3CGWA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei. northeast structural genomics consortium target mar46
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
303
structure length
303
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPPG:FO 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 78
structure length 303
sequence length 303
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3cgwA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3cgwA01
3C3EA 3CGWA 3C3DA 2P0YA
chains in the Genus database with same CATH superfamily
3G0GA 3V2GA 2QYTA 3O75A 4D4JA 2FEMA 5A4FS 4ECEA 4NMXB 5KNBD 2MDTA 2HK8A 2YS7A 2CT8A 1B0PA 4ENVA 5HX7A 4TL6A 2Y71A 4AJIA 3ROKA 3RS0A 2I71A 1SC3A 4YRPA 1R88A 4BOYA 5IJWA 2NQTA 2XUGA 3REFA 1NHGC 4FSDA 5K45A 2GN4A 5IW8A 2BUBA 3BBLA 3PKJA 1FSPA 3O8OA 4FWGA 1YZNA 3V1TC 2HO4A 3ONDA 5JE8A 4BVEA 3OD1A 1CF9A 4JA0A 1PM5A 4PLFA 4J7AA 4W9NC 1FY2A 1Q50A 1Z45A 4BP8A 1E1CB 4B4VA 5BNZA 4Q05A 1DGQA 5L4LA 4CFYA 2JFXA 5HF9A 1SBCA 2R6AA 2G3YA 3T7RA 3IQWA 5L8VA 3UQYS 2VF5X 3AEQA 2ZRMA 1JEEA 3ZE9A 1Q2UA 1XCMA 2NQ8A 5JXWA 1FFHA 2JIZA 2FMFA 4Z7QB 2QD5A 1TTHA 4DEXA 2H63A 3AEKA 3DZCA 3F6CA 1HJPA 3KYBA 1HL3A 4KGVA 4RQAA 4GI2A 4CLOA 1RI4A 2CUNA 1N5RA 4GPIB 2ACVA 2GDZA 3TGPA 1P2GA 3AP1A 5DFLA 3RE8A 2BONA 5K8IA 3DBIA 4UAJA 3AHCA 3M9WA 1T8SA 1FBTA 2FWJA 2DVMA 3QKUA 4NBSA 1W4LA 2F8SA 2KZUA 2J5BA 3VGJA 3L0IB 1N2CB 1TH3A 1A50B 5C1OA 1YRQA 1EDDA 1TZCA 1I13A 1N57A 4M9QA 3FNGA 1M2WA 2BEKA 5DBOA 3V1UA 3EN0A 4MSUA 2AFHA 1CZKA 1XMSA 4L4RA 3TZQA 1R66A 4D9NA 4B4WA 3ZI7A 4HDAA 1I4DD 1VG8A 4UEQA 4Z86A 5K0FA 5CNKA 2QTZA 1OZFA 3OVMA 3B6EA 3EBLA 2V8BA 1HOTA 4GVLA 2B35A 3RC1A 3BXGA 2VUIB 3EG5A 5ES3A 1M75A 2V7VA 4S12A 4BLVA 1OIPA 2VHVA 1Q83A 2XUZA 1CYDA 1NZJA 1AXGA 2OPFA 2B1JA 2BFDA 3L9WA 3PC3A 3OAAD 4HNTA 4I5FA 1E6UA 4B08A 5AW5A 4RZ2A 4RPIA 1ZJWA 4HLUA 2RAUA 1Z6YA 3DTVB 4MVCA 1X7DA 3QHAA 4WOCA 2PZGA 3J2PB 2VZ9A 4ZQBA 4Q7QA 4F8JA 2ZJ3A 3H1FA 4X97A 5I8WA 3GMIA 3V42A 1BAPA 4D0LB 1TJ3A 1CY1A 5TF4A 4ITQA 3KB8A 5EXTA 1OXTA 1ZN2A 1J0DA 4IGAA 5E0KB 5C8ZA 4CNQA 1T8TA 1ZJJA 2I3GA 4WXHA 1T10A 4RX1A 3QPCA 1DC7A 4MR7A 3CRW1 2CMGA 2OOSA 4B40A 4QU8A 2W2XA 4R1MA 2FRXA 3RSLA 1SK9A 2XEPA 2G8NA 1UBMS 2ZRJA 4PLTA 4JEHA 3GO8A 2D2XA 1T0PA 1R0YA 4J0KA 3RSGA 4J1NA 3S7TA 3TQTA 1AS2A 4A8JC 3QX9A 3OECA 3IUNA 4G24A 2R62A 2WF7A 2NUBA 4C4RA 1YK1A 4K28A 2NP7A 4AFNA 2ATXA 5JJBA 3RGWS 2EIXA 4E1AA 2FU5C 2WYWA 1HE3A 4FIDA 4YP6A 3FCAA 5FBRB 5AHOA 3JRNA 3I4CA 2YKGA 3LC2O 1SHJA 4QHYA 3G1TA 3AWIA 4RJTA 4PHTA 4HAZA 2DP4E 3MNFA 1W76A 4MHTA 3GAZA 2V7XA 2O8BA 2GJ9A 1ODIA 1YQEA 3EG9A 4K2AA 4R8MA 2DY0A 2VJMB 2GAIA 2OFOA 3K72B 4DIKA 1TRHA 4L4UA 3PHGA 2WHXA 3I45A 1NUSA 2DQZA 2AMLA 3KJZA 2GCOA 2P1DA 4OYLA 4ZVOA 4LQCA 1U0BB 4K9SA 1XRPA 1P39A 4YACA 4BFWA 3MAGA 3GCWA 1J8MF 3EQ6A 1UH5A 2FWPA 2ALJA 4C4PA 1DXQA 2CB9A 5ALZA 1G20E 1P3DA 2ZSJA 3OMLA 3W78A 5K8UA 4Y9SA 2WU3A 4WZBB 1JJAA 1CQXA 2N46A 2QRGA 4ZAXA 2H1FA 4Q3BA 2HRZA 5KMGA 3QPAA 4NYJQ 3AV0A 1Z0AA 2BGKA 1U8TA 3QI2A 2HGSA 4RDCA 3LQYA 4TVBA 2Y0QA 4M0CA 1W88A 1EUDB 3RG2A 3DDNA 4KN5A 4XCVA 4Q37A 1Q91A 2DHCA 5DM1A 1KAMA 4EI8A 1BU8A 1C9DB 3A04A 4DLUA 4QXOA 4YQZA 4YRLA 4NZYA 2EKBA 1NVWQ 2YWHA 4L15A 4CIDA 3ORQA 3HBNA 4DV2M 4XA8A 3ZWCA 1AQYA 2OLEA 2AN4A 2C5FA 5LQJA 3KXDA 3TCNA 4OXRA 3ZZTA 4M1WA 4A0HA 4OFZA 1SM4A 1F1JA 4J3NA 2J5KA 2B4TO 1N7HA 1YI0A 1QIHA 2I78A 3STTA 2P5TA 4DIDA 3EF3A 1K2WA 2GKGA 2PUJA 5B3JA 2J67A 1NKVA 1UK9A 4KOEC 4WKCA 4TRMA 1S8FA 5LP1A 1K75A 4QFMA 2O8CA 1ZRMA 2FGKA 4OGKA 3BIXA 4FT2A 3FNIA 1L5YA 4D9IA 1B41A 3HVKA 1L1ZA 1DIOB 1Z39A 1ONBA 2X14A 4H9GA 2FWMX 3CB2A 1B43A 2Q3CA 3HJRA 1Q95A 4QOZC 4R2IA 2WT4A 2ISSD 1Y3DE 2GJ4A 1P45A 1HM5A 4CM4A 1HT0A 5FWYB 2H2HA 4Q1BA 2NO4A 3UW3A 3M3HA 2DPHA 2UXDM 4HDQB 2P8JA 3U61A 3GUZA 2GPAA 4KR3A 2OP1A 3D6TB 3IJEB 4LTDA 4OHWA 1A7JA 5J5AA 4U2BA 3R9WA 2H4ZA 3CVJA 4HN4B 2RHCA 2H5XA 3KFXA 1QTNA 3HQ4O 5ITRA 5IBPA 1R12A 3AQIA 2AFVA 3V1NA 1OJLA 3ENVA 3ABSB 1ODLA 4NECA 5FOQA 2HA3A 1C3JA 1YQXA 3CV3A 4I9UA 2D5LA 2RH9B 4HYTA 1ZMVA 4QOSA 3GVXA 4YT4A 1FJGB 3SQLA 1N5LA 2OCAA 4Q9NA 1QIMA 2ZSAA 3FMGA 2BJVA 6PFKA 3PG5A 2PT6A 3ZWBA 2A1TR 5C31A 3DE5X 1I5RA 5JR3A 4UPEA 1GAXA 2JL1A 1WMEA 3NBFA 4GDFA 1X74A 2XD4A 1MIOA 3F3SA 1G59A 1U2ZA 3N6RA 3LX8A 3DW3X 2B1QA 2PX8A 2ZFUA 5DHUA 2IUSA 4LAFA 4HRYA 3BWMA 4KOAA 1YVPA 4UTNA 4ZQHA 1XXHA 4I14A 4IIJB 4IV8A 1SAYA 4IKEA 1AGNA 5LU8A 4YIKA 2WZJA 3TRFA 1OLSB 1UMDA 3UAVA 2WJ3A 5A3SA 5EHNA 2MMCA 4LBWA 2PG3A 2NYRA 1IBKB 2XMSA 1CNFA 1P17A 3BRWD 1V7QA 4HNSA 2H65A 5KI6A 2W93A 3O0DA 3CZMA 4WN3A 5ANRB 1SC1A 3K9QO 3K4QA 4Z4FA 2PSSA 3A7EA 3PFHA 4B3FX 2QRVB 3NAZA 4YP1A 3T3GA 1TMGE 4HX9A 4N03A 3UH1A 1W34A 1KEVA 5E6UA 1BKSB 1JSLA 3V4LA 3TAXA 2QR2A 3PFIA 1B14A 2JF0A 4IPTA 4A36A 1U3GA 4FMBB 4DMMA 3MLBA 3C4JA 2NVUB 4K0KB 1ZIXA 4KSCA 4BAGA 1TNDA 2E5LB 4Z9BA 1IZ0A 1GNVA 4CT0A 2GTHA 2V6FA 1DKNA 3THWB 2P30A 1Z5PA 2W82A 2MOKA 1RACA 4GKAA 3FDJA 3P2JA 1SY7A 2X0JA 2GSDA 3VOTA 1NQVA 3CT6A 3QLUC 3NS7A 5ITZA 2XOEA 3TB4A 3JQQA 3BL6A 2FSVA 3GUHA 1H2RS 4JQCA 4Z3OA 4COOA 2R6JA 5F9FA 2Q6VA 3R09A 3A2LA 5BOSA 1WPRA 5IC5A 1KETA 2TYSB 1AMNA 4G0QA 2FR0A 621PA 2QRHA 2WAAA 2RKOA 3OZDA 2QG4A 1KI3A 3WLIA 1QQ7A 5DI3A 2UYHA 1JH8A 3H5TA 4RQTA 2QAGA 4P4UA 3JARB 1JR3D 1GL3A 3BTOA 2KRKA 3DNFA 1RAFA 4NESA 3HR7A 4HR7A 3H19A 2QL6A 4LQDA 3ESQA 1ORYB 1UP4A 1Y1QA 1B73A 1VKOA 1VDZA 2J7OA 4W6ZA 1TCVA 2R1VB 3GLFA 3OQBA 4MKXA 1JYFA 1TUGA 3SWWA 2P9BA 4W6QA 1X1TA 1U28C 3RO7A 3RYCB 1E6LA 4E31A 2WRZA 2G07A 1SBYA 4NG5A 3IP7A 1HZZC 4TYPA 1QB8A 3VDXA 4MLCA 1ZITA 5IARA 3DCIA 1YRBA 2PX3A 5CIQA 2V0CA 1KI7A 3JWHA 3EGVA 1EDOA 2PX5A 1BHO1 1U7OA 1U0EA 3D3EA 4ZI2A 4S04A 4IH4A 3TMYA 3IT0A 3PWKA 4A6DA 2XB8A 1EFHA 2DWNA 4EFLA 1FP4A 3K35A 2XDQB 3VNUA 4DCVA 3D4LA 5EJGA 5I5EA 3R40A 3PD7A 4DCCA 2RAFA 1QQ5A 2CXSA 1PJ2A 4URYR 2B6NA 3U7JA 1GSOA 3TX6A 1I5OA 3WQRA 1BCRA 2PZ8A 1N3YA 3OLZA 4HWPA 1PS9A 1EA7A 1IRXA 5L3ZA 3WDLA 1A7UA 3S2FA 1HXHA 2CBZA 1UK7A 3WTCA 3ZCQA 1AD2A 4FEEA 1Y4ZA 4GZ3A 3FIUA 2X1LA 2CNNA 4OAQA 5TY0A 2KBFA 4LFCM 5KJ6A 4YRZA 4PVDA 4DR2M 1GPH1 1MAUA 4LDZA 4QBHA 4U9IS 3WLHA 1ESMA 2Y1FA 4IS2A 3MOGA 1X7XA 3CLTD 1QV7A 1TK2A 1M1UA 3OCJA 3RWOA 1Z12A 4M0WA 3I5MA 1OH7A 4CKWB 4P8RA 1TJ4A 2CKDA 2A67A 5E6RA 1IL0A 4WUTA 4ACBA 3KHSA 4IH9A 2A0WA 4OPMA 4YP9A 5JJKA 4YRQA 3CPSA 1V1MB 3ADBA 4PO8A 1TJNA 3ODGA 3OCXA 4LEIA 3BKXA 4UE2A 1X3SA 5CA0B 4DPKA 1X8KA 3CUUA 3ECSA 1NBMA 4O2AF 5HBRA 3T6PA 3T35A 2WWWA 3ZLUA 1RZRD 2ATIA 4EHLA 4HFMA 3ROZA 1IJKA 4H3VA 3STYA 2OM2A 4FX2A 1V7CA 1XTRA 1DAIA 3FWZA 2V98A 1BWRA 3PGXA 3J7AC 3SKYA 5CH8A 2B7BA 4TS9A 1CY6A 4DJAA 4WK6A 5GQSA 5C52B 4FLMA 3PIRA 3SYLA 3WZLA 3DOOA 3D8UA 3NIDB 4LF7B 4ER0A 1N0IA 5K3CA 3E9MA 3LVQE 1WEHA 3RHZA 4TTVA 3DBRA 3KZOA 2I6QA 3EOAI 4WI1A 4EZIA 4D8WA 1QGDA 4OQZA 3ANXA 3U44A 1FDRA 2JLRA 1ZOPA 1T8RA 3GCGA 4RESA 4F56A 4HLDA 1R0RE 2XVMA 2AT1A 1QIKA 1NYRA 2QTLA 2ZYHA 1Q1AA 4DA0A 3PL1A 1E0JA 1ZONA 3IP6A 3WQQA 2B9VA 1NR5A 1DEXA 4FM9A 4DCTA 3EXEB 2XX3A 1FDIA 3TZHA 2YYYA 3FWKA 1XNJA 1YRYE 4H0FA 4HWOA 2CJYA 4FFOA 4CMEA 1Q02A 1R6XA 2ZM6M 1DV2A 1JAIA 4NPHA 4HFNA 5FO1A 3LQ4A 2GTPA 2DZDA 2V7PA 1U0HC 2VFAA 2KHZA 3EEBA 2VJAA 1QGOA 3Q40A 1OAAA 1ZH8A 4Q4AB 5I7RA 3HADA 2R45A 3KSXA 2PH7A 3GAMA 3I64A 4Q12A 4MIOA 1J0AA 5ARCA 1JIJA 2JI7A 4LE1A 3ZKWA 2JAPA 1N8NA 1EZ4A 2X4GA 1Y1PA 3RYIA 2X8WA 2WJJA 4FYWA 4MV0A 2I22A 3LA8A 2ZRGA 3G2LA 2A30A 1GR1A 3ESYA 1Z38A 3J27B 1RAGA 2GXSA 2ZREA 3KHUA 1GG5A 3TINA 1ZNYA 4LX0A 4FWHA 1FQKA 2F3PA 1N5JA 2BDUA 2M6RA 3QVJA 1FNNA 1XPOA 3GMDA 3GJYA 1R50A 4DV4B 1HR0M 1I1HA 1VLJA 3PYLA 1MOQA 2K9DA 4RBNA 1EMDA 3OTOB 4AWAA 4I1OA 1RXIA 4G1UC 1VRVA 3JYNA 1GPUA 3TQFA 4F96A 3HKCA 2GAJA 3HZRA 3AFMA 5K8TA 2CNLA 3FB4A 3B9BA 3PEUA 2E89A 1LD3A 5BOVA 2JFPA 4HQLA 4BKPA 4MXDA 1JMVA 5KTYA 3R20A 1F20A 4KV7A 4K6HA 2AIRA 5FB3A 4MUFA 1NE2A 2MCFA 3DYBA 1D03A 1ZRSA 4QUDA 2IOFA 4WBNA 3IQHX 3QVUA 4CLEA 3K5IA 2CNWD 2V7GA 3TOSA 1C0EA 3L6RA 4RKFA 1P1HA 1E32A 1Z22A 1EGHA 2DAEA 1A9QA 1QPBA 3KSMA 2PS9A 1P19A 8ABPA 3M7GA 5CYOA 3KD3A 2XR1A 3R7LA 1T8YA 3K71B 4W63A 3HJTA 1JIUA 1NFRA 3QM1A 3OO0A 2L0XA 3A1DA 4BO9A 4HX2A 2C84A 2R68A 3A14A 4KNWA 1JSZA 2VAWA 5E6JA 4RLQA 3V8RA 1WPQA 1O5IA 3HZJA 4XD7D 1T5IA 3FE3A 3JAWB 3D8HA 1XXLA 1ZA1A 1KRWA 3GRZA 4IXMA 4F6LA 2OHOA 1T6YA 1C7JA 1ECJA 1PHPA 3IOYA 4MA5A 1LK0A 3P9QA 3HDVA 3SAVA 1QO7A 2I2BA 4GFDA 1T8PA 2ROQA 3ZV7A 4UNIA 2IXAA 3DKRA 1U0FA 3H9JA 2IUUA 2OO7A 2GOYA 3Q7QA 1NVKA 3K53A 1H22A 1K06A 2BKXA 1SXJE 4LRYA 5DI9A 5CA1F 4XQ9A 1GPBA 2RHOA 4MRMB 1PDOA 4QXQA 1SD2A 2D7CA 1Q6ZA 4BNXA 3DT9A 1PVOA 2FE4A 3QKWA 3EGXB 3IBFA 1DC3A 5GONB 1YZLA 2ZW9A 1OU4A 4L50A 2WAXA 3RVKA 5L40A 1HPLA 5L4NA 1QAQA 4WACA 1DWPA 3AFGA 2RKBA 5D2CA 3LLVA 2XNKA 2FX5A 4IZOA 1TK3A 1M3SA 2X22A 3U3XA 4MIKA 3J81k 3QMVA 2XNDD 3C3CA 3DL0A 2WF6A 3TZCA 3W9YA 2PJRA 4Q24A 5KTSA 1MQ8B 3RGPA 2LUOA 4J7CA 2CK3D 1NJ5A 3CNBA 3I4LA 2Z3XA 3WL4A 3BX1A 3RAPR 1PS8A 4HDSB 4LZAA 3ZBUA 4TUWA 1I80A 2BWEA 2VSOA 1Q39A 1F4VA 2B1IA 2ZR7A 4C3VA 2OE2A 1IJBA 2Q5FA 2OZKA 3A8TA 4YREA 2IHVA 4CCSA 2OK8A 1JKXA 1LQTA 5J4VA 1PG0A 5A9RA 2QN2A 4QEKA 1Y4AE 5BQPA 1GQFA 3DUWA 2W71A 4RTMA 2JFNA 3GEPA 1NXWA 5EVCA 4B2IA 1BRMA 1LY1A 4JHLA 2OO3A 1R0XA 2WHPA 4MJLA 4DJEC 5EXDA 3JZFA 3TBHA 3WS7A 4CT4B 3K3PA 2EP5A 1YC5A 4O1HA 3HKDA 4S3MA 4ZI7B 3LHKA 4OV6B 4M7WA 3KT0A 2QLJA 3X2SA 2O19A 2EFGA 4CCAA 2AWNA 3CF4A 3OTHA 3LFUA 5EGSA 1R0ZA 1XFDA 4JB0A 5CT4A 4BVHA 1TLLA 1XQ1A 5KSOA 5E3IA 3AYXB 1KYVA 3T99A 1XZKA 1T3ZA 4D5GA 1SUAA 3I9FA 4JJZA 1VI2A 3GRKA 4CHTB 1QQAA 3DMRA 2ZK7A 5IXSA 3SE0A 4G0NA 2R25B 3KDAA 3NBZC 4V1CB 2Q4EA 1SCJA 2BLLA 4UU8A 1AZTA 1D04A 3E7PA 1DADA 2QVCA 4TQAA 4EKYA 3L84A 3B6JA 2O7QA 3W5JA 3ZCSA 4AS2A 721PA 3JVVA 2Y8EA 4UVIA 4MYRA 1F4IA 3QYFA 3DE1X 1AUAA 3USCS 4UHDA 4I19A 3AEZA 1ULBA 3IOEA 3KXEC 5DNCA 4G4SP 3S2GA 4J07A 1J56A 3GXOA 3L3BA 5TT1A 4YAWA 2UYGA 3CLRC 4EW6A 4X9XA 4ARUA 3K0CA 3WK6A 2YRXA 1YC2A 1G8PA 1EVZA 1FUYB 3BSSA 3AUYA 3OCCA 4XVQA 3PBKA 4FHEA 1Z2AA 2LTUA 4YVFA 2WZCA 3BT7A 4FW9A 1TF2A 1VJGA 4R69A 1YMVA 4INZA 2ZCUA 2W6OA 4QTZA 2UYCA 1IBSA 1QONA 2RGNA 1Q21A 4MS4A 2CHEA 2GBIA 3I0ZA 4ME6A 3AF4A 3R6GA 1LLCA 3NHMA 2Z83A 3LK6A 4PLHA 3OPMA 4XDYA 1A1SA 1Y6JA 5EWJB 1O1YA 1AVTA 1Y6QA 1JPNA 3EXHC 3W5HA 1Q2XA 4ZGGA 5ALVA 4CLRA 1C30B 3MUNA 2GYWA 2XEDA 1LSOA 4J0HA 1XG5A 1O6FA 2JHFA 1DELA 3EF1A 1KDZA 3FCYA 5MGBA 3QJGA 1A04A 1A95A 3L79A 5CLIA 1ZIOA 1RLJA 2IP2A 2IV7A 2YXBA 2XNJA 3ER8A 4V0ME 5I9SA 4F3NA 4EMTA 1Z28A 4E4RA 3K2BA 2IYZA 3OETA 5KQRA 3Q7TA 4NAUA 3KYCA 4N5HX 4HS4A 2IEGA 4FGWA 1FC0A 4PC7A 1I36A 4BLSA 2NV6A 1R1DA 4GGPA 3A27A 1BA2A 2R0QC 4OQYA 1ZC4A 2IHBA 1CEQA 1N2IA 2VHYA 1KJWA 1P0PA 3NT2A 4WKBA 3MB8A 4Q00A 4I36A 4CM3A 3A37A 1BQEA 1CDOA 1O6BA 5AUQA 1IPEA 5AP9A 3QU5A 2AN5A 3DMFA 4RK0A 3HDYA 5E7MA 4ZANA 1V41E 1UBKS 1SVSA 5TQVA 2J85A 2PWYA 1ZRNA 1MW8X 4FMDF 5EJEA 1JL3A 4AJ4A 1HQCA 1F8XA 1YSYA 4R98A 3T3PB 2VOEA 3CLVA 1UKVY 2Q99A 5AKXA 3NCHA 1SU7A 2V4ZA 3ULKA 3A1VA 1XRJA 3F9CA 3WL5A 3I52A 1HDGO 3RT7A 3LZ6A 2YX1A 2B1GA 1RI2A 4IJQA 2V58A 3WKBA 3C2QA 3CC8A 4HSEA 2IYXA 3P9KA 4XM1A 3N2NA 4Z8XA 5GTDA 2R6HA 2HJRA 2YVKA 3NH6A 1VDLA 4R6WA 2G9UA 2OQ4A 2V96A 3OEEA 2C4WA 1NBHA 4A3SA 3G82C 3QK7A 2VPWA 5ENDA 2A86A 2LIVA 1JVNA 1WJ7A 4IJFA 2VQFB 3HJSA 4L8YA 4B3DA 4DMKA 4L0DA 4PZAA 4L78A 1SCUA 3UXEA 2QDXA 4C89A 1X70A 4BVLA 4YROA 3DB1A 4GPD1 5FORA 4PHCA 3D6NB 4FNOA 3VAZA 3CUEF 4JJ7A 3PJRA 1AKVA 3JY6A 1P29A 3BK7A 4G5GA 1YJ8A 1XEWX 1JDVA 2QM8A 2EKPA 3EHEA 5CPFA 4TTTS 4A2QA 1E7RA 3T54A 3CEAA 3K9GA 1CZLA 1WDKA 3MQ4A 3AOEA 1HKUA 1EXVA 1VEKA 2XE8A 4US1R 4Y2QA 1HFKA 3QVGA 4RC9A 5ITYA 2RDMA 2AW3A 3M0EA 4KIJA 2EXXA 3ZWMA 4WMLA 4NXMB 2ZJOA 5BNWA 5CU7A 2O3SA 1YJ5A 1M2JA 2DPLA 2RGHA 1GTL1 3GEDA 3BXEA 1DV1A 5G02A 3ZWXA 4KFUA 1SKQA 4URVR 5KKAA 2AGVA 4GXQA 3OEHA 3RIHA 2Z4RA 3MA0A 2CB0A 2ID4A 4NBUA 1PNQA 5JEDA 4I55F 2CUZA 3RFTA 4A23A 3Q8XA 2BFWA 1UBRS 3DE6X 4HXYA 2XODA 2UXCB 1IN4A 5I45A 1Z59A 3GDOA 2QYOA 4WNCA 4AS1A 1A2KC 1UXJA 3TLGA 1TD1A 3UYLA 5LU9A 2H4YA 4EF6A 3TGWA 2GZMA 2X49A 4NDAA 5EE9A 4ROTA 4BU1A 4XYBA 3H2HA 4R2KA 1G42A 3BE4A 1GQSA 2NWQA 3OKAA 1E4VA 3QU7A 2XA2A 4XASA 2JFGA 2GFHA 3CEJA 5JDCC 5AUNB 4GZ5A 4R8KA 2ZRKA 4YCJA 2EDCA 5DHPA 4DUGD 4TMTA 4WH0A 4PSCA 1ZOSA 3MQ2A 1SXHA 1FFAA 3IRUA 3QVOA 3FD8A 4MVJP 4FWDA 2ASEA 4MGZE 5IVHA 3C6MA 1F0PA 1YBHA 1UJBA 4D4KA 4ZQGA 2ZRLA 2R96A 1H1LB 2FSHA 3EZGA 3OQVA 3QAUA 1YF3A 1YAHA 5AM4A 3E9SA 3MWGA 2JCGA 2JY6B 3SAUA 1O08A 2WJHA 5H9WA 3GT0A 2GHTA 1LTMA 2AE1A 2R6CA 1KKMA 4QUIA 1E9EA 4HAWA 4N0QA 3BAFA 1S0UA 3QU4A 1OSNA 4X90A 3DMYA 5IBCA 4TYWA 1SVLA 3BXFA 1LPNA 4ALNA 4BXOB 5C8YA 3PKZA 2PMWB 5AK6A 3D5QA 3W6OA 4M87A 3DPIA 3R7WB 2ADFA 3KB6A 2FGJA 3HWRA 3U6DA 1AS3A 3R0VA 2PL9A 2M5ZA 2H4WA 1V96A 2P9JA 2BFCA 3KOZE 3A58B 5IXYA 4MVJG 3QPWA 4HWTA 1AE1A 1AUPA 1P9WA 4FHGA 3A26A 1T6OA 3EDCA 2NU9A 2C4MA 3GJ5A 3D2CA 4OYYA 4FFMA 1KPGA 4UVDA 4NEHB 3ZBTA 3S0JA 1W6UA 3TUJC 1Y3CE 3VMFA 3O8CA 4PLPA 2DPXA 3MFQA 2I0FA 1LKZA 1R0WA 3AO0B 4P92A 2J3QA 2E4ZA 1WD5A 1A5SB 3ZC3A 3IR7A 4N5LA 4X84A 4RF1A 4FOLA 3SY8A 2AEEA 4XRRA 1T1GA 4NR0A 2E0IA 5H37D 4IHJB 3TEMA 1UFQA 1U2TA 3WLTA 4E94A 3QUTA 1X7WA 5ECGC 4OQFA 1KO1A 2JKVA 5C5IA 4UCWA 3S55A 1ECBA 1G4AE 1F6BA 5E6SB 4U7GA 3KWLA 5TSDA 1TM7E 2VCHA 1NF2A 1H94A 3L4BC 1TM2A 3KWJA 2R3SA 1IEWA 3KOUA 3K8YA 5JYEA 1MIHA 2VEOA 4RACA 5CLGA 4B5LA 4Q47A 4X93A 2Y05A 1GCOA 3C98A 1I3KA 4H7FA 2V3CC 1THMA 4HGZA 5F77A 4C08A 5J2TA 4LZWA 5EIFA 3A0UA 2PQ0A 1H3NA 4J0CA 2PM8A 3AVPA 3VHRA 4RMIA 4LDAA 3DV0B 1XF9A 4Y2SA 3DOAA 8ADHA 2DFLA 2HJHA 4U1RA 3RJTA 3QGMA 4O4IA 4IS3A 5DLYA 3IUSA 2W7TA 1ICEA 2QRKA 1RXCA 3B5JA 4IHKA 1VE5A 2B0JA 5A5DA 4DM7A 1WUIS 4JQYA 3MXOA 4XWOA 2CLKB 5JWRA 3GXBA 1P7VA 5AM3A 3DWFA 2JGDA 2L4EA 1VL5A 2ENUA 3ILVA 1IY8A 4X8OA 3EMBA 4EJSB 4CT5A 1OFTA 3C41J 3Q15C 2XMCA 2FWBA 1KAHA 3UMVA 4KQMA 2ZE6A 4RE5A 1LBQA 1M1YB 1QYXA 3L82B 1IEQA 5LMZA 5FL7D 1L5QA 1B0ZA 2YN2A 3UT5A 3IO3A 1ZESA 2W2MA 3SIRA 4ZYVA 3MLAA 2R4EA 6REQA 1NPYA 5JVDB 1FS6A 1PJLA 2BLNA 2PCJA 1Q1EA 4E5VA 3PHCA 2AC2A 4JLPA 1T8UA 4UNNA 1X86B 4UVGA 3CF2A 1X9HA 4RKWA 2BEVA 4IF6A 1NDUA 3PQEA 3QKTA 1IXYA 3WYEA 5DWVA 1GQYA 5FQOA 3LFTA 1VGVA 3KC2A 5GY7A 3N39C 2VK1A 5L7WA 1GXSB 4EMUA 5U9CA 4KPFC 4LF5M 5JSZB 3ORSA 5AK0A 2OPBA 2G09A 2EC5A 3LQFA 4X92A 4KWCA 4KZKA 9ABPA 3W3AD 5C8DA 4HGNA 4YWHA 1QOZA 2R751 2X3YA 2I4TA 1RQ7A 3W5UA 4RELA 1THZA 2E48A 2MR6A 2PBZA 3EZYA 3GV0A 3G9ZA 3DAPA 3VKVA 5ELXA 4L4ZA 1KJYA 2WHRA 3JV7A 1F8FA 4I6JA 2I3ZA 1SOAA 2VF7A 1Z15A 1ML4A 1XEWY 3MK31 1XRMA 3OIYA 1ATZA 4JT9A 2AX3A 4E21A 3OU6A 4TT3A 3FFTA 4JYAM 1EM8A 2E82A 1HYHA 4HCJA 3PF8A 3NAMA 4HQ0A 3EDMA 3GUYA 2CYAA 2JCBA 2YBDA 3EUFA 1YCHA 5AJTA 4M4SA 1C7ZA 1RWMA 1YJAA 3BMOA 2B8WA 5BQFA 4UOZA 4BJ6A 1SJ9A 1DVRA 4N6NA 3G8YA 2G1AA 4N3NA 3GR6A 5LDHA 2L19A 3M9XA 4OLFA 1BH6A 1P4HA 4R8SA 4LQ4A 3H9GA 3PYXA 4AJOA 4MARA 3QWIA 4XYGA 3ESAA 4M36A 3TSWA 2B98A 4I4CA 4QFBA 1U8ZA 4YS6A 2P6MA 2R4TA 5FPQA 4EX7A 3ILSA 2CUTA 2H92A 3OHMA 3MWJA 4RK4A 1E7YA 2F5OA 3KZKA 3IEIA 5BORA 1Z2DA 3S1LA 2I80A 2JKYA 1N6PA 4BRSA 5KNBH 2DWPA 4LBVA 1U8YA 4JDUA 3VVLA 3CVUA 1WBBA 4X66M 1RYBA 3GEEA 4KWTA 3LGXA 4OBBA 1I5EA 3OT4A 5C5EA 2ZJFA 1XZHA 3FPBA 1D1QA 1GRNA 4BMNA 5CGZA 5F1KA 2NQ2C 4BNWA 4B81A 1UJNA 3W9SA 4CPDA 3EQ2A 4C06A 3VPDA 5C1PA 1NQXA 2DSNA 5AHKA 3UAZA 1E2QA 3HI6A 3AHGA 1MQAA 5D6OA 2IZ1A 4DQ0A 5MN4A 5A1JA 3WL3A 2YV5A 3FGPA 2IZ7A 2IYQA 4GD3Q 3SCZA 5YASA 3KE8A 1X7HA 3W3AH 1U0RA 3CUSA 4YCLA 4G0UA 3GC6A 3UV3A 1FE8A 4FDMA 3F4KA 3N07A 4DIBA 2OAQ1 1SG9A 2C99A 4QXAA 4MS3B 1VOTA 3LUDA 4JDPA 2VCYA 2HSEA 5EQDA 3VTKA 4PWZA 3H5WA 5ALWA 5ES4B 3D3WB 3R6TA 2WWGA 1ZJ4A 3N9IA 4G8BA 1SKBA 4REQB 3UB4A 1HNXM 1SA0A 5WRFA 3O47A 2R6GA 4MLDA 4EHIA 3K31A 1F8UA 1ND6A 4KT0F 1TVKB 3B3QA 1GA4A 1Z3CA 4C9BA 1RMYA 2IE8A 5B7GA 1IB0A 3I1JA 3ZZUA 1EFPB 1U7XA 4NTZA 1EUCA 3I8SA 2ODWA 3O91A 3EEFA 3F6SA 5L3RA 5JRDS 3BORA 4Y7DA 5EL0A 2PX2A 1OH6A 2E7ZA 1FRFS 1LPAB 2QVXX 3RREA 1K89A 1BXGB 3KTFA 3NHSA 1C9NA 5LP6B 1RLUA 1N3LA 5DHSA 3SJAA 4QFDA 2NN3C 5IPFA 1TKCA 4G1FA 3CEPB 4IINA 1ND5A 1U8CB 3IAUA 1QFSA 2EJUA 1OY1A 4WFKA 1ADJA 3QBJA 3QOFA 3V4SA 1CJBA 3OCZA 3LI2A 3I34X 3NEJA 3EVEA 3KKPA 1DTEA 2FUG1 4R3NA 3PXUA 4IGIA 4DYDA 2Y93A 1JH9A 1BMTA 2BEWB 1MPXA 1L2DA 1O5TA 4DBZA 3ELUA 3EIOA 3GFFA 2JARA 3DHVA 3FKJA 1Z0SA 2DFKB 2VHWA 5HIAA 4NDNE 5IHXA 1L1RA 2VPQA 2CV2A 1YGPA 1DL5A 3PHIA 2X4DA 3T06B 3BXPA 1XZAA 1UM8A 3JZAA 4CIWA 4IJKA 4ND5A 1FDTA 2DEUA 5KB3A 4N3AA 4B45A 3VR4D 5K0SA 3HKEA 2BPOA 3CZ9A 5GZ6A 3C9PA 2WTEA 4D97A 3B3AA 1Z37A 1A69A 4PDGA 2WT8A 2JGFA 4HATA 2X2FA 4AS3A 2CE2X 4X3OA 3JX9A 5BWMA 3H2BA 2C8KA 3Q98A 3OQPA 1Z7GA 5AHRA 1NBIA 3PHBE 3HYNA 4RABA 3PXCX 5SY4A 2W6ID 4JEMA 3W2HA 1HEYA 4I5EA 3HB9A 5EINA 1FCJA 4YHBA 3D3JA 4JROA 2C7PA 2R97A 3X0DA 2A9PA 3RD5A 3MMSA 4EKEA 2C2GA 5F1OA 2K0BX 3WGJA 2QCUA 4M8KA 2G28A 1E7QA 4CUKA 4Z0NA 1DAOA 5PGMA 2ZKLA 3ABIA 3OKPA 1XN4A 2G70A 1NM5A 3WVNA 5A9SA 4WTOA 4BV2A 4CJ6A 3CXUA 5HKAA 4CL8A 2L09A 3M5PA 1QX3A 3C3PA 1GM5A 3OSZA 1U6JA 5LA6B 1QTRA 4YHHB 4ESOA 1N6HA 1JEQA 1E3QA 3U6CA 3QMWA 3ID6C 5IYZB 1BVYF 4ZALA 1VKHA 1EZZA 1GPYA 1RJEA 2WINI 3V8MA 2J5XA 3UJ3X 2GETA 3BHNA 2KLBA 4ZCTA 2N42A 4E1VA 4KFSA 2GJSA 1UADA 1XVIA 1K98A 2AS0A 4QVKA 2OBMA 3MWYW 2WUDA 3BXHA 1CR6A 4MUIA 4TLMB 3OLVA 1GVHA 1J2TA 1N1EA 4KLRA 2YWFA 2DWLA 2QTRA 3LC7O 3OTQA 1F5SA 3F5FA 1IDOA 5FPKA 4HUQA 3R2JA 3TSOA 1U1GA 5KQLA 3OPXA 3RASA 3MG9A 1TEHA 1LSSA 4ZA2A 3PT5A 2PWPA 3INNA 1CS0B 3F98A 1EIZA 4Q3EA 4H1TA 3JD2A 3AR5A 4NYJR 4ZRNA 3QFRA 4MUHA 1CUVA 4F04A 6ABPA 4ZYTA 4HN2A 3TDNA 3U4DA 2QU7A 1S2GA 5FI0B 4AM8A 3C16C 1RE0A 1W4BA 5L45A 3GBVA 1PWYE 5ALUA 1D2GA 4DCJA 4Y9DA 2W0MA 3VR4H 1W94A 4A7PA 3RVDA 4DAEA 2JCSA 2HBRA 4DKXA 3PEYA 3KLPX 1U4NA 4N3BA 2J59A 1USVA 2G1KA 2OBFA 1WLYA 2C5EA 3T5DA 3BQ9A 2PGDA 4H31A 4RMJA 1IXZA 4EG1A 4RF2A 5IKMA 3C74A 1XP5A 1H2ZA 5A6SB 2OYSA 5BYJA 5JYCA 3UWMA 3AF1A 3KQOA 2OXEA 2ZB4A 3V00A 1XZNA 4IKPA 2ODBA 1G2QA 2JIDA 4GXNA 2DXIA 2OILA 1B2RA 4P0QB 3CZRA 2HRDA 4BO0A 3PE6A 1F38A 1KH3A 5KYGA 2PS3A 2FOLA 4RS3A 3EUWA 4Q1VA 4ZVSA 1WV0A 4YFVA 1X6VA 5MDHA 2FSGA 3SYMA 3ADCA 1E3SA 3JYLA 4C0AC 4XYEA 3WYCA 3CZQA 2QTAA 3A3PA 3FN4A 1UM9A 2NIPA 2NO5A 2WJ4A 1JU9A 3B36A 1E79D 4IO0A 1TO2E 1SVKA 1YFKA 3PFKA 4EHAA 3L7MA 1FDVA 3KXLA 3CMCO 1L1EA 3LGAA 1A82A 2JP7A 5E8JA 1MX9A 2R8XA 4CMCA 2VQEM 1S2NA 3B20A 5FUMA 1E94E 2VQ6A 5GINE 5FBHA 1K5PA 4OH1A 5DPMA 1Y89A 3DE0X 4MJ7A 3AU8A 2C7VA 1U04A 3NBIA 4FFWA 5HF5A 3EIFA 4WAUA 1JDUA 2KM1A 3X1XA 4OXKA 2B2CA 1RXUA 4IAOA 2XHEA 2G9QA 3RTCA 4QQ8A 2VPTA 2HYDA 4UBLA 3P45A 5CFNA 2VAVA 4HZUB 2J7PA 2YIMA 1Y81A 1SHLA 4YQYA 4II3A 4QODA 4ILEA 1GQRA 2VSNA 3UK1A 4JBYA 3TG8A 1H66A 3CTMA 3N8HA 2O8DA 1SVWA 3EXEA 3V2IA 5IM4A 4LHYA 3GPCA 4X8LA 5DGCA 3L7LA 4HL4A 4O02B 3E35A 5AJXA 3FUWA 2PMKA 2GF2A 4HUTA 4H1VA 4YYEA 1EGQA 5EWLA 4DWWA 4RMHA 2OG2A 2WSLA 3RW9A 3EPLA 1JGTA 4GOJA 2PAAA 2XPCA 1LBIA 3TSZA 3MGKA 1VGQA 1WPXA 2O0LA 1IUNA 2FFHA 5CDYA 3LUCA 3KSBC 4PLYA 3SYTA 2EIHA 3RSZA 2G06A 4YUAA 3QYPA 4TRJA 4AKHA 2I3DA 3CH7A 3H18A 2QSZA 4ML3A 3S4YA 3V32A 2ZS7A 3UB2A 2QF7A 1ESEA 3M4NA 3N3BC 5BNFA 5FEMA 5C46F 4PYMA 1FZTA 2LXNA 2QXUA 3MCVA 4D42A 3MFYA 4HNQA 1G21B 2DZOB 1OVGA 3EFBA 3RJ5A 1WZCA 3II6X 3SC2A 2FPPA 2PEZA 3SPXA 1ONSA 1SHUX 1EX7A 1XHEA 1SOWA 1DBIA 3QTTA 3E5RA 4Y28F 1TW3A 2JH9A 4CL2A 2GLUA 1MXHA 1GZVA 3E3NA 3BK2A 5DN9A 1PKXA 3DSRA 2Z5VA 1E0KA 2Y1CA 2J3DA 3DDHA 2Y1DA 4NSOB 3PQDA 3VPCA 3VLFB 1D2MA 4ZVKA 5CDFE 1QIEA 1SWVA 1S2OA 4ZGBA 5ALLA 3DYIA 5FL3A 1ZP6A 1WZNA 2EATA 1TLFA 3SS7X 2XUPA 1QIFA 4OBWA 2XXAA 2II6A 3TKAA 3VA7A 2WKRA 3VDMA 2E37A 2H3HA 5SY6A 1JIXA 4Z4IA 1CUFA 2P3OA 1J7KA 1DZIA 1PEKE 3T3OA 3WGUA 3K2EA 5FPHA 2ZZNA 2HUPA 4QXPA 2IDMA 4C7JA 3WLQA 3Q0EA 3TWOA 3IOCA 4C76A 1CUCA 3KJFA 1A96A 1Z35A 1MB2A 4AQYM 4ZTZB 3TR5A 3D4OA 4NYMR 2EKQA 3KO8A 2CF6A 2GZAA 3BERA 3OF5A 2FSIA 2IVFA 5AVKA 2GAAA 1M2NA 1P0FA 5K3SA 3L7NA 3OCYA 1JFVA 4C4XA 3GGCA 2PRYA 3NYRA 1C9KA 1YUMA 2X9LA 3JAKA 2AHMA 1PT5A 3MELA 2VTDA 2AUTA 3IUPA 1JTVA 4U7DA 4FR0A 2YWJA 3JTMA 2L7HA 3TRKA 1WDTA 3C7AA 5JY1A 1RZ3A 3COSA 1NU6A 4JP8A 1I3LA 4NMLA 4FKBA 4TWBA 2DHRA 1T5SA 3KXKA 4ARZA 1N2OA 1E64A 3KSZO 3NEAA 4UE6A 4C4AA 2QRZA 2PTHA 4YJFB 5TPWA 4WA8A 4PQFA 5EMHA 5K0JA 1N9GA 3VSBA 5TQ0B 5CCXA 1PFUA 1J5EM 3CZ4A 5JXIA 2HLDA 3IB3A 1H6DA 1XTIA 2B5VA 2Q2WA 1OWMA 3R4CA 2DWMA 2QRMA 4YNBA 1PJQA 1GA6A 5ICMA 1I7NA 1J70A 3T0GA 5CDSA 1YTUA 1FUEA 3DZIA 2WM3A 4W7SA 4BQIA 3AJAA 4BN4A 2QTFA 3DF7A 3ICEA 3K9WA 1PDWA 1U2GC 5HKKD 2KRUA 3PUJA 1QVWA 4HV4A 4RXTA 2D74A 4UTPA 3DMDA 2B82A 4UXIA 3NX4A 2QZ4A 2N47A 3LK7A 2FUCA 3L5OA 3S1AA 1KDOA 5FBVB 6CHYA 2VTKA 4D99A 4CG2A 4U2GA 4MWEA 2IV2X 2DZNB 5KBYA 2PJZA 3HEMA 4L9WA 2JAHA 4I4TB 5F64A 3GFOA 2WTBA 2J46A 2QI9C 4L5AA 4RCZA 4W5OA 4U8HA 4D4GA 3K0EA 2OXRA 4YONB 2QZPA 3OE7A 2I5PO 3NWOA 4WJZA 4KAJA 3R7DA 1JU4A 4Y8VA 3RUPA 3U40A 4ZVMA 3WO0A 1J8FA 1KMCA 3TPZA 1A4UA 4QDUA 5A4DA 4S24A 4D9CA 3FTEA 5FSWA 1WMDA 1ZJYA 1GWNA 3L8GA 2AD5A 2QROA 3EXIA 2J41A 4D81A 2O5EA 5FDFA 2QEQA 5EKSA 1XTKA 2NVBA 1LJUA 1YS9A 1NW3A 5BSFA 2BI7A 4AKSA 4B3HA 1QQ6A 4PYRA 4NBRA 4NC9A 1V2GA 2VT6A 1QC5A 2RB4A 2FAXA 1L4FA 4MVJE 3QLJA 1NQ5A 2QN6A 3A25A 4KQCA 1H42A 3PA8A 4QUAA 2WSIA 3JQAD 3GIWA 4F72A 2V9PA 4PZZA 5KTOA 4IHAA 1HFJA 4WD3A 1Z18A 1UBHS 5GVSA 2QLMA 2CVFA 4FILA 4EA9A 2XGOA 4JGBA 1NBAA 1QHIA 5DZSA 4KMOA 2ZP1A 3QWAA 4QECA 4JI1M 4RTNA 3EEQA 4D3FA 2IS4A 1O58A 4KODA 4AZFA 1YJCA 2JVKA 2FG5A 1TU3A 3IHLA 5C5CA 3NIGB 1UWCA 3E1KA 4JELA 3N28A 4DDTA 1TAUA 2Q3BA 1QG6A 3N2GB 1HFWA 1TIPA 1AUVA 5K2MA 4J3FA 4DR3M 3LWDA 2WB2A 3LV8A 4TTPA 1MH9A 3DC7A 4PBRA 1PT6A 3PVCA 4MWDA 1QVRA 3TL3A 1P0QA 3LNCA 4GPAA 4OQLA 2GGSA 4CJXA 4ZRMA 4KLZA 3GJ6A 4JI5B 3JS5A 4X6XA 1Q0PA 1OIWA 2IPLA 5C18A 2VCEA 5HCNA 5JASA 2FUG6 1E6CA 1V9CA 1E1QA 5AKKA 4Z8YA 3OFNA 3CUTA 2J30A 1JLRA 1ZN7A 3KCQA 4I4NA 4R8LA 2A14A 3DP9A 1RBYA 2XRZA 1HDYA 1OBVA 4WINA 4EB6B 3HCCA 4PQEA 3U3MA 3BA1A 1KOFA 5LQAA 2V9ZA 3ESZA 2IS2A 3F6BX 2NO7A 1FA9A 2X0KA 4FCCA 3GJ4A 2FQWA 4TV9B 1QG0A 3HV2A 4DTCA 4IQ8A 4RF3A 3WKAA 3Q85A 3K20A 1I2MA 3QG1A 4D82A 4L9RA 4F5EA 4OGLA 4M37A 3HJHA 4YI5A 1VP9A 3HGMA 2DB3A 4RV5A 3SOZA 5HEKA 3K8ZA 1T4GA 1G8HA 2G9VA 4J7UA 3A06A 1JR4A 2L82A 3OFVA 4XM2A 3NTXA 4DRZA 3L18A 1Y5RA 4RANA 4LVNA 3WYDA 1Z8NA 3M6VA 5EIWA 3G0BA 3H05A 4EK9A 4OMFG 4Z9YA 1IBLM 2OAP1 1LPPA 2W42A 2Y1EA 4ARCA 4MULA 4Q7JB 2FEAA 1PQUA 1RADA 1VCMA 1UL1X 3T9BA 2A9QA 1M7BA 1VHDA 4PX5A 2H48A 3A1WA 1ZMRA 1TD9A 3UK7A 3DOHA 3GLGB 5H7XA 3I2JA 1E3WB 3U7IA 1Z8FA 3ZYZA 2DT5A 1E20A 1IOLA 3M2TA 3NHZA 4MKFA 2Y1XA 3PX7A 4LUCA 1TM4E 3A31A 1HOXA 3IPRA 3ROTA 3N0TA 5KX5B 1X9IA 4MIYA 2P3QA 1L6RA 4AXXA 5AMXA 5CXUA 2DKOA 5KSWB 4LECA 1L4HA 1K7SN 3BDIA 4DWVA 4IV0A 7MHTA 3W5CA 4WNAA 2VUHB 5CUQA 2KNZA 5TQJA 2VWPA 1H4TA 3H9UA 3W5AA 5KQPA 2HT1A 2VPYA 4L5IA 1K63A 1E2FA 3HFSA 3D0RA 4L7QA 3C7TA 3R9XA 1PR6A 1QGYA 2V7TA 1WD7A 1ULTA 4NOKA 1Z16A 2ZI6A 2JI6A 4XLTA 5DGXA 3ROQA 3ELDA 5K2OA 2F64A 1K3TA 3T7JA 2ECOA 2Z95A 1RWKA 4ZDJA 1UKYA 5C8VA 1E5VA 2ZE8A 5EOVA 3VQTA 2GSWA 2Z2KA 3U4MA 1QANA 1D9XA 3A98B 4I1SA 3RVRA 2QYHA 3WHKA 4OKSA 1EXNA 1SCNE 1PWEA 2IYNA 1JHZA 4TV8F 2QTVA 4GI1A 3G1WA 3HDGA 2VDWA 4TTJA 3A4VA 4TXNA 2FZ5A 4PTZA 3QFCA 2ZYGA 2YY5A 4YWJA 1EVYA 2C96A 2X6QA 4RM3A 4M6WB 3F73A 3CW2A 4PC2A 3QXSA 5FIUA 4HUJA 4CIBA 1I1QB 3C6QA 1CIPA 3DWIA 3H8VA 2HDHA 1BWPA 2FMXA 2QVYX 1LTKA 1BGXT 4CMHA 5JO0A 4JX9A 4HLCA 2BR4A 1W7AA 3EA0A 1M1NB 3RSSA 5U4QA 1WEKA 5I7UA 2C3MA 2XY4A 4ZHQA 3ZDCA 3JASB 1CRWG 1IG0A 4MUAA 1YO6A 4NJOA 1YH3A 3EGDA 3WGKA 2W6MA 1PIWA 4TMZA 1W8DA 2A58A 3N8DA 5FRDA 3QE0A 4L28A 3C3JA 4EABA 1KQNA 2J5RA 3ZE7A 4XVHA 4P4SA 1RWPA 3IP9A 1SUIA 3O8QA 1QE3A 5JWOA 1KVSA 5G4LA 3WMXA 1NNLA 3ICOA 4EYSA 5C34B 4EO7A 5FO0A 1Q1BA 3F6EX 1DCKA 3AR7A 5HZGA 2ZCVA 4Q34A 5BR4A 1G9SA 4D8YA 3HHYA 1LRJA 4CI0B 5K0GA 4RZIA 1H0SA 2X4LA 4GYYA 2F5NA 5FQNA 1HORA 4KGDA 1WHSB 3G5UA 5B58C 1JG3A 1CZRA 4IJUA 2UVPA 3L29A 1DIRA 3E82A 4BNKA 5JS1A 4QPPA 5DHAA 3AKDA 3W5SA 3KEGA 3SX0A 4EVQA 3G8DA 1A9RA 3OJ0A 5DCYA 5JAQA 4JQSA 2JLUA 4IMJB 4UNPA 4ZU6X 3GB9A 4J6FA 5A2GA 3EY9A 4M9RA 4XGNA 1JALA 2ZSDA 1HE2A 2JLYA 4CW7A 4M83A 2BKAA 3COVA 4OQQA 5IX8A 1PVVA 5EYPA 1Z2OX 3KSRA 3TSCA 1IUOA 3ZYCA 1ENYA 4W9MC 4INJA 2AMYA 3GK3A 2VIIA 2C5LA 3VC7A 4QO8A 5JAUA 4OB8A 2HHHM 1IAQA 3IAFA 4FN4A 2VHZA 4TUYF 1NLUA 3ED5A 3UXYA 2KEBA 4G0PA 3AF6A 1N7JA 3UB3A 1P1FA 3MRVA 5AUPB 8LDHA 3FTCA 1ZK1A 4PINA 2YWGA 4UUAA 2OK7A 6ADHA 5H4HA 4D02A 2ZSFA 5EEGA 3DEAA 2D7DA 1D0KA 1WQ3A 2YHUA 2KSQA 2DAKA 5EQJB 1S8NA 4QSHA 1K82A 3NC0C 1L7MA 7REQB 1SZCA 5CVUA 2AJCA 5EZYF 4YAEA 5JBIA 3VH2A 5C7YA 1W59A 1K0FA 2JGNA 4RDIA 5ITVA 2GEKA 2HC9A 4JI6M 1N5OX 1P62B 5IFKA 1FFGA 1BEUB 3T94A 2PT5A 2XWQA 1JDZA 1BOFA 1ISPA 5HQJA 4JP3A 3K9FC 2LBCA 2GZ2A 1LJ8A 5HE8A 3UAXA 4DUYM 1YQGA 4NFYA 3DMTA 5AW1A 1FX0A 1J9GA 1EFVB 3LXMA 1P75A 3WGVA 3D0OA 2C31A 3QXGA 3VR5D 2H9AA 2GBLA 2Z0MA 3HO6A 4DCPA 3SI7A 1BXKA 2YWEA 3OT1B 1M9NA 1ST3A 3KQPA 1M1XB 4B8ZA 1T8WA 2H2GA 1Y5MA 3VH4A 3EMDA 5TQ2A 2J33A 3L8MA 3UMYA 3CA8A 4TS3A 3BXXA 2XYVA 2NZVG 1ODJA 3H5OA 1JW9B 4RHFA 1SC9A 4HQ6A 3RHSA 4AW9A 2QX6A 1V5FA 1KZ4A 4FSXA 3ILXA 5TGTA 1G6OA 2AI3A 3PR3A 3LSYA 1LC0A 2XCLA 1W0CA 3MUEA 3RAEC 1M5UA 3CX4A 3DAGA 3I8XA 1QF6A 1VPWA 2IHTA 2I1LA 2EFEB 4KQWA 4UQLA 4FN5A 4Q82A 2COKA 1J8YF 2OCXA 3PE4A 1ZAYA 4E5PA 4ZEMA 3HYRA 2EGHA 4FW8A 4TM7A 3C8MA 5BW8A 2OZPA 1ACMA 4KFRA 4L0QA 1CUYA 4P38A 1IN7A 1KK3A 3FJYA 4LE0A 4OJKA 4EW1A 2W8BB 1FPMA 2ON6A 2F62A 4D41A 3RJMA 2ZBRA 4B3MM 3MGAA 4V3BA 1PLLA 1MB9A 1GGEA 2J7KA 2EW2A 2B83A 3KYJB 1NI3A 5HGJA 1B93A 1SKYE 5LMCA 1ST2A 2WJIA 5AKGA 2UZIR 3OZ7A 3SQOA 1OV6A 3OPNA 2PLNA 4S1TA 4AULA 2DECA 3GRYA 4K9NA 1E1CA 1IXRC 1V34A 5A7HA 3WYNA 1IVSA 3RSCA 2Q2VA 3A2MA 3A70A 3IE1A 1JRLA 4GKJB 3BD6A 1JXQA 3LDHA 4OOFA 1RKBA 1U7ZA 2PX4A 4QBTA 1NMXA 4EM6A 5DT9A 3QW4B 1J2RA 2JY7A 1Z4PX 3KPJA 4QG3A 4CU5A 3SR3A 4F2WA 1UT5A 2MINB 3I6BA 3N0XA 1R6AA 4GYKA 3VR5H 3KL4A 4XJTA 2XAAA 4B7HA 3QA3E 5FCDA 3R41A 4F5WA 4RF4A 1XUOA 3WKEA 2PCLA 1UBLS 1ZLYA 4URWR 3KL2A 2OXTA 4ETMA 1N2CA 2FKAA 4OHRA 3VZDA 1O6ZA 4HH1A 1Y63A 2EUCA 3EMVA 3HX3A 4D45A 4UTZA 2HXGA 4EG3A 2JAUA 3QY0A 4ZPJA 4GOKA 5LQNA 1AUOA 1YZHA 3V1LA 5JSKA 4MLPA 1C3XA 3UT6A 3WK9A 3UHFA 4UEWA 1TCBA 2XQJA 5LZ9A 1U1IA 3HJFA 1ZVKA 4A8TA 3VYWA 1Y42X 1CETA 3QPDA 4B44A 3LDUA 2MHCA 4V0KA 3HU1A 1F06A 4LE2A 4FFLA 1YB6A 1IZYA 2E85A 1L8LA 3L8YA 2CUKA 1DAEA 3BFPA 5M5BA 1QRSA 3G6WA 1M34B 1AIPA 1WKCA 2EKZA 1AA6A 4D0GA 4MB0A 1G5TA 3DTVA 3IIIA 2H7CA 4X7BA 2AFIE 1ZIPA 2OV6A 2M98A 4YX9A 4GOMD 1XIVA 2I62A 1HL7A 2BP7B 4MVJD 4B6FA 2PBRA 1F14A 1WU7A 2AG1A 1QDEA 3GIDA 3O2QB 1PBNA 3NVMB 3TDMA 1QHSA 4CLHA 5KINB 4OU4A 2DR3A 3V8VA 4FT4A 1N75A 1N2ZA 5A04A 1PQWA 2IH2A 3RS7A 1W36D 3UFBA 1ZN8A 1U3DA 1TYZA 1NXQA 3P2OA 3GT4A 1ITZA 1FMFA 3L4KA 1KARA 5EKXA 1Q7GA 4AJPA 3BSFA 1SQ6A 1UOPA 3HCOA 4BE7B 3GA0A 4A5OA 4O4HF 3T5BA 4Q9LA 1VZ3A 1AXEA 3NFRA 1ZPDA 4D3SA 1E5LA 4ROSA 4B47A 2QIPA 1W52X 2B2NA 2O0KA 4PAOA 1SXJD 1PFKA 1GAQA 3KFUG 2WFLB 4ZEVA 2H7XA 1DT5A 4CF5A 3FKEA 5HJ5A 3OQJA 2EF1A 1RPAA 3LIIA 3FLEA 2AZTA 3P8ZA 4BIMA 3LYUA 2QM0A 3BHJA 3NDPA 1O6GA 4BCBA 4OA5A 4M21A 1KSGA 4X00A 1N6NA 2EVWX 1RQRA 1ZD9A 3CLTC 3AEXA 3HZZA 3NDRA 5LMNB 4WLNA 1ZIYA 1BFDA 1YDMA 2V54A 2BKLA 2PFKA 3NDIA 4JYPA 5JAPA 1BE0A 3L6EA 3ZNQA 2VJMA 2OKGA 2MSKA 3GLVA 3BEOA 2ZBGA 1AQNA 3RVQA 3O8DA 5LP6A 1N34M 4A0QA 3BWBA 3FF1A 1DOHA 3KOWE 3DH0A 3EFOB 4X94A 4BN0A 2HMUA 2WHQA 1EWTA 4X64M 3JPWA 1Y7HA 3RJZA 4WHMA 3C6ZA 1WNFA 2OOKA 4E32A 4ZVRA 2QI9F 2O05A 1VFNA 2YWBA 5K9ZA 4R7GA 4YMWA 3DHNA 1KSFX 4WZBA 1RWWA 4N3CA 4QGSA 3WX0A 2PPLA 2J9RA 4TQUS 4ZQFA 5CK4A 4ETWA 4QG7A 4I9NA 4QM7A 5KQMA 5LBTA 4L27A 2R7MA 2A7XA 4R81A 1EUDA 4Q7LA 3NHWA 3HA5A 3KZXA 2J9YB 3CVXA 3A36A 3I2GA 4MVJH 5H68A 1T15A 1O6CA 1U8AA 1F0KA 3CB4A 1MC1A 2A5JA 3W6PA 1IVNA 5HM8A 3K9HA 2FQQA 4DBVO 1GT91 4IOLA 1IC6A 1XZJA 1XDUA 4A1OA 3VK7A 3DZGA 3DFFA 1O0CA 3EXG1 4Y0VA 1RWXA 4OX9M 4O2RA 1VIAA 3W5IA 4CF7A 5AVXA 5AVUA 4UHCA 2Q9AA 1XZGA 4QOIA 1MJHA 4R2MA 3TYXA 5K51A 3M4YA 2VJCA 2RHTA 4KAFA 4G9BA 3P52A 1DC8A 4DV7B 4DQVA 3KAQA 3WICA 4DR6B 2WWVD 1BW9B 1K8QA 2O54A 3TQSA 2XSZD 4PSUA 3SHWA 3VC2A 1P4RA 3RLFA 3JWJA 1GNSA 2NZXA 3KELA 2H9YA 1QYCA 3E7DA 2GQFA 4IG4A 5FWYA 2FW1A 4EHHA 3N8IA 2GESA 4YAGA 1JHUA 5DTEA 5C80A 3OICA 3UJCA 4R1PA 1W5TA 3SQNA 4HAOA 2ID8A 2EZ8A 3GHYA 4DA9A 2Z6QA 4PRYA 2Q9BA 1TA9A 2C42A 1FS4A 5B4UA 4X60A 2VRNA 1I7LA 4M1OA 1ENPA 4CCWA 1SPBS 3I76A 2HLPA 2XUHA 1G0NA 2WUVA 2QUHA 4W7HA 1W0JA 2PAFA 5E7IA 1JHVA 3H1EA 2ZJYA 1D1PA 3I62A 3C4VA 4HH4A 1ZHOA 4G5HA 4LJKA 1KBOA 3OOSA 2YMMA 4WEQA 5JNSA 1QMGA 1J23A 3HK2A 1QR2A 5DN6A 2PQMA 1XQVA 2REXB 3CZ5A 1YWGO 2ZDGA 3L6CA 2D7JA 4G1EB 5AKYA 4BX8A 1XZQA 4G8DA 2FI1A 1ZYUA 1OI7A 3W04A 3E3AA 1EVQA 1ZKMA 2XTAA 3H5IA 1P4AA 2CLSA 3C6KA 3D0QA 1ISHA 1QX4A 3GLIB 3CKMA 1QCDA 2X0IA 3AXSA 2PZFA 2WG2A 1PZGA 4KREA 1P73A 1XVLA 1JS1X 4F60A 2F48A 1GNRA 3GO4A 2IKSA 2ATCA 5FXMA 5TT0A 4E07A 3ETEA 4G41A 1WDMA 3E53A 1FU7A 4IIJA 4JLDA 3KPWA 3VVCA 2NZ8A 4JI8B 1R5LA 2C20A 1OLSA 4WDRA 4DSOA 4KE7A 1JDBB 3O9ZA 4B17A 3RUAA 2XMPA 3VK8A 3PD1A 4XQCA 2QJWA 5JCOC 3EQZA 2HDWA 3KQLA 2QRVA 4FFVA 1N6RA 3U3KA 3A28A 5LMUM 2BEJA 2PXCA 1VBMA 5DM2A 4UM5A 4PIPA 3UUFA 5BUSA 3AGPA 2P9EA 4G5YA 2NVUA 1XZLA 4TL7A 5IJAA 4KZPA 3GCZA 4KHPM 4QUBA 4WZAB 3BE5A 2FWRA 1OH5A 1ZMUA 3THWA 2WYOA 4KQ9A 4MVJI 4RVGA 3GJ7A 1OR8A 3LKZA 3L8ZA 1PJCA 5JDIC 5DCUA 3HP4A 3EQ7A 2GFQA 3H2YA 5SZHB 2FR8A 1XRQA 2C2YA 3QELB 2EWWA 3IEPA 1NMYA 4FP9A 2F9LA 5CRIA 2QGNA 2PWAA 5AW6A 3DLCA 1QUFA 3H65A 1R0KA 4L1KA 3C1OA 1A9XB 2ZVQX 1PJZA 3AG5A 1URPA 1ULSA 1MVOA 4E6PA 4DLXA 1P91A 3JARA 4BLWA 1CRQA 1MEOA 1KI6B 4XB6B 4DIFA 3SOPA 4F6CA 3E9ZA 4JYCA 3BB3A 4LYAA 2C7GA 4GPTA 5A71A 2P4UA 3FZNA 1DUVG 2O2JA 2NU7B 2BI4A 2R1VA 5AM2A 5D00A 1CJSA 4ZMSA 3IR5A 2ZS8A 3YASA 3RYCA 1TC2A 2CCGA 4DTIA 2HPHA 5BSMA 4F86A 1TIBA 1UKEA 5C7IO 3RU9A 3KQTA 4LHSA 3RKUA 3UBTA 5HSGA 1C1XB 5F3DA 3OLWA 3KJHA 2QW8A 4U02A 2FNAA 3DVRX 5SYAA 4MR8B 3I6QA 4UXHA 1M33A 3HJQA 4ITVA 2D1FA 3I2KA 3PJDA 5JD6A 2GBPA 3KLMX 2C4KA 5GAJA 2EZUA 1H8HD 1JTEA 2GXAA 3QPBA 3KOYE 2GLTA 3RYTC 4U39A 3PPWA 2OXFA 2VJBA 2Z1MA 5B1HA 5DM60 3IMFA 5EMKA 3ADOA 4O2AB 1VTKA 2XDQA 2VN8A 4PM4A 2C78A 1ZL2A 2NGRA 3L41A 3R7BA 3J80S 1FQOA 1Q44A 4X3PA 1XAGA 3LL7A 3CSDA 1BU5A 5CNJA 1ZK0A 4R9VA 5JZMA 5DTMA 4E22A 5JHHB 4BNUA 4FLEA 5B7PA 4FYVA 3IEKA 3ZN2A 3KRTA 1AHNA 1XZEA 1V4NA 1DRJA 4HJXA 4Q93A 2G63A 2WP8J 3HB7A 3ILKA 4JU9A 5B2FA 4RGYA 2YHBA 1MHPA 4FMCF 2BRUA 2QTWB 3BIJA 3EQ8A 2YJ3A 4LW8A 5CBPB 2CXOA 3T4UA 2A7QA 4TTIA 1ODCA 2IYSA 4LOLA 3P97A 2HXSA 2ASVA 3QLEA 4QRHA 1CEYA 1VYUA 4V38A 2DF8A 4IWXA 4PTLA 4TMWA 1P6QA 5HF8A 3RV4A 3H3JA 2IPOA 5ED0A 2ZTLA 1UZAA 2GA9A 5DSXA 4GI5A 5DKFA 2X7JA 1E92A 3H4TA 5DXJA 2VZEA 5CW1A 4CM9D 4CKWA 2AFHE 1H4SA 3DFMA 4YLGA 4LG1A 4JQZA 1XDBA 5JJ5A 4A6EA 3RIEA 2XNSA 4MX8A 3DQPA 4FGJA 4XIGS 2HZBA 5CXXA 3LRPA 2ZROA 4G5FA 2BGTA 1V1MA 4PT5A 3TWLA 5JYDA 3FYUC 2J0QA 1NXXA 1H3FA 4ZQCB 2QORA 5CA0A 5SZIA 4P31A 3ZCPA 2G5PA 4YO8A 2FQYA 4F2GA 2QQ5A 2VBIA 1JAXA 3PDWA 2P2NA 5SICE 1YA6A 3CKKA 3O74A 1L0BA 1EAMA 3CBGA 3ICPA 4Q9KA 2XV1A 1U2DC 3RYHB 4Y6SA 4HZIA 1ZISA 1G8FA 2A0KA 4JB3A 2GD0A 1PVDA 1QUEA 5FT9A 4KRGA 5AH0A 4Y6GB 4WZ6A 1FFWA 3HBMA 4PZDA 2AB0A 1OLUB 1HDEA 3WGTA 1DLIA 4TMXA 3T1QA 4BB6A 1UK6A 3O5AA 1ZM2A 3CLUD 2I4LA 1NXSA 4JJFA 1BDMA 1GKLA 1EE8A 4EY6A 4A91A 1B6TA 2HQOA 4I1IA 4F4CA 1YJBA 1JSXA 1RZVA 1NE7A 1JFSA 5BY2A 2Y27A 4HQNA 3L25A 1NRIA 4MROA 3REGA 2FY8A 2CHFA 3L6UA 1LDGA 1A5AB 1R6TA 2XMGA 1U1FA 1A72A 1OCEA 4NBVA 4LK3A 3CNNA 5F1PA 1PZEA 1UF9A 2FVYA 3DO8A 1EGMB 4WLEA 1PX0A 3NOOA 2BE7A 3CTPA 1MGPA 3V8EA 3H2IA 2VA8A 3C5WP 4GOLD 4MHOA 3DGEC 4ZO4A 3HKPA 2XCRB 3FLMA 5EHIA 2AF3C 3ZE2B 5BT9A 4GHLA 3FBWA 1QKKA 3HNPA 4B2PA 2C9ZA 2VP2A 4DYHA 4X8HA 2IPAB 4Q4AA 3WNZA 4P7FA 1OV4A 2B36A 1DKOA 3TLJA 3UBMA 2B5OA 1LRLA 2PLAA 3A1CA 3QOWA 2AXQA 1KXZA 1FP7A 3U7RA 3TIXB 4IIBA 1TUBB 1VZ2A 1HE1C 1P2FA 3KR9A 1ORVA 2JBAB 4M3NA 1A5ZA 4EVRA 1K88A 1OKKA 3LUBA 2O8NA 1IXSB 2R8BA 3PRKE 4E30A 1IM5A 1NTOA 1OD6A 1L7EA 2ZPUA 1U0OC 2PH1A 2RAPA 5IXJA 2CKMA 4ADSG 3NBXX 4G81A 3V55A 2PXAA 1BVUA 2P6NA 2FZWA 1ZUIA 2Y20A 1E63A 1E2EA 4OY3A 3LIPA 5HIMA 2OD2A 1ISIA 4AURA 2KDLA 2WYIA 4TL8A 2VK8A 1WMAA 4OLJA 4JR2A 1U0JA 1Z08A 2ZTCA 3CBQA 1HLGA 3P4XA 1LDNA 3K70D 4V0SA 1IYZA 2HWWA 5CA1B 1E77A 3D4IA 3S3TA 4GLJA 1G3IA 1RLMA 5AVTA 4OHMA 4FS3A 3FMOB 4G1VA 4HQRA 2A2ZA 5FPSA 1A5TA 5BWBA 3KHKA 1C8BA 2DOKA 3LUGA 1S2DA 1XLVA 5H8WA 3BQMB 4EQZA 1H6CA 3L7IA 1YQQA 1OREA 2RGYA 2ZRIA 1Y3HA 5HOQA 5FYDA 2QDKA 3DHWC 4D3YA 2Y99A 3UMSA 4E03A 4MMXB 2Y4OA 5F35A 4P3OA 1YOVB 1NRJB 4B85A 2DFNA 1KP2A 5I4CA 5BPFA 1II0A 1YU9A 4O33A 2IXDA 5CEEA 1UDAA 3C1AA 4EJ2A 1WSDA 2ZJ2A 4J3JA 2C5SA 4AU1A 2QWXA 4MYUA 5ESRA 2XYPA 4BB5A 3Q3GE 2YW2A 2JJYA 2QUBA 1YK0A 4F84A 1U8EA 2AG0A 2GH1A 3ZNNA 2Q5QA 3JAWA 4G63A 3A2KA 5EUMA 3T7AA 1WGNA 3HUUA 4DQXA 1WW8A 3P94A 3PNYA 4K6KA 1B26A 2WI8A 3WYFA 3K9PA 3DCNA 3VC1A 5T5QA 2V5VA 1DQSA 1I7DA 3I58A 3I9NA 3WLFA 4E14A 2X9VA 1I3NA 4MYCA 3Q7RA 3EPHA 1NVUQ 1JLSA 5DP1A 4KL8S 4QTXA 3FPHA 3Q3EA 2HSJA 2PL5A 1BFKA 4MRMA 3WB1A 4D4HA 3MS4A 2NSYA 2J0EA 1UIMA 4HGPA 3PUWA 3TE7A 1VKJA 3FYHA 4MW0A 2Q5CA 3EGXA 5GONA 1CR1A 3WLMA 5FI3A 1D6JA 3G2OA 4LHXA 1T3GA 4P5DA 4OHOA 4A8JB 1D0MA 4Z4HA 3W2GA 3OE4A 5KPTA 2ERYA 1AT1A 3B70A 3I9V1 4ZEXA 1RHRA 3STUA 4R9UC 1Z7EA 2WIFA 3EXAA 4QUEA 1HYQA 2UDPA 3K9OA 2DULA 4JI2B 1W46A 3GDFA 3AL2A 3NTQA 3ITEA 3LH5A 2XGNA 4X0EA 5J2UF 2EKLA 1QGAA 2XNCA 4HDSA 3K09A 2ZIWB 5E9AA 1E8DA 2UUCB 5EXSA 2D54A 2LHGA 1T6XA 5FTMA 2P91A 4C22A 3DPUA 4KYVA 2O3TA 1KPIA 2AW5A 1OTRA 1Q74A 3FNRA 1XJQA 2PUDA 3L06A 3U16A 4P58A 4O2BF 2IIBA 2OORC 5TC4A 3H1BA 4MGIR 1WA5A 1I0ZA 1T0UA 4TXHA 2FZEA 2OMEA 1A71A 4JLJA 2XIQA 5AXBA 4BDSA 2EQ5A 1OYYA 2NO9A 2X8BA 2ID7A 4BV8A 5UKDA 3FCCA 3IBSA 1W47A 1TDJA 3UCFA 3TWKA 2X9QA 4YRDA 4ZARA 1ZVJA 4UXJA 2BN4A 4ZI7A 2WIGA 1RYYA 1ZNQO 3FLBA 4M1SA 2F55A 3NKFA 3JVUA 1WXWA 5CT8A 1VBKA 1GTG1 3ONNA 3ANLA 4F3KA 5AVSA 1Q3TA 3BGWA 4MGKR 2WILA 4EUKA 5K3FB 1WXFA 5DEIA 3N58A 1EFRD 5L6MB 3GRVA 4CHTA 4GMFA 2CJWB 4OVKA 5K05A 2Z04A 4XXHA 4N0MA 5ARDA 3ZOZA 5J4HA 2F3TA 1T25A 4JUIA 4E51A 4X44A 4V1CA 3QPUA 1YQTA 1L5FA 4PC3A 2IH5A 3AVYA 2ZWVA 3FZEA 4TSFD 1C80A 1V11B 3MRXA 5KVQA 4B6PA 1N2GA 4UE3S 2WYVA 3DTTA 1F48A 5EKTA 3ON5A 2BZGA 4IUCS 4DCMA 1R8QA 2O48X 2H51A 2O8EB 1KA9H 2H1SA 1HQKA 3T9FA 3IT3A 3CT4A 5I4KA 2ZT7A 3E9QA 5FOUA 3L7OA 4CKEB 2AL7A 1N3BA 4Q9IA 1EUZA 5FBKA 3G8AA 4GLFA 3LP5A 5ALMA 1Q20A 2I6SA 2C8VA 4KVAA 2DBQA 3TK1A 1OYVA 3N2KB 1VDMA 4GECA 2CDNA 3MJSA 1DMSA 2VP6A 2MGWA 1Z5VA 1EWKA 4ALJA 5D84A 4BGDA 4HFRA 3FGZA 4H77A 2HMAA 4FMDB 5HVNA 2GK7A 3KTAB 4R83A 4X8MA 3NATA 3A6JA 3HZOA 1H93A 4G9GA 2IX9A 5EWJA 3DOUA 4G8JA 2JI4A 3CH4B 3NHPA 4XLLA 1SB8A 5HS6A 2VJQA 3QA9A 2O8VA 3FRJA 5JQGF 3GDHA 2RBEA 1C30A 4R2JA 3OURA 4NOJA 3VKWA 3IUEA 3V8BA 1JI0A 3OPQA 3KV1A 3R3YA 1Y7LA 3GEMA 4PWYA 1H2AS 1T3SA 1BVHA 1GPDG 2Y0EA 3Q6IA 1KIAA 4PAQA 3HCWA 4MJXA 3WY9A 1JHRA 4ZCMA 5ELLA 3SZ3A 2CFCA 3EC2A 1KDPA 2GBFA 2QMOA 3DONA 4RVFA 3OZWA 4QPJC 2HSDA 3HLYA 1XRRA 3NJ8A 1PQYA 4HQFA 4OKIA 1YR3A 5F23A 1YJQA 1SXJC 4DLVA 3ZC7B 2BFEB 4B3XA 3MMZA 3OZCA 3WLPA 3IPAA 1DBSA 4ZAYA 3ZCXA 5G3ZA 4KAXA 4DLKA 3EVDA 3IV7A 1J42A 2ORIA 3MTQA 3ND7A 3HA2A 2C9MA 3HO8A 1Y7IA 2FSSA 4RAOA 1JG7A 5LKRA 1D2EA 1RM4A 1J20A 4FE4A 4X5OA 1NI4B 4JP5A 1NLZA 4DLYA 5DBFA 3PQ7A 3EGEA 2GO1A 1DIHA 2DHEA 5ER6A 4BBZA 2VTBB 1YE8A 2XWPA 3R44A 5HTOA 3WGMA 4JYBA 3ZWQA 3E5HA 1A8HA 2ODPA 1SNYA 3C6BA 3ND8A 2R79A 3DYVA 3PGA1 3WNQA 1P1RA 2ZAGA 2OO5A 1REQB 1QHGA 3AVWA 1PO7A 2O2IA 4IJ5A 4Q02A 1J07A 4W9RA 1GKIA 4M99A 3NWBA 4HADA 4J9UE 2ZAMA 5I7FA 3N76A 2OCDA 1CUWA 1UDRA 1C41A 4G86A 4Y2PA 5JSYA 1WB4A 4OI4A 2MU1A 3NFYA 1LI4A 3RRXA 3SKXA 2CNDA 1E96A 1SBNE 2YV1A 1NWHA 4IJWA 1UBNA 4FDAA 2JLWA 3G5LA 5EJMA 3H7AA 5JAOA 3UZUA 3GRCA 4YY3B 4RK1A 1G8YA 1HDOA 1DWOA 2KWIA 1KKUA 4NFSA 3KQQA 1L4KA 5CITA 4D25A 4QU0A 1FJ2A 5KOYA 3EA4A 1PJBA 3X1WA 4J43A 4NBKA 4LY6A 3PC6A 1IZ8A 4RHTA 1CFJA 4EA6A 1E3MA 3KU4A 4PSAA 3IX7A 3IOMA 5K6AC 5AJYA 3O1IC 3Q9UA 2QQ0A 2ZGVA 3NT4A 2CRUA 1AKYA 2GHQA 2YJ6A 4MGHA 1UCFA 1YDGA 3KZVA 2VAPA 1YFZA 1WXGA 2HA2A 2H85A 1UOEA 3LO5A 2AE2A 5IK2D 5JWHA 1FFDA 5ADWA 1U7TA 3PVZA 3DE4X 3L46A 1QRUA 2HXYA 1J49A 4YAKA 3VJLA 3ZU5A 3LG2A 4B3TB 5BXYA 2DI0A 3QMPA 1WX1A 2O6LA 3QEJA 5F2OA 1VB5A 1SBTA 1OASA 2HI0A 3ES9A 2RAVA 1V8BA 3CCBA 4TZKA 3EF0A 3HACA 4UQOA 2G1PA 4ZO9A 4KDCA 2O4UX 3WXMA 2J5YA 5EC8A 3OU7A 3WLEA 4IWNA 4DJFC 4TKVB 4RKQA 1ZH2A 2OUKA 1ZJ5A 3C1TA 4XB1A 4DT1B 2QT1A 2ZITA 1O94A 3U1VA 3HWX1 4WDQA 4W1RA 2CWWA 3SFVA 2QSUA 2O7NA 3LUFA 4MCAA 1XZDA 4BMZA 5AW0A 3H9CA 1RCTE 3HABA 4DA6A 4GVPA 1N32B 1LNSA 1GITA 4ER7A 2W6NA 4LXIA 2FMKA 1EK6A 4OATA 1O03A 2OD7A 3FOEC 2UUBM 4U7JA 4R1UA 2K2QB 4GE3A 1H1LA 1XCLA 3WWEA 2GCIA 1D2NA 1XEFA 1RDFA 1M67A 2HQSA 1A97A 3AY7A 3M49A 1IY2A 4JI7B 3L7DA 1NKSA 3C7DB 4RA9B 4BKRA 4BNMA 4C20A 1TRKA 3OCWA 2XYHA 3T52A 3TI9A 2XF8A 4PN3A 2Z2JA 4BXOA 3HR4A 1CPYA 3IYLW 1NMZA 1T26A 3FNQA 5EMJA 3PGLA 4EGQA 3R7WA 2XCOA 3S8EA 2AG8A 3NJ4A 1IEVA 2C0QA 1N78A 4EVIA 3QIVA 2ARKA 2VNKA 1TF5A 4HVTA 1E5TA 4KO2S 2R8RA 2IYEA 3M3DA 3GLSA 3W2FA 1YHYA 4H6VA 5KDLA 3O4HA 4I4IA 5DYNA 1NGSA 1LFDB 2ZR8A 2X42A 1KEKA 4AJJA 3WGZA 1IXKA 2W43A 1XA3A 4TLBA 1RQ2A 2C57A 3WL8A 4RVSA 2ONKA 1EIWA 2VZLA 1KDRA 3HYSA 3TTSA 3U6MA 3BWVA 2BTEA 3PEVA 2J31A 3W4KA 2D13A 1RC1A 1PTJC 1RS0A 1FJGM 3CVOA 2WPNA 4BLPA 2E4VA 3M7IA 3G9TA 2NZUG 3H2JA 3D3QA 1XBTA 2OWDA 3GGSA 5IUJC 2IITA 4IHJA 2H1IA 1WCIB 1YD7A 3WA7A 2C5HA 1NL3A 1RNLA 4INAA 2R5FA 1FL9A 4MPRA 2FW8A 3D2BA 1SUEA 1R5JA 5E6SA 5E7JA 2O2EA 1WCV1 3LMMA 1AKWA 4E09A 3SDSA 4RTSA 1YZUA 3WMFA 2GK3A 1X1RA 4LF8B 3HDHA 2HQRA 1EXMA 5F76A 4QKQA 4DSAA 1Z7YA 4C0JA 3A10A 1GPJA 3ZS9A 1DGBA 4F92B 5K4GA 4DDHA 1EFKA 4FFDA 4E13A 3M4ZA 2CHGA 3UV7A 3W7BA 1GPAA 2IZZA 3TIGA 3WFIA 3DV0A 3QEAZ 1GABA 4UOEA 3TFQA 3WRYA 5I5GA 2H59A 5EP4A 1TUEA 3NAQA 1IBKM 2A5GA 3E3LA 3QP9A 2RJNA 2EKFA 3HI4A 3FAZA 2WTMA 4P3PA 1E62A 3DFUA 1SMKA 3UFXB 1XN1A 3U1TA 2YUIA 5FHQA 4B7GA 1WE2A 4MJ3A 1MDFA 3MOIA 4OG2A 1YB5A 5KYUB 2WT9A 1LFAA 1ZI8A 4MO9A 4WOPA 1ECCA 4EJSA 3G8CA 4XJSA 1VJ5A 2F00A 1K27A 4K0KM 4YDRA 3DDUA 3H83A 5DBHX 2E5LM 1GEEA 1M1YA 2EP7A 2WAMA 3EVFA 4JOSA 4DC9A 1ES9A 3ETCA 5GKNA 4UW9A 5G0UA 1OIXA 1I24A 1JG1A 1LDYA 1E3IA 3ZPXA 4LIPD 5JVDA 1E89A 2I87A 4UDNA 1ZEJA 3EIXA 1XVVA 1IK4A 3R3UA 1XD2B 1ZO8A 1RWBA 4H7DA 3B51X 3O3CA 1P60A 1KDVA 1T9ZA 1G64A 2VVTA 1Z73A 1OFHA 2GRAA 4IEIA 3DHYA 1AZSC 2ZIEA 1GXSA 1CHDA 4IBCA 3JWPA 1J97A 5JSZA 1WXQA 3A1FA 3E61A 1QRRA 4PG8A 2B30A 1QDRA 3NHJA 4PYIA 1POWA 3ME5A 2JNWA 1K8XB 3U6SA 1ZMTA 2NZWA 1MRNA 3L7KA 1VCHA 3IT2A 4QZVA 4CM1A 2XB4A 3I9V6 2W48A 3PLAE 4M22A 2GEDA 1AKQA 4C0HA 4DNPA 5JPIA 1Q0QA 5IF3A 1WSAA 3TQIA 4LOKA 5DVZA 3KG2A 4M1ZA 2QAJA 1PNRA 2I8LA 3AR3A 5CM9C 2VDBB 3QNUA 4E7OA 1RKQA 4P86A 3FSJX 5TJ9A 3SLKA 3MERA 1QH8B 3SMVA 3FNBA 2J3EA 4QDOA 2LVOC 5THQA 1KSJA 5JAZA 4BB9A 2JZ0A 4QT0A 3H04A 3CZPA 4QAJA 4EHNA 3VTFA 4FZVA 1LV8A 4C2UA 3LRTA 2VP9A 4JBNA 3TECE 1AS0A 1NUAA 5D6NA 5T8KA 5JCPA 2H08A 2J4FA 4HDMB 1NATA 4KR0A 2NTYC 3KCNA 1VJ0A 4RTKA 1TCAA 3ZDZB 3EZNA 3L7AA 3E2IA 1DTWB 5EHQA 3B3FA 4MWGA 5ALJA 3T9EA 3A9UA 3GPYA 3R1IA 2Z3VA 3L27A 2CL7X 3FF4A 2ZRCA 4RGQA 2FPRA 2JJMA 4ZT7A 4URFA 2OHXA 5G40A 3O4FA 2PSJA 1TGVA 1GLNA 2FSFA 4P4NA 3GP1A 4LISA 4JLBA 2IHKA 3SK0A 3KZCA 2D2VA 4B6GA 4N41A 1UDCA 3Q4GA 3OIGA 2QTMA 1I2DA 3KOXE 3AI7A 3BRQA 3PQ8A 4XDZA 3OKCA 1ZS9A 4ILKA 3PXBA 3O73A 3TLBA 3ZU2A 4M0DA 5AKZA 3L6BA 1G5PA 3WWCA 2EG9A 3DMNA 4B48A 3C6YA 4KXWA 3LT1A 4GP7A 1KAEA 5H16A 1WP9A 3E0QA 2FK8A 3G5TA 2YXPX 2A9JA 2QLTA 2HT6A 1YA8A 3E4DA 1PJJA 2E2WA 4XPZA 5KVCA 1P7YA 4HN9A 1MNAA 4BNFA 3GA5A 4PCAA 2RJ3A 3A3KA 4MRRA 4C0SA 3M6FA 1BYIA 4LC9A 4PFQA 1RRMA 1RW4A 4C0WA 4ANRA 4OOEA 4LDJA 4BVFA 2WWYA 2AR0A 2XXBA 4HC4A 1P81A 4RHEA 3ITDA 4NRVA 3MGCA 5DOZA 4JVNA 4H4CA 1E9BA 2WQZA 4DZTA 5KNCD 4TVKA 4YI3A 3R0IA 2XB9A 3ROPA 4MS3A 4MWBA 3BTVA 3KJXA 3HBJA 4L3VA 3HP7A 3TW8B 3KQHA 3OJCA 4C07A 5JZBA 3D3WA 4I8IA 1YZTA 4RCVA 3CRQA 3T34A 1C14A 1G2OA 4REQA 3A6EA 5FOSA 4WJKB 2B25A 3PTZA 4Y6LA 3FZQA 1V7PC 2FUKA 1DAPA 2CSXA 3T41A 3UAWA 1TVKA 4LF7M 2FH0A 3W2TA 4KWHA 4EO4A 1BX3A 5H82A 4TKUB 2X40A 1G3RA 2FJPA 1C4WA 5EJ2A 2BMVA 4GQBA 4WP2A 1EFPA 1P6XA 1E4EB 1UKBA 4XWWA 3ZY3A 1MU5A 2BDTA 1MQ9A 1TEVA 3NVAA 2VDUE 2O07A 1W581 2X0DA 3EHDA 2FFJA 2NU6B 4HMQA 4V3CA 1BXGA 2JAWA 3VBEA 2YRFA 3LQ2A 3NYQA 2MROB 3R0QA 3B7GA 5BR7A 1TVEA 2PUVA 2ZUTA 1SBZA 3T61A 2GEFA 2WA1A 3HVJA 1P4JA 1QG2A 5AXCA 4R3WA 1N3IA 5KHOC 3ED1A 1XVTA 1ZWLA 3IKMB 5JH7F 1IHYA 2IZOA 4FGKA 5BURA 2ORVA 4E70A 2WF9A 3N2ZB 2G7MC 4GZLA 2BEWA 2ISCA 1KJNA 1UJ5A 3MCWA 4GITA 2JFWA 2QTCA 1LDMA 1VG5A 5GIPE 1TYEB 1L2CA 2HIAA 4RJJA 4YRSA 3DUFB 5IUKC 3F4BA 3HJBA 3TRIA 4CDMA 4WFJA 1AURA 2OR3A 1LLUA 3KSDO 1AV7A 1LBEA 3ICCA 4OFBA 2OZEA 1FU8A 4Z2AA 4EVSA 4PNHA 2YXLA 4PZUA 4FINA 2O0MA 2TSYB 5FTKA 4DA7A 2OB2A 4Y7CA 4CQMB 4L95C 4BBPA 3H5NA 3RIYA 3OM0A 1CF2O 3JYPA 3VNQA 4Z2YA 4HVC