3UZUA

The structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRFGQNFLVDHGVIDAIVAAIRPERGERMVEIGPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIARPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAFSQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase A
publication title The structure of the Ribosomal RNA small subunit methyltransferase A from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
total genus 77
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uzuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3uzuA01
1L9KA 3V97A 2GAFA 3FPEA 3M6VA 5HFJA 3DXXA 2QRVA 2F8LA 3PVCA 3A7EA 5DT2A 3NMUF 3LKZA 3LDFA 2FK7A 3IV6A 2IFTA 5E9JA 3G88A 4MHTA 5EHIA 3ANXA 3TLJA 2IP2A 3HCAA 3CBGA 3K6RA 5DTQA 5E2AA 4MIKA 5DX8A 5JR3A 3BXOA 3DMGA 5EMLA 2HTEA 5FWDA 3TM4A 5EKUA 3A25A 2PT6A 2BH2A 5K09A 3I64A 4K6MA 5DSTA 5ICGA 2OKCA 1X1AA 1X1DA 3HM2A 3SXJA 5D1NA 1AQJA 1AQIA 4BLWA 1JG3A 3DULA 3UFBA 1QZZA 1AV6A 5EC8A 4FZVA 1YFLA 1BC5A 2YX1A 2YR0A 5HEKA 2ZZNA 2NXCA 1EG2A 3KQYA 3R0QA 4GOOD 4FSDA 2AR0A 1FBNA 3M6UA 1O9GA 1SKMA 4CKBA 1JQEA 2NXNA 5ICCA 2WA1A 5HILA 3JWGA 5EIWA 1DL5A 3LECA 3CVOA 2ONZA 1P1BA 3KQVA 5FHQA 5GM2A 3GRYA 1YZHA 3GO4A 3HCBA 2G70A 2HMYB 3NWBA 4WVLA 1KR5A 4P58A 1G6Q1 1V39A 2R6ZA 3BUSA 3K0BA 4PCAA 1EAMA 4ISCA 2P35A 4R6XA 2AOTA 3OFKA 5LQKA 2OYRA 5KVAA 3AY0A 4RVGA 4PYKA 3UA4A 4RV9A 3TPZA 4HGYA 2JJQA 4C06A 2G72A 2ZZKA 1TPYA 3HP7A 3OFJA 3EPPA 1BHJA 1P1CA 4XUCA 2IBSA 5LQUA 2YXLA 4QVKA 3HEMA 1NW6A 2BM8A 3MHTA 2OB1A 3NWEA 3EGEA 3UJ6A 4PONA 3FUUA 3G7UA 5H02A 1T43A 1TW2A 2PT9A 4E31A 3UJ9A 4CWAA 4KDRA 4RTQA 4PGHA 3DLCA 5FA8A 2JG3A 2YXEA 3PB3A 4DQ0A 2Z6AA 2GH1A 1WXXA 2VS1A 3KHKA 5GIPE 4H0NA 5CIYA 3HVHA 4EQZA 1RJFA 1P39A 2ZBPA 2I6GA 3KQWA 1ORIA 4P7JA 5EMKA 3S68A 2CKDA 2HNKA 3A27A 1YFJA 2XVMA 2EFJA 1N2XA 3BWCA 2YXDA 4HG2A 4IKPA 3TKAA 2P7HA 4DA4A 3TQSA 5IKMA 2BR3A 3B89A 4GQBA 3EVEA 1VIDA 5DX0A 1DUSA 4M7RA 5DM4A 4RYLA 3BWBA 4M36A 4G56A 4XUDA 2ADMA 4E33A 1O9HA 1RI2A 3OZRA 5HIMA 3HVIA 5M5BA 4LECA 3IYLW 4OQDA 3CJRA 8MHTA 3HA7A 1IY9A 1R18A 4HTFB 3FYDA 2FHPA 2PV0A 4LWOA 3VC2A 2UYHA 4GOND 4A6DA 4YUYA 3KU1A 4POOA 2NP6A 1M0EA 1VP9A 3HVKA 4EMSA 4GEKA 2XYVA 1VP3A 2N47A 4DZRA 3AXSA 2DPMA 5LQCA 3ELUA 4Z2YA 1I9GA 2NYUA 2AOXA 3FUTA 3WSTA 4F85A 5LSAA 3GRVA 2C7PA 1NW7A 2CL5A 2P3QA 2PX5A 5DTRA 3P9IA 2G1PA 3A7DA 2QE6A 3BZBA 5DWQA 4CTKA 2YUIA 2IH5A 3V8VA 4OBWA 3OCJA 3GWZA 7MHTA 5K0JA 3TRKA 3EEYA 3AWIA 2QY6A 3SGLA 1NW8A 3VYWA 5CD1A 1L3IA 1WZNA 1YB2A 3R6TA 4RTLA 4BP1A 2PXCA 4ER3A 2PVCA 3CCFA 1KPGA 4PYMA 3PT9A 1R00A 3LX6A 3M6XA 4P7FA 3BT7A 3G8BA 1FPQA 1FP1D 2ZVJA 3NDJA 1IXKA 2PX8A 4FGZA 4M37A 5G02A 3RIEA 3SM3A 3HA3A 5F2KA 3E23A 3REOA 2OZVA 2GPYA 3KPVA 3LDGA 2BR5A 1F3LA 1VL5A 5EIFA 1WY7A 1KIAA 3L8DA 5FULA 3T7SA 3FTCA 4R6WA 3ID6C 3DR5A 1XDZA 3C3YA 2ZW9A 3HNRA 3NTVA 4FSXA 1BOOA 2P3LA 1L3CA 5FHRA 4RTKA 1RI4A 4RTJA 5DRTA 1JR4A 2O0LA 3GJYA 3M4XA 3SSNA 2P3OA 3BKXA 5FQNA 1JG4A 2PKWA 3DMHA 2EJUA 5FADA 5CVEA 1KPHA 2BR4A 5K8VA 4X41A 5K0NA 1WS6A 5K0FA 1SUSA 1KXZA 1KYZA 5GOZA 3NVKI 3G5TA 4PINA 2ZWAA 4RTPA 1UIRA 4R05A 4E2ZA 4E32A 5CCBA 2VDWA 1NV9A 3C6KA 5T67A 3TM5A 2C7QA 4ER6A 1KHHA 5CVDA 2P41A 1JG2A 1G8AA 2PXXA 2O07A 3MERA 4C08A 4FT4A 4LG1A 3SVZA 2IIPA 3EVAA 3UJAA 5BP7A 4X60A 4YUZA 1KYWA 3NDIA 4GOLD 5EOVA 3P8ZA 1NW5A 2NXJA 4PYQA 3FRIA 3P9KA 2JH9A 1SUIA 5E2BA 4Y30A 5C0OE 2HR1A 4PGGA 4GOMD 5KQRA 3MCZA 1NW3A 1X19A 2H11A 3KR0A 3BWYA 3MTEA 3QOWA 1R6AA 3P2EA 3THSA 5LR6A 2EJTA 5DM1A 1YZ3A 2LD4A 2VDUE 3G5LA 1WXWA 3LL7A 2EG5A 5KYGA 2B25A 1D2CA 3P9NA 1NV8A 3D2LA 1MJFA 4DF3A 4YUWA 5C1IA 2O57A 2B2CA 3GRZA 3OE4A 4NECA 5DSXA 1NBHA 1XCLA 4IV0A 4CKEA 3R24A 3THRA 3UJBA 4IWNA 1ZHFA 4MWZA 3CJQA 5CVUA 5EHGA 5K0LA 4GF5A 1QAOA 2IDKA 2O05A 2ORED 2YVLA 1XVAA 5HZMA 2JHAA 3Q7EA 4DMGA 2AN3A 3DTNA 4RVFA 4ER5A 5JUWA 2IPXA 4PYJA 2AOUB 1X1CA 5DX1A 2VZ9A 2AN5A 3ELDA 3FPHA 1D2GA 5T6BA 4PYLA 5CVJA 4C4AA 3NVMB 1L3BA 2AZTA 2UYOA 1VLMA 4YV0A 1SVUA 2O06A 1TW3A 5E1DA 1EJ6A 3BGDA 4PNEA 1R8XA 1JQ3A 2G71A 5K0CA 3EMDA 2AS0A 4AX8A 3NW9A 5K0GA 3EVBA 3CGGA 4PYNA 1R8YA 2PBFA 3UWPA 2IBTA 2B78A 3EVDA 4QPNA 5B1SA 1RI3A 3LCCA 3BKWA 1FP2A 4ZTBA 2OXTA 5BXYA 3F4KA 1F38A 3LGAA 4RTMA 2ZFUA 2QRVB 3GDHA 5IH3A 1G60A 2ESRA 3PFHA 1N7IA 3C0KA 4MQ4A 4AUKA 5K0EA 1JTEA 1Y8CA 3SMQA 1INLA 5P8WA 2G8NA 3U81A 5K03A 3GCZA 3G2QA 5GIOE 1PRYA 2HV9A 3AXTA 1QAMA 3FTEA 3EGIA 1JTFA 2C7OA 2K4MA 2NP7A 3OU7A 1NBIA 5F2OA 3PX3A 4QTUB 3FUWA 5BW4A 4R8RA 2BM9A 3MTIA 2FPOA 3PS9A 1D2HA 3MQ2A 5EEHA 4AZTA 4E2XA 5KQSA 1SQGA 4KVZA 4OX9Y 2AVDA 3SR4A 2PX4A 5FTWA 3P71T 2ZTHA 4V0RA 4QTTB 3I58A 1MHTA 2XYQA 1FJXA 4P7GA 3I5UA 5EZQA 5EQJB 1KPIA 1EIZA 3TR6A 3X0DA 4EVIA 2ZBQA 4BP3A 2E5WA 1YF3A 5KS2A 4A6EA 1XCJA 2P7IA 4E70A 5K05A 4RVHA 4AZWA 5E1BA 4RVDA 4U7TB 3FZGA 1IM8A 5DLYA 5DPMA 3KR2A 4CKCA 3FTDA 5DXJA 1G38A 3B3JA 5EGSA 4FP9A 5FA5A 1HMYA 3DXYA 4OA5A 3JWHA 4X61A 4GUAA 4U7PB 3TMAA 2VP3A 4CXMA 3PFGA 2AN4A 5CUQA 4E2WA 5ICEA 4E30A 2AOTB 3MB5A 3M6WA 3O7WA 4QPPA 5FUBA 5E1OA 2BZGA 3FUVA 2R3SA 2ZBRA 1EQAA 4FT2A 4JXJA 1XXLA 3LSTA 3B3FA 3KPYA 2I62A 4Y2HA 4YV2A 2PGXA 2ZCJA 2B3TA 5F2NA 2V74B 3G89A 2AOUA 3IEIA 3GXOA 3KR1A 4OBXA 1QANA 4LWPA 4RTNA 2YQZA 3ER8A 2IGTA 2ZULA 2ZIGA 5CM2Z 2PX2A 4QQNA 4AZSA 3ELWA 4HGZA 3KKZA 1XTPA 2VDVE 1L1EA 1RJDA 3LKDA 4KRGA 3ERCA 3FYCA 4YUVA 3KR9A 1P91A 5FCDA 3FTFA 4X1OA 2JHPA 1G8SA 2DULA 5K01A 3PX2A 3LDUA 5LQRA 1KP9A 4FR0A 5FWAA 3UA3A 2GS9A 2CMGA 4C03A 5LQJA 4GC5A 4C07A 3UJ7A 3R3HA 3UBTA 3H2BA 2PJDA 2PY6A 3HCCA 2EX4A 1NKVA 3RW9A 5E1MA 2Z6UA 3LHDA 2ERCA 1HNNA 3OE5A 3QOXA 4RSRA 2ZWVA 3P2KA 1R74A 4DKJA 4HTFA 4P7KA 5EVJA 1M6EX 3B3GA 5HIJA 3SX0A 3E8SA 3KQQA 4UOEA 2AVNA 3KPUA 2B9EA 5EMJA 4PWYA 2NNWB 4PYOA 5U4XA 1VE3A 4F86A 3HTXA 1Q0SA 3HCEA 3P97A 1ZGAA 1JSZA 3A4TA 5T64A 3VSEA 4BY9E 1NE2A 3DMFA 3MCTA 1ZGJA 2ZIFA 3LPMA 5GP1A 3GGDA 2HWKA 3DOUA 4PCLA 3T7TA 1ZQ9A 4B17A 3TKYA 4F84A 4KW7A 3P9CA 3T7RA 1XDUA 3EEOA 3M33A 3DLIA 3CKKA 3GRUA 5E8JA 4YUXA 3KQTA 2ZSUA 2UYQA 1XJ5A 2PSSA 3OU6A 5HIKA 1YUBA 2Z6QA 3HCDA 4PYIA 1VQ1A 2CWWA 5MHTA 1Q0TA 4RTRA 3KQPA 1XDSA 1SQFA 2IH2A 1ZKDA 2Y1WA 3SSMA 3ME5A 4IV8A 1NT2A 4MTLA 4DCGA 4RTOA 1UFKA 4QDJA 4PIPA 1SG9A 2GA9A 4QVGA 3DH0A 3EVZA 3BWMA 5HOQA 3P2IA 4HSGA 4M38A 5BW5A 5EEGA 1G55A 1UWVA 5ICFA 2C7RA 4KWCA 5DM2A 3ER9A 4XCXA 2XVAA 4EKIA 3AJDA 3Q87B 4YV1A 4RTSA 2A14A 3PTAA 3LCUA 3C3PA 1QYRA 3G8AA 5D1HA 4KDCA 1VPTA 4WXHA 4GBED 4L7VA 2FK8A 4HC4A 2OB2A 3MGGA 3LCVB 3DXZA 4CTJA 1PJZA 3PLAE 1DCTA 2XBMA 2Q41A 3CC8A 3KPWA 3B5IA 4EKGA 3TFWA 2GLUA 4GC9A 1RI1A 3MAGA 3R9XB 4RX1A 5GINE 4X63A 3I9FA 5DXAA 3DP7A 4C04A 3O4FA 5E9WA 3KQMA 2OO3A 1QAQA 2FCAA 1H1DA 4QDKA 5CVVA 5LQNA 4HRAA 3FUXA 2H00A 2QYOA 1RJEA 4DM3A 3KPJA 1BKYA 3B7PA 2AOWA 5DM0A 3UJDA 1AF7A 4OA8A 3OU2A 1WG8A 3OZSA 4PIMA 5DTMA 2FYTA 1M6YA 1N7JA 3BGVA 3GIWA 2UZ4A 3UZUA 3ORHA 5GWXA 1VBFA 2AOVA 3T0IA 2ZZMA 4XUEA 5GM1A 3G2MA 3TOSA 9MHTA 2Y1XA 4EK9A 1RI5A 2OBFA 1U2ZA 3BGIA 2V7EA 2PXAA 1JQDA 2I9KA 2IH4A 3IHTA 2H1RA 3HA5A 2KW5A 3VC1A 4ER7A 2CMHA 2P40A 3UJCA 3EGVA 4KIGA 3CJTA 3GNLA 5CCXA 3FPFA 3EVFA 3QV2A 1RJGA 1O54A 3HVJA 1I4WA 4YMHA 3LBFA 1X1BA 4KIFA 1B42A 1EJ0A 3M70A 3I53A 5EG5A 2ZLBA 5EKXA 5EZSA 2OPBA 2I7CA 1ZG3A 2OY0A 5LQAA 3C6MA 3FRHA 4V0QA 3GRRA 2WA2A 2WK1A 2ONYA 2P8JA 2IDJA 3EVGA 3HCFA 4AZVA 3LBYA 2GB4A 5E9QA 5E8RA 4ER0A 2PWPA 1JSXA 1JG1A 4R8SA 3A26A 3FPJA 3OPNA 3UJ8A 3KQOA 3DUWA 3GU3A 5ERGB 3NJRA 10MHA 2FRXA 3G2PA 4RWZA 3JWIA 2PLWA 4ATNA 4FS8A 5K0BA 2UYCA 1I1NA 1Z3CA 3FPGA 2XYRA 3OZTA 4OQEA 4O29A 5EPEA 5EMMA 5HIIA 5DRYA 3SSOA 2PWYA 3O31A 4DCMA 2JHCA 4YMGA 5FQOA 3KQSA 3JWJA 4E2YA 4QQKA 2QM3A 4C05A 1OR8A 3ELYA 3E7PA 4BLUA 3EVCA 2P1DA 3E05A 2JH8A 3RODA 2ZIEA 2YTZA 5C9ZA 4HH4A 3EMBA 2NXEA 4BLVA 3G2OA 1ORHA
chains in the Genus database with same CATH superfamily
3ZWPA 2X0RA 4K03A 1HE3A 1AQNA 2E4WA 1AC5A 4UPEA 1T26A 2NT3A 4MR9A 2BHTA 1Q6ZA 2OG2A 1MZPA 3ZXIA 1IBKB 5LJLA 3LUGA 5DBEX 1N8KA 1PZXA 1XCBA 1N8SA 1J7KA 1U5BB 4DV4B 1Z2OX 3DLPX 5IPFA 3BMXA 2ZR8A 2NUAA 4ECAA 3L4BC 1HXHA 3HP7A 1W4CA 3NB0A 4ESOA 2VYVD 1C29B 2YWEA 4F1KA 3RK1A 3D81A 2GMWA 4FILA 2E4ZA 2H2FA 2LHCA 1FK8A 4OM8A 1VI5A 3MVEA 4LK3A 3ITKA 3JY6A 1NSTA 3PD1A 4EJSC 1Q77A 4OFXA 5FUWA 4QM6A 1N1MA 4OX9B 2COEA 1U2EA 5T57A 3ZV5A 1E6LA 3FUTA 4O63O 3CLTD 2DE0X 1JQLB 3QP9A 1UMCB 1ECFA 4DSUA 3ZCPA 2FLWA 3OFND 3WHKA 2WT9A 1IBLM 3H0CA 1T1JA 5ADWA 4LNUB 1FFEA 4K6FA 4E1BA 2IY7A 1CJKC 3CR8A 5DRTA 3LYHA 4QGGA 2YCBA 3PHLA 3H13A 3WQRA 4PHTA 3GP5A 5ALFA 5IP5A 2TMYA 4BKMA 1PFQA 1QLJA 3BWEA 1R0SA 2C5RA 4IHAA 1GCAA 2N9UA 5FT9A 1JB9A 1FMTA 3SZGA 2WAAA 3HHZA 4B74A 1LCIA 1K88A 3KSMA 1LLFA 5HDBB 1X3LA 2Q27A 1DCFA 2IDKA 1P80A 2EJBA 4FTWA 2ZI6A 4DTCA 1R5OA 2UYOA 4RPKA 2ZP1A 1YBHA 4WZZA 2B2XA 5CFNA 3WMWA 1UKAA 1ZOSA 1Q1ZA 2HI0A 3N8KA 5K0EA 2AMFA 3KNZA 3W8RA 4K9QA 1Q2XA 3DQPA 4LJ8A 3SR4A 4LOAA 5JHGB 3AETA 4EYKA 3M9WA 1LW6E 3L41A 2X3FA 2HJWA 5DYGA 2P6NA 4DIFA 3ZZNA 4EHIA 2W2TA 1FJ2A 5F76A 2XMZA 4DW8A 1TTQB 4JI3B 1MABB 5JDIC 1DIGA 3JQ7A 2RBKA 4J90A 2WJ4A 2IYEA 1NMEA 2YV2A 1N3IA 5AHXA 1BE8A 1YJAA 1WW3A 1QBGA 4XJVA 4AURA 3IEIA 5BVGB 4G4NA 4U7DA 3ER8A 3TCXB 1T10A 5SZKB 3ZLUA 1OLSB 3K1TA 1VLVA 3F6PA 1K6XA 5KPTA 1S2MA 1QVAA 1NIJA 3UTCA 3BULA 4LMRA 3GW8A 1LDBA 3QY0A 3ZN2A 4C88A 1VCMA 2UXBB 3HM9A 1JKJB 3KALA 1U9JA 4MW9A 3UHAA 2QG9A 3LCRA 1H8EA 3A0UA 1GT6A 4CG3A 2RAUA 4L0MA 5DLEA 2NXWA 2ZRQA 3L04A 1GAEO 1EE9A 2EZ8A 3ZWVA 4CCWA 2A1UB 5FUQA 1C0PA 4KQGA 4MV4A 1ZI6A 2Y0EA 4WK2B 5FF9A 2VF7A 2XBMA 5LB4A 3EODA 2H18A 2H85A 5IAGA 1T1EA 4TWIA 1SK9A 2IT1A 1QFSA 2OO3A 4ND1A 2BM1A 3C5EA 2ZPAA 2VBIA 3FFTA 1BMFA 1C9KA 4O4HF 1F2TA 4G24A 3O4GA 1T34A 1A71A 4JJ4A 3U5TA 3ZK9A 1SXJC 3UTDA 2HU7A 1V1RA 7ABPA 5A3QA 4PG7A 1EFRD 5HW0A 4A2WA 4YMGA 2IF2A 2WIGA 4JI8M 2VT7A 4MVJA 3FLBA 4A6PA 2PU5A 3VTFA 4AJ2A 4UVEA 1N0UA 5IK2A 3LK7A 4YMUA 3FWNA 5HCUA 1YJBA 4PDIA 4YJ2B 2N75A 5HIAA 2GA8A 3UK7A 4EUKA 1F1BA 3T3HA 4MUHA 1HT0A 5AP9A 3GJ0A 2I7PA 2ETVA 3FWPA 3KQYA 2VP4A 2O8DA 1LZLA 3M3HA 3TOCA 1AIPC 4KQXA 3ZWBA 5ALLA 1FU4A 2JJ1D 1OXXK 2L17A 3CEJA 3TRDA 5KVAA 3ETEA 3VU9A 1ADJA 1KI1A 4B3JA 4GSYA 1YKSA 4TKZA 4Z5XA 4FGUA 1KYYA 5TLSA 4K2HA 4NS4A 4BE9A 1N0VC 2WOOA 4FUQA 2L4EA 4F2LA 3NHZA 4YROA 1TJYA 1Z2DA 4QUEA 4YDHB 2DVMA 2QTAA 3QUSA 5A05A 4C89A 1O9HA 4P86A 4Q1FA 3NH6A 1PR3A 3U4IA 3JYHA 1BXRA 1DAFA 2PLNA 4ESEA 2DFLA 2HW8A 1H6BA 3MWJA 4YRJA 4XWTA 1SR8A 2YUIA 3ND9A 4EW2A 4CIDA 5K0JA 4R81A 2PTGA 3PNMA 2ZI9A 5DNUA 3G8BA 1P0CA 1THZA 4D9FA 4FB5A 5ICMA 3V2HA 3W5UA 4I4TB 4ZV9A 1IJFA 5BRJA 3CFYA 3HEBA 2EZ4A 4TUWA 4DQLA 4HPJB 1DEOA 2HMSA 4C9BA 3Q8XB 3DEYX 5CCBA 3M5CA 3QE3A 1N5RA 3MWYW 1GUAA 4C08A 1M72A 2FPIA 2XYHA 1G21E 4WJKB 3SYKA 4DV5B 2V97A 1S8AA 1G20B 5DGHA 4D3FA 3AJ8A 3FIUA 3UYKA 2E49A 5T4BA 5DSXA 4ZMSA 1EBFA 4L15A 3AR9A 3CJQA 5G4KB 1KGDA 3VR0A 1K92A 2IYRA 2R8PA 5SZJA 3L1VA 2W2KB 4NYJQ 1CUWA 5TC4A 3CUEF 2J0QA 2CFOA 1LVGA 1P3JA 1NUSA 3LRXA 2H2WA 3OOHA 1EFVB 2BKUA 1GKKA 1ECBA 3KVOA 1I3LA 1UP7A 1XFAA 5HM6A 5JJBA 1TB4A 4J94A 3FUWA 4F2HA 3LY9A 4ODIA 1C1HA 2VPZA 5A5EA 2Z6VA 3S2UA 3RS8A 1HG1A 3QHPA 4EJSB 1CQXA 3Q98A 3V4RA 3IG8A 4D81A 5ALQA 3DKPA 1L5ZA 2H08A 2ZIXB 2J3LA 1RCFA 5EIEA 1ZRNA 4OHBA 1P77A 4HX5A 1R6TA 4Z4FA 3H18A 3T3MB 3BXXA 3OD5A 4LOIA 2VDOB 3OPYB 4PGMA 1UOEA 2RGGA 3OIUA 4QGSA 1NONA 1QR2A 3CPHA 3Q6IA 2XRFA 4FYVA 5PGMA 2AVNA 1KE2A 5BQOA 3LOQA 2BVNA 4DV3M 1CNEA 5GP1A 4B17A 3FMIA 1HQYE 2YHUA 4GGOA 4Q9DA 3GRUA 1XKTA 1KEEA 4K40A 3SNHA 1UANA 3QYFA 1SOUA 1Z0IA 1OCEA 4N01A 5AD1A 2O20A 5F77A 2V7UA 3UXMA 2DCMA 5D3ZA 5LOVF 1DG3A 2CBGA 4R83A 1H9CA 1NPDA 4RZSA 5T3YA 1W4RA 2PL3A 5SYMA 1KBOA 1VBKA 4ILEA 4HDMA 3KXKA 1RJEA 3TF5A 4RIIA 2PYZA 4PIMA 2QSUA 3A1FA 1E1DA 3TEJA 3FVRA 4A92A 3IIKA 2I78A 4Z9BA 1SUFA 1H22A 1KJZA 1QS0B 3BN3A 1YBAA 5F98A 5ALJA 1XPOA 5F4BA 4YCSA 4NSNA 3G2PA 2ZDHA 3RVNA 1W88B 4Q9KA 1KU0A 2G25A 2QM3A 2L7IA 4BLUA 4MVJE 3S1AB 5AM5A 3RF6A 4GMHA 3IILA 4EDHA 1XN1A 1WOMA 3NYQA 3DZ8A 2AJ8A 3SASA 1YNSA 3IDAA 1H2YA 1ZM9A 2XDYA 3U62A 4B9EA 1E9FA 3IT1A 5C4IA 4O4HB 3GVIA 1RQ2A 5JC1A 2P5SA 4JU9A 2WM3A 1Y1SA 4J0CA 2QT1A 3MJSA 5CBPA 1QM5A 4Z9FA 2H5EA 4RABA 1OZFA 1JFFA 3I9LA 3TE6A 1Z7GA 2OB1A 3LT0A 4IWXA 4QBFA 3EG5A 1O4VA 3VR1A 1D5CA 5F23A 4YO8A 1KYIA 1ZEJA 2OCIA 1EFCA 3VVBA 4LXYA 3ROMA 3AFGA 2A4KA 2P7HA 3O8QB 5BT8A 1W1WA 3HNPA 3EXIA 4Q7EA 2PTHA 1HYBA 2A33A 2CXRA 3M1YA 2W9XA 2IUUA 2FV8A 2GSWA 3ANYB 3RVQA 4YT5A 4IBEA 5L6MB 5BR8B 4MGYE 2HX1A 2BUCA 4YXWA 1T6ZA 2COUA 2PVCA 1WU8A 4CT4B 3PC8C 2VO1A 3GN2A 1SXJB 3KS4A 3JPWA 4JKYA 4ANFA 1C41A 5IAKA 5FOQA 3U1BA 4DV7B 1YB1A 4C29A 4W5RA 1PTKA 1UK7A 1OBVA 4ENSA 5IJZA 2QPAA 3BIWA 1OAOA 2YIMA 1E9CA 4ZEVA 3OESA 2PXXA 5BN1A 4AWAA 5MF6A 2C88A 3U9TA 5KQRA 5LXTB 4MW7A 1XL0A 3OSUA 1P7WA 1VL0A 2FJ0A 1L2CA 1NR1A 3UGTA 5JANA 1R0WA 1SXHA 1Z0SA 1CUCA 1E2HA 2VZ9A 5DZSA 5E6SB 5JZMA 4J43A 2RC6A 5DF1A 1UL1X 3I8SA 1E69A 1XQVA 3VBEA 2ATVA 5FL7A 4L78A 4LCBA 3IDSA 3WV5A 5JH7A 3EEBA 4QUKA 4AF7A 1Y6FA 4KO4S 1Y7HA 4HB4A 4RY9A 5F1YA 2P62A 3FCOA 4TM8A 2JL1A 1I3NA 4M1KA 1XQWA 3TMAA 3B9PA 2VRBA 3PGXA 3NATA 4ENWA 3E7XA 4PC2A 5B58C 4MWOA 3JD1A 3JTEA 1VM6A 2GZDA 5DNEA 2JD2A 1SCKA 3VKVA 1Y80A 3W0FA 3W3AH 3C98A 1A4UA 3U6MA 4M54A 2QVGA 3T15A 4BGEA 2WM8A 3OZDA 1FFBA 1PR1A 4WBXC 4HVLA 1ZQ9A 2Y4OA 3RF7A 3WB1A 4QVIA 3C7KA 4L9AA 1QQ7A 4BNIA 2JZ0A 3DEHA 2XOXA 1R9NA 4G85A 3OP1A 1NXXA 3GOHA 6ABPA 3FXAA 3S2FA 7AT1A 1X3SA 1TIPA 3P4UA 3OC6A 4DCUA 4Z4IA 2XGJA 1V25A 1AHIA 3FPCA 3FOWA 5E3HA 4N9QA 1ZD1A 1V7QA 1TZJA 4JHXA 4LF6M 1A4XA 1CIVA 3BHNA 2KM1A 5CA1B 2Y1XA 3MMZA 2BAGA 3VAYA 1TOAA 1RYNA 2GPTA 2XF8A 4BQNA 1OWLA 3SBOA 1RWBA 4Q18A 3S6JA 4ZRMA 4RGVA 4W5TA 3C41J 1DELA 2ZRIA 4YC7A 4UHBA 4Y2JA 5B36A 2O2YA 3ORSA 3A7EA 4E51A 1KEKA 3ZE8A 5B7GA 1CUHA 3EH1A 1KDVA 4MIKA 4LGCA 2RH8A 3HBFA 1T4BA 5I7SA 3CM0A 5AQ1A 2YR0A 2QXUA 1CWUA 2F5PA 3VXKA 4C4RA 3UM9A 5GOTA 1M9NA 2DBYA 4TWRA 3GAZA 5DHRA 3KZXA 4QLOA 1MVOA 1P2UA 4C06A 4RZ2A 4JCCA 1ISGA 1C3VA 1PRBA 4K9OA 4RDXA 2YL2A 2KYRA 1SBNE 2H54A 1UWLA 4N12A 3VDMA 1XDBA 2LP4Y 1JJVA 4DQ0A 2JLWA 1IZYA 1I33A 4FHGA 1K1EA 5IS2A 4DLTA 2JUJA 5KAMA 1U3VA 4HG2A 4QAJA 3RVOA 5B4VA 1HEYA 2CKMA 1B0AA 1IM5A 2P5UA 2BF7A 2WD7B 3NIGB 3T5CA 4P6VF 3PZRA 2GEVA 4Q4JB 1TK2A 4BNDB 3E61A 4DR7M 1J09A 3H4TA 3RT7A 2IYPA 5TMBA 3ND6A 4B8YA 4G5QA 4MV0A 3BILA 3FSJX 1BROA 1YOBA 2Q9UA 4CU2A 3C3MA 1H85A 5LQSA 4LFCB 2NO4A 3A11A 1E5DA 3OT5A 4R0VA 4MS3B 2P9JA 5AT1A 2RJ3A 3D9QX 4YMVA 1UFRA 1JHAA 1I3OA 3CLSD 4TPKA 2RDMA 3PJGA 2QSZA 3DVQX 2X2OA 1C3OA 5DHPA 1A4RA 4GWKA 4I4LA 3W2TA 4D9CA 1Z13A 5FORA 2VZEA 3KXIA 4KYIB 4XVQA 3VHLB 3OX1A 4MHSA 1MC1A 3THSA 2PO5A 4X7PA 4MCIA 3R3VA 3TIXB 1B41A 2X2FA 4LHSA 1U2RA 2QM0A 2IYSA 3DZIA 1N57A 2AXPA 4E88A 4UU8A 2W11A 1VSBA 4LY9A 3WGIA 2R45A 1TC1A 1P33A 4O4JB 2LDBA 4QYMA 1YR1A 4JUIA 1TJNA 4NU6A 3RJTA 3WS7A 4QXAA 1IZ7A 1RXIA 1HQDA 3HVUA 2ODBA 4HAUA 1L8QA 5E6RA 2YHSA 2B61A 4CM8B 1XMXA 3N76A 1DHRA 4YHHM 2VAWA 3FPSA 2HU2A 1HDRA 5AUQA 1F14A 5AIBA 1J22A 1OT3A 4V0OA 4G5FA 2ZUUA 4YMWA 1J23A 2C4UA 1QFYA 1K3TA 2IV2X 3P9SA 4GL4A 4GGMX 4MA5A 4ZRDA 2ZUVA 2WPNA 3LKDA 2FPLA 4G4SO 5CH3A 2VYNA 2WVGA 1NF2A 1OJLA 1Z36A 1C9NA 1D2NA 3G2KA 5DBGA 2ZBUA 1QC5B 4TV8F 1XD2A 4UNRA 4M0CA 4X20A 1LVHA 1DLJA 4INPA 4KC0A 1NHGC 3WB0A 2ZTUA 4N7MA 3ZKAA 3FNIA 2M6KA 3A98B 3ACCA 1NZJA 4HB3A 2I4OA 1PEYA 3TJRA 4LHYA 2Z2XA 3H1PA 3K20A 1G64A 4WX2B 3E9EA 2Z4RA 3I6ZA 4INJA 3ET4A 3RUCA 3HB9A 4BATA 5EEGA 4UEOA 3D2CA 1FXWF 1PV1A 2PV7A 3C1OA 1CQJB 4LF4M 1UMKA 3UMSA 1U4SA 5CDTA 1RACA 3PUJA 1X7YB 2Y1LA 3HJUA 3N2NA 3D6MA 3AEZA 3UPDA 1HFKA 4QASA 1CDOA 3WLNA 2GF9A 2A92A 1M2VA 1N2JA 1NMSA 4Q39A 5AI8A 1J0DA 3I5MA 1KK2A 4PEVA 5IEJA 1Y8RA 2GBLA 2FPSA 3L28A 2VQEM 1CUAA 1ACLA 1J39A 1EVEA 5HIIA 2QN9A 2ADFA 3IPAA 4G3XA 5F5XA 1YJCA 4JYAM 1T0JB 3DOOA 4HH4A 4BNVA 1DRWA 1KIFA 4EO9A 1ZWKA 3EIWA 1E1NA 3VOAA 1G8HA 1GYRA 1XB2A 3R1IA 1QHFA 4GKBA 1CJTC 3QBDA 1RXUA 4OJTA 2Y9PB 2C7BA 3ZGNA 1W76A 5GM2A 1FJHA 1I4TD 4ZQGA 3D64A 1UK8A 5J23A 4ISCA 1JVSA 2VEOA 4EIWA 2EGGA 3RHZA 3WI7A 4H7PA 2B36A 5G53C 2XVYA 3NTLA 4M9UA 4HMQA 1WW2A 1H4VB 1Z4LA 3SS7X 3QPBA 3HMKA 3G79A 1WV1A 5AIAA 4N18A 1DTSA 2HCTA 2GO1A 2WFZA 2RGEA 3BE5A 2CFTA 5A4KA 5DTIA 3URKA 1SOVA 1RQGA 2QTNA 4BE7B 1NUTA 4EVQA 3FE3A 3KU1A 1QHYA 1NC3A 2LNDA 5EJ9A 3WXMA 2ZJFA 4UNIA 1VA5A 2KRKA 3EZ6A 5LNK1 3Q8MA 3NEJA 1Q14A 2PSDA 1FYFA 4WHMA 1Z33A 2R1VA 5KTNA 3KKLA 4IF6A 4TWAA 4DILA 4Y2SA 3ZGOA 5LKAA 1SO8A 3DXFA 3SS8A 1RE0A 3MXOA 4M53A 3BGSA 3FA2A 3MT0A 4B4DA 1Z4QA 3EF3A 1EFUB 5LLDA 5HX7A 3DBVO 1AA9A 3VPCA 5KCMA 3FMGA 3PNPA 3AIKA 4BEVA 4DREA 4JEIA 1N92A 4TSFD 4HH3C 3NEAA 4QGFA 5K0ZA 3C3DA 4PYNA 2FR8A 3L0ZA 5BNFA 4HEA1 4I46A 4C0WA 1PWYE 1H1LA 5A3RA 5F9HA 3TMYA 5JYDA 2FQXA 2ZAYA 1FFXA 4J0JA 4R8RA 1IBLB 5L3SA 4AWXA 5JY1A 5AQEA 1XEXA 4NZYA 1HH4A 4QOFA 4EVIA 3GQVA 3VZSA 4KLCA 4FXPA 4UUBA 3UWSA 4CIXA 5JZOA 4YJKA 1WGLA 1ZW1A 3OEWA 3TZQA 3QA3E 4LSZA 3ABOB 3LSTA 3E81A 4IBKA 4K6KA 4NCBA 4B6EA 2ZIGA 1K7YA 2G9NA 3H9BA 1YR7A 2DLDA 2FA9A 3RDPA 3IODA 4B8WA 2INGX 4P8RA 2QX9A 3JQQA 2GS9A 5EUQB 3KAKA 3NGXA 2ZSDA 3X1YA 4GR4A 4Q4LA 2HWKA 4NC9A 4HEQA 2ZYGA 2IIBA 5IBCA 3GYBA 2Q07A 1GU0A 1XQ9A 3E58A 3GCXA 3NKVA 5ISMA 3FLMA 4YY3B 2OQVA 1QCDA 2DSNA 2R2AA 4WXHA 4WEOA 4I5DA 1CNFA 2BIFA 3DONA 4O3MA 3DUFB 2ZVQX 4C04A 3MLEA 2HCBA 3VR2D 3BGVA 3N2EA 5JFOA 1LZKA 2ORYA 2XAAA 3ZHRA 3VR3A 4G01B 1V8DA 5BO5A 3HJFA 1HDGO 1GIAA 2DG2A 3P9ZA 4OLBA 2QU7A 1HFWA 4BLQA 3QH4A 3IOBA 3A06A 3EEQA 4M49A 4RY2A 3V8PA 3IKVA 1U4NA 3DWGA 3OMWA 1S5PA 2GTIA 2XQKA 4LVOA 4YVFA 2A1TS 2EFYA 4KGZA 2WSIA 3DTTA 1YO6A 1KO8A 4EHJA 3N5CA 2EIHA 2NQTA 1C7IA 2OKCA 4CEIB 4HSEA 4EYGA 4BKRA 4JI7M 3ENNA 3VO2A 3QTBA 1HLFA 4Y9TA 3OOYA 4QREA 3MRTA 5CG2A 4E6EA 1GZUA 2HXGA 4CL0A 4IDNA 3WP0A 3L01A 4ND6A 4TRRA 3F7TA 4CCAA 1PP4A 4PWZA 1OBCA 5J2UB 2JJQA 2H8GA 3KEMA 1IN1A 2HO4A 2ICAA 3F5SA 3V1KA 2R62A 1ZA2A 3EZ9A 4R7GA 5I9BA 4WBNB 3L49A 2D7GA 1DWOA 4JLJA 4G56A 4POAA 1ICIA 1DADA 2V4ZA 3L1HA 5CX4A 3I1JA 5GJBA 1OLUB 1DIOB 1VMKA 1R50A 2H63A 3R7FA 1U1CA 1JHYA 3GGCA 3WLOA 3ZX4A 1L4HA 2ZM6M 1NVDA 2BRUC 3Q7TA 1KU6A 3CY6A 1YS1X 1YZNA 3ECCA 5C35A 2HJ9A 3SKVA 3MLBA 4XGKA 3QKSA 5HZKA 1TECE 4I99A 4NZOA 4D43A 2MU1A 4OW0A 3AW9A 1F3LA 3IP6A 5JPIA 5A5FA 3GCDA 2QLNA 3N9IA 1WXGA 1DVRA 2FQYA 4OXRA 4I8XA 4PHHA 2PYIA 2V98A 1IQ0A 4BO5A 5YASA 1UC8A 1BD3A 4OXXA 4CLDA 3X43A 1E0KA 3GAAA 2C0QA 3I34X 3U4CA 2FUKA 5BSWA 2TYSB 4LYYA 4UTNA 5FIUA 1ZHFA 3W90A 3OZBA 5KTSA 1WDLA 2G09A 4EW1A 3ROFA 3TCKA 1F8XA 4LXQA 1CUDA 1JHOA 5E7MA 3S27A 3PWKA 3SBEA 4IGEA 2YJZA 1EAYA 4BCBA 1P5RA 1R8YA 5FH9A 2PUDA 2XKAA 4H7EA 3IQIX 2QN7A 4LYHA 1O8CA 2BBWA 3LXUX 2I4LA 1CCWA 4UZSA 4K86A 1YHYA 4BVEA 1D9XA 2R8XA 4IIBA 2X77A 5HWSA 1KNQA 1Y6ZA 5ALRA 3O4JA 4JBHA 1MB3A 2KJQA 3QVTA 2DWOA 2EYUA 2WE7A 2EHJA 1HOTA 1X8XA 4DV6M 4IWYA 2K5UA 3FTNA 1OZAA 4RMHA 3DYIA 4N3AA 3SIXA 4X8OA 4DLYA 3WGTA 1VRWA 1ULUA 2XVXA 1VG5A 3DT8A 3I3OA 1SWWA 2Q99A 4A8PA 2DWQA 1WMAA 2I3GA 2D59A 1I4DD 4AROA 4JB2A 5TQ2B 2QX7A 1X39A 1STOA 4C6TB 3OM0A 1N2SA 4BFTA 2Q2WA 5AVOA 2PHZA 1NBAA 5AVJA 1L7NA 1YGYA 4DARA 3LC2O 3K0EA 1XMQB 1L1RA 2Y71A 3PGA1 1ZW6A 4HKTA 1NXWA 2Q3BA 1RZ3A 3CB4A 3TD2A 2DH5A 4HNUA 1E20A 2F9LA 1OI7A 5AUNB 3I2FA 4MP8A 1P19A 3SE7A 1H0HA 1AGYA 1QSGA 3ONFA 4G89A 1V92A 1KWKA 4HPWA 3K7EA 2RJNA 3JAKB 5I01A 1ONSA 2QB5A 1E4YA 1ZJYA 1EE2A 2C3OA 5FPSA 4J7XA 1FB5A 2GHRA 3RYHB 4ZP1A 3AUAA 3RUHA 1QTNA 1XNGA 5EMMA 1Y3AA 1ZUNB 3S81A 3ELYA 1JEQA 1JHPA 4NBLA 3PBKA 4PSUA 5BWLA 3D5QA 5KYUA 2IZ1A 2ZAOA 5E9JA 3MWDA 4PD2A 2R0IA 5E2AA 3EMVA 3GGJA 1XDDA 3GT0A 2ZWMA 1FW6A 5F12A 1Z6TA 1W25A 1VMIA 1YS9A 1NDUA 3EUEA 4FN5A 5CLJA 1URPA 2R6ZA 3GI1A 1APBA 2EHDA 2AZ4A 2OYRA 3GH1A 4UBJA 3EGXA 4JN6A 3Q3EA 3IEXA 4D8VA 1GHTA 2QM8A 5JMWA 5BT9A 3V2UA 1UEIA 2VXBA 4E3WA 2JLUA 4MV3A 1T3LA 4BTVA 1FFGA 3B52X 1P4RA 3WYAA 2GYUA 2HADA 3WB2A 4GQBA 2GZRA 4OI0A 3LT4A 4NRVA 3I2YX 1R0LA 2R79A 1S3FA 3DOCA 2WTNA 1U9IC 4GOND 2QN6A 4AIRA 2CCJA 2Q45A 5LSAA 1V34A 2P9YA 1SULA 3ZDAA 2XMSA 3FYTA 2GAAA 2QTRA 2J3KA 1QYXA 4F6RB 1OX6A 2H5XA 3HDGA 1J8MF 1N2CA 3AUXA 3VV2A 4E5UA 4NFHA 1P81A 3ZWYA 1PVDA 4KXFB 2MSNA 2WB4A 1XU9A 4DIOA 2JWSA 4J07A 2N3ZA 3V42A 1BNCA 4GP9A 5JARA 5C8YB 1V9CA 4E32A 3G9TA 1FDUA 2EKZA 1DBWA 3L1IA 2W6CX 4HXGA 5JNUA 3KUUA 3QBJA 1D8TA 5JI3E 1P3QQ 1N6NA 1EM8A 3G49A 1ZS9A 5HRAA 2VUHB 4QLBA 4J6EA 4QSMA 4D3YA 1XTRA 3OQNA 2F5QA 4E5KA 1YI8A 3TINA 4AMVA 1FXSA 3L0BA 2IPXA 5ELXA 4U0KA 2FUEA 4YRQA 1TMYA 1UZMA 5L3QA 4IGFA 1MV5A 4OVKA 4MGKR 3AU8A 4L72A 2OBYA 1KI4A 2D2VA 5BN4A 1DGGA 4YJ2F 2VPWA 1P2VA 1JDVA 1QFZA 3Q9UA 4GIBA 1F17A 4HDAA 4DJAA 1EBUA 1PG2A 3M6IA 1LNQA 1PKXA 3F2VA 2EKFA 5K9ZA 2B4KA 3IHLA 3ZIAA 1QP8A 4IXWA 2VK8A 3F92A 1YQEA 4NCKA 2ILTA 3IB3A 2BPOA 1TRHA 4NZPA 2L0XA 2PJRA 2ZCJA 1YJ8A 4HAOA 1G3UA 4MUGA 4RV4A 1OXMA 1D2AA 1RWMA 4HDRA 1SCIA 5G0WA 4YDQA 3UBMA 3Q7RA 5H70A 5IUNC 4QDTA 1VEKA 3VDPA 2MSEB 3VISA 5I47A 2J9FB 3V3KA 5CA0F 4WLUA 2X76A 2WF6A 2AG8A 3LCMA 4ZYTA 1EK5A 2YJ4A 2XQIA 1DBPA 2AH5A 2X1HA 4YECA 3FKSD 3DV0A 3LHKA 3R9IA 2XT0A 1GG5A 2Q29A 3HDQA 3I6BA 2UZ0A 1UWVA 2XMPA 5FOWA 3ASZA 5ER6A 4QXOA 3A1UA 4I4TF 4JEMA 2YS6A 2DQZA 4ND8B 1M0WA 5BNWA 3SBJA 4FZRA 3O4FA 5E9WA 3PFWO 3FUXA 4UUPA 4DM3A 4UHEA 3I1YA 3H4JA 4FCCA 4AS3A 5GWXA 5KNDH 3DP9A 1VBFA 2YJ3A 5ELMA 2MMGA 4IAOA 4WXPA 4QX6A 2YCLA 3VNAA 5HMLA 5ADVA 2P40A 3CJTA 1KQ3A 4H4DA 3T1QA 3EVFA 4DCPA 4UZEA 3D4IA 4YDRA 3AB8A 1GPMA 3LF1A 5JWHA 3WRWA 2ZIVB 4NZ9A 1NC1A 4JI2M 3IR6A 1NURA 1RXWA 4DCMA 1WZIA 4D8UA 1FTQA 3JRXA 4NFSA 2JY5A 2G80A 3ZXXA 4RFVA 4L4XA 3M3DA 4UN2B 1NGSA 2XQGA 3RFCA 4YWJA 1T9GS 4AG3A 5I45A 421PA 2FZWA 5JLAA 3TTTA 4WCFC 4UEKA 3QVXA 1AQIA 3N2ZB 3DULA 1T2EA 1CU1A 1BC5A 3SJUA 4LY0A 3NBYC 2ZT8A 1OKSA 3U1TA 1JQEA 1G21A 1U9ZA 3CNNA 4ZI3A 1K3FA 3P19A 3OSZA 3ZNQA 1JBKA 1UBLS 3M83A 2AF4C 3EPPA 5GVRA 2AJCA 4NAHA 4LF6B 5IDYA 2FSHA 4ARZA 4H0CA 4KMOA 4D0LB 1EWYA 1QH9A 2H9YA 2QMHA 4RKYA 2NSYA 2FP4A 1SBHA 2J07A 3B2EA 4EQZA 3COZA 1ZOPA 1XF1A 1L5WA 2HHLA 1XD9A 2DC1A 4IKPA 1BEEA 1U1GA 3IQZA 4K87A 4IUBS 5TQJA 4BKUA 1KL7A 5COAA 4CFYA 2VUTA 4M3NA 2P2DA 6ADHA 4G0WA 3RSSA 4A91A 3OZUA 2OORA 4C7JA 2PPLA 4UHDA 2DFTA 4KR9A 1YR6A 1GARA 3STTA 5U9CA 4HGQA 1DX9A 4AJNA 1SZPA 2IEZA 4RIFA 1LWOA 3V7FA 1N2CE 5ALNA 1SKYE 3DLAA 4I66A 4EYSA 1X8LA 5DP1A 3ROXA 3UQZA 3O8DA 3DV2A 1YCFA 2ECPA 3W5IA 3P4YA 4V38A 3PXAA 3AYZB 2JFWA 4DNQA 4OGGA 1T0PA 3BX1A 2F9MA 4PINA 2F8TA 3V8BA 4Q7LA 5DYTA 1IQPA 3NLLA 4L28A 5J4YA 3EIOA 1KSJA 3NHSA 3H9CA 3VSDA 1AZSC 3LL7A 1FY2A 1HDYA 1ZH4A 1JZSA 2FMUA 2PUVA 3WFJA 1V4BA 1OYOA 1K98A 2O06A 4QJIA 2QY9A 2IS6A 2Z1DA 4NHOA 4WOJA 5LN1A 3M8KA 3HZJA 1IJKA 1GKIA 2AK3A 1T91A 5TJHA 1U7UA 4PR3A 4C1NA 3LPLA 3SMQA 4GHWA 1ZM3A 2W0SA 3ICOA 1Z7BA 2FPPB 5TEWA 1W6UA 1OXVA 2P7IA 5DLYA 3Q8WA 5K7SA 4E07A 2Q1SA 4B32A 3D2AA 3FG9A 1MEEA 1RPZA 3DFUA 2OFPA 2B92A 4IX1A 3LHIA 2DSTA 2O52A 4GFDA 2VDVE 3QWAA 5JW6A 4URZR 2GN0A 5KYXA 1PG0A 1GRQA 1VC2A 1G2OA 3BL6A 2BFDA 1V11B 3PRYA 3M4YA 1Y37A 2HV8A 3W77A 1M2WA 1QGUA 1AO0A 2ZWVA 4HLUC 4EFMA 3SX0A 4NAVA 2AF3C 4HJRA 1NVBA 4B3XA 1IIBA 4L2IA 1V37A 3DMFA 1IOVA 3WKDA 2FU5C 2H6EA 4DVJA 3E9CA 1WRBA 1F5NA 4TTVA 5EXSA 1SU6A 1V1MB 4MDFA 1GPH1 4YHHB 3TZBA 1T6OA 2C61A 4XCXA 3JALA 5HTOA 2D0PB 1OC4A 5F3WA 3ONEA 2QSYA 2QR2A 1KH3A 2XUOA 3VR6A 1Y9AA 4PAMA 4IKEA 3KEFA 1HORA 4U2CA 4K9PA 4KXQA 5CA0B 4H0FA 4GXTA 5L3RA 3ZCQA 4KIGA 5LXTF 2I7DA 2Q3EA 4HDKB 1WX1A 2L7HA 1Z39A 3AJRA 4LSWA 4PANA 5LC1A 4IDBA 1X80A 3N3BC 2VPQA 10MHA 2AEMA 1RWPA 1YQTA 3BK1A 2VDRB 5JMPA 2CHQA 1ZUIA 2PWAA 4UMVA 2ZWIA 3UHPA 4JB3A 3A58B 4Q37A 2FH5B 2GAOA 3O7MA 4DR2B 4QDOA 5EJAA 4I5IA 2P5TB 3JR5A 3F0TA 4BO2A 1DOZA 1THMA 2Y0QA 1GKYA 1PGNA 2ID7A 2BFBB 4B6OA 2IX3A 1GQRA 2B8WA 2Q5IA 1ISIA 1JXMA 5CT5A 1XZJA 3NYWA 2VYQA 1S01A 1P39A 1HE5A 1VYVA 1NVMA 1XZHA 2V7XA 2XUQA 2ZJ1A 1WHCA 1O2DA 1GRCA 3LC1O 2C5LA 4TMKA 1T15A 5CEEA 1IY9A 4EAAA 4LWOA 4YUYA 2DR3A 3LPCA 2AZXA 2C59A 2EP5A 4Z9XA 4CF4A 3OAAD 1KEWA 4JYAB 4ZYYA 2GN2A 2IH5A 4LDNA 2ZUTA 4PO1A 1BWPA 1YDWA 1Y5LA 1NW8A 5BRAA 3ZE2B 3R6TA 2OBXA 1E8NA 1XU7A 2JLXA 4G5HA 1QR6A 4IJWA 1TT5B 2BMEA 4ZREA 1C4XA 1M8JA 3AF0A 4YACA 2C3YA 2JY7A 4GG1A 4IP0A 4GBMA 2C7QA 1MRZA 5JCJD 3NP9A 5E2BA 3QYBA 4K7JA 2PUBA 5TQVA 4X8HA 4WCFB 5CA1F 2EDCA 3QXSA 4M1WA 1WBJB 3X1XA 4Q01A 2QKYA 1FFYA 3AF4A 4YDSA 2G4LA 1D5WA 3HKCA 5E3IA 3OTHA 3I01M 3BPSA 1U3UA 2BBSA 2M60A 3LDHA 1A8UA 1XRPA 2QL6A 4V02A 1UBJS 1RYBA 2OBNA 4MKXA 2DPHA 2I8AA 4A5OA 3HK2A 3EF0A 2J6HA 1ZM2A 4C0SA 3CYFA 2XCOA 5AW2A 1KPIA 4U0JA 1I4OA 5EJ8A 5K5EA 2FMHA 4AZWA 3MAJA 2YWCA 4BLOA 2PRSA 1IJEA 1Y9JA 1SKAA 4GUAA 2GJKA 1BVUA 3LX5A 4D41A 3UAWA 1MNAA 4U2KA 1QOZA 2J9YB 4LTDA 3G0IA 1NYLA 4XVHA 3H87A 4Q9LA 4IO0A 3KKZA 3WV4A 1Y82A 2KPOA 5BUZA 1RRKA 3LP6A 4PRZA 3V4OA 1MTZA 2ZXFA 4M0UA 1KJIA 1Q0SA 3WK9A 1FFSA 2ZE5A 3MCTA 4X97A 1MAWA 1NNSA 5AJTA 4XDYA 2ZIZA 4EMTA 2JGDB 1TH4A 1OVGA 4UHFA 1KJ8A 4MTLA 5AVWA 2FQQA 3OKCA 1PJCA 2EO2A 1EFLA 2BMFA 2NSDA 5KDLA 1UPXA 1XK6A 3DLBA 3TEMA 1XALA 4TXNA 4K6HA 3LW7A 2A4MA 3GLSA 4IDEA 4XOUA 1E5QA 3BWXA 2QAJA 5BYKA 3ORHA 2JD0A 1J9ZA 2GJ9A 3CLTC 1ZUHA 4TKUA 1RVV1 1FQJA 4WFJA 3AHCA 1KEUA 3EQ8A 3A6PC 4PLVA 2YICA 3DG9A 4YCJA 2YVAA 1PG5A 1M2OA 1QO0A 4UJ5A 1J97A 4QPCA 1DMSA 3HSSA 4DC1A 1X6VA 1I1NA 2H5IA 1DCMA 1T9DA 4R01A 1QQ5A 3WIVA 4O4JF 4KK3A 4QYIB 2JAOA 1QG6A 3BIOA 3DOJA 5JNSA 3TQQA 3IQWA 3AERB 4FEAA 5EHXA 3DMGA 4ITUA 1BD4A 3OTQA 4UAVA 4EI2A 3OWHA 4YGXB 4NXNB 3FI0A 2PBLA 5EIWA 2CB0A 4TSRA 3EC7A 1N2EA 2FOIA 2DHYA 1G6Q1 2BGNA 4KH1A 4IZHA 4PC6A 1KDYA 1E2KA 3AVOA 2C2WA 3FFWA 4IGAA 3CEMA 1F8UA 1H2BA 5KSPA 2JIZA 2J3MA 1ZO8A 2UZIR 1Q0QA 2VS1A 3C97A 3KSZO 4ZHQB 2FFAA 4GHLA 4MUNA 4E13A 1I0IA 4GITA 2VYCA 1EXVA 4C4OA 2J0UB 3TI9A 5M7EA 4DRZA 1QGAA 2NP6A 4GEKA 4Q4AB 2QRZA 1JH9A 4R2XA 4CW7A 3ZD7A 2QE6A 4F1WA 2B7LA 1VLLA 4K26A 1XMIA 2H06A 3WLMA 3I04M 2BKAA 3LH5A 1G8YA 2HL7A 2OZEA 1JNXX 1QH8B 4WNAA 2GYVA 5A3VA 4BVFA 1GKLA 3L8DA 4JI7B 4XRGA 2QVYX 4LS3A 1T3HA 2PL5A 1ZAYA 5FTKA 4GHAA 3UNXA 1T35A 4R4JA 2CGEA 5TGZA 3C58A 4KRXA 5DB4A 4Q05A 5ITVA 2EKLA 1DC6A 4XX0A 1NW5A 4PYQA 1IMJA 4FVMA 2WC1A 2WU4A 3KR0A 3R7DA 3DQZA 3JD3A 2CXQA 2DHQA 4GP6A 2AYXA 1C3LA 2YJNA 3IJ5A 2GAJA 3MFYA 1M34B 4YJ3A 1X1CA 3OQOA 5L8VA 1AXEA 5JO0A 5KX5A 1Z5CA 4IXDA 1EJ6A 2JFBA 2RCYA 2B78A 2OCGA 5ALGA 1OH8A 2NACA 2QRVB 3H65A 3L6CA 3UT5B 2AYYA 2NIPA 2IIQA 3GAMA 1O95D 1OTRA 1B93A 4OX9Y 1R8SA 3T5DA 3I58A 2X22A 2W43A 5AJHA 1OXBB 1EIZA 1TAQA 3ZK7A 3KUXA 3PWSA 4FP9A 1CETA 4UUOA 1S2IA 4CXMA 1M1NA 5KPRA 5BSFA 1L8XA 1LEHA 4QGBA 5F2NA 2O01F 2FEAA 1Y98A 4NV1A 3KO8A 2RE8A 4GI5A 2X0NA 3KKMA 3FZEA 4UBOA 4M1MA 4MS4B 1ZBDA 4CL8A 2I54A 2QZ9A 5TMDA 4W7HA 1ISMA 2ZJ7A 4P1ZA 4YJFB 2TS1A 4PSDA 4DJTA 1XAJA 1XFDA 1K7FB 3A4MA 1M2HA 5FPKA 4FC6A 3R7WA 3R3ZA 3OCUA 4RTRA 2PL1A 1AK2A 4Y0NA 3WL8A 1JYSA 3HYNA 3BMQA 1QIMA 2C2HA 2DTDA 3IAS6 4KNWA 1G55A 5DM2A 3NHMA 4PVDA 5H1YA 3EGDA 1Z5BA 4RH3A 2LIPA 2GLUA 5DLQC 1V41E 5B37A 3C3EA 1CEEA 1MXHA 4DV6B 2ZK7A 3JRWA 4D3XA 1YWGO 1M6YA 2ZSKA 4MARA 4WN3A 4GAEA 3OO0A 3T7DA 2FN4A 3IHTA 4W9NC 2R7LA 1XRLA 5LQDA 1R6VA 2VAXA 3KDAA 1AUVA 1C9YA 3UJ8A 3UH1A 4Y18A 2WAMA 3C1TA 1NF9A 4HL6A 4GZ3A 2UYYA 3P2OA 4HX9A 1QV6A 2YY6A 3B7ZA 3U5ZB 1X86B 1K4YA 3ABSB 4JVMA 2A0KA 3LXXA 4G23A 5FL3A 1YKFA 5DSTA 1JA0A 2CYCA 4NQZA 2YRWA 2VHEA 4E4RA 1CVIA 1NFQA 2QNRA 4G0ZA 4IW3B 1XDWA 4QWWA 3SXUA 1B0PA 1SIOA 2VNJA 5DHSA 1CDZA 1PQWA 3AFMA 5LQKA 3ZTTA 3T7AA 1N36M 1OQYA 4KYVA 3JRNA 1SU8A 1JG7A 1NW6A 2VZ0A 1ZQ1A 1RLOA 5KU7A 4D4MA 4FYMA 3UAOA 3THYA 4L73A 3TRIA 2CF6A 5D3MA 3V4VB 4RPGA 3LQ2A 3H86A 1DKRA 1VIDA 1F7VA 1KJQA 3HKEA 4D1YA 3TLZA 4WIAA 2FE4A 3IJPA 3IIEA 4BMPB 4HDCA 2JGKA 3PFCA 4WFKA 2YN0A 2VH5R 1XA3A 4YO7A 3WYCA 2CL5A 3QKUA 3W67A 3MWEB 1W93A 2PXCA 2XCIA 5AI0A 3MMNA 2RRUA 4FGZA 1MB0A 3Q4GA 5AJZA 3JAWA 1U90A 3ID6C 2XKBA 2JBHA 1C9MA 4EITA 3AIMA 5FQNA 5HKKA 3T34A 2K7ZA 2G06A 4BZXA 2F48A 1XTJA 3TM5A 2YZMA 5DHTA 3GA0A 4NYMQ 4D26A 3GA5A 5DKFA 4WZAA 4G8DA 2A1IA 2OD2A 5KQLA 2KSQA 3OM9A 1FQOA 4EAQA 1D0SA 3M49A 3WFIA 1TEVA 5MN6A 3SF8A 1C1DA 1NBHA 4DBLC 3VJRA 3W4KA 4KHZA 3K0FA 2F90A 2JCSA 2V7TA 1YB4A 4WQMA 4ER5A 2YZGA 2H1IA 1QBKC 3MJ4A 4PLYA 1NN1A 3T9BA 3L8FA 2VDPB 1QDUA 2N42A 4L8RC 2XGGA 1MQSA 1I7SB 2FWJA 4FD3A 4LXGA 4XARA 3COPA 4C78A 4QZVA 4Q7QA 3TIFA 2VQ6A 2XUIA 5KJEA 4CNBA 5C3MA 3T41A 4X6YA 5E6JA 2WU8A 4YT4A 2FPOA 1D2HA 2FUG6 2HT6A 4JLWA 3KG2A 4JJIA 5J5VA 1B3BA 2EKDA 4X71A 1U6IA 4ALKA 2BHLA 3R5JA 4Z7OB 2W4QA 3RC3A 3WFZA 2AKYA 2AN4A 2FJUA 2HUPA 2DKFA 5JRDS 2P4HX 4LNAA 2CBXA 3OHPA 5J2UF 5BXQC 2V8OA 4H1UA 2VOJA 4NFLA 1DP4A 2R85A 3JQEA 3UKDA 1QQBA 5EP4A 2HKJA 3NKFA 2XQJA 4J9VA 1AUAA 4DJFC 1TQ8A 1XEWY 1Y1QA 4TZKA 4UMDA 2GSDA 1C9DB 4WBNF 5IT9A 3SP1A 5IZCA 2GBGA 3BJRA 1EVZA 3F6YA 3L7NA 1ZL2A 3REGA 4UE2A 1LU9A 3RJ9A 4QQRA 3CUUA 3PHCA 2JGRA 4R9NA 1E2NA 3CWQA 5D85A 3AVPA 3QW4B 5L40A 2Q2OA 3OMLA 4X6UA 5JDCC 1NVUQ 1TH2A 4PZAA 4RW0A 5LU8A 1HY3A 3L25A 1HEUA 1N6RA 2KEBA 1HYGA 2P2LA 5ECDA 2I5PO 5A2QA 2IU6A 2BMWA 3RC9A 4UFPA 4IMPA 4KX5A 3LC7O 2G1UA 2LVPC 2E1RA 1CS0B 1FF9A 1UKYA 1WHSA 4MTCA 4OSEA 1R4GA 2YBEA 4FR2A 4I9NA 3TOSA 3GX1A 5K3FB 1N34B 4BNHA 2DUUA 3PD0A 2D5CA 1E9DA 2JDIA 4P53A 4RHTA 5EG5A 4A0QA 1UAGA 2BEJA 3FLAA 3NPAA 3HB4X 1Y6QA 3MW8A 3OJEA 4D3DA 2EJCA 5ES3A 2AHMA 3DBRA 1ES9A 3RAFC 4D8XA 4YMTA 3E7PA 5ECWA 3RODA 3A6JA 4BKPA 3V97A 4H7JA 7GPBA 4E15A 4FX2A 3A9WA 3LY8A 2YHIA 4OSPA 2F1RA 2FEKA 3EHDA 3IV7A 3U7RA 2KZUA 4FCVA 1OTHA 1QG4A 5JSUA 2FR1A 1SKMA 3FCEA 4IRUB 4DFDA 4Q00A 2F5SA 2WDPA 4BV9A 3IH5A 4JC0A 2IK8A 4RVGA 3ZYCA 4RV9A 4L6IA 2NU9A 1SXQA 2IYYA 1GO2A 2BUBA 3PUIA 2WD9A 1MKYA 3Q3CA 3ZD9A 3OP4A 1C1XB 3VO9A 2D8MA 4RJJA 3ACBA 3T38A 3W2GA 1LX7A 3WWDA 4U2BA 1Q7CA 1TCCA 5KHAA 3RFUA 4AL4A 2J31A 5F9MA 2H5LA 5CDYA 1H65A 3TKAA 3TQHA 2G8LA 5DX0A 4J0EA 2JLZA 3LMMA 4ABYA 4JI2B 3VJMA 1RHRA 5JCZA 4U7FA 4KK4A 4CISA 4QRIA 4AYXA 7ADHA 3GLFA 3A7DA 4FDUA 5CT4A 2VA8A 1MP0A 1IPFA 2IOHA 1P3Y1 3C5WP 2QWXA 2LNHC 2UUPA 1XMJA 3FKJA 3BT7A 3KPVA 1QRRA 4IYJA 3W9BA 3MGAA 5I9LA 4AP5A 2WPDA 3WC4A 2I2FA 3AKDA 2XF2A 3K9CA 4N5DA 2HBRA 1K2WA 2FZ5A 4B35A 4WZAE 4IEFB 3W3AA 1NF3A 3JD4A 4PAOA 2FRDA 1VHQA 1BRTA 1GEEA 1U8TA 4NWIA 1O0SA 3THRA 8CATA 3IAFA 3QKRA 4EB0A 4ND5A 4ZWNA 3K9BA 2GHIA 4AJ1A 4FN4A 5ICSA 1ZRSA 3AT1A 4KE7A 4A8JA 3F9CA 2OILA 3GZNA 3FAKA 1OKKD 3AWDA 1Y7PA 1W4AA 2IC5A 1I13A 1XZCA 4AKTA 1DQRA 1RE1A 1A0OA 4Q1DA 5AM4A 3MTAA 4LWQA 5BW4A 4HB2A 4ID3A 2XYQA 5J2TA 2FQWA 2W6ZA 3VAAA 5H9WA 5EQTA 1HM5A 2VJBA 2CSXA 1S2GA 3QNWA 3L6OO 3K6SB 3O2NA 3D59A 3OJLA 2PSFA 1BW9A 1K7EB 4UNNA 5ALUA 2BFAA 1XWFA 2H92A 4QFBA 1UEXC 2WT4A 8ATCA 4ALIA 4R3DA 2VWHA 2HK9A 3TCNA 2ZTCA 1DZ3A 1JHXA 3GLRA 2OOBA 4MGYR 5A7HA 2EKKA 5EMJA 3ENZA 5U4XA 3D3EA 1SCBA 4NDAA 3HCEA 4CQLA 4BQEA 4BY9E 3S2EA 4IINA 4AY2A 2FXIA 4TN5A 3KSJA 2XQFA 4C2UA 3DPIA 3HUFA 4A1OA 3WLFA 5IT5A 3HACA 3DOAA 3HWWA 3FYUA 1PLJA 3AEQB 1YR2A 2CCGA 1MA0A 1Z8HA 3SIWA 1NN3A 1QCZA 1SG0A 2R8ZA 3RBVA 2NYAA 4E11A 3FDIA 5T6MA 1SXPA 3GUVA 4ZJZA 2WJHA 4YRGA 2QROA 1Z4PX 4KLZA 4BU0A 2G04A 2DUMA 4D92A 2Z3ZA 3OQ1A 3FJYA 4IMRA 1UJBA 5C8YF 5BSKA 2YWJA 4NVRA 2IEDA 1IXYA 3NNSA 1UMDA 2O8EA 1NQVA 2DAIA 2XRYA 4JI8B 1U3CA 4QFCA 3VVLA 2DRIA 1GQ2A 3ANTA 1IK6A 3M5WA 2R8EA 4XVCA 3KQOA 4P33A 1BEUB 3OZTA 3H0KA 1DE0A 4I4NA 1FS5A 2GK4A 1WABA 3CLSC 1ARZA 4UD6A 3U7IA 3VZRA 3BERA 4FYJA 3G1UA 3HGIA 1M0TA 4Y1FA 2WSBA 1W85B 2QL5A 4MDEA 2HA2A 2MR5A 5JSHA 5HEKA 4NOJA 1FBNA 1WBDA 5EWJB 4FLEA 4GKVA 2CVFA 4N49A 1H5NA 3UAXA 2HK8A 1NL3A 1NJ8A 4GLOA 2FMIA 2QN8A 2FPWA 5FLXS 1II0A 2JCYA 5EIHA 2VH1A 1CR2A 2AX3A 4JI0M 4PONA 5COBA 4HXFB 1FPMA 1VKHA 5GKNA 1AZLA 4AP6A 4JGGA 1H69A 2YXEA 1S6YA 4H3SA 2EERA 1UFOA 3MOIA 5KNCH 1N6HA 3ESXA 4PZPA 1YMVA 4DA4A 2IOQA 1QONA 2VNIA 2Z2KA 3G17A 1R18A 3RD5A 3V32A 1GNQA 2QTLA 4JAVC 4OHYA 3GLFE 4CQMA 2AL7A 3BRQA 3RIHA 4F06A 3SDZA 3P0EA 1GJTA 2EBWA 4KQMA 1FPQA 3NDJA 3SQMA 3R7SA 1TGUA 1W52X 4TMYA 4AW4A 5EIOA 4TT3A 2JJ8A 1XI2A 4KIUA 2IUFA 1V3VA 1Z4IA 1I7PA 5MGNA 1SUSA 2EZUA 3U3JA 4F4UA 5JZBA 3A2KA 5HFAA 5B1IA 2GZMA 1Y4AE 4H3HB 2BGUA 4Y2VA 2HRZA 4RK6A 1JU9A 4ENUA 1ZL0A 3NBXX 3W5JA 4HWRA 1TQ4A 3WMXA 2RIRA 3RSLA 4WXEA 5FR1A 1Q0ZA 2QXTA 1NNEA 1D2MA 4RGQA 3IE2A 4MO2A 2PBFA 1FP2A 5IC6A 3WRXC 5SZHB 4FHCA 5LZ8A 3PYMA 3CTMA 2ODNA 2ZAIA 4NENA 2J7OA 5H68A 3L0CA 2J30A 3MTIA 4B2YA 3LZ6A 2DAGA 1OYWA 2LIVA 1M73E 5IG2A 3B8HA 5T4EA 1QIDA 5KNBD 5I7AA 4UVHA 1KJYA 4FWBA 5H7XA 3SJAA 2XE4A 5B7PA 3OZVA 2CP8A 5K8LA 3OG9A 2ZWPA 4KO2S 1WETA 2PUJA 2BZGA 3G0BA 2AQ8A 3JQRA 1SD1A 5CMLA 1ADBA 3I39X 1TI7A 4BHTA 2AK2A 2C0CA 4DV3B 2EYQA 3RRYA 3QBEA 4YH1A 4LJ4A 1SZJG 4L0CA 1Z16A 5ALOA 4LKRA 1XIVA 4U3JA 1L0BA 1U7OA 4RJLA 4EHFA 2NU8B 1R4AA 5G4LA 3EXG2 1UKCA 3ZD6A 2C83A 2ZUCA 4YFVA 1YS2X 5H3CA 1JZTA 3LU1A 1P9RA 1TVKA 5AW0A 3HJHA 4B45A 3WYEA 3NASA 3ZU6A 2ZJ2A 4P9NA 1CZRA 8AT1A 2I4RA 2JFOA 2OENG 3DC7A 1NT2A 1D0KA 1Q44A 2HQ1A 3VKGA 1OWOA 1UDAA 3O9ZA 1G3IA 4NY1A 1PVVA 1UK9A 3KLMX 4FOTA 5C3UA 2G82A 3D5TA 2O8FA 3ZE0B 1GFWA 3WISA 2P11A 4NNJA 2AOWA 2OR3A 3QLUA 3CTPA 4DMUB 4IMJB 1G5RA 1CRQA 4N4AA 1WB6A 2ZVPX 1ZCAA 3DZFA 1E7YA 3BORA 1Z34A 1BYIA 4H18A 2I6SA 3ZHXA 5EI5A 2R8RA 2GARA 3M3PA 2Z4SA 2DH6A 1TM7E 3OUZA 1B2LA 5IJ9A 1RQPA 4RDCA 3RPEA 2FMTA 1G3QA 3QVGB 3PVCA 3PNBA 3CGWA 4MUMA 4C76A 5LDHA 5B5SA 2XV1A 3DE2X 2A9PA 5AW3A 4KQ2A 1YOVA 1PE0A 2PT6A 4AF6A 3OLWA 1AQJA 3ICCA 1QZZA 2H48A 5BV0A 3JWGA 5PNTA 4QPDA 1WTCA 4O0MA 2P6PA 4OREX 4MV6A 4B4UA 4ZEOA 4NZNA 1ISHA 4BMVA 4EZBA 4W9MC 1L7MA 3DOHA 3WBJA 3N1UA 3FE2A 5JVDA 2LGJA 2ACEA 3DLCA 2X6TA 4U7GA 3K35A 4QTYA 4G1BA 4TL6A 3MMPA 1U8FO 3QVJA 5C18A 1QO9A 1GRNA 5T4HA 3RNLA 2ZJOA 3ZY4A 3E7WA 1J5EM 1BXGB 5E4FA 4MQMA 5TS3A 4YP1A 3SR3A 2X4AA 4A10A 2IZ0A 4RD4A 4W5OA 4LOKA 4YEDA 2AW3A 3WSTA 4QHSA 4K5QA 2VCHA 1OGJA 3H42B 2FDXA 4F3YA 2ZB2A 2GYYA 5HS6A 4P17A 3B1KA 5EIFA 1TD9A 4RQTA 5IWCA 4IOJA 1XCOA 3RYIA 1FTNA 5IFLA 4EW3A 1RXVA 1JG4A 5DN6A 4GH5A 1RBYA 1SQ0A 1SUPA 5CDGA 1A9SA 5AKZA 4V1CI 1B0ZA 1Y1RA 4X1KB 3BDAA 1H9BA 3LS2A 4PQEA 3UHFA 5IKEA 4DADA 3CF2A 2BCGY 3ET5A 2B7CA 3BWYA 1ZGGA 3B1XA 3H1EA 1RZRA 4OKNA 3K0CA 4IWNA 1CULC 4DZTA 2UVPA 4UVDA 1FLDA 4R84A 1K5GA 1OX4A 3ZBUA 4WE3A 5JMOA 4D56A 1CUBA 4YUAA 1NQXA 4JBYA 1OIXA 4B44A 3LRPA 2LVNC 2RHCA 4DYHA 4NU8X 3PX3A 5T8KC 2FVXA 3NBZC 1M0SA 1YZYA 1RIFA 2QTVB 2OQ4A 3KKKA 1M6WA 1IM8A 4CKCA 2HLPA 3DSRA 1V35A 2PH3A 4NL4H 3G8CA 1V3QE 3AG6A 4G5XA 2SHKA 3LQ4A 3K96A 1RWVA 1P4GA 4WADA 2QHXA 2VJMA 2OP1A 2KBEA 2YMPA 4GGPA 3S2ZA 2E4VA 3KR9A 1P0IA 2R8BA 5BR4A 3TXXA 5DGTA 1R5JA 5EL0A 2Z6UA 4DA7A 5CH5A 1JAHA 3BHIA 3B36A 5EE9A 4M1SA 1W44A 2P9FA 3DOEA 2YNMD 3NIWA 1W47A 1QU2A 4EABA 2OGTA 3W8EA 4X90A 1A95A 2XTJA 1A7AA 4J0KA 4EHAA 3GG2A 1O57A 1XN4A 1UBTS 1XZQA 1EHYA 3DKIA 4IXNA 2Q8QA 1SG9A 5A9SB 3ND5A 1SQSA 2YASA 3GLIE 4IH9A 4OQQA 2QTMA 4KJZA 4E5YA 4JNKA 3U6OA 5GINE 1RXCA 2CUNA 4L5IA 4YS6A 5IM4A 5TPZA 3R7BA 4D4HA 5FUMA 5KNLA 2IQIA 1ZD8A 1NBMD 2X4LA 1OU0A 4RJ2A 3HL0A 1VE5A 3U7JA 1KZ9A 2GXUA 3GFSA 2DWCA 2FPMA 2DFNA 4INZA 1U2QA 4R1NA 1A69A 3KU4A 4ER0A 1E9VA 1EUZA 3STXA 4XAQA 1BHSA 4OXIA 4DLKA 4O29A 3L7JA 2DNAA 3MPUA 3JAMA 3T5MA 1Q3CA 2FB9A 4C14A 3D1LA 3CA8A 1NQ5A 2R4JA 2VVTA 3K3PA 1CIPA 4UCWA 3FWKA 5HK8A 1EG2A 4X0EA 3E15A 3M6UA 3Q9NA 4ZKEA 2OT3B 1S2DA 4R68A 3HB5X 2VTBA 1RXEA 1NIPA 1UBNA 1TAGA 3ANLA 4RKEA 5DEIA 1SCAA 4AZ3A 3L7IA 2IRWA 1FP7A 5DW3A 5IJAA 4NOOB 5ESRA 3I05A 4AJHA 2PIAA 1KI6A 2IEIA 3B2NA 5DLDA 4BE4A 1RHKA 4DR7B 3AMVA 3N0RA 4K6CA 3MBIA 1YS4A 1JIKA 2EGUA 5JSZA 3VPHA 8MHTA 3ANSA 5J59A 4N5IX 2BWBA 1NQWA 3PENA 3GLHE 3RV4A 4O08A 1XC7A 5I9IA 3L2AA 3BSYA 3GWZA 2OXRA 1SIBE 4W5HA 1QPGA 4LRYA 2CB9A 4M1OA 1QGOA 3SQNA 1XZEA 2BGGA 5DI3A 4Z0TA 1EK0A 5DWVA 1M5TA 3CMCO 3AEXA 3K2EA 2E5LM 5E4JA 2RK6A 1DX4A 2JA2A 2EJUA 5CVEA 3BB4A 2PUFA 4LF8M 5AVZA 3G9QA 2C9DA 4DCNA 2OOSA 1J5XA 4EUEA 1REQB 4U9UA 3OETA 2VDKB 1U7TA 2H59A 4WKBA 1H2XA 1PJTA 1DAHA 2D7EA 4PNEA 5BORA 1QHSA 3N0TA 4XB1A 1JEYA 1RM5A 5CR9A 1NX6A 4RFSA 5BXYA 1ZMTA 4AUKA 4G5OA 1E59A 1N25A 1GUFA 1D0VA 4F11A 3S5JA 2EBUA 4I6JA 3KJQA 3LTNC 5IC4A 4OHZA 1U5AA 3HXOA 4TS4A 3C5CA 4XD2A 4Q7KA 4HZUA 4RQBA 4TYMA 1VECA 2EFCB 1QO7A 1ZLYA 5JROA 5L6LB 4JVSB 1ECCA 1UXJA 3B82A 1GABA 1T9AA 3UFXB 2O8BA 4WKCA 3TNJA 2HPHA 1ULZA 5K01A 3AYXB 4XM0A 1W94A 1UT8A 4ZHQF 4W1QA 4ENTA 1YFKA 2BFMA 4BZWA 2FSSA 1MRSA 2JAXA 3B3GA 3D4LA 4HQ6A 5I8WA 5JSYA 4PWYA 4FYHA 3E9MA 1FTYA 1NE2A 2WQ7A 3EZ2A 5KYYB 4LRTA 3I4YA 2VP9A 4W1RA 1E1QD 4NBWA 4AF8A 4UMEA 3N7TA 1G4UR 3NS7A 4LF4B 2WHXA 4U6NA 2IV3A 2BI4A 2NU6B 2A3NA 4OGKA 4J0QA 1PGOA 4EATA 2H1WA 1NWHA 2X8JB 3DMTC 1PJJA 4K28A 4CTJA 4LJLA 1LPPA 2MJ5B 4EX6A 2V45A 2WF9A 4OH1A 2YFYA 3G82C 1NI4A 3IPRA 5F64A 4ZMBA 2YDXA 5EJ6A 2CHEA 2OHGA 3JQ9A 4MW6A 2VQEB 9MHTA 2HPVA 5C1PA 2W2LD 4N47A 121PA 1RS0A 1UFVA 2Z56A 3WY9A 3EQ2A 2ZRDA 1RR6A 1A3CA 3HHPA 3BWVA 1D6SA 3JQGB 5THQA 2H9AA 5MFPA 4XQEA 4OATA 4YGYA 3L18A 2YTZA 5C9ZA 3A1SA 2DY1A 2Q28A 2BZSA 3TNLA 2IFTA 4EO7A 4QOGA 2LVQD 3GFQA 2GPWA 1K86A 5DGCA 4N6GA 4C7OB 2CNNA 3PL1A 3WL6A 1XCMA 3CVUA 2VUIB 5EXDA 2GEDA 1CUUA 1XTSA 3QJ5A 3VDXA 2W6PA 4QELA 1SUDA 3UVEA 2Y1EA 3TNFA 3AINA 3TPZA 2WU3A 4M6WB 5IM5A 4XUCA 1N5JA 1TM4E 3NTQA 2HWXA 4DLAA 1UFZA 5A9RA 1I6KA 3ELBA 4OQPA 3K05A 2YW2A 3SS9X 4D0SA 2WDZA 2BD0A 2C3MA 3KQWA 4OQLA 4GDFA 3CZ5A 4D4IA 4UQPA 2QS9A 1VPWA 4FFBB 2K6GA 4K6GA 2KE5A 3HVKA 3FMPB 4J49A 4LHWA 3KJNA 2W6JD 5EUBA 4JP5A 1NY6A 1Z5AA 2V0GA 3IMEA 2J32A 2O2DA 1L3IA 1U8UA 4WLEA 3TVTA 1RWKA 3C3XA 3KYCA 1ML3A 3GRKA 1GDDA 2HQBA 5CYFA 3R0VA 3ZCVA 1ZJ6A 4JX9A 1KS9A 3DR3A 5H3HA 3GL9A 3V8NA 1XJCA 1I5EA 4AJIA 4MWCA 3OE7D 5CB4F 1BXKA 1G42A 2XMCA 1LTQA 2NSHA 3FRIA 1GPLA 4XWAA 4ETMA 1Q39A 4CV0A 2C5HA 4RHUA 5ETJA 2O3RA 3KTAB 2AT1A 3RFXA 1RC8A 1YQDA 1XK7A 4ZOAA 4J7UA 3W1VA 1KARA 5JAUA 2KZSA 5BY2A 1P1HA 1KY4A 3FFXA 4YI3A 2X9QA 3PHIA 3TI7A 4RKUF 1R0YA 3AUTA 4OHRA 5IN4A 2ZATA 4MQEB 5JISA 1FMJA 3CEPB 5AM3A 4O02B 3WHLA 3JZMA 4U00A 4F93B 3OU7A 5BWCA 2WIFA 5JSQA 3GJSA 5DTEA 3ILSA 4XFJA 4TV9A 1Z6XA 3JR3A 4OOFA 1WMSA 5C31A 3PQ6A 2KA6B 1I36A 3U61B 3RABA 2E4AA 4HLCA 5KNDA 3CZQA 4MGEA 5CB8A 4RZIA 3COVA 2WKWA 4YV2A 5KWSA 4BFXA 3PXUA 1JS1X 4IOMA 2XPCA 5LP6C 2B4AA 3WSVA 4DQUA 1L8AA 5CRIA 1X1SA 4EL0A 4MS1A 5FCDA 2X5NA 1ENPA 4MXDA 4IHJA 4OVZB 3H8JA 4GECA 4XPZA 2PRZA 3AUFA 3KSBC 4ZAFA 2ZYRA 1FBTA 1FFDA 3MRVA 2C4MA 3LFUA 2PD3A 4ZVTA 4XEHA 1QYIA 4FYKA 1BTOA 4YUXA 1ZYUA 1WY5A 4BMNA 4TQAA 4Q7JB 4PHCA 2J3JA 1RXSA 5ALWA 3ZDQA 4TVBA 3KYIB 2LW7A 3L79A 3AR5A 4KQ9A 1CIJA 3LUJA 1D0LA 2WTAA 1NOKA 2VRWA 2A14A 4FE4A 3G8AA 3S2GA 3I4FA 5EWMA 2FK8A 3ZHQA 4YLYA 9ATCA 4NK4A 5LP6F 1BFKA 2PMBA 3THWB 4X6XA 1JT9A 1O6GA 3ODPA 4L4SA 3LWZA 4LYFA 5HPYB 1J42A 4UDNA 3U56A 3I9MA 3UG7A 5I4KA 5BSUA 4PTYA 3S8EA 2ZEJA 3L9WA 3AP1A 1FUKA 1CUEA 3EXFA 3R9WA 1Q1NA 3H5IA 2GUGA 2L18A 4DB2A 5FJJA 1WIVA 2BGMA 4NARA 3G85A 1JIXA 3ABIA 3P0FA 4FFDA 1QZEA 3BCSA 3I73A 5ALKA 3G88A 1U28A 2ZRPA 1EGHA 3AR4A 1PUXA 4GU5A 4G81A 1Q91A 1JFSA 5G2OA 3TAXA 2ZZNA 4AMGA 1E1LA 1O9GA 4CKBA 3E2PA 5TGDA 1J21A 3HZZA 2J5RA 1XLWA 2VP2A 2IEYA 4LCJA 4TKVA 1BGVA 1CQIB 4MDYA 1NXTA 5B4TA 2IWRA 3RBAA 4WPGA 1WVMA 1C7JA 1RDFA 4J1TA 1UJNA 3AVTA 1PDOA 1AOXA 5K3SA 1QKJA 1NJSA 5ITUA 5LNK6 3GDWA 2ZM6B 1L1QA 2JKYA 1DJMA 1XPUA 4G37A 2PGJA 2JBAA 1BDJA 2CUKA 4E94A 2C57A 4POOA 4W6QA 5LQCA 2GPBA 2Q6KA 4YLEA 3LA6A 1IN6A 2WFMA 4PTZA 3GZTB 4MQFA 3U6CA 4D3ZA 2R751 3PE3A 2I2CA 4HFMA 5BQ3A 5JCPA 2DHRA 3SCZA 2OV3A 4KODA 2ZM5A 2P2SA 2YMLA 3SF0A 4R1UA 4EG1A 2O0LA 1T25A 4RVSA 4AKHA 3O90A 4HNTA 3KKEA 2CD7A 2RH4A 1QZUA 5AXCA 3JWEA 2XH9A 2XA2A 3LT5A 4GZMA 4JC4A 1DPFA 2IZ5A 1J25A 4MJXA 5IW8A 2MSCB 3BIFA 5C1IA 3H3JA 3WLTA 3C3JA 2NVWA 3ISVA 3BFPA 5AOAA 4IH1A 1DEXA 1EIWA 3QWIA 4JP8A 4P4TA 4ASUA 1QUFA 3K9GA 4GSLA 4PC7A 4B71A 2VHYA 2JHGA 4EPXA 1CZNA 2XTZA 3V46A 4XIYA 1C5KA 1KO5A 4HVTA 1DSSG 3QVVA 2LKCA 4NKRA 4RVOA 1TDHA 3V7UA 3RG8A 1T4DA 3SICE 1OIPA 5CB4B 4QGAA 1TYDE 3ZQJA 1EIJA 4YRSA 2PUTA 2DY0A 3TVYA 4DS3A 3TR6A 4G84A 1BGWA 2ZPUA 3L5KA 1DJQA 3K9NA 2YXBA 1P5ZB 2PGLA 5AI5A 1KSHA 5FPTA 2TECE 1J49A 3NHLA 2VPXA 5IF9A 1MX5A 3K1JA 4O2AF 1OY1A 2UZ1B 1YS7A 2Z7JA 4ZD6A 3RI3A 4PX5A 4P81A 4HGZA 1E0SA 3K1ZA 1TMOA 4BMOB 4TVSA 1PS9A 3PX2A 1KP9A 5TSDA 1VMDA 4KSBA 2BFPA 2V5VA 2B6NA 4ZFNA 4L4ZA 2EX4A 3WBBA 4GYJA 3OKAA 1ITZA 4U5XA 3WJ2A 1IWBB 1G3MA 4GW3A 3U0BA 4KV9A 4V1CA 3U4DA 4GYWA 4J7CA 4F9TA 2X4IA 2ZSUA 3H83A 3WVNA 2FX2A 2PSSA 4PYIA 3DE6X 1Z0UA 2L69A 1MAVA 3IHPA 1B1CA 3L8CA 3RKRA 2WWYA 1UFKA 4HN4B 4ZQIA 3ZQ4A 2PFGA 1WAMA 1J2RA 5JG7A 3HY5A 4FMDF 5J4VA 1G1MA 1JDUA 5FJIA 3IXQA 2BEUA 4KR7A 1E98A 2YWHA 4F12A 1SCNE 1QAQA 1XNQM 3CX7A 3ICEA 2SKDA 3U6QA 4GOXA 5D5PA 1R4MB 4ZN6A 3W0LB 2I4NA 2XNKA 3DEFA 3ULKA 2M1XA 4GI3A 3T1TA 2IYUA 5LU9A 3QY9A 4AN1A 1LS1A 3R09A 5CT8A 4L8WB 4RJIA 4UULA 3E2MA 4ZAZA 4H7DA 1N33M 1M83A 2BTQA 4UUMA 3T1YM 3R7AA 5LP6B 3W4JA 5FBRB 3JYNA 1QQTA 1DAKA 5J5CA 4DXHA 4QU8A 5EUMA 3I64A 3PCTA 4NJEA 5A1TA 1XAGA 1N5DA 1RWOA 2R65A 3Q8GA 3OHMA 3KE8A 2PKYX 2Z5LA 4Z1MA 4OUDB 2NQ8C 1A9QA 4MQBA 1UBEA 2ZIAA 5CX1A 3NCHA 1EUDA 3KT8A 4G4QA 4WUTA 2NZXA 1OH7A 5KAPA 2C5GA 3TPFA 4HBGA 4I50A 3K8ZA 4I9UA 2J8ZA 4E33A 3RFTA 1QHEA 2B5VA 5EE0A 2PV0A 3TQCA 2JZCA 4FWDA 2VAVA 4RA6B 3OLYA 3QX9A 1NW7A 1ISPA 5JXWA 2PU7A 2Y77A 5TXGA 3M81A 2CRUA 5HXAA