3UZUA

The structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRFGQNFLVDHGVIDAIVAAIRPERGERMVEIGPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIARPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAFSQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Ribosomal RNA small subunit methyltransferase A from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase A
total genus 77
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uzuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3uzuA01
2ZBRA 1EG2A 3G8AA 4FGZA 4FP9A 2DULA 4X61A 2WK1A 3D2LA 4DF3A 5F2NA 5KQRA 2B3TA 2BR5A 4LWPA 4PIMA 5HZMA 1M6YA 3OE5A 3TOSA 5DTMA 3A7DA 3SSOA 1G55A 4Y2HA 4E2WA 5DT2A 3QV2A 3CGGA 3E05A 4QDJA 5JUWA 4U7TB 2WA2A 5DTRA 2OYRA 1NW6A 2C7QA 1FP2A 3DP7A 2QYOA 1JQ3A 4PYKA 4HGYA 2PGXA 3Q7EA 1ORIA 5CVDA 2E5WA 2GAFA 3FPHA 2JHPA 5EKUA 3KQOA 3C6MA 3G5TA 2P7IA 3IHTA 5DSXA 3SSMA 1WXWA 3FPGA 2EFJA 2YVLA 1L9KA 2I9KA 1XJ5A 2ZBPA 5EMKA 4CTJA 1BOOA 5EC8A 4ZTBA 3KR9A 1O9GA 3RIEA 3EPPA 3UJ6A 1B42A 5JR3A 4FZVA 1YB2A 3NW9A 3OU2A 5DPMA 3TLJA 4E32A 3NDIA 4EKIA 1QZZA 4QVGA 2XBMA 5GM1A 5EEGA 5P8WA 5LQKA 3GRZA 1RI5A 3L8DA 5HEKA 1YZ3A 3UJ7A 5LQRA 2Z6UA 2NP7A 2NP6A 2G70A 3BT7A 2YR0A 3DR5A 1P1BA 5FHRA 1D2CA 3HNRA 5DXJA 5CVUA 5LQJA 1JTEA 3LKZA 4MWZA 2P3OA 2ZIGA 3B89A 5EMLA 3H2BA 3EVBA 3CJRA 5F2KA 5U4XA 2Z6AA 1F3LA 2PX5A 3OZRA 1V39A 3FTCA 3KQVA 3LCUA 3LHDA 3MB5A 2PX8A 3KQPA 5GIPE 5DM0A 2LD4A 3TPZA 2GS9A 4X1OA 4RTLA 2P40A 4KVZA 3SX0A 5C0OE 10MHA 5GIOE 2YXDA 5CD1A 3HTXA 1ZGAA 2IFTA 5E2BA 2AOTB 4PYQA 3T0IA 1KPIA 3TRKA 3QOXA 3P9IA 1FBNA 4UOEA 5GWXA 2I7CA 2EG5A 3GCZA 5FHQA 2PBFA 4ER5A 2ESRA 4RYLA 1G6Q1 3UA4A 4PYNA 3UA3A 3G88A 4HH4A 1KIAA 3UJ8A 1FJXA 1HNNA 3DTNA 4ER7A 5DRTA 3HA3A 1ZHFA 5E9JA 3TKYA 2JHCA 4EQZA 1BC5A 2CL5A 4K6MA 2GH1A 3HCAA 3HCDA 3TM5A 5K0JA 1ZKDA 1JTFA 2QM3A 5HFJA 2GPYA 5K01A 1MJFA 3HVJA 3O4FA 2OXTA 3FPFA 5K0BA 5K0NA 4ER0A 2GLUA 2AOXA 2H1RA 2O57A 2OPBA 2BH2A 1R00A 1JG2A 3EGIA 1NV8A 2YUIA 4BLWA 4E70A 3Q87B 1JR4A 3BGVA 3EGVA 3KHKA 1X1DA 2H00A 2UYQA 3FPEA 3HCFA 3KKZA 3QOWA 1O9HA 5CUQA 4YV0A 3KQSA 3M4XA 1SQFA 4DCGA 3UFBA 4RSRA 3E7PA 2AN5A 3CCFA 3EVEA 3FRIA 1R8XA 3EGEA 5FCDA 3K0BA 5FQNA 5DLYA 2NXJA 5CVVA 3GRVA 1KPGA 3B5IA 2QE6A 4PONA 2AVNA 3KPUA 4FSXA 4MQ4A 1X1BA 4M37A 3M6WA 4M38A 2XVAA 3PS9A 3FTFA 1SG9A 2P7HA 1X19A 1JSZA 2ORED 2QRVA 3M33A 3PFGA 4FSDA 5E1DA 3MERA 2BZGA 4XUEA 1RI1A 4YMGA 2IH5A 3TFWA 3BXOA 3PB3A 4V0QA 2PT6A 1XDSA 2PY6A 3EVCA 4FT4A 3G8BA 4MHTA 4PYMA 5CVJA 1VP3A 1KP9A 4IV0A 4GC9A 2ZCJA 5EKXA 2V74B 4EVIA 4X60A 4ER3A 3ORHA 1YZHA 4BLUA 1YUBA 4R05A 4QVKA 2FCAA 4P7GA 2IBSA 3EVZA 5K8VA 1JQEA 2IBTA 4RV9A 2Y1WA 2FRXA 2ONZA 3EVDA 4IWNA 5E9QA 3TMAA 4IKPA 3DXZA 3U81A 2P1DA 2UYOA 3GJYA 3P2IA 4GOMD 3B3JA 1I4WA 2YXEA 2NYUA 3LCVB 4PGGA 4RTRA 4GOLD 2P3LA 3R24A 3LX6A 5MHTA 3MTEA 1UWVA 2F8LA 5K0GA 3A7EA 2O06A 2PXXA 3DMFA 2CMGA 3B7PA 3E23A 3BWBA 2PXAA 2I6GA 2AOTA 3LDFA 4OA8A 3SMQA 3SVZA 4RX1A 2AN4A 2BM8A 1R6AA 1SVUA 1L3CA 1KXZA 3P8ZA 4RTPA 1L3BA 3KR1A 3VYWA 5FUBA 3G89A 3BUSA 2I62A 4YUVA 5EMJA 4AZTA 4AZSA 4AZVA 5C9ZA 1NBIA 1YFJA 3VC1A 2AZTA 4R6WA 3DULA 4L7VA 4C05A 3OZTA 4DM3A 1DL5A 1NE2A 1TPYA 1JG3A 3E8SA 5LSAA 5F2OA 3BZBA 4A6EA 3CJQA 4C07A 2UYCA 1ORHA 2PT9A 2ZIFA 5FTWA 5CIYA 3OFJA 1M6EX 3LKDA 4KRGA 5DM2A 1VLMA 2AOWA 5CCBA 3GXOA 5FWAA 5DSTA 5HIKA 2KW5A 3NDJA 4CWAA 4JXJA 3UZUA 2WA1A 5E1MA 4E2XA 3FYDA 1BKYA 3P97A 1P39A 2HV9A 4GF5A 1DCTA 2AN3A 2CKDA 5E1BA 3I53A 4R8SA 2P41A 2JH8A 4CXMA 1KPHA 1XXLA 3AY0A 5EIFA 1X1AA 3BGIA 3KPJA 4KIFA 3UJBA 2P8JA 4MIKA 2AR0A 5ICCA 2G1PA 3TKAA 4B17A 5IKMA 3KQQA 2GA9A 4KDCA 4YV2A 1Z3CA 3DOUA 1XTPA 4PNEA 4X41A 3TQSA 3ER9A 3JWJA 3MAGA 4YUXA 2IGTA 4XCXA 2ZW9A 5EHGA 1VBFA 4XUDA 5FWDA 2EJTA 3LGAA 1HMYA 5DX0A 1YFLA 2ADMA 3FUTA 2O07A 3EMDA 2AOVA 4M7RA 3R6TA 4AUKA 5FQOA 4ER6A 2V7EA 4C03A 2OY0A 1DUSA 3G2OA 2VZ9A 3KPWA 3MTIA 3P9NA 5DTQA 3LDUA 3ID6C 2YTZA 4CTKA 3UJCA 1WS6A 3G2QA 3RODA 1UFKA 4Y30A 4MTLA 5KYGA 3A26A 4FT2A 4RTOA 1KYWA 3FRHA 1IXKA 2Z6QA 1VL5A 4EKGA 2IP2A 1RI4A 2QY6A 4KIGA 2O0LA 1WG8A 2CMHA 1ZG3A 1RJFA 2P35A 4LWOA 3G2MA 2CWWA 2PVCA 4WVLA 4PCAA 4E33A 4Z2YA 2ZFUA 3R9XB 3PFHA 3LPMA 1KR5A 3T7SA 3DLIA 5FULA 3IV6A 2JJQA 4ATNA 9MHTA 1RJGA 3NWEA 3S68A 4PWYA 5EZQA 1QYRA 2PLWA 2ZZKA 5DXAA 5E1OA 4ISCA 2C7OA 2FYTA 4GEKA 2QRVB 3CC8A 1QANA 1NT2A 3LSTA 2YX1A 4PCLA 3UWPA 2FK7A 3DH0A 3DXYA 5E8RA 3EVAA 1YF3A 2JG3A 3SSNA 3UBTA 3VC2A 4RTMA 2R3SA 3PT9A 3C6KA 3NMUF 3SGLA 2YQZA 1RJDA 4OQEA 4AZWA 2HNKA 2OO3A 3KR0A 3IYLW 3P9KA 4QDKA 1Q0TA 1QAQA 2B2CA 2FHPA 3AJDA 3CKKA 4QQNA 3HVKA 3KPYA 5DM4A 3GRRA 3GNLA 1INLA 1L3IA 3UJAA 2ZVJA 1JG1A 3C3YA 2G71A 3P2KA 5KQSA 3NVKI 1ZQ9A 3F4KA 4RVDA 4PYIA 2B78A 2XYQA 5GP1A 3FTDA 5LQCA 2ZWVA 3KR2A 3EEOA 3EMBA 3FYCA 1D2GA 1G60A 3PTAA 3FZGA 3NTVA 1AV6A 2BR3A 4YUZA 2NXEA 1O54A 2B9EA 4C4AA 3OU7A 2R6ZA 5GM2A 3ER8A 4CKBA 4EK9A 1I9GA 3HA7A 3DMHA 5T67A 1VIDA 5T64A 2GB4A 4P7FA 3GGDA 2DPMA 1H1DA 2N47A 1QAMA 1P1CA 3HA5A 3M70A 3V8VA 2FPOA 4FR0A 4HG2A 4CKCA 2HR1A 3PLAE 2NXNA 5HILA 2XYVA 5DWQA 3ERCA 2YXLA 4GUAA 2ONYA 1NW7A 3CBGA 5EGSA 4A6DA 3GDHA 4HC4A 1XDUA 3PX2A 2OBFA 5FADA 3REOA 4BLVA 2VP3A 3IEIA 3PX3A 3TR6A 2Y1XA 3GWZA 3DXXA 3THSA 4DQ0A 1VQ1A 3JWGA 5HIJA 4F85A 1FP1D 3NWBA 1XCJA 1OR8A 4PGHA 4DA4A 1T43A 4BP1A 1NKVA 3GU3A 1NW8A 4YV1A 1N2XA 4RTQA 5FA5A 1VP9A 5DM1A 3SXJA 4HTFB 3LL7A 3G7UA 1TW2A 3DMGA 1TW3A 4HTFA 5E8JA 3G5LA 5EIWA 5K05A 4RTJA 4WXHA 3FTEA 5EHIA 1D2HA 2PWPA 3BWCA 3TM4A 1N7JA 1RI2A 1XCLA 4OBWA 2IIPA 1Y8CA 2JH9A 3M6UA 5D1NA 5M5BA 2ZBQA 4QPNA 2EX4A 1XDZA 3OU6A 2AOUB 3BWMA 3GRUA 5K09A 2AOUA 1AQJA 4OBXA 2G8NA 4DCMA 4E2YA 5K0EA 1EIZA 4M36A 2OZVA 4R6XA 2C7PA 1G8SA 3LBYA 4X63A 5EG5A 4HGZA 3ELUA 2IDJA 2P3QA 4HRAA 4YUYA 2C7RA 2HMYB 3THRA 5EZSA 3AWIA 3RW9A 3ELWA 3DLCA 5BP7A 2ZZNA 3M6XA 4RWZA 2ZTHA 3HCBA 1WY7A 1XVAA 2PJDA 3C3PA 4E2ZA 1MHTA 3KQWA 3R3HA 5E9WA 5LQUA 4DKJA 4QTUB 1R18A 4C06A 5IH3A 3HCEA 5DRYA 8MHTA 4RTNA 2ZSUA 2JHAA 4U7PB 3ELDA 2XVMA 5C1IA 4CKEA 5GOZA 1BHJA 1JSXA 2PSSA 1M0EA 4KWCA 1QAOA 1Q0SA 1EJ6A 4OA5A 2B25A 4H0NA 3I9FA 5E2AA 3SR4A 3A25A 2UYHA 5ICGA 3HCCA 2OKCA 4P7JA 5EOVA 4C04A 3EEYA 2ZZMA 3OPNA 4PINA 3O31A 5H02A 3V97A 3HEMA 5ICEA 1SKMA 1R8YA 2FK8A 3I64A 5HIIA 1JQDA 1NW3A 4G56A 2UZ4A 7MHTA 5ERGB 4OQDA 3JWHA 1G38A 5KS2A 3SM3A 2PX4A 2AS0A 2NNWB 2VDWA 3UJDA 4BP3A 2PX2A 3O7WA 3NJRA 2H11A 4RVGA 5EPEA 1RI3A 3C0KA 3HVHA 3FUVA 1NBHA 3EVFA 3P2EA 4PIPA 3K6RA 3CJTA 4QTTB 5GINE 1NV9A 4RTKA 1EQAA 3KQTA 5CVEA 5CM2Z 4FS8A 4LECA 2ZIEA 5G02A 3X0DA 3CVOA 4BY9E 4AX8A 1IY9A 1N7IA 3G2PA 4P58A 3JWIA 1RJEA 3MQ2A 4PYLA 1EAMA 3FUUA 4RVHA 3FUXA 4GBED 2IPXA 2ZULA 1EJ0A 3BKXA 3AXSA 3OE4A 5ICFA 5BW5A 1VE3A 1PRYA 4F84A 5FA8A 4PYOA 1SQGA 3WSTA 5KVAA 1L1EA 1X1CA 1KHHA 1WXXA 3HP7A 3I58A 3OFKA 3GIWA 1NW5A 5HOQA 5LQNA 1ZGJA 2HWKA 2IH4A 4PYJA 3MCZA 3VSEA 1AQIA 4DMGA 2PKWA 1SUSA 4R8RA 1SUIA 2PWYA 2VDVE 2OB2A 3KPVA 2ZWAA 3OZSA 5EEHA 1JG4A 2XYRA 4OX9Y 1AF7A 5K0FA 4C08A 1KYZA 4P7KA 3T7RA 5T6BA 2AVDA 2IDKA 4GQBA 4EMSA 3MCTA 4POOA 2BR4A 3OCJA 3GO4A 2NXCA 5EQJB 5BXYA 4RTSA 4YUWA 3KQMA 5B1SA 1PJZA 2ZLBA 3KU1A 5EVJA 4GC5A 2PV0A 2PXCA 3FPJA 3UJ9A 1FPQA 5DX8A 3DUWA 3PVCA 5LQAA 3A4TA 2G72A 2Q41A 4QQKA 2BM9A 5K03A 5CCXA 4YMHA 1G8AA 3P71T 3BWYA 4O29A 3A27A 5K0LA 3LECA 2IH2A 4NECA 4LG1A 5HIMA 3FUWA 4F86A 2HTEA 4RVFA 3BKWA 4IV8A 3LBFA 3ANXA 3M6VA 2VS1A 4GOND 3MGGA 3T7TA 4E31A 1P91A 3B3FA 5D1HA 1IM8A 3R0QA 3HVIA 3GRYA 3AXTA 1R74A 1I1NA 3ELYA 3I5UA 2OB1A 3LCCA 2ERCA 4KW7A 4DZRA 3ME5A 3P9CA 1UIRA 4GOOD 3KQYA 4KDRA 3NVMB 5DX1A 5BW4A 5K0CA 3EVGA 4XUCA 4E30A 1F38A 3HM2A 2A14A 3BGDA 4QPPA 3MHTA 1WZNA 4V0RA 2K4MA 5EMMA 2VDUE 4HSGA 2O05A 5LR6A 2EJUA 1VPTA 1U2ZA 3LDGA 3B3GA
chains in the Genus database with same CATH superfamily
1L4EA 1ISSA 1QZUA 5E4JA 2RGXA 2BGNA 3V1KA 1E59A 1GXSA 4ZANA 4OU4A 5CAEA 5CFZA 5LM3A 3HWSA 4EABA 3QVLA 4YC7A 3HY5A 2F1RA 2H0RA 2BHLA 4D43A 3OE5A 3L4EA 4I55F 4QO8A 5HZMA 3G85A 4Y8VA 5HA5A 4D4LA 5KKCA 4Y2HA 3ADCA 2QDXA 4QDJA 1EE8A 1DSSG 5IYZB 4U7TB 1VKOA 1D0KA 1FP2A 4HEJA 4P84A 3IELA 4HNVA 1NUUA 1X86B 4JL5A 1CS0B 4L0DA 2CW5A 1WB6A 2DLNA 2EXXA 2UXBB 1E58A 4Y3UA 1QVWA 2WHXA 3MIIA 1YKGA 1YDWA 3KXEC 2C5AA 2CZGA 1I13A 2ZRDA 4V0ME 1DIOB 1U02A 4MR9B 4BP9A 1TDZA 4H0CA 1RM0A 3BJEA 1PWYE 3E7FA 4C4YA 5ILOA 3HCWA 2LV8A 3KYDB 4FFWA 3PHCA 4Y0VA 2F64A 4A92A 1Z35A 4M46A 4B83A 4MCAA 2GZ3A 2I4LA 2QD5A 4FZVA 5B6JA 3L9XA 2ASEA 4EGAA 1BGXT 4UPDA 1WLYA 1YOVB 3T1VA 3EGCA 1BKDR 1NDUA 2O3JA 2VK1A 3ABIA 5EESA 1Z4LA 1KMMA 5HEKA 1TB4A 1XA4A 2ANCA 1ISFA 4FMDF 4IQ4A 3ZU4A 3DSRA 1PYDA 1JDSA 3EWIA 1S01A 3B2NA 5CVUA 2CFOA 2OHFA 3PUHA 1IEVA 3B12A 3GEPA 4OQPA 5BQPA 3B89A 3QHPA 5E3HA 1Z6TA 2XGNA 1L4YA 3JQQA 1ZK1A 1XWIA 1F3LA 5TEVA 1VB5A 1H4TA 4M8IA 4JT8A 1XFDA 1TFUA 3T6KA 2GYUA 2JGIA 3W7VA 5JZBA 1GNSA 1A95A 2HT1A 2YVAA 2JW5A 4KQKA 3CINA 2WTXA 2IFTA 1CVLA 4BJHB 5C4GB 1CDZA 4M8LA 3A6FA 3AI3A 2PG3A 2FPUA 4NCKA 2RHMA 4B7UA 2WRZA 4CLOB 5BXQC 1U65A 2PE5A 3GLGA 5FOXA 2WTEA 1A8UA 3LM8A 4EJFA 1C5KA 3WLMA 5E9JA 1CHNA 4DUGA 4AU1A 1HBJA 2A9JA 4F3KA 1AT1A 1XP5A 2P4QA 4DA9A 2QM3A 5F7ZA 5AW5A 2I65A 4C0KA 4XR4A 3AVVA 3PL1A 1DXQA 3W5JA 1R2QA 3DE1X 5K01A 3OPYA 4JI4M 1KEUA 1GYRA 3QEMB 3V34A 1N2CB 3EB9A 5AW4A 4URUR 4GL4A 3ZD6A 3OCUA 2C88A 4CFZA 5K6AC 3FNEA 3PNLA 4K9OA 4KP7A 3EZLA 1JEAA 2J7KA 3GCGA 3QQ5A 3UCEA 3U5ZA 5DNYA 1DCFA 2HNAA 4E6EA 4D46A 3O3NB 2K2WA 3AX6A 3BTOA 4D3SA 1BGVA 2C2XA 2CT8A 1U31A 2OXRA 4HNRA 4Q15A 5LUAA 3GUUA 4RLHA 2C3YA 4NEQA 1SXJA 1A4UA 1WU7A 1BA2A 5AP9A 5LZ9A 3FMOB 2RC6A 5E1DA 4K2AA 4MDYA 3P94A 2X49A 1PWHA 3IAAA 5BSRA 1J4AA 4G8CA 3ZY2A 2ZB2A 4BEJA 2FEOA 1TJYA 5A0VA 1QTIA 2IU3A 3E5NA 5BVHB 2WNIA 2QX4A 1QS0B 2HV8A 2JLWA 3MJRA 4Q1CA 2ZIVB 2YYSA 5IDVA 1IE3A 1Y8RA 5B7PA 1LS6A 1QH8A 1TVEA 5J9FA 2JF0A 3CO0S 2P2GA 3O74A 2AG6A 3GZNB 2AR9A 1ISIA 2CUKA 2RBGA 3ANTA 3ZCXA 4DZTA 2P9GA 1A5AB 3FMGA 3CUSA 1L5HA 3DAOA 4QFCA 5AM5A 5F64A 1YQEA 1NLZA 1Z5GA 3DG9A 4DLSA 4PNHA 1G8JA 1LRLA 5AW0A 5E9QA 3AUTA 1NIPA 3DVSX 2RC5A 5E7IA 1ODCA 2JFQA 4ACBA 1KZGB 4KQCA 3KQNA 1MO3A 3MLEA 1UPTA 2AFHA 1TEZA 5J1TB 3MQFA 3OIFA 3SASA 1QYXA 1J6UA 1RAHA 3DNPA 4TV8B 4MVJG 5LCXA 2VL7A 4D6YA 4B4KA 5IBCA 1RAAA 3ZKWA 1E66A 2EKBA 3DMFA 4NU5A 4X6LA 2ZETA 4FB5A 4Q7LA 4RKWA 2W6NA 4P5EA 2JCXA 2J9ZB 2PJUA 3WQHA 2MMCA 5K3CA 4BN5A 4CISA 1DWPA 3SLRA 3FFWA 3JYNA 1DDGA 3TVTA 3O91A 3I72A 1ISRA 2FVXA 5C7IO 4PTZA 5EE9A 2QIOA 2X9LA 2NU9B 2OCKA 2YXBA 2H5XA 2J85A 3DDOA 1I2BA 1F2TB 4C07A 3Q8MA 3CIFA 2ZIFA 1Z2PX 4TWJA 5HVNA 3I28A 2VJAA 1K6MA 1WABA 4LVUA 4UMFA 5JG7A 4C2UA 4N5HX 1ZK3A 2OMEA 2VKQA 1PT6A 3RSHA 1CUUA 1Q91A 3Q9SA 5D01A 4D3XA 1R4AA 4ZFNA 2GDJA 4NBUA 2B1JA 5CNJA 4BNDB 3PRHA 5FV4A 1UZAA 3GT0A 3K31A 4JBNA 3BMOA 4IBIA 1XR3A 2XODA 4DNQA 3I32A 4KIJA 1ZZEA 3WGUA 1FY2A 4A8HA 1I6LA 2WD7A 4JIGA 4HFNA 4Z53A 4CL8A 3TPFA 3IAS6 2WM9B 3OZEA 1R8QA 3KE8A 1HG1A 1PJ4A 2GSWA 1K3WA 2G1PA 3EBPA 4G86A 5B3JA 3OEEA 2K7FA 2W2QA 4BDTA 5HRCA 3WBJA 1CLEA 1QB7A 4B6QA 3FKQA 4G8BA 3J81A 3VO9A 3AL2A 4Q18A 4H7DA 4KHPM 5JAIA 1SO8A 3QX7A 1LTMA 3IPCA 4M9RA 4MV3A 5ADHA 5KYWB 4IJFA 5K51A 1FVHA 3ICCA 1B23P 5SYMA 2RGGA 5DX0A 3A36A 2HQRA 3LKBA 3HJHA 3E58A 2XNSA 3AR5A 1P2FA 3F46A 2YZ7A 2N75A 5FQOA 4TKVA 1ND5A 4EENA 3CQ9A 4PQGA 2I71A 3E35A 4LHYA 1CEQA 1DC7A 1LDBA 4AKIA 5I9IA 3L5KA 4K9RA 5B3JC 2I76A 3W2EA 1KMHA 2OG1A 1COZA 1ZN2A 1YJBA 4LDAA 4TRMA 4PFQA 4Z3DA 2OM6A 1WS6A 2YJTD 4ZHQB 1E5VA 4H15A 2C1XA 2GOYA 1FNDA 1KFKB 2QENA 2W0MA 1JYEA 4YI3A 5AW9A 1MRSA 4LDJA 3BZWA 3TXAA 4QLBA 4NYIR 3TE6A 2DWZB 2XWPA 4BFZA 1IM5A 1WKVA 2VQEB 2CCKA 2WPNA 4BV8A 1KGDA 4WVLA 2PDAA 2WM2A 3ORYA 1H2FA 2I7XA 4AMZA 2I0FA 5KQ8A 1OWNA 2OP1A 3HB9A 3TXYA 1BO6A 2V0CA 1H9AA 3REFA 1BZYA 2W2XA 2B20A 5J40A 2V0GA 4PWYA 2CHQA 4RPLA 1G2OA 3C7CB 3NI2A 1R4NA 1ZGGA 5JHGB 4LOIA 5AR1A 3DV2A 3JARA 1I1HA 1FFHA 4EO7A 5K0BA 3FWZA 2P2LA 4L0CA 3RIYA 2NU8A 3OG9A 1Z4QA 5AJHA 2BHSA 2H7VA 3FYUA 1TLFA 2MSKA 4DBLC 1BDIA 4KPEC 2NZVG 5K8CA 1FXUA 4CCWA 3EH1A 4TVBA 1PR3A 3RIHA 4F2WA 5L51A 3H9GA 4WN3A 4QDKA 3LO8A 3EXHC 1B1CA 2QHOB 1D4AA 1T0UA 4PWZA 3TIVA 1G1AA 3M82A 4QUAA 3KPYA 1QYIA 3A1WA 4TUYA 2L2DA 2NSDA 1MX1A 3C6QA 3IQIX 4ON9A 3ZLTA 4JT2A 1DO0A 3S2EA 5JC1A 5ALYA 4B3TB 3VTKA 5IDXA 1XTSA 2IWRA 3RSOA 1BMFD 2EHDA 5BPHA 3MK31 1YI0A 1U63A 6ABPA 4PQFA 1J0XO 1E2DA 2W2LD 3ZQKA 1CF4A 2B61A 4WT7A 1HDGO 3E27A 4KGXA 5KQGA 3HJGA 2C4UA 5DF1A 3J7AC 1AV6A 1N6IA 2B9EA 5I9SA 4O4IA 3D7LA 1KS2A 4EK9A 2D5IA 1JWBB 3HA7A 5D7NA 4ISBA 2H3EA 4QYIA 1JG6A 4C4TA 4J3JA 1XYGA 4HZUA 4A10A 3EUFA 4W82A 4GMHA 4NZYA 2E1RA 2J1LA 4M0UA 1P1CA 3WJ7A 4L7QA 4CMJA 1ESDA 1L5RA 3UM9A 3WLJA 4NX2A 5I7RA 2JVIA 4CKCA 2KB0A 2HKJA 4IW3B 5DYYA 4AFNA 4GL2A 3T1HB 2VPIA 2HPHA 4ZOLA 4CKYA 5FXMA 4BBJA 4JB0A 4O4LA 4GG1A 2OBFA 4F0JA 1OX4A 4IUBS 4E12A 3PX3A 2F8TA 4RY8A 5ALZA 1L6RA 1ZK2A 4IAOA 4UAVA 2GEBA 2E21A 4Z6KA 3QPUA 5HQJA 4S35A 4GITA 2NTNA 2V45A 5HE8A 3OPXA 3OKCA 2ZRHA 1OKSA 2YRWA 1PJQA 5K6RA 4WZBB 1I2CA 2JIZD 3WGQA 2EU8A 1Y9JA 2BMEA 4N6OA 2FSIA 2G9UA 5FWNA 4XDHA 4UUPA 1FXWA 1AF4A 2GFQA 2MYNA 1E96A 5A5DA 2VUUA 3DB2A 4R16A 5A2QA 1FFWA 1EFHA 3QEMA 1XA3A 4R8LA 3HKDB 5HYVA 5TNXA 4S1WA 5LWHA 3GRUA 3O8QB 4G0ZA 2W0SA 4PS0A 3RUAA 3VPFA 3J7TA 2BNKA 5B6IA 1CULC 3QK7A 1Y89A 3GIDA 2BV3A 2N46A 5I4KA 4EELA 4OY3A 2PS9A 3BD6A 1ISJA 3ZWNA 2O48X 1U04A 1BFKA 5HIAA 4I55A 2PO7A 1NPTO 2WJ4A 3CZAA 1OWPA 3EDCA 4BUZA 1TAHA 1TU3A 1PT7A 3JARB 1T10A 3R3UA 2BZ1A 2IYVA 3DOEA 4J4TA 4RA9A 2SKCA 4Z86A 1TCUA 4PZPA 1N5KA 1IB6A 1NVUQ 3O2QB 4KQ6A 4XJTA 4ZZ3A 4W4TA 3FSEA 3RS4A 3RS8A 3IDSA 4N39A 3RTDA 3M0EA 3X1YA 5EWJB 2HJHA 5I9LA 2HA7A 3ESZA 1P4SA 1OWLA 4MUXA 1GQSA 3IUBA 3RI3A 4RKUF 2OHOA 3BSFA 4QG3A 5IN4A 3E03A 3H9UA 3L7NA 2I1QA 3DR3A 4L02A 1F4IA 2OFFA 4TKUA 4BMSA 1MC8A 2AFIE 2FJUA 5BSEA 4ZVRA 4H4CA 4RVCA 2V9CA 4DT1B 4EVQA 4DEVA 4UTPA 4R2WA 1RRKA 2E6UX 2Y21A 4OH7A 2O2HA 1U9ZA 2F3RA 3EDOA 4C4RA 2GNOA 2IS6A 4ZYLA 1ZK0A 1U0RA 2PSDA 1PI3A 3T4XA 1CUWA 1TH4A 5KQDA 1CY7A 4WXYB 2FK8A 4RADA 4JI5M 1JQDA 1WE2A 2QRGA 2Z1NA 2I2XB 4MAFA 5KOHA 7MHTA 1COWD 2HMWA 2PX4A 1YBFA 2GN9A 4NE7A 1IOZA 2WU0A 4BP3A 1EWTA 1R6VA 2DUJA 4UNSA 3SNKA 1PGYA 2EATA 1FQWA 3G8DA 2IYUA 1TZ2A 4MARA 3TXXA 1V33A 4OJMX 1A9XB 3ZH2A 5F23A 1DO8A 2FN3A 4I1VA 1M2WA 3G2IA 1JVBA 1MXHA 1QHHB 2UVDA 4FS8A 4I9UA 3CVOA 3F71A 1RDFA 2EKLA 3H5AA 4J4BA 4WCFB 1OGYA 5B64A 4BMDA 3WL3A 3MQ2A 3N2EA 5CH8A 1BXRB 4U0JA 1W9HA 3LHSA 1RQXA 2VC2B 3D3QA 1JQJC 3N8DA 4R2JA 2NTVA 4GX0A 3RTBA 4TS9A 3W0LB 5TR9A 4JK3A 1SQGA 1RW4A 3KOWE 3EYWA 1SU7A 4X24A 2JFWA 2TYSB 5KYXA 4X94A 4AKHA 5C18A 3GLRA 4Z8XA 4FEAA 4HXYA 5BXYA 2IOQA 5L9AA 1E2KA 2C1EA 1YCFA 1G3MA 1AX9A 1U3DA 3NBYC 4MPTA 4QOJA 2JFHA 2DNAA 5K8TA 2C94A 1FJGB 4RMGA 1WV1A 3UV7A 1QQ7A 5A05A 1QO7A 1UJ4A 4EHLA 5L6LB 4E21A 4JEHA 5JXHA 1JG4A 1WVIA 4X6YA 4OX9Y 1PVOA 1MEEA 5AUQA 5J2UB 2JY8A 3IQZA 4RF3A 1NBAA 1FYDA 3KBOA 4FQ5A 2H4YA 2C4TA 4UJ3A 3RTEA 4BX0A 4FX5A 4JBWA 4PD2A 1S8FA 1KKUA 2XD4A 1YHYA 2AC2A 4UFOA 4WAUA 1QORA 4IGAA 4ZKEA 1TYBE 1V6SA 3L77A 3FAKA 3E7XA 4WJZA 2WJHA 1E3LA 3I1YA 3O93A 3OE7D 4X7PA 4XQGA 2J32A 3VV2A 2JCVA 2PXCA 5JAQA 1U1DA 2TSYB 3M83A 3T1YB 3ZDQA 1QGUA 2IP1A 2R2GA 4UU0A 2Q3EA 1AHNA 2F67A 5LQMA 2OTCA 1R3DA 2FFAA 1H6DA 2IHUA 3CNOA 4J2HA 4N65A 1R1DA 3U1VA 1P8AA 4D3FA 3L92A 5IKEA 6YASA 5EI5A 3HA2A 1THMA 2AKYA 3G0CA 1ZXLA 3Q7TA 1DPGA 2HHHM 1ZD1A 1JL3A 4F91B 1SHLA 1W2GA 3UFXA 4C0JA 1ZRNA 4PC3A 1NKTA 2CCJA 3U2QA 3OTOB 1IY0A 2E0IA 3KKEA 3I5UA 3LX4A 4O2LA 3WWDA 4P34A 4QX6A 4LGMA 1GPDG 3RRNA 3ZWWA 3FWNA 4OM7A 2IDZA 4CIVA 2J0QA 3EVGA 3PL5A 3KCQA 1THGA 4H17A 4WINA 4TOIA 4N82A 4QULA 4HGPA 3KLMX 4TRRA 1ZINA 5CFRA 3FRJA 3K2QA 5LR6A 3G1UA 2B5WA 2Q2WA 1UBGA 3BGWA 3MMSA 4KV9A 2G4VA 3ZIAD 1MO6A 4EB6A 4EH1A 1PR6A 5JALA 2JGDB 3RF6A 4PIMA 1DOZA 3QELB 4BKRA 4IQGA 3TOSA 2R86A 1T4CA 2WHYA 1LW6E 4N0EA 1YDFA 3DS8A 1FS6A 4ZI3A 5LD2C 3H4TA 3SHQA 3L8MA 4JJFA 5K2OA 2C4VA 3S1LA 3GJ5A 1R5NA 1Z29A 2KPOA 3D6TB 2QYOA 3LWZA 2UXCM 3WBFA 3VC3A 4OHFA 1GYQA 1BDJA 1F0NA 2L19A 2I4TA 2EAUA 4A16A 2PAFA 3FMPB 3KAJA 4QGSA 1BS1A 2GCPA 3OIUA 5DSXA 4IIBA 1PFVA 2DKLA 3EXG1 2C4MA 2EFJA 5FBQB 3WK4A 3SVLA 4C5AA 2ACWA 4R9VA 2EQAA 2OWEA 2IY8A 4BUJA 3HB4X 4ZTUB 1TJPB 3EPPA 1W5TA 1G17A 2Y1GA 4GLOA 4MUNA 2F2TA 1Y6FA 3ZOKA 5JR3A 4MAAA 2BMDA 3H1BA 4NENA 1ZC3A 4LUCA 4W1RA 2R6FA 3WHLA 4XYGA 2Q07A 5AKZA 5H3CA 4ESOA 1KY5A 2JB9A 5BUZA 3TSCA 3U7FB 2WVGA 1R0BA 2DMRA 3B6ZA 3IXLA 1P1BA 1I1OA 1ZD5A 5LQJA 2PEYA 2RHBA 4HMOA 1F0PA 1A7AA 2ZIGA 3WTCA 1DBWA 3AL0C 1BE8A 2IGBA 4NONA 5KSPA 5HZKA 1P2SA 4W5WA 3IV7A 2X76A 1BDHA 1OZFA 3KIPA 5IU6A 2JGKA 2Z08A 4DR7B 1BHSA 4YMUA 1UFRA 2ZIZA 1W34A 1JEQA 4N1AA 1SC6A 5G2OA 5HUHA 2EZ9A 4H7FA 4PNPA 3QLVC 4DFDA 5HF9A 1PWEA 3KL2A 3HTXA 3CN9A 1UMDA 3BGSA 2A9RA 2HEIA 4WADA 3AJIB 2A4MA 4X90A 1J8DA 2C54A 5AHXA 4C01A 1YQXA 3RAEC 2PKYX 3M6AA 1WXIA 2HMTA 3K9FC 2AT1A 4XVQA 4FDLA 1XZQA 3I4CA 2QJTA 4N6GA 1L1FA 4YJKA 4CGYA 3D6MA 3R9IA 2JHCA 2ZRCA 3ON5A 2IYYA 2P2DA 3LUDA 1CNFA 2FV8A 3WZMA 1PR0A 1IIRA 2MU1A 3OVMA 1Q74A 2QZZA 1L7QA 1HF3A 2Q0XA 3F6BX 5AWFC 2ZUWA 1LD3A 2JIRA 3W3AH 2OXTA 3N3AC 1K8XB 3QQPA 5IK2A 5THXA 3H42B 1FDSA 2CDAA 4BC1A 1EGVB 1WMEA 2P0AA 4R1MA 4C0LA 2GD0A 3HCPA 4E70A 1M1UA 2VXCA 5ALSA 3WNBA 5A9SB 3E3MA 3OLXA 3TSWA 3RF7A 3WLEA 2R85A 3H2IA 3EXIA 4YV0A 3OC6A 1QHHA 3K96A 4HDCA 4QBGB 4L27A 3RFXA 4DWOA 1YXMA 4BBAA 2XZFA 3HB7A 1NJ6A 1RKVA 2G36A 2JRCA 2QB5A 4GW3A 4KYIB 5CVVA 5JS2A 4MZXA 3V4SA 3ZW7A 1GPLA 1CS0A 5L7YA 4N03A 3U3KA 3GRAA 3GLSA 1UQRA 3B38A 3TTWA 4L8RC 2XVAA 4OAQA 3MT0A 4MR8B 4FD2A 2A9KA 2P7HA 3SNHA 3ZXIA 4DMCA 5C4MA 1C1KA 1Z45A 3DW3X 2QTAA 4V3BA 2O59A 1JLRA 2BISA 2IYWA 4P3YA 4ICIA 3VU8A 1YE9A 3VKFA 1ZU5A 1NBWB 2O3UA 1RXVA 4DA6A 5AI0A 3PDWA 2WZCA 3R8CA 2EP7A 4FDMA 2D4HA 1PJ3A 4RAQA 1R0ZA 3LXMA 1L4MA 5CU7A 4DSNA 3CUYA 4ZALA 5JH7B 4DV5B 4BKQA 1ND6A 5FBLB 2E9SA 1ZMBA 2GZSA 3FDIA 2WMOB 3PU6A 4PXAA 4Q3DA 3UUEA 3I9MA 4JQCA 5D5HA 2KZSA 1MX9A 1EUCA 3E9QA 1J9EA 3T52A 1EUCB 1PT5A 1A8QA 2RAVA 3ACBA 3KKNA 3PPXA 4DN6A 2IBTA 2W6ID 3QUTA 3RWBA 1L7EA 4QM7A 1GRNA 1HE1C 1OLXB 1VBKA 2NVOA 3D8SA 5B1IA 5DKFA 2X4IA 1HDZA 3ZZNA 5ER6A 4PR0A 4MGEA 4TV9A 4CQMA 2BGMA 2FW6A 2P3LA 5CDUA 1CP2A 2VDRB 1WCIB 1ZEJA 1YB4A 4HNTA 3U1BA 1MJGM 4H7EA 4WN9B 3ZCBB 1XEWX 3L1JA 3QKSB 1C7IA 1RYEA 1KFVA 3PDCA 4KH0A 4B43A 1TL7C 4B3JA 5JMTA 2WSLA 5C52B 4JDPA 1U0LA 3EOZA 1GPMA 4C43A 1R12A 3TW8A 4QL3A 1V34A 2CCGA 4G1VA 4GNKA 2Z3ZA 4ND1A 3I6BA 3A3NA 2I62A 2PK3A 1JVSA 4TMZA 1DVRA 3W04A 4LE1A 3OZAA 5JWOA 2Q5IA 1P44A 1EE1A 3OZTA 2RCNA 4DM3A 5ELXA 3AEZA 3SHGB 1T4DA 4IVRA 3CJQA 4YP0A 4A6EA 5ALUA 5A62A 1NF9A 2PT9A 3WLLA 1UMKA 4URHA 3C5EA 4YRMA 3TG2A 1BEEA 1T9CA 3RVLA 1UP7A 2X0KA 3HJTA 3O7MA 1UP4A 1I5EA 1RAEA 4BXOB 4RESA 2G77B 3T61A 1G59A 3TAHA 2P9QA 2XR1A 3E8MA 2WICA 3FGPA 3COZA 5TPWB 3PC8C 1XVTA 4OJKA 1K4KA 1F12A 3UHAA 4JXJA 4PO1A 5E1MA 4ZZ2A 3O8RA 3W5DA 1XYVA 1PJAA 1FS5A 1QX3A 1Z9BA 1SCAA 2AXPA 2FEMA 3FB4A 4LNUA 3DL0A 4MPRA 5D3QA 3V1MA 2X8JA 3ZY6A 4QU8A 4N0DA 3ZHVA 1YRHA 5AJWA 1KPHA 2BFDA 3G0IA 3TIXB 5EIFA 4MUBA 3CVXA 5EJEA 5H4HA 3JZIA 2YHIB 1NDHA 3TKAA 1ZM4A 2PKEA 3PQEA 4LJAA 3KFLA 1PUXA 2CC2A 2WWFA 2BM1A 2HA5A 2XV1A 2HL6A 1X38A 5JSUA 1N2IA 4U8GA 1E6WA 3MWLA 1TEHA 3N28A 4OI1A 5JSZA 1VG9B 1ZJWA 3ZJUA 3KOYE 3KHUA 2A9VA 3GQBB 3MBOA 2LXEA 221PA 1CZRA 4KE6A 1ZK4A 1AZSC 4BCBA 4PE5B 4AY3A 1POXA 2P77A 5A2QS 1ZOPA 2VRBA 4KNVA 4Y9UA 4TMXA 1UDWA 4MW1A 3EMDA 3RQSA 1VEGA 4JLKA 5T3YA 2ZUEA 2C9ZA 2DFKB 4EEZA 1PZNA 1REQB 3KQKA 3ZI7A 2VWQA 3V76A 1PUIA 2C00A 4YRKA 2REQB 3P9ZA 2GVNA 2C5FA 3ANMA 3WYEA 3UJCA 4RENA 5TF4A 4U7GA 1V71A 5EMNA 2OCDA 4BNXA 3NHLA 1QIDA 4O4IB 4UKDA 1H2AS 1ORTA 1XDGA 3BEOA 3ZGNA 1BXGA 5IF3A 1RI4A 5SV2A 3MT8A 3UN1A 4CMCA 2FN4A 4ENPA 1IMOA 1IZYA 4WXMA 1C1XA 4OXNA 2BVNA 3O8BA 4P35A 4PSDA 5JBIA 3DHNA 2JFGA 2HHLA 4DR4B 1R6UA 3RIXA 1KR5A 2GHTA 4FHCA 1QC5A 1UWKA 3Q8LA 2I2DA 1DKNA 2H1HA 5F5XA 4KRFA 1NONA 1RJGA 2Q8QA 1UAGA 2GN8A 3F7OA 3F3MA 2D4AA 5KDDA 1EM8A 2BD0A 2P5YA 2ZZKA 1LPBB 3BERA 3BRQA 2Q3DA 3EDRA 2MYTA 3GX1A 3RABA 4ZZ1A 5I01A 3N2GA 1FW6A 3HDVA 1XLWA 1DT3A 1H66A 5EJ4A 4WESA 1JZTA 1ZOIA 3EVAA 1KH2A 4ZO4A 3THYA 4XSGA 2XB8A 4WKOA 3RVQA 2FPMA 2LHCA 3WL4A 4JXKA 1YZFA 2FHPA 5HP4A 4LXXA 2GTIA 3IAHA 3L6EA 3GRRA 2OZKA 2GZHA 5TMBA 2NO6A 4L6V6 3C3YA 4HDSB 4HNAA 4DXDA 1ZQ9A 1KQ3A 3RVJA 4DUYM 3G13A 4CODB 2XYQA 1PTKA 5GP1A 2Q4TA 3A0RB 4WY5A 1CVRA 2H4FA 1OLOA 4XM1A 2JD0A 2GAOA 3WA6A 3FZGA 3NWJA 3RRXA 2H59A 3EPRA 1ADCA 3H9JA 1I2ZA 4F9FA 3SC2A 3Q9UA 5EJAA 1I9GA 1JQBA 2CD9A 1IN4A 4JSRA 4NS1A 3DMHA 4JOCA 3F78A 1M1XB 2JJ2A 4X3CA 5T64A 4LC1A 4P7FA 5GADl 2RK4A 1CJBA 3Q0EA 3GPUA 3KDSE 1GG9A 2L0XA 1X1EA 2P65A 1GO5A 3N07A 4HG2A 5SY4A 3UB4A 5I7EA 2I91A 3RROA 5KU1A 2YXLA 4MRAA 4MA0A 4REQA 2VHCA 3KSZO 4MA5A 1WL8A 2W8BB 3KVNA 2ZJAA 4XEUA 2JAWA 2TMYA 4KN9S 1NXPA 2O4UX 1OU0A 3QLTA 4G37A 4G84A 4UHBA 1KDZA 4BLVA 4C7JA 5LKAA 2CBXA 3AFHA 5AI8A 1KZYC 5CFPA 5G4LA 1E89A 2BEVB 2JAPA 3OM8A 1NC1A 2VDKB 1ELOA 1VP9A 3NCTA 4IDPA 4M1TA 5DM1A 1EFPB 1T2AA 4TXNA 3GJ8A 4HADA 1E4EB 1O4WA 2AXNA 2YYAA 3EULA 3PE4A 3IVRA 1JZSA 4F8YA 3ZDAA 1F8FA 4BKOA 4D92A 2HYIC 4EHNA 1KDTA 3D4OA 3UCFA 5ICGA 1IPFA 4QRDA 3LCJA 4LDRA 2IP4A 3CFYA 3PFNA 1O58A 4I08A 5HBRA 1GCAA 3W4JA 2ENWA 1P2GA 1XDZA 3MRTA 1VYHA 4AZFA 4FN4A 2OC9A 2QTNA 4TMVA 4OFXA 3UUWA 1C2YA 5KTOA 2QX7A 1A3CA 2QAJA 1R4ZA 4GMKA 1H42A 1UKAA 4UU8A 2NX2A 3RLIA 4BO0A 3BBLA 3KEFA 4B5KA 3GUHA 4R3NA 4OHVA 2HMYB 4Y1RB 1J5EM 4OI2A 1AC5A 4OQFA 3QIAA 4QC2A 1Q1EA 5D3MB 4URVR 5B6PA 5JMWA 3AM4A 1WY7A 1CUZA 1E9DA 1LJUA 4YLYA 2PUTA 4C06A 2ENUA 4UHFA 2ZI9A 4F5YA 2QE7D 2Y1OA 4G26A 5CX1A 3V4FA 2LIPA 4MLZA 1C9NA 3OPMA 2KM1A 4J1TA 3DGEC 2X2FA 2C0CA 4LIPD 4Y1EA 2HCBA 4B6FA 1G8MA 3E15A 4DV4B 2XADA 4CR6A 1QRSA 5JSHA 2DUMA 1BDBA 2B25A 1NVTA 1VLJA 4YRLA 1IZZA 3SR4A 1WF3A 5GJCA 5K5EA 1RR6A 1D5CA 1XZHA 5DGHA 4C04A 2YZMA 4YRBA 4M7PA 4ZJPA 1JSLA 2BEWB 1HY3A 2QXYA 3H19A 4G63A 1KI3A 2WJJA 1RVV1 1VBMA 3OOYA 3PXDA 1R8YA 3F97A 4RGBA 3U61B 4Y2SA 5HIIA 1IBKB 3AVOA 1MC5A 3S27A 3ZD9A 4B2LA 3KZ1E 1I01A 4RGVA 4DA8A 1O97D 4IBBA 4RSGA 3R1IA 4FINA 3NAQA 4E15A 5ABPA 2DR3A 1ONBA 3FKJA 3VH4A 4HAIA 5D5PA 1GZ4A 1P9OA 3HVHA 4YT4A 4BRWA 3UQYS 1QCCA 3SYLA 4NG4A 1Q16A 4O4HB 3FPLA 2OSVA 2PMKA 1YAHA 5F76A 5SY6A 1N32M 4ALMA 1Z5AA 4V39A 1JILA 1XEXA 1RD4A 1KZ9A 1Q0RA 2SHKA 5BW5A 4BGIA 4KACA 5AJVB 1DDIA 2QHXA 4CEJA 2NMVA 3OTGA 5A3VA 4R1OA 5EJ2A 4J0IA 1HOXA 2CXTA 4G09A 3PITA 5DEOA 2Q7OE 4C0BA 1NJ2A 3IAS1 3Q7SA 5IJ9A 4B3TM 2QKYA 1B6TA 3BTVA 3GFGA 3QLUC 4UNQA 1N5MA 4TV9F 5REQB 2OCIA 3NTLA 1AQIA 2ZKIA 3OZDA 1SBYA 2BTEA 5CLJA 2O2EA 2OKGA 4UD6A 3ZHXA 3TPCA 2RB4A 4XDZA 1XG5A 1V8ZA 2ZI5A 4D1YA 3WNQA 1NVBA 4RIIA 5K0FA 1Y5MA 5ALIA 3TW4A 1XQXA 4RMJA 1F8YA 3PGVA 2Q21A 3J27B 1T6YA 3K4HA 2HY7A 4UDXX 2VPWA 3D4BA 4BMPB 2WQ6A 2PYDA 3HMQA 4RTSA 2UUOA 5EINA 3LWBA 2GO7A 1OBOA 3FCYA 1B2LA 4UQPA 4L8YA 2VA9A 2XUGA 4YLEA 1WZCA 1WZEA 1ZUHA 4WK2B 3H17A 2WUEA 1N5OX 1FJGM 4HD8A 1F7VA 2RH4A 1RWOA 2G72A 3KLNA 2NPIA 1NN5A 3PP8A 2X23A 2Z9DA 3SN6A 3ZK9A 1QM5A 1CZOA 3QKRB 2IH2A 3QA9A 4LG1A 2OVFA 1KIMA 3U9LA 3OQJA 3MWGA 4C0AC 5A06A 1JKMA 3B1VA 3BCRA 2JFXA 2QYSA 3WC4A 5TY0A 1BQ4A 3NORA 4NVRA 4Q0MA 5TPWA 2ORWA 3HEBA 3QGMA 5IAKA 3SHTA 5KHAA 5BUCA 5IH7A 1JP7A 1H2HA 2DWMA 3IT3A 4CFSA 1GU1A 4JUBA 1W47A 2FQWA 3AI2A 3WK8A 4NZNA 1OH8A 2I33A 1QMGA 2PKCA 5FTMA 2CHUA 3TLYA 2DFPA 4K40A 1P2UA 1FXWF 3WGHA 1QVRA 4DIFA 5K0CA 2EGHA 2ASVA 1ZGBA 4YT5A 1R9NA 3V4OA 2IPMA 3ZVLA 3KOZE 1J0EA 4C30A 2ORYA 6PFKA 2FEAA 1YE5A 4Z7NB 1YZGA 1MKYA 3PKJA 3PQ7A 3V2IA 4ARVA 1FUIA 1LDGA 1SBIA 2JCYA 5AW3A 2G76A 1A77A 1GUBA 2AX4A 2B3TA 4LWPA 3CMCO 2FTKE 3Q6NA 1OLUA 2RK3A 1X9HA 3KUCA 1XZ8A 4B09A 2E85A 4PSUA 2V58A 3GFQA 1Z07A 3CGGA 3WTBA 3QVGA 1W8IA 1IZ9A 3CR8A 1CY1A 3EQ2A 2I7TA 2CMDA 2QXTA 4MM3B 1ISPA 3F6RA 3OOSA 4U9HS 1TF7A 2X7HA 4XQCA 2E5WA 5AI4A 4OVZA 4YJ2F 2O1WA 3F90A 2IUEA 3D7SA 3HDTA 1HOTA 1EFPA 3MJHA 4RXUA 4A2QA 3DDUA 3IHTA 4IBEA 4MZDA 3HGMA 2D5AA 1O8CA 2GR9A 2QDKA 2WIBA 2GJKA 4G5QA 3TUIC 4RIGA 4JR0A 4CM8B 5HKLA 1Z5PA 2POCA 4NABA 5J5CA 3LYUA 3MWEA 5FTJA 4LXGA 3TTYA 2O7SA 4DLBA 4TMTA 1ZCFA 2QTVA 4E32A 2YJ5A 1H2RS 4HQLA 4PHHA 4JBXA 1QK3A 5GM1A 4AWAA 2OCPA 4Q66C 4CGYB 1JX6A 2NN3C 3L8DA 5FPHA 3CZCA 4WZAB 3TZEA 6CHYA 2DR2A 4GE3A 1KEEA 1DV1A 4P4SB 4XE5A 3GLFB 2ZYGA 3HY6A 4NMMA 1F5NA 4LCBA 1VMDA 4U2BA 1D2CA 1UT8A 2BFBB 2PRKA 4WP2A 3GEMA 4MWBA 4TT3A 3A8TA 1X7GA 4D8YA 3VNUA 1ZFNA 3DD1A 4CF7A 3EDMA 2HRRA 4UEKA 2ZSAA 3D2CA 3QLEA 5KUTA 4PPQA 3VVBA 1C7EA 3K1JA 2IXGA 4G97A 4DYHA 2PL3A 1TUGA 4GM0A 1VLHA 4ILEA 2JFVA 4DYDA 3D2AA 4ZQBA 5AT1A 1DIHA 5KYWA 2EQBA 5A4AA 2QRKA 5CH5A 3T7AA 3UQZA 1NOJA 4KVZA 3K0AB 2DEUA 4WERA 1KFBB 1NN3A 1QH1A 3SU8A 4GBGA 4YAGA 1U0NA 4NOJA 3EIXA 4I5FA 4D7AA 3V1LA 1I80A 2HU5A 5CT9A 1CEEA 2FR8C 3H1TA 4PT5A 2Q5JA 3M2TA 2FZVA 4FWTA 1HQDA 3VPCA 4MJLA 3QU7A 5FBVB 2P67A 4XWAA 1KIAA 1UKVY 2R96A 3VSDA 1GOTA 1Q21A 1GARA 1T9AA 4JXXA 4HRVA 1F4VA 1V2HE 4K6MA 1EE9A 3S0JA 1YS6A 1M54A 1Z6PA 3QV1A 4ZV9A 3UO8B 4CM6A 1ATZA 1ECPA 5J1SB 1XMQB 6REQA 1UK6A 2D54A 4D44A 1SUEA 1JHPA 1XJWA 2BKEA 2IYZA 2OFWA 4UBMA 5HCNA 2ONJA 3H0KA 1US8A 4NCXA 4CQLA 5LQSA 4DILA 3OTIA 4PG6A 1KU6A 1DAIA 3L6DA 4GM4A 1UOQA 4AIRA 2XVYA 2ZE6A 1T25A 1E2GA 4JELA 1ZD3A 2IEZA 3FPEA 5CLIA 3UENA 1TO1E 3EPKA 4PXSA 5L4LA 2ZG6A 3M4XA 1VHWA 5FPKA 3LHFA 3NU1A 3K70D 1FX0A 3EX7C 3A05A 5JMPA 3QXGA 2CSXA 4X1IB 4IDOA 1LDYA 2Y0QA 1NUSA 3KW6A 3NHSA 1SPXA 3KUDA 2Z8YA 3WKDA 2R1UA 2VTEA 3PS9A 1G6OA 4BFSA 3I62A 1XVIA 1X19A 1JSZA 3CURA 1W0KD 1M6VB 2JD2A 3CWZA 4BQRA 4XUEA 2HEGA 2V1CA 1AB6A 2PWAA 2IYFA 5KPZA 3KOWA 1U99A 2DWLA 1E6MA 3P27A 1QH9A 4MMZB 1EBFA 1IAVA 2WJZB 1I5RA 4N01A 4BIIA 2BGWA 3ZZUA 2HW8A 1ZLXA 4MHTA 3HO1A 3AETA 1II9A 4C6SA 2PQ2A 2K47A 3WX0A 1K3XA 1LB1B 2FH5B 3L5OA 4KXFB 4OKIA 4NNJA 2QN2A 4RMIA 4V38A 5HUQA 5I7VA 1CC1S 1MO5A 3WV4A 1YS1X 1XQ1A 4QVIA 4X60A 4LWZA 2OD9A 2PLFA 1HFWA 1CJMA 2REXB 4XIJA 5FYQA 3OIYA 4N7JA 4RPKA 3UFXB 1XTRA 1MTOA 5KJFA 2OOBA 1T4GA 5A7FA 5EUBA 5EWMA 2ONZA 3EVDA 2R4JA 3L7YA 5CITA 1I51A 2P1DA 2UYOA 1ENZA 5CA0A 4AMUA 3B3JA 5BR4A 2ERYA 1NLUA 1DARA 1W6UA 2QE7A 2QR2A 5MHTA 1UWVA 4WE3A 3STHA 4DR7M 2P9CA 1VKNA 1S8AA 3LPDA 1ZJ5A 2LVOC 1I0IA 2AHRA 2OO5A 3KKOA 4OA8A 4D99A 2X0DA 1PQUA 2O6HA 4RPCA 5H9VA 3SVZA 3PC2A 1ID1A 1SVUA 5IRCD 3PHHA 3W5BA 1MDFA 2H0AA 2H7CA 1LPNA 2DHRA 2IPLA 4CIXA 3DO5A 2VJNA 2AFIB 4LRQA 2WSBA 1M2VA 4X8MA 5IEJA 2VQ6A 2C03A 3P2MA 3SZOA 2WMNB 3DULA 3MJTA 4BNFA 2QNRA 2RGNA 3TW6A 3KZMA 7REQB 3MC1A 5AYVA 3UAVA 5CVTA 5ITZB 1W96A 1Y6QA 1M1ZA 3H1GA 3QXHA 1AH2A 2JBAB 4TL6A 1FVOA 4BNLA 3FWKA 2PZBA 2IUTA 4KRGA 1TVMA 4QBHA 4MW9A 3RH0A 7AT1A 3D5EA 4HWOA 4S12A 5FWAA 3UATA 1WWKA 3WB1A 4EKDA 4S1VA 2WC1A 3MLBA 5TVKA 3UZUA 2WA1A 4B0PA 5AICA 5KWVA 1Y1RA 1UR5A 3E7WA 1H9BA 5JVDF 2PL5A 5E1BA 1JHDA 1E7MA 1FSSA 2J5RA 3EA5A 4WCFA 3O75A 1XK7A 1U81A 3AY0A 1H6AA 1Z5WA 3ZQJA 2BFEB 3PENA 2WSFF 1IN6A 4WDRA 2LNDA 3H0EA 5LP6B 4TZ6A 5IVHA 3DMNA 4NEHB 1NNUA 3CZMA 3V00A 1A9YA 1I7LA 4PNEA 4K8RB 4OOFA 2A57A 4MB7A 1XWWA 3ER9A 4TSRA 1P7ZA 3HWRA 3AZOA 2PD3A 1II8A 3MSXA 4PRLA 1RP1A 1ZCJA 3L8CA 4WZBE 4Z9YA 2H63A 4HVCA 1J1IA 3ZQUA 2ZJ8A 1WA5A 4TLCA 2ZWMA 3KKLA 4TVKA 3MBIA 2HPAA 1Z33A 1UJ6A 3H16A 1PR4A 2J5KA 2J07A 4WZZA 4B3SM 4JJEA 1A5SB 4MKHA 3VDMA 5JPCA 1UXKA 3TEMA 1RRGA 1U9IA 4QELA 3IC5A 2OXEA 5EZYF 3UY4A 1OYVA 2VZ9A 2JAQA 3OM9A 3ZIUA 2X1MA 1G71A 5NULA 3K1YA 1SHUX 3NC1C 4DR2B 1C7JA 1XDWA 4R3WA 4WEQA 1ENOA 2OL4A 4F8JA 2PN1A 5ENVA 4CV2A 3R8XA 5TE9A 5KYNA 1CERA 2JZCA 2QN3A 4K3VA 2EEPA 3CVJA 4UVEA 5LZ5A 1GADO 1QRAA 1IXKA 3R6WA 4OFBA 5JZMA 4QEZA 2R0IA 1QVZA 4IUDS 1N9GA 4L4RA 2WFZA 1FNNA 2O0LA 4KIGA 4IOJA 4PFJA 2QSZA 2WG2A 4K2HA 2PVCA 4ZVUA 3CTPA 3SWWA 4Z2YA 1S89A 2BT4A 2D2VA 3E0QA 1UC8A 3FCAA 2DTEA 1B6GA 1BJTA 3A4MA 5JJIA 1IXRC 2I2WA 3FUCA 4ND4A 4ZT3A 4WCDA 1JQAA 4X20B 3QFRA 4FBMA 1BEUB 4CKXA 1Z4MA 3FPKA 1OLUB 1TQDA 5AKHA 1SMKA 3G1TA 1B2RA 3EMKA 3I45A 4IILA 4IG9A 3IQDB 2I2AA 4R8KA 4CLHA 1WUHS 1HZJA 4LRXA 2E4UA 3KL4A 3SZGA 1NVVQ 3DYIA 3UK2A 4I9GA 1XCOA 2JG3A 1CTQA 3OQVA 1P3DA 3BD7A 2ZPUA 3OT1B 2RKWA 1XRMA 3RGPA 4OQEA 4UE2A 4A8JB 1HDIA 3U60A 3ESYA 4Y2PA 1H6UA 3VR5D 1M73E 3AJDA 3L8HA 2FLKA 2IHJA 5DM4A 1E9AA 1UDBA 4WQMA 2PZLA 1MB0A 1FX1A 3EEBA 5A6SB 5AVZA 3WB9A 5K99A 1EWVA 1QP4A 3GOQA 3ETEA 2B78A 2X7XA 3DJYA 4WOJA 2VR1A 3FTDA 2JK1A 2ZRPA 5LQCA 2ODAA 2J0SA 4U2DA 2CEKA 2DHYA 1THZA 1LQTA 2JLAA 2WTAA 4BLPA 3AY7A 1BRMA 1EUQA 4K81B 2BR3A 3QFHA 2YHIA 4G0YA 3FPAA 3BK1A 1X7XA 4DMFA 1VPEA 4WHMA 3K9LA 3AG5A 4B2IA 2BGKA 4YK7A 1M7BA 1K86A 2VHWA 4L8FA 3THXA 1KYIA 1R6DA 1OD6A 4B2YA 1RM3A 1I7NA 2DPMA 2GVZC 4RPIA 3FJ1A 4DR3M 3NT2A 3LHIA 2C31A 4XGIA 2QGFA 2NVUB 5DWQA 4CLDA 2OCAA 1F8UA 4JI6B 4GUAA 5JDCA 3ZJTA 4XIYA 3P9PA 3ERCA 3BFJA 4HSEA 3ONVA 1R50A 3NRBA 4J1QA 4ZIRB 2HWYA 2Q2EB 1EFUB 5FADA 1ZNZA 2DYKA 2VP3A 1XZBA 1BVYF 1J8FA 2IY7A 1SKYE 2CMFA 2DQ4A 4NU6A 1FP1D 4F85A 4HVLA 4OV6B 4YA6A 4WRRA 3CF6R 4PHFA 1N2XA 5KAPA 4WZBA 2Z09A 4NRWA 4Y98A 4TM7A 3PTLA 4NPHA 1DCMA 3Q8XA 2YASA 4A73A 3FTEA 2ZJ6A 3IOYA 2FFRA 4IHJA 3TM4A 3FG9A 5E95A 5C5EA 1XEFA 1IQPA 1Q19A 3NIBA 3RSQA 3SLGA 5IWCA 1ZGZA 4UHKA 1CW2B 3IHLA 2WNSA 4I5DA 3FA2A 5M7EA 1BSVA 2HMAA 3AB7A 3PT5A 1PVDA 4L57A 3IEVA 1SU6A 3A6LA 4C4OA 3BB1A 1VFNA 1UOPA 1R0KA 4JLSA 3BM5A 2Y6VA 1JDTA 3CH7A 2AH5A 3OAAD 4NBKA 2R60A 4DSUA 5EG5A 1ZDMA 2M6RA 4LKRA 3BH6A 3UWMA 2HBZA 1H8EA 1T2DA 4Q03A 4C7KA 4V0OA 2VUIB 5B5SA 1ZJYA 1P6UA 2QW1A 3NEJA 3X43A 3M6XA 4G5YA 5EJ8A 4CETA 1R6XA 4IBOA 4Z9AA 5E9WA 3SJAA 1E8MA 1R18A 1XFAA 2PPLA 4GLJA 4LXYA 4M7OA 4MQUA 3JQEA 4YMTA 5LU9A 3RC1A 4D9FA 1LNQA 1P75A 3D4LA 1Y4AE 4HJXA 4D56A 4P0PB 1VG0B 1UBOS 1WTCA 2PSSA 4ETMA 1VYTA 3O4RA 2DOKA 2Q4OA 4JLVA 3EIOA 4LZOA 4LSZA 4OA5A 4Z9BA 3UAXA 4BTLA 1CUDA 4BEBA 5K7SA 2J31A 5FUVA 5CB4B 2PXHA 4G8DA 4M0FA 4HP8A 5EOVA 4PINA 1X94A 3SVTA 3A04A 2QJOA 3DT6A 3HBNA 3WMFA 2G3QA 4CCSA 2AKAB 2UZ4A 2AQKA 3OJCA 1XQVA 2JHGA 4TKZA 1IUPA 1Z18A 2VHJA 2XVZA 4LGYA 4D98A 3SZRA 4CGZA 3LLUA 4KNYA 2VDWA 4BQIA 2EJWA 1D9ZA 4ZXPA 1GNQA 4O0MA 1GZ3A 3AHJA 3WOVA 5KBYA 3B2QA 3CLUC 1RRVA 4W5JA 2B7CA 1A76A 3EVFA 3ZU2A 1MF7A 3B3AA 5KHLB 4NCNA 4JBLA 5BT8A 5J2UF 5GINE 1EQAA 1NFQA 3QRWA 3RHTA 5JAPA 4LECA 4QDTA 2GPBA 2SKDA 4XGQA 1PAUA 3DWIA 3L3BA 1W36D 4NCHA 3AOEA 1ZM3A 2NSJA 4JP3A 5EY5B 1ZN7A 3TFQA 3KSDO 4YHHM 4HDMB 4HGQA 4P81A 1AUVA 2DPYA 1PRYA 1XTVA 2V4MA 3F98A 4KRXA 4YX9A 1Z5OA 1NNEA 2I34A 1K8ZB 2GT1A 3NOVA 4BO1A 1JSRA 1X1CA 4RV5A 2DLCX 3F5FA 5H83A 5AI5A 1ACLA 3CV3A 4IL5A 1D04A 1NW5A 2ZWIA 3EIWA 4QUEA 4KE8A 3WP1B 5IK2D 3ECAA 4L07A 2YH2A 3N2NA 4N9QA 1L1ZA 2PWYA 4U63A 3L4KA 1W19A 2OYSA 5LOVA 4JC4A 3OZSA 3ZD7A 2Q7XA 2F1IA 4C20A 2MDTA 3PFBA 4M9CA 5JS1A 1MIOB 4IQ0A 3P4XA 3L1UA 3SZUA 2HHHB 4GXQA 4JEUA 2REBA 2BCEA 2B8EA 2W6QA 3EUAA 3VMMA 2WYWA 3G2HA 1RYHA 1D2AA 4PIVA 4GC5A 1TO2E 2P9BA 3IO3A 4V2IA 5EVJA 1Y34E 5KX5A 1GV0A 1FPQA 3IP7A 3QXSA 2Q41A 1P5FA 3MW8A 1EESA 1N2ZA 1GUAA 2DTDA 4YMHA 5BV8A 2IIQA 3G02A 4MWOA 2J7PA 1D6MA 4NECA 4O8ZA 1Z83A 1XHBA 2Z2XA 3RAFC 1E3MA 2YHUA 5D6NA 3D8RA 4IKOA 4TKUB 3DVAA 1KMNA 1MOZA 4DIDA 1P73A 1KZ6A 5IJZA 4MYTA 4V3CA 5I7WA 3F8WA 2XE4A 3E48A 1X42A 2QG9A 2IEGA 2IXFA 1M5UA 2BHRA 2FSGA 1HXHA 4WZ6A 1N0VC 4MJ3A 4QNRA 2QAGA 2ZAMA 4AJKA 4WNYA 3D54D 3HUDA 3U6QA 1QQTA 2VTDA 3MWFA 4ADSG 3R40A 1XEAA 4OHMA 4JASB 1IH8A 4P82A 4V0RA 3A58B 2N3ZA 1Y5NA 3ZE8A 4M9UA 4H27A 4EA8A 2XQIA 3EXHA 4HSGA 1C7ZA 1VPTA 1JB1A 5BN5B 2F1KA 1H5QA 3F2IA 3NXSA 3N8GA 1HEUA 1XNQB 5FNVA 2G17A 2MSCB 2QTLA 3G9XA 4KGZA 4DJFC 4REZA 2KBEA 1XC7A 2VHVA 2FP3A 3O8QA 2HOQA 1KE2A 4BNZA 1EIWA 1QUTA 2B1IA 1SUCA 3HXLA 5AVSA 4ERNA 3E05A 4QARA 1GRVA 2GAAA 2P6NA 2F8MA 2DQZA 4GR4A 1DBPA 4MS3A 4JXZA 4A0FA 1A04A 1Y8ZA 5D86A 1PP4A 1JQ3A 3CO5A 2RMKA 5KPTA 1TMOA 5JFTA 1K9SA 4TMFA 1ORIA 1XIVA 3FTPA 4TWBA 4Q9HA 5E6SB 1YBMA 4YJ3B 5EPUA 5EKUA 3IUSA 4NDAA 2O3RA 2VJQA 3T15A 4V0LA 4JP2A 1BCSA 3WJ2A 4JUDX 5EMKA 3Q9LA 4LRWA 1EFVA 2IV7A 3KRTA 4RY0A 2VPTA 3O92A 4YB8A 2C3UA 4JNKA 5CMLA 2X3FA 4NCJA 3OE7A 1Z7WA 4NH0A 3SYKA 3NW9A 1G3UA 1KYVA 4J29A 1U2EA 4PN3A 1DXOA 5G0WA 4JKIA 3CXRA 4QPCA 4DW8A 4F5WA 4AVYA 3E3AA 3C9PA 1UC4B 2IYOA 2V7PA 2VSQA 1T8UA 5LQRA 5G1PA 1M8JA 1RABA 1QU3A 3VNBA 4DREA 1GSHA 3DDSA 1SK8A 1A27A 4Q5IA 3RAGA 5DULA 4DUZM 5TMPA 3ZVNA 1E79A 5ECDA 4LOAA 4QICA 4UUOA 4CN9A 5FOQA 4EGQA 3E70C 3VOTA 3LCUA 4J0FA 1WHTB 4YMIA 2QRZA 4RULA 3AR8A 3GXBA 3KQPA 4JQYA 5GIPE 1CNEA 2I80A 2YIJA 3JYLA 1T8YA 2MOKA 1T4MA 2B35A 3DFIA 4AG3A 5BWCA 1JA1A 1ZH2A 3PQ3A 1Y3FE 2QTHA 1I94M 2VHEA 1SCIA 2FWJA 2JKZA 2JIMA 2O7NA 3LY8A 1KPIA 5E7MA 5AW7A 5K6AA 3RJTA 2H85A 2VH5R 3IULA 3GHYA 1XMOB 4DV6B 1D3AA 1H4VB 3TW8B 2W6JD 1V3QE 1Y6RA 2GXSA 3G88A 4G67A 4JVNA 4NBTA 1PG5A 3ED5A 2EZ4A 3GAFA 1SIUA 4ZVLA 4BLOA 4C87A 5FOSA 1DEHA 1JIJA 2CD7A 1QGAA 3I04A 1OBVA 1H0RA 2I67A 3HCDA 4F6LA 4D4JA 4ZJYA 1SQSA 3KYDA 1RPTA 1YCHA 3H9BA 5FOUA 4RD6A 4DIEA 2UYHA 3O4FA 3SARA 5K0NA 3TW0A 1U6JA 1DG1G 1E9VA 2I3AA 1NOKA 5FBRB 1JG2A 1U80A 5LYJB 1MD9A 4G1UC 5HQ3A 2Q3HA 7ADHA 1PFKA 1FZTA 1P1KA 1WDKA 2AJDA 2VHTA 4MW4A 1IPEA 5EHQA 4F06A 3B60A 2RBEA 4OHZA 3TS1A 3U80A 2DCUA 1HFJA 1YGPA 3KQSA 3KV3O 1ZN8A 1LLFA 4L95C 3LQFA 3DE4X 2VP2A 4MRVA 4PLFA 2GYWA 5K8IA 1KO7A 2B4TO 1UH5A 3KP0E 1DIRA 5L40A 3OWHA 3UH1A 1FP4B 1TO6A 3TMKA 2P0EA 4ND6A 3RS0A 1F0KA 3LAWA 3U6DA 1AHHA 4EJSC 4LFAM 3VJMA 4RVSA 1OGIA 1TNDA 2H6EA 3TFWA 3EZ9A 5KX5B 2E4XA 4HH1A 5JBQA 4RF5A 1AUAA 3I30X 4W9RA 1PLJA 3QYAA 3VVCA 3K1AA 1RCUA 3BN3A 3TSOA 5JD6A 3GD5A 1ZVMA 3BA6A 1PNVA 1Q5PA 2IY9A 4XVRA 4R83A 3G0HA 3GP5A 4O2AB 4D4KA 3HZOA 3K35A 4KJXA 4BUCA 1ORWA 1VKZA 2Q99A 2I54A 1KVRA 3EFOB 3VU0A 4B4OA 1E1YA 5CT6A 1AMUA 1TJ4A 1XZEA 1PDWA 2DPLA 1IN5A 2O2GA 3SHVA 1VSBA 1U1CA 2O4CA 1YUBA 4WJLA 2YQ5A 3VPBA 1X39A 4JI6M 4I4TF 2RHHA 3PSHA 4FMDB 3J80S 1XQWA 4US2R 4IWNA 3ZEAA 3N75A 4FNOA 2Z2ZA 3A3YA 1SPBS 1M2EA 3HKCB 4MUEA 1RYFA 5SYNA 4C5CA 5KDLA 2VIIA 1RC8A 2FEPA 2J67A 5T4FA 2NYUA 4MYHA 3RFUA 1YVDA 2QG4A 4FBGA 4ZQHA 1FFAA 3RRZA 3S29A 4CMIA 1JEQB 1Y3AA 4BVHA 3NC4A 5HUJA 5JCXA 4EDFA 2VUSA 2J0EA 2XDQA 2PD6A 3PRJA 3DDZX 5U1PA 2WAXA 2EIHA 4GMGA 2PXXA 2HH9A 1HE5A 1C1YA 1ZHHA 4QJ4A 1SCBA 4DV2M 5TARA 5AK3A 1JMVA 4DA0A 2QIPA 5JMOA 3F3YA 2AN4A 3QI7A 2KMLA 1U9IC 1XCBA 3DOHA 3WGYA 4R9SA 9GPBA 1H23A 2MGWA 2KA6B 1M2OB 5GGYA 1V47A 3RS5A 3AR3A 1S2OA 3TIIA 3MNFA 1THTA 2FWAA 3LSYA 1JG3A 4UD2A 1DMRA 1NXOA 2KEBA 2W4IA 1T8WA 1WZIA 1GJTA 3JAWB 1XMIA 2HF9A 3ANNA 2ZUFA 4II7A 2WILA 5BW6B 2E4ZA 1CJSA 4HYQA 2XDWA 4F4JA 4D0SA 3I9LA 2YV3A 3LLMA 1ZONA 3ZBUA 3TJRA 3PXXA 1MG5A 5CCBA 4P86A 4FMCF 5EGNA 4TLBA 3RSGA 4KITB 1BMFA 3ZXUB 3KJQA 3M1LA 2ZYSA 3NIFB 1JDUA 4X7BA 1VEJA 1KS9A 3ZW9A 5CB4A 1UODA 3N74A 3HKEA 1XC8A 2P41A 1J7KA 3KKQA 4ID9A 4KQJA 2DFLA 4YQYA 2JVKA 4G9EA 5KOYA 4N0PA 2O5CA 1DZIA 2NT3A 2M98A 3LO5A 4JVOA 3WIVA 2AFHB 1MO4A 1Z3IX 2KWIA 1FRZA 4CW7A 1EUDA 1M72A 3BSWA 5C4IA 1P3JA 2BTOA 3JWJA 4GKKB 5IARA 3E9DA 4K6CA 1XX6A 4ECAA 4IOMA 2ZW9A 4PZAA 1PD1A 1JKXA 2RG7A 2ZJ2A 3PUXA 3DJFA 3FR8A 4C4PA 3PC8A 4EF4A 2AOVA 1M75A 2FWMX 1NI5A 3EZFA 3O0TA 4IIVA 2YHAA 1QTNA 3G79A 4ZO8A 3DLPX 2AB0A 2FSVA 2GAJA 4G0OA 1P5HA 3HRHA 2XMZA 4EI7A 5GJVC 2BGRA 3VRHA 3GV0A 1G1MA 3MPUA 2YCLA 3CRQA 2JFBA 1WNFA 3IMFA 2WSYB 2BL4A 3FDFA 4YCCA 2XTAA 4K5QA 1MA3A 1YVRA 2DAPA 3GDGA 4K7JA 5BR7A 1WB5A 5L3SA 1YZUA 5TMDA 5JPDA 5BSKA 3DMTA 2Y77A 3Q1KA 2PNFA 4ZOBA 5AVKA 5DP2A 4LWOA 1QJCA 1TYDE 5FOVA 3RRMA 3DAFA 1PX2A 1TIPA 2VHUA 4IIUA 2VQDA 3GBPA 1DWQA 3PFHA 1C1XB 4X54A 1XNGA 4LRYA 1PR2A 3BMQA 3KT8A 3QBJA 3RJ5A 1T29A 3ZWBA 3NWEA 4N7RA 3PNOA 3FCCA 3L1KA 3QVWA 5DXAA 3RUHA 1PS9A 5E1OA 4RNAA 1DAPA 1GTG1 1SK9A 4MRMB 2IL1A 2SICE 3LSTA 3GMTA 3FE3A 3ITNA 3CLUD 4QUKA 4OVZB 1RHMA 2Q5FA 3A6KA 1KMHB 4WIAA 4AJIA 4A0HA 3EC1A 4WECA 4L74A 1XMSA 2QVCA 4TMKA 1TIKA 2G28A 4IV5A 1KJ9A 4I3FA 1C3VA 3RFWA 1B3RA 3TZCA 2RH8A 1JFVA 2E6KA 1TKRA 1EQ2A 4S05A 4OUDA 1NVMB 2D0DA 2HLDD 2NUPA 2OGSA 1SOUA 1QUEA 3K0FA 3SF8B 3BMXA 1AK1A 2K6GA 121PA 1TUEA 3S40A 2QVYX 1I10A 1FOEB 1JG1A 1H22A 2V7BA 7CATA 3CE9A 4O4JA 3IG5A 1CQIA 3K6SB 4JI3B 4QUGA 5CLGA 1GZ6A 1MB9A 5TJ9A 1Z5ZA 4Z7OB 3Q8WA 3B1YA 4KR7A 5TGDA 4KK4A 1G8PA 4R9UC 1D1SA 3RU2A 1TJ3A 5J2TB 4CYMA 1NMXA 1LKZA 4BDSA 4GMDA 4IH4A 1N3BA 3LUKA 4B71A 1Y4SA 2REOA 5LBIA 4F2DA 4AO6A 1S9DA 1PW7A 3IUQA 5T67A 1LQ2A 1YQUA 1Z2CA 2PCLA 2WVJA 2O3SA 4M2LA 4O0LA 1OB5A 1TEVA 1C80A 1H1DA 2AHOA 3IQHX 1UKBA 3U7JA 4F1JA 3IJ5A 2PZGA 2A92A 1ZMVA 5ISMA 3LOQA 3D8NA 1X1RA 2IUSA 4U2GA 3KKPA 3OIDA 4BGVA 3Q0TA 3F1LA 2P79A 1T34A 3NWLA 4EYOA 1ORRA 1DLIA 1P3Y1 1V6CA 4N18A 1BXRA 3M6MD 2F9LA 2AMLA 2QTFA 1HYBA 4E07A 1N5JA 2HJWA 3GFTA 1RPZA 4M88A 5JCZA 1XCJA 2P68A 1I7QB 1JAZA 2GD2A 1U8XX 4FGKA 3A2MA 4MVCA 1E3WB 2QK4A 3BH7A 4L16A 2X13A 1NIJA 4Z4QA 1Q7CA 2DTXA 5LDGA 5C34B 3ISJA 3P9SA 4CMAA 3GNSA 4JWKA 2XLCA 3P2JA 2PWPA 3BXEA 1X2EA 3WIBA 5CFMA 1L5VA 1PK9A 3FPSA 4MV5A 3AUAA 3MJCA 5JJCA 1KK0A 2MROB 2IIVA 3USES 2WIGA 3QY0A 3ACDA 4WZAA 1R0RE 3PWZA 1HDCA 3BIJA 4M36A 1L1RA 2PIDA 1H6CA 5DYGA 1C2TA 4N41A 1CDEA 1RJWA 4B79A 1QX4A 1UAAA 3MN1A 4G0PA 2Y76A 2QPLA 1PFQA 1C1HA 4RFSB 4EG7A 1EWYA 2WMDA 3NUGA 1SCUA 5FNVB 1ZV1A 2N35A 1YJCA 2ZTHA 5LPNA 2ZTUA 2VYFA 3SICE 2ZE5A 4I50B 4ZI7B 1UJ2A 1EHIA 3QEAZ 1J06A 1EXDA 3QX3A 2Y92A 1A2KC 3UIEA 5IHPA 3FY4A 3R77A 3HU3A 5BOVA 4D3DA 3OD1A 1GA1A 1VG5A 1U8FO 2ZREA 1PEDA 4K87A 1EFUA 1I4DD 2JJ2D 4IICA 1YZNA 4COOA 1ZD9A 1S4QA 5E2AA 4NE2A 2EWMA 1UM8A 3WI7A 2VYNA 1ONSA 2ATVA 2YC4C 2DRIA 5EXEA 4HB3A 5F52A 2FSFA 2LXNA 4HMPA 2JLQA 5H02A 3V97A 2ZWPA 5GJBA 4QNMA 1XAHA 1OUMA 1XYYA 1DGGA 1QGED 4QXAA 5CDFA 2GLXA 1ZUNB 2H18A 3UAYA 3H18A 4D9MA 4UTRA 5C80A 4JT9A 2B5OA 5GOTA 2VJMB 5IM5A 3JWHA 2O6LA 3SM3A 5JY6A 3A6DA 2AS0A 2NNWB 1Z63A 3P96A 4LNHA 5F1OA 1IHYA 2X77A 2GPTA 1WDLA 3B36A 4C6TB 4DQKA 5A9SA 2QV7A 1NJ8A 2P4UA 2DY1A 1OJ7A 3NBFA 1B6RA 3K8OE 3K20A 4QGAA 1WR8A 3UEOA 3W6ZA 2FN9A 3SQWA 3UXMA 3BFVA 1GTZA 1N7IA 1QIHA 1M2OA 4P58A 3CZ9A 3JWIA 3PA6A 1K8YB 4I5IA 4W7IA 4ZA2A 5G0VA 3SOZA 4A23A 5KQLA 1Z7YA 4DV0B 3NNSA 3AXSA 3DEHA 4ZMRA 1CIVA 1RLMA 1D7OA 2LP4Y 1X80A 3CA8A 2ID8A 4QYTA 4NBSA 3U3JA 2AF3C 2B4AA 1K7FB 4S04A 4AJ9A 2R0QC 2G7MC 2QN8A 1GPNA 1U8AA 4Q12A 1BMTA 2XMDA 1QO0D 2HWKA 1LVUA 4IZHA 4ZVVA 2Z4SA 2JHFA 1GGJA 2ZWOA 4OHCA 3KZKA 1J49A 4MKIA 4EPXA 2PH3A 4YJGB 3NR2A 5AVOA 4DLRA 4EHAA 3HUFA 3EF0A 4OJQA 1ACJA 3A1TA 3F8TA 4OSPA 3SATA 1CY8A 3NGXA 4UM9D 4DLKA 3HXTA 3WLRA 4F4IA 2B8WA 1QPZA 4P3KA 3ZTYA 2FF5A 2BOVA 3WMGA 3V6MA 3E9MA 2IXEA 4MS3B 3IURA 3A37A 4ARAA 1LTKA 1JXOA 1L5MA 1XZAA 2IBMA 3OJ0A 3C4VA 3QLUA 3ZXSA 4ERXA 4D9JA 1V0JA 4Q3KA 3A4TA 4I6EA 4ZRNA 3VKUA 4EMBA 1P5ZB 1TQ2A 4Q3CA 5KU7A 3U5TA 2GILA 5FWXA 5CX1B 3C70A 4JLAA 2JI7A 3AGQA 1Q6ZA 1PR9A 3MUFA 4C9BA 2W8BA 1I2DA 2BZ0A 4IJMA 4GO1A 3FFBA 4ZN6A 4FLFA 2V5AA 1CE8B 2YNMA 3FIJA 3LFTA 1IY2A 1O94D 1HC7A 1C4WA 5EAIA 4CM4A 4E5MA 5F35A 3KHSA 2Z4RA 1VCOA 1Z4KA 3ABSB 4ENSA 3H6HA 1Z13A 3R7NA 3V1TC 1L5WA 5D3ZA 5L8VA 1DKMA 1BWQA 2H2HA 1NP3A 2QZPA 3MGBA 4BLTA 3OPVA 4EITA 1NY5A 2PWBA 5BW4A 3PGXA 1WEKA 1OXXK 1B0UA 1GZDA 2ZE7A 4H7HA 3V8RA 1ZOLA 2O05A 1G19A 3YASA 1QDEA 3J81S 1I3MA 4FGZA 4FP9A 3X1XA 2F8SA 1A98A 2D74A 4KK3A 3U56A 4D5EA 2EGUA 4BBZA 3LW7A 4MVJA 3G8YA 1L7RA 3B7ZA 4AJ1A 3FWPA 4P5DA 4IWXA 2P2NA 2WMYA 4JENA 5T4EA 3A7DA 2PX0A 1L2CA 4V1CB 1SD2A 1FLAA 1WULS 4I6JA 3HB0A 3GPLA 1CQJB 4D0GA 1YZQA 2AN9A 2DHQA 5KVQA 3DP7A 5COAA 4ZQGA 3S99A 1QE0A 4HGYA 2VJLA 5CVDA 3CLTC 2AE2A 1I0LA 2GAFA 2R1VA 4PC7A 1CDOA 2C7BA 2RGDA 1YIDA 2YVLA 3IX7A 3PR2B 3TLEA 3COVA 2GYVA 4WX2B 3RM3A 1L5SA 4R51A 5M29A 1JKJB 1WUJS 3R3YA 2CHFA 1NBOA 3E6AA 3CNNA 3HSSA 3RVKA 1ZAKA 3LTNC 1TZCA 2KRKA 2BCGY 2IPAB 2WINI 3AHDA 2CLIB 3GR6A 4ZV7A 2EOAA 1E18A 3BBZA 1QZZA 3O8NA 3H8VA 4RS4A 1V1MB 2H16A 4BBPA 1W5EA 2HA4A 2OV6A 1CQIB 4LTMA 1HNWB 4IBDA 4MTCA 2NP7A 2RB5A 4AQYM 2UYYA 1SXQA 1SA0B 2G70A 4D4HA 2C2GA 3DE3X 2VNSA 2HIHA 2C57A 3A6ZA 2DH6A 4MWZA 5I51A 4WJKB 3JZFA 1PL6A 2AG5A 1LVHA 1JFFB 1GNRA 3L1IA 1MPXA 3WWCA 3FTCA 1OFIA 1N0HA 2GARA 2QLNA 5CTJA 5DP1A 3S8MA 2QL7A 1JV2B 3UB3A 3TFOA 1HYHA 1NMSA 2CKMA 2LD4A 2QT9A 3A9CA 2DWPA 1T8TA 2IYLD 1J0CA 2V55B 1IJKA 3W5VA 4Q4JA 4MDFA 1G4UR 2A5FA 4URYR 2O25A 4DNPA 3M1AA 2V1XA 4V03A 3U6PA 4OVKA 3OCZA 2BW0A 1SGWA 3BIOA 1MB3A 3LT5A 4TKMA 3MUEA 3N39C 1M9NA 3IHWA 2V7QA 3NYRA 4NJMA 4UOEA 3N8IA 2PS3A 1TZJA 4MP6A 4DS3A 2Q1YA 3WYNA 2MT9A 2O3TA 1T9GS 5LFAA 4X44A 4QXQA 3ZQ6A 4LJ8A 4JIMA 3ETJA 3BL5A 3QE2A 4OLHA 3R7SA 2JGFA 3MWYW 4RK4A 3WQBA 4BVAA 2HX1A 1ULHA 1ZKDA 3RC2A 3LFHA 4YHBA 3EBOA 4CPDA 1ECFA 3AU9A 3BVPA 2P2SA 3D6VA 3EXHB 4LQDA 4EGFA 1JWLA 3AU8A 2Q5EA 4PFSA 4ER0A 3WGGA 1AUPA 2Q6TA 2R47A 4FILA 3RBZA 1H0KA 3PKIA 1NV8A 1YS2X 2JFZA 4EECA 4GI3A 1P9RA 3MAJA 1W94A 1XNQM 4QGHA 4DUGD 5LA6B 4BFUA 1OYYA 4BWFB 2X19A 2NZUG 1RJ9B 5ES3A 5EXDA 1W1WA 1CRZA 3W8DA 4KI0A 1CRQA 4EA6A 1U11A 3ND6A 2HI0A 3DO6A 4WOKA 3N0VA 4YRNA 1A0OA 2C82A 3M6WA 4HLDA 2QMYA 1SG9A 1T3SA 1Z0UA 1GNTA 1OX5A 3FFTA 4GQIA 4O63O 1QTRA 3IP1A 3U62A 3PD7A 1CHDA 1DKRA 1SUWA 3T9CA 4WBNA 2ILTA 4EHFA 1OPRA 2ZIAA 4MINA 3SJ7A 1G9TA 5KNLA 2CF5A 4NK4A 1LWOA 1O7JA 3G8BA 3GJ0A 4NJEB 2ZUTA 5CVJA 3EQ8A 4WOCA 1J0BA 1U0EA 2OZLA 4TX1A 3VKGA 1L5HB 2CLOB 3PLRA