3CGWA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei. northeast structural genomics consortium target mar46
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
303
structure length
303
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPPG:FO 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 78
structure length 303
sequence length 303
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3cgwA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3cgwA01
3C3EA 3C3DA 3CGWA 2P0YA
chains in the Genus database with same CATH superfamily
3ZDZB 5ALWA 4TL7A 1E7SA 1CUSA 3C97A 2XUAA 3QG5A 3CWCA 1KO5A 1MEEA 4I6GA 1VJGA 3SJAA 4KACA 2R8OA 1P4GA 4PFJA 1T9GS 1Z0AA 3OICA 4H16A 3NBZC 3NHJA 3K0CA 1WVIA 3OF3A 2B8JA 1DDGA 3FYDA 4RJTA 2O0HA 3KAKA 2AJCA 3BSYA 2AXPA 5FTKA 2BBTA 3OMWA 5G1NA 5ICCA 1OLUB 1UDXA 1DUIA 4BV9A 5AW0A 2AWOA 1G8FA 1ADJA 4NK4A 1QUSA 1YHNA 3NBIA 4KO2S 2QGZA 1K88A 2X42A 1RI5A 2AJLI 4DW8A 1PE0A 4K05A 1LRJA 3DDHA 4LHYA 2Z2YA 5E7MA 4YAKA 1U02A 4C4TA 4MUXA 4KSCA 3GMSA 1JEAA 1A04A 4MV8A 4MR7B 4PFSA 5DO9A 1LSUA 5KCMA 3VPGA 4CR8A 2ZTCA 2DQYA 3IAAA 3CM0A 4DV5B 2Y3IA 3X1XA 2XCIA 1YB2A 2GEVA 4ZVVA 1IVNA 3C74A 3CLUC 1T6BY 5KWJA 5AW4A 4GHLA 4ZP1A 5E9AA 1UMDA 2XJ9A 2W43A 2RK3A 2BPOA 2QKYA 2OQ4A 4L8GA 2JGIA 1F8FA 1PV4A 4CUKA 5CDYA 4TV9B 3WB0A 3B3QA 4NPCA 3U6LA 4UAUA 4FYVA 4LJ9A 4FS8A 5CK5A 2DT8A 7CATA 4JCOA 3ZZ1A 3LM8A 1DAPA 2D3WA 1JPVA 1ZW6A 3W6ZA 1OFUA 5I7AA 3D3JA 1KPHA 1VGQA 1I7NA 2W58A 1JKJA 1XB2A 5K0JA 3AB7A 4MQEA 4IUYA 2RI6A 1Z0ZA 4J9UE 1GM5A 4U6SA 2AUTA 4LFBM 1K9SA 2QAJA 5IZ7D 2GTHA 3DGEC 5IPFA 2F17A 2OGTA 2HAKA 4E2ZA 1YQQA 5E1OA 2WMYA 2EL7A 2YZGA 2HPZA 4TS3A 3P94A 4G3OA 2ZYUX 4M7PA 2EF0A 1QUTA 2P6MA 4HPXB 5BORA 2O3QA 1VHLA 1MKYA 4NBWA 2ZSKA 3G0DA 2IIBA 1F0NA 16PKA 1CY2A 2HJRA 1MO2A 1KNXA 4NCAA 4X8OA 5EJ6A 3IHKA 3LNTA 5AVRA 2Q5FA 1ABEA 2GYVA 1LCIA 1T29A 3GY0A 4FGUA 1GRCA 3PQ5A 1U0OC 3SAUA 4YJ3A 1FPQA 3P32A 4EOGA 1YZGA 2RGCA 4C04A 3U19A 1Q0HA 2ZROA 4JU9A 1E2HA 4AQYB 4ZOCA 4LBWA 2WHPB 3N2YA 1XAHA 5JAPA 1PGPA 1BXRA 5LVAA 3NRJA 2EW1A 2YASA 3GPYA 3IAHA 4K9KA 3ZUPA 3P0FA 1Y8RB 1GCUA 3ICWA 5EP2A 3G0OA 4QKQA 4K6GA 5KPJA 4BO8A 4RV9A 1AUQA 4FCTA 4MQ6A 2QD4A 4AUMA 1FP2A 1IXYA 1DQZA 2PHZA 4TPKA 4EKEA 2EYUA 3DFKA 1WJ7A 2C8KA 2VVTA 3V7UA 5ALEA 3WYAA 3UMBA 4IBKA 4Y2RA 1PDWA 5CFZA 3EARA 4LJYA 2E3JA 2ZIWB 3AUJB 5F9HA 1FDSA 4TS9A 1U8AA 4N9WA 2CXHA 1X37A 3W3AA 4KL8S 1ZUD1 3W2HA 2FU5C 3HP7A 5BWBA 5JCZA 1ONNA 2XI4A 3ROFA 2QJWA 2PWPA 3VHXB 1QZ3A 3EFEA 3KS9A 2EJWA 4XX1A 4P0TA 4O4HB 1IBCA 4GOJA 1XRMA 4LC0A 3NETA 5KTPA 4QOEA 4F3RA 1UBJS 2WYOA 2JVIA 5KYKA 3K8OE 4JBGA 3Q7RA 1ONOA 2VDNB 3FFTA 4ENWA 1ACLA 1RP7A 1R27A 2OHGA 3W4JA 3EVBA 5LMNM 1THMA 2CVFA 1T2DA 4LOKA 4TL9A 2JF0A 3TYXA 2EBUA 2AQ8A 3DFZA 3FZQA 4KGVA 2O3TA 3J7BA 5CYFA 3C4JA 4XUCA 4DSTA 1Z39A 1JJIA 4H7JA 4RF0A 1U8CB 1QH8A 4M4SA 4CGYA 3RSQA 4G8DA 1M7HA 1EP1B 2Q62A 3PFWO 1DDIA 4ZHQF 3OWOA 1T25A 3ACDA 3AIIA 1FMJA 4WKNA 5CLIA 4HH3C 5BUZA 1RM0A 3GROA 1GAXA 3LG2A 3EXFA 2DBZA 4UFNA 1VP9A 1KL7A 2IW1A 2BYTA 3JV7A 1KSJA 5K0CA 3HFJA 2O8FA 2JHGA 1J5EM 4IFEA 4OGGA 3UV7A 1P6UA 4RGVA 4F8YA 3K5HA 3INTA 5JFGA 3HXQA 2AUNA 1JQAA 1XZCA 3R23A 3B82A 3C39A 2BSQA 4ZMSA 4EKGA 2Z04A 3GW8A 1JRLA 1RM5A 1E5LA 3IEPA 4KR0A 4MS4A 1DFIA 2E5LB 1YMVA 2F5QA 4BMOB 3VQTA 4ER3A 2VPWA 3E48A 2Y76A 2J3QA 3Q88A 1ECPA 3NEYA 4EPRA 3MXOA 3G59A 1QAQA 1JZQA 2B2NA 2HK6A 4V03A 1E0DA 1C1DB 1L8QA 5TF0A 3NBFA 2CB0A 3ONWA 1CX9B 3LYLA 2OXFA 1QKIA 3BMOA 4MR9A 4L27A 2ZRAA 3ZU6A 1IBMB 4OHUA 4O3MA 1ZAEA 1HNWB 4CUJA 2Y05A 2GHRA 1DQSA 5IJAA 2WU3A 5ADUS 1W9MA 4LYFA 3EJWA 5FL3A 1FVOA 5KOHA 5ARBA 4X85A 1NRIA 3WOVA 1YFZA 5BN5B 3ITDA 1SXJC 3FR7A 4DDTA 3KSRA 3NNNA 1E98A 3OEEA 1I0IA 1KH2A 3A0UA 3T12A 4M1TA 1L8LA 4D46A 5EE1A 4OF4A 5A6VA 4HQ0A 4IBFA 3F98A 2IZ6A 3CISA 5ALMA 4X7MA 2LXNA 1Y5IA 2GN6A 3WL5A 2QM8A 4LF6B 4RTLA 4K26A 3NQ41 5TLSA 2GPNA 3SVZA 4PLYA 4G25A 2QUZA 3GQ3A 4B3RM 3VUEA 2J7NA 3I30X 5I01A 4F4IA 4CGZA 3BCUA 5FX2A 5FLKA 3C3YA 2HL7A 1HYEA 1OAAA 2O1WA 4N7BA 2P5SA 4RF4A 4ZZ3A 2ENWA 4KXYA 1J09A 4K7JA 1OWOA 3I0NA 4WERA 5AI6A 5A0VA 1TU3A 1TD1A 2H4ZA 2HU5A 4FWIB 2Q2EB 1JDTA 1CF4A 1VHJA 4WPGA 3GJTA 1CR2A 4BNHA 5F5NA 4C7MA 3IE1A 1P62B 1ZG3A 3OHMA 1A9SA 3NEJA 2W9XA 1JKXA 1HK7A 3OEWA 3Q9LA 3NJRA 2MSWA 2WFLB 5JBQA 3BE4A 3JZIA 3THYA 4LDPA 4LMBA 1IUOA 1ESCA 4HRXA 2A5FA 2WC1A 3U2QA 3G8YA 3B3AA 3NT4A 3V8PA 3F6YA 1GQQA 5MGNA 1OWNA 1Z34A 1NRJB 5I9MA 2DJIA 5HEKA 2AW3A 5IXJA 4KR9A 1YAHA 2ODEA 3GXOA 4MM3B 4G4SO 1X19A 1VLZA 4JZKA 2VT7A 3TWOA 5FPPA 3U09A 4PPQA 5D87A 3AFMA 4CEHA 2WT8A 4JP5A 1M1YA 4UZEA 4TTSA 3K1YA 5DE3A 3MXTA 4PWYA 3DXYA 2A30A 4PZCA 5FB3A 3H18A 4JCCA 2ZJZA 1NF3A 4QG7A 3FY4A 4LN1A 1T8WA 3JQ7A 4EDHA 4IVNA 3KE8A 1F60A 4PHCA 3HE3A 3UY4A 3CX4A 3BIJA 1GL9B 1CK4A 3OZGA 5TDHA 2HWUA 1ZU4A 8GPBA 3PIRA 1KAQA 3PPWA 5AVXA 2OLKA 2A0UA 3FTPA 1GV0A 3INNA 3HJSA 1NDUA 4DV2B 3PD7A 2BM9A 4IYRA 4WGGA 1N6HA 5IJWA 3UTDA 4DMKA 3RVMA 1HDCA 1Q44A 4W8GA 4YJDA 2RHWA 5B64A 4ZV4A 1U0NA 4U5XA 1TE2A 2QL9A 3GJ5A 1JBQA 3MS2A 3VDQA 2NU9B 4MGHA 3HY3A 2EDAA 2XXAB 5EWMA 1C8LA 1CUVA 1TB4A 1W9HA 3OM1A 3TG2A 2PA0A 2YXPX 4S1TA 3OLWA 2XEDA 1YKSA 1ZN2A 2QUIA 2C7BA 4CM8A 3EGDB 2PSFA 4YI3A 4LYGA 3A6GA 4MNTA 1F5SA 1UKBA 4RY9A 3C3KA 3E1SA 3GI1A 3UB3A 4MWTA 3JWIA 1KVSA 5AI0A 2F3QA 3EF1A 3TXXA 1QYDA 1SOWA 1I32A 2WLTA 5C81A 3JR4A 3QTLA 4EQ6A 3L05A 3KLNA 1IQUA 1LVGA 1MJ5A 4YGYA 5ALGA 4EX6A 4LWQA 4IV5A 4AX4A 2JFQA 4YCDA 5HFJA 4O4IA 3DP7A 3R2JA 4PYOA 4Q7JA 2W6JD 3K96A 1A96A 2R6HA 3ZXYA 2VLBA 3A6ZA 2XUZA 3VR4H 4CCYB 3DMGA 4KMOA 4URVR 4MKFA 4N6NA 2VJQA 3OKCA 3OTIA 4PLZA 4LRUA 3U7FB 3NPAA 5BSVA 2O3SA 1JSLA 2YYAA 1VE5A 3F5DA 2G9RA 1ES9A 4BB5A 4QOHA 1PLLA 3H5TA 3EQ6A 3BD8A 3U3MA 3ZVKA 1F0KA 3NDIA 1Z5NA 5HZKA 2UUCB 4QBKA 2IHTA 1EMDA 3RHTA 3NUQA 3L0YA 4BHTA 1IY0A 2AMLA 2R4UA 1PVVA 1ZSYA 3PT5A 4H08A 4G5GA 1FTYA 5AO9A 4WN9B 1PK9A 2DFKB 2XUOA 1NO1A 1RYZA 2ZB3A 3OECA 3C2QA 5FUMA 1PW5A 2ZAMA 4L95C 1U98A 4HVTA 1OBCA 3IJ5A 3B60A 2AN4A 2BHSA 3QLVC 4I8OA 3NR2A 1NPDA 1J7JA 3HTXA 5GM1A 1UZUA 2QX7A 2FK8A 3ORQA 3ICQB 5TIIA 4IS2A 2OOBA 2B6HA 3I04M 5TNXA 1LPPA 2OXIA 4O1IA 1TKBA 1N32M 4RGYA 2XGJA 4ZKEA 2CV2A 4DV3B 4FBMA 3DQQA 3OX4A 1P73A 1U0BB 4EI7A 3SYKA 3L3BA 3H4JA 5J1TB 2AHMA 5BWMA 1LS1A 3GDWA 1MQSA 2Q45A 3ZOKA 4B85A 1R64A 1P7PA 4ZU1X 3R7FA 2GXQA 2R85A 3LD9A 5BNTA 1XRLA 5A9SA 1NMXA 2NP6A 4CMAA 3PVCA 3PNQA 1ILEA 3A2LA 5LD2C 1TF5A 4E2YA 3E9YA 4U6NA 4ENSA 4IHJF 3LECA 4V0MA 4G67A 3WIEA 4DADA 3O2SB 5BVHB 2LR0A 1BMQA 3OAAD 3GVHA 4I1YA 3JQQA 2X19A 3O8LA 3UT5B 3IEKA 3VV2A 2V45A 1HLFA 1P7CA 4A1OA 4R84A 2VA8A 1DXYA 3HYNA 4DCGA 2BBOA 1LJ8A 2QWXA 4DG9A 1N6IA 4CDGA 1SXJA 3HRHA 1IPFA 1CUCA 4Z3OA 5H82A 1Z38A 4J6FA 4G1FA 1MFPA 1V8ZA 4B3CA 3Q8GA 3TZKA 4JBLA 2B36A 2FPXA 4P35A 4M7OA 2EA0A 5DM60 5HIAA 4IAOA 4ZHQB 1XTJA 3LTNC 5G40A 2NXNA 3JD2A 4OQEA 3SLKA 5JLAA 4CKWA 2VDOB 1WJGA 1PHPA 4OTZA 1AH2A 1XTRA 3WS7A 4RWEA 3W0LB 1ACJA 4GX1A 3G3EA 1LNZA 1DIHA 1U2QA 4UNQA 4O4JA 5E3JA 1WXGA 1WHTA 3B8HA 2H1LA 3VHQA 1PDOA 4PONA 1SBTA 1VL5A 4HVCA 1RXUA 2J30A 1RABA 1C3EA 3Q40A 1POWA 4LZWA 4LZOA 3PKZA 1MP0A 1RYEA 1BHJA 4PO8A 4B73A 2GGSA 8ABPA 3ET5A 2V3CC 2E2WA 2RHDA 2UXDB 1NGSA 3V5NA 3KR0A 4LSZA 4UDXX 3K6RA 2EV9A 5CXXA 3W8FA 3E27A 1H0HA 3I2HA 2VUHB 3QWLA 4MYRA 4OBBA 1NVUQ 3I45A 5LKRA 4FKBA 1CC1S 4NCXA 4ZO8A 5KYTA 3REQB 3HX3A 2NQ8C 1PNOA 4O2BA 2O2DA 2FHSA 4TL8A 3SEAA 5EMHA 1LPBB 4EA7A 1RAHA 4ZVUA 1N8SA 1AQLA 5AJZA 4P83A 4BNDA 3MNFA 4Y1RA 3R9XB 2XUQA 2CNOA 4TN1A 5F1YA 1WMAA 4MV9A 3HFRA 1WB4A 4HAIA 2NT3A 2D8MA 2UZ4A 1DC7A 4TXJA 2VHXA 3SZOA 1J33A 3KZ1E 4J0QA 1Z4NA 2CVZA 1ULSA 4BUZA 4QDXA 2FOIA 3WGTA 2XWQA 2B61A 3ZXUB 1VRVA 5K51A 1PJZA 4D82A 3LP8A 4DUZB 3RRNA 1C1XB 2J9RA 2OD2A 4U8GA 2ZR7A 1NZFA 3WL8A 1GTMA 4QRIA 2C3MA 5HKAA 1X15A 4GYJA 1BXGA 3F5QA 3RVQA 4Q1BA 3PHGA 3LL7A 1VE1A 4R2IA 3KWLA 3ZWYA 4Z9BA 3SC6A 5IUJC 2PG3A 1IHPA 4FMDF 4L75A 2C2GA 4X24A 4EI2A 3K09A 4B9AA 2PSSA 1MEOA 4L02A 3UMRA 5TMEA 5LPNA 3SMSA 3PL1A 1Y5MA 2JGEA 1ZXLA 2RJOA 1R8QA 5D86A 3FZNA 5BPVA 4H59A 4H77A 4WKCA 2JD2A 3RFXA 3MUFA 4DWVA 1WMSA 1HBJA 3QU4A 1NBIA 2EX4A 1QCZA 4J1TC 1VBKA 1LC0A 1BYIA 4MJLA 2F4VB 1UMCB 4GYYA 3IGFA 4D0NA 1GPBA 2BTQA 3EGXB 4CTJA 5IANA 4FNAA 2O8BB 5KHAA 1HO3A 5EJCA 1ZAKA 3G5MA 3NBYC 4J43A 1DFGA 4K9MA 3PHBE 1TOAA 1JB9A 4WCFB 5HK8A 3P0HA 5DM1A 2P9HA 3QYBA 2DPHA 4BMPB 2A3RA 2NU7A 3SG0A 1FZTA 4LYEA 3UJAA 4OX9M 1YULA 1F48A 4EH1A 1ZD1A 2YIMA 4XVQA 4BCCA 1LD3A 1C41A 1MZPA 4EAAA 2HLPA 2RARA 3IPRA 3ZN2A 3GB9A 1C2YA 2K5UA 4ZDJA 1MHTA 1Z0FA 4FKMA 5HP4A 3QEAZ 3LQYA 2WQZA 3UK6A 1NSTA 3MWEB 3O2QB 3UBTA 5D7NA 3EZGA 2RCNA 3QNUA 2IYUA 3LT4A 1BOFA 3K6SA 1XXHE 2W4MA 5AVQA 2FP4A 3SYRA 3DR3A 3WGOA 4N40A 3DL2A 4RVDA 4G0QA 4Q4DA 1S9DA 1KJQA 4WY5A 1MB9A 4ZVOA 2CN1A 5LMUM 3DCIA 4LYJA 2CJYA 4YJ2F 1FMTA 3IRUA 4MVJD 4YIKA 2IY9A 5FNVF 4ZODA 3K4HA 5CB6A 4C3UA 4UVEA 4YQYA 3DKRA 1J00A 3WLMA 1WZ2A 1JLHA 4K6KA 1G5FA 4WJKB 1D3AA 1FJGM 3F47A 3V1YA 3AEZA 2HSDA 3RFFA 3NBAA 1DP4A 1P0CA 1DV0A 2ZIAA 4G6ZA 1AM4D 1X1EA 3DPIA 3KVYA 4C2UA 3QLVA 4J29A 1QS0B 1OJLA 2QRGA 4DR2B 2FW7A 3IBTA 3S1AA 2PSEA 4KKXB 5IBCA 3BBZA 1E3DA 1U8ZA 2X41A 1MOQA 4YO8A 5FF9A 4DREA 1XQYA 1KC1A 4DSUA 1ZWKA 3C1OA 2F55A 1SVNA 1JQKA 1J21A 1USKA 4C7KA 4MLDA 1QK4A 1OOEA 3W67A 3FZYA 2IEYA 1Z7YA 4X62M 3O4HA 4EJSA 3TPFA 5E26A 2Z5LA 1SD1A 4J7XA 3AR3A 2LP4Y 1W8IA 4PYRA 5FWXA 3KFVA 4ROTA 3T0IA 4AQ7A 4HSGA 3SS8A 4D0LB 4HQOA 4CIXA 1CF9A 1SK8A 4UBOA 4HDOB 5E4JA 5ULLA 1J42A 2QW0X 3LZCA 4Z49A 3KQNA 2Q3DA 3C8MA 2VSNA 3UATA 2FZGA 2ZTUA 1Y0BA 3TM5A 4LI0A 2FZ4A 1B7GO 1ZGCA 2C7OA 3CPSA 4QLAA 5C37A 2QSFX 1OKKD 5JYEA 3ZK8A 2VP6A 3DE2X 4S1VA 1QP8A 5JO0A 2C92A 3GN1A 2W0SA 4PG5A 3WYBA 1O94D 4QELA 4BQNA 2DLCX 2JY8A 3AHIA 1KKUA 5K6TA 3X1KA 3EMVA 3JARB 1ZNXA 1QIFA 2IX3A 3EDQA 1ONBA 1KZ7B 3C15C 3MJTA 5BW4A 1Q3TA 1MGPA 2FFQA 2A5DA 3RTGA 2LHCA 2HYDA 4FX5A 2WP8J 4G3XA 2ZUWA 1ADBA 1FQWA 3ZTTA 1K8XB 3COYA 5FBZA 2RK4A 2RBKA 4CYMA 4MKIA 1GG8A 2P79A 4JB3A 3VKGA 1SBQA 2XDQA 2DEUA 3RJMA 3R0ZA 2CE7A 2XYGA 3A1WA 2NADA 4LF8M 3EBLA 4PU0A 3DE6X 4CU5A 3TI9A 2W0MA 3VC1A 4RJKA 4FHEA 4JJ7A 3V97A 4FK8A 2OFXA 2X4GA 1WXDA 4YJHB 2J4FA 1KU0A 1RI4A 3IPYA 4M54A 3UXHA 1SD5A 1NQAO 4EG3A 2IU4A 3LE8A 5CRIA 1LLQA 3F8TA 2BMFA 3BIWA 4ZQBA 6LDHA 3ZD6A 4RD3A 4ARIA 3AP1A 1K2VN 4X8HA 2DZNB 2EP5A 4Q37A 4MCHA 1QPBA 2ODAA 2AG6A 2WMNB 3KQQA 4JL6A 2XEPA 2NQ8A 2HA6A 2JK0A 3T7AA 5ITUA 4XJXA 1G20B 2AHOA 5K3FA 4QVKA 4AAYA 4AJLA 1LSOA 3GVXA 5HW0A 1O2DA 1YDWA 3I6BA 4ZAYA 2ZEJA 4C5AA 5JUWA 1TAHA 1O77A 4DIBA 4KRYA 5IAOA 4G0NA 1ZQ9A 4XIGS 4HS9A 4IHJB 2J8ZA 2ZYVX 4F6LA 1FX1A 3CLRC 2C03A 3IP6A 1I4TD 4IFBA 5DTJA 3MUOA 1DRUA 2JARA 4GICA 4W8HA 2TMKA 4D4IA 3SVLA 3ISVA 1KI6B 1YB5A 1W1UA 3C9PA 3D4PA 1F6BA 5SY6A 1VLJA 1GR1A 3C1TA 2AOTB 2FQQA 2QTWB 3QYJA 1L4KA 2BFEA 4Y2SA 4C4OA 2VN8A 2XODA 3M7GA 3TLEA 4CF6A 3F3SA 4RULA 1VG9B 1SKMA 3CF2A 2BFFA 3VVLA 5H68A 1W87A 1XDSA 4TT3A 2ZAYA 4LDNA 2HREA 5HKKA 4RA6B 4Z9XA 2MOKA 3U4GA 3GFPA 4MS3B 4E3ZA 4JDUA 1QH0A 4PCVA 1Q5PA 2CUKA 4ZZ1A 2ZFUA 2R97A 1EKXA 4NFLA 2OBNA 2CXQA 1D0KA 3RTEA 4NCKA 3TQOA 1L9KA 3ZVMA 3ROMA 3EXG2 4J1TA 3QPVA 5KTTA 3H2BA 5BWOA 4PYJA 1DTEA 4QUBA 4LHVA 2MSCB 5KJCA 1XKLA 3KOXA 3TW6A 2FWMX 4URWR 2YOHA 4AIRA 1IHOA 5AHXA 1NJ2A 3VYWA 4URFA 5PNTA 4NH4A 2P9JA 2ZRKA 1SQFA 4MIKA 3AJDA 4DIEA 4BNJA 4UPVA 5JASA 2I2WA 3MN1A 3ZWOA 3QBDA 2EKZA 2JEOA 1MU5A 4HLQB 7REQA 5JD4A 3E2MA 4Z7JA 3KP1E 3G0IA 1DKUA 4B6QA 3W8RA 3IHTA 1NHGA 4RQUA 2PZGA 3D2AA 1UOPA 5JVDF 3WGVA 2AXQA 3QOFA 4U8HA 1UWVA 3ONEA 4D25A 2JDIA 1WDKA 4F7DA 4HVLA 5ENVA 4PRLA 3FE2A 2PEYA 4IJ6A 3DBVO 4JS0A 3Q0IA 3RW9A 1JJAA 5EESA 3VKFA 4TRRA 1MC4A 3I28A 1EJBA 4KQMA 2ZUDA 8ADHA 2OD7A 1RIFA 3BXFA 2M98A 1JQ5A 4PSKA 5IK2A 1WULS 2I2XB 4YH1A 2NO9A 3L7AA 4JOCA 1MG0A 1UBSB 1PT8A 1SAYA 5BV7A 3KQHA 1B4DA 1W36D 3OBBA 3OX1A 4NYMR 4CEJA 5TPWA 5LMNB 5EIBC 4AXXA 3RBZA 1DX6A 2D2XA 4AWAA 1L4LA 1GZSA 3T3EA 4NOLA 1LPNA 1RFLA 3JASB 3HL4A 3BWVA 5BW5A 1A3CA 2FE1A 2VJYA 1VCOA 2JCXA 3G9ZA 1KI1A 2ZRFA 3C16C 4Q4AA 5F4BA 3D5QA 1QXSA 3KOOA 1SXPA 3LZ6A 1PS8A 2GNOA 3EZ2A 1MT3A 2JASA 4IFTA 2HF9A 4L9SA 5AKYA 1K6XA 4KWCA 4FFWA 2OD9A 1QMPA 1J5EB 4INZA 3AEUA 5EXPA 3HNRA 4V39A 4RD4A 1NKTA 1OLSA 3GR6A 2J5QA 2HI0A 2V5AA 1HA3A 4IHKA 4BFYA 1TU0A 3VOSA 4G0OA 4XVCA 2PRSA 2SHKA 4KPFC 4TQAA 4R2LA 2C59A 1RFGE 3QXSA 2FSIA 2IZ7A 2VF8A 2DBRA 4PZLA 4AP9A 5FEUA 4ML3A 2M6SA 1TQ6A 3DHNA 1D1TA 3PXBA 2LH0A 3KPJA 1O9GA 2SBTA 4XFKA 5B58C 4WE3A 2Z2ZA 4XPIA 5LJIA 3PPYA 3Q8LA 4I5SA 4IJUA 3RSZA 3TBFA 2APLA 3KFUG 1QZTA 3K5PA 2FPPB 4V0SA 3DA1A 4KN9S 2ZJFA 3LDUA 1YVPA 4LF4M 1E2UA 3KOWA 1UBTS 1GIAA 3EIOA 1KMHA 1GFSA 1VEJA 2GTIA 3KUDA 3CZ9A 3G17A 1AJEA 4YT5A 4KDRA 3WICA 1JXMA 1NXQA 3T1QA 1QCDA 4L9WA 1EX9A 3GVIA 1N1MA 1T6YA 3K1JA 3H83A 3GN2A 4YJ2B 3WKDA 3NWLA 5D3ZA 4RPLA 3PXAA 3KTDA 3LXXA 3BGIA 4D0GA 4F2GA 1J9ZA 1F8YA 2HF8A 3VR5H 2R8BA 1W5TA 1ZD5A 2CC2A 4RTNA 3AF2A 1IBLM 4EGFA 1XCOA 4E5UA 3L9WA 2QORA 2VG8A 3QGMA 4QQNA 5MHTA 4M0MA 2HSEA 4QUHA 3ZGYA 4MI9A 4IQ8A 2VPTA 3KEGA 4B45A 3I5MA 2VZ0A 3FGOA 5F7JA 3QUCA 4N5NA 3LPAA 5B30A 3GQBB 5FUBA 2Z2IA 221PA 4PO3X 4GYKA 3BDAA 2Q4TA 2OFOA 1EWKA 1E2BA 3U49A 3W5HA 2H7VA 3GRAA 1BKYA 2ZRPA 4GE0A 3OZBA 3PRKE 2WU1A 3J7AC 2L2QA 2KMLA 3NWOA 4CFYA 3HLYA 4HKTA 2WTEA 5BOSA 1OX4B 4BWGA 5JSZB 2Y0EA 4OM8A 4ZRNA 1ZRHA 5CDUA 1W2WB 1AB6A 1LBIA 5K3DA 4OQNA 1XEXB 1T2UA 3WZ2A 5H4HA 1H2WA 1Z59A 3IVRA 3V3TA 1LW7A 2AFRA 4LOAA 5LLDA 4JOQA 3S2SA 4GUDA 1LV8A 2QSUA 3LOQA 1HDRA 3L29A 1DMSA 3EODA 4FZVA 5H3LA 2XB2A 4QWWA 4Z99A 4IX9A 2LVQD 2OV6A 3B1JA 1GJRA 6YASA 4CF5A 4U00A 2YV2A 2RRUA 3FRHA 1ZNQO 2Z2XA 3BS4A 1WZUA 3SHOA 1JQ3A 4DR6M 3O93A 3RS8A 4L1KA 1GN8A 4KZKA 1M2WA 3SSNA 4X1IB 4MVJI 5DVZA 3FHTA 4UTPA 3QVXA 4WN3A 1NVWQ 2XGNA 1FC0A 4BFZA 2IYLD 3GPUA 4I66A 3CH5A 2PL9A 2BGLA 4JA0A 2H1HA 1O96A 1E1RA 3U17A 3SQDA 4QPCA 2FFAA 4LOLA 2Y71A 3BQMB 2AJTA 3JWGA 3ICEA 3GJRA 3DL4A 4MGZE 5HG0A 4NAHA 4FT4A 2CLOB 3NH9A 1OZAA 3OT4A 4YAJA 1WEKA 1B6SA 1DJPA 3KSBC 2C2MA 3DZKA 1OLOA 1KBZA 3MLBA 3BDIA 2HZBA 3L0PA 5KQLA 3ZI7A 4WBNA 3SXJA 3Q3CA 3TLGB 3EAFA 4E30A 3ZLBA 1NI5A 1OWLA 1T2FA 3G8DA 4H7PA 3S8MA 5EERA 5HIMA 2PMBA 1CLUA 3BGSA 5LA6F 1I1OA 1AKEA 2N35A 5G41A 1ZAYA 4GZ5A 1WG8A 3KVWA 5C7YA 3HHZA 4Q1AA 1NVEA 2Y1WA 1WBJB 3U1VA 3I1FA 5ALVA 5B3AA 1GQOA 2O2YA 3QX7A 2VF7A 3FFBA 4G89A 1MPTA 1JHXA 4JEMA 2G1PA 3C8DA 3Q5DA 1N2BA 2QLNA 2XT0A 3IDZA 3PG5A 4ZALA 4OBWA 3STUA 3IBGA 3A11A 2HMTA 4FYHA 4YTEA 1RKVA 5C7LO 3WOHA 4KPUA 1QHEA 1FJHA 3HSSA 4DRZA 4RCVA 2Q41A 4KFRA 2DPXA 4YMGA 1OLXB 4BO6A 1UR5A 1U28C 3RAFC 4LSMA 3ANNA 5IM5A 3RRBA 3B7PA 3Q12A 3M3HA 3D6MA 2B1QA 1DAEA 2Q9AA 5KYGA 2BR3A 1NVFA 4E32A 1XI2A 3OKAA 2JGDB 5FOQA 5IN4A 2XT6A 4CEIB 4CE6A 4TM7A 5ALLA 1K2WA 4MUNA 3HV2A 5KI6A 4I4CA 2BTOA 1L7XA 4BQEA 1GNQA 5EZYA 1RM3A 1GAEO 2B2CA 2J07A 1C30A 5A9TA 4ZVLA 5KTKA 1LTHR 2Y0DA 4LDAA 1Y8QB 2H65A 2Q5JA 2BZ1A 3UAXA 2AC7A 4MV0A 4B80A 2QRPA 4NSOB 4NV1A 2YJZA 4Z9FA 2A33A 1XN1A 4BUCA 5FQNA 3NS7A 1HX7A 2ATEA 1X7XA 1L8OA 1FP4B 3FLMA 3ZPXA 2FPOA 1EUZA 5CEFA 2GWRA 5AW5A 3RQIA 2OHIA 4YROA 3WP0A 1VFNA 1HRDA 2FLWA 5AH0A 3DXFA 1PG5A 1JFTA 4B5KA 3RVNA 2CHVA 2GDJA 2E4VA 1IAVA 2H51A 5CFNA 3K0AA 4YMSA 1IHYA 1FDIA 3Q4GA 2ZREA 5EE5B 1PVOA 1VI6A 5CVVA 2J3DA 3DEJA 1O97C 3KT0A 2HQBA 3A25A 4GOND 4UM8B 1M6YA 1JDZA 1N32B 1W25A 5KNDD 2PL3A 1FFDA 3DS8A 5DLYA 2GK6A 3PNBA 4KQHA 1U2GA 4M88A 4L0MA 4IJWA 2CGEA 3QNWA 3D1VA 4RCZA 3T3OA 2AN9A 4RZUA 4ZCIA 2Z58A 3ZBUA 1NOJA 1E7QA 2PZFA 4IKOA 3PLAE 1VPDA 1F0PA 1H9AA 3IDAA 3BRCA 4F86A 3DUWA 5K20A 2J9FA 1KO4A 4N0MA 5M3BA 1E8NA 2HMUA 4JLJA 4LEIA 2CXNA 4C7VA 3PWZA 5D51S 3U6PA 5SZHB 1QH9A 3MHVC 1K3FA 1GZVA 3BD9A 1T35A 1G291 3KQPA 1ZGHA 2WZQA 4XX0B 5GOZA 3W7VA 3HXOA 2XZUA 4WCVA 1EEXB 2VPIA 3CE9A 1X1TA 1ZK3A 3RBVA 4TZ6A 4XM1A 4N5IX 3VJRA 3Q7PA 4OKNA 4MGIE 3ZU2A 3NYIA 3RWMB 5BRNA 2TYSB 3P9RA 1VJDA 3H2IA 4I6EA 3W7AA 1N5RA 3AT1A 2AC4A 5DFLA 4KFCA 3OQVA 5TJ9A 4JJ6A 4B6EA 4U7PB 1PSZA 2GN4A 4CU2A 3MW8A 1GYQA 1M0EA 2BEVB 1OFTA 2J7KA 3SAWA 4BWYA 1N5MA 4KLRA 3ZX5A 2F3TA 2GLTA 2B4YA 3PL5A 1BYUA 3T9CA 1U8EA 4GDMA 3JRNA 3B52X 1J8FA 1H5QA 1E3SA 5T3YA 3ZJYA 1FRQA 1ZK2A 5LMZA 3NXSA 3SMPA 1IEVA 2DSTA 5EJAA 1U8TA 2Q6KA 3F5SA 4AN4A 4QOZC 1XD2B 1UDBA 3DTTA 5TJHA 5CG2A 5MFZA 1NL3A 2A9KA 2PSHA 4J2TA 1XEWX 3E9DA 5JE8A 4IV0A 2VDRB 2BFDA 1D8TA 3KR2A 5E6UA 1GXSA 5EVJA 3LVWA 5B3LA 2N1MA 1E1QA 1F4IA 4N76A 1EM8A 3ZW9A 3LK6A 2W6ZA 5A71A 1G8MA 3DVLA 4OJKA 3VPFA 3BKXA 3U3KA 4V1CA 1P5HA 4LWPA 1YWGO 1GEGA 3H1FA 1E3MA 3IQDB 3BXOA 1ENPA 3MCAA 1VIVA 1OYWA 2FWJA 5JCOC 3T06B 4W5WA 4ZOLA 2Q9BA 3AZPA 3DBRA 5E9WA 3WLTA 4FGLA 4JXKA 4DCPA 3AKDA 1RJEA 5HGJA 5KNCD 4FCVA 1OKSA 3IKVA 1T0UA 2DY0A 1ZJ6A 3S0JA 3PNMA 5DNYA 1U6KA 3KJHA 2YC2C 4RKFA 1YOVB 4Z0HO 4GPBA 5K9ZA 1QGUA 1WZEA 4DLVA 2ZANA 2ZYIA 4HNGA 4CQMA 2D4HA 1SXGA 4O8CA 2A58A 4B34A 3GPXA 1W93A 1B0AA 2YVAA 4BUJA 2P2LA 3HY4A 2GPTA 2PKQP 2HNBA 1UKVY 3H2GA 3G02A 3SX4A 1T9KA 1NC3A 2WF9A 3NWJA 3FWYA 3M89A 4QGBA 1BMFD 1G5HA 2AT1A 3NHAA 1BS1A 2YNMD 4RSHA 2JCGA 5LWHA 1G18A 4PO1A 2EL9A 4RK1A 4X65M 5H16A 1NBAA 5KZMB 4OXKA 4MIEA 4M9QA 4BC0A 3LLVA 3NC4A 4OMDA 2QTMA 4DWWA 2NZ8A 1GSAA 2R2AA 4XGQA 1BWPA 3U3RA 1PGQA 1FS6A 2XFSA 2W4IA 2GD1O 3QIAA 3R7BA 4J7UA 4NAVA 3HR7A 4LXUA 4M9XA 5EUQB 1GCOA 2ODWA 5A0TA 4MW5A 4ZANA 2I54A 1QKJA 1U28A 4BO9A 4OX9B 1H8HA 1HETA 4KBYA 3SSAA 1M2OB 3KCQA 2FFJA 4WX2B 1YZNA 1XKQA 4B0PA 1VG0B 1ZGAA 2EIXA 1N2GA 1NNEA 3VHLB 5J43A 4D3XA 3O8QB 1W5AA 2HDOA 2EKKA 3DM9B 3LC2O 4IEIA 4DJAA 4Q66C 1MB3A 2QM0A 2FOIC 2FSSA 3CVOA 4KKVA 5IARA 1VHQA 3HO1A 5LMUB 1WV1A 5J9FA 1G3UA 2IV7A 3A58B 4P92A 2XKKA 3V4FA 1L2TA 1YK0A 2JI6A 3B85A 5EKXA 1NTRA 3DEAA 2DPMA 3QBVA 3SBJA 5JEDA 1FJGB 4BJHB 2PM8A 4NXNB 2Y66A 2G3QA 1QQBA 4FDMA 1IUNA 3QE9Y 3BMNA 1JPUA 1NULA 4OQ4A 2XGSA 3UEOA 4L74A 3KU4A 5BN4B 3D3QA 4F9GA 4J2HA 3KLMX 1E69A 2O06A 4ETMA 4MWOA 3K09C 5DNAA 1YIDA 5LA6B 2PR2A 4QG3A 3GVCA 2NSJA 3C7DB 2R62A 1M83A 3PJEA 3D3WA 1QYVA 4RTKA 3VZSA 4K9PA 2EX0A 4KIWA 1BJTA 3CEMA 4A5SA 2C99A 1OHHA 1SIWA 1D1PA 1R0ZA 2AK2A 1XYVA 4UHBA 5A4JA 2OPHA 3DMRA 4RK0A 5B37A 4C43A 1D0SA 2LCQA 4ZCMA 2C0PA 3K9NA 3EPPA 2GZ2A 3ME5A 2O2EA 3G5TA 1M5UA 2ZAGA 5F7OA 4P3PA 3CUEF 3WL6A 3H11A 1U3FA 2Z9DA 3MTQA 3MIZA 2PGXA 4HMPA 2CUTA 4EWLA 1AXRA 5B4UA 4Q4JB 2ZSAA 4DJJA 1TUGA 4WZBB 3HJBA 5AWFC 4TV8A 3W5VA 5ALKA 1SVKA 10MHA 1J4AA 1ZOLA 3JVUA 4K87A 4DVJA 5EUBA 4F3KA 5ERYA 2KZSA 5A4MS 1KDPA 4QFDA 1DEAA 3BRWD 1I1NA 2W37A 1AHPA 4PHFA 1NZJA 3S2GA 1JEDA 4PAQA 2G63A 4XCQA 2OHVA 5H02A 1XROA 3B13B 4AKEA 4RNCA 2L6OA 1GL3A 1RRFA 1E2IA 1PS0A 4ZYYA 2HRRA 3HK2A 2OUKA 4GQIA 1R2YA 2PL5A 4PINA 2W6QA 3AKYA 1PUJA 3ZNOA 3HHWA 2YN4A 2XE6A 4ZD6A 3RKSA 1BFKA 3DBIA 2JXNA 4PPGA 3FWHA 2AIRA 3D3NA 3HWWA 1GQYA 4FYPA 5IKOA 4H6VA 3S29A 1HUQA 2OOSA 5JS7A 2YY5A 4ARSA 4G8BA 1PWHA 5EVCA 3KHTA 1H2EA 4LF8B 3FKQA 3T9AA 2CYAA 4LRTA 2QQ0A 3N1UA 3LW7A 1XP8A 5JT1A 4YNBA 1VRCA 4D8WA 4DA0A 2HXSA 1R2QA 2VXOA 1XA0A 2CMKA 3PGKA 5H80A 3R4VA 5ILOA 4NRDA 4DQLA 2Q6OA 4GZMA 2G5CA 3FPKA 5JDCA 1HTBA 4N0DA 1MCZA 3A04A 4M8NE 2WB2A 4FZ5A 1EFKA 1I2AA 4ZRMA 2V74B 3QEMB 3X43A 1SRRA 2V0CA 2AZTA 2NUBA 3AV0A 4YCAA 3DSRA 4Y1FA 1Y3BE 5EC8A 2FPRA 4RY0A 3ORYA 3S70A 3C3AA 3L8CA 4MV7A 3O4VA 1KQOA 3EIHA 1XZMA 2Y9PB 3UZUA 3SQWA 1E2DA 2V58A 3SXUA 1ZM7A 2YRFA 2WUVA 4D9IA 4DHWA 1IBKB 4DBZA 4M0DA 1HDOA 3BHJA 4OJYA 2IEZA 1XAJA 2QN7A 5JCOA 1R0LA 3AJ8A 1XTTA 2DUWA 4EJSC 1XDBA 3QA9A 3KTOA 4NYIQ 3K72B 4J94A 4PLVA 1U3GA 5F3RA 4DJTA 3H5WA 2BMJA 3IAUA 3H8VA 4L08A 2B8NA 3KEQA 4UMFA 3B8EA 5EHGA 1ZITA 4U2GA 4CXMA 2B5OA 3SC2B 3FNGA 3PDIA 3BUSA 3RU2A 4L85A 1W73A 2P65A 3ZW8A 4GEGA 4C7OA 3D8SA 2NXCA 4Q34A 1XCBA 3IDQA 1XNQM 4GGPA 2CYBA 4EHJA 3LWDA 1R16A 2MCFA 3NT5A 3U37A 4LISA 1LQ2A 5K4HA 3Q2OA 3PTLA 3QF4B 5GONF 4FFOA 4F3NA 4HO1X 4TRNA 1E4OA 2I8AA 3EGOA 2ZE6A 2GEUA 3PU6A 4D4HA 1SHLA 3OUUA 5I5EA 4FJ1A 4F2PA 1U9ZA 3CWZA 4FFVA 4U2FA 2Y67A 3P71T 6NULA 3VAYA 2EZ9A 4V0NA 2UUPA 2ZUSA 1ZRSA 3THWB 1I3CA 1FFBA 2GYWA 1TJ4A 5EQTA 4EHBA 4NK5A 2EFGA 4HRAA 4ZJZA 5DGIA 3IULA 1Q39A 2YZMA 3UGQA 3WHPA 3I62A 3U4AA 1L5KA 1X1BA 1R5JA 2O8EA 1CDEA 4FWBA 2YDXA 1NUPA 1NW3A 4HBGA 4DIMA 4JI4M 4HZIA 3N3AC 2PD4A 2GPBA 4KODA 3H65A 2NACA 1CIVA 3KALA 1N5IA 1V1RA 2FPGB 2QTZA 1OWPA 2L4EA 5ESWA 4ENUA 1ODJA 2JJ2A 3VSAA 1E4EB 1C50A 3FKSD 3UK1A 3B38A 1TO6A 2X76A 3PZBA 5DTMA 2QLLA 1MORA 5HF6A 5BXYA 2OG1A 3OE5A 3MWGA 4OB7A 4KHPB 3WGNA 3S44A 2M5ZA 2XB4A 1OXVA 4I6JA 5JNUA 4YMTA 1CTQA 2VAPA 2NLOA 3D4IA 3QV2A 3FTFA 3I9KA 5L40A 1MB4A 4WXMA 2WMDA 2DP4E 4RC9A 3HN2A 4G0ZA 4OD0A 1NN5A 4ZHSA 4FR5A 2OM6A 3L1HA 1QFZA 3D7SA 1GNVA 2CL5A 2Z6QA 4KWTA 3OT1A 4QRDA 2Y0BA 2PZKA 3AI1A 3NKLA 4KCGA 1BDHA 4DJDC 1G6HA 1YE3A 5I9NA 4IUBS 4DSZA 4HNVA 4AM8A 2V7GA 4HEA1 4RIIA 5GVSA 3DBHB 4DL9A 3RPEA 1EFCA 1N78A 4A16A 4ZV7A 1Y63A 3OTQA 3N76A 3QE0A 4JXJA 3JQAD 4V0QA 4ZVNA 3AH8A 2I7TA 4MPJA 1REQA 1W5EA 3PRYA 1TW3A 5KBYA 5DX8A 5FUWA 1N2ZA 3I2JA 4REQB 4M0WA 3TX6A 3P9PA 3ZI4A 3K9CA 4EGQA 1QZUA 1Q1AA 1TYAE 1X7YB 3FOAA 1QE0A 4PZYA 4ZI7A 3GIWA 3B5IA 2NO6A 1YB7A 3K2LA 3A0RB 2R9VA 2GZDA 1ISFA 2C98A 4WD3A 2D7CA 4OSOA 1Z15A 2QYOA 2XNDD 1IONA 5J40A 1DTWB 3DTVB 3N6VA 3KIPA 2QZJA 1CUGA 3GEIA 1GGVA 5FAXA 2Q3BA 1CPYA 3C8HA 4EFKA 1FNMA 3EGEA 4DZTA 1ITZA 4DBLC 2ZJBA 5D00A 5AJXA 4MKZA 1IZZA 4G56A 4GM0A 3LUDA 3N87A 5B2FA 5F52A 3JAKB 2KDLA 2P9ZA 3E61A 5L3QA 2VXYA 3THXA 3BFXA 4FD3A 3BMQA 3HI4A 3I58A 3SOZA 3VPCA 1NDHA 5FFNA 4XWTA 2VYCA 1DC4A 1WX1A 3FYUA 4UCXA 2Y9MB 1R0BA 4HAUA 3WC4A 3DAYA 3KB8A 3DYBA 3G68A 3SHVA 1KQNA 1NHGC 1AX9A 4D3YA 1HL7A 5TGDA 3GRYA 3KFXA 4LF4B 2A14A 5E3IA 3AJ9A 1X1CA 4Y7DA 2CV0A 2VT3A 4R9UC 5BV0A 2F9MA 3P2OA 1DTSA 2OGSA 1PG0A 1XALA 3HVKA 5DP2A 1RWPA 1J06A 2P6OA 1A69A 1KGSA 1XCJA 3ED5A 1T24A 4QU5A 3PUXA 2ZZNA 3WGKA 5KREA 1WOMA 5E1MA 1BROA 4KDCA 3IP8A 1BCSB 1IBLB 2B69A 3ZXIA 4QDOA 2GCPA 1NLZA 4H6XA 4JEUA 4BX3A 4UUNA 2AE1A 3S8YA 1C9KA 2BJHA 1YNSA 1I0ZA 3EPLA 3PYLA 5IJ9A 1UJBA 3DAPA 3FGZA 3L0OA 5I7UA 1D0IA 4AG5A 2C7RA 2I55A 2FQYA 3DT8A 3GU3A 4YMLA 1BX1A 4KFTA 3ZIAD 1CY1A 1F4PA 3IVCA 2WAMA 3T7JA 1NURA 3S2FA 2HAEA 4H4EA 3A05A 1Y9DA 4NZ9A 4ZGGA 3AXSA 1C7FA 3N74A 2QMUA 1MW9X 3LX8A 2HSWA 2Y0PA 3CUUA 5FCDA 3DLCA 4ZC1A 3OPXA 2ZVQX 3TIIA 4V2IA 3TBHA 3PNYA 2QRHA 4C21A 2ZYHA 4LCEA 3ZK9A 4P3NA 4TKVA 2YV3A 2AI1A 2Q27A 4HNHA 1Y82A 2XVZA 3UFBA 1YJCA 3A1UA 4PZAA 2AVNA 4HYEA 1YR2A 5KYYA 4Z1MD 4Z54A 2O2XA 5SY9A 1D2CA 4JYPA 3A31A 3EXG1 2P4EA 4M37A 4YRFA 2QTRA 4URZR 4EENA 4IGFA 3ADDA 2EX1A 3NOQA 4GLOA 1ZLYA 4OI4A 5FO1A 1TYBE 4LXYA 2EZUA 2AB0A 2AOUA 4MLPA 4CV1A 2J33A 2EJSA 2VTDA 3LVFO 2WSLA 2G9ZA 3DT9A 5LLSA 4Q4CA 5BV1A 2NNWB 2P78A 3STHA 2C7QA 4Z5XA 2EATA 1C29B 2FQWA 5EIHA 3M6FA 1YQUA 4RE6A 2YUIA 4XE5A 2C9OA 4Y1EA 4QYXA 1MZVA 5AD1A 2ZSJA 2VEOA 1K7XB 3P45A 4IWYA 2V7QD 1LF0A 1J22A 5DI3A 5FA6A 4RFVA 3DD1A 2Z1DA 2ZCUA 4CLHA 3BIFA 4OAQA 4LHEA 3U3OA 3NHSA 5HQ3A 2SECE 3GZTB 3O26A 2C07A 2KX7A 5BUCA 5J5VA 1JYFA 2DLNA 3UJHA 2IUTA 1T0IA 3MGAA 2Z1MA 3ON5A 4LTMA 3WLRA 4BNZA 3A6HA 1Y8CA 3A2NA 2QPTA 1Z12A 2G09A 3WSVA 3H7AA 4CKBA 3GT4A 2K4MA 3B2EA 1T36B 4O29A 2NP7A 3O73A 4IIFA 5LQUA 3LLUA 3OMLA 4JYZA 3FUUA 2EHJA 1YQEA 4J0GA 4XLLA 1QR2A 2ZE5A 5D8DA 1WUYA 4ZT2A 1H23A 2YFQA 1ZC3A 4X8LA 4QDJA 3ZU3A 2JH3A 4G4NA 1W0KA 4YREA 3T4EA 1S96A 2ZSBA 2H5XA 1ZOOA 3SASA 4DDUA 4DV7M 3IOMA 1RCTE 4CMEA 4L8VA 3QUSA 4MHTA 2L42A 1IJFA 4DCSA 1YONA 1TT5B 1Y1PA 2L17A 3BF8A 5DOVA 4M0PA 1LJUA 1YD7A 1AS0A 1HOTA 3FCUB 4GMGA 5C8YA 2IYNA 4N03A 2MH8A 3RUAA 4WZAB 5LQCA 2X14A 2MT9A 2P91A 4BFLA 2E1PA 1G1MA 1ZICA 2MMCA 5KYXB 2VUTA 2VYQA 1ISIA 2A4MA 3WRVA 5GONB 1OAOC 4L8WB 5EMKA 2X1MA 4X1YB 4KGZA 2FEMA 4LFBB 3IILA 4CIDA 4KN5A 3FMOB 5FUVA 3R1IA 5AUOB 4YXWD 4K1XA 1L1FA 4AY3A 3P4UA 2FGKA 2WP0A 4W5QA 1IU9A 4L5AA 5ITYA 1RD4A 3TGPA 3LHIA 5HFAA 5JFOA 5DWVA 3ODPA 5CIWA 4B8WA 2VRCA 2EFEB 4FB4A 4JLNA 2I03A 2MR5A 5IBRA 4QULA 2PT6A 1OE0A 3VTZA 2FZLA 4R2HA 4IIXA 4B6RA 1XTBA 2HBZA 2REQB 3LSTA 3JQPA 1Q15A 3UIEA 2QU7A 5IS2A 3ZE8A 4JXZA 4HGNA 1O57A 3SKYA 5HUJA 1E2KA 2QP4A 5E6SB 3QVGA 2Y0TA 4OH7A 5JMTA 4IH4A 3HDQA 3GQ4A 1QAOA 2ZRGA 3SYLA 5JC8A 3UJ8A 4AKIA 3LT0A 1T8UA 2H9YA 3U6SA 1T2AA 2L82A 3A6DA 3SATA 1I6WA 2F5PA 1CJMA 1QDTA 1G7SA 3AHHA 2QB5A 1ZIDA 5BSRA 5CNJA 1EVJA 3OQIB 4B43A 2GYUA 1SCUA 4V3CA 2PT5A 4MMXB 4MQ5A 2X58A 2PS3A 1EAYA 4ADSG 2GAJA 1PR5A 1R4NA 4QAQA 2MDTA 1Z5OA 3HWSA 2YJ5A 3SGLA 2W22A 4M8LA 3P9XA 3B6MA 2X22A 2CJWA 4NICA 1OGYA 2WWRA 3CNBA 1K1EA 5FR1A 3CF6R 5JJIA 4IUCS 3EZXA 3V32A 3H4MA 4UQLA 4ND3A 5K8VA 2BV3A 3ADKA 2JKVA 1Z2AA 3DH0A 3UICA 4EEKA 1V9SA 5L53A 1J2UA 1GSHA 1Y7IA 2ZM5A 1UKYA 4BJ1A 4WACA 3OHSX 4QJ5A 3ESAA 3GGJA 4YDQA 4K0KM 3GP8A 1HE8B 2G07A 1Z5PA 3QOWA 2PE5A 3SQMA 1EDOA 3PHHA 4CIVA 1AQ6A 2A9VA 5U9CA 3K9FC 2QPLA 1M66A 4ZVTA 2EQAA 2MINB 2WIFA 2AH5A 1YRYE 5CGQB 3U4QB 4DXHA 4B3XA 1T5IA 4LY3A 3EZLA 4LSGA 4UTXA 2VSQA 4FMDB 1O95C 2YMQA 1E3WB 1V47A 4MW6A 4D1YA 4DTCA 2W93A 2BZ0A 4E70A 4MKGA 1TZCA 2XW6A 4U1RA 2LGJA 2EQBA 3B48A 4LHSA 3V33A 2OB2A 1CHNA 3DZ8A 3KZKA 1PJAA 1DZ3A 3LV8A 4X44A 2GN0A 3F49S 1Z4MA 3GRKA 5K7SA 2GPYA 2JZ0A 2RAUA 3LAWA 1WW8A 6REQB 3I9JA 2HK9A 3BPSA 3HCOA 1NVAA 3RVRA 2V7PA 4JP8A 2JLQA 5LM3A 3MK31 4PCAA 5DN6D 1L0BA 3DFIA 3IA2A 2ZT7A 1PKXA 4HY3A 4M86A 1EK1A 4AZFA 1I7SB 3R9IA 1E1DA 3HA7A 3B6ZA 4KVGA 1PJRA 1D2HA 2I7CA 5L7WA 1KDOA 3RKUA 1U2GC 4KWIA 1DEHA 5ES4B 2FF5A 4JJFA 2FPIA 1T26A 2W6ID 4XWWA 1PJIA 3BTSA 5ECDA 2GNAA 2GVNA 5FO0A 4JUAA 3RIEA 1ZJJA 1V48A 1Y3CE 5CP8A 4B4DA 2C3OA 3P19A 2P5TB 2LVPC 2NN3C 2QM3A 4P22A 4PG4A 1P7WA 3ENQA 5FHRA 2Q8QA 5DT9A 1IXSB 4JJGA 2HHAA 3RFWA 1R6VA 3HUEA 1Y3AA 3MINA 3PQ3A 1WCIA 3KW6A 2ZBGA 3FSRA 2AJDA 1TEXA 2MJ5B 1FA9A 4P31A 1OY1A 1CNEA 3URMA 2OXRA 2JAWA 3DV2A 4F6RA 5KMGA 2PZ8A 4PAWA 1SZCA 4QJ4A 4BVFA 3FFXA 3R6WA 4YJGA 4GSLA 2JL1A 1EK5A 2G70A 4W99A 3LGAA 3U13A 1ZO8A 2DMRA 5JSQA 1FXSA 1QFSA 2TRSB 2XMPA 5K3AA 2PANA 3WDMA 1RS0A 1E9CA 4WIAA 2LVOC 1SHTX 3SXPA 4K03A 1QCCA 2J0UB 1K7SN 4HPWA 5FNVB 2PO5A 3OJ0A 4KFUA 5KPDA 4PXSA 1L5FA 2YDYA 5HUQA 1QZEA 5EYPA 1TGYA 1RJGA 3C5EA 1YJ8A 4LRQA 2I6UA 2J7PA 3UKDA 1JG6A 3GLUA 3W79A 3VR4D 3WB1A 3RG8A 5IX8A 2ES4A 2CNNA 3GVPA 2BP7A 3QU9A 1DI0A 2YVUA 2QG9A 2P1ZA 2ZYWX 2WD8A 2NUAB 2H2IA 3IUBA 4BTEA 4RF2A 5JPIA 3TW8B 1P1JA 3VU1A 4FM9A 2XCQA 3JPWA 4B4KA 4WH0A 5FBRB 3E46A 1SVOA 3N2LA 2RC5A 3DQZA 2I1LA 4B3RB 1Z5WA 2SKEA 2OP1A 3CLTD 1EWYA 1TU4A 2VDVE 2EWMA 2Q1WA 2FSVA 4RL4A 2DHEA 1KJWA 3L8ZA 1L2DA 4IDHA 3BK1A 3VUFA 4BO5A 1J8MF 3QWHA 3X2SA 1E1MA 5CB0A 2W71A 5TMBA 4XDHA 3QWBA 2WA2A 3C3PA 5AI8A 2WSYB 1A88A 3DEZA 4JLPA 3DD5A 5CFQA 4W6QA 1VPTA 2IGBA 2OPBA 2OFPA 1XMQM 1DADA 1HTWA 1NTOA 4NPAA 4YGXB 3KS4A 1R6UA 2VHUA 3D8RA 4EKIA 3HBJA 2BRUC 2H4YA 3LBYA 5DX1A 2H2WA 1T0JB 4G97A 2C9BA 4GXTA 3LDAA 4HXYA 4JNKA 2Z43A 4QBHA 3NHLA 4MWSA 4DY6A 3FSGD 3QMPA 3C4QA 1OAOA 3L8GA 1QIIA 5KX5F 4X45A 2V6JA 3QE4A 1ZD3A 3H2ZA 4K0RA 4D57A 5IW8A 1LEHA 1PQ4A 5CA0F 2XE8A 1S7CA 3A36A 4E6PA 4JLVA 1N7GA 4I4TF 2CNLA 3U39A 4JLOA 3KWFA 2E21A 4UTNA 2ID4A 3RVLA 4L50A 5TQVA 2GZ3A 3ZZTA 2QQEA 2EZTA 3USZA 3A3YA 2J09A 2PWYA 4LBYA 3QXXA 2ZWPA 4KXWA 2X0KA 1OC2A 4AG6A 5A6SA 3DHYA 3LUCA 2FUCA 3E03A 3NM6B 2HSZA 1Z26A 3UTCA 1P8AA 5JAIA 4NEGA 1NIPA 3GJ0A 1S6YA 2W2OA 4D97A 4X92A 1Z45A 5A03A 4KU4A 1O0CA 3DE0X 2JFVA 1KK0A 2ODTX 3O1HB 3QPCA 3ETEA 2V65A 3DKPA 3KEOA 3AB3A 2BFMA 2VJMA 1A5ZA 3VKWA 4J76A 3P0IA 1WWKA 4CN9A 2G80A 4PHTA 2FR1A 1UBHS 3WIBA 1X80B 4C78A 4S0ZA 2NU6A 2QOEA 5INTA 1K7YA 4BX8A 3UB2A 2OZLB 2ATCA 4D8TA 1USIA 2UVPA 2AOWA 2Z8XA 4Z4IA 2PD6A 3E82A 3SZLA 3CT4A 1UM9A 1K68A 4IX1A 2V6GA 2P3SA 3PITA 2QR3A 3GLIB 3QYFA 2ZVJA 1QPGA 2APJA 2UKDA 1NVKA 5IABA 3BK7A 3STTA 3SMQA 2VRBA 4YAOA 4KQ9A 2ENUA 2ETVA 4LFCM 1K3XA 5A2QS 4QOIA 3DEYX 2PRKA 4GBGA 2DQSA 3V2IA 3KVOA 1KAHA 2BWJA 3GRFA 4CNBA 2GEDA 1JSRA 3UV3A 1B41A 1XF9A 4PGAA 3CRW1 1U2SA 1UWLA 1CDOA 2JIMA 1RWQA 4XR9A 2M6RA 2AYXA 5CJJA 1N8TA 5I3ZA 4K6FA 4Q05A 2CKMA 4MRSA 1O95A 2PO7A 2KPOA 2RHCA 2VC2B 3H75A 1HDZA 5CDFE 2JS7A 2QEQA 4BJ6A 1BWRA 4E5NA 1ZP6A 4P5EA 3RNLA 4X94A 4KQJA 1QVRA 2GN9A 1Z62A 5ELLA 2C88A 1UBFA 4X71A 2JJ8A 1TIBA 3X1DA 5L3SA 5DI9A 2B7CA 2R6FA 2WU4A 4JAVC 1HFWA 4BB6A 5TQ2B 4LRYA 4JN6B 4YRLA 1HORA 3CRVA 1NM5A 4Y2PA 4AY2A 1GQRA 4K86A 2YZ7A 1U2DA 1PUXA 1RXVA 3KJFA 2HDNB 1B6GA 3PXUA 2WSIA 3GRZA 4XSHA 3NRCA 4E94A 3GLHA 4BX0A 4Y9DA 3OHPA 3TOZA 4C4SA 4TMXA 4BNUA 2PK3A 5H3CA 4ARZB 3PQ4A 3FCOA 3VU9A 1ZJZA 1V3QE 2ZB8A 3V1KA 4KG7A 5JVDB 1N2HA 2H1SA 1AZSC 3MQFA 3RYIA 1H6AA 1EHIA 1EB8A 4II2A 5EXEA 3BWXA 1QLWA 2WYIA 1WMEA 4C7JA 1K27A 3CJQA 2RKOA 2FWNA 1G4UR 2IELA 4YYEA 5JYCA 2J08A 1XNQB 1DXQA 2WTBA 3U5ZB 3FOFC 3QKSA 5T3UA 4RTOA 1MENA 2WFZA 3RVDA 4N3AA 4TYWA 1RJ9A 1SZPA 4L5JA 3HVHA 4C4AA 5DYYA 2FUNB 3IQEA 4LKOA 4DABA 2FN3A 4E11A 5LN1A 1TF7A 2X0DA 3HZRA 2JGFA 2H0AA 2W5UA 2CBZA 2GEJA 4PPNA 4MWZA 1QQAA 3A6PC 2QMOA 2QQ5A 1UBKS 3TE6A 1YZFA 2QG4A 4ENRA 4P0PB 3IAM6 4TTAA 5CB4F 3BL8A 1XX6A 2ZIUB 1YZYA 3AJRA 3V6MA 2BGKA 4WZBE 5LLTA 1KY3A 1ZI9A 1SUDA 1XRPA 3MWFA 5D3QA 3TIVA 1ESMA 1ECCA 1KH3A 1VEKA 4OU5A 1JU3A 2IEGA 4GR4A 4O2AA 4E12A 3ELYA 1VDDA 1ZN8A 4HQ6A 3PC2A 1YDHA 1KEEB 2ZS8A 3CKKA 3CMMA 4MWEA 1PJSA 2ORVA 4QECA 1OV4A 4M8KA 5JDCC 1VSQA 3G2QA 4U02A 2YXBA 1CIJA 4L2IB 3NRBA 3ZDQA 4EO9A 4KH1A 3ICOA 2RKBA 2Y1EA 4UW9A 1YKFA 1FFCA 3GNQA 2R68A 2XY4A 4DA7A 1P39A 2I3GA 1VSVA 1H93A 2PMFA 1COZA 4KLCA 3HUTA 3AF6A 1D2RA 4KQEA 2HK7A 4Y2HA 3W5UA 2BRUA 5G3ZA 5LNK6 1PX0A 5CPFA 1I5RA 4AP6A 4RNAA 2HHHM 2DWOA 1ZVVA 5IUNC 5DULA 1CEEA 1GTVA 4BB9A 1NW7A 1C7EA 2QUBA 3HR4A 5JALA 2QAGA 3VZCA 2ZJ8A 3D7KA 3BCHA 5HE9A 2D2FA 4AMZA 1SO8A 3HNOA 1FVHA 2X86A 3K70D 2WSCF 3Q7TA 2AG1A 1HSOA 3KXIA 4ZVMA 5L8RF 2FS1A 2ZYSA 3FDIA 5ALDA 2PYIA 1N1DA 2ZBKB 4OAOA 1V11A 4HUQB 4HYYA 2DWUA 2VUSA 1J7KA 4YAFA 3H05A 4NU8X 2G4LA 1R0SA 5B1IA 1R6XA 3EA4A 4OY3A 4UC0A 1A2KC 4H1HA 3QZUA 3HKCA 5JZMA 2B82A 4UBJA 4MQ4A 4RK4A 2GXAA 4H0NA 1K98A 3LC1O 3FTQA 2X8WA 2IXTA 4ZCPA 3I23A 3T61A 1OU0A 3T1VA 3SC4A 3UJNA 5MF6A 2OBYA 5B3KA 2X8JA 4GEKA 2DHYA 2PR7A 2AFHA 4MTCA 2KHZA 1PQWA 2PWAA 3AR6A 1OU4A 3G0HA 4ZPXA 4RZ3A 4EMUA 2H59A 4DM4A 4MUHA 5REQA 3I8XA 5LDHA 1ZBQA 1KZHA 4ERNA 1JFSA 1AHIA 3KHSA 2OQ2A 5F3WB 1NNUA 4TQUS 3ESCA 1HJPA 5JECA 4RD2A 2Q3LA 4YUWA 5JATA 5JEEA 4JMLA 1A7AA 3U61A 3BL6A 4ZZIA 1NBME 4QBIA 2AK3A 2ACKA 4I1UA 3OIYA 2X8AA 3HY6A 3OFND 4WBXC 5G0WA 1E0AA 2W42A 3GO4A 3VZQA 1M3SA 3T3PB 1JN0A 5F1KA 4KLNA 4B2LA 2PV7A 1J1ZA 5HM8A 4TZKA 4KQXA 1UP7A 1PRYA 2R11A 3EHEA 3HKEA 2RSLA 5DHUA 3DMPA 4EDFA 4ZEMA 5CAEB 4NFSA 4RVFA 1OFIA 3ZZ0A 2EW2A 3VAZA 3VO1A 1IY8A 1XZKA 1F51E 4C6SA 3FN4A 2C3UA 3R4CA 4CM5A 2QDKA 1IIRA 2G9QA 3PQ7A 1S5PA 4B6JA 5CA0B 1SIBE 1SWWA 1Y33E 1OTXA 5GV8A 1GGEA 2TS1A 1ORDA 2RHBA 2AEEA 1PYOA 3LUJA 4H1UA 1S3GA 3G1UA 1H3EA 3QVWA 1NVMB 3DMHA 4LHXA 3DKVA 2RGUA 5EXXA 1Z2CA 2GO1A 4R8RA 4M6WB 4C0BA 3JWPA 5A4FS 5IBQA 3CTWB 1OI3A 4NS4A 4QUEA 4WK0B 1CF2O 5IF9A 3CVWA 3KHUA 1NV9A 2JLWA 1PZMA 2IXEA 3PEYA 5AM3A 2NSDA 3W05A 2XOKA 3CRMA 1DU4A 2W2KB 4S05A 3JQ8A 2OZPA 3MTDA 3ZE6A 5IRCD 1QSGA 4MCAA 1JL3A 2AZXA 4BQOA 2Z3WA 4ZT5A 3TVYA 3G89A 1HGXA 1LPMA 1XPJA 3J7AS 2P35A 4HDQB 4FJ2A 3G1WA 1WU7A 4RENA 1NSFA 1B14A 3F1KA 1KQGA 3J2PB 2JJMA 3GFVA 1G8GA 4CFSA 5ALIA 1Q1GA 2V7BA 4HG2A 1GKUB 1T2EA 3AVPA 4YUZA 1JI0A 5BP7A 3KYDA 1KYZA 4FFBB 5DSXA 3A28A 1N2SA 1EWRA 3BTVA 4X62B 2HJ9A 4NJEA 1DEKA 1GADO 2A78A 4LXHA 3VNUA 4BNMA 4F11A 3G9XA 3JYOA 1OSNA 5F98A 4X20B 5FDFA 5JNLA 2J31A 2AYZA 1APBA 1IRIA 2EW8A 4FWDA 4RZIA 4RDXA 2PX4A 3KZOA 1IH8A 1V1MB 1GGJA 5KJFA 3FYUC 3NAQA 3ER8A 5KYWB 3LL4A 3L27A 2V1UA 3JD0A 2QRUA 2DB3A 5EHZA 5F23A 2JH8A 3EEFA 4UULA 5CJ2A 5T41A 4RLQA 3TL6A 4YA6A 4ER6A 4YLGA 3K71B 3ROPA 2D00A 3B6JA 2XZPA 1V4NA 1JWBB 1ZD9A 3RVKA 5KSYA 4RPHA 4L51A 4RHCA 4CHTA 5I9TA 3MF4A 1P18A 4RKWA 1G2IA 5KTYA 3RU7A 1G3RA 2XUHA 3LC0A 3WLPA 5J4VA 2G9NA 5BT8A 4MEBA 3DCNA 1NFFA 1TKRA 5I9BA 1AUPA 2IEAA 2EWVA 4LJAA 2R1VA 1G6KA 2QJTA 4OA5A 2FZCA 2BE7A 3AF4A 2YRWA 1FBNA 3I34X 2X77A 1ZH4A 3WRYA 2QG6A 4Q9LA 5HS6A 1RZRD 1TDHA 3SCZA 4OQQA 2FYTA 5CDGA 1B16A 4IOKA 2XCOA 3VSDA 4X1KB 4MKXA 1QFXA 4P17A 1BXZA 3OE7A 3IMCA 1QR6A 1KR5A 4BVJA 4AJEA 5JJKA 4RZSA 4OXRA 1P0IA 1FTQA 1ZOSA 1EE2A 3G2KA 5AXAA 3T3HA 1QB8A 1YB4A 1F38A 4YRPA 3GLGB 5AOCA 2VWHA 2EQ5A 3QTTA 3PFKA 9LDBA 1JG7A 1FIUA 1BVRA 1F4LA 3VBEA 2JCYA 4RIHA 3JAMA 4PZEA 1ND5A 2GK7A 1JVNA 3FVRA 4MW1A 3I6IA 3AESA 4N5DA 3GEBA 5BV8A 4RK5A 1ESEA 1RW4A 2VO1A 4MW2A 3TQCA 1WA5A 2R7MA 3QFHA 3BWDD 4WDRA 1CRZA 1JR2A 3WHLA 4ZIRA 3AP3A 2WFAA 4GI5A 2GZSA 5DNCA 2FHPA 5ITXE 3EXHB 4LBVA 1EVYA 1E6WA 4UHCA 5CFLA 4XGKA 2CLMB 2VJOA 4DCTA 2D2IA 4XJTA 4P3KA 3FOWA 4OLBA 1VB3A 3F67A 3AI7A 3TVDA 1N2EA 4Y98A 2PX2A 1KJZA 1JQLB 5CTAA 1VBFA 4FYXA 3K1AB 1PJQA 2RH5A 4QGGA 1DBPA 1CS0A 4YJ3F 3QBEA 2LRHA 4ZYWA 1M67A 3A1TA 2Q5CA 3EIFA 3DMTA 4JJIA 4RH3A 1ICIA 2GXSA 2VFAA 2C5GA 3TR6A 3S27A 1AY0A 1OGIA 5TRTA 1L5YA 5CB4B 4AN1A 2C3YA 4QEDA 1P6QA 3KYCA 3KVNA 2GXUA 1RYBA 2DETA 2J6IA 3FFWA 3ZWPA 2YICA 3EDMA 4PFQA 1H6DA 5SYMA 1EBBA 4AJ1A 4WINA 3E9CA 4BQIA 2CXPA 2EARA 2RGXA 1E3LA 2Q4BA 3GDGA 2BCJQ 5JNVA 1YQWA 5ECWA 2PUEA 2JIOA 3COPA 5A3VA 1XC8A 1J2YA 1ZEMA 5EJFA 4FR2A 1DV1A 3BBPA 3JVEA 1JEQB 2ZE7A 1VL6A 5G1PA 2WM2A 4Q9HA 5BWNA 2EGUA 2VBCA 3VR5D 1CUIA 3EIEA 1OI2A 1R0YA 3D6FA 1JX6A 1VKRA 4GQBA 5FPKA 3F0TA 2XDWA 3ITKA 5B1HA 2LE0A 4YRDA 3ZDYB 4P80A 1GN9A 4FE7A 5KPTA 1C3JA 2FJPA 5BSWA 4RHFA 2CJPA 2LVBA 2J9GA 3ES9A 3B3JA 2A5LA 1XJ5A 2DFNA 4D0RA 3E4RA 3IJPA 4NBKA 5EN4A 3EEQA 1BE1A 3C4VA 2IRWA 2XMRA 1KY4A 4Q9NA 4BFWA 1C1HA 4CMEC 2R4TA 4KMRA 3K15A 4RFSB 4PBRA 4MRMA 4DQUA 1GAQA 5C4IA 3E3AA 3NP7A 1RNLA 1AB5A 3FCYA 1GPKA 1U7OA 3ISTA 1AGRA 3CKMA 3F90A 1RXSA 1UBEA 3OCWA 1CUYA 1QF9A 1NJGA 3HHYA 2IHNA 3RJ9A 1Q7RA 1XR3A 4A4DA 3SQOA 3JYLA 5LQJA 5HKBA 5IDYA 4K0KB 2DAKA 3WO1A 3E9RA 3IESA 2OEPA 1KMCA 3K4PA 4RMGA 1MTZA 3RAJA 3MMNA 4JROA 3C5VA 3A9TA 4A15A 2BISA 3A1CA 1JU9A 3FUVA 2ZRNA 1Z9BA 4N0QA 4OXXA 4A8JB 2DUJA 3BJMA 2XGGA 2KHHA 2REBA 4MUYA 3QTBA 4ALMA 2X5NA 1BXKA 2CD9A 5G1OA 1B8UA 1G20E 2RG1A 4DB2A 1OAIA 1R0RE 4N6OA 3ETGA 3JTMA 1ANKA 1ZQ1A 3B70A 3LRXA 2ZZMA 4WZAE 1ZVKA 5CX1A 3T35A 2ZRBA 1D0MA 1E0SA 4TTJA 3X2FA 1C0KA 3QVVA 4G9EA 1YJQA 1LLCA 1B23P 4HZUA 2PMCA 2ZU6A 3TECE 4WT7A 1WXWA 4BNNA 5ICSA 1Y7PA 1U4SA 1M1UA 2YWFA 2J5KA 2JY7A 2GCNA 2VDMB 2G28A 2YKGA 1M6EX 1P44A 2BD0A 5CBPA 1KK3A 4U7WA 4X00A 1KVUA 3H3FA 2ZBDA 1ZOPA 3F8SA 1OGJA 3P9QA 4XQEA 2XZLA 2OYCA 5AM2A 1LBEA 3CX8A 4J2OA 3TZEA 4ZN6A 2NZWA 1SU7A 4C05A 2WWFA 3VR1A 4YR9A 1OTRA 4G09A 3UUFA 3QVMA 4UAJA 4FYYA 3RFUA 3ELWA 2XMQA 2PKCA 1QVAA 3T1HM 1QU3A 3D0RA 3HH8A 4PR3A 4JSTA 3D4OA 4NTZA 4GKKM 1T8PA 3F74A 4MB7A 1BHSA 1X14A 4MO2A 2FW1A 2JLXA 2O3RA 1K0FA 4PLFA 4FE3A 2HBQA 2QV7A 3H8SA 1IJBA 2ZBQA 2NYRA 5ALFA 3WQSB 2QF7A 1M1ZA 5DJ5A 1V8DA 2YJTD 4EG7A 4Q9DA 4TOIA 4MYCA 3G23A 3PFIA 5M29A 3DV0B 1SA0B 3OZ7A 3T7SA 3HLKA 4OQXA 2OQIA 2QGFA 1NVVQ 4DMGA 5KJ6A 1NKSA 1P0FA 5GIOE 3R7DA 3Q7IA 4S1OA 2CMDA 3R3JA 5KJ1A 3NHRA 4PAMA 2UXBM 2F48A 2GPJA 2MSLA 2Q1XA 4O02B 4U7DA 3W9YA 3GJ4A 5A5VA 3NV7A 2WJGA 1GYRA 1PJLA 3HU3A 5ADVA 4FNOA 3RF7A 3A4MA 1WXXA 1T2CA 1GYPA 3IYLW 1JAIA 3L7LA 5HXAA 4IP0A 2BW0A 1TA0A 3K9HA 7ABPA 1GWNA 3EB9A 2MSEB 1F9AA 5LZ4A 2W83A 4RPIA 3LNCA 1WHSA 5ALQA 2O20A 3L84A 4BN4A 2VHCA 4AUNA 2Q9UA 4X6LA 1X9GA 3HJCA 2WYUA 4MWDA 4LGYA 4ZDWA 4UHDA 4MVJA 1S89A 4LPSA 3RUHA 3NUGA 3WK7A 2ONZA 4JFAA 1NP3A 2G67A 4Z3KA 1LS6A 1VKZA 4IBCA 4OI2A 5K8CA 5DHRA 1R8JA 3KD2A 4G65A 4ND7A 4PBTA 2FQXA 2IUYA 1C8KA 5HRUA 4QFBA 3TOXA 1Z73A 4WOJA 4NV0A 3K4QA 4QBGB 3FI0A 4JVMA 3TTXA 2WVGA 3L8FA 3FDZB 5G2OA 2VNSA 4I9NA 3LDFA 3TOVA 3U4DA 2O8NA 2ID9A 1NFQA 1XTUA 5SZKB 4O5OA 2VF4X 5LBTA 3NDJA 3SDBA 2J3HA 3COVA 3IXQA 4DR6B 1EK0A 2ZGVA 3D7NA 4QSMA 3WWPA 1FYEA 2R86A 4IDQA 3G88A 3AL2A 3VSCA 3JYHA 2FG6C 4EY8A 4JJ4A 5HWSA 2XADA 3K53A 3FWNA 3AF0A 3MWKA 1FB5A 1L5ZA 1UCFA 2GKSA 3LKDA 2IUEA 3OOSA 3FHOA 3UUWA 3EGVA 1AG9A 1C14A 1NBWB 1GPH1 4IW3B 3Q98A 1RVV1 4CV2A 5C8ZA 4LVUA 5HA5A 4IRUB 1UBOS 1T6OA 4BNFA 2Y1XA 1N25A 3T34A 3V2GA 4ZVKA 2QN6A 2G77B 1Y8ZA 4B40A 1OKKA 3IMKA 1YBMA 1A8IA 2YYZA 5TSDA 3HUFA 5B1DA 1DDOA 3B6EA 1Z8HA 1P3QQ 3K1ZA 1O94A 1KFVA 1B93A 2B98A 3RIMA 4FEGA 4XRGA 3TUZC 3G2MA 3DHEA 1ZK4A 1FW6A 1GQ2A 1MABB 3RWBA 1TX4B 4ZU3A 4BE9A 3TZCA 4MSUA 4NOJA 3KAPA 1YBAA 5ALRA 1JR3A 2ZI7A 2QCUA 4MQFB 3F46A 4U63A 4NMMA 1RHJA 1TPYA 4P98A 1ZIYA 3IA7A 4WQMA 2FSVC 5JO9A 2H57A 1T9ZA 2ZJ0A 4F2LA 2D13A 4YRCA 2PUBA 3WMEA 4E2XA 4F71A 1W48A 4O4IF 4OOEA 4RVGA 1PWYE 4JWTA 4E5DA 4MQEB 3H87A 4WCDA 2QUAA 4DLWA 2HCFA 3GG9A 3DDUA 3TO5A 4BFXA 2QZSA 3IFSA 4MA4A 4D43A 1OBVA 3MB5A 1X87A 4KLZA 1AUXA 4P7BA 2SCUB 1GP2A 4COKA 4LFCB 1HDIA 4EHHA 3WA6A 1X8LA 4TYYA 4TS4A 4YXFA 2OHJA 4PC7A 4RA9A 4YJ3B 3VRHA 3HDTA 1RBQA 2HWKA 1QANA 1QRUA 1ILWA 5ITSA 5BW6B 5MGBA 1FX0B 3QX3A 3UFXB 1FVFA 1TXGA 2QD5A 1UH5A 3OIDA 2MYNA 1G8KA 4QOSA 5JQGF 1CQJA 4PLCA 4G5OA 5GJWC 3B1VA 1KI7A 3CW2A 3NIWA 2WUEA 3NTVA 1PFKA 3DE4X 4I4NA 5EY5B 2NG1A 2X5OA 1MO4A 4X3OA 2FE8A 3GT3A 3WTCA 4JI3M 1XVTA 2HF7A 4EUHA 1XTQA 1PBTA 1ZBDA 4FFSA 4HC4A 2XQJA 1MBZA 4AZ0A 3N6XA 3Q3GE 5T64A 3B2QA 2J5YA 1AKMA 3W4IA 2G76A 3GLFA 1CUHA 4LOIA 1NN0A 3L4EA 4P9NA 2PSJA 1YQGA 4PN7A 2HCBA 2X5JO 3R3UA 3G5AA 1EPUA 2A5GA 2P40A 4PNEA 4M1YA 5E4FA 1LUAA 4FFDA 1UJNA 4UOZA 1BS9A 2PXCA 2WNHA 3VPHA 1KNQA 1DQRA 2AKEA 3T9EA 4B17A 2CMHA 5JH7A 4B83A 1PKEA 4X6YA 2FWIA 1KJIA 3F2IA 4GL2A 3PF9A 3FHCB 3VSEA 3WJ2A 4X64M 2B25A 1GA6A 2CWBA 3N0VA 1TH2A 5BYAA 5FEMA 3PDCA 4DCOA 4ENPA 2PVSA 1JUDA 1QGED 2A86A 2BUBA 4TWRA 3O8OA 3PV0A 2OO3A 2VHZA 3QKIA 3NHBA 4IEEA 1TH4A 4R8KA 2KNAA 2O5RA 5T67A 2ZRCA 4HGRA 4RJ2A 4C9BA 5CT9A 1AUVA 4W7IA 3IJRA 2DI0A 5TS3A 2BIFA 2IF2A 3QVUA 2I3AA 4IMRA 3WFIA 1E92A 3MZ0A 2NTEA 8MHTA 2C7PA 3W1VA 1QH8B 2VJBA 2LBPA 4CGYB 3GNSA 4Q3LA 3A6FA 4Q18A 1H8ED 2H0QA 3I53A 5FRDA 5JCJD 1GNSA 2G0TA 2WLSA 2Q29A 1KEVA 1T5BA 1VJCA 4ZREA 2IOHA 4JI6M 2Z6UA 1XL0A 1PJBA 2LDXA 3NHYA 1WMFA 4O4JF 3VPSA 1JHOA 1QVWA 3TKYA 4BQRA 1NLYA 1D04A 3Q87B 1VFPA 3GLIE 2Q6VA 4BLWA 4QYIA 1PL6A 3PC6A 2X7HA 3KPVA 2LPMA 2WYWA 3AFNA 1ZD8A 1Z2NX 2YYSA 4YCJA 4AY6A 5JROA 1AKNA 3GC6A 4V3BA 2HA2A 2A92A 3ZBPA 4IJFA 1JMKC 4EI9A 3DAOA 5HMLA 1T3TA 2FUG6 3J27B 3M5WA 3CJTA 3JU3A 4TKZA 1AS3A 4P3YA 4QYSA 4PYKA 1IMOA 3ASUA 5AVSA 1NM5C 2CWDA 1TGVA 4O2BF 1XWIA 2QE6A 3FA2A 4ZXFA 1SIOA 4F56A 1K08A 1U2DC 1EFRD 5AUPB 5FORA 1VMKA 5T6BA 4YMWA 5C3UA 3IUMA 4M1WA 4LXIA 4GRIA 4ZYUA 4GX5A 2QVGA 5HBGA 1J2TA 3A32A 3I9NA 1QFJA 3FSEA 1PEYA 1YZUA 2QRNA 4UNIA 3P9NA 1GZ4A 5HF8A 1NFRA 2EFDB 2G06A 5KOHB 4XIYA 1XPRA 2HHHB 3LVRE 2XEXA 3IP1A 1DUVG 2G71A 4LNHA 5ICMA 5CGZA 5H5JA 4UTRA 4RMIA 2XMCA 2PS9A 5D3MB 3SM3A 3T9BA 4Y2TA 1GRRA 1QJ4A 3HZJA 1VCNA 4D8YA 1MMFB 4DWJA 4WEOA 3I9MA 1A50B 2AZDA 3FMVA 4BLRA 2DKNA 3D9QX 1TUBA 3SR4A 3BDVA 1A9QA 4CV0A 4PGGA 2F5NA 1JMYA 1DB3A 2XKBA 1EH5A 3RIGA 2JUJA 4PS1A 2H3EA 2QK4A 4DLXA 2D0DA 4IZIA 2ZPUA 1XEFA 3GD5A 1ISJA 3EHDA 4YDSA 1U5CA 3KB6A 1E2LA 1KKLA 4UU7A 1HKHA 3BXHA 3KUKA 3FOCA 1K82A 2BGGA 2DUMA 2E1RA 1GUBA 2E9SA 3S8EA 2HA0A 4P4GA 1YSCA 5FBVB 1PLJA 3LMKA 4YC7A 2JVKA 3IKMB 1UMKA 2HIGA 2F3UA 4NHOA 4X65B 1R5BA 2R45A 3RTBA 2JLVA 2Q6TA 1OZ0A 1WCYA 4HP8A 2GD2A 2ZQ5A 3GT7A 3L04A 2O8CB 5AW2A 2XXJA 4UN2B 4D2IA 3RAEC 3L01A 5BWCA 4CM4B 3O82A 1ZL0A 4N82A 5KNBH 5EPEA 5KDDA 2WJ4A 1Y5LA 1II8B 3EG9B 5TGTA 2J5BA 3B53X 3CUYA 1EBUA 3QBJA 2W8ZA 1QOZA 3QUAA 3E7WA 2PGOA 5E95A 4OB8A 3SX2A 2IK8A 4YMVA 1UC8A 3L7OA 4QREA 3OFJA 5HKOA 4GKJM 1CIPA 4LG1A 2VDUE 3JALB 2CCKA 4BRZA 4WADA 3B51X 1N2OA 2PPLA 5DW0A 4H15A 2QMHA 1M1YB 3NNSA 1CEYA 2P11A 2ZUTA 1L5HA 2ALJA 3GEEA 1DRKA 3UANA 2AI2A 5E38A 2OCDA 3VR2A 2CMFA 5EQDA 3O8BA 3LPMA 1NNI1 3NO4A 4CCWA 3OCCA 5HHTA 4HQRA 2ZE8A 1B6RA 1MX3A 2QAGC 5E3HA 3T99A 4FYIA 1THTA 1YL5A 5JCXA 3WY9A 4TUYA 1MN6A 2ORWA 1O5TA 1VCIA 4P4SB 2QVXX 4CQLB 5LDGA 1XN4A 1RRVA 4QDTA 5FQOA 4MUIA 2DH6A 3T5BA 2WUDA 2RB5A 1CULC 5HM6A 4EJ6A 1UKZA 1XFAA 1GPMA 4Y30A 2G1AA 4QXMA 4R16A 1FFEA 1SHZA 4N3NA 1UJ6A 2QQFA 3UXEA 3SKVA 2GT1A 2XWBF 1GU1A 3FMFA 3ILHA 1RWMA 4ZCTA 1AVTA 5EWMB 4Q1FA 2P6UA 2PRIA 3ZNPA 4OXNA 4P34A 3UJ9A 4JQZA 1Q77A 3EWAA 1GL6A 1XPOA 4GI1A 1JSZA 1L7MA 1H6BA 1HLDA 3ZNQA 1E0JA 2X1LA 3D0KA 4BBAA 2XUKA 2YHUA 4O1HA 1YUMA 3M81A 4OQMA 3WNBA 1BW9A 1SVIA 4RF1A 2YQ4A 3O9MA 1AF4A 4ZYVA 1P5JA 2ACVA 2WHEA 3BRSA 4HNSA 1KP2A 1WSAA 3PA8A 1OASA 2HWJA 1CJVC 5G53C 1KFKB 3FD8A 4D9KA 1V95A 3RU3A 1J0AA 2VTKA 3ZI0A 2L7IA 4Q7JB 5SV2A 1LI5A 2X13A 4GNRA 2IYEA 4XQCA 4RVCA 1VMDA 1NNUC 4IF4A 3ZGXA 3IELA 2AG5A 1Z5AA 4DA8A 4MYSA 3HGMA 3HGTA 2WWXA 1A9XA 3CUWA 2VZEA 4NABA 2WPDD 4KC0A 3NOOA 4KP7A 1NU8A 3HSKA 3NDBB 2OK8A 1RJFA 2D1RA 1PR6A 3P97A 4JBWA 1O8CA 1F2VA 2OENG 4HS4A 3N3BC 3EULA 1EWTA 2GUWA 3OH8A 5BY2A 4TWBA 3TMKA 3ZJTA 3S28A 2ZSIA 5LL6P 3L07A 3ORRA 2HLDD 3Q6NA 5ITVA 4EB6A 2B78A 1BAPA 4EK9A 5JQGB 2Q2QA 1MPXA 3EC2A 2VHJA 3PPXA 1IG0A 3EXAA 3G2LA 4DQ0A 1ABBA 5ALOA 2ZP1A 1SVLA 4FS3A 3EXEB 4F2WA 1LI4A 2CK3D 2ZKLA 3DTYA 3QMMA 3MJSA 3UOWA 1W34A 2ACEA 2JI7A 1NG9A 4Q4LA 3LVQE 4IG4A 1M5TA 3DLTA 5H4GA 1T6ZA 2X8BA 3RRZA 4HWPA 1NQXA 4E6EA 2B99A 3L7MA 1UJ4A 1ISRA 1N9GA 2NU8B 4B3M