 3U6KA 2JFVA 3RYFA 3X1ZA 5FLEX 3W6UA 1H66A 4RH3A 1VOTA 3AEKA 4ZYVA 1VKZA 3PQDA 1OKSA 2VUIB 4V2UA 3TTTA 2VAMA 1AV7A 3SLKA 4Z53A 2K7FA 2IUTA 5FPTA 1W19A 2UU9B 4MKRA 3KQPA 3CZ5A 4Q3CA 2FFRA 4TKUB 4TTQA 3K92A 1G98A 1ABEA 3IXMA 5FTNA 1HNWM 2RI0A 4YMWA 1M2KA 1L2BA 1LLQA 1E64A 4NFHA 221PA 2GN2A 3FI9A 3TB6A 1T24A 4IHJA 5ITTA 4LZPA 3R8FA 1EVJA 1NMYA 4JI6M 1XFDA 3U6PA 1YFKA 4YT5A 2ADMA 2JIBA 1FP4B 1VDMA 5DMHA 4F6LA 3BE8A 4G26A 2Q3FA 3OPYB 1WIVA 4CWAA 5LQRA 2H4WA 5L40A 2XZPA 3FGPA 4WJZA 1YR8A 1ZD4A 4FFDA 3L8FA 4DYDA 4I6JA 4GE3A 2WSFF 2J3LA 3B5JA 3FUVA 1DEXA 4B6JA 1VLQA 3VR5H 2M1ZA 4WUTA 4UARA 4YAJA 4OQMA 1K3FA 1ZOLA 1O2DA 5K3SA 3I0ZA 4L5YA 3IPXA 4XDZA 3C70A 1Y1KE 1W25A 3HWRA 4OU5A 3Q9NA 2Z6UA 1YXMA 2EERA 5C1PA 5K2OA 3DT8A 2BELA 2XQJA 3OD1A 1XB2B 5IBPA 4YT8A 1DOAA 1XF9A 2G80A 2IX9A 3S6JA 1UODA 1P44A 4KYUA 4GX2A 4KBFA 5E9QA 3DXXA 1EYZA 3K0AB 4L0CA 3BILA 3B1XA 1NQ5A 1E3WB 1WPQA 2BE7A 5BNTA 1Y6GA 1KFCB 1J8DA 1RAEA 1UPBA 1OKKA 5JZOA 1Y7PA 1DGHA 2HCRA 3T1QA 2C20A 1J2EA 5C8YA 4V0QA 3WMWA 5FBKA 3TQRA 1W1WA 4LE0A 3NBKA 4CKCA 1KAEA 3FPFA 4FWIB 4C04A 4Q4HB 3H97A 2GA9A 2W4QA 2NT3A 3Q3VA 3MTDA 3MQ2A 5ALOA 2JFYA 3A2LA 4DLSA 3HYNA 3DZJA 3HABA 1EEXB 1QB8A 4MV0A 3IUMA 3QPBA 3KQNA 3DBLB 3COYA 3P9YA 2ZIZA 1ISSA 2V97A 1ZJYA 4JLPA 5TEWA 4GSKA 1T4DA 1C3XA 3I8SA 4IH4A 1KEEB 2XUKA 2G72A 1UZUA 3C5VA 3M8KA 2H8KA 1RI1A 3L8EA 3B20A 5AI9A 1NMEA 1TU0A 3K0HA 2VP4A 3A9WA 2H7YA 3VV3A 1A2BA 2IE0A 3W05A 4OHWA 4PD2A 1NLYA 1GGKA 3QVGB 3I30X 2R3SA 2R48A 2XQKA 3R6TA 2FMTA 2H4YA 5JQGA 2FLVA 2QW0X 3OO0A 1OFUX 1LQ2A 4QOZC 5A7GA 3RFTA 5FAKA 2H29A 3T6KA 3QWBA 2ZT7A 1MX5A 1YE3A 3L7NA 3U1VA 1GR1A 2ZVPX 3RKRA 1YBMA 3TSZA 4KDRA 4GVPA 4IDDA 4A7PA 2Y2VA 3GQ5A 2O2ZA 1BW9A 2GJAA 1Q83A 3C6BA 3D6UA 3KQQA 4RVHA 3VAZA 2NO7A 1XEWY 1YQQA 1LH0A 3L0BA 4O0MA 4W7HA 3V4ZA 5IK2D 4WERA 1SPBS 3E82A 4TROA 3WZMA 1DC7A 2XEPA 5FR1A 1G8YA 4HKTA 3QUBA 3AM4A 1E2PA 3KT3A 1WUIS 4ROTA 5FTJA 2H3EA 3C9PA 4GICA 1RS0A 2H1RA 2BDUA 2YWDA 1D2GA 2HX1A 1IY0A 3GEDA 4DMGA 1YMUA 3UEOA 5IYZA 1E0SA 3EB9A 2UVDA 1VI5A 3DPIA 3I12A 2P2ZA 2GZHA 2ODPA 3G5LA 2OXRA 2I4NA 4JL6A 3S2GA 3P45A 4F5DA 3WJAA 2BD0A 2PO7A 3AXTA 4BFZA 1Q0PA 2VQDA 4UHEA 3ZDBA 2QL6A 4B6OA 1QUEA 2FMXA 3R75A 5L51A 3LQ1A 3FHCB 4RE6A 3LHFA 4N6NA 3A28A 3I64A 4X66M 3GQBB 4MW4A 1OH5A 1G2OA 3PNQA 4JI2B 2PT5A 2YX1A 4RLFA 4HAVA 2RGNA 2JFNA 5JDCA 4I46A 3GOHA 1XMSA 2VP2A 3LBNA 4NDAA 1QH1A 1KARA 4XJSA 4TTVA 4J0JA 5ESDA 4ZVQA 3VX4A 3FB1A 3KB1A 3DEKA 4JYAM 1IVSA 3JWJA 3AP3A 1YU6A 2VT6A 2WHEA 1Q74A 4JBLA 1YUMA 3EAGA 4UNIA 2QHXA 4E5DA 3GD5A 1S3SA 5CTAA 2JGMA 2SHKA 1C29B 3UCEA 1PU2A 1WDLA 3QW2A 3NBXX 1SBTA 3UB2A 1ESEA 2P27A 3AEKB 3D7NA 1ZHHA 5K2MA 1YNOA 1BQEA 3MOGA 4KQ9A 3EG5A 2QRQA 4E5SA 4V0NA 1ECCA 3TGPA 1UDXA 4ER7A 2OP1A 4MS3A 4ED9A 4WBNF 3K8YA 3QSGA 5E38A 5FPHA 2XB4A 3AZOA 1ONOA 3ZGYA 2WUEA 5KYTA 1BS9A 1JPJA 2ECFA 1N2SA 4NNPA 4B3MB 5JECA 1SUDA 2NTJA 1LX6A 3P7MA 4J76A 3OQHA 4UHKA 3NT5A 1YQWA 1JNXX 1YK0A 2V74B 2WWHA 1GQSA 3LS2A 1K66A 1UBJS 2ZUEA 4HTAA 2E5WA 3ZX4A 2R86A 2OCYC 2XEDA 1H2YA 4TS4A 2OKGA 2WA2A 3CT6A 1GIAA 1B6TA 5JAIA 1MQSA 2JVJA 2C4HA 1ZCFA 3GRZA 1Q2XA 5FL7A 2I62A 4DSNA 2EF0A 4K87A 2WVHA 4HAOA 5EXXA 3OC0A 3OWXA 1Z4PX 4WXHA 3FNIA 2XBMA 4HNGA 4QG3A 3MCAA 3A2NA 3SKXA 2NADA 1JHDA 4L57A 4RTLA 3M9WA 5CXUA 3H5RA 4YIHA 4L5AA 4RF0A 3N9IA 3Q8LA 4WOPA 2B7LA 4ZU6X 2PH7A 5BVGA 1EFRA 2BFBA 5F3WA 1YQ9A 3FYSA 3K9PA 2AZXA 4BNYA 4YTEA 3K4QA 1ZAYA 1IM5A 5ALYA 2Q1YA 3UVEA 5L45A 5AR1A 4C0SA 3DE3X 2DPGA 3QUCA 1T9AA 2I55A 1D0SA 1DGHB 1M72A 4ZOAA 2FH0A 3W6NA 3A14A 3PWTA 3X1WA 5ARDA 2W6PA 1WBJB 3K4PA 4CKCB 3ZXSA 3WKAA 2EARA 2AZ4A 5H4HA 2JCXA 4ZYZA 3O1LA 3OIYA 1S6YA 1PR4A 4MP3A 4NATA 2O54A 2EGGA 1USKA 3EUEA 5C37A 1LTHR 3D1VA 2C3OA 3GJQA 1YZUA 4NWIA 5E4YA 5UKDA 5IC6A 4IO1A 3AHGA 9GPBA 3J81A 3LL4A 4CFYA 1HC7A 3AOEC 3RDPA 4B3TB 3QU2A 5C1OA 1KPIA 2X8JA 1GLGA 2C8KA 4LXIA 1U3TA 2O07A 3LK6A 1IMOA 4RGBA 4F9FA 1A71A 2NP7A 1BU8A 4QM7A 2V7BA 1Z0JA 3DPUA 3Q7RA 3R09A 1U63A 4YRPA 2GD0A 5IREB 2V96A 4R1NA 4E70A 1X87A 4PR3A 4EYKA 5DFAA 1ZCAA 3HKCA 2C5SA 3U7JA 1WNTA 4C0LA 4HCJA 1QBKC 1MG0A 1ZXLA 3IR6A 2QIOA 1OIPA 4EUHA 1TUGA 3KOZA 4BRWA 4X8OA 2VZ0A 1NJ8A 2XE8A 4HFMA 2B8WA 5ICEA 4E2ZA 1QVZA 3ASUA 4IHKA 5L7WA 3PIIA 4TLMB 3ZI4A 1O5TA 4JYPA 2DHCA 1J5EM 2VHJA 3N39C 3KKOA 2I6UA 1TTHA 1XJ5A 3UAOA 3HGQA 3EPKA 1Q19A 4RC9A 2BEUA 1R16A 1V1MA 1Y9AA 1CPYA 4OP1A 1E2JA 4BCCA 4UFNA 3O90A 2MWMA 2V3WA 5JAMA 2EKPA 3B6KA 3ZWDA 1CDOA 3LVQE 2WWGA 4GWKA 4DCUA 4GAEA 1BWRA 1I3MA 2HO5A 1IG0A 1WCIA 4R7ZA 2HWUA 3HR4A 3BTOA 3HUTA 1SUPA 4C2BA 3TZCA 4C6HA 1Y9EA 5HRUA 2HK9A 1BWPA 5EWLB 2OCPA 4RIGA 2PS3A 1WA5A 1M2NA 3FB4A 2UYQA 4KI7A 4L6AA 2B1IA 4RANA 5KX5A 3LI2A 2QA5A 3B52X 4I9UA 2D7CA 3HBFA 3H9JA 3OEYA 5ARBA 2WWFA 4L08A 1YB6A 4HB2A 4TZKA 2IDKA 4FBLA 3TEJA 4X24A 1H23A 3L8HA 2WZCA 3LUFA 4PLYA 2FB9A 4IBOA 1IBKM 3ZHYA 1CLEA 3A3YA 4WDQA 1R0SA 4IF6A 1EM8A 5BSWA 1QYRA 3G2QA 3H1BA 2G5PA 4JH0A 5JPCA 4GXNA 1YTLA 5DGTA 3Q6NA 3X1XA 4HH0A 4YGYA 2NAFA 3UGJA 2C8LA 1GDHA 1XRPA 3RYTC 2F5SA 3IBCA 1ZHFA 4AMVA 3C6KA 3MT7A 3Q72A 4S1VA 4PLVA 2YCLA 2WG0A 1YCHA 2D1FA 3ET5A 1L7XA 2XGOA 2IH5A 3QQPA 2AF4C 1QFYA 2HWKA 2ZW9A 2NZYA 1YACA 4M89A 2HIGA 1PS8A 1SMKA 5L53A 1KO5A 3TSAA 4HG2A 4GI3A 2C2YA 2GCPA 2B1JA 1NTOA 5F77A 5IXSA 3PCRB 3WXBA 4E21A 2BHTA 2JAHA 4G6ZA 4INAA 4JC5A 4RF5A 3PRJA 5FTLA 4TLDA 2B9EA 1GU0A 5I7AA 1XCJA 5IJXA 4NBUA 1RD4A 4FQ7A 2CVQA 4FS3A 5AIBA 4KVFA 2Q07A 4CV0A 3TAHA 4DDKA 4PFSA 1JE0A 4JA2A 1SNYA 1YRHA 3PC8C 5A2GA 3W7BA 4KLCA 5CU7A 4LF8B 1MU0A 3GFVA 4ZO8A 4EJ6A 1M8KA 4PZPA 4EPTA 1N2GA 2QJFA 3G2NA 4Q9HA 1YO6A 4N40A 5CLLA 5ITYA 5J5AA 4N18A 3GU3A 3ZTTA 5FA5A 3WK6A 4Z86A 1R88A 4W82A 4TLBA 1MCZA 4YS6A 2ARKA 4TN1A 4JJGA 1RAFA 1U1EA 4ITVA 2WKRA 2YRXA 5BVGB 2BFBB 4BKUA 3W7VA 4A16A 4LY0A 2WE7A 4L8WB 5CGQB 2D5AA 1JIXA 4EI8A 3K5IA 1JHPA 4B40A 4CKZA 4J43A 4TS3A 2J33A 5CJ2A 3OTOM 1KI6A 2CV2A 2J46A 5GKNA 1FP7A 1GVHA 4R0MA 1P4SA 4ZPXA 1JHRA 2PJDA 2XF3A 2HA4A 1G3UA 3W5IA 3P9XA 4HL6A 1DTWA 4Q03A 1D04A 1NSFA 4HXYA 2PQMA 2VSYA 4N5NA 3OUUA 4HLUC 1YRAA 3IUPA 1QU2A 4ZT4A 3PRYA 3Q8GA 5F2NA 4UBLA 2YIDA 3M7GA 2FEWB 5SZHB 4JK3A 3FYDA 1ZY2A 4ZEWA 3B51X 5HE8A 2OO9A 3UNXA 1CQWA 3CNOA 1FU7A 3EFBA 5EIBC 2LZ0A 4HDNA 3IIJA 2EWWA 2CBXA 3K0FB 4OMDA 4L0DA 3SJUA 4D3ZA 4TMYA 4GWLA 4PIPA 2VXCA 2Z8YA 2A9RA 3L7DA 4V2IA 3GLIA 1R37A 4OGGA 2I5PO 3D8BA 4GZLA 3KU1A 2V7QA 1XWIA 2Q3CA 3IQDB 3SD7A 5JJKA 1TA9A 4KV7A 3CF6R 2NU7A 5LMUM 1J0DA 3HRHA 4HATA 2FQXA 2IYRA 3HKCB 3OIFA 5EPEA 3B12A 1MC5A 1QE3A 3ODGA 4IDNA 2I1QA 1L5FA 1GT6A 2WTAA 2OHFA 3ETNA 4RHUA 2QR3A 3M6LA 4CG1A 4NR0A 5NLLA 3BWCA 1FS4A 3GBPA 3Q9LA 2Q29A 3ESQA 1N36B 3G2JA 3DFZA 2X1LA 3SZ3A 3IO3A 5JLAA 4AZFA 3VZCA 1HDEA 3UJNA 4M1OA 5EUCA 1H6DA 3OTGA 1W94A 4HQNA 3C98A 1NVTA 1SIOA 2E4WA 2ZIXA 4JJAA 3WYEA 2PNFA 1FMLA 5AW6A 1D6NA 3NHFA 1L6RA 3O8NA 1JI0A 1SXJA 3UGTA 4L3OA 4CR7A 1JDBC 4HGZA 4LJLA 2W6MA 4FSHA 4DV3B 3ESDA 1DTSA 2GZMA 4MV8A 4FYXA 3YASA 4ENRA 2WSMA 2JW5A 4MA0A 1Y3HA 2X8AA 1PS0A 2XJ9A 1GCIA 4TWRA 2G4CA 4MPTA 2D7DA 5E7JA 2RKOA 2D0OB 1OIWA 1AO0A 4ZREA 6ABPA 4UPEA 2SICE 5KNLA 1AIPA 4LFCB 3AJAA 5DM70 3JPYA 1BQ3A 5I7VA 2AJBA 1H65A 2NVOA 4K9SA 2EKLA 1MJ5A 3AR5A 2H9AA 1PQUA 5KX5B 4Z2AA 3H8WA 3O0TA 5C46F 2Y8EA 1B8PA 1SBZA 4F3YA 3K0CC 2BUAA 3RYIB 4YV2A 3A06A 3GCZA 5AUNB 3U4DA 4IBGA 1GP2A 3PXXA 2QS9A 3C6ZA 3H86A 4WCFC 3STXA 3V8MA 4N8EA 2ZR8A 3Q10A 4OQQA 3NKFA 3VO8A 4I2VA 1RQGA 4G9GA 1V1RB 1Z4NA 3HUFA 4MGKR 4G4JA 4IIGA 5LBIA 4NG4A 2ZYAA 1VHJA 3GH1A 4M0FA 2XAAA 1MAWA 4AJ4A 4DIEA 2E49A 2FXVA 2CDNA 3K35A 2DUNA 1ZGAA 3EA5A 1I4LD 2QTTA 3W78A 1R50A 3DDSA 2J4DA 2Z5LA 4D9NA 4G5SA 4PO1A 1T6YA 1B23P 4DVJA 1ONNA 3R3VA 2ZB3A 1AB6A 4J03A 1RQLA 1VI6A 4CGYB 4JV5M 1SHTX 4OSOA 3H1GA 1F06A 4KRXA 2JNWA 1N7GA 2OXIA 2PSJA 2UZ4A 2D3TA 2JI6A 4JMLA 8OHMA 3CBGA 3F46A 3JR4A 2H2DA 1UL1X 1A8PA 2X49A 1TI7A 3SBDA 3MVEA 3PHLA 4Y9UA 1AN0A 4NJMA 2G5TA 3HCFA 2ZZKA 3AR4A 4WXPA 1Z35A 2Q49A 3EVDA 2RRUA 5TPWA 1MOSA 1M2FA 2QNJA 4HUTA 1A97A 2C57A 4ZZ1A 2PAFA 3EXFA 3CSUA 4H1VA 1C7JA 2M32A 3KQHA 3GEIA 2CHGA 121PA 1KHHA 3GV0A 4PIMA 3PPIA 1O8BA 2ZI3A 2ZSBA 3P4XA 1Z6GA 2PPLA 2FPLA 3ESAA 4PO3X 2QL5A 3KJQA 2A5GA 4OGWA 2ZAOA 2XKAA 3T3PB 2NT4A 2CV0A 2Q5EA 4AW4A 3WQQA 2WILA 3QX3A 1LNSA 3UJ7A 1JKJA 2MIIA 2PA3A 1H5NA 4Q7JB 2CRUA 3JD2A 1JLLA 2IXGA 4W9RA 1GEGA 2G40A 1KZ9A 5FI3A 3CG4A 2MTBA 2ZXEA 3NHSA 2FMIA 4IY1A 3IPLA 3MTQA 5KQRA 1MB9A 1OTRA 1CE8A 4J8PA 2VK4A 5H82A 2ZIGA 4TT3A 4UTPA 1KI6B 4RF1A 1DX6A 2YWXA 1DIRA 3PFGA 1X74A 3H3XA 2Z1NA 3I51A 4LMAA 3GR6A 2OUKA 1FRFS 1Q44A 4EMUA 4MZXA 1WGNA 4DANA 1GPNA 2OBYA 3OM1A 4LSGA 3S2YA 3KEFA 4CUJA 3I4YA 3LP5A 3H9BA 3T7EA 1NQWA 4JR0A 4DV6M 3TF5A 4OAOA 2C4UA 2H54A 5KTOA 2PRKA 5AHXA 3H2ZA 1Z2AA 2P2DA 3CRW1 1MDBA 4LF7B 2JIQA 2DFNA 1X1AA 2R1VB 3T94A 3EOAI 2FNAA 4AAYA 4PRKA 1BVSA 3RBVA 3GUUA 1U3CA 2PTGA 3EVBA 2YFYA 3SHQA 2NPOA 2Q5HA 4EG0A 4D57A 2D8MA 3WGIA 2HQBA 4KN8A 1K06A 1ZC3A 5JMOA 2AMJA 1NR1A 3AG5A 1N5DA 3GLIB 2H57A 3KJHA 5JXWA 2WPDD 3SS8A 4NBVA 2CV1A 4DCCA 4I5FA 5ER9A 4KQXA 4A6EA 1BE1A 2PGLA 3LGXA 4XOIA 5EIOA 3O8BA 4JROA 3A26A 3JQCA 1OFIA 5KPZA 4HB0A 4Q93A 2OZPA 3QP9A 1JJIA 4WVLA 2AKYA 1JQ3A 2VF2A 4ALKA 1GG8A 1G5TA 3KVVA 1OWMA 1AHIA 4EP1A 3HJCA 3VK7A 2BP7B 4LTNA 1Z08A 2BMAA 3MFQA 1FP1D 2JWSA 3KUXA 4JI0B 3SJZA 2ZIVB 5FHQA 3PA8A 4NHOA 3RVLA 3QVUA 3SEQA 1JB0F 1UXIA 4CM4A 3RFCA 3FNFA 4N0EA 1VPWA 1KIFA 1SBQA 2NO1A 1A88A 2ZIXB 2W93A 1OC4A 4QL3A 4JENA 4EMSA 5AVVA 3BN3A 4R9SA 3LCJA 5IXJA 3KK0A 1E6KA 3JVIA 1SXJB 5LA6A 4E1BA 1B2LA 4K0KB 2F8MA 1Y5MA 1QVRA 3L5KA 2IYEA 1VIMA 3I5AA 3PUKA 3HY5A 2I6SA 4ZI7B 4RULA 3GGDA 2R6CA 1MH1A 3J2PB 3RSSA 4Z0PA 5LDGA 5CFLA 1A2OA 4GH5A 1T5IA 2YMQA 2F5QA 4M86A 4CU5A 4RY2A 1F4PA 4UCXA 3W3ZB 1IHOA 5G1NA 1W59A 3PBKA 1Z2PX 3QLEA 3BE4A 1XDDA 1G64A 3NW9A 4QQNA 2Z6QA 5B55A 4XVHA 4ZYXA 1K0UA 5E2IA 4LWOA 1OLSB 4PZCA 4I5SA 3IVAA 5HKAA 3HI4A 4CFSA 1QZMA 3ZE0B 1TF0B 1OMOA 4QGBA 3P97A 1ZK4A 4RV4A 2ZJ4A 4FIZA 4KO3S 4RPLA 4DV0B 3R1IA 1RPTA 1RRKA 4HX9A 3CUKA 2NSHA 3R4CA 1X0XA 5B6PA 1B74A 1ZCBA 4DR6B 4P34A 1P1KA 4JLMA 2Q5QA 4FYVA 5H9WA 4HQKA 3EHDA 1Y42X 3HZZA 1QR2A 1DQZA 1TCVA 3U3MA 4IS2A 3LXUX 2BF4A 2WU1A 3TTSA 1E66A 4OL0A 2VKQA 2SCUB 4N7MA 1V11B 4G5XA 3RASA 3HCAA 4YP6A 2QTNA 3F78A 3L7BA 1ZGHA 2RC5A 3P9KA 1MO6A 2HY7A 5AK5A 3CH4B 4MSUA 5B57C 1XVAA 3GJTA 4HWTA 2WYUA 4MDFA 1CC1S 2NU6A 3TG2A 1Y3DE 5FJIA 3DL4A 4CT0A 2RARA 5TPWB 3RRBA 2YZ7A 1TT7A 2C88A 5BQXA 4UHJA 1T0JB 3DE6X 5FOWA 1YDMA 4DJDC 4LNHA 1HZZA 1Z06A 1VSTA 3PUJA 4CF4A 4AG5A 3MCVA 3HLYA 4FKBA 4IIFA 3WGHA 4KXLA 3S2UA 3ERCA 1MKYA 4HFRA 1X2BA 3HFRA 1E1NA 1QC5A 4K9PA 1NRJB 2YIVX 1SIBE 4HLNA 3OJ0A 3FSGA 4ZOEA 4NYMR 5HF5A 2W37A 1G9TA 4OD0A 1B0AA 3A70A 2HK7A 4LGYA 4EPRA 3NCTA 2V9ZA 5DXAA 3EEFA 2FOXA 4W9MC 1Q1AA 2O7SA 2C95A 2G0TA 1JLLB 1OILA 3JAKA 4U2CA 1EGHA 1LK7A 5BQFA 1M0SA 1NBEA 1IEVA 4DW8A 1NVBA 2HNAA 1P72A 4RELA 4BN5A 1HDOA 5IWCA 5B3AA 3AEYA 2WZQA 4CJ6A 3W5CA 2PZGA 1YJAA 5F7JA 2C03A 2WTNA 4KSCA 2VI5A 4L8LA 1N6HA 1S9HA 2YYSA 4XWTA 1UBKS 2WT9A 2IHKA 3EXHC 4B3RM 2LCIA 3SYTA 3WB1A 3IEIA 3VI3B 3U6BA 5G0UA 3QELA 5TMDA 3RFVA 3OFVA 2NTYC 3NP7A 3VR3D 1G5QA 2GN1A 5ISMA 1GUYA 1J56A 4I4NA 4IX9A 4G0XA 1ZUNA 1A0OA 1IN7A 5DVZA 5B2ZA 4RVUA 2GPJA 2FPOA 5B3KA 2QTAA 5T7BA 3D7SA 3HBJA 4QOJA 1QKJA 5LVAA 5HKOA 4YJ2F 1H6CA 1RC8A 2JFQA 3AU9A 3WLHA 5JAZA 4JI5M 4YJGA 4ZVTA 3VNAA 2QN1A 4GBMA 2FW0A 1VC2A 1VLMA 3JQFC 4UDYX 3PEYA 1SUBA 3QHPA 4BO3A 2DT8A 3GT3A 2CLKB 3HY4A 2JRCA 2WQZA 5DZSA 3S40A 4JJ7A 1QM5A 2JDID 2BGIA 3I2JA 3JYQA 1P2SA 2P35A 3T5DA 1B1AA 5DBGA 4ZRDA 5ENZA 2YH2A 2Y0DA 2D7GA 3R7BA 4IVQA 4AUEA 5T3YA 1GOTA 4HO1X 1B00A 4R2JA 4BBPA 1D1PA 1WD5A 1Y37A 2QN2A 4KO2S 3I62A 4O33A 4F72A 1CFZA 2OP0A 3NT2A 3KWJA 3QZUA 1HTTA 3EXIA 1RXEA 4LE1A 1O08A 1OAOA 3PNYA 2CL7X 3AZQA 1IOVA 1XYYA 1Y7HA 1G20E 4MXDA 3UMRA 1UXJA 2P4UA 4DQUA 2QMZA 1B6GA 2ZB7A 3IP5A 2EDAA 4OEHA 1DBIA 3E4DA 5COBA 4PW0A 4KR9A 4OBBA 4JIGA 4OOEA 2BCEA 1ZRHA 2L6OA 3E05A 4H2DA 2GBIA 5K8IA 4XA8A 1C3OB 1W36B 3U4QA 4FOSA 4QPNA 3BF7A 2ZB8A 4B8YA 5K1ZA 1VL8A 2ZE8A 4YPFA 2GEJA 1XVIA 4LFAB 5BPHA 2WINI 1VIAA 2E85A 5JNRA 1RYNA 3KFXA 4JJ4A 4DUYM 4RHTA 1YB2A 4ZVOA 2BM9A 1II8A 2PMFA 1H5UA 4RIHA 4F93B 2BY4A 3P8ZA 1X9GA 3ZCRA 5AUPB 5A4AA 3WC4A 1P1RA 3NNDA 1NRWA 5A4MS 3TRKA 4ZO7A 3KSDO 5HPYB 3EGVA 3RWBA 4OKSA 4JHLA 3DF9A 3H4TA 1K6MA 3R74A 2JCYA 3HB5X 3IUNA 2VUUA 5HBRA 1E8NA 3C6YA 4GGMX 2R62A 3A05A 4RYDA 3ZE8A 1QIHA 3GGCA 3SMQA 3BVPA 2CNBA 4UC0A 1UKEA 2J08A 1GGVA 1U28C 2IFTA 1A8HA 4FHGA 4F0JA 2OC9A 2I2DA 2II6A 5DLQC 3RRJA 5EJ2A 3PQ5A 1W30A 3OZ7A 1OIZA 3P2MA 4GPBA 1SA0A 5K0LA 3PJEA 4FB4A 4BX3A 1FU4A 1DEOA 1OBHA 1FX1A 3IXLA 4E3ZA 2XZDA 1D2CA 4O2LA 4DLBA 3ENZA 1XX6A 1NQAO 5G53C 1DO0A 4D6XA 2RAPA 2P9FA 3JRXA 4HYYA 4QASA 2AJTA 2NU6B 3LPDA 3UOGA 5AVQA 3ZWQA 1WXQA 4TXNA 2HRRA 5DGHA 5CT5A 4RIEA 2WF6A 1W0JD 3R7WB 1N92A 1XEWX 2DKLA 1ZMWA 1CY6A 4FZJA 3KP0E 1GTZA 4UTRA 2WAXA 2XQIA 1J0EA 1GL9B 1RM5A 1WZIA 4M8NE 4ZZIA 1FLAA 1QC5B 2YJTD 3UAVA 2H1SA 1KEKA 3ELYA 5IEJA 1USVA 3HCBA 2IPOA 3L82B 5ITWA 2AHMA 1I5RA 4NBWA 2O2HA 2HSEA 4DRYA 5EE9A 2JFXA 2WFLA 3UMCA 1X94A 3RGGA 2QLFA 5HM8A 4HSEA 4FMCB 4G9BA 3GLFE 3LJKA 3ZK7A 3OJEA 4E15A 2Z0MA 3ZGOA 4ETNA 4BNTA 2J4FA 1W0CA 2OG1A 2O48X 3IHKA 3DOCA 4BCBA 1RWMA 2R47A 3JAKB 1A7KA 2DCUA 3CF6E 4UULA 1NVMA 4YRCA 4LBVA 1XTSA 3W9SA 4ALMA 2JGKA 3GO4A 1UJ4A 1QQAA 2PBFA 5C51B 4JUIA 5DYYA 4GZ3A 1Z6YA 1LLUA 2ZQYA 1QJ4A 3A04A 1I94M 3A6HA 4AN1A 2I2FA 2ZRJA 3KO8A 2O2YA 4FM9A 4AX4A 1SKBA 2FOIA 5JCOC 2KQUA 4B33A 3ADBA 2ZBUA 3TPZA 2A57A 2O2XA 5AOAA 2KYRA 3UH1A 3QIVA 2A86A 5AP9A 3LBHA 1Y3BE 4MM3B 3OAAA 4ECAA 1TYBE 5DNVA 1Q92A 4EG7A 1F51E 5JCJD 5CIQA 2B5WA 1DS6A 5BQ5A 3H05A 1D3AA 2NVUA 2FS1A 4M46A 3WYDA 5KJCA 1HNZM 1RE0A 3QAUA 4ZQGA 4CLXA 1KYTA 4CLOA 4PC6A 4BUJA 2DQYA 3LQ2A 5K51A 3ZTWA 5BURA 3QHQA 1P81A 3HJFA 2R6GA 4W99A 2L42A 1NNEA 3UF0A 3EOZA 5ITZB 4LXHA 4YJGB 1EUDA 1EG2A 3SAWA 4PLZA 2FEAA 1CQXA 2XQGA 2YWHA 3DV9A 3PNVA 3UUEA 4CMAA 1RVDA 2BHRA 1KK0A 2UUCB 3PGXA 3C3DA 3FSRA 4EW1A 4IIHA 4X65M 4AXBA 2R6AA 2ZBKB 1HMYA 3R9XA 3QLVA 3ZIUA 4MRVA 1EGMB 4S2UA 4A2QA 2Y67A 2EJUA 1DFGA 3GDFA 1JDZA 3CRVA 5ANRB 1N6IA 2WVJA 1S2IA 2ZSHA 3OQIB 2C3MA 1FYFA 4C3UA 3EXIB 2OHVA 2OCLA 2QR5A 3DKPA 2W71A 3MRSA 3CEMA 5AI4A 3KKPA 4RK6A 1NW9B 3KLBA 4R3UC 2KDLA 4ASUA 2IVFA 1S1CA 1E3TA 4I1OA 2ZJ3A 1NMSA 1M5TA 3ZD6A 4KG7A 2B1QA 3SBOA 1NYRA 3BGSA 2PR2A 4I1PA 4PPFA 3HKDA 2KM1A 4NE9A 2GT1A 2M6RA 3GWGA 1DIGA 4WPGA 4WN3A 2G67A 4COOA 4C4SA 4JC8A 3QYEA 1Y98A 4GPIB 5IF3A 4MMYB 3WWEA 4IDEA 3C4VA 4XPIB 4BZXA 2GZ3A 5EJ5A 4EX6A 2VHEA 4L3WA 1KQ3A 1CNEA 1Z6ZA 5CDTA 2D1RA 3A1TA 3B3QA 2ATCA 5J59A 4OGKA 4ZI2A 4Q4JB 3HUEA 3HP1A 1IBRA 2VDOB 3ZV4A 2J6CA 1Z4OA 1YZHA 4A2CA 1V43A 1SVUA 1Q0SA 1NU8A 4KQCA 4KXMA 1VP9A 4Q3OA 1VM6A 3QOFA 1OXXK 1MOZA 3Q2KA 3U44B 2ATIA 3HO1A 2G6BA 3I9OA 1JIUA 5EKDA 2CXOA 3BUSA 4JB3A 1RZUA 1E4YA 3CKKA 4QPPA 1F4LA 4ZRMA 3NKVA 4MIYA 2PD4A 1G63A 4CKEA 1SA0B 4ZQBA 1Y4UA 3KKEA 4FQ5A 3N8DA 1L1FA 3U3ZA 4DCGA 2H2AA 1QDTA 4P7JA 3V48A 5BWLA 4IPTA 1WMFA 3R6DA 4Q12A 1V7PC 5HK9A 1JI3A 5B1IA 3QKRB 2LIVA 4ZDKA 4TM8A 2AFHA 1SU4A 2JLRA 3FPBA 3QPCA 4W8HA 4S1TA 4ZJPA 2OBXA 2XVYA 1IXKA 3I9NA 3DCNA 2JLUA 3LPAA 2YUIA 3MXOA 1X0VA 3NC1C 1MH9A 2ZZMA 4N8SA 2ZVQX 5B37A 3D1LA 1J2YA 2AR0A 3ESYA 1ND5A 2VS1A 5K99A 4I4CA 3E7WA 3Q0IA 3H87A 3DF7A 2LBCA 1XV5A 1BO6A 1CUWA 3QUQA 4WBSA 4DNFA 3K6SA 2XCUA 3KWLA 2HSDA 2YJ4A 1PHPA 1G42A 3OEEA 1H94A 2XGJA 1TB4A 3K70C 2QORA 3C74A 3NWJA 2VJCA 4CISA 1TC2A 1WDTA 2UZ0A 2WFLB 1H42A 4ZMSA 2FQYA 3KJXA 2VF8A 3OQOA 3LECA 1A5AB 3LCCA 3UWOA 5HRCA 3TXXA 5FFMA 4R1TA 1ZX1A 1Y48E 1ZUIA 1KE1A 1HYBA 4YJ3A 3E1SA 4XEUA 3J81S 2GPWA 3A1VA 3BRWA 2YOHA 1BNCA 3SC6A 1YS2X 2YVUA 3EVNA 1NVMB 4J2TA 2OILA 2PFGA 4G8CA 3ANSA 2AS0A 5B4TA 1JXQA 4BNIA 3LX4A 2ADOA 4PSVA 3IRVA 3OE7D 5KSZA 4OY3A 2QENA 5BW5A 2Z2XA 1I5EA 3P0RA 2NUAA 4G5OA 3H13A 3ZGVA 1CRZA 4FYPA 4KQWA 4CTJA 3RYFB 1L4NA 3JQPA 3O4JA 4BNUA 1J9GA 3ND9A 3L8MA 1A4RA 2H06A 1SVWA 3LXRA 4K9RA 3MIIA 4WK4B 1EIJA 4EEZA 3DFMA 4RTKA 3VR2A 1GPAA 2ZITA 5TGTA 4ZOLA 1EWQA 2NVUB 1AY0A 4PYIA 3SCZA 4KKVA 2ZDQA 1VBNA 1C4KA 3IBYA 4WH0A 4PZLA 4CLOB 1U0OC 4E31A 5E1MA 3BWBA 4NZYA 4ZO6A 1VMKA 3QE9Y 3ZWOA 2SNIE 3DV2A 2CWBA 4IHJB 3UMBA 4CKBA 3DAYA 1CY2A 2CHEA 1PVVA 1XD9A 2FFBA 5FWNA 1B43A 4I2NA 2O5EA 3P2EA 4DR3M 4MO2A 5AHKA 3D5TA 3D3KA 1WF3A 4NFSA 5DLYA 3C6QA 2J7PA 3KR1A 2EFJA 3JASA 1JVNA 4Q34A 3N3BC 4MITA 4W5NA 4V02A 4FHZA 4P3YA 3F73A 2DPYA 5EJ9A 3QYFA 1Y1RA 3R9XB 4ABTA 2Y76A 2A94A 4X91A 4EBFA 3PL1A 2IXEA 4MYRA 1QXSA 2Y77A 1R15A 3GT4A 1ZM4A 4YH1A 3AWIA 1L5RA 4LSZA 3H3FA 5K8UA 4NYJR 5CNKA 1CUFA 4OHZA 2ZYDA 2ZIEA 4ENQA 4PRLA 2IZZA 3RUAA 3EA0A 4RESA 3LLUA 1M33A 2F64A 2XH9A 4JUDX 3GLRA 3IX7A 3KJNA 1CP3A 1UDBA 2EV9A 4F7WA 1DL5A 5FKJA 5SZJA 2IYSA 4IRUB 1SULA 4XIJA 1TYAE 3DDHA 5KKAA 3NHUA 5KOIA 2Z3XA 2OZVA 4M7WA 2GCIA 2L69A 3N2YA 4NU0A 5C8YB 2XY4A 2ZRNA 1G0NA 1V9SA 2J32A 1ANKA 2O8VA 1XYVA 3ONEA 3HKDB 1KDVA 1XPOA