3UZUA

The structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRFGQNFLVDHGVIDAIVAAIRPERGERMVEIGPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIARPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAFSQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Ribosomal RNA small subunit methyltransferase A from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase A
total genus 77
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uzuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3uzuA01
4PGHA 3KQVA 3G2MA 4CTJA 3OU2A 3PT9A 2PX4A 3MTEA 5GM1A 2PXXA 1KHHA 2YXEA 5KQRA 4HRAA 2VDWA 3KQSA 3EEOA 3PLAE 3IEIA 2OB1A 3Q87B 2JJQA 2PV0A 3LBYA 2ZBPA 3GCZA 3ANXA 4XUEA 3V97A 2HR1A 3G2OA 4YUZA 2ZSUA 2FK7A 1MJFA 5CM2Z 3FUUA 3GJYA 1RI4A 3KPWA 2ZIGA 3PVCA 2EJUA 4LWOA 5H02A 1WS6A 1L3CA 3A26A 3NVKI 1JG2A 1L9KA 3HEMA 3OZTA 5FHQA 3B5IA 3OZSA 3UJAA 4RTPA 3A7DA 5FULA 3UWPA 3UJBA 3T7TA 3EGVA 3A7EA 2PBFA 1NE2A 3AXTA 3FPJA 4R6WA 4C06A 4IV8A 4GQBA 2VDUE 2ADMA 4E31A 4YV2A 3SMQA 5GOZA 2YVLA 5EPEA 1ZGAA 1N7IA 1NT2A 5LQKA 3B3JA 4FT4A 1EJ6A 5CUQA 1NW6A 3EVDA 3FRIA 3UBTA 2AVNA 1YFJA 1D2CA 1SUIA 3DR5A 4AZVA 3DULA 4PCLA 4Y2HA 1O9GA 1EIZA 3UZUA 2GPYA 3BGDA 2HTEA 2B9EA 1JSZA 2N47A 4KIGA 5DXAA 5HEKA 1YUBA 2G71A 4RTJA 2P35A 3P9CA 4ZTBA 3GDHA 3TLJA 5BXYA 1D2HA 2XVMA 3EGEA 4U7TB 3PTAA 3KQPA 4F84A 4C04A 2Z6QA 1KIAA 2YXLA 4QQKA 3UA3A 1JTEA 1RJDA 3BZBA 1VPTA 3UJ8A 2ONYA 1M6EX 2B2CA 2P7HA 4MIKA 3WSTA 2O57A 4RX1A 4PCAA 2G70A 3S68A 5DM4A 1G8SA 3PFHA 4O29A 3TKYA 3R3HA 2R3SA 5CD1A 4LG1A 1ZKDA 1EG2A 3BWMA 1AQIA 4OBXA 4RVFA 3KU1A 1BHJA 4ER7A 4CTKA 3G5TA 2IGTA 3DMFA 4YUVA 2PXAA 5DM2A 3KR2A 1P1CA 4E2YA 1SUSA 4PONA 2CL5A 5HZMA 2IP2A 3LCCA 5E1OA 2YQZA 5E2BA 3REOA 3C3PA 2Y1WA 4A6EA 2AOTA 5HIKA 4RSRA 1FPQA 1VBFA 4ISCA 1XDSA 1N2XA 2VS1A 5EOVA 4EQZA 5CVEA 2GH1A 5LQRA 1TW3A 5JR3A 2BH2A 3HTXA 4RTKA 4EMSA 1SQGA 1XJ5A 2OBFA 3B89A 3R6TA 4MWZA 1R6AA 5C0OE 4R05A 2PX2A 3LDUA 5ERGB 3RIEA 4AZSA 3I5UA 1JTFA 4IKPA 2ZIFA 3OU7A 2HNKA 1NV9A 4M38A 3GRZA 3HCAA 5K0EA 3FTCA 2AN5A 5E9WA 5FQOA 3OE5A 2C7PA 4ATNA 1Q0SA 2H1RA 2ZLBA 4EKIA 5DX8A 1QYRA 4FS8A 3P9NA 1ORIA 2OZVA 3LECA 4JXJA 3HCCA 3NW9A 5M5BA 2CWWA 1ORHA 1RI5A 2AOWA 2P3LA 3CC8A 2UYQA 3FPHA 4NECA 4UOEA 1R74A 2PX5A 1X1AA 4RTNA 3KQTA 3ER8A 2P3QA 5LQUA 1YZHA 3JWIA 4YMGA 5DXJA 4E33A 4QVKA 1PRYA 1JG3A 1IY9A 3EPPA 1JR4A 3KQMA 3MERA 1X19A 4RTMA 4BP1A 2PGXA 2EJTA 3LDFA 1ZHFA 3M6XA 4C4AA 2B78A 5EHGA 2YXDA 2ZTHA 3DP7A 2KW5A 1XDUA 3EVCA 3TFWA 4PINA 2ZWAA 1T43A 4HTFA 2AZTA 3SM3A 1KR5A 3SX0A 2E5WA 1D2GA 2K4MA 4PIPA 3FYCA 5LQJA 2O0LA 4YV0A 2VDVE 2ONZA 3H2BA 2AN3A 3QV2A 2O07A 1Y8CA 2NXEA 4P7GA 4EVIA 3BGIA 4YUXA 4GC9A 3C6KA 4E32A 2C7OA 2XYQA 4C03A 3TR6A 3HA3A 3KPVA 2UYHA 2JHPA 3FPEA 3KQOA 5E1MA 3PX3A 1G55A 1L3BA 4ER6A 5DRYA 1RI3A 1YF3A 8MHTA 3M70A 3DLCA 1UWVA 1DL5A 3A27A 5K09A 1I4WA 1FP1D 1G6Q1 4FP9A 3SSNA 3PX2A 3G8AA 1N7JA 3B3FA 5EVJA 4PYIA 5FA8A 1VP3A 1WZNA 3DUWA 4KWCA 3T7RA 4RTLA 2WA1A 1WXWA 2YR0A 3MGGA 2F8LA 4QTTB 3IYLW 1YZ3A 3IHTA 3KPJA 1XTPA 4FSDA 5T6BA 5E1DA 3SVZA 2NXCA 2PVCA 2PLWA 5E1BA 3FTEA 2PWPA 5IKMA 2AOXA 3ERCA 2ZZNA 3A25A 5T64A 2QRVB 4BP3A 4XUDA 3LBFA 2NYUA 2O05A 2JH8A 3EVFA 3M6VA 1JG4A 3B3GA 1NW3A 4FT2A 3MB5A 4XCXA 4DKJA 3HM2A 4PYNA 5DT2A 5EEHA 1VL5A 3P97A 1HNNA 4R8RA 5HIIA 3CVOA 3K0BA 5EEGA 5DPMA 3OE4A 1VIDA 3C3YA 3G7UA 5LQAA 4QQNA 2YTZA 3LGAA 4ER0A 2P8JA 5CVDA 2H11A 2IPXA 1RJFA 4QPNA 4WVLA 1RJGA 5EIFA 1ZG3A 5FCDA 4BY9E 3FUVA 3EMBA 2GLUA 2PJDA 2NP6A 4XUCA 4KVZA 2LD4A 2C7RA 3MAGA 3DMGA 4POOA 2I9KA 5EMJA 5FWAA 1SKMA 3O31A 3P71T 4AZTA 4CWAA 3UJDA 2ZIEA 3R0QA 5LQNA 2Z6UA 4BLVA 4HG2A 3O4FA 2IIPA 3G2QA 4PYOA 4FZVA 3BT7A 1M6YA 1X1DA 3AXSA 3M6UA 3DOUA 1KPHA 4RV9A 4PNEA 4RTRA 2HWKA 3HVKA 2UZ4A 5EMMA 3EVAA 1P1BA 3OFJA 2ERCA 4ER3A 5FHRA 3CJTA 5FQNA 3GGDA 5GWXA 4Y30A 5KYGA 4E2XA 3KR1A 4DQ0A 2GAFA 3HVJA 3ELWA 5K05A 1JQEA 2YX1A 3ID6C 4E30A 3GRUA 3CJRA 5DRTA 2AOUB 3LCVB 1SVUA 1Q0TA 1MHTA 4F85A 1B42A 5ICCA 2XVAA 4U7PB 1R18A 3G89A 5BP7A 4GOND 4M36A 4GOLD 3OU6A 3UJ9A 4DCGA 5LR6A 4RTSA 2XBMA 2NNWB 1L3IA 3TKAA 2AS0A 2A14A 4GOOD 2NP7A 1WY7A 2UYCA 5FUBA 1HMYA 3EMDA 1BC5A 3LKZA 4MQ4A 5FADA 5K0NA 4RTOA 4YV1A 3P9KA 4BLUA 4B17A 2B25A 3JWJA 4EKGA 3UJ7A 2P40A 3P2KA 4OBWA 4DA4A 4PGGA 3E7PA 2IH5A 2WK1A 4RVHA 5E8JA 3IV6A 5F2KA 2P1DA 2AR0A 2HMYB 2PKWA 1P39A 3X0DA 2VP3A 3DLIA 1P91A 2QYOA 2IFTA 3FUXA 3AY0A 3E23A 3PB3A 5EHIA 2IDKA 5DWQA 3B7PA 5DSTA 1BOOA 2I6GA 3A4TA 3R24A 1UIRA 5EZQA 3NMUF 3LHDA 3L8DA 2G72A 3ME5A 4KDCA 1JQ3A 5FWDA 4BLWA 3UJCA 2EG5A 2QRVA 3M33A 1DUSA 2ZBQA 3QOXA 4KDRA 3DMHA 3FPFA 3SR4A 4CKEA 4DMGA 4V0QA 2ZW9A 2DPMA 4H0NA 2ZWVA 2FYTA 1NW7A 5G02A 3I9FA 3JWGA 4RTQA 3VC2A 2NXNA 2PXCA 1VLMA 3ELDA 5E9JA 4C05A 4HH4A 2BR5A 2P41A 3HVHA 3OZRA 3JWHA 3KKZA 5KQSA 1ZGJA 3BKXA 3D2LA 3DXXA 5EKUA 2PSSA 3PFGA 3HA5A 2CMGA 4DCMA 3DH0A 4A6DA 1AF7A 5GINE 3KQWA 2WA2A 1R00A 4P58A 3LPMA 5HIJA 1PJZA 5ICEA 2IBTA 4E70A 3O7WA 1EJ0A 4IWNA 3SSOA 4F86A 5BW4A 3NJRA 2OY0A 1XCLA 1H1DA 2G8NA 1NBHA 1KPIA 3NTVA 3FZGA 4X1OA 4DF3A 5P8WA 4OA8A 2XYVA 4QPPA 5K0CA 4DM3A 4GC5A 4E2ZA 2IH4A 2GB4A 4R8SA 3HP7A 2P7IA 2GA9A 1XCJA 3E8SA 2GS9A 1XXLA 2QM3A 5FA5A 5DTQA 3TOSA 3U81A 1NKVA 2XYRA 3LCUA 4YUYA 3ELYA 1I1NA 3TQSA 5GM2A 3RODA 5KVAA 3NDJA 5LSAA 1G8AA 2OO3A 2Y1XA 4X60A 1AQJA 3G8BA 5GIPE 5HILA 3BWYA 2FHPA 3MHTA 3T7SA 2BM8A 5EC8A 3OFKA 2NXJA 3I58A 7MHTA 1EAMA 2ZFUA 4PYQA 1WXXA 4QDKA 2AOUA 4PYJA 5LQCA 5CCBA 1YB2A 5EMLA 3G88A 5EMKA 3UA4A 3C0KA 4HGZA 3FTDA 3TM4A 3NWEA 3DXYA 4V0RA 3I53A 1G38A 5GP1A 1I9GA 3GNLA 5CVUA 1G60A 5DSXA 2CMHA 5K0GA 5GIOE 5IH3A 2I62A 3ER9A 2ZVJA 4E2WA 2R6ZA 2H00A 3BKWA 5B1SA 1QAMA 3EVGA 3GO4A 5K0FA 3QOWA 3LDGA 3GRRA 3FTFA 1QAQA 3LL7A 4QTUB 5DM0A 4C07A 3FPGA 3BWCA 1F38A 1AV6A 1JQDA 1R8YA 2FK8A 3OPNA 3E05A 1QANA 1O54A 3VC1A 5ICFA 2ZCJA 4G56A 2P3OA 2EFJA 4HC4A 4AX8A 2JHAA 1SQFA 3THRA 5KS2A 3C6MA 2ZULA 3UFBA 1UFKA 4P7JA 3P2EA 5HOQA 2QE6A 5EG5A 3KPUA 3R9XB 3CCFA 4GUAA 2OXTA 3OCJA 3FRHA 1QZZA 3ELUA 3M6WA 4PYMA 4P7FA 1XVAA 4AZWA 3EEYA 3KR9A 2PWYA 1NV8A 3MQ2A 1KPGA 4R6XA 3DXZA 3V8VA 3M4XA 3CBGA 3K6RA 4PYKA 5DX0A 5DLYA 5C9ZA 3BXOA 2ZZMA 2FPOA 4X63A 3TMAA 4FGZA 4QVGA 1KXZA 5K0LA 4IV0A 4HSGA 2BM9A 3P2IA 1NW5A 5D1NA 4YMHA 2BZGA 2JG3A 5CVVA 3T0IA 3HCEA 1FBNA 3AJDA 4FSXA 4OA5A 2BR4A 5EGSA 1JSXA 2IBSA 3HCBA 3DTNA 4RYLA 5K03A 3GIWA 5U4XA 3MCZA 4HGYA 2AOVA 3ORHA 4RWZA 3SGLA 1L1EA 1DCTA 1FJXA 3LSTA 4HTFB 5ICGA 2VZ9A 10MHA 1KYZA 4M37A 4GEKA 1EQAA 2O06A 3BWBA 3HVIA 3Q7EA 1ZQ9A 4OQEA 3GXOA 3I64A 3MTIA 2PT6A 5EKXA 5EZSA 2BR3A 4ER5A 4AUKA 4CXMA 3EVBA 5MHTA 3EVZA 4CKCA 1INLA 2C7QA 4KIFA 5K0JA 1FP2A 3TM5A 3KHKA 4L7VA 2ESRA 5DTRA 4FR0A 4K6MA 1KP9A 3FYDA 1JG1A 3HCFA 5E8RA 1RI2A 1IM8A 3LKDA 5EQJB 4QDJA 3GU3A 1NW8A 1F3LA 5CVJA 2JHCA 2OPBA 3GRVA 4Z2YA 1TW2A 1IXKA 1BKYA 4PIMA 5K8VA 5CCXA 3G5LA 3NVMB 4LECA 5C1IA 3RW9A 1Z3CA 5BW5A 1VP9A 1RJEA 2YUIA 2ZZKA 3THSA 3NDIA 1VE3A 3HA7A 2PT9A 4KW7A 3SSMA 3VYWA 5EIWA 3NWBA 1TPYA 2G1PA 2OB2A 5HIMA 4OX9Y 4P7KA 1O9HA 2I7CA 3BGVA 3EGIA 3GRYA 3F4KA 4M7RA 2Z6AA 2IH2A 3VSEA 3HNRA 5T67A 2V7EA 3KPYA 2AN4A 3LX6A 5JUWA 4RVDA 5E9QA 3FUTA 4MHTA 2UYOA 1QAOA 3KQQA 4GBED 2AOTB 2QY6A 5DX1A 4KRGA 3PS9A 2EX4A 5F2NA 3CJQA 3UJ6A 1R8XA 1KYWA 3BUSA 3TPZA 2PX8A 5DM1A 4PYLA 5HFJA 1XDZA 3KQYA 2JH9A 2IDJA 3HCDA 3P8ZA 1OR8A 1X1CA 2OKCA 3CKKA 3G2PA 4X41A 5FTWA 1M0EA 3SXJA 3TRKA 5CIYA 5K0BA 1VQ1A 1WG8A 3P9IA 2CKDA 4GF5A 4LWPA 2OYRA 4C08A 3CGGA 4YUWA 2HV9A 5D1HA 3AWIA 2ZBRA 4GOMD 2DULA 2V74B 5DTMA 1RI1A 3FUWA 2AVDA 4WXHA 1V39A 5E2AA 5F2OA 3EVEA 1U2ZA 4PWYA 4RVGA 3GWZA 4CKBA 1NBIA 2Q41A 5K01A 4DZRA 1X1BA 1SG9A 3KR0A 4OQDA 2B3TA 4EK9A 2FRXA 2ORED 2FCAA 4MTLA 2PY6A 9MHTA 4X61A 1YFLA 3MCTA
chains in the Genus database with same CATH superfamily
3RC3A 3E3OA 4BJ5A 3K5PA 1OC2A 3CFYA 4HH0A 5FWYA 2F3SA 2PX4A 1H3FA 3CEMA 1KHHA 2X0KA 4JI0B 4G5RA 4NONA 1AHPA 2G7MC 2W4MA 4MKGA 4LHSA 1MCZA 3PLAE 3IP3A 3RS3A 2GPTA 1I0ZA 3CTPA 4O4HB 1OX4B 3ZK8A 3RGGA 3QFSA 1UINA 3DVQX 5I3ZA 1CF9A 3PG5A 3KE8A 4DUGD 5TMDA 4EHLA 3VBCA 2QUZA 3IR6A 3SARA 4JI7B 4KV7A 1DGGA 3AVWA 1MJ5A 2FMIA 3DZJA 2C42A 3UCXA 1L9KA 4DR4M 1LPSA 1U5CA 4BNDA 4BEWA 1W87A 5EERA 1ZN2A 1K8ZB 1Z2AA 5FYDA 3WKEA 2H4XA 2A5JA 3KLPX 2YJ6A 2GWRA 2HQ1A 2ADMA 2IEYA 5BOSA 1NMQA 2YINC 2PRYA 4MRVA 1MT0A 2CBXA 1NJGA 1DHRA 1KSFX 3G59A 2QENA 3QVMA 4HEA1 2I3DA 1M5TA 3F47A 3V1UA 2AVNA 3GNTA 3G7NA 5JAQA 2B4KA 1N1EA 1FIUA 2A1TS 2SICE 1UMCA 2N1MA 2O8CB 4QQ8A 1XLTA 3UZUA 3OG9A 3ZHSA 4XAQA 2Q9AA 2OGZA 4LFBB 3E5NA 4OB6A 4WFJA 4FFRA 4FJ2A 2P35A 3P9CA 4OLFA 1D2HA 2Y0BA 2QOEA 4BB0A 3AVYA 2ZRFA 1CF2O 1Z0ZA 3OICA 4I8XA 5HDBB 4Q9JA 4F84A 2Z6QA 2JDIA 4QQKA 4LVNA 5KVVA 4G5SA 3WJ2A 2NOAA 3W3AA 4K6CA 2IUUA 2ONYA 5KB3A 1EJ2A 3EYWA 5LMNB 2WG1A 3BE5A 4NU5A 4XX0A 2D4HA 3SZMA 3TYXA 1JHVA 2G08A 1T9KA 4ZHQF 2R44A 2C98A 5IEBA 4FDMA 2C31A 4OBXA 1XDGA 2MROB 1AQIA 1W44A 3DNPA 3HMQA 4DWOA 3QLUA 4KC0A 4PS0A 4TMZA 3WQBA 4KQKA 3ZBTA 5BQPA 3C4JA 5T3UA 4MB7A 4ARZB 3INRA 4LI0A 3RGWS 2Y0EA 5BOVA 2UXCM 1KY2A 1Y1LA 4BMDA 4W1SA 2HMTA 1DTWB 2IHVA 4ZO9A 3VSCA 5KTKA 1XC8A 3FHLA 4A6PA 2VTEA 4BVKA 2A0WA 3GRCA 4L5CA 1C1YA 4L9WA 1E2FA 4EA6A 5HVNA 5JS6A 3P9ZA 1EBUA 4AMBA 5LQRA 4HGRA 5BVGB 1I24A 3DHNA 2B36A 3HTXA 4J94A 3OE7D 1N2HA 2C97A 3HZOA 5D7BA 2F9LA 2EIHA 3AJ9A 3SASA 1V8ZA 3I8SA 4H35A 1T5BA 4FYIA 4NMXB 4Q34A 1R16A 3ESAA 1ULUA 1LLFA 2QZZA 1DXOA 3MJFA 1F9AA 4FOTA 1YHYA 2C4HA 6CHYA 4OHVA 3AG5A 4HVTA 1JXQA 3R3SA 4FOSA 1MR3F 4YCBA 4ALNA 4BEBA 5E9WA 1CY4A 1YZUA 3HDGA 4F4JA 4ZYZA 3PFCA 2H1RA 1KJNA 1QUFA 2HK7A 5DX8A 4AN1A 5CDTA 4M7WA 2WSCF 1RWVA 2J6CA 2IEIA 4XIGS 4LF7B 1WCXA 5J58A 4ED9A 4YQZA 1MW9X 4LDAA 1JZTA 1Z18A 3RVQA 4MULA 4G5YA 3U4QA 1QMPA 1U31A 3R0XA 2IE0A 3H5IA 4H1VA 5G53C 4RTNA 3KXDA 2ETXA 1HWYA 3NH6A 4LV6A 4TN5A 1WDLA 2A35A 3IKLA 3LHSA 1GVHA 1K68A 3K0CA 1G3IA 5DXJA 3U6LA 5JW6A 4JI2B 1OTXA 5TARA 4HLDA 2OHXA 2PGXA 1T1EA 4EVRA 4U9IS 3PNQA 5SICE 4WT7A 3T1NA 4AN4A 1ZQ1A 1Y5IA 1RKQA 3DP7A 4L8YA 2XYHA 1KS2A 3T6KA 4WFKA 1V5IA 1BMFD 1S2GA 1T0PA 2L6OA 3R0ZA 4WADA 3EG9A 1E6KA 3PRJA 2RGNA 4OH7A 4B7CA 3BYZA 4H60A 2KLHA 2ONZA 5AKXA 3SJ7A 3ZKAA 3VU9A 3ZY6A 2HSGA 3EQ2A 4DQVA 1AO3A 4ZOLF 3J27B 1NU8A 1IXRC 3L26A 1F2TA 3GJRA 3V48A 2BEVA 8OHMA 2JHPA 3BM5A 1G55A 2XB6A 2Z5VA 1P7VA 1TA4A 3LF2A 3B9RA 1QZUA 2OCLA 3B51X 3OTWA 3RJ5A 3FOEC 2ADOA 1U5BA 2WHPA 1RC8A 2DSTA 4JASB 3BD8A 1F4IA 1HYQA 1VJTA 3VPHA 4EW2A 3DZDA 1NQUA 1VP3A 2M6LA 3HJQA 1ZAKA 3BC1A 1AKVA 4PC2A 1NBMA 1D0IA 4MJXA 4Z4CA 2ZJ4A 3Q10A 2WB2A 1VMAA 2ZBDA 3EHDA 3B7NA 3ILSA 4OMUA 4RFVA 1OLOA 2H2HA 4TSRA 5DP1A 4ECEA 4MW5A 1UKZA 3ERCA 2AOXA 4JNCA 3C3WA 4MW2A 1N2CA 1ZNWA 1HRDA 2PUVA 5B6PA 2ZE5A 1DQNA 3QP9A 2HKJA 3LBFA 4XPIA 1YT5A 2JH8A 4CM4B 1NW3A 4IQ0A 2RI0A 2VRCA 4KRFA 3PK0A 3NOQA 2OMKA 4M8IA 4Q4LA 1GZDA 2REQA 2CWDA 3HE3A 1MFZA 3PR2B 1CWUA 5CJJA 3FSJX 4OXQA 1A8SA 5LQAA 1VKJA 3VV2A 1HZZA 2YYYA 3LZCA 4EHAA 3KQHA 1NQWA 1UANA 5FEMA 3F5FA 3WRXA 3MINA 2PUEA 2COKA 3IAM6 3TOCA 1CE8B 3NIWA 1RTKA 2ZT8A 4GIPA 5ITRA 2YHAA 4GH9A 4KXMA 3MWEA 3QI7A 5JXWA 4XWWA 5I4BA 5LCXA 2WM8A 1D2NA 4O2LA 3R0QA 1NURA 3PXEA 3ND8A 3C5VA 4DAEA 3ESDA 4LDQA 5BQOA 5AVRA 1HX7A 4CGYB 1T6OA 2C88A 3N2GB 4P0PB 2VH5R 4NMMA 5JROA 2BBSA 1Y3BE 4C6RA 5ALZA 2EOAA 5LLSA 1FMFA 5GWXA 1F8FA 4XBOA 3KR1A 5AKEA 3IPAA 3VPAA 2CDAA 3DEHA 1V2HE 4IQFA 4UTOA 4QSHA 4E30A 1MU0A 1YL7A 3IE2A 1BCRA 1G1AA 4GKAA 4CR6A 5ICCA 4KWIA 3RTAA 2H1HA 2LVPC 2RHJA 2WQZA 3IO5A 4P4GA 4BRWA 2GPSA 2FMXA 4FHGA 4XH9B 2OA0A 4GOLD 1R9GA 1KZ4A 1X8XA 4RJLA 3O3NB 1EFVA 2G17A 3UXYA 5A3JA 5JHHB 5LUBA 5JU6A 2FN3A 1GZ6A 2Q2NA 5FUBA 4DNPA 3H1GA 5IAGA 1W5BA 1TI7A 5JXJA 4LZZA 4LGYA 2ZRJA 2MT9A 2PYIA 4M86A 3JYNA 3ZZUA 5D3MA 3Q5GA 3VDRA 1PJ4A 1QMGA 3ZE2B 3VU3A 1D1TA 1HLGA 4TXLA 4BMSA 2YJ4A 2JIZA 2X5NA 1ZPDA 4KTTE 4UMVA 3H2IA 1MW8X 3KJFA 3ZHQA 1D5WA 1H85A 2WZBA 2GNPA 1U7HA 2ABWA 3DLIA 1IQUA 3K94A 4LYDA 4XDYA 4N76A 4P4NA 1IBLB 5FX2A 1KEUA 3C6BA 3U6KA 2QUIA 2H4YA 4MWGA 5DGTA 3TTVA 1II0A 4EY6A 1ZNXA 3ESCA 1UIRA 4ND8B 4PAOA 3TUIC 3UPUA 1JQ3A 4YMTA 4UASA 2HDHA 5CNJA 3JD3A 5SYMA 3C3XA 3SR4A 1UK6A 1VPVA 4DRZA 4MGIE 2ZW9A 4XTCS 2Q50A 3A31A 4CU2A 3J2PB 2ECFA 2ZWVA 4ZJZA 4JI6M 2F8TA 4BO1A 1IN8A 4X90A 1VLMA 1N6LA 3L1UA 2HH9A 1MH1A 2YOHA 5E6SA 4COOA 2AF3C 1QVVA 1VIVA 1V9CA 2IIQA 3FNFA 4MZDA 5CDHA 1IY8A 4G0MA 5CFOA 4ZCMA 1XTQA 4WL0A 5EKUA 3NRCA 3UMVA 1E79A 3IUNA 5E95A 5E3HA 1X92A 1IHDA 1JX6A 2YIVX 3V7WA 4UM5A 1R00A 3K9BA 2HNAA 4ZAZA 3NJ4A 2ID8A 4RF2A 1S4QA 1EJ0A 1CUEA 1OFVA 4FZRA 3G0IA 1TCUA 3A6DA 1OVGA 4RA9B 1TFRA 3VR3D 3EEFA 1PJ8A 2I4RA 2J08A 3V4FA 4FWIB 4AL4A 4QTXA 3IVXA 2Z2JA 3ZHRA 1IU9A 1LPPA 2GILA 3B8EA 4QGFA 4X7PA 2O8EB 5FNVA 3CSUA 2CXRA 4WNIA 1VGVA 1IBRA 3V8EA 4DIOA 2WJ6A 4KQGA 4KH1A 1EK6A 3TEMA 4YUYA 3DMTC 1GLGA 2I29A 5DGHA 1M1YB 4F3TA 5HILA 1RAAA 2WT4A 3NATA 3TSWA 4L8FA 4E4TA 1GNVA 2UZAA 3E61A 2HO4A 2OK8A 2ZFUA 3BIWA 4LRWA 2OFFA 3CVYA 3VJRA 5H37D 1QUEA 5EMKA 2IKQA 3QY0A 4XJXA 1A5BB 2EERA 2CXNA 4DMLA 3NWEA 4CIYA 3UW1A 5ED4A 1G38A 2CFRA 5GP1A 2BVNA 4L8LA 4QUHA 4U2DA 2V0CA 3T9AA 1N8SA 2QDXA 3HDJA 1L8QA 1PYDA 2PKQP 1Q3BA 1KEVA 2H00A 1G8KA 2QMQA 3B1YA 3FG9A 4IMRA 3M34A 3Q2IA 3WYCA 2B8TA 3KOZA 4JBHA 4C21A 1T6XA 4QTUB 4PFKA 3FPGA 2PJZA 1KMHB 4BO6A 2J09A 5AHKA 2VAPA 4MJ3A 4YCNA 1Y4SA 4WGFA 1RJ9B 2A9KA 1T26A 4J7XA 3MWEB 1CEQA 4ZI2A 1SQFA 3MMPA 5JVDA 1V43A 3ZDRA 1EAYA 3M83A 2JCVA 5E26A 4X3PA 4A36A 5CU7A 3X1WA 1ZIXA 2DT8A 4UE3S 3U19A 2R6GA 3DAFA 4FIZA 2C7BA 3DE5X 4UEOA 5DBGA 1JFRA 5EUCA 4IZIA 3ROPA 4ZK2A 3CPHA 3U09A 1EP9A 4QEDA 2MTBA 4CGZA 1QIJA 2CJWA 4L9SA 3A4VA 3KB2A 4QDZA 4R6XA 3QPWA 5ALYA 3V8MA 4YQFA 3M4XA 5LB2A 1TDHA 4XQCA 4NTZA 1KSJA 4QBIA 2V6GA 3L46A 3T06B 2ZBVA 4ZV4A 3SCZA 1S1MA 5TF4A 1C0IA 3A3PA 4C87A 4ITUA 1KJIA 4KGXA 3ZHBA 5KNCD 1PR3A 4J9UE 1ONOA 2PGAA 3OKFA 2CVQA 4WK6A 1NN5A 1Y89A 5CYGA 4J0IA 4CQLA 1NE7A 3AJDA 1KQPA 5C53B 4JYCA 1LF5A 3L2AA 3T4PA 1HO3A 3A3NA 1ECGA 2KYRA 4HRXA 4EFLA 3Q8KA 5K03A 5AW0A 4NNOA 3IELA 2BGNA 4LKOA 1V26A 4J75A 4LBYA 2Z09A 2Y1GA 4NCNA 3W5IA 4RF1A 2VP5A 4L78A 3TFQA 4JEIA 4M37A 1AS3A 3ZS8A 4BNKA 2BEVB 4GSYA 2Y4OA 5LOVA 1RYHA 2EDCA 3V1MA 3TWLA 4G9GA 3KDSE 3N7AA 4NG5A 621PA 4MX8A 4LFAM 4QECA 4ARBA 1U0EA 1ZMTA 3GZNB 4XK8F 2J85A 3MWGA 2JIZD 1P4AA 4TV8B 3VGPA 2C7RA 1ZX1A 6PFKA 5DTRA 1JWAB 4Z3DA 5H4HA 3SQOA 4UEWA 2D2XA 2JRCA 3L92A 2R65A 3T1HB 2LBCA 4DR5M 3D6JA 2IOFK 5ALPA 2R5FA 2YHIA 4WDQA 5ICMA 3HGTA 1F3LA 3SEFA 2RGBA 4HUTA 1BDIA 1TQHA 3ORYA 4J3JA 4YAWA 5FOVA 1VG5A 2L09A 2I87A 3Q2OA 3RO7A 4HVCA 1L7MA 4GI1A 3PENA 4RD3A 3K8YA 1ND6A 2YUIA 2W6IA 4WP2A 1ORDA 5IS2A 3S0JA 4W5HA 2PT9A 3T3PB 2OP1A 1IWBB 2UU9B 4OX9Y 4N40A 5CURA 4V0MA 5H3HA 1O9HA 2BV3A 2R87A 3GRYA 4M7RA 2YMPA 2YW2A 3ROGA 1BS2A 3F7NA 4KB5A 4YT5A 2A84A 2CXHA 2FWRA 2IELA 1S3SA 3WQHA 5BVGA 1TUIA 3QW2A 5DBEX 3DCNA 4L3WA 2VJMB 5KYKA 4LJKA 3VVLA 1PW7A 2NG1A 2IEDA 3C98A 2B4TO 3QEMB 1XTJA 1DQYA 1Y1RA 4QU0A 3U4DA 2XUGA 1M0EA 4O2BA 1MD9A 2LTUA 2YIJA 1DRUA 3RYIB 3V8NA 4IRUB 4F2LA 2AFHB 5JMPA 5C5IA 6NULA 2IEBA 5J9FA 4A4DA 4CF3A 3QYAA 3F74A 3EOBI 4Q5IA 1SG6A 2HMAA 4HXYA 5K9ZA 5J2UF 2HV9A 3D0KA 3G3EA 5AWFC 1UT5A 5B6JA 1Z2OX 3NFRA 1T5LA 4RF0A 3EFEA 1PG0A 4K87A 4JL8A 1GZVA 4DIEA 1PS8A 5JATA 1JIVA 5DGIA 2ZRLA 3DE0X 5BW8A 3LE8A 4HGOA 3PRYA 1SG9A 3L6CA 3DDOA 3GGGA 4QGBA 3UKJA 4TVOA 5C8DA 3A9SA 3RHSA 2II6A 2PH7A 2FCAA 1SXJA 3UUGA 5C8XA 3WIOA 1ZZEA 3NH9A 4P2GA 4LF8B 3I3OA 9MHTA 2HA6A 3LM8A 4LQ4A 3MGCA 3MB8A 2YFQA 1ZCAA 3FE3A 4I81A 2H5LA 1OUMA 2XD9A 3PT9A 2VEDA 4HN4B 3HN2A 3O4RA 4MS3B 3RUDA 4ASUD 2RGRA 4G8JA 1J2JA 2O8CA 5IZCA 1US8A 3PVZA 2CVPA 2OB1A 1C29B 4YECA 3PXGA 1IL0A 4MRMA 5JRJA 4Q3EA 4BE7B 1RI4A 1XZPA 3KTOA 2IYRA 3WMWA 4I4LA 5C52B 2EDAA 3PVCA 5IWAB 3EPKA 3BQNB 1L3CA 2XOXA 4EH1A 5I51A 3KOXE 2XUHA 1QTIA 2F9FA 1FYFA 1QM5A 4JP8A 1T24A 3UWPA 2ENUA 5LBIA 3IJEB 2O2EA 3DL0A 2VQFB 1SOAA 2Y1LA 3SJZA 1R37A 2B5VA 1GGHA 1PS0A 2ROQA 4ZV7A 1ZJ5A 4P98A 1MB4A 3OTIA 2KJQA 3I28A 4FFMA 4X7BA 5GJWC 1DE0A 5CHYA 4IHQA 3IVCA 4QNRA 4G25A 1DP4A 5JH7F 4F5YA 4M89A 1O9GA 1EIZA 5DXAA 2FJPA 1R50A 1Z7EA 3E3LA 3OT1B 2FWBA 1WQ4A 1LK5A 4P5PA 2NW6A 5INTA 4CIBA 3KKQA 4E4YA 1C8LA 1C1XA 5AR1A 4DTCA 1FYDA 3RBAA 1LDBA 3GG2A 5IXYA 4QM6A 1V6AA 1XZKA 4LTDA 4LRSB 3GR6A 1ECCA 1UEXC 3T34A 4KMSA 2IODA 4G1FA 4I36A 4R51A 5P21A 5I45A 5DM4A 2OXCA 2WFLB 3PFHA 2WZQA 2V6IA 2YS6A 3OOEA 4MMZB 3NTUA 4X20B 4ZAVA 1ZUHA 4HKTA 1V37A 1KQNA 4DBZA 5A5EA 3FYTA 1E9DA 1Z47A 1P3QQ 4I5DA 2X14A 4C88A 1N25A 3VTFA 4DHWA 5FTKA 1HKHA 1KGDA 1LA2A 3D5EA 1QV9A 2HZBA 5AJWA 3V76A 1GGJA 1SUSA 3EUWA 1L1ZA 4ND4A 2FB9A 3HBLA 3VPFA 4US2R 2O3QA 2V5VA 4RMIA 3EGCA 1ORTA 1EM8B 5HIKA 5HWSA 2H3HA 2COUA 1XVTA 1RYYA 4DC0A 5AFSA 3JZMA 4CR7A 5AHRA 4ZAWA 1Y6JA 4OGFA 1UJNA 2BH2A 5DBOA 1QX4A 3M8KA 4NJOA 3JD0A 1UBMS 4MWZA 2ODTX 1WVGA 2VPIA 4FMDF 4UVDA 3RIEA 2PZ8A 5IEJA 3IMCA 1NRXA 3I5UA 1GL3A 2ZE8A 1XF1A 5CB6A 5EJ7A 4PF1A 1ZINA 3GPIA 1YB7A 1ND5A 4A1FA 4PCZA 1QBKC 1Z0DA 3RC9A 3DOOA 3VPSA 4RC9A 3A1NA 3W06A 2FNAA 2XTZA 4YCLA 521PA 1YAHA 4BLQA 4DLWA 4FS8A 1JEQB 1P0CA 3P9NA 1IOVA 1XALA 5FFNA 2VYND 1YVDA 3ANSA 1QK5A 4HAXA 1UXIA 3UYLA 1YR6A 1J23A 2NV6A 3QVTA 1TH4A 3HCCA 2GBPA 1ZN9A 2ZG6A 4C78A 2C9ZA 2P3LA 4ZHQA 4TL6A 4L02A 2VIIA 1VLZA 3BXPA 3NOOA 4KMRA 5BYKA 1E9SA 3QFHA 1EM8A 3KQTA 4C0JA 1IZ0A 4QM7A 5ESRA 1NI4B 5M2QA 3ECSA 3C97A 1ODFA 1U9ZA 2NO1A 2OC4A 1F20A 2EJWA 3C1UA 3O8QA 4QREA 5AK3A 3L27A 2O50A 2YZKA 1N9GB 3CZ5A 4GECA 3AK4A 3QKIA 3NWPA 5T4FA 1SVSA 3Q8MA 3BGWA 1QZ3A 4J0QA 5CXXA 2HJ9A 2JGLA 2IS6A 1Z5NA 1SBHA 3B7GA 4RY8A 4A10A 4EF4A 1JHMA 2GZDA 5LDHA 4MCIA 3THXA 5DNWA 1E1CA 1U3WA 2XLBA 3RVJA 3OQPA 4NBKA 4YV0A 4E5KA 1Z59A 1J2UA 1N5JA 3GLTA 1O0CA 5DLPA 2YHUA 3TJMA 5HHTA 3U7JA 3F90A 4ITVA 4YUXA 2CHQA 1F0YA 1NNUA 5THXA 2AI3A 2FF7A 3IERA 4IIBA 2EX0A 1ZL0A 3LF1A 4I8IA 4EG8A 5TQJA 1R7RA 5EJFA 4ER6A 5FWXB 2XNJA 3CX8A 3NXSA 3NP7A 4LHXA 4L15A 4J1NA 5DRYA 5CG2A 1U1GA 1C9YA 3JQDA 3IRUA 1A7JA 3WYFA 1H6UA 1V45E 4ZV9A 4EHIA 2X1VA 1Y5NA 4N7MA 5HRUA 3AF1A 4K0RA 4QTTB 1X8LA 5LD2C 3IA7A 3U6PA 3OLXA 5SY9A 2P8SA 4U6NA 1AVTA 2PZAA 5B2ZA 5AIBA 3LLSA 3MIIA 1QQAA 1M8KA 3T5DA 4DGQA 4X00A 1G8JA 5DEIA 3RG8A 3PGXA 4FT2A 3E9ZA 2XQJA 4QRDA 3KD2A 3PNVA 4H6PA 4LHZA 2F5OA 4HAVA 3HU5A 5DT2A 3FKJA 1JKJB 1HNNA 3CYFA 3I92A 3CVOA 4L8GA 3ND6A 4WE3A 3TQIA 3W1WA 4F2PA 8ABPA 4HAZA 3SIXA 1UR5A 1HE1C 2UZ1A 2IXBA 2MYPA 5E2IA 1A8PA 1WL8A 1JR3E 3ZU4A 3GD7A 2X5OA 3TL3A 2EWMA 1PGNA 3PC8A 1ORWA 1ZG3A 2DEUA 4MRMB 2DP4E 4YRLA 4O4IF 3P0RA 2HRBA 4KVZA 5EP3A 1UK9A 4WXYB 4AX4A 2GZHA 4S12A 4JB2A 1FRVA 1CB0A 1OLXB 1WMBA 4KCGA 4MW4A 1E5TA 4OY3A 2E1RA 3WWEA 2WTNA 3P4UA 2FR8A 2ZUVA 1G0NA 1EVZA 1OT5A 2YZGA 2M60A 4Q39A 4AZTA 3L1VA 2A94A 1Y6ZA 3PGVA 4PN3A 1NSTA 1OBHA 1QDUA 3D7NA 1N2IA 2AQIA 3I2KA 4J0KA 4JOQA 3RVNA 1X1RA 2C2BA 2HJHA 4I66A 4BU0A 4BZPA 3HGQA 2QMUA 1LJ8A 4MGHA 2NO6A 4NX2A 4YPFA 2QW8A 2DY0A 1ISSA 4L72A 4MYRA 4OUDB 4G9BA 1JQEA 2BELA 2JPDA 1PW5A 3R3XA 4K81B 1B15A 3OE1A 3WRWA 2H1OA 1EK2A 4C89A 3AV0B 4CDMA 3PEYA 5CVCA 1PWZA 3LCVB 2KA6B 1SVUA 3F67A 4G5HA 4HGPA 4KIUA 4WN9A 2YWBA 4U7PB 1SNYA 1UUFA 3TZLA 4BLOA 1IUPA 1UP6A 1TRHA 2QSYA 8ADHA 2BUBA 1YCDA 3BMXA 4OW0A 1WNFA 3HWX1 1QNFA 5FIUA 5BSTA 3T61A 2IP4A 2OLEA 3GFBA 4QOEA 3QEKA 3R7FA 3SN6A 3KKMA 4C6SA 1ZGZA 4DA0A 3C87A 2WT9A 3V4OA 2DFTA 3SBDA 4RTOA 2WWFA 3OFND 2YYZA 2ZJ5A 2Z7JA 4HMQA 5MFPA 4B17A 5ESDA 2XB2A 2X1HA 5TEWA 4JXKA 2G1AA 4OBWA 3K5IA 1Z73A 2Y9PB 5LWQA 1U2DA 3RFCA 1W1IA 3LPLA 1T5IA 4NS1A 4U8GA 1TYDE 4KP7A 2GM3A 1TMGE 2GUWA 3DDHA 3AY0A 3HRKA 3EXIB 3IDQA 5F3DA 3S2IA 4BB6A 1CXZA 4TYMA 1NQOA 3GY0A 2X3YA 3VYRB 4A0GA 1BOOA 4GD3Q 4WKCA 4YJGB 2ORVA 3KEGA 1ZGHA 3LHDA 2FCRA 1UF9A 2BE7A 4LBVA 5JJLA 4U2CA 4PZ9A 3ZWOA 3LT5A 2XCRB 2QRJA 2B8JA 4TQ9A 1ZOLA 5BWMA 5KKCA 3E8XA 5FI3A 2HNBA 1PX2A 2VDKB 3GV0A 1YVPA 2C99A 2AWNA 2B4AA 3DV0B 3P9YA 1VYTA 2R7NA 1BXGB 4MGEA 1QR2A 2JIDA 1GNTA 4FQ8A 3RUCA 3PU6A 2I7VA 1FXWF 4ZEXA 4BZXA 4MYUA 2QIOA 4Q18A 3UA4A 3VGJA 3CXUA 2BGLA 2GBGA 1RZUA 1YUMA 3OC6A 4UMEA 1R4MB 4UKDA 5KJFA 5EJ6A 4G9EA 2I1WA 3E15A 1NNSA 3E7DA 4O2AB 3K70D 1O95A 1SHUX 4P58A 2I6FA 4V24A 1JXOA 3B1VA 4QJ5A 1K66A 1GGVA 4LXYA 4MUXA 5HW0A 3O7WA 4B48A 1O95C 4QRHA 3VPGA 1CUUA 4MB2A 2J3JA 4DPLA 2Y2VA 1EWYA 2H4HA 2G5TA 4IJMA 1I33A 4D0RA 2R62A 2X77A 2EBFX 3PDCA 4ZFNA 2XITA 2FUKA 2ZI9A 4DF3A 3DUFB 3VKUA 1H69A 4OKNA 4M83A 2DUWA 1NM5C 2W6QA 4BNHA 4Q4DA 4R8SA 5FOQA 3AHIA 3KK0A 3MNFA 5HTKA 5AK4A 3I04M 2WYUA 4G84A 4LQLA 3KVVA 3TOSA 2J7NA 1DQRA 1NVTA 1TYBE 4M98A 3KG2A 4GI5A 2R96A 1FW8A 4GNRA 4F2HA 3DZGA 1M1XB 3E3MA 4OHBA 4O33A 3W9SA 3IQFA 1LSOA 1UKAA 1ESCA 3TX6A 1WF6A 4Q21A 3ASVA 3I58A 1T5SA 3F9IA 4F4UA 1RAEA 3TMYA 3PDHA 1U81A 5LB4A 1S0UA 4TKUB 1TJ5A 4AS3A 3HM9A 2B94A 4IYRA 1E32A 4D81A 1TXGA 3GT3A 1D6JA 2GCOB 2WJPA 2R2GA 2J9ZB 4EW3A 1M2VB 2C9CA 1NA5A 4CKYA 5KUTA 3PPYA 2QTWB 1CQIB 3LVFO 2B34A 1QAMA 2NU9A 2GXSA 1XDBA 2GHTA 3R1IA 4LCEA 1ODLA 1RXVA 1CDZA 4JI1M 4M8LA 1QP7A 3U6MA 5K3SA 1ZVKA 4KHPM 1N8KA 1PGQA 3EXHB 1TZMA 2QLFA 4G4IA 2QL9A 4UAUA 1I2CA 3HJGA 2Z2ZA 3AP1A 5A9TA 3KS8A 4BIIA 1QRDA 3BXXA 4F4DA 2FPMA 4L1KA 4PQFA 5IJZA 2BPOA 5F3WA 1DWQA 1EFKA 2FLVA 1NJ8A 5AVUA 4PLWA 2O6HA 4JI2M 1JA0A 1YGPA 3FYUB 3N9IA 3KPUA 4GX2A 2KNVA 5H7XA 3VC3A 4F12A 3W9BA 4BFWA 2HL6A 3AETA 3N5KA 4YN3A 2A8YA 5D00A 4W8GA 4K9DA 4IIUA 1Q11A 1RWOA 3S2UA 2C2XA 1M6WA 4E2XA 3GBVA 4TSFA 1EFPB 3OO1A 3NAGA 4MPJA 2VC2B 4BKMA 3GARA 5CM9C 3PUIA 5JQGA 1VDZA 3GLGA 1H42A 1T29A 4AZ3B 1YQUA 4Z5XA 2QAGC 4CR8A 3AHHA 1RP7A 5FBQB 1DUIA 1UBNA 8LDHA 2DLDA 2QQFA 4HNAA 1PZHA 3I9MA 4IAOA 4XGQA 2BEWA 2VRWA 3H42B 1RBYA 2AG6A 2FRDA 3K15A 1ZMWA 1XAHA 3UKDA 5LM3A 4ME6A 4TYPA 2GF9A 5EUBA 2IBSA 2YMQA 3MS7A 4WXEA 2XE7A 4PSAA 5AHOA 4WV3A 3SQDA 4RYLA 3RC1A 1D09A 3EXFA 2W2VA 3V9AA 4JLOA 4F46A 4PXYA 3S1AB 1QV6A 3OM1A 3T5MA 4DA8A 2VH1A 3NYRA 1EDOA 2G3YA 4JSRA 3BX1A 4O3MA 1RM0A 2GQ0A 1KMIY 1R4GA 1EQAA 1SC9A 3BL5A 3EEBA 4M0CA 1NNEA 1C3OB 1DARA 4OHXA 2P9BA 3THWA 5DTIA 4PZZA 3DNFA 1L2TA 3AY6A 3P20A 5BQFA 5LD2B 3MHVC 4U2EA 2F2TA 2W2OA 2RGNC 1DI0A 2GO7A 4LNUB 4DLLA 5JAOA 2WKRA 1R66A 1L4FA 1S8AA 4FINA 3KHKA 4FFWA 5F7JA 1CS0A 1Y3FE 5JEDA 4HB2A 3E03A 3MCAA 2BHTA 1CLEA 1TE2A 3AR5A 3FYDA 5CLQA 1SUPA 2QM8A 5I48A 2OBLA 4ESEA 1RI2A 1MXHA 1FVXA 3MFQA 3K0CC 3R76A 4A8TA 4EPVA 5CGZA 2FPIB 3U4HA 4DIKA 1N36M 3TZBA 1XTIA 5LNK6 2Y2UA 1MAHA 4R2HA 3KQLA 5K3CA 5FFFA 1ID8A 3VSBA 1U7DA 3OF2A 1OREA 4CM5A 4JLDA 1VJCA 4A15A 4RF5A 2C9YA 3GP1A 2VNSA 3AESB 4M2LA 3ZHCA 5HIMA 5DK4A 5JRDS 1QYIA 3H8VA 3ENQA 5DIZA 3DVAB 2IEGA 4YIHA 2ST1A 3DFMA 3LX6A 3N6VA 4LG2A 1JLLB 4RWEA 2ZYAA 1ZA1A 3KQQA 5EZYA 3OHPA 5JYBA 2Q5OA 3OX4A 4L7QA 5K6AC 1AGRA 1TVCA 4PU0A 2QXYA 3IOCA 1AXEA 2Y1DA 3DTVB 5HYVA 1VSQA 5F33A 1RRFA 1FTYA 2DAIA 1YI8A 3E9YA 2W48A 5FTWA 3I09A 4OSEA 1Z74A 3QVOA 5D7NA 5KNDD 4A8PA 3UJ3X 1QORA 4YUWA 5CR9A 4ZZ3A 1O8BA 1JDPA 1EFRA 2V6MA 2ZBRA 4FYWA 4N47A 2DULA 1USVA 2I2XB 5IH7A 2AC2A 4ZRNA 1FMLA 2PRIA 5IULC 1E7YA 4B3SM 1SR8A 5EUQB 2QUHA 3S1LA 4DZRA 1OD6A 3PC4A 2BHLA 4UM9D 1UJ2A 5JD5A 4X71A 1IY1A 3ZVNA 1Z2EA 2JJ8A 3G8CA 4IFBA 4UPDA 4IBEA 1US8B 4BUZA 4F5WA 2Q29A 4R9SA 3K92A 1CUSA 3FMPB 3ZVMA 2GM9A 1E7RA 3VZBA 3G0HA 2EX1A 2XH8A 1A2BA 2B8WA 2FWPA 4QYIA 4S0ZA 1KO1A 2W6NA 4S3MA 1UJMA 3WNZA 4G09A 3GJ8A 4N0PA 1WZIA 3G23A 1MX9A 1CJTC 3IAFA 4ZI5A 3WKAA 3RQIA 3ILYA 1EXNA 1IHXA 1QOPB 5B7PA 3G2KA 4I1YA 4PXAA 3FUCA 3B1ZA 3MINB 3IILA 4LI3X 1ZD1A 1OBVA 1K7FB 3FUUA 2O7QA 1KOFA 4LDNA 4RJ2A 2WOOA 2VHYA 4MA4A 4WKNA 4F0JA 3ZJYA 2MSLA 1GSAA 1RW4A 3FB4A 2VBCA 3B85A 2YC2C 1U94A 1RXEA 4FDTA 1EQUA 2CKMA 3EQ7A 4ND2A 3SNHA 2WJAA 3LUCA 3IBFA 3QJ5A 2FN7A 3EDQA 1I1QB 3H2JA 4FPXA 3JZDA 5CH5A 5DN9A 5CB8A 3RYIA 5FA6A 4D26A 3F6YA 3IHPA 3THOA 3TD9A 1J1ZA 1RIFA 3SMQA 4B32A 3OOJA 5EPEA 3SQNA 5B37A 3DJYA 1Z88A 5DK6A 4JVSB 4PQEA 5FOSA 3EVDA 5TF0A 4MI3A 4N54A 1SUIA 4H6XA 3PYLA 1QK3A 5DWVA 1Q3TA 4I6EA 3CUWA 3RAGA 4EYEA 1C4KA 1U5BB 1YU9A 1Z22A 2WHPB 5ITXA 1TT7A 2IU4A 2XGNA 4B7FA 2HRCA 3H87A 1GQYA 1FVOA 4ZTBA 3RS2A 1H0HA 1OJ7A 1BXKA 2JCGA 1T0HB 3UAYA 5CAEA 1XXHE 3ES9A 3F6EX 1HT3A 1FFCA 1YOBA 1JSRA 1K6JA 1TVKA 2JEZA 4HEQA 4AKHA 2BKXA 4ZOBA 4OI1A 3HDHA 3W2TA 5F35A 4GMDA 3UHPA 2VF2A 2B82A 2H2GA 4EUNA 2IZ7A 1G21E 2UYGA 1J9ZA 4QUBA 3C7TA 4NQZA 2H0RA 1W0KA 4X44A 4BECA 1L7DA 2ZIXA 3DOJA 1NPDA 2CLSA 3GFPA 1T9ZA 1V4VA 1XRJA 2GM5A 2PLRA 1NBEA 4DRXA 1JXAA 4E4RA 5ILQA 1EZ4A 1MUUA 1PUJA 3WB2A 1NO1A 3GZNA 3CBQA 1FNNA 1G5HA 2HC9A 1V8BA 4C5CA 1YZTA 1R15A 4NPAA 4KXVA 3NVDA 3FFTA 1X7XB 3H04A 4BJ3A 1HE5A 5JC1A 3OZBA 3ESXA 3ESBA 1NMZA 3LNCA 4YAIA 1OGJA 4R9RA 1E8NA 4EEZA 4KOEC 1TU4A 4DMFA 4RTKA 1LZKA 4G97A 1VE9A 3COPA 1TMOA 4H1UA 4IIXA 1C30B 4LBZA 3N7TA 4JJKA 5EGNA 2Z4RA 2ZSIA 3AR4A 3ZHZA 5JS7A 4FB5A 2UYYA 4HX9A 3VKVA 3STWA 1E1YA 1Z33A 5ARBA 3AHJA 1I2MA 5B3JA 3C3KA 1JLLA 4NC9A 4W9MC 4W5QA 2ZLBA 4QWMA 2RGAA 4G8DA 4LMPA 3DLAA 1T3ZA 2QPTA 3OEED 3SYRA 4C0HA 4ZP1A 4AQYM 4S1NA 4OQXA 1BDJA 2K87A 4UOEA 3SF8B 4PVCA 1XPRA 1EK5A 1M6HA 4GPD1 4YMGA 2XNDD 3N2NA 2AFIB 4RHEA 1IJFA 2CE7A 3IQWA 5IAAA 1KRHA 3K1AA 2PQ0A 3I83A 2FY8A 4LZJA 1WF3A 4RZ2A 2GZ2A 2ID9A 2Q1WA 2I3ZA 2AH5A 2JAXA 4M0KA 4POAA 3NHPA 4XLTA 2J5RA 1N1DA 4HZIA 2EW1A 1FSSA 2IDMA 2AD1A 3RYCA 2D00A 3DTVD 1H3NA 1KF0A 1BGWA 1XJ0A 1A2QA 2FZWA 1PR9A 3GHHA 3LQQA 4HTFA 4LV5B 4CF4A 4LGMA 2E5WA 2XTAA 2VYQA 3FYCA 1DELA 4PLHA 2VDVE 1T8RA 1SKUA 5BQ3A 5I7FA 4UNIA 3PFWO 3WADA 2KW0A 1VRVA 1OAAA 1XWFA 3PBKA 1D3AA 3LY7A 4JLSA 3U13A 5MF6A 2O1XA 4BFLA 4G01B 1QO0A 3BIXA 5DISB 4QBHA 1WBDA 5L8VA 2EAUA 3GC6A 5EE1A 2NUAA 4EGJA 1CTQA 3FVWA 2VI5A 3N2YA 5LXTF 1RE1A 1Y5MA 1ZD5A 3L7CA 3ONFA 4DQDA 4PLGA 2PR2A 5K09A 1PNOA 2DWUA 1P9WA 2RAVA 3G8AA 1WZNA 3MS4A 1NF8A 2JFOA 2P9CA 4MDEA 3NDPA 2DC1A 3EF1A 3R7WA 3V42A 5GZ3A 2F8SA 3MTBA 1YASA 2X1MA 1I13A 1EGQA 1T0JB 2YVQA 4AULA 1NVWQ 3FNBA 3NGXA 2YL2A 1JQAA 4DGSA 4LE0A 2ZZNA 1K63A 2L4FA 3GQBA 1G8HA 3QE4A 2RGCA 4LC9A 5G1PA 4CBVA 2BWJA 2JFWA 2ZBEA 3X1ZA 4JL5A 5LMNM 3KYCA 3FOZA 4DKJA 5MN5A 1EFPA 4JJIA 4UDOA 1B1AA 1M8PA 1PT9A 2E4AA 4R8RA 5ALEA 3ZE0B 3VDPA 2GERA 2V7QA 2Y1CA 3A2NA 3CO5A 2PZBA 2NNLD 4B45A 3GIDA 4AECA 3PIRA 3UB4A 4H7FA 1NRIA 1IUNA 1XNJA 4IR7A 3FYUA 3FLBA 4BY9E 1XU4A 4INAA 1L7VC 1W47A 1XIVA 1YVRA 2D1YA 2MHCA 2YMMA 4INOA 4BGIA 4KN6A 1WVMA 3QNMA 4RJIA 1AUAA 3VU1A 3VO1A 1XTKA 1SN7A 2QRKA 4OV6B 1IN7A 1E6LA 2PSFA 4GQAA 4MQBA 2DI0A 1USIA 2H7VA 4UM9B 1CNFA 2OK7A 3NANA 2N0SA 1BZYA 1FUKA 2W6MA 2QLMA 3FGZA 4DMUB 5L6LB 4XB1A 2R8XA 5DW3A 3DOUA 1OBFO 2VPTA 3JSXA 4E08A 2F3QA 2HWKA 5HS4A 1SQ0A 3B6JA 3EQZA 2YFHA 5KPZA 3OFJA 1VYVA 3VR5H 3GGDA 4YALA 4EZIA 4E03A 1WZCA 4RELA 1W9MA 2JFGA 4N6OA 1W88A 1QG0A 3TNDA 1BQ3A 2TMDA 3ELWA 2IP1A 2JFVA 1IBMM 5K05A 4AMGA 3JALB 4EL0A 1KA9H 1YB6A 2JW5A 2XRMA 1W36B 1L1RA 1PK9A 3CUYA 1HQYE 3AUXA 2NSJA 3LWDA 2GXUA 2ZYWX 4M36A 1E3DA 3A14A 1SMKA 2FUEA 2UXDB 3WHKA 3OU6A 3TLZA 1UXGA 4G1CA 2C5EA 4GOOD 1N8TA 3BJRA 3I6ZA 3KZKA 1Y34E 3VH3A 4B7GA 1H0KA 2X6TA 5GPBA 1KEEA 1RTTA 3DBRB 4TTAA 4TZTA 1KJQA 1I5RA 1VDLA 3I30X 2G9QA 3OPQA 1XNQB 2B25A 2N9UA 1ARZA 3WMGA 2F67A 2R45A 4J76A 3FCUB 1EE2A 5I8ZA 4RVHA 3S44A 5BURA 2DZOB 1KDZA 2YV1A 3OZGA 4F4IA 5GVRA 2P2CA 2PYZA 2QYOA 2IFTA 3SK0A 1ADFA 4RM3A 3I1FA 1SH7A 3O92A 2XNKA 1RJWA 4U00A 2F55A 1V5EA 4MWBA 4DLAA 4MUHA 3ND9A 3KZ1E 4HZUA 4LWQA 1HYEA 1PT8A 1OLUA 3L77A 3ZCVA 4ONEA 3E9MA 4N7JA 3R6GA 1MO6A 2G72A 3OO0A 5EJAA 2O8FA 3JARB 1DG9A 1K6EA 5CDUA 9ABPA 3FPFA 3JS5A 3SXPA 2QE7A 1KJWA 1JEAA 3IUEA 1X3SA 1CRPA 1DIRA 3URKA 1W35A 4BTLA 3KSUA 2DH6A 3P4XA 4IMIB 3DV9A 2W00A 4TMWA 6ABPA 1FYWA 2GJ8A 4TWAA 3W3AD 4C05A 4L8RC 1XKQA 4PGAA 2PGIA 2P41A 2ZYGA 3GDGA 4D3ZA 3KWLA 1G2PA 2BWEA 2O7NA 4FYPA 1P7WA 1KK2A 4DYDA 2ZU6A 3DOIA 2JLVA 1T2CA 4LGVA 3L93A 13PKA 3OM9A 1I8TA 3CRVA 1I5OA 1M6VA 4KLZA 1CP2A 1E1QA 1FFEA 1MAAA 1NC1A 1Z29A 1TAGA 2IYPA 4Y0NA 1A76A 4F86A 3TUZC 1XZMA 4TZ6A 1EX9A 4TS9A 5AW7A 1QGOA 4ACAA 2OY0A 2FTKE 4ZYTA 1BSVA 4ALLA 3KOOA 3TL4X 3ESZA 3U7GA 1SBNE 1GQRA 1PG2A 3NTVA 4M1QA 3VR2D 3AF6A 2XYVA 1YQDA 1SOUA 1RAIA 3GLIB 1J24A 4DM3A 4L5BA 4EJ6A 4KNYA 2NADA 1SOMA 3TLYA 1ZP6A 4GU5A 3I2IA 2FMKA 3Q6MA 1QVWA 3THGA 2IUFA 3P7MA 2XYRA 3M0EA 2OCGA 5DHFA 1AXRA 1HE3A 5ELMA 4E46A 1CJVC 1H5NA 3G8BA 5AM1A 1IB0A 1YDEA 3BWYA 4AURA 4C3VA 1K97A 2BM8A 2X0EA 3RRZA 1K89A 5BWLA 3D6VA 3BSFA 3PHBE 1MA3A 2HIHA 2RJ3A 4EHKA 2VSXA 1LK7A 4HAIA 3EF3A 5CCBA 5EMLA 1QDTA 1FCJA 3JD4A 2C5RA 3U7QB 4MDFA 3FTDA 1F51E 1NUAA 4KGZA 5CH8A 1PJTA 4D0SA 4AIIA 3LQKA 3O84A 3S7TA 2CW5A 3I53A 2P2GA 3W2IA 4B8ZA 3K31A 1FX0A 2Q5CA 4FU0A 3IPLA 1AZSC 4NMWA 4Z86A 3PGLA 4HEOA 2VUSA 2LIVA 4Z1OA 2NYRA 4BKPA 2RGYA 4F6RA 5KYUA 3I61A 1WETA 2GRUA 2C03A 4RKEA 3EQ9A 2GBLA 1PBTA 4OFZA 5CX1B 1RWWA 4YAJA 2IUEA 2J3HA 2IHJA 3NIBA 2C77A 3C1TA 5EHXA 2VXBA 2WVHA 1Q0PA 1Q1QA 1O03A 1LDMA 1M0TA 1RCFA 2QRNA 5HRCA 2PKQO 3NETA 4I6GA 3WKDA 4LEIA 1E20A 1VMEA 3WMRA 3EIEA 3CH7A 4MV1A 3P5SA 4LUCA 4W6QA 4IIWA 2AXEA 2F4NA 4KYIB 4JX8A 4L5YA 2XKAA 3FYHA 5HOQA 4LDJA 4NPCA 1BH6A 3O8OA 3CCFA 2MYNA 2VQEB 1AKMA 4ITRC 4DV4B 3DOHA 3SVTA 3NT4A 1VPLA 1NYRA 2BFEA 4QD3A 1P5JA 2UZ1B 3AL3A 3CONA 5AVWA 1NF2A 1I5EA 1D1SA 2PWYA 5IC5A 4MVWA 4O4LF 2AG1A 5DYYA 2VDNB 1ZIDA 2YWRA 3FRJA 1CUWA 4FFVA 4FGWA 1JW9B 4XXHA 2YOFA 4MRPA 1KKLA 4P31A 4DR2M 4PSUA 3SDZA 2K9DA 3WLKX 2Q62A 1V16B 4FFOA 1L5OA 1GN8A 3SMSA 3O21A 3VJLA 4CTNA 4XRGA 4CL2A 1BFDA 4NDZA 3ZGYA 1KHTA 2DFKB 4UOQA 2EFGA 2QUBA 4AJEA 1S2DA 1Y6FA 3VKWA 2WYWA 1NBAA 1J6UA 1Q91A 2NIPA 4BE9A 4YCMA 4RXUA 5EIOA 4FD3A 2VAMA 1UPUA 2O3JA 2IEZA 3ANTA 3MMXA 1IQPA 2WOJA 2XB9A 3WRXC 3BXEA 5L3SA 4OCZA 1J1UA 3GIWA 2AOVA 1QNLA 1WHSB 1Z2PX 5IZCC 3D8HA 4K05A 4EG3A 5GMOA 3HZHA 5DIFA 1F6WA 1SWVA 2VZ9A 3MWKA 4L5IA 2ZSDA 3D59A 3K1YA 4FFSA 4FKBA 3UMCA 5IT4A 1MO3A 3P2OA 1N32B 1YK0A 5JDCA 2IS4A 4P7BA 2DBYA 2KBFA 3W7AA 1HNZB 1RWBA 2XH9A 3U3DA 4QJIA 4R31A 3EVBA 3UICA 1YR2A 4R41A 2Q3EA 3NI2A 4HUJA 4U9UA 3TEJA 4N41A 2XW6A 1P60A 2HWYA 3N0VA 1XMQM 1DO2A 1ACJA 4FDLA 4QDTA 5TSDA 3UK7A 4D3DA 1RQXA 3GCWA 4DUPA 3NC0C 4Q4CA 3KKEA 3E9EA 5EQDA 3HVUA 5BSFA 5B57C 2Z5LA 2QQGA 4NEHB 3EISA 3VO2A 1TM2A 4LKRA 5A9RA 2VXYA 1M74A 5KJ6A 1SCNE 1A8HA 4WKGA 3OX3A 3TG2A 1OLUB 2IYOA 2OG2A 3DG9A 1T4MA 3FVVA 1GPDG 2RIPA 3QENA 4JYPA 2C3MA 3IXMA 3PDWA 1AKRA 4LECA 1XNRB 3JWEA 4DJFC 5BV8A 2QTMA 2WKPA 1WHCA 1G9SA 3UXMA 3WRYA 4OPMA 3VYWA 1Z4PX 4QXPA 5B7QA 2I3BA 1XZ8A 1Z4IA 4J16A 4BKRA 3U9LA 2VNHA 3JTMA 1H9CA 3O82A 1G3MA 4FWBA 5DNEA 2H3EA 4IBFA 2WWWA 3HNRA 5T67A 1SCUB 4MR9A 4DY4A 4J4TA 5EWMB 1TU3A 4JJFA 4EWLA 2ILVA 4CI9A 1KAOA 4M1KA 4US1R 4I3GA 1B76A 3EVNA 1HH4A 4XUGB 3D43A 1EUCB 2WVGA 2CDBA 4HQRA 4QRIA 4S1TA 2GBFA 2ZI7A 2I4IA 4TXMA 5FBRB 1BA2A 2ORIA 3F6RA 4G4QA 4H31A 2PX8A 2IQ5A 3PDJA 2J3KA 3GQVA 4D4JA 1SPXA 1KOLA 2NQ8C 1V71A 2FP4B 1YB5A 1BEEA 2PNFA 4D5GA 4LRTB 3ZWMA 2J9YB 4E88A 2R9VA 2CVOA 1XZNA 2XZDA 1NVEA 3G0OA 1E9AA 4GF5A 4A2CA 1U7TA 1AK2A 3MTQA 3OX2A 4YCAA 4BNDB 5KDDA 1GNQA 1PHRA 2ZYUX 4LWZA 2XT0A 1OCEA 2EF1A 4UTRA 3FPCA 2WQ6A 2NX2A 3E81A 1U2ZA 3OZCA 4A0RA 3L4BA 1TD9A 1NBIA 2CEKA 2CXTA 4Q3AA 3LVWA 1ZD8A 3N07A 3U40A 1K0UA 2DR3A 4RK0A 2NACA 5B1DA 2PSEA 3UWSA 4EG0A 3OZUA 4GPAA 4RHTA 1HT1E 1EINA 3BVPA 4MTLA 4MWSA 4E5VA 1AKEA 3H9QA 4K6GA 5GV8A 3L40A 1SXPA 1DXYA 4PGHA 3LGSA 4UBLA 2JB9A 4IEFB 4MPPA 1SWWA 2GR9A 3E7FA 1RM5A 2PXXA 4RU1A 2KNZA 3PTZA 4QDUA 4R1LA 5AOBA 4NV1A 3GQ3A 1NFFA 1GYQA 2MYUA 2QL5A 2IY9A 3Q87B 5AK5A 1G7TA 4JI5B 4UHDA 4G1UC 2WJ3A 4X91A 2KRUA 3I2FA 4AW4A 4JUIA 1ACLA 4QFCA 1P1FA 2ZSUA 3IP7A 4GVPA 1WB5A 2XVXA 3VAYA 5T5QA 2POCA 4II3A 4BBPA 3CLKA 1T9HA 4DV2M 1DPGA 3GA7A 1QPGA 1Y37A 4P4LA 2YFKA 3UUEA 4JIMA 3IV9A 3OTOB 1DC8A 1MC1A 3IKJA 2VHCA 1SBTA 2OGTA 1GGMA 1CR1A 2P5SA 2P9FA 1P77A 2FSUA 2Q3FA 5DFAA 4UEQA 1ZRSA 2FP4A 3GQBB 4RPLA 5BYBA 1JZQA 3V4PB 3FVTA 3LZDA 1KL7A 4ZVTA 3IUQA 2E6KA 1CC1S 2JGNA 1LV8A 4G4JA 1QLJA 2YY7A 4H0FA 3RWBA 2BKAA 3T3IA 3TTTA 1RYMA 2BKEA 1CX9B 3E4DA 2VSYA 3FRIA 3UBTA 3V4RA 1QPBA 2JFZA 2IHTA 3NYIA 1QCDA 3RRJA 3SOPA 1QLHA 2I76A 3IXLA 3MTAA 3PHHA 4NFHA 3G1WA 2Q6IA 1M2GA 2WTEA 3J81A 1T2DA 2N47A 4GLJA 1V7CA 5J5AA 2IIBA 1S9DA 3UKOA 4C4XA 4F4FA 2L82A 2IUSA 3GDHA 1BCSA 4PC6A 5C32A 2FZLA 4PSKA 5JFGA 3RT1A 2JJMA 3KQPA 1WMDA 2D7GA 1X39A 1JTEA 2HEGA 2IW3A 1H05A 4DR5B 1DUVG 2D8AA 1SKYE 2ERXA 3S68A 4RPJA 4ON9A 4IQ4A 3TTXA 1G8SA 4OQMA 4Q16A 2W42A 1RQ7A 1ETUA 3NHJA 2OAQ1 3DPUA 3PXXA 3L7LA 2ZJFA 1W75A 3DMFA 3QH4A 4GKVA 1XZDA 3HI6A 4P86A 1RCUA 4QIHA 4D8WA 5A5GA 3F4BA 3P96A 4MRNA 4Z4QA 4PLZA 1XRQA 5DSZA 3SFZA 4EW6A 4RVSA 4PONA 1NSFA 1W49A 2XMSA 2YJZA 5E1OA 1LWNA 5E2BA 3OJCA 5EYPB 3REOA 4GRDA 1V11A 4YVFA 1NLMA 4HYQA 2ECPA 4TMTA 4WZ6A 5DU2A 1D7AA 1XDSA 3HHWA 3CNBA 3GFRA 3KWFA 3RS4A 4RDHA 5KX5A 2BM1A 2CLIB 5HZKA 2PQMA 2FMTA 3DDNA 1GYRA 4MWTA 3W5DA 3FD8A 4OLAA 3A2MA 4MZXA 3LPNA 1FP7A 1V9LA 4AZ0B 4DV3B 1XVIA 1C0KA 2ZWPA 3VTAA 2GRAA 2VPYA 1Y81A 3AINA 3DE6X 1DSSG 2ACEA 3MG9A 3U3XA 3ETJA 4ZXFA 1CF4A 3VU0A 1C80A 3IP5A 4YREA 1Y7PA 4EBBA 4X24A 4G07A 1EX6A 1KQGA 2LPMA 3OOSA 1I3OA 3AUKA 4IO0A 3F3MA 2CDNA 2VZLA 3K4HA 3U16A 4DB4A 3QVGA 1U28A 2APLA 3L05A 3A6ZA 1PWYE 1UZUA 3O4VA 2ZSBA 5LYJF 6ADHA 1JALA 1E63A 1RI5A 2YN2A 3HN7A 3HY3A 4AS2A 4BV3A 1U9CA 1U7ZA 4MDHA 1EZ1A 4WJKB 5CX4A 1P4RA 1KQFA 3SMVA 1T9DA 4TRJA 3PI7A 3N0WA 3E7XA 3FF4A 3ZBUA 4E2FA 4PZYA 2C5HA 1JG3A 3EPPA 4QVKA 3ZZ0A 3ENKA 4MKFA 1WB4A 3L29A 4WK4B 3H9EO 4KK4A 2JJYA 3LDFA 4C4PA 5CB0A 5HR5A 3KHUA 4MUEA 1NG9A 1GV1A 2HA5A 2ZIXB 4II2A 1XDUA 4EABA 3QEBZ 3PIDA 3ZDBA 1ZW1A 1QF7A 3JR7A 3LG2A 1Z0UA 4WAUA 4UE6A 3P0JA 4L3OA 7REQA 2G0AA 2UZ0A 4GVLA 2GN0A 2QRLA 3WYAA 3T1YB 1OZGA 1U3GA 3N6XA 4TWJA 2GN1A 1TVKB 3PC7A 3I1IA 4URYR 3NHKA 3K7EA 3TDKA 1AMOA 5I9IA 5BXQC 1B0PA 3KB6A 5ALDA 2H54A 5AXBA 2I3AA 2O1WA 1U8AA 2VSNA 1L3BA 2Q6TA 5AXDA 1ZMVA 4B3FX 1J0AA 1JEJA 1FX0B 3M70A 3BREA 3R4CA 1OTRA 1SZJG 1UWVA 4IWXA 4MW1A 4TTRA 3QLJA 1PLKA 4KFRA 4NRDA 2H48A 4HHEA 3GNQA 4FUTA 3G0BA 5B1IA 5EVJA 2XHEA 3TL2A 4DCCA 2YZNA 1JQJC 1W5EA 3RE8A 4LJ6A 1G5IA 2JAUA 2R6JA 1TYEB 1X1SA 2R6CA 4DFDA 2IRWA 1EVLA 2YNMD 3HKDB 1LDGA 2QV0A 3IHTA 2QRZA 3DYBA 3HU3A 5GONB 4MNTA 3EIQA 1HDIA 1PT6A 4R98A 3DAYA 2EQAA 3EA5A 2FZ4A 3OEHA 4UJ5A 1KP3A 4F11A 4UAVA 3EPJA 1I4OA 1BGVA 1DFGA 1L7OA 3BD7A 2RJOA 4UBMA 2O7SA 2YY6A 4L0DA 3GJ4A 4FHEA 2CNWA 2WMYA 3QMVA 2CV2A 3M6VA 2BUAA 4HPJB 3C14C 4WLOA 2B7BA 3K2EA 3MB5A 4A1OA 4PYNA 2G28A 3DAHA 3IBCA 3RD5A 2WINI 3D7KA 3QIAA 1YHNA 1UZMA 4FFPA 4U3JB 2P2NA 1Z8DA 3GLHB 1SVKA 3OE4A 1PZNA 3Q7SA 3QU2A 4IQGA 2RHOA 2V03A 4KXXA 3LOUA 3WNQA 1NHWA 4W7HA 1MGOA 1VE7A 1FX1A 1PBNA 4QPNA 1UWCA 2HU5A 1AUQA 4WBNF 2DBVO 2PJDA 2NP6A 2CB9A 2Y68A 4IILA 4RZIA 1LC3A 4EB8A 4EBFA 5HCNA 1CPYA 2BJVA 2UUCB 2CBGA 3ZI4A 2DBQA 1VEKA 2O0KA 5CDFA 1RJ9A 3VMFA 3ZN2A 1SBCA 5LMUB 1VJ1A 1LEHA 3Q0IA 4W5TA 2Z3XA 1OAKA 1XHLA 3F6CA 1Q3KA 4BGUA 2BGGA 3DF7A 1QHIA 1TA9A 4RV9A 3WXBA 4F5DA 4CQNA 3STVA 1JEDA 3D7MA 1W4RA 3BOSA 1GSHA 3QG5A 2Q07A 1P1BA 1JQLB 3QM1A 4JUAA 5AIAA 5TY0A 5JCOC 1ZONA 1Z0FA 4UPEA 2WM2A 3PA8A 2QRPA 2GAFA 2JAQA 3FMIA 1KJ9A 2OSVA 1UBUS 1MQSA 4PAMA 3J80A 1MG5A 1EFUA 4XW2A 5IYZA 4D3SA 3WBFA 1E6EA 3GT7A 3ZIUA 4B3RB 1YZFA 1GUZA 3WLQA 4TT3A 4I1SA 5KU1A 1B42A 3AGPA 2XVAA 2HDWA 3B78A 3L7MA 1CR0A 1TC1A 2JNWA 3RVBA 1NVMB 3TIXB 3DTVA 5JQWA 4IJVA 1K75A 4UBKA 1IJEA 1CUVA 1PL8A 3TW0A 5JCXA 1O5IA 4HMPA 1LY1A 2X4GA 2VHUA 3QUAA 1Y8QA 1BE8A 1E6WA 3P9KA 3QVUA 1J5XA 2IXAA 1A5SB 5HP4A 1QONA 3L0OA 1KEEB 3A70A 1E7MA 4ETNA 3TEFA 3PHCA 4X62B 2Z8XA 1DXHA 1A1SA 2HJWA 3IQZA 1H94A 1P39A 3GUCA 3OI7A 4ZVOA 3T1OA 3ZGLA 3BSSA 3NBUA 2Y1EA 5E9AA 3C8UA 1M34B 5BSEA 4JLMA 1I0LA 2FX2A 3H2HA 2BM0A 1E99A 2GEUA 2GZ3A 4P16A 3AB3A 3KFXA 4TWIA 4Y7DA 4B4OA 4BBZA 2EYUA 3DMPA 4DUGA 1BQ4A 2RHBA 4KR3A 1R5OA 3LOPA 4KDCA 2H65A 3FLAA 2BTQA 1NXTA 3X43A 2XIQA 5A3QA 3NASA 2VNAA 4HAUA 2QBYB 2Z8ZA 1YQEA 4D1YA 2BFBB 1QXSA 2Q1UA 3MD9A 4IIFA 4YS6A 5LYYA 2OUKA 1Z5ZA 4FWHA 1UP7A 5E6SB 1QU2A 2PKYX 3LT0A 4HAWA 4UTNA 1JIXA 1OB2A 4HH4A 2DKLA 2FX3A 3CF6E 3Q40A 1G5RA 2VZEA 3TIGA 1CY0A 3QW4B 3SS8A 1EE9A 1ZD4A 2HV8A 3MAJA 1Z35A 5GONF 2LTAA 3PUWA 1JJAA 5BWNA 1B26A 3T5CA 4TMYA 2LVOC 3K8OE 2NO5A 3FD9A 1AUVA 1NI3A 1VXRA 1F8UA 3AHFA 3NALA 4GGPA 3MT7A 2I6XA 2HSDA 2VQDA 2LCQA 4IWNA 3S1AA 4YMUA 4RKFA 4PT5A 1DIGA 2AG5A 4FDAA 4KU4A 3NWLA 2ZYIA 4BUCA 4KGDA 4X1OA 1ABBA 4HNUA 3QYBA 5P8WA 1XRLA 2CNOA 4FR2A 1V6SA 1VC2A 3W05A 3A1SA 4ERNA 1L7PA 3L25A 5FTMA 4IM7A 4HDMB 5L4LA 4TUWA 3DFUA 1TTEA 2GS9A 3D2AA 2IYLD 1CJBA 1OX6A 1RBQA 3C3CA 1V9SA 4K9KA 1N0HA 3N58A 1EXVA 1V7QA 2QRUA 1V1RB 5FI1B 5IKPA 4DLRA 2V7PA 1TEZA 2AMVA 4O2AF 3EUEA 4NWIA 2P90A 3IR7A 1KP2A 5J2UA 3AP2A 5J2UB 1LVHA 1UKBA 2NXJA 1ZK2A 3R7WB 1R6XA 2X3UA 4KO4S 1WXXA 4QDKA 7MHTA 3MUEA 3A1DA 1P18A 2VPPA 5LQSA 1OYOA 2IQIA 3CNLA 4O1HA 4U2KA 3SBXA 3FIJA 3B6KA 1EU1A 4V0RA 1DKOA 1BU5A 4DV4M 3PXCX 5HMLA 4C0SA 3ECAA 4ZI7A 2ZVJA 4M9SA 3GJ6A 4GXNA 5JZVA 3TTUA 4J29A 3FSEA 1F60A 5AVXA 2OM2A 4DV6B 3J7AS 4PG8A 1Z7WA 3G7SA 3PI6A 1D9XA 1BYUA 1JH8A 5DCUA 2GF2A 2GM4A 2FK8A 1KC1A 1EGHA 4AMYA 5JNTA 1XWIA 5KOIA 1TPZA 4G56A 1D0VA 2CVHA 3B7ZA 1SURA 2RHDA 3WGVA 3OTOM 2O3TA 1NC3A 3KUKA 3L7DA 3O93A 2WWYA 5ELXA 4IP0A 5JANA 1E3IA 3GJQA 3T7IA 1YIAA 2FSPA 3DAGA 3WR5A 4UXHA 4YROA 2IOQA 5EE3A 3EEIA 4CU5A 5FV4A 3G0CA 2ZJ8A 3K1AB 1V25A 2EJSA 2I66A 4PYMA 5K3FB 5HF6A 1CK4A 3MXTA 2IPOA 2WTBA 3DXZA 3N8GA 2REQB 1GRRA 2VBIA 5L3VA 3K6RA 1AKNA 2AV6A 4K8RB 1BS9A 3BXOA 4NBUA 3EGXB 3KKPA 1E2MA 3W0LB 2V3VA 2W2KB 3DOFA 5FTLA 4FHZA 4YRDA 2XBLA 3BB4A 4JB8A 2O52A 4QAQA 3DAOA 5K0LA 3DWFA 4RACA 3BDAA 1FJGM 2B1IA 4HL6A 4TS4A 5CVVA 4YQEA 2C4WA 4MLPA 3T1HM 3TSAA 2OZKA 1XMQB 3SIPA 4FCVA 3U6QA 2A7QA 3BH7A 2VF7A 1WBBA 2ZR7A 4DDTA 2V5AA 2P4EA 5ITSA 4TMFA 2C4VA 1YJBA 4PLYA 4C3OB 1E5QA 1PZGA 4ZYWA 1A3CA 4UNNA 3VR6D 1C7RA 4X66B 5KKAA 2ZRMA 1Z4KA 5DNAA 4OH1A 1MA0A 1SUEA 3U31A 2DWNA 4B7AA 2D6FA 1EVIA 3K72B 2B35A 1DZ3A 4MRAA 2WJIA 3HVIA 4MRSA 3CNEA 1NF3A 1PGJA 4F1WA 2UXCB 2FQ1A 4PBSA 3LRPA 2EP5A 3IUMA 4WZAE 1TT5A 4NDNE 5ES3A 1IBKM 1QHNA 4ZT4A 2F3UA 3CKMA 1INLA 4WN3A 3TSCA 5K0JA 3IUYA 2ZBKB 4E0BA 5BUZA 1C8VB 3CRQA 3FOFC 1P1RA 2HYIC 3T9EA 4UAJA 3ROKA 3AF2A 2ZI4A 3PP8A 1AUXA 3ZIDA 4KQIA 2WB4A 3NU1A 1DMRA 1D2EA 3COZA 1G8MA 1JG1A 1N8NA 4K6MA 4BVLA 2LWXA 1NFQA 4LRUA 2GN4A 5C4IA 2XQGA 1QPZA 2DB3A 3LKDA 4PG7A 4P5EA 3WLLA 5KMGA 5PNTA 4NR0A 5DLEA 1D0SA 2EQBA 1X15A 2M98A 2ZI3A 3T5AA 2ZT6A 3KAJA 3OUUA 3CCCA 2YZMA 2VJOA 1AZWA 1J5EM 4FMDB 2R5WA 4JA2A 1L4BA 4PIMA 2FEKA 4G23A 1OLSB 1VP9A 2ZSFA 1E1MA 1DAGA 2FEOA 2RH5A 1P73A 2IF0A 4FKZA 3FNHA 1K88A 1W581 3CW9A 3R7DA 5K51A 4DABA 3M7IA 4F45A 3OCVA 1CUKA 2D5LA 4IICA 4CQLB 1TR8A 1A8IA 5B3JC 4BLPA 3CPJB 1G42A 1T3SA 4G4OA 3OE7A 3BXHA 1RQGA 4R2WA 4UUQA 2AR9A 3UJ6A 3WRYC 3ACBA 4XVCA 1O94D 2B8EA 3ETLA 1IMJA 1G8YA 3EXHC 3FB1A 4QICA 3KETA 3EX7C 1XDZA 2V8BA 1XJWA 3B52X 4L0CA 4JI0M 1Z6ZA 3ASZA 5H0IA 1B4DA 2C2YA 2VT7A 3TDNA 3CV3A 1G20B 2AL7A 3K96A 3IOMA 5FO0A 3SXUB 3D8SA 2OYRA 4PR0A 2AG0A 5D1HA 4BV2A 3ZPXA 5DGCA 1POXA 1I2ZA 1RI1A 1U28C 1JAHA 3D1JA 1AK9A 2WDPA 2A0XA 3TAXA 2JIRA 1U2TA 2JGAA 1I2BA 3GWZA 3EIHA 4IGKA 1N2ZA 2KZSA 4O1MA 2J9FB 4I2NA 1LBEA 2AT1A 2RGGA 3SC6A 4ARZA 5JPIA 3BPSA 4JJ8A 5ALRA 5JOQA 1YA6A 3HC7A 2V7QD 2UUAM 1XPJA 4IZOA 1S96A 1A8UA 4BRSA 1GKUB 1YFLA 1YDGA 2V4ZA 3ICOA 2WIBA 2A9FA 4GVXA 3UH0A 2GNAA 2GYUA 2VDWA 3EEOA 3NDBB 3ICWA 1Z6TA 4IZ6A 1ZM2A 1FA9A 2OV1A 4WNAB 3KYDA 5CLHA 4ZAXA 3AR9A 4LFBM 1NQ5A 3IESA 4IDGA 2HL7A 3LSYA 2O2GA 1M8JA 4LWOA 1IN5A 1WS6A 1MPTA 4O5AA 1L5VA 4OXYA 4Z7OB 4UREA 1JG2A 2D8MA 1RXUA 3GJZA 4WLFA 2AXNA 2JIMA 2ZAGA 3PD1A 4Q0MA 4DTIA 3J81S 3AT1A 3I72A 1O77A 4IV8A 1UH5A 2R7AA 4G1MB 4XIYA 2WQ7A 4YV2A 2M32A 5DBFA 4KT0F 3ICPA 1GPJA 2WD7B 1N77A 3L3BA 4EYOA 2QI9F 3C7DB 3W77A 5E4YA 3D4OA 2OHJA 2WHEA 4QYXA 5KQMA 1LC0A 2OAEA 4ACBA 5EIEA 2B9EA 1Y6GA 2VHZA 3W3ZB 4TYQA 4QGSA 3W2FA 5KSWB 5D5QA 2LE0A 4WRRA 5K2OA 2BSQA 2IXGA 1J0BA 3IEUA 1X13A 1D03A 3R0JA 3JQPA 5B7NA 4LRYA 4I5SA 4F06A 1MO5A 3GPDG 5JLJA 2BMJA 2OILA 2QTVB 2UKDA 4IIYA 4B35A 1ZAYA 1YJ8A 2P7HA 3ZV3A 4M8KA 4PCAA 2ZUEA 1OQYA 2VYVD 2VJAA 4XM1A 4MWOA 2RDMA 5AKYA 3V80A 2R3SA 3FDFA 1C7IA 4JYAB 4RZXA 3MYYA 3OZ7A 4PCUA 5LP6C 3VUFA 5ALVA 1L5FA 3VR6A 1SULA 1QIGA 5CFPA 4LJAA 4WBSA 2ZTVA 1DO0A 4JCCA 2JZ1A 2VOEA 2VTKA 4LNUA 4YRJA 1N57A 1VLJA 3RRFA 3DLPX 2P9TA 4ZT7A 4KE9A 1POWA 2I2CA 2X76A 1R8SA 3NM5A 5FFMA 1CRWG 2Z2KA 4JBNA 1M8GA 5JXIA 3HR8A 1VBFA 2AF4C 4G0VA 5I4IA 1WCIB 2Y3IA 3GQ5A 1EX7A 5JAZA 2QL6A 2QMOA 1QOZA 1L8OA 4ZA2A 5FI5A 3UWKA 1A9OA 4BEVA 3HRIA 1Q0LA 4D9GA 5JR3A 3R0IA 4GE0A 2P9EA 4MAAA 4AICA 4EMSA 1BRTA 1HR0M 3AEUA 3BIFA 1JS1X 2W2PA 3S8MA 1U1FA 3TR5A 1PJLA 2DTDA 5ERGB 4GFDA 1NNUC 2V6ZM 2JVJA 1P2DA 3SLRA 4OVZB 1B16A 4DC9A 1URPA 1QUTA 1Q0RA 1GZ5A 1RLOA 1XU9A 1DFIA 3ZEIA 1EP2B 3C3DA 1IK4A 1MAVA 4O5OA 4WZBB 5BPHA 5IM4F 2PZJA 2BBTA 1BNCA 2BGMA 2EEPA 4GI3A 5L40A 4KXUA 2NVOA 3WL7A 2HJGA 2AD5A 5FKJA 1NLZA 1E2IA 4J3NA 3BHJA 3LECA 3HMKA 4Q9LA 4ZCIA 3GLGB 3AH8A 5G4LA 3QVVA 2AOWA 2EKQA 3NPAA 3OMXA 4A92A 2B6NA 4BNZA 1HDXA 4KMOA 2AXPA 1QR6A 5CG1A 2WG0A 2QLJA 3C7AA 4JZYA 3X1XA 1EWTA 3PQ3A 4KVAA 1G4AE 4ES6A 4ZOLB 2QPAA 3AETB 4BQFA 1U0LA 3NC4A 5KWVA 3LUKA 1Q92A 4G41A 3UMBA 5AOVA 1DHTA 4LCJA 3STUA 2F00A 4Q7JA 2A78A 4N01A