3CGWA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei. northeast structural genomics consortium target mar46
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
303
structure length
303
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords LPPG:FO 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
total genus 78
structure length 303
sequence length 303
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3cgwA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3cgwA01
2P0YA 3C3DA 3CGWA 3C3EA
chains in the Genus database with same CATH superfamily
1CR0A 4DV1B 2LDXA 2OORC 4JMPA 4EMTA 4Q9AA 1IG0A 2VQ3A 4FM9A 3NBFA 1Q11A 3FUVA 1V8PA 1E1QA 5T8KA 3FG9A 3RJ5A 1WUJS 2BKAA 3RSGA 4BQSA 1A5AB 3BSYA 1Z4NA 5FA6A 4A27A 4AMGA 4RZQA 1C80A 4YJGB 1AZWA 1T10A 5KTTA 1FDOA 3VVCA 1HEYA 5MN5A 3PIDA 1E98A 4IIJA 1M5TA 3II6X 4JZYA 5LBTA 2Q3HA 3OCJA 2DERA 1UT5A 3H2IA 3GJSA 4HPWA 1XFDA 2G67A 3ZCRA 3BUSA 1JDSA 3VHXA 3QU7A 1HPLA 4GMHA 1R4MB 2P1ZA 1MJ5A 4Y6OA 5JY6A 1NVMA 1FTSA 1UPTA 1L5LA 2WQ7A 2DHYA 2F64A 1XZQA 3A1WA 5I8WA 3V7FA 4G23A 3D59A 4YAIA 3S0JA 4BNKA 1O94D 4WJLA 4P86A 4YECA 4P1ZA 4YGYA 4WLNA 3HSKA 3BWDD 4P3XA 1PT5A 2LWIA 1XVUA 4C0JA 4EB6B 4ENTA 2I6GA 3KWJA 3V1UA 5JQGB 4IDBA 3BYZA 4AJ9A 4RPJA 1ZUWA 4JN6B 5HW0A 1EFKA 2HMVA 2PH7A 1JHQA 3TUZC 1P9RA 2VTDA 1Q6YA 1W6RA 2JLQA 4PM4A 4NC9A 1IM8A 4O02B 1RXUA 3Q0EA 3ZDCA 1H6AA 3DKKA 1XCJA 3TDMA 3F78A 4OHWA 2P4HX 3PDIA 4BS9A 3EULA 2O05A 4IVRA 4B47A 3PYXA 1G64A 1K3WA 4O4IF 1EB9A 3MA0A 1PR5A 5CK4A 4PINA 4PSKA 4FR5A 3IQXA 3D6TB 1N7JA 2YWDA 4NOJA 5CXSA 5FADA 5LXTB 2PV7A 4KE6A 3THXB 2WC1A 3ACCA 1ES9A 2VA8A 2A57A 1CZNA 5BV2P 4LTDA 4MVJH 3IMKA 3ND9A 1ZIXA 2NTJA 1VI6A 2ZTVA 4DCVA 3A1NA 3LWNA 4AIIA 1SC3A 3VR4D 2R6R1 2RI0A 1MHTA 5IEJA 3SSMA 4XCQA 4G4GA 4YJ3F 3F8TA 1GPJA 1N2JA 2O5CA 2G0AA 4Q1AA 3T12A 3K7EA 3OSUA 4PGFA 3W79A 1VCMA 3E1SA 1ZJ6A 2XEXA 3G0GA 5TQ0B 2J3QA 3WZLA 4TN5A 3CM0A 1P7CA 3NHKA 2WUWE 4GVXA 1Q1QA 3S5JA 3K6JA 1B74A 3B9BA 1SG0A 2O0MA 3EMKA 2WILA 4OXYA 4YCNA 3I4YA 4RF2A 2F59A 2FZKA 4F2LA 3GFRA 3JPYA 2P4SA 3B20A 3NOOA 4NF2A 3LPMA 2IOYA 4YAOA 1EDZA 1PG2A 4HSGA 3NIDB 1YQTA 5LOVB 4WRRA 2O8CA 1OY1A 1V8ZA 2D74A 3HPQA 4TLDA 4MLZA 4YDHB 4LYGA 1SCIA 4L75A 3CCCA 3GARA 4JBYA 4Z86A 2IYFA 4ZALA 1C0LA 4YJDA 4JBGA 4X44A 1Z0DA 2CNWD 4G0NA 1RRMA 4DR1B 1E1RA 3BA1A 4F5ZA 1Q7RA 3R8FA 4F8EA 4GQBA 2YJGA 1ICIA 5KX5B 4RM3A 5JD6A 2DWZB 2X3YA 4H59A 3HC7A 3LLCA 4IICA 2NPIA 1BDIA 1C0PA 1T43A 1FF9A 4YRJA 2DY1A 4WBNA 3A1SA 2R68A 2JL1A 4WACA 3UCEA 4ALLA 4AU1A 5IKOA 4L57A 3RT1A 2RGOA 2WF9A 4YCDA 5A2QS 4G4RA 4Q9HA 3MW8A 2TMDA 3Q3GE 1E2BA 1RWQA 4DR1M 2PS1A 2NU9B 2IHKA 1N5DA 4ZVUA 4OQMA 1I24A 1OI2A 2UXBB 1GTG1 3GLVA 5IZ7D 4A1FA 1EFRD 3JAWA 4KFRA 3BK2A 4CCAA 4MXDA 2J7OA 3VPSA 2ZAYA 3MTGA 1X8JA 3X1XA 1FNMA 3T1OA 5L7WA 1C7IA 1P44A 2PXHA 2FLKA 1I9GA 3IP5A 1IK6A 5DX1A 3LL7A 4B7HA 3HN2A 3VK7A 3GZNA 3MM4A 3ENKA 3MEQA 2XUQA 4K28A 4JLKA 2AUNA 1N7GA 1UH5A 2PTGA 3W5HA 1IZ7A 2ODNA 4QDKA 1H3EA 5CFMA 1XEXB 5EINA 1PEDA 1X1DA 1WGLA 4EATA 5AK3A 1H5UA 2EP5A 3C6KA 1DXQA 3FDIA 5T6MA 4J0DA 2V7PA 4I8IA 4X66M 2WZDA 3RJZA 3SYKA 1IZ9A 5F9HA 3PV0A 2EFDB 1MAWA 1U0JA 5T3YA 4ZVPA 4J16C 4MZXA 2GLTA 2Z5GA 3KWMA 1X7XB 3AJ8A 2AZMA 3KOWE 3PK0A 1Z4KA 4KH0A 4FDLA 5BY2A 1FXSA 1W7AA 3Q8GA 2HLNA 2BI8A 4IFIA 1HJPA 2R4UA 5F52A 1O95D 4OVZA 1RJFA 3HO1A 3U1BA 3QGMA 2FMTA 2UZ1A 1WCYA 4BKPA 1VEKA 2PT9A 1YBMA 5F2OA 3PHHA 3OOWA 2O2XA 5FSWA 4J3FA 1BWQA 4QE3A 3F5MA 2H6EA 5JO9A 3DULA 3ABSB 2Q0HA 3FNEA 3CLVA 1A2QA 2H8GA 3E46A 4AQ7A 3WBFA 3R7SA 1P1KA 2C99A 2IS1A 2CLFB 5AM1A 3I73A 1L0BA 4EJ6A 2W2KA 4MR7B 1PUIA 1A8IA 4Z4FA 1MC4A 4LDRA 3AGQA 5AI9A 5T4EA 5KAPA 1CULC 2XGJA 3HUUA 3PHLA 4Q37A 2VRNA 2XUFA 6LDHA 1JBKA 1UOOA 1UXKA 3MXOA 2VZ9A 3R7WA 3KVOA 3G5LA 1JBQA 3SZRA 4ZICA 1A9YA 2FPPB 2I7CA 4JEHA 3I61A 4TV9B 1ZK0A 2K7ZA 2OZLB 5E6RA 4J1QA 1FSFA 1PL6A 3CH7A 3DCNA 1E5XA 2OQRA 4LRUA 4AO7A 2PMKA 1JT2A 1E3WB 3FF4A 3MS7A 4O63O 1G6Q1 3TE7A 1OX4A 3MLEA 3MWJA 1RAFA 2P3QA 3FPEA 5BUSA 3X3HA 3KSBC 4FMPA 4RH1A 5JSUA 1PZXA 4Q00A 4ADSG 3SATA 2V96A 4NXMB 2JZOA 1NU6A 2FFQA 4UUOA 1GQOA 4FZ5A 4P4NA 4TXLA 1KFVA 2F3PA 3W5VA 5KPZA 2QY9A 5ADUS 4OYYA 2VRWA 1P4HA 3TTYA 3CZ4A 1UFKA 3QI7A 4I4NA 3PDJA 4A0HA 3OEED 3M1IA 4JZKA 2FWAA 2H1VA 3BE8A 2BHRA 4LOAA 3S7TA 1UZNA 4OGFA 4MIEA 4U1RA 1Z5OA 1RWOA 3AX6A 4A2WA 4HGOA 3WOVA 3H1AA 2XRZA 1YAJA 1GPUA 3HCEA 2WU3A 1K8RA 3HQ4O 2XIQA 2QTVA 3EODA 2XTMA 1YZUA 2ZTLA 2AI2A 2X0EA 4C0AC 3OFKA 2G40A 3IR7A 3X1MA 4YYZA 3QP9A 1ZMRA 5K0LA 1AUVA 4RVUA 1B23P 1CUSA 5HPYB 4RNDB 3SYRA 1LF5A 3T34A 2R96A 5CX1B 2C3OA 3N74A 3OC6A 4DQDA 1C29B 4URWR 4ER6A 1SVIA 3LLMA 3KHKA 1T9CA 2WU1A 3I37X 4J07A 3WQHA 4L4YA 5D6NA 3GRYA 1Y4UA 5JVDB 2GEUA 1AQYA 3FIUA 4DBLC 1NMZA 1T2UA 3E9NA 4BDSA 2FJUA 2VK4A 5BVGB 4RNAA 3DFMA 2O8BB 3NASA 3M6UA 5KX5F 3AVUA 2IEIA 1OBHA 4FGLA 1V9LA 3RO7A 4NENA 4AJJA 4HZUA 2LZ0A 1FQOA 2WE8A 1BQ3A 3PF9A 1BRMA 1EPUA 2O8DA 3HYLA 1TM1E 2LKDA 4FX2A 4YI5A 4IDQA 5EFZA 4EB3A 2P79A 2WM8A 1XTJA 1P74A 2ZQ5A 3ORSA 5TQ2A 1ADYA 5G4KB 1JKJB 3AVTA 4YRMA 2GT1A 3CXUA 2IPXA 4F45A 1HLGA 2WWHA 2HOQA 3HKEA 1GN9A 2JLSA 2KHHA 3AU8A 3MGGA 1NVEA 2AHMA 4Y2GA 4ZYYA 4IH4A 4HRVA 4LJKA 2Q8QA 4CNQA 5JEDA 3AHEA 4FD3A 3NT4A 4YAKA 4F97A 2ZRNA 3PJFA 2Q3FA 1PBTA 1XA0A 3A9SA 5E6UA 2H1SA 3I39X 4PLHA 1JKIA 4B73A 2J4CA 2XBLA 1SO8A 3WLHA 1YDHA 3VR2D 3ANSA 3P5SA 3W05A 3B5EA 2WTNA 3C6ZA 3KEGA 4G1CA 3KUXA 4FMCF 2GA9A 2C78A 3PQCA 5ES3A 3VQTA 3HXOA 3VYSB 4YWHA 2GXAA 4NHEA 1XZKA 3IECA 4E2YA 2RGXA 5ALMA 4AYTA 2QU7A 4FKZA 5K3FA 4ISBA 2VPIA 1ENZA 1XWWA 1MQ8B 4R01A 1IATA 5A2GA 5DIZA 1GQQA 1GADO 5IT9S 1VA5A 1QTIA 2EIXA 3QY9A 3ZW7A 2PKQO 3PITA 4P6VF 5T8KC 3B52X 2Z2KA 1SXIA 3M4JA 3KOYA 4G4SP 1WJGA 2Q2QA 2ZPUA 5AW6A 4RS4A 5T6BA 4QVIA 3KSRA 4GWGA 2I7PA 2HCJB 3UKOA 5DBOA 5T41A 3ABIA 2AUTA 4KSYA 2O59A 5LQRA 2DH5A 4UUAA 3A70A 4N9WA 4MUYA 4UM9B 1X8LA 3B3FA 3BMQA 3TQRA 2ORED 2Z1DA 1UBRS 3C3JA 1MX1A 3JALB 3KAJA 4F5EA 3U5ZA 1BS1A 5JANA 5AKGA 2QD2A 1MA3A 3GNLA 4DEVA 2VA9A 4CKZA 1IOZA 3KYCA 3EF3A 1E1DA 2ID4A 4ED9A 4XASA 2F9LA 2H06A 1F2UA 5AICA 5EHQA 3BBLA 1ODIA 2XMPA 5L3RA 5D3MA 3AW8A 4D4JA 2Z0MA 5EJCA 4IXMA 1GJTA 3AHJA 4MUKA 2BGJA 4RF1A 5LIRA 3QE2A 1XQXA 4RHTA 1SB9A 1V5FA 1T9DA 2FG6C 3BX1A 2P11A 2Q2VA 1AD2A 4DLYA 2ZWMA 1V11A 1YJXA 1OXVA 1XQ1A 3KR9A 1ML4A 2E6UX 2QJFA 3DLHA 4LFCB 5C4MA 1VRWA 4UTOA 2O6HA 4YUXA 4DBGB 2JFZA 4EB0A 3LX6A 3U9LA 2XY4A 4OQPA 2IZ7A 1FP4A 3FYCA 5DTJA 4ARBA 4CPDA 4GKAA 3T3MB 5DDIP 3DE4X 1JG1A 4LECA 1NBOA 2QMUA 2EUCA 1IAVA 2PN1A 4TTQA 4FB4A 3P2YA 4S12A 3CEHA 5LCXA 2J3IA 2YXDA 3PHIA 3QEMA 2X8AA 2R8OA 5CD1A 3CTWB 4M9SA 1WV0A 4QFCA 5C37A 1TO2E 4AG6A 1OYOA 4PSUA 4LFCM 3IAUA 4I4TA 4LGMA 5AFSA 3HY3A 2XAAA 3K5WA 5I6DA 2VO1A 3DFZA 2Z04A 4I1VA 1CDOA 4OB6A 1ZGGA 3EQ7A 3CBQA 3TFQA 1JAYA 1N8TA 4EMSA 3S27A 2QSYA 4P7KA 3KIPA 3FPFA 4R9SA 4ZC8A 1EFPA 2OAGA 3NDJA 4MHSA 3LT0A 4WLUA 1GGJA 1E2PA 2XCIA 4X1KB 4PHGA 4G8JA 3BD6A 3OLWA 1GYQA 1JG3A 1K68A 1BHJA 4DR7B 3PRJA 4WK2B 3GNTA 1Z4OA 4IBKA 1M2EA 4XEHA 5AKXA 4FHEA 2F17A 3GU3A 3RTGA 1A8HA 1JHVA 4NTZA 2UU9B 4CEIA 3ASVA 1E79D 2NNLD 3ZDAA 2OQVA 3EVCA 2VP6A 3ZQUA 1U0FA 5TE9A 4Q9JA 2PSHA 3WGIA 4JP2A 1YVPA 1PDOA 2B20A 3GFFA 4TT8A 4FZJA 4R2MA 4B3XA 3RUHA 2YX1A 2FSUA 4QOIA 4DR7M 4Y1FA 4Q39A 1U8CB 1WDKA 5IMBA 3ROFA 5M3BA 4LHSA 1UP6A 4IL5A 4YP9A 4NSOB 4HAXA 5JVDF 3TPFA 2ZTDA 1S02A 2ZJ7A 2AG6A 1HTBA 3PU6A 2NP6A 2QRNA 2BR3A 3AOEA 2Q0XA 3OF5A 4WZBA 3PTAA 4FINA 1WHTA 3FWHA 3FCOA 1G5RA 4M0FA 2WINI 3AB3A 4PC6A 1XXLA 2XMGA 2O3SA 4NV1A 1XNHA 1RI2A 4MPJA 4HNUA 5JI2E 2H1RA 5H9WA 3R9KA 2HBRA 5DFAA 2BYTA 2QUIA 3RU9A 5AW9A 1TTEA 3HNPA 4ZXFA 2IH5A 5AW5A 5EWMA 2FRVA 4GDFA 2ATEA 2XF3A 1H8HD 1R66A 4WZAA 3TSCA 4OHMA 3VGJA 2GCNA 4QOHA 4M55A 1CPYA 1NRWA 2AXNA 2RHWA 1G9TA 4ZAVA 3I64A 2V0NA 3MCZA 3TPZA 5G4LA 4DDVA 1XHFA 1IY1A 2GILA 1CW2B 3VO8A 3LUKA 5PNTA 4KW7A 3QUSA 2QJWA 4RVFA 4MWDA 2B4KA 2Y1WA 3A6GA 3H2KA 1TAUA 4N6NA 1OWOA 1C1DA 2WKPA 4IGKA 3I0ZA 2WQZA 1N0IA 1ZR2A 1USKA 4FOSA 2GGSA 1JPJA 3A1TA 4RK4A 4NBRA 3CVUA 1AGPA 2PGOA 1C8LA 4FWDA 4OJNA 5FA8A 4IBJA 2G7MC 2Z5FA 4MVJI 5BW6B 1Q1GA 1QQTA 2ZT5A 1PR9A 2I3BA 3MLAA 3LCCA 3P9XA 4Q1BA 2BFBB 1BA3A 1J20A 3FF1A 3KPWA 2ZRAA 3QUBA 3BQMB 3UPTA 1D2RA 1G3RA 2Q6OA 3WL7A 2AT1A 2SKEA 4IDGA 4N3AA 5J2UA 1YR1A 3LCVB 3TZ6A 4QICA 4BMYA 1EZZA 2EJSA 3NZEA 2OHGA 1MRZA 2W2NA 4ZGBA 5FUYA 5FWYA 4XIFA 1YR3A 3KLNA 3ZE6A 1YQGA 4IIEA 2F8LA 1DCKA 2ZWAA 1XQVA 2UZ3A 2DHEA 2CBGA 4X65M 1GL3A 3I12A 5K09A 1Y7PA 2VG8A 1I94B 3C3MA 3HJSA 1NR5A 2HJ9A 5FXMA 2DWQA 3OZVA 3DOUA 3JAKB 3PX2A 4W1RA 1M34A 1ZK3A 4RPGA 1Z4IA 4MP8A 3ISTA 3RYCB 1PN3A 5ER6A 3EXG2 1WIVA 5KUTA 2WLTA 3M9XA 1T8YA 3KWLA 3L82B 1XAIA 3ROZA 3OOYA 4AJKA 1TJ5A 3BRWA 4Z1OA 3JQ6A 3FHLA 2EBFX 5KTYA 4BVFA 2JBAB 1ESEA 1SPBS 5BR1A 3R7FA 4Q4JB 2YXBA 2HBYA 2OD9A 2FH5B 4IG4A 3AZPA 4PCUA 1D2HA 3PQ6A 2WTUA 2ORWA 5ESDA 1JEQA 3CH6A 5JHGB 2Q27A 2UYYA 2FXVA 3WHPA 4JJIA 4OJQA 2A0FA 1NNSA 3CRMA 4MMXB 1UJNA 1JJBA 2PUWA 4DCNA 4TQ9A 3BL8A 4F4FA 2UUPA 4WCVA 2B4AA 3QYFA 1OI3A 1JJAA 3G8YA 1V8FA 3HVRA 2V7TA 1YOBA 2WWYA 2GETA 5M2QA 3DBIA 2X14A 1UT6A 4B80A 1AKQA 1ZSNA 1P0CA 4CQMB 3UMFA 1L2CA 3NYIA 2P6NA 1K5GA 1IQPA 4B4UA 2A5YB 1UPXA 2ZULA 1USWA 2QX8A 4IS3A 2HWYA 3IE2A 3W4KA 3ND8A 3COSA 1SU6A 5AJXA 4KTVE 1ZM7A 5BSGA 3VV3A 3WKDA 1DAEA 5KYWB 1NW3A 4MULA 2NYAA 3RRZA 4H0CA 1XD9A 1ONBA 2L4FA 5H80A 2Z9DA 1EVIA 3RODA 4BVAA 1QUSA 4KPUB 3OHSX 4OQEA 2AYXA 2GN6A 1L7NA 3RK1A 3EA0A 1T91A 3B36A 3RFXA 2LUOA 4TTRA 1BVSA 2XGOA 3PFNA 1XT6A 3BTVA 4MQMA 3HUEA 5KJCA 1P91A 2AKYA 5H16A 4JUBA 4P08A 3F8SA 3WMRA 4B35A 4NWIA 5KPRA 3PNLA 4ZV7A 2YJ5A 3DB2A 1G20B 4WESB 3Q7SA 4G67A 1N5JA 1W94A 4OOEA 2XGNA 1GGVA 3T38A 3QE9Y 4L0DA 3DMYA 5GONB 4DC1A 2J3KA 3VNRA 3TW8B 4QNRA 3H6KA 3NDBB 4IJWA 3LO5A 4FJ2A 1XDUA 2KDLA 1D1SA 3WYDA 4MB6A 3KOXE 1JG6A 4UOQA 2A0UA 1MGPA 4GBED 1XRSB 4DG9A 4F9TA 1PJJA 1Q7TA 1B2RA 4MRNA 3RTEA 4AYXA 3GD5A 4HYYA 4L9WA 2X8JA 3U4HA 4G4IA 1UPBA 1XL1A 1SVOA 3CN7A 2HBQA 4TMVA 4WLEA 3GDGA 3J7TA 2XVXA 5SY4A 3CWZA 5CW2A 3HA5A 2GMWA 1I6LA 3OCWA 1B00A 2Q2OA 3GJ7A 5EQJB 3LDHA 1PNVA 3JVDA 4R3DA 2HCFA 5B3LA 2NZ8A 2IYVA 3WDKA 3Q1LA 3B1KA 3C8HA 1SHZA 4B3MM 1J99A 3HB0A 4TS1A 4XFJA 3WYCA 2H0QA 2QIOA 5K51A 3P7MA 4KRGA 5JAPA 3CRVA 4BUJA 2V0GA 5C31A 1PQ4A 1V5GA 2Z1MA 1CUVA 3VSBA 1EBUA 5ULLA 1S8NA 4OU7A 2QPOA 1ESMA 4OU5A 4IJUA 4B85A 5KYUA 4X71A 1SUAA 4V0SA 1H69A 3SIRA 3GUUA 4WNYA 4HJRA 3G85A 4XEUA 1H2HA 3DJYA 5HRUA 3TPCA 3NHUA 4XX0B 3V4OA 1OBVA 4L6AA 4INAA 6ADHA 4XWWA 2UUOA 2F00A 2ON6A 4QATA 2CFTA 3GFOA 3D4LA 2R3SA 4NONA 4D4LA 1B2LA 2J6BA 4CRWB 1EUZA 1QFZA 1DQYA 1U3CA 5FCDA 1R50A 1KSGA 2C29D 5E7JA 1WUYA 2PA0A 1YGYA 4NCHA 4JGBA 2LV8A 1UK8A 1QG0A 2A88A 2HMSA 3LVFO 5GMOA 4C4TA 1G2IA 3WLNA 4DXDA 4POOA 3K9FC 1GM5A 2GNAA 2EA0A 2XDWA 3OTOM 3WWYA 1Y1LA 4R7TA 3W5SA 5HOQA 2LBCA 3BKXA 3DZGA 4CYMA 4UTNA 1B73A 5H8WA 3NAMA 4YIHA 5KC8A 1WQ4A 4E13A 4H15A 1WF3A 4LCBA 2VPWA 1RT9A 2OKGA 4I50A 3MUNA 1SVKA 2WNHA 3AP2A 4B3TB 1UWLA 3PDWA 4I8DA 1YZQA 4L3OA 1U9IC 5KDOA 2ZYHA 1DEHA 2ZRQA 2QN3A 3C45A 5KNDA 1BJKA 4M21A 3UWMA 5L7YA 4Q9KA 4XFKA 3TIGA 5KPJA 3I23A 1L1EA 1DJOA 1JQKA 5A4AA 4IBCA 1CYDA 2IPAB 2CUNA 1CZKA 4B3TM 4E0BA 2FGKA 5KTNA 2D1FA 1TK3A 3ZTYA 3IA7A 5IS2A 3CF6E 4XWGA 4JROA 3QU5A 3AG5A 2B25A 1JAXA 2DBZA 3IXLA 4MP6A 4IHQA 1OWLA 5AVTA 1NW5A 4KR3A 2J9RA 2ZOSA 4EG1A 3VSAA 2EKZA 1RQ2A 2QX7A 4D3YA 5H70A 1WU8A 1ADJA 3T35A 3Q5DA 3JD2A 2XDQA 4JHXA 1NDQA 4CL2A 1WTCA 3GT0A 3MMNA 1JR3E 1JTFA 1XZCA 3ZGYA 3IALA 1U1CA 3HWRA 2BR5A 4KR6A 3L18A 4K0RA 4OB7A 1XZGA 1KMQA 4BFSA 4HY3A 4PCVA 3MJ4A 3C2QA 5ALQA 4MOWA 1Y6GA 1QFYA 3F1LA 3AF0A 2QXUA 3Q2KA 4HX9A 3C8MA 5EUCA 4X00A 3OZEA 1LJ8A 5I9BA 4AJPA 4NCAA 3K5IA 3AR2A 3A3PA 1ETHA 3ROKA 4IAOA 3VH1A 4K81B 4MPRA 1YA8A 2HJHA 3JAWB 2HV8A 2XRFA 4B71A 3F6SA 2QMQA 3WNCA 4Y9TA 4LNAA 3DMNA 1IONA 2JGEA 4OUDA 2GXQA 2AVNA 2HU8A 1NBMA 1Y3AA 4UARA 4CIDA 1C3EA 3VR6H 4MP3A 1QQ5A 4DRXB 3E9DA 2X49A 5EZYA 2DHDA 1N2HA 2G36A 2SHKA 4NX2A 3TW4A 3INGA 2WYWA 2BF7A 4PAMA 4UEOA 1A2BA 5E1OA 3AIIA 2Q99A 3EVGA 3UH0A 4CKEA 4G0QA 1UL1X 3C3DA 3OOJA 1OXUA 3L7OA 2QX4A 4JQYA 2H3EA 5TVGA 4G4OA 1YA4A 2ZIAA 2ZRCA 5KYNA 3FJOA 4K6FA 1H94A 4OQDA 4KQXA 2W8ZA 2O8NA 1XZJA 3UUFA 5PGMA 1BU5A 4QDOA 4EO4A 1SK9A 3GUHA 4ZEVA 4ETMA 1V2GA 3PL1A 1E2QA 3DLAA 1Z5NA 3EG5A 4AI6A 2QP3A 2QTAA 2GSDA 2C5FA 4KWHA 3TB4A 1K8XB 1HXHA 2ZSDA 4ZI5A 3FH0A 3HP1A 3N75A 3HCPA 3QK7A 1DCTA 3UMJA 3FPJA 4AJOA 1VIDA 4Z9FA 1KI7A 3NHBA 3Q9SA 5FNVF 4OJTA 3STHA 2WSBA 3K4PA 4TUYB 1RQXA 3VJMA 1DWQA 4TKZA 3TLKA 2XGSA 2W2KB 4R4JA 2B2XA 3R4CA 1JDUA 2DULA 3F5QA 4DIDA 1W36B 3I9KA 2B3TA 1IBRA 3WKEA 2XZLA 4ZYXA 3JYQA 1YBFA 3N2IA 1N9GA 1Q3HA 3DVAA 1L8AA 2CXPA 4B7GA 3RSLA 3E3NA 3CLHA 4EUKA 3EIXA 1AGXA 4IBGA 5JAMA 1NBEA 3OZTA 2IITA 1FTQA 3V48A 2ONZA 4CIVA 5KHOC 3DC2A 2JLWA 5E9WA 2IYWA 5E6RB 1GL9B 3HK2A 1WX1A 2V97A 5ADHA 3UKJA 1YB4A 1KMMA 4RULA 1VPEA 1A2KC 5EIEA 2P91A 4C20A 5JE8A 3FR8A 1YZNA 2B7CA 3ZCBB 4GS5A 4L5YA 1UPAA 1OX4B 3ELDA 4QOFA 2AFIE 3NYRA 2F8SA 1MENA 3FR7A 4YLGA 3QVUA 4ID9A 4IDEA 4KWTA 3FVTA 1M2VA 2G1UA 4HI0E 4XR9A 1A7KA 3KJFA 3HADA 3EFEA 1DT3A 3HV0A 4HRAA 1BS9A 3RTAA 4L73A 1YR9A 3ANNA 3ZV4A 4AZ0A 3ZPXA 2VRCD 1U3UA 3NEYA 1G21E 5FDFA 4UXIA 4EW2A 3OFVA 2X9GA 1TUEA 2VBGA 3M7IA 5KNBD 1CF9A 2BUAA 4Z9AA 2BMJA 2I4LA 3QLEA 1OLUB 5EE9A 1R0YA 1QRRA 3OIUA 1CUZA 3KJHA 4MITA 5HCNA 1JH8A 2GVNA 1O77A 1P7WA 4RHYA 3MFYA 2BY4A 3WLPA 3ZD6A 4EZEA 1DT5A 1LWOA 4BQRA 4CU2A 1XRLA 4FMBB 5L3QA 4AG5A 2QTVB 4OHZA 1KZHA 3SLRA 4EABA 1PZNA 2M6LA 4D9JA 1JHZA 3FCXA 2FSSA 4TV8F 1J0BA 3MOSA 2FMXA 2X6TA 2ZJZA 1QB8A 1CFZA 2VXBA 1BVHA 2CLCX 2JRLA 4IO1A 2AV6A 1W48A 4AN0A 2IY9A 5K0TA 4JC0A 5F7XA 4PO3X 2XLBA 4L07A 3GT4A 6ABPA 4OLJA 1J5PA 1NT4A 2JFWA 1DX9A 2XKAA 3UT5A 3FSRA 1NA5A 4ND3A 4GI1A 4NENB 4PQFA 4HZUB 4Q1CA 1R8SA 2R5NA 1XMOB 1TUBA 2O8DB 1HQKA 3F46A 2L2QA 4BX3A 5DPMA 1O1YA 3ZHBA 1QS0A 4EF5A 3WNVA 4H31A 3IAAA 4KSCA 1UOPA 3MCVA 5F3WA 5GZ3A 2OAP1 4HNSA 4M9ZA 2C42A 3CSDA 5TQ2B 2Y76A 2RGUA 3P45A 2WWFA 2BM0A 4B4VA 4PRYA 3P2EA 5CA0F 4DV1M 2HEGA 4OAOA 4DT1A 3HKEB 2I8CA 3TVTA 3KTAA 3B8EA 4WP2A 4Y2JA 1RCUA 2OP1A 3GDOA 1SCJA 3ZI7A 1X80A 2DHRA 1Y7IA 5H1YA 5B30A 2HL6A 4D99A 1DELA 3ZXUB 3WBJA 1XMOM 7CATA 2QI9F 3B7ZA 4I7EA 3DEYX 4HPXB 1SBHA 3CF0A 5E6UB 1SMKA 5D5HA 5JAIA 3CO5A 4D79A 4F9FA 2UDPA 3OJFA 4KGDA 1OKKA 3ZWXA 1ZH0A 1NW8A 4Q7JB 1J21A 3LOUA 2HGSA 2YC2C 3NKVA 3IDFA 1FP1D 3J81S 2XCSB 3HDHA 5C1BA 4X7PA 3OE4A 4U2FA 1K66A 3K96A 3SS9X 2QORA 1WG8A 3CEPB 2GERA 2R1VA 1FQKA 4YCBA 3LCJA 2EGUA 4FMDF 4ENQA 4H7EA 3D8RA 4FOPA 3PUZA 5JXHA 3UAGA 3IMEA 3DMFA 2CXUA 3P4YA 1QIKA 4R2XA 1U98A 1MVLA 4RZXA 3CZMA 3MF4A 5E7QA 3LT4A 4K88A 1WZUA 5AJWA 1D03A 2Q5LA 2ONJA 3GLFE 1O0BA 5IXJA 3BMQB 4JJAA 1KRXA 1XYYA 2AQ8A 1X14A 3E0QA 2Q5OA 5BW8A 4HDQB 1EFVA 4CI9A 4L51A 4RM2A 3U5ZB 1LRKA 5IKMA 5EZSA 5HIKA 1MW8X 2FY8A 1GT91 4Z2AA 1EFLA 3VR5H 1F6DA 3QBDA 3WLOA 5K0BA 2NVBA 4TUYF 3QWLA 3KYCB 1QANA 3W3AH 1VECA 2DENA 1F2UB 4QRDA 1SCAA 4DLRA 4R81A 5D3MB 3ZHZA 4UHJA 3K4HA 3BILA 1HA3A 3P52A 3TLXA 3VR3A 1IVSA 2WYIA 2FFAA 3UMGA 5JPIA 1MX3A 1ODTC 1FYXA 3QEOA 2Q4EA 4RNCA 1K7SN 2I80A 1ZVKA 4LFBB 2WOOA 1SXJA 2GFQA 3HL0A 3CFYA 3QBTA 5AK5A 1BXKA 2MSCB 2OCXA 3CRZA 1EDDA 4ZVNA 1T9KA 3OPNA 2QHOB 4D1YA 1V41E 3B3QA 3O90A 2R8PA 4URXR 4PLWA 4ZMSA 3KKEA 1FP4B 3GCGA 2VDVE 5EEGA 4PYQA 5BT8A 1GTJ1 5JZ9A 3RHSA 2OPBA 3ZC3A 2GPAA 3BGIA 3JTEA 2QTWB 3FFWA 5AK0A 3D4PA 1Q0QA 1YDMA 2EX0A 5EXTA 4LFBM 3QEMB 5LU8A 2B99A 5HCUA 3LXUX 4B79A 1HH4A 4I4TB 1N2CA 3JASA 4MI1A 3QEBZ 1SHKA 1FTWA 1ONSA 4DLZA 1Y9AA 1DBIA 1PT8A 2NG1A 2WNIA 4TYMA 4P0QB 1EG7A 1QZTA 1OYWA 3TLJA 6NULA 4S1PA 1Q15A 4LJ6A 4KOEC 1UWVA 5TS2A 1C0EA 4HN2A 1M7BA 4FDAA 1W2WB 1Y3BE 3CW8X 5CM9C 2VHUA 2K87A 1QFXA 1EFPB 3QG5A 2FKNA 1BN7A 3D3WB 1JT9A 1AZLA 4YT8A 1X39A 3G8DA 5DGXA 3E22A 5IANA 1CUKA 4PX3A 4F21A 2FRXA 1AS2A 3JSXA 5IC6A 5K3DA 2AJCA 1VCOA 1NQVA 3A3KA 1SOMA 4BX9A 1W34A 5KKNB 4EENA 1B8VA 2KNZA 4EW1A 4HX5A 3UAYA 3TNYA 3AMVA 3N2GA 3JQGA 1SU7A 1E20A 3NFRA 5BPHA 1GL6A 3AETA 2UVPA 1TH2A 3N59A 4QPJC 1DDGA 4BNLA 3CF6R 2UXBM 1UBTS 1YZYA 3L9WA 5KAMA 2VVTA 4PY2A 1P18A 2GQFA 5EXPA 3EWIA 2F3SA 2ZDHA 2PM8A 4OATA 4O08A 4LMPA 2F48A 2Y1FA 4HVLA 3FVWA 4GICA 3L28A 1CIPA 4DDMA 2VWPA 5E7IA 4KQGA 5FPPA 4G5RA 3ZGLA 1GWNA 4BECA 3ISVA 3TFWA 2XYVA 4LYJA 2AXEA 4KVAA 1E3EA 3QE4A 4ZAXA 1WHTB 1VE3A 2C2KA 3BZBA 1OIXA 1ORWA 2QD3A 5EE0A 3DSRA 4M98A 3D8TA 4G4QA 2B8TA 1G8KA 4UREA 1YSYA 3BWXA 2IODA 4QDXA 2VPPA 2VP9A 1PNRA 5HF8A 5EWMB 2O54A 1VKHA 4ARUA 3IUPA 1E89A 3CHYA 4F9GA 3ZE0B 4GKBA 4QO8A 1XMJA 3JWJA 3MQ2A 3ODPA 2LP4Y 2P2ZA 5C7LO 2BD0A 3L93A 3L1JA 1Z2DA 2ZB8A 2HEIA 1I80A 2VUHB 3F74A 4QG3A 3E1GA 3VU8A 5G1OA 4X60A 1IMOA 3D7MA 5A0VA 2Y0CA 4PPYA 3ZXXA 3EGWA 1TUGA 2V1XA 2C07A 3RE8A 4KQ1A 5ALTA 1Y7TA 4KACA 1C1DB 1TW3A 2J6HA 4DZRA 3QYJA 1UC9A 3I8XA 1I4OA 4KNYA 2IW1A 3SNHA 1KP3A 1P3DA 1RU3A 5JQGF 1G66A 1VDDA 2I34A 4QJ4A 3U4CA 4G8DA 3V3TA 4AWAA 4DJDC 2GD0A 2FE8A 3SMPA 2W48A 5EJIA 2VSYA 2OMKA 3VU1A 3RWMB 2ZUSA 2OHXA 1I2MA 1NIPA 4P3OA 1TIKA 5AHWA 2ZB2A 5A3JA 3EISA 4FN5A 4YAUA 1W581 4F3TA 4FI3C 1FYVA 3OQ1A 4C6SA 4S0ZA 5J2UB 3MGAA 1CS0B 4AP9A 3HKBA 3X1WA 1NULA 4IJQA 5FWYB 2AL7A 4PCZA 5LXTF 1LDBA 3NWEA 1Q84A 1Z6TA 2NT3A 1KYWA 2IP4A 2IYQA 1JPNA 1E60A 2JH3A 1H23A 1FNDA 3MJHA 2EF0A 1FL9A 3PNOA 5CBPA 5L4SA 3KSAC 1JEEA 2MOKA 3COPA 1GCIA 2GN2A 4Y7DA 3SIPA 5HK9A 4A6EA 2VK2A 3MHVC 3BEOA 2V9ZA 4YA6A 1XNGA 4P3PA 2H11A 4WKGA 2XEPA 3Q8KA 1XCLA 1OFUA 1Q44A 4AY2A 1Z7YA 2Z1NA 4D0GA 1TCAA 1W6UA 5DNVA 5JMTA 5JCXA 4NARA 5C5IA 4KQ2A 4Z9BA 3I28A 4KDEA 1BOOA 1XLUA 5K8CA 4NBSA 2ZUBA 5DMXA 2LVOC 2PA3A 3WWCA 2ZCJA 1UQUA 2PH1A 3UOAB 4NXMM 1K5DA 5IAEA 3IB3A 3KYDB 2P5TB 4CJ6A 1QDTA 2WFZA 3OU7A 3TZEA 2CHFA 4ZI7B 2LIVA 2VTBA 1DO8A 2A4KA 4ND8A 3JU3A 2GXSA 1FXUA 2SCUA 2OAQ1 5KB3A 2BP7A 1X3SA 4I1YA 1N1MA 4XLLA 4DVJA 3H4MA 5LOVF 3UFXA 1IOVA 3L8EA 4G97A 4MUJA 4Z9XA 4WJKB 4J0EA 4V1CI 4YO7A 4TWJA 1TFUA 1NLUA 5DI3A 3CZPA 2YDXA 4K9LA 2V3VA 3PHJA 2V58A 4NU5A 1GP2A 1U1DA 5EWLB 3KP1E 2YDYA 5B6JA 1OT5A 3BF7A 5DSZA 4F92B 4PHHA 3RB8A 1I3LA 1QGUB 3B51X 4FGKA 3ITDA 3H2GA 1QX4A 4PAOA 3RUAA 3MGCA 1ULHA 3X2FA 1YONA 2OCBA 5EJ9A 1Q74A 4HEA1 2BN4A 4CLHA 4ZCIA 2DT8A 4MVJD 2E87A 2YTZA 4Z3OA 1N8NA 4FOOA 4GP7A 4CIYA 1YCHA 4TKMA 1XDGA 1YKSA 2GCPA 3FWPA 3UHPA 2DT5A 1TT7A 4QLAA 2Y66A 1EP3B 3C3XA 4D92A 3HA3A 1JFFB 1ZN7A 4G65A 3EQ9A 4FDMA 3H9GA 1WLSA 2JH9A 3BXPA 3Q5EA 4KR7A 4EELA 2C57A 1CF4A 4QOEA 4DA0A 4EHIA 2AD1A 4X3PA 3FPAA 1JJIA 2Q9CA 2ZSAA 4KR0A 4RHEA 4DLWA 3AFHA 4MUEA 4CMIB 2GPSA 1T2CA 1BKYA 1XHEA 3ZHVA 4PS1A 5IZCA 1IPFA 1QUFA 1P0FA 2IJGX 1DPGA 1RAGA 4L6V6 3P94A 2P9QA 2XOKD 3LVVA 3BJRA 4G9GA 4L3WA 1C30A 1YMVA 2WT4A 3MB5A 4P5DA 3LX4A 2X8JB 3M2TA 4PC3A 2P35A 4UM5A 3PXEA 1NQAO 4CL8A 1P72A 4K9SA 2EATA 3K9GA 3CPJB 3T1NA 2XUAA 1SBIA 3DLTA 1RCFA 2JFNA 4R31A 3CIOA 1OC2A 4UJ3A 4MTLA 3NM4A 2P6OA 2O8EB 1DADA 2G3YA 1CVRA 2XB8A 4PS0A 4NZOA 3PEEA 1DO2A 4BNTA 3D3QA 3JQ7A 2IV3A 4KR2A 4B3JA 5AI5A 2HU2A 3AL0C 3FHCB 1Y1KE 2WPDD 1WZIA 1XZLA 3DWGA 4O59O 2I4OA 3E9QA 2J41A 1U9IA 4NG4A 1L5NA 3WGNA 3M89A 1RQRA 2AKAB 3CZ5A 4RSHA 5TEVA 5KYUB 2X8BA 1V47A 2KNAA 4W1QA 1K2WA 2WHEA 1OXBB 3G82C 1PJ8A 3GEGA 1PHRA 3PWKA 5C1DA 1NRIA 3B1ZA 1D8AA 2VPYA 2FE4A 3FCSB 4RXMA 3KYIB 5CFOA 1F6WA 1B7GO 2J9ZB 1XI2A 2Q4TA 2VXCA 4BV9A 1OX5A 1UKYA 2JAHA 2ST1A 4XLZA 2ZSFA 3HZHA 1NTOA 5DNWA 5JSKA 3EIFA 3SIWA 3V4FA 2WHQA 4ON9A 3JARA 3OPYA 4GX0A 4TV9F 4RDIA 3GYGA 2O3RA 4P31A 1CEXA 5IX8A 3BN3A 3A7EA 5CVCA 2XECA 2P5YA 2HFKA 3OETA 1HBJA 1SB8A 4EGSA 2I99A 5J2UF 4CEJA 1DARA 1ZGHA 4YREA 3DE1X 5ILGA 2QJOA 3T9AA 1HLDA 2MYNA 3MILA 5TARA 1E9FA 2FUG1 1TNDA 1IJEA 3GJRA 3K2BA 4A73A 1T6ZA 3U5TA 1E69A 4EPTA 5HQJA 3G2OA 3LK7A 1O54A 4I50B 2QYOA 3QKSA 4XQCA 1VBKA 2ZXUA 4MW2A 5FPTA 3ZWKA 2LCQA 3SICE 2P27A 3PA6A 1Z2AA 5BSWA 2C20A 4X93A 1ZUIA 6GPBA 3RS5A 4IJMA 1X2EA 1RKVA 2ZYIA 3LC2O 2F8TA 3C5HA 1F8GA 1I5EA 4PN7A 1J06A 1UJ5A 1W76A 4ENVA 4KITB 3RSCA 1PDWA 3DCIA 4R9VA 1SXJC 5G0WA 2VP2A 5LIPA 3RFUA 3VYTB 5FTWA 2G88A 4ZI7F 4ME6A 1KE2A 3T94A 3KSUA 4JU9A 2R6JA 3KVWA 1B8NA 2LPMA 2IY8A 3EZ2A 5MF6A 5COQA 2NMVA 1YE9A 4HADA 3QHAA 4X7BA 4TQUS 4ZP1A 1GDDA 3EIEA 1RACA 4OL9A 3B1XA 5B6IA 4N49A 5BQ3A 5DN6D 2PYZA 3UJBA 1XRNA 4GE3A 1X1AA 4EPVA 2XDQB 3K0CA 5CLHA 4MV8A 1S2DA 4FJ0A 2BBWA 3UWOA 3RVKA 1T8PA 1WO8A 2JJ1D 2XJ9A 1HT3A 2UU9M 3LQYA 5EJ8A 3FMIA 4PZYA 5IFLA 1DAMA 3LQQA 1NKTA 2NO7A 1OH7A 4LVCA 3DZ8A 4EAAA 1ZXXA 1JFTA 1C9EA 2UZAA 2OLEA 2V03A 1QHHA 2ZE5A 1R9GA 1GLVA 4PQEA 1W2GA 4ZOBA 2O14A 2Y27A 3D43A 1A8PA 4A0GA 3MTAA 4JBIA 2YJTD 3VHLB 3ZY2A 1ELOA 4BQIA 3JVUA 5K4HA 4C2AA 4EARA 2V6MA 2GX6A 4I1IA 4U7FA 3VO2A 5BORA 5EHXA 1BS2A 4L02A 3V4PB 3DUFB 3MQFA 1MPTA 1SQ5A 2IIVA 3LQKA 5ALYA 5AXCA 4WLVA 1Z18A 2I4NA 5EZYB 2QRVA 1C9DB 2IYNA 4BWYA 3L0OA 4M0MA 4JQCA 5LDHA 1FXWF 4KBGA 1PGOA 4XARA 1EHCA 2DVMA 5I7AA 2EWVA 1VZ3A 1PEYA 4FSXA 1Z74A 2VRBA 2QZ4A 1Q0PA 3RUCA 1A88A 3N6VA 4CKEB 3CT6A 1MH9A 1DRUA 3DV0A 2FSVA 2PRKA 5NLLA 1P17A 2Q6IA 3FOWA 3K6SA 1PWYE 2GZHA 2YVLA 4C5BA 2I7XA 5IDWA 2P2SA 3C6XA 3EYAA 2XNKA 4Q4AA 2JCYA 4JOQA 1IXKA 4NS4A 2DBYA 1BDJA 5DJ5A 1TM5E 2XWSA 3ZV7A 4I6EA 3D5EA 3SKVA 5DYWA 2VATA 2K5UA 3ESRA 3AVWA 3RSOA 3DT8A 3IAFA 2E4VA 3A1UA 1JJVA 1KK1A 4B84A 3EIQA 4M0PA 3AJEA 2I3GA 4YJFA 2HXYA 2XD9A 2DAEA 3EG9B 1XMSA 3IX7A 2ZFUA 1SRQA 3IAM1 5LNK1 2TSYB 1AGYA 2D2IA 1VP3A 2JGDB 1TEVA 2Y0DA 2QGNA 2C9YA 2EG5A 1XUOA 4CMKA 4OKNA 2IYUA 3C7DB 3C8ZA 3HA7A 5KS2A 3U3JA 1B0AA 2B4QA 3BREA 5CCDA 4YCMA 3BJMA 4Y9UA 2BIFA 4OBEA 4FQ5A 1Y63A 2FZ4A 1YRAA 1X87A 1U9CA 1QE0A 1NP6A 4BKQA 3KOZE 1QVZA 3WL3A 4L15A 3RU3A 1P7YA 3G9XA 1Z5CA 2YRFA 2DGDA 3K5PA 3ZWNA 1QOQB 4AJ2A 4QQNA 3K3PA 4LTMA 2FPGB 1SH7A 2CCGA 4DA4A 4HQLA 3KL2A 3BQNB 4EUHA 2V7WA 3QAUA 2WUVA 1N9GB 3GG9A 4DXHA 2Y9MB 3DVAB 4LF4B 1FE8A 1A72A 3K32A 1VB5A 2HSEA 2L18A 2YZKA 1IQRA 1DRJA 4A92A 2C4VA 1A04A 2ZJYA 2Z6VA 2CXQA 3WO0A 1XTVA 4INPA 1GGNA 1I94M 1EJ6A 2OA0A 4ARZA 1HF3A 4LF5B 4KIFA 3ASZA 4BAZA 4ALIA 2C7PA 1PP4A 1JQ5A 1CE8B 4LF4M 3B7WA 3WWOA 1ISIA 5IVPA 1KJYA 1L6RA 1U94A 1ZBQA 5AWFC 3RLIA 2BAGA 2JEYA 1DTWA 2BFCA 3CNLA 4HDAA 4PRZA 1M0SA 3QEKA 3E6AA 2I6QA 2ZTUA 4BP3A 4R3NA 1JSZA 3UHAA 4OHXA 3W90A 3PGVA 4B6PA 1E2EA 4Y18A 4LF5M 1YC5A 1K82A 1WJ7A 2YW2A 1G0OA 1G8AA 2EBHX 3ENVA 4BJ6A 1G17A 4C21A 3L43A 2JLVA 2HKIA 5A3QA 2BV3A 4J0FA 3G0BA 1BJRE 2GJ9A 4YMGA 1L3CA 3EC7A 3I9OA 5FR1A 5ADWA 2BHSA 1NAIA 4TZTA 2JZNA 3OUTA 1BZYA 3IUEA 1YO6A 3LG2A 2RAUA 1GARA 4OGGA 1QK3A 5L3QB 4I55A 3H2JA 5DW0A 1E2JA 2WIJA 1E4VA 1PGNA 2HRDA 1YIAA 3ZZTA 3I9V1 4GRDA 4FFLA 4LC0A 3UB4A 4MNTA 1TQ2A 2WTAA 2OPFA 3CPSA 3OEHA 1XRJA 2NTEA 3CNNA 2HR1A 1V25A 2I0FA 3TTUA 1KAQA 2W2MA 4XZ3A 2YN4A 3C4VA 1GT6A 1HTWA 2JI6A 1XKTA 5A5GA 1GSOA 3FW1A 3EY4A 1RXEA 4QXRA 1CD5A 4KB5A 1M2WA 3ISJA 3QOXA 2YZGA 5E4TA 3LKZA 3NTVA 5IH7A 4K9DA 3UT5B 2O1XA 4J49A 3JD4A 4HQ6A 2P2CA 2HWUA 1JX6A 5ENVA 3I0MA 3H13A 3ADOA 2EZ9A 2MINA 2VZLA 4AW4A 1BE1A 1TUBB 3KS9A 1KOJA 4Y2XA 1P0QA 1SOVA 5D3ZA 3ZGNA 4IDFA 4D0RA 1XZEA 4HXEB 2HJWA 3E2MA 1ZMWA 1DO0A 1QS0B 4DV6B 3WGOA 3MWGA 1PTKA 4PT5A 2EBWA 4F93B 1XCBA 2R7AA 4Z51A 1VKNA 3OQJA 1G8GA 2JP7A 3T1HB 1STOA 3N2EA 4N18A 4IH9A 4IIJB 1X37A 2HBZA 3MB8A 3BE4A 1EKXA 1KNQA 3Q3EA 5ILOA 4R7ZA 3Q1KA 1OFUX 3KJEA 2HQ1A 3VHXB 3KTAB 5JISA 3V4LA 1OHHD 2HHLA 3NHYA 5ERYA 4FWIB 4RIHA 5DHSA 1NVMB 1P31A 2FLVA 4ZVOA 3FLMA 2JFUA 1V39A 1M74A 1W0KD 1T5HX 4HGRA 2H1CA 1JHMA 4GL2A 4FPXA 1C3VA 2OBLA 4NS1A 3T1HM 1MW9X 4PPGA 4DNFA 2PFKA 5AOCA 4IVPA 3IEVA 3MYYA 2QRLA 3ZC7B 4AL4A 4BFWA 3KKOA 4R1QA 4ZKEA 2F6RA 1UJ2A 4MI3A 1G1AA 3O92A 3VMFA 4Z0TA 2R1VB 2AEFA 5IZCC 1JG7A 1FLVA 4TL6A 4EW6A 4OUKX 5DGDA 3EPPA 2HRQA 3PDIB 3WLAA 3LFTA 5JMOA 2H4YA 4HQKA 8MHTA 3K0SA 3FMVA 1QPGA 2H85A 4A1OA 2GF2A 4CM9D 1PBNA 2DBQA 1TAGA 5A5VA 1C3JA 5IVHA 4JCCA 3AHIA 3GF4A 3QXSA 1FVFA 1XMPA 2NO6A 2OVBA 2Q46A 3O95A 1L2BA 3KR1A 2NU8A 3SR4A 1C8VB 1EIZA 1EFVB 1Z0AA 4Q15A 1L5HA 1XMIA 4RDHA 2G0NA 1BYIA 3LYHA 4RAQA 2BEUA 4GPBA 421PA 2QPTA 2WM3A 1M1NA 5DO9A 5CLQA 1D1QA 3U7GA 1G9XA 3UW3A 2FU5C 1UXHA 5CLIA 3BH0A 1D2CA 4GOXA 4ZTZB 2ZWOA 1M6VA 1RYHA 3Q5GA 1P77A 3BJEA 1Y5LA 4HEQA 3UWSA 1VDLA 2LW7A 3ZE8A 2R00A 4FGWA 4IOLA 1Y3HA 2VUUA 1I1NA 1V7QA 5B7QA 3AI7A 1CY2A 3RI3A 2CL7X 1HLFA 3OA0A 4LE2A 1Y6QA 2OCYC 3E3LA 1CJKC 3HHZA 1NN1A 2V7BA 1ODSA 2SBTA 3QVVA 1NX9A 4ZEWA 3U56A 1SXJB 1GQFA 1X1TA 3KG2A 3IV7A 5I51A 2JFBA 3KKPA 3A9CA 1TKCA 1DEAA 1SZCA 5JRJA 2PK3A 4E5VA 5ITYA 4GITA 1PYGA 4YJ2A 1ZNYA 4NFLA 2O8CB 2C5HA 3NBKA 4X5OA 5EN4A 3QEJA 4YHBA 1N75A 4DJFC 4MJLA 2I2BA 1KZYC 5IJXA 2QM0A 4LF6B 3VZBA 3UK6A 1JHPA 1K8ZB 4I3FA 3GFPA 4EECA 1ZJYA 1Q0TA 4IJ5A 2YWJA 3S70A 2GBPA 2E48A 1N2CB 3JASB 1VGRA 3EJWA 3PQ4A 4L8WB 3CISA 4KPGA 4WBNB 1UAAA 4E5NA 2YCLA 3I01A 2FFHA 4MW1A 3D0KA 1Z2EA 4LHYA 4OLHA 1OYVA 1I2BA 3ZHXA 5REQA 4QKQA 1Z7WA 5IDXA 3DOAA 4LF6M 4TN1A 2WVGA 1J0EA 1YF3A 5B6PA 3LXRA 2GK4A 2OV4A 4Q6WA 3PQ3A 2GO1A 3DTVD 3E22B 2OYRA 4ZN6A 2G72A 1G7TA 4Q02A 3BZWA 4ND7A 1TM4E 2W37A 1GKIA 3VPDA 1NW4A 4K9KA 3GY0A 3I5YA 3WQBA 3FKJA 1LLDA 2GXUA 1DAOA 4UHCA 3KALA 2DUUA 4C43A 3DE0X 2O5VA 4AQYB 2CZQA 3TOSA 3GZNB 2H1HA 1LVGA 1B1AA 3N2GB 3DC7A 3AEXA 5CTAA 3DD1A 1Z29A 3AETB 4TWBA 4BMXA 1VYVA 3AH8A 5DISB 3E4DA 2ZBPA 1U3TA 2O7QA 3PNPA 2ZWPA 4HS4A 2QLTA 4K86A 3RAJA 5GONF 3OZRA 1N36B 2JHFA 5EUBA 4OHBA 1VHQA 4KQJA 2K0BX 1PRYA 3CYFA 1JNXX 2W6JD 2ERCA 5A02A 1GN8A 3QU9A 2GHIA 5EOVA 4DIKA 4C29A 4JMLA 5I7FA 3P2JA 3K0CC 4AQYM 3UGQA 1RYMA 3DZFA 3LMKA 3H75A 4EI8A 2PWBA 2PRZA 2GCGA 2Q5QA 4GOOD 1RI5A 1WSWA 4EHNA 3UB3A 1L7MA 1QQAA 4OVZB 5F5NA 1ECPA 4FN4A 5EG5A 4B3GA 3WXBA 1ZN9A 2UZ1B 3H04A 3MWEA 3TNDA 4XWTA 1NOIA 4IIJF 4N3BA 2R8XA 3WISA 2Y99A 3TAHA 1C0KA 3UCFA 5ITWA 2ZUEA 3LPNA 4JLUA 3WL8A 4ZGGA 3FHJA 2DFTA 4BGUA 3ORRA 1PX0A 1KF0A 4JI0B 2BMVA 3I1IA 4QG7A 2RHOA 2YRWA 3ZNQA 1YVRA 1XDSA 2FOXA 4O1IA 3SM9A 4PGHA 2XRMA 4BDTA 3TQTA 5SY6A 2P2NA 2X1VA 5BNTA 3PLNA 1T5DX 3R7WB 3L1UA 2MSLA 4N5IX 1YE8A 1XAHA 2DBRA 1JIJA 4GRIA 2Z98A 4BVGA 2FSVC 2N9UA 1Z6AA 3G6KA 1CJVC 3QWFA 1TZKA 2J46A 4RD1A 4KGVA 2O8FA 4KQCA 4JI0M 1KQNA 1H6UA 4AO8A 4M49A 3QMMA 2ZSKA 3B9PA 3ZW9A 3RVBA 2BUCA 1ZD8A 4OAQA 4DBLE 1V7CA 1TF2A 2WWRA 2YN2A 5KWSA 4WKCA 1ZGZA 3SYTA 1GNQA 3LBYA 2JIBA 4UNRA 3HKBB 2ZSUA 1ST3A 1IWOA 3K70C 4TTTS 1UDWA 4ZU3A 5JYCA 4EEKA 2IY7A 3V8RA 5JI3E 4W5RA 3UJDA 1V7ZA 3LYUA 4KO8A 1BGVA 4PZ0A 1ML3A 4F1KA 3KHUA 4HEOA 4DIUA 2G3QA 3I5UA 2KE5A 4ZOLA 3O5AA 4Q3CA 4MUNA 4D3ZA 3LHDA 2R97A 2V4MA 1GU0A 2A86A 3PWTA 1PJ3A 4D3XA 2OL4A 3KSJA 1Z4LA 3QEAZ 1BE8A 3NGLA 4EKDA 1URPA 1CUFA 3R0VA 1U28A 4Y3UA 4YRKA 3PUKA 2RMKA 3KKQA 2XDAA 6YASA 5CP8A 2QAGA 1QHEA 4NP6A 4M1ZA 4P93A 2QDXA 3B82A 1QGZA 3ADDA 3NDIA 1NF2A 2G5GX 1ISRA 5GZ6A 1F8YA 1G20E 3WZMA 3DBOB 4MQEA 2PAFA 4D6PA 4WN9A 4CLRA 3GQ3A 2QUHA 1E4OA 2H7XA 4DUGD 4GYWA 2VTBB 3JQ8A 4RFLA 2BFEA 1TCBA 4ND8B 4HTFA 3CW2A 1A7UA 3RVPA 1LFAA 2PAAA 4KAJA 4XDZA 4O0LA 2N1BA 2BP7B 2C82A 4Q4HA 3K71B 2AR7A 3ZWMA 4QECA 3UFXB 3ETGA 2IK8A 5CYPA 4XWOA 1CJBA 4EWLA 4REOA 3REGA 1W35A 3GJ8A 3U0VA 3ZGOA 1YUBA 1TZJA 2VSQA 1DJMA 1ODFA 3LUCA 1HX7A 1JE0A 3LFHA 1AF7A 5DI3B 3T5PA 1FSPA 2CJPA 3FBWA 3J7AS 2E0IA 3FOBA 1S2IA 2J7PD 5JH7A 1E9SA 3DDSA 3EEOA 2DQZA 3TJMA 1WE2A 4U8GA 3MG9A 4PLZA 4ZJPA 1XD8A 4ZZ1A 2F5NA 3HKPA 2ZSBA 2AW5A 4PLYA 2LTUA 1T1SA 5K3CA 3PGLA 1MEJA 3AKEA 3TKLA 3NIFB 4WBNF 1RWWA 1OZFA 3ORFA 4JBWA 1E7MA 3CSUA 2I6FA 2Z5VA 3TIXB 1MCZA 1Z7EA 2AN1A 3BFVA 2A14A 3H9CA 3VC2A 1VL1A 1ZHFA 3IXQA 4YAGA 2XTJA 4C0SA 1CYEA 5GPBA 2LVNC 3H4VA 2J9FA 4S1TA 3DPSA 3TH5A 5JXWA 3L6DA 2VDNB 1WY5A 1PJCA 1YVUA 1NMQA 1PZMA 4QXPA 1FRZA 1GQ2A 1DLJA 4CTMA 4M9CA 3RDPA 3DL0A 1QAOA 2O1SA 3VGPA 2EZUA 4W7HA 1SEVA 4WOJA 2BFMA 4DQXA 2JI9A 1THGA 2AZTA 1GAWA 3E4CA 5LZ7A 1Z2NX 1XZ8A 1X7YA 3MWYW 1FFSA 5E2BA 1I7SB 2YFQA 4V3CA 1LBEA 4XVCA 1SBTA 4B82A 4PZUA 1H2FA 5K3FB 1JWAB 4B3IA 5K6AA 4JSRA 3REOA 3HXTA 2FEKA 4DWVA 3U4IA 2MT9A 1LKZA 1DIGA 3KYJB 2VOEA 4R1NA 3HRHA 3IGFA 1H8EA 2PUEA 3TWOA 1X9HA 2JY7A 4P80A 1CY4A 4RKUF 3SZLA 4XI9A 4NZPA 4AZFA 1XB2A 1KO5A 2Z09A 3H86A 1MRNA 1OT3A 2QN7A 3DNPA 2BLNA 3ZE2B 1PR2A 5KYTA 4QIHA 3GFVA 1AS3A 4QRHA 3B7NA 1J2JA 3G1TA 3QQPA 1YL7A 4ER7A 5ADVA 4II3A 4G5HA 3ZWQA 2VPQA 2OVFA 1BOFA 1BC5A 2I87A 1XEWX 5AOVA 3EVEA 3EGIA 3V34A 4XM2A 4MDEA 1W8DA 5TT0A 3FMGA 4LRWA 1AT1A 2IPLA 2IUEA 4CM8A 4PO1A 3GVIA 5C35A 2DAKA 3H7AA 5C7OO 1U3GA 4C08A 5KTRA 1SIBE 3CC8A 4E5KA 3CGGA 5JJBA 4GOJA 4G5QA 3MAJA 1QDLB 3DAHA 2QR5A 2XYQA 4Z53A 2E3JA 4B9AA 3IVMA 1G5TA 5ALHA 1F2DA 3C0KA 4IDHA 2F3TA 2PGLA 2ZYRA 3IEXA 1V11B 3GJTA 3EA5A 4B2LA 2ZI7A 3AZQA 5CXQA 8OHMA 3OPYB 3VR6D 1E6LA 1SVWA 2PSSA 2CXTA 2R5WA 3EUEA 3HZJA 1IULA 3QMPA 5F4ZA 1QYDA 1J2RA 1Z35A 1SVNA 3V33A 1PJBA 1QNFA 3NXKA 2XSZA 5JWOA 4CEJB 2ZJ8A 3VI3B 1X0XA 3L02A 2HU5A 2P69A 4ZU6X 5C9ZA 2ZYDA 4BBPA 3NHWA 1JS1X 4H1UA 2HHJA 4MQFA 2N35A 4CLXA 2GLUA 5E9JA 1PT7A 5FP0A 1XA4A 5AKEA 2I2XB 1KHHA 3QKSB 3CLUD 3HYNA 3LY9A 4JJGA 1ORRA 5EMLA 5FUQA 3ADCA 5EP4A 3OLYA 4KWEA 1DAIA 3UZUA 3UQYS 4RTLA 4Q0MA 3S2YA 4EDFA 5ECDA 1QRTA 4C01A 4P4GA 4OHOA 3PJRA 2FR8A 4KZPA 2R00C 2G5CA 1RHQA 1GNPA 4PC1A 2XXBA 1IBCA 1RAIA 2IXFA 4OXKA 1JECA 4MCJA 1UXGA 2A9KA 2C3UA 2AFVA 5C0OE 4QDZA 3JX9A 3K9LA 1OJ7A 3GPXA 3V9PA 3PQ8A 1MO4A 4NCXA 5D00A 1YQQA 4Z7JA 1YFZA 8ATCA 5JAOA 2Q5JA 2D1SA 2I4RA 3DE5X 1EE8A 1Q57A 1DKLA 2WLSA 4CEIB 5TGDA 4HEHA 2A5FA 4N41A 1QAMA 2NVOA 5E3JA 1SY7A 3ORQA 4H7KA 1Z2PX 1VI5A 4BMSA 1UK9A 3Q72A 1VA4A 1YS6A 1SR8A 4UNPA 1DB3A 2C2YA 5G0VA 1N0WA 4POAA 3KT0A 1E94E 3DEJA 3G2KA 3NNSA 1ZVQA 1T4DA 4LBVA 1XG5A 4TYQA 5IFKA 1H4VB 4X7RA 1M8JA 1A7JA 3P5BA 3O4RA 4D8YA 3S4YA 3VTZA 3QFRA 1IUNA 2F5PA 1UQRA 2OGSA 1AUOA 3THRA 3P9YA 3FOCA 1JFLA 4WZBB 3V7NA 3H16A 2XMQA 2V5AA 1H2WA 1C2YA 3G89A 1RBMA 2R18A 1H1TA 4J1SA 3G9UA 4W5JA 4YROA 2X8LA 1GNSA 3PEWA 2EGHA 2QV7A 1KZ9A 4EGQA 1GZDA 2ZJ2A 4Y6LA 4WZAB 4FNAA 3HBNA 3JCZA 1VJ5A 1C9KA 2PFGA 2XT9A 4IUDS 4UUPA 3AM4A 5KINB 4UEJA 4WXPA 3R44A 1E9RA 3B7GA 1T1IA 4AC9A 5BRJA 2QRVB 1Z38A 4YJHA 4PYLA 1EBBA 4M1MA 1U1IA 1MGOA 4EW3A 1IEXA 2XMRA 4B6GA 4TKUA 4BNZA 4WVLA 1PGYA 2QRUA 2C8JA 2O1WA 3N2NA 2J6CA 1EWKA 3IKLA 1E2MA 1OWPA 1CUXA 5ALIA 3SBEA 3DV0B 1XN1A 3K6SB 1PD0A 3ZDYB 4GUAA 1LV7A 4Y1GA 1IZ8A 4BVHA 3DMGA 1AO3A 1QIDA 2AQKA 2ZDQA 2A9OA 3WMGA 3FMPB 4ZANA 4YRNA 3NBMA 1TTQB 1KZ7B 1GZUA 1WF6A 4OFBA 1Y6RA 1DU4A 3D1LA 3WLEA 1PJ4A 3HS3A 2QSZA 4YJFB 4F6CA 3KKMA 4GT1A 2PEZA 4WNCA 3CF2A 2JLAA 3QW4B 3LQRA 5FOWA 4OK5A 4FR0A 3TYXA 4ZD6A 1MHPA 4CR6A 3BKWA 2QA5A 3GRFA 4GFDA 1I9CA 2AJDA 4CKCA 4OJYA 1CUCA 3OCYA 5JFGA 3IUNA 2ZUWA 1MQ9A 1BFKA 1RQGA 1XLTC 5IC4A 4JL5A 2EZ4A 1RXIA 4CKYA 4EFDA 2PZJA 1REQA 4MO9A 1R0XA 2PU5A 3TRJA 2X1LA 4YVFA 4WY2A 3W5BA 1M34B 1WDWB 5BNZA 4KIUA 1EBFA 5K0GA 4RENA 3E4RA 2C5BA 1Z5VA 5EJGA 4F1IA 2WVAA 4GBGA 1QGOA 3UJ9A 5EIBD 1G63A 3L6OO 5LKRA 4MGKR 4DN6A 2F2TA 4ZOCA 2HV9A 3GR6A 1Z36A 3CXRA 1LUAA 1QE5A 1QFMA 1PJTA 4J91A 5K0SA 2VJMA 4P4TA 1TGUA 3RC1A 2XCRB 3RRYA 5KOHA 4ARZB 3KFXA 1JEQB 1HNNA 2HXGA 4UBKA 2C5EA 1FVOA 2Z2IA 1SD1A 4HKTA 3SYNA 1Q0HA 1Z47A 1NRXA 3T7AA 3K0EA 4M60A 1KK3A 1NWHA 4S3MA 4TOIA 1FTNA 5EFOA 1ZKDA 4FVMA 1V3QE 4H77A 2ZE7A 1OE0A 3TZCA 2F5SA 2BFCB 5IP5A 2JGFA 1SKMA 3U6PA 4XOUA 2WG1A 1LLFA 3IP9A 1HFJA 2YWBA 3LUHA 5AW7A 3B53X 5CJPA 5DT9A 1VPWA 4ES6A 3QTBA 3OG9A 4H4EA 2Z57A 5H81A 4TQGA 4MKZA 3FWZA 3E7PA 4W5NA 3JY6A 1RPAA 5F3RA 1L7DA 4I4TF 5GINE 2MR5A 4RX1A 3JYLA 1TJPB 4WXMA 4NYJR 3UCXA 4DV7B 2X0KA 3OWHA 4JC8A 4RGQA 2VAVA 3DEKA 3E3AA 5A4MS 1V6CA 2O1EA 1EYZA 4LZNA 3H5LA 3CLKA 4M0DA 2Q6LA 1GPH1 1U28C 3O4HA 3OZUA 1EHYA 5B3AA 3IP7A 1CHDA 3ECAA 2QAGC 2JY8A 1D3AA 1ZW6A 3S2IA 4HAWA 5FF9A 4BNDA 4YQYA 1UK7A 3C7KA 3DE2X 1Z4MA 4DB4A 1WHCA 2X0NA 3VR5D 3JD1A 2KPOA 4HWKA 3MTQA 2HQBA 1R7RA 4E3WA 5IDVA 3SR0A 3BTSA 4DV7M 5I7VA 2HHHB 3TR5A 2B78A 1XP8A 3W3AD 3U48A 1E6KA 5EMKA 5G0UA 2D5LA 1VHJA 2XQKA 3WK5A 2VQEB 5HXAA 3HWX1 2JI8A 3GBPA 1ZCFA 3NV7A 1UXIA 2V6FA 2OGTA 4TYNA 3ZN2A 3AF1A 1WPXA 2CEKA 5DSXA 3ETLA 3KOYE 3BAFA 2ZR8A 3M1AA 1EZ4A 3PYLA 4MKRA 2PKYX 2Y20A 4GR5A 1ISFA 3HR4A 3BWMA 2REBA 1PT9A 3HDYA 4TSFA 3K0FA 1O0SA 4FXOA 2BFAA 1ZPDA 1GUZA 4LV6A 3Q7IA 3ZEIA 2GA8A 4KMOA 1DWOA 2VQEM 3BGOS 1M0TA 5FD8A 5AJTA 5MGNA 2HB6A 3HHYA 2MIIA 4LUCA 2Q3BA 3THOA 1U7TA 1FYDA 2C31A 4RHXA 3EDMA 1YDFA 1LD3A 1D8TA 5FO1A 3L29A 1E0KA 1IAQA 1G8MA 2CF5A 3MD0A 2CL0X 4E03A 1P7ZA 1ECFA 1Z6GA 2VSXA 1U90A 3AK4A 2K6BA 3QVLA 4YR7A 3PI6A 3OLQA 5GAJA 3ZCPA 2MDTA 5CR9A 3COVA 4CR7A 2HF2A 1WCWA 4U6SA 5ELMA 1QP0A 1WA5A 5EKXA 2IS4A 1B0PA 2LNHC 3IIEA 1UFOA 4DDUA 2CXRA 4LDZA 3LHIA 5FTLA 1J2TA 4X84A 2QSFX 4GMDA 3A6EA 3QLVA 3TWKA 1NJSA 2RGYA 4TTPA 2POQX 4PTLA 4IXWA 4CDMA 2FW9A 1R4GA 5LUBA 4R2WA 4IBDA 3U4MA 2DCMA 4IEIA 2HDOA 3ZXIA 4GLBA 4RY2A 1U0TA 2DETA 3DL4A 1XOIA 4C6TA 3R09A 5K6TA 2HA0A 4K6CA 4Q18A 3IPRA 5K6AC 4KKVA 1CDZA 4FYHA 3X1KA 3RF6A 2JFVA 1CVLA 2PVPA 1Q0RA 5HTKA 4UHKA 1G55A 2B1IA 3OCVA 4P82A 2CVHA 3K1TA 2NU8B 3HUFA 3BDVA 4DV4B 4YIKA 5LA6A 3FB4A 4CF6A 4G89A 1QRUA 1DC5A 4DSUA 4R5HA 4W5OA 3NNDA 1FLAA 3RVMA 3JQPA 3LS2A 4PIVA 1M1NB 1QP7A 2OOKA 3IPLA 5K1ZA 3WOHA 4QBTA 1FP2A 3TBFA 1VG5A 2D2FA 4CV1A 2HF8A 3NIGB 4QVKA 4TQAA 1KYYA 5CLLA 4ZXPA 1QV7A 1GPWB 3ZWAA 4BFYA 4I5FA 1DKMA 3WLQA 4X85A 5JTUA 4DV4M 3SHTA 1PO7A 1GHTA 2OSVA 4KN8A 4KE7A 2JJQA 3FN4A 3QFFA 5G3ZA 1FOEB 4RJJA 4B3SB 5FEMA 1Y5IA 1NXSA 2H63A 4OHPA 2PO7A 2P78A 2GN9A 2I1WA 2FEPA 5KEIA 4JS0A 1ZSVA 3IG5A 4Y30A 1YK1A 1CUIA 5DEOA 5JEEA 3ZJ5A 1O89A 1QHXA 3WXMA 2WD7A 4Y2PA 2I78A 1P6UA 3DTTA 4S2EA 1OXXK 3B7QA 2GHRA 5F77A 2VT6A 3L0YA 1XKQA 3M6MD 3TCKA 4OLFA 4J6FA 4Q9IA 2Z43A 4ZQGA 3H83A 5KTKA 4JODA 4WZBE 3IP1A 3V1KA 3FHOA 2J3JA 4ZVSA 5IT0A 1IN7A 3DT9A 3HCAA 3L26A 3KETA 3TL2A 1TYEB 1QHNA 2A30A 2OFWA 4F72A 3D02A 1WLYA 2B4YA 1IM5A 2YZMA 3JVIA 3JV7A 1GCOA 3F67A 4HC4A 1U80A 4WZAE 5EZ5A 4D9IA 4TL9A 4FJ1A 3KHTA 1Y8ZA 3QKUA 4FP9A 5E1MA 2EWWA 1YA6A 2IXGA 2FR8C 3A4VA 3R77A 5HYVA 2ZU6A 1EK2A 1V6SA 1Q3KA 3VC1A 4NVRA 4ID3A 2PPVA 1O6BA 1JHAA 4INJA 4OUDB 4FFVA 3W9BA 1R6XA 1AY0A 1N5LA 4I81A 5DBGA 4QOJA 4XSGA 4RWEA 1P5ZB 4ZYWA 1SC4A 2OUKA 5HX7A 1X7GA 4XYBA 2R8RA 4JUIA 2QE6A 3EX7C 1WP4A 4HLQA 1BDBA 1ISGA 3X2EA 1C3OA 2IA5A 3M6FA 4WH0A 3PGJA 2R6CA 3QX7A 2R4QA 4EP1A 3L6CA 1YHYA 3OC0A 3SJ7A 4BU0A 3RG2A 2YV4A 3V1NA 1YDWA 2FWMX 4F2WA 5J58A 4OXRA 4JSYA 5B3KA 1HI9A 2ODTX 1DXHA 1PJQA 2EFEB 1P2TA 1DMRA 2OR3A 4A16A 1LDEA 1FFXA 4JASB 4JI1B 1JAHA 2ZIWB 2CUTA 3OQBA 2WU8A 1GTL1 5K01A 3UC5A 5JBNA 3QVOA 3QOYA 5GIOE 3NLLA 1J9GA 1QXSA 2B94A 4G1UC 1ZMBA 1H2XA 1ZI8A 4W4TA 3MWEB 2QT1A 1X7HA 3P71T 3A4TA 2O3JA 4XR4A 4KN9S 2HLHA 2JJ2D 4Z6KA 3L06A 3UBMA 3RVOA 2D0IA 3GLKA 2P1RA 4JWTA 1MU5A 3LX8A 1M34E 4NI5A 4R1UA 4ENUA 4Y0VA 4EKNB 4EFMA 4XM1A 5IAGA 1G38A 1K86A 1KGSA 1OILA 4JI1M 1ZY2A 2C7GA 2D7CA 3QXHA 3FJ1A 4O4LA 3WB9A 3CR3C 3SQWA 3CX4A 4H7IA 1LC3A 4KE8A 4UD6A 4XQ9A 5ELLA 2A0KA 5CVTA 2GCOA 3OH8A 3VNQA 2OK7A 1FJXA 3DL2A 4GUDA 4RDXA 2VQ6A 4UVEA 3MJ5A 1TRKA 3CUKA 2O52A 1RYEA 4Z2YA 3TQSA 5FOXA 2CLHB 2ZJ3A 1IUKA 4W7IA 3D9QX 4JBLA 1E5LA 2DQKA 3SK0A 2I76A 3K8QA 1FUUA 3PG5A 3A1EA 2O8FB 3ZQ4A 1CQJA 2YHIA 1PR4A 1WBDA 4CMGA 3QW2A 2XCQA 3QFTA 2RGGA 5A03A 2P2LA 3UY4A 4P0PB 1EUQA 2KW0A 2PNFA 3FFXA 2NO0A 2IP1A 4JI2B 4TZKA 2CD9A 1RIFA 1T9GR 1L4NA 1GEEA 3L7LA 5J5VA 1OD6A 1QTQA 2IOQA 2P6UA 2D13A 4BYMA 3OBIA 5THXA 2QW1A 4HRXA 3E3MA 1QIJA 4RZ2A 3G9QA 3B3GA 5HZHA 5B2FA 3DT6A 3FSEA 2XVAA 1BXRA 1L5RA 1M2VB 5J4HA 3LHFA 5B12A 2QVZX 4J03A 4N03A 2AF3C 5ESRA 3HCWA 3H0CA 3D7SA 1CZHA 3ABQB 4J75A 4TMTA 13PKA 4RVSA 5CG1A 4ZOLB 4AZ0B 3DA1A 3CV3A 3N2LA 5HBGA 1ZI6A 1MO5A 5JRZA 5A7FA 4K8RB 4JI2M 2OGWA 1ZJJA 1H9CA 4ZDKA 1ZD5A 5EP3A 3BXHA 4L08A 4GZ5A 2YMQA 3THYA 4DSAA 2XMSA 4FXPA 2K9DA 4I50F 3HPRA 4MYUA 2Q7DA 4H7JA 4K9PA 5FHQA 2VCEA 2ZYSA 4R9UC 2QAGB 4UHDA 1X1SA 1XCMA 3GVXA 3OIDA 2PVSA 4P2BA 3I62A 4YP5A 2Y8EA 4HAUA 4F4IA 5E4FA 4MQEB 3EUWA 3PKIA 3GLIA 4NDAA 4WN9B 4CLRB 3TO5A 3HEMA 3LO8A 5FI5A 3JQ8B 4D8WA 2BFEB 1F0NA 4HTFB 4RW0A 3TZQA 1JQJC 1MKYA 2P8JA 4EUFA 3GLGA 5KHAA 2GFHA 2ZUTA 1ENOA 2IBSA 4XPZA 2GRAA 3VKHA 5JNTA 1TIPA 2WPNA 1EZ1A 1NAHA 4EKEA 2FVYA 4KLRA 4F46A 1QWOA 2VNSA 2I7VA 2X2FA 3GHHA 3T7DA 3SZMA 1SIWA 3E58A 4WGFA 4ML3A 2XOXA 4U8HA 3T5BA 4LIPD 3GDWA 2RJOA 1UM9A 3ZDBA 1D6JA 3FPKA 4HGPA 4KQIA 2N3ZA 4AKTA 2BC9A 3EXAA 2XBMA 1N4AA 1XRMA 4PFJA 3E5NA 1KWGA 1LZLA 1EGAA 4BY9E 2XQJA 4Y9RA 3KUUA 5F3WB 1UBJS 3THSA 4BNYA 5FAXA 3PCTA 1XR3A 4XYLA 2QTTA 5EE1A 1Y3IA 3AJ9A 4AUMA 3LIPA 5BXYA 1I4TD 5KJ1A 3LDFA 4DT1B 2J9FB 2VDWA 1FU4A 1CUHA 1NN5A 1SQ6A 2VF7A 2IDZA 2X0JA 4WD3A 4P17A 2AC4A 1X80B 1F5SA 1CZOA 1U8AA 5KNCH 2G0TA 1JTVA 2ZYTX 2WWIA 3CX8A 3HP4A 3JR5A 4DV6M 1AMUA 1Z6ZA 2FSIA 3GOHA 3HCNA 5FOUA 4LE0A 4U2BA 4YXWD 5G02A 3STVA 2VDMB 5EZYF 2CK3A 2VIIA 3MCAA 2FW8A 2G04A 2ZI4A 4CXMA 3IMFA 4KO2S 3PWSA 2YN0A 1JHRA 2O2ZA 2AMYA 3GDFA 2LTAA 1X7YB 3EPJA 2J5KA 3UPDA 5JD4A 2M60A 2B4RO 1P1RA 1NMEA 3NUQA 4OK6A 1YQEA 4DMRA 1TJ3A 4ZI2A 1ILWA 5AVYA 2VN8A 3MHPA 3DLIA 1L3BA 3RQIA 4CG2A 4B87A 1KYTA 3A9VA 3FUUA 3FZYA 4NR0A 1TK2A 1R3DA 4BWGA 3OT4A 3DGFC 4FI3F 2IHNA 2YFKA 2IT1A 4CQJA 1XB2B 1A97A 3OECA 4YMHA 1A27A 1UF9A 2OAEA 2PKQP 1PFUA 2WJWA 5AUQA 1R0KA 4JP8A 2E49A 2X9QA 2ZANA 3F4BA 4D3SA 5HF5A 5FJJA 1JDNA 4NJOA 4D74A 1TD1A 3ABRB 2Q2EB 1A0OA 2QN9A 3D6UA 1Y33E 3RVRA 5J1SB 1L4YA 3MUEA 4QWWA 3HCDA 2IYRA 4CM8B 3RLFA 1AHPA 4QEZA 3A3NA 4N7RA 1TDJA 4QREA 3BF8A 1P2SA 2DB3A 4JLSA 1EDEA 1BDHA 2C5SA 2E7ZA 3ENWA 2FW1A 5CB4A 4G26A 5AM0A 1SXQA 1KPHA 2DTXA 1C4OA 2ANBA 1PD1A 1KEWA 1L7EA 3JQDA 3QLVC 4BMDA 4IGIA 2DM6A 1QCCA 3GC6A 3FSGD 4L85A 1PYDA 4DYVA 1HZJA 1Q92A 2QIPA 4TTJA 4MV0A 4IZ6A 4H3SA 2IIPA 5IJWA 3L0CA 2QX6A 1SG9A 2TMGA 5DE3A 4A7PA 3BHMA 2B21A 4JR1A 1VIMA 4RMJA 3ROEA 5FBLB 3TOCA 3C15C 3PFIA 4IM7A 4GR9A 3D6NB 1QKKA 5B5SA 1G9SA 1JSCA 1J42A 3AYZB 1P3Y1 2VYQA 1KJNA 3L7JA 4L76A 3TCXB 4MS3A 1G18A 3TI7A 1B6GA 2FQQA 4ZOLF 3TUJC 3FCCA 4PZDA 3FGNA 4Z7QB 4MMZB 1RQ7A 1A5TA 3BERA 1ILEA 2Z3XA 1CLEA 1YRWA 1HE8B 3PFFA 3IIJA 2XHZA 2DVWB 2D7EA 2WSSA 3CKKA 4RTQA 2I1VB 2X2EA 5CPBA 1P75A 2NACA 4HPJB 5HRAA 2FPLA 1RAAA 2WKQA 1FIUA 2I1QA 3WGJA 5FBZA 2W6QA 1NBME 4RANA 1FMLA 5M29A 3DFKA 2ZPAA 4HUTA 1K7XB 4YUAA 1CIVA 4N8DA 1QBKC 4Q6BA 2RK6A 3WNZA 4LE1A 2ADOA 4ZQCB 3QJ5A 1Q0LA 3VYRB 3IR6A 4X7MA 5GJWC 1U8ZA 2JK1A 2WJZB 3KM0A 1IMJA 4YMWA 4MGZE 3F7OA 4E14A 4V0OA 1MMFB 3GLTA 3LL4A 3JQGB 3VDMA 5AYVA 2WNSA 4KLNA 1TIBA 4N0MA 2OG1A 3E9ZA 2UVPB 2PGJA 3JAMS 4O3FA 2I67A 3GEEA 3G13A 3W5DA 1UBGA 2HPAA 5CH8A 4R2KA 3P9ZA 1QYWA 2VUTA 3OAAA 2CKMA 1VJRA 4HDCA 2PCLA 1ARZA 5JZOA 5KQPA 1JDBC 1WBBA 2O2HA 2KZSA 4QQRA 1IN1A 4ZT4A 10MHA 3N7TA 4LJ9A 3IDAA 4Z5XA 3MTBA 1CJMA 1L4KA 3P8ZA 4UBNA 2G9VA 4AS1A 1E63A 4KI7A 1LF0A 2H65A 4UTZA 4C4OA 3UFBA 3CH4B 3KOOA 4KUHA 3HR7A 1RJDA 2EKDA 4KVZA 2ATVA 2C0PA 1ORDA 3E8MA 3HHPA 1KVUA 4M0KA 3G2IA 2E82A 2F1OA 1I5RA 1N36M 1R6BX 1FRVA 2F62A 3AUKA 2IXBA 2HQSA 4UAUA 2TMKA 1PR3A 2W82A 1M1ZA 5JDIA 4TTIA 3ZV6A 4XD7D 1XLTA 2IOHA 3VC7A 1RYBA 4MLCA 3AXTA 2DP4E 2GD1O 3HUTA 2Q28A 3O82A 3O1JC 4EY7A 3OZFA 3ESDA 3BICA 2A9FA 4YJHB 2FZLA 4BTLA 2R65A 2VHWA 3ZQ6A 4MGKE 4CIZA 4JWKA 4OHUA 3E0XA 2OV3A 1V9CA 1QP4A 3FTDA 5BN4A 4JT2A 1YJAA 3TUIC 4I19A 1YS4A 2D06A 1T3HA 3BFJA 4DSNA 3DZIA 2CDRA 2YWXA 3D8LA 4CKXA 4LG1A 4ZJUA 1EUDA 3RU7A 2BF4A 4IGEA 4HNTA 2A1UA 5EVJA 4F5YA 1XVVA 3B6ZA 1XTQA 4HH0A 3WYAA 4OYHA 3WIEA 3F2IA 4Z4QA 2I4MA 4EGAA 2QSJA 5ENZA 1JU3A 2YR0A 1L5SA 4Q3EA 1QFJA 1DQRA 4AJNA 5J43A 2P7HA 5ABPA 2DUWA 4ZQFA 1COWA 1DNPA 3TTVA 2A0YA 1WCIA 2BISA 5B1HA 2HCTA 4GF5A 3OIFA 1WULS 1FLDA 2X19A 1VYTA 3Q15C 4RTPA 3RAPR 5KQMA 2GNPA 2K47A 2Y1CA 3STTA 1M75A 4E33A 3CNEA 4EY4A 1E77A 1RTKA 5F78A 4QHTA 5CBPB 4ROTA 1REQB 3IEKA 2WJVA 3MK6A 3LE8A 4FWHA 3P9CA 2X5JO 4G5OA 5E4JA 2WSYB 1QR6A 3L8GA 2JNWA 5DMHA 1QKJA 1YZTA 4DMKA 4EHJA 3T9DA 3VVMA 4EHHA 4N7JA 1VJTA 1FVXA 1SUDA 4PLGA 5T4FA 5B55A 1YZLA 3GGOA 4JYZA 2M6RA 1M7HA 1BEZA 3LP8A 1NQ5A 4GSLA 1EUYA 2FMFA 1ZJ5A 5TF4A 2YNMD 1K63A 4BE9A 4DA6A 4QSMA 3NC0C 4ZO8A 3DNMA 1FBNA 1OIVA 2I4IA 3ILHA 2ZAOA 3WWPA 2I1LA 1H2EA 4OGLA 1SOAA 5KOHB 2Y1GA 4OXIA 1LTMA 5KNCD 4E31A 2VQSA 2WG2A 4CG1A 1NVGA 5JNSA 2Q5FA 1K6EA 3O1IC 1PV2A 1BX3A 1Y8QA 1T1GA 1G4HA 2SCUB 1AOXA 3FUCA 4C78A 3FVQA 2B5VA 2F9MA 1AQUA 3LX5A 2QTZA 2JEZA 5L3VA 4I14A 2X4AA 4I9UA 2EJUA 1Y0BA 4BVJA 1JYEA 3PXDA 2V7VA 1YKGA 3UIEA 3DQQA 2VHCA 4RPCA 4P81A 2WP8J 2G9RA 5F73A 3MINA 5TSDA 4MLDA 1WXHA 4W8HA 4LXQA 1HYEA 4QM7A 3NOQA 4DTIA 4O2AA 3A4YA 4OM8A 1C7YA 5F1OA 2CXHA 4NMLA 2G1PA 2ZROA 5DP2A 2H0RA 3FRIA 1Y7HA 2RGWA 4DG8A 5IT4A 3URMA 1B93A 3CRW1 1YJ5A 4G0MA 4OQYA 3E9EA 1KE1A 2HXSA 3RAEC 3PXXA 5K0FA 3IKJA 2OV6A 4XKJA 3DV9A 2WD8A 3PFHA 2G7ZA 1LB1B 3R9WA 3RUEA 1RZRD 3L0IB 4BNDB 3TR0A 4MV9A 3R3VA 4C87A 1YGPA 1NFQA 6REQA 2D8MA 3PEUA 4HSEA 4ND4A 4GRAA 3IOEA 1CF2O 3IT3A 3S2GA 3I6MA 3LC1O 3W9UA 3IP8A 3EC1A 3IVRA 5IF9A 2A9RA 4W8GA 4EIWA 5TB5A 3KZVA 3IE0A 1Q2UA 2CN1A 4HO1X 5LMCA 1J8VA 4E88A 1YS9A 4IFEA 2WY2D 5JDCA 2GHQA 1XRRA 2C4TA 1QVWA 1IBLB 5M04A 4M9UA 4CM6A 1Y6FA 1GRRA 5I9MA 1UUFA 1JEJA 2PS0A 1L7RA 2H52A 5EIWA 4U7WA 1QMPA 1PU2A 4ZCLA 3USCS 1JXAA 2ORVA 1C8KA 1ZJWA 3DR5A 2WJIA