4IIWA

2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
304
Chain Sequence
SKEKITVEIPAGSSISDISTILEDKKVINNASIFSFYVKYNNDTNLKAGNYELSPAMNTDQIVKKMQEGKTVAPAKLVIPEGYTLDQIADRIVAYQPKLKKADVLKTMDDPEFVASMIKAYPETVTNDVLNKSIKHPLEGYLYPATYTFKGTDVSAEQIITEMVKATDVNIAKYRDELTKQKMSVHKFLTMSSIIEKEATENVDRKMIASVFYNRLAKDMRLQTDPTVLYALGEHKSKTTYKDLEVDSPYNTYKNNGLPPGPISNSGDSSMEAALYPEKSDYLYFLANKVYFSKTLEEHNKLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lmo1499 protein
publication title 2.6 Angstrom Crystal Structure of Putative yceG-like Protein lmo1499 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
total genus 83
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02618 YceG YceG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1150 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4iiwA01
4IIWA
chains in the Genus database with same CATH superfamily
4W5WA 4FVMA 2XF3A 4X66M 1Z6TA 1A5TA 2JY8A 3MJ5A 1R2YA 2R4EA 2D7EA 3IG5A 1NJFA 2VIIA 2HCBA 2Z7JA 3K2LA 4CJ6A 4OU7A 1NNUC 3J7AS 2LVPC 3D8LA 3L2AA 4JI1M 1SXJA 1GO5A 2VDBB 1C7YA 3QYBA 2UXBM 4IJFA 2C99A 4PCZA 2QNJA 1IY2A 1QAOA 4KT0F 3WHKA 4G3OA 2G5GX 4DR2M 4LF8M 4DR1M 1MX0A 2ZTDA 1QZMA 2Y20A 4MM3B 3SC3A 3ILKA 4JI0M 3ZCBB 1IFYA 3VKGA 4NSOB 2RRUA 4REZA 2EA0A 2DWMA 5IT9S 4IJEA 1D0KA 2CEAA 1MU5A 1G3IA 2J7NA 2E5LM 4NXMM 2X49A 2EO2A 3GQ4A 4K0KM 3TWKA 4Z6YA 5BR8M 3PVSA 5KPTA 1VDDA 2KW0A 3GLIE 2QSFX 1DGFA 5C1BA 5LMUM 2Z4RA 1V33A 2XEPA 3T1HM 4G4OA 3U61A 3NWLA 4CGYB 2JWSA 1HQCA 5DYIA 1W5TA 1OAIA 1RU3A 2O25A 4LF5M 4L8RC 1TTEA 2F5OA 3U5ZA 1DV0A 3SARA 2RKOA 5FTJA 1IN6A 3VKHA 1UFZA 5EQTA 2DHYA 2M5ZA 3GRVA 2EJSA 2F5PA 1AIPC 4B3TM 3KFUG 2CV0A 1UM8A 3CF0A 3U6SA 2DXIA 1WIVA 2DWZB 4LJ6A 4AG6A 3BOSA 4EIWA 2XLJA 3L26A 2GNOA 3FUVA 3HHYA 5ITXA 3GPYA 2L6OA 4LY6A 4ITQA 1G59A 4X65M 3JAMS 2N35A 3B7ZA 1HNWM 1YLAA 1NHWC 1ZMUA 2I7NA 5FTKA 4KODA 1ORYB 5LMNM 4IBEA 3GRUA 4AKHA 1LTMA 2KZSA 2UUAM 3FTFA 1YUBA 3VK7A 3SATA 3SHGB 1XXHE 2DAKA 4JI4M 1WHCA 3AOEA 4GEWA 4DR3M 4MH0E 2OOAA 3C3DA 3L27A 1R6BX 3T38A 1SG9A 2ZAOA 4G4RA 1XMOM 2YR0A 4LF7M 3TWLA 2YNMD 3GRRA 4KO8A 2V1UA 3DA1A 3SMSA 5GKNA 3A46A 2ERCA 2P5TA 3DOAA 4FCVA 1I94M 4UN2B 3R9XB 1NSFA 3HGIA 1OTRA 3GLGE 4BLCA 1QUSA 2DWLA 2KNZA 3L28A 3IG8A 4RKUF 4GKJM 1OAOC 3MMPA 2OPFA 4NRWA 2JP7A 1NO1A 4I81A 3J81S 4DV2M 4JYAM 3GLHE 1XXHB 2DKLA 1VQ1A 2V6ZM 3VDPA 2F5SA 3B89A 4MGIE 1T3TA 1G8PA 3H4MA 2XFTA 4I5SA 5A2QS 3HX3A 4B3RM 4YHHM 4M0WA 4LZZA 1GABA 1FJGM 3VK8A 4GRIA 1J09A 4D82A 4S12A 1VEGA 4RF0A 3KSJA 3EIHA 3PFIA 4LGYA 2R0IA 1KYIA 3NBXX 1D2NA 3GLGB 2ZM6M 3TL4X 1NY6A 3HKPA 4YY3M 2K47A 2R18A 4P16A 1N33M 1GL7A 1DGGA 1S3SA 4JN6A 3FYDA 4DV6M 2R6FA 1C1KA 2KZUA 3DZDA 3KOYE 4BBAA 2JA2A 5IREB 3U6CA 4B3SM 5JI3E 4I4LA 4LF4M 1OIPA 4M9XA 3GLHB 2CV1A 1OFHA 2MROB 4HLQA 4Q7JA 1KFVA 1IM2A 2C96A 3R8FA 1IY0A 1ZAEA 1ZV1A 1L2DA 1NJGA 1PJSA 1Q39A 2C9CA 4G4QA 2WSFF 5KQDA 1D0MA 4DR5M 1DGBA 2KNVA 2FFJA 4B7HA 2DZOB 4FCWA 3UJNA 4B3MM 1GJTA 1WJ7A 4IBDA 3FD9A 4LJAA 1NHGC 5JI2E 2DENA 1L1TA 2MJ5B 2QPAA 3U6LA 1TDZA 3M6AA 1F4IA 2ZAMA 2L4EA 2O5RA 3SAVA 2XFSA 4DV1M 4JI3M 2CP8A 4LJ4A 3OTOM 1E9SA 2NQ8C 3THGA 1L1ZA 1D0LA 1IQPA 3W67A 4DV3M 4JI6M 2FH0A 2R46A 2DZNB 1Q3BA 3UK6A 2F5QA 2XH9A 1K3WA 3HU2A 5C18A 3U60B 3L25A 5IWAM 1VEJA 3RE8A 4DV4M 4LFCM 3QWLA 3FTCA 3KOWE 3W0LB 1XXHA 1N34M 4LFBM 3PNVA 2UXDM 1VDLA 2BWBA 2KNAA 3W68A 2JY5A 1G4AE 1T43A 4X64M 2DWNA 4JV5M 3E46A 3KP1E 5IZ7D 3AL0C 2D7HA 1VEKA 3CF6E 1P3QQ 1L2CA 1PJTA 4GHLA 3I51A 3M0EA 4L6V6 3GLGA 4JI5M 1GJSA 1CUKA 2O01F 2WSEF 2XSZA 1I4WA 4IIWA 5FSWA 3E9SA 4MGYE 3L29A 2KRUA 4FWDA 4NRVA 3MK6A 1HR0M 1HNXM 5EP3A 1TF0B 4AKIA 2DHRA 5H37D 3SAUA 4LJ9A 4JI7M 1TGUA 5ITYA 2DAEA 4GC5A 4DR4M 3GLHA 2F4VM 4XBOA 3GLIB 3Q8XA 3SYLA 4B7GA 2DAGA 4ZPXA 3DFZA 1E9RA 1QZEA 3TE6A 4FWHA 3C9PA 4IBGA 3T6PA 2Z3XA 3HHXA 3TPZA 1V34A 2KRKA 3HJQA 1N77A 1IN8A 2J7OA 2R4JA 5E6JA 1XWIA 1V92A 3B74A 2H5XA 1OJLA 4AW4A 1JR3D 2YQZA 5KQ8A 2R62A 3W0FA 3LVWA 1GL6A 5DFLA 3C3EA 4LF9M 4L15A 4TUWA 3F92A 3FUXA 1N32M 1FNNA 3K92A 1N78A 4CIZA 1QDTA 4NXNM 4DUZM 1QANA 2CRUA 3U6QA 1MJGM 4DV5M 1NV9A 4OX9M 1OFIA 2L7IA 3KOXE 3BXWA 4CISA 1PGYA 4JXJA 3LVVA 3QAUA 4OW0A 3GLFE 2FS1A 2R44A 3GPPA 1SXJD 5ITQA 3WHLA 4KHPM 2DNAA 1XC8A 2QCUA 4R71A 3JR5A 3U60A 2JUJA 8CATA 3U6PA 1L8QA 3J27B 4MGHA 1WGLA 4LCBA 2J5YA 3GO8A 1PJIA 4M9ZA 1J7KA 4GMQA 2CV2A 1ZMWA 1XB2B 2JY6B 3CF2A 3ZC7B 2K9DA 2Y21A 2Z8YM 4DV7M 1G71A 2VQEM 4GITA 2FNAA 3KVWA 3IECA 1LV7A 1AUAA 1TH3A 2EKKA 3A45A 3I4YA 3LQQA 1VG5A 3E4RA 1TH2A 5ITXE 2EUCA 2QP9X 3FTEA 4QOZC 3K9PA 3FUWA 4QNRA 1OKSA 3GLFB 2CHQA 5DYGA 3T1YM 1QAQA 3A42A 3E21A 5E26A 4AG5A 4PD2A 4DR7M 5FTMA 3HWSA 1TH4A 3KS4A 2GQFA 2LVAA 4LF6M 3GQ3A 2ZTCA 2LWXA 1QQWA 3QYEA 1YSYA 2Q2EB 2XSZD 3I01M 3B7NA 1N75A 3GLIA 3SASA 2JZ1A 3HU3A 4Z8XA 2KEBA 4MGZE 7CATA 2F5NA 1EE8A 2H1RA 4XGIA 3PXGA 2QBYB 2UXCM 1XHBA 2CWBA 2L09A 4P17A 4F1IA 3HHZA 4DUYM 1NVMA 1IXZA 1QUTA 3H4JA 2HL7A 2LBCA 4II7A 5KO3A 2LH0A 4R3DA 2ZANA 2RGHA 1WR1B 1IXRC 1JQJC 4G6ZA 3AOGA 4WP2A 2CFOA 5EJCA 2DI0A 2K0BX 3FYCA 5BPVA 2OO9A 1H6UA 4RF1A 3KW6A 4DBGB 1WXQA 5L8RF 3UMMA 5ITTA 4MB7A 5FTLA 1Q02A 2LNHC 4LJ5A 4X62M 1PJJA 4WURA 4FCTA 2G8LA 2R65A 3VLFB 2UU9M 3SMPA 3I4VA 4KLNA 4IBJA 2R45A 4QOSA 1T6OA 2L2DA 5ITUA 4QNMA 1IXSB 1HJPA 2X4AA 1E32A 2EKFA 4MGKE 1BVSA 2A5YB 2MGWA 4LJ8A 4B7FA 4WW0A 2OOBA 3U6DA 1IBMM 1QYRA 1QAMA 2Y0QA 4CHTB 3SBJA 4F2LA 3RGPA 3J2PB 4M9SA 2XGNA 3AKZA 1EIJA 2DVWB 3FUUA 5FTNA 1DGHB 3TWMA 2DZLA 1SXJC 3ZH9B 2K6BA 4ANRA 4IBIA 1K82A 4PT5A 3VFDA 2VF8A 3GRYA 4AKGA 4LGMA 3KOZE 4AI6A 1QVRA 4D81A 1PJQA 2BJVA 1ZMVA 2AHMA 2BJWA 2LVNC 4PDGA 3GP1A 3U6EA 5KPRA 2JXNA 3LW5F 1Z5BA 2C9OA 3GLFA 5F3WA 2YFQA 3M7GA 4NC6A 2HAKA 2MH8A 1JR3E 2VQFM 4DV0M 4LRSA 3V76A 2XZFA 2XZUA 1J5EM 3LCVB 1K3XA 1IN5A 1E94E 1OIZA 2I7PA 3CGWA 4GH9A 3VDUA 4PDIA 1OQYA 1HT2E 4QHSA 3RGSA 1Z5AA 1HNZM 1Z59A 4IBKA 3K8ZA 3SAWA 3K9OA 2CHVA 2RGOA 3B9PA 2KDLA 1Y8GA 3SYKA 4OVZB 3B7QA 3HJSA 2C5RA 2QBYA 1SXJE 2WZJA 3RFWA 4NOOB 2FOIC 3C58A 3LCUA 4LRTA 4G4NA 4HEOA 1R7RA 1X37A 3FKEA 4LJ7A 3HZJA 2LXEA 1TR8A 1XNQM 3FRHA 2ZBKB 2V1CA 3HY5A 3TQSA 2D7GA 1IY1A 1EFUB 1Q3CA 5EXXA 2L4FA 2VF7A 1ZQ9A 2LTUA 5EXPA 2M60A 5EXSA 4D80A 3FTDA 1GVNA 3GPUA 2UUBM 4DR6M 3I04M 1R5LA 5DNYA 5EP1A 1W5SA 3GPXA 2L7HA 1DO2A 4GC9A 2FE8A 1NNJA 1IBKM 3KP0E 4FW9A 4JI2M 1QDRA 1GKIA 2BNKA 3KSXA 3K1JA 2CE7A 4NL4H 4JI8M 1XNRM 2KA6B 2W82A 3HJ8A 2LVQD 4LZJA 2Y0TA 2G3QA 1IXSA 2DAMA 1SXJB 5EP2A 4BB9A 5ITRA 2QHOB 3AOEC 2JZ0A 4FWGA 3ZQJA 2MR9A 3JR4A 3J7BA 2B3TA 3HU1A 1JB0F 3EIEA 1KSFX 2QENA 4LFAM 3FUTA 1HT1E 1DO0A 1DGHA 1WGNA 1MN3A 4L4UA 2JNHA 3LQRA 2HKJA 1TDHA 1R4GA 4M0DA 3HHWA 1HQYE 4RNAA 2DAIA 3KDSE 4HL4A 4XK8F 3UGJA 1IN4A 4Y28F 3SHFA 4IBBA 2APLA 2JY7A 3BBZA 1GLNA 1IN7A 3LMMA 4IBFA 1R2ZA 2HHHM 4A3VB 2HWJA 2X8AA 3GQ5A 4AQYM 1XMQM 3PNYA 2Z4SA 3AFHA 2KXEA 4GHAA 3NBIA 4NSRA 3AJIB 2LVOC 4LG2A 3U6MA 1NY5A 3U61B 5FLXS 4FD2A 1YE9A 4L78A 2LHGA 1PM5A 1L2BA 3FE3A 5KPZA 1IBLM 2WSCF 3U5ZB 4IBCA 5EP4A 3UZUA 2KHHA 3CTWB 4I8OA 4AZFA 3A98B 4OVZA 3T15A 2CUZA 5EXTA 3D8BA 3U6OA 2QZ4A 4L16A 4GKKM 3IHPA 3MHVC 3AV0A 4QHTA 3Q8GA 3J80S 2OQ4A 2UUCM 3KXEC 1Z5CA 3SFZA 2BWEA 3FRIA 2QQ8A 1G41A 1JR3A 4GIPA 2LHCA 1N36M 2C98A 3KS8A 4R7GA 4B08A 2CHGA 1PRBA 1NV8A
chains in the Genus database with same CATH topology
4W5WA 4FVMA 2XF3A 4X66M 1Z6TA 3MJ5A 1R2YA 2R4EA 2D7EA 3IG5A 1NJFA 2VIIA 2HCBA 2Z7JA 3K2LA 4OU7A 1NNUC 3J7AS 3L2AA 3D8LA 4JI1M 1SXJA 2UXBM 4IJFA 2C99A 4PCZA 1IY2A 1QAOA 3WHKA 2G5GX 4DR2M 4LF8M 4DR1M 1MX0A 1QZMA 2Y20A 4MM3B 3SC3A 3ILKA 4JI0M 3ZCBB 3VKGA 4NSOB 4REZA 2EA0A 2DWMA 5IT9S 4IJEA 2CEAA 1MU5A 1G3IA 2J7NA 2E5LM 4NXMM 2X49A 2EO2A 3GQ4A 4K0KM 3TWKA 4Z6YA 5BR8M 3PVSA 5KPTA 1VDDA 2KW0A 1DGFA 5C1BA 5LMUM 2Z4RA 2XEPA 3T1HM 4G4OA 3U61A 3NWLA 4CGYB 1HQCA 5DYIA 1W5TA 4LF5M 4L8RC 2F5OA 3U5ZA 3SARA 2RKOA 5FTJA 1IN6A 3VKHA 4B3TM 5EQTA 2M5ZA 3GRVA 2F5PA 3KFUG 2CV0A 1UM8A 3CF0A 3U6SA 2DXIA 4EIWA 2DWZB 4LJ6A 4AG6A 3BOSA 2XLJA 3L26A 3FUVA 3HHYA 5ITXA 3GPYA 2L6OA 4LY6A 4ITQA 1G59A 4X65M 3JAMS 1HNWM 1NHWC 2I7NA 5FTKA 4KODA 1ORYB 5LMNM 4IBEA 3GRUA 4AKHA 2KZSA 2UUAM 3FTFA 1YUBA 3VK7A 3SATA 3SHGB 4JI4M 3AOEA 4DR3M 4MH0E 3L27A 1R6BX 3T38A 2ZAOA 4G4RA 1XMOM 2YR0A 4LF7M 3TWLA 2YNMD 3GRRA 4KO8A 2V1UA 3DA1A 3SMSA 5GKNA 3A46A 2ERCA 2P5TA 3DOAA 4FCVA 1I94M 3R9XB 1NSFA 3HGIA 4BLCA 2DWLA 3L28A 3IG8A 4GKJM 2OPFA 4NRWA 4I81A 3J81S 4DV2M 4JYAM 1XXHB 2V6ZM 3VDPA 2F5SA 4MGIE 1T3TA 3H4MA 1G8PA 2XFTA 4I5SA 5A2QS 4B3RM 4YHHM 4M0WA 4LZZA 1FJGM 3VK8A 4GRIA 1J09A 4D82A 4S12A 4RF0A 3KSJA 3EIHA 3PFIA 4LGYA 1KYIA 1D2NA 3GLGB 2ZM6M 3TL4X 1NY6A 3HKPA 4YY3M 2K47A 2R18A 4P16A 1N33M 1GL7A 1DGGA 1S3SA 4JN6A 3FYDA 4DV6M 1C1KA 2KZUA 3DZDA 3KOYE 4BBAA 2JA2A 5IREB 3U6CA 4B3SM 5JI3E 4I4LA 4LF4M 4M9XA 3GLHB 2CV1A 1OFHA 4HLQA 1KFVA 1IM2A 2C96A 3R8FA 1IY0A 1ZAEA 1L2DA 1NJGA 2C9CA 1Q39A 4G4QA 5KQDA 4DR5M 1DGBA 2FFJA 4B7HA 2DZOB 4FCWA 3UJNA 4B3MM 4IBDA 3FD9A 4LJAA 1NHGC 5JI2E 1L1TA 2QPAA 3U6LA 1TDZA 3M6AA 2ZAMA 2O5RA 3SAVA 2XFSA 4DV1M 4JI3M 4LJ4A 3OTOM 1E9SA 2NQ8C 3THGA 1L1ZA 1IQPA 4DV3M 4JI6M 2R46A 2DZNB 1Q3BA 3UK6A 2F5QA 2XH9A 1K3WA 3HU2A 5C18A 3U60B 3L25A 5IWAM 3RE8A 4DV4M 4LFCM 3QWLA 3FTCA 3KOWE 3W0LB 1XXHA 1N34M 4LFBM 3PNVA 2UXDM 1G4AE 4X64M 2DWNA 4JV5M 3KP1E 5IZ7D 3AL0C 2D7HA 3CF6E 1L2CA 4GHLA 3I51A 3M0EA 3GLGA 4JI5M 2XSZA 1I4WA 4IIWA 5FSWA 3E9SA 4MGYE 3L29A 2KRUA 4FWDA 4NRVA 3MK6A 1HR0M 1HNXM 5EP3A 4AKIA 2DHRA 5H37D 3SAUA 4LJ9A 4JI7M 1TGUA 5ITYA 4GC5A 4DR4M 3GLHA 2F4VM 4XBOA 3GLIB 3Q8XA 3SYLA 4B7GA 4ZPXA 3DFZA 1E9RA 3TE6A 4FWHA 4IBGA 2Z3XA 3HHXA 3TPZA 2KRKA 3HJQA 1N77A 1IN8A 2J7OA 2R4JA 5E6JA 1XWIA 4AW4A 1OJLA 1JR3D 2YQZA 5KQ8A 2R62A 3W0FA 3LVWA 1GL6A 4LF9M 4L15A 4TUWA 3FUXA 1N32M 1FNNA 3K92A 1N78A 4NXNM 4DUZM 1QANA 3U6QA 4DV5M 4OX9M 1OFIA 2L7IA 3KOXE 4CISA 4JXJA 3LVVA 3QAUA 4OW0A 3GPPA 1SXJD 5ITQA 3WHLA 4KHPM 1XC8A 2QCUA 3JR5A 3U60A 8CATA 3U6PA 1L8QA 3J27B 4MGHA 4LCBA 3GO8A 1PJIA 4M9ZA 1J7KA 4GMQA 2CV2A 3CF2A 3ZC7B 2Y21A 4DV7M 2VQEM 4GITA 2FNAA 3KVWA 1LV7A 3A45A 1TH3A 3I4YA 3LQQA 3E4RA 1TH2A 5ITXE 2EUCA 2QP9X 3FTEA 4QOZC 4QNRA 3FUWA 3GLFB 2CHQA 5DYGA 3T1YM 1QAQA 3A42A 5E26A 4AG5A 4PD2A 4DR7M 5FTMA 3HWSA 1TH4A 3KS4A 4LF6M 3GQ3A 2LWXA 1QQWA 1YSYA 2Q2EB 2XSZD 1N75A 3GLIA 3SASA 3HU3A 4Z8XA 2KEBA 4MGZE 7CATA 2F5NA 1EE8A 2H1RA 4XGIA 3PXGA 2QBYB 2UXCM 1XHBA 2L09A 4DUYM 3HHZA 1NVMA 1IXZA 2HL7A 4II7A 5KO3A 2LH0A 4R3DA 2ZANA 2RGHA 1IXRC 1JQJC 4G6ZA 3AOGA 2CFOA 5EJCA 5BPVA 3FYCA 3UMMA 1H6UA 4RF1A 3KW6A 1WXQA 5ITTA 4MB7A 5FTLA 2LNHC 4LJ5A 4X62M 1PJJA 4WURA 4FCTA 2G8LA 2R65A 3VLFB 2UU9M 3SMPA 3I4VA 4KLNA 4IBJA 2R45A 4QOSA 5ITUA 4QNMA 1IXSB 2X4AA 1E32A 4MGKE 2A5YB 4LJ8A 4B7FA 4WW0A 3U6DA 1IBMM 1QYRA 1QAMA 2Y0QA 4CHTB 3SBJA 3RGPA 3J2PB 4M9SA 2XGNA 3AKZA 2DVWB 3FUUA 5FTNA 1DGHB 3TWMA 3ZH9B 1SXJC 4IBIA 1K82A 4PT5A 3VFDA 3GRYA 4AKGA 4LGMA 3KOZE 4AI6A 1QVRA 4D81A 2BJVA 2AHMA 2BJWA 4PDGA 3U6EA 3GP1A 5KPRA 1Z5BA 2C9OA 3GLFA 5F3WA 2YFQA 3M7GA 2VQFM 4DV0M 4LRSA 2XZFA 2XZUA 1J5EM 1K3XA 1IN5A 1E94E 4GH9A 2I7PA 3VDUA 4PDIA 4QHSA 1HT2E 3RGSA 1HNZM 1Z5AA 1Z59A 4IBKA 3K8ZA 3SAWA 2CHVA 2RGOA 3B9PA 3SYKA 4OVZB 3HJSA 2C5RA 2QBYA 1SXJE 3RFWA 4NOOB 2FOIC 3C58A 4LRTA 4G4NA 1R7RA 1X37A 3FKEA 4LJ7A 2LXEA 1XNQM 2ZBKB 2V1CA 3TQSA 2D7GA 1IY1A 1Q3CA 5EXXA 1ZQ9A 5EXPA 2M60A 5EXSA 4D80A 3FTDA 1GVNA 3GPUA 2UUBM 4DR6M 5DNYA 5EP1A 1W5SA 3GPXA 2L7HA 1DO2A 4GC9A 2FE8A 1NNJA 1IBKM 3KP0E 4FW9A 4JI2M 1GKIA 2BNKA 3KSXA 3K1JA 2CE7A 4NL4H 4JI8M 1XNRM 2KA6B 2W82A 3HJ8A 4LZJA 2Y0TA 4BB9A 5EP2A 1SXJB 5ITRA 3AOEC 4FWGA 3JR4A 3J7BA 3HU1A 3EIEA 1KSFX 2QENA 4LFAM 3FUTA 1HT1E 1DO0A 1DGHA 4L4UA 3LQRA 2HKJA 1TDHA 4M0DA 4RNAA 3HHWA 1HQYE 3KDSE 4HL4A 3UGJA 1IN4A 3SHFA 4IBBA 1GLNA 1IN7A 3LMMA 4IBFA 1R2ZA 2HHHM 4A3VB 1XMQM 2X8AA 3GQ5A 4AQYM 3PNYA 2Z4SA 3AFHA 2KXEA 4GHAA 3NBIA 4NSRA 3AJIB 4LG2A 3U6MA 1NY5A 3U61B 5FLXS 4FD2A 1YE9A 4L78A 1PM5A 1L2BA 1IBLM 5KPZA 3U5ZB 4IBCA 5EP4A 3UZUA 4I8OA 3CTWB 4AZFA 3A98B 4OVZA 3T15A 2CUZA 5EXTA 3D8BA 3U6OA 2QZ4A 4L16A 4GKKM 3MHVC 3AV0A 4QHTA 3J80S 2OQ4A 2UUCM 3KXEC 1Z5CA 3SFZA 1G41A 1JR3A 4GIPA 1N36M 2C98A 3KS8A 4R7GA 4B08A 2CHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIW A; 
#chains in the Genus database with same CATH topology
 4W5W A;  4FVM A;  2XF3 A;  4X66 M;  1Z6T A;  1A5T A;  2JY8 A;  3MJ5 A;  1R2Y A;  2R4E A;  2D7E A;  3IG5 A;  1NJF A;  2VII A;  2HCB A;  2Z7J A;  3K2L A;  4CJ6 A;  4OU7 A;  1NNU C;  3J7A S;  2LVP C;  3D8L A;  3L2A A;  4JI1 M;  1SXJ A;  1GO5 A;  2VDB B;  1C7Y A;  3QYB A;  2UXB M;  4IJF A;  2C99 A;  4PCZ A;  2QNJ A;  1IY2 A;  1QAO A;  4KT0 F;  3WHK A;  4G3O A;  2G5G X;  4DR2 M;  4LF8 M;  4DR1 M;  1MX0 A;  2ZTD A;  1QZM A;  2Y20 A;  4MM3 B;  3SC3 A;  3ILK A;  4JI0 M;  3ZCB B;  1IFY A;  3VKG A;  4NSO B;  2RRU A;  4REZ A;  2EA0 A;  2DWM A;  5IT9 S;  4IJE A;  1D0K A;  2CEA A;  1MU5 A;  1G3I A;  2J7N A;  2E5L M;  4NXM M;  2X49 A;  2EO2 A;  3GQ4 A;  4K0K M;  3TWK A;  4Z6Y A;  5BR8 M;  3PVS A;  5KPT A;  1VDD A;  2KW0 A;  3GLI E;  2QSF X;  1DGF A;  5C1B A;  5LMU M;  2Z4R A;  1V33 A;  2XEP A;  3T1H M;  4G4O A;  3U61 A;  3NWL A;  4CGY B;  2JWS A;  1HQC A;  5DYI A;  1W5T A;  1OAI A;  1RU3 A;  2O25 A;  4LF5 M;  4L8R C;  1TTE A;  2F5O A;  3U5Z A;  1DV0 A;  3SAR A;  2RKO A;  5FTJ A;  1IN6 A;  3VKH A;  1UFZ A;  5EQT A;  2DHY A;  2M5Z A;  3GRV A;  2EJS A;  2F5P A;  1AIP C;  4B3T M;  3KFU G;  2CV0 A;  1UM8 A;  3CF0 A;  3U6S A;  2DXI A;  1WIV A;  2DWZ B;  4LJ6 A;  4AG6 A;  3BOS A;  4EIW A;  2XLJ A;  3L26 A;  2GNO A;  3FUV A;  3HHY A;  5ITX A;  3GPY A;  2L6O A;  4LY6 A;  4ITQ A;  1G59 A;  4X65 M;  3JAM S;  2N35 A;  3B7Z A;  1HNW M;  1YLA A;  1NHW C;  1ZMU A;  2I7N A;  5FTK A;  4KOD A;  1ORY B;  5LMN M;  4IBE A;  3GRU A;  4AKH A;  1LTM A;  2KZS A;  2UUA M;  3FTF A;  1YUB A;  3VK7 A;  3SAT A;  3SHG B;  1XXH E;  2DAK A;  4JI4 M;  1WHC A;  3AOE A;  4GEW A;  4DR3 M;  4MH0 E;  2OOA A;  3C3D A;  3L27 A;  1R6B X;  3T38 A;  1SG9 A;  2ZAO A;  4G4R A;  1XMO M;  2YR0 A;  4LF7 M;  3TWL A;  2YNM D;  3GRR A;  4KO8 A;  2V1U A;  3DA1 A;  3SMS A;  5GKN A;  3A46 A;  2ERC A;  2P5T A;  3DOA A;  4FCV A;  1I94 M;  4UN2 B;  3R9X B;  1NSF A;  3HGI A;  1OTR A;  3GLG E;  4BLC A;  1QUS A;  2DWL A;  2KNZ A;  3L28 A;  3IG8 A;  4RKU F;  4GKJ M;  1OAO C;  3MMP A;  2OPF A;  4NRW A;  2JP7 A;  1NO1 A;  4I81 A;  3J81 S;  4DV2 M;  4JYA M;  3GLH E;  1XXH B;  2DKL A;  1VQ1 A;  2V6Z M;  3VDP A;  2F5S A;  3B89 A;  4MGI E;  1T3T A;  1G8P A;  3H4M A;  2XFT A;  4I5S A;  5A2Q S;  3HX3 A;  4B3R M;  4YHH M;  4M0W A;  4LZZ A;  1GAB A;  1FJG M;  3VK8 A;  4GRI A;  1J09 A;  4D82 A;  4S12 A;  1VEG A;  4RF0 A;  3KSJ A;  3EIH A;  3PFI A;  4LGY A;  2R0I A;  1KYI A;  3NBX X;  1D2N A;  3GLG B;  2ZM6 M;  3TL4 X;  1NY6 A;  3HKP A;  4YY3 M;  2K47 A;  2R18 A;  4P16 A;  1N33 M;  1GL7 A;  1DGG A;  1S3S A;  4JN6 A;  3FYD A;  4DV6 M;  2R6F A;  1C1K A;  2KZU A;  3DZD A;  3KOY E;  4BBA A;  2JA2 A;  5IRE B;  3U6C A;  4B3S M;  5JI3 E;  4I4L A;  4LF4 M;  1OIP A;  4M9X A;  3GLH B;  2CV1 A;  1OFH A;  2MRO B;  4HLQ A;  4Q7J A;  1KFV A;  1IM2 A;  2C96 A;  3R8F A;  1IY0 A;  1ZAE A;  1ZV1 A;  1L2D A;  1NJG A;  1PJS A;  1Q39 A;  2C9C A;  4G4Q A;  2WSF F;  5KQD A;  1D0M A;  4DR5 M;  1DGB A;  2KNV A;  2FFJ A;  4B7H A;  2DZO B;  4FCW A;  3UJN A;  4B3M M;  1GJT A;  1WJ7 A;  4IBD A;  3FD9 A;  4LJA A;  1NHG C;  5JI2 E;  2DEN A;  1L1T A;  2MJ5 B;  2QPA A;  3U6L A;  1TDZ A;  3M6A A;  1F4I A;  2ZAM A;  2L4E A;  2O5R A;  3SAV A;  2XFS A;  4DV1 M;  4JI3 M;  2CP8 A;  4LJ4 A;  3OTO M;  1E9S A;  2NQ8 C;  3THG A;  1L1Z A;  1D0L A;  1IQP A;  3W67 A;  4DV3 M;  4JI6 M;  2FH0 A;  2R46 A;  2DZN B;  1Q3B A;  3UK6 A;  2F5Q A;  2XH9 A;  1K3W A;  3HU2 A;  5C18 A;  3U60 B;  3L25 A;  5IWA M;  1VEJ A;  3RE8 A;  4DV4 M;  4LFC M;  3QWL A;  3FTC A;  3KOW E;  3W0L B;  1XXH A;  1N34 M;  4LFB M;  3PNV A;  2UXD M;  1VDL A;  2BWB A;  2KNA A;  3W68 A;  2JY5 A;  1G4A E;  1T43 A;  4X64 M;  2DWN A;  4JV5 M;  3E46 A;  3KP1 E;  5IZ7 D;  3AL0 C;  2D7H A;  1VEK A;  3CF6 E;  1P3Q Q;  1L2C A;  1PJT A;  4GHL A;  3I51 A;  3M0E A;  4L6V 6;  3GLG A;  4JI5 M;  1GJS A;  1CUK A;  2O01 F;  2WSE F;  2XSZ A;  1I4W A;  4IIW A;  5FSW A;  3E9S A;  4MGY E;  3L29 A;  2KRU A;  4FWD A;  4NRV A;  3MK6 A;  1HR0 M;  1HNX M;  5EP3 A;  1TF0 B;  4AKI A;  2DHR A;  5H37 D;  3SAU A;  4LJ9 A;  4JI7 M;  1TGU A;  5ITY A;  2DAE A;  4GC5 A;  4DR4 M;  3GLH A;  2F4V M;  4XBO A;  3GLI B;  3Q8X A;  3SYL A;  4B7G A;  2DAG A;  4ZPX A;  3DFZ A;  1E9R A;  1QZE A;  3TE6 A;  4FWH A;  3C9P A;  4IBG A;  3T6P A;  2Z3X A;  3HHX A;  3TPZ A;  1V34 A;  2KRK A;  3HJQ A;  1N77 A;  1IN8 A;  2J7O A;  2R4J A;  5E6J A;  1XWI A;  1V92 A;  3B74 A;  2H5X A;  1OJL A;  4AW4 A;  1JR3 D;  2YQZ A;  5KQ8 A;  2R62 A;  3W0F A;  3LVW A;  1GL6 A;  5DFL A;  3C3E A;  4LF9 M;  4L15 A;  4TUW A;  3F92 A;  3FUX A;  1N32 M;  1FNN A;  3K92 A;  1N78 A;  4CIZ A;  1QDT A;  4NXN M;  4DUZ M;  1QAN A;  2CRU A;  3U6Q A;  1MJG M;  4DV5 M;  1NV9 A;  4OX9 M;  1OFI A;  2L7I A;  3KOX E;  3BXW A;  4CIS A;  1PGY A;  4JXJ A;  3LVV A;  3QAU A;  4OW0 A;  3GLF E;  2FS1 A;  2R44 A;  3GPP A;  1SXJ D;  5ITQ A;  3WHL A;  4KHP M;  2DNA A;  1XC8 A;  2QCU A;  4R71 A;  3JR5 A;  3U60 A;  2JUJ A;  8CAT A;  3U6P A;  1L8Q A;  3J27 B;  4MGH A;  1WGL A;  4LCB A;  2J5Y A;  3GO8 A;  1PJI A;  4M9Z A;  1J7K A;  4GMQ A;  2CV2 A;  1ZMW A;  1XB2 B;  2JY6 B;  3CF2 A;  3ZC7 B;  2K9D A;  2Y21 A;  2Z8Y M;  4DV7 M;  1G71 A;  2VQE M;  4GIT A;  2FNA A;  3KVW A;  3IEC A;  1LV7 A;  1AUA A;  1TH3 A;  2EKK A;  3A45 A;  3I4Y A;  3LQQ A;  1VG5 A;  3E4R A;  1TH2 A;  5ITX E;  2EUC A;  2QP9 X;  3FTE A;  4QOZ C;  3K9P A;  3FUW A;  4QNR A;  1OKS A;  3GLF B;  2CHQ A;  5DYG A;  3T1Y M;  1QAQ A;  3A42 A;  3E21 A;  5E26 A;  4AG5 A;  4PD2 A;  4DR7 M;  5FTM A;  3HWS A;  1TH4 A;  3KS4 A;  2GQF A;  2LVA A;  4LF6 M;  3GQ3 A;  2ZTC A;  2LWX A;  1QQW A;  3QYE A;  1YSY A;  2Q2E B;  2XSZ D;  3I01 M;  3B7N A;  1N75 A;  3GLI A;  3SAS A;  2JZ1 A;  3HU3 A;  4Z8X A;  2KEB A;  4MGZ E;  7CAT A;  2F5N A;  1EE8 A;  2H1R A;  4XGI A;  3PXG A;  2QBY B;  2UXC M;  1XHB A;  2CWB A;  2L09 A;  4P17 A;  4F1I A;  3HHZ A;  4DUY M;  1NVM A;  1IXZ A;  1QUT A;  3H4J A;  2HL7 A;  2LBC A;  4II7 A;  5KO3 A;  2LH0 A;  4R3D A;  2ZAN A;  2RGH A;  1WR1 B;  1IXR C;  1JQJ C;  4G6Z A;  3AOG A;  4WP2 A;  2CFO A;  5EJC A;  2DI0 A;  2K0B X;  3FYC A;  5BPV A;  2OO9 A;  1H6U A;  4RF1 A;  3KW6 A;  4DBG B;  1WXQ A;  5L8R F;  3UMM A;  5ITT A;  4MB7 A;  5FTL A;  1Q02 A;  2LNH C;  4LJ5 A;  4X62 M;  1PJJ A;  4WUR A;  4FCT A;  2G8L A;  2R65 A;  3VLF B;  2UU9 M;  3SMP A;  3I4V A;  4KLN A;  4IBJ A;  2R45 A;  4QOS A;  1T6O A;  2L2D A;  5ITU A;  4QNM A;  1IXS B;  1HJP A;  2X4A A;  1E32 A;  2EKF A;  4MGK E;  1BVS A;  2A5Y B;  2MGW A;  4LJ8 A;  4B7F A;  4WW0 A;  2OOB A;  3U6D A;  1IBM M;  1QYR A;  1QAM A;  2Y0Q A;  4CHT B;  3SBJ A;  4F2L A;  3RGP A;  3J2P B;  4M9S A;  2XGN A;  3AKZ A;  1EIJ A;  2DVW B;  3FUU A;  5FTN A;  1DGH B;  3TWM A;  2DZL A;  1SXJ C;  3ZH9 B;  2K6B A;  4ANR A;  4IBI A;  1K82 A;  4PT5 A;  3VFD A;  2VF8 A;  3GRY A;  4AKG A;  4LGM A;  3KOZ E;  4AI6 A;  1QVR A;  4D81 A;  1PJQ A;  2BJV A;  1ZMV A;  2AHM A;  2BJW A;  2LVN C;  4PDG A;  3GP1 A;  3U6E A;  5KPR A;  2JXN A;  3LW5 F;  1Z5B A;  2C9O A;  3GLF A;  5F3W A;  2YFQ A;  3M7G A;  4NC6 A;  2HAK A;  2MH8 A;  1JR3 E;  2VQF M;  4DV0 M;  4LRS A;  3V76 A;  2XZF A;  2XZU A;  1J5E M;  3LCV B;  1K3X A;  1IN5 A;  1E94 E;  1OIZ A;  2I7P A;  3CGW A;  4GH9 A;  3VDU A;  4PDI A;  1OQY A;  1HT2 E;  4QHS A;  3RGS A;  1Z5A A;  1HNZ M;  1Z59 A;  4IBK A;  3K8Z A;  3SAW A;  3K9O A;  2CHV A;  2RGO A;  3B9P A;  2KDL A;  1Y8G A;  3SYK A;  4OVZ B;  3B7Q A;  3HJS A;  2C5R A;  2QBY A;  1SXJ E;  2WZJ A;  3RFW A;  4NOO B;  2FOI C;  3C58 A;  3LCU A;  4LRT A;  4G4N A;  4HEO A;  1R7R A;  1X37 A;  3FKE A;  4LJ7 A;  3HZJ A;  2LXE A;  1TR8 A;  1XNQ M;  3FRH A;  2ZBK B;  2V1C A;  3HY5 A;  3TQS A;  2D7G A;  1IY1 A;  1EFU B;  1Q3C A;  5EXX A;  2L4F A;  2VF7 A;  1ZQ9 A;  2LTU A;  5EXP A;  2M60 A;  5EXS A;  4D80 A;  3FTD A;  1GVN A;  3GPU A;  2UUB M;  4DR6 M;  3I04 M;  1R5L A;  5DNY A;  5EP1 A;  1W5S A;  3GPX A;  2L7H A;  1DO2 A;  4GC9 A;  2FE8 A;  1NNJ A;  1IBK M;  3KP0 E;  4FW9 A;  4JI2 M;  1QDR A;  1GKI A;  2BNK A;  3KSX A;  3K1J A;  2CE7 A;  4NL4 H;  4JI8 M;  1XNR M;  2KA6 B;  2W82 A;  3HJ8 A;  2LVQ D;  4LZJ A;  2Y0T A;  2G3Q A;  1IXS A;  2DAM A;  1SXJ B;  5EP2 A;  4BB9 A;  5ITR A;  2QHO B;  3AOE C;  2JZ0 A;  4FWG A;  3ZQJ A;  2MR9 A;  3JR4 A;  3J7B A;  2B3T A;  3HU1 A;  1JB0 F;  3EIE A;  1KSF X;  2QEN A;  4LFA M;  3FUT A;  1HT1 E;  1DO0 A;  1DGH A;  1WGN A;  1MN3 A;  4L4U A;  2JNH A;  3LQR A;  2HKJ A;  1TDH A;  1R4G A;  4M0D A;  3HHW A;  1HQY E;  4RNA A;  2DAI A;  3KDS E;  4HL4 A;  4XK8 F;  3UGJ A;  1IN4 A;  4Y28 F;  3SHF A;  4IBB A;  2APL A;  2JY7 A;  3BBZ A;  1GLN A;  1IN7 A;  3LMM A;  4IBF A;  1R2Z A;  2HHH M;  4A3V B;  2HWJ A;  2X8A A;  3GQ5 A;  4AQY M;  1XMQ M;  3PNY A;  2Z4S A;  3AFH A;  2KXE A;  4GHA A;  3NBI A;  4NSR A;  3AJI B;  2LVO C;  4LG2 A;  3U6M A;  1NY5 A;  3U61 B;  5FLX S;  4FD2 A;  1YE9 A;  4L78 A;  2LHG A;  1PM5 A;  1L2B A;  3FE3 A;  5KPZ A;  1IBL M;  2WSC F;  3U5Z B;  4IBC A;  5EP4 A;  3UZU A;  2KHH A;  3CTW B;  4I8O A;  4AZF A;  3A98 B;  4OVZ A;  3T15 A;  2CUZ A;  5EXT A;  3D8B A;  3U6O A;  2QZ4 A;  4L16 A;  4GKK M;  3IHP A;  3MHV C;  3AV0 A;  4QHT A;  3Q8G A;  3J80 S;  2OQ4 A;  2UUC M;  3KXE C;  1Z5C A;  3SFZ A;  2BWE A;  3FRI A;  2QQ8 A;  1G41 A;  1JR3 A;  4GIP A;  2LHC A;  1N36 M;  2C98 A;  3KS8 A;  4R7G A;  4B08 A;  2CHG A;  1PRB A;  1NV8 A; 
#chains in the Genus database with same CATH homology
 4W5W A;  4FVM A;  2XF3 A;  4X66 M;  1Z6T A;  3MJ5 A;  1R2Y A;  2R4E A;  2D7E A;  3IG5 A;  1NJF A;  2VII A;  2HCB A;  2Z7J A;  3K2L A;  4OU7 A;  1NNU C;  3J7A S;  3L2A A;  3D8L A;  4JI1 M;  1SXJ A;  2UXB M;  4IJF A;  2C99 A;  4PCZ A;  1IY2 A;  1QAO A;  3WHK A;  2G5G X;  4DR2 M;  4LF8 M;  4DR1 M;  1MX0 A;  1QZM A;  2Y20 A;  4MM3 B;  3SC3 A;  3ILK A;  4JI0 M;  3ZCB B;  3VKG A;  4NSO B;  4REZ A;  2EA0 A;  2DWM A;  5IT9 S;  4IJE A;  2CEA A;  1MU5 A;  1G3I A;  2J7N A;  2E5L M;  4NXM M;  2X49 A;  2EO2 A;  3GQ4 A;  4K0K M;  3TWK A;  4Z6Y A;  5BR8 M;  3PVS A;  5KPT A;  1VDD A;  2KW0 A;  1DGF A;  5C1B A;  5LMU M;  2Z4R A;  2XEP A;  3T1H M;  4G4O A;  3U61 A;  3NWL A;  4CGY B;  1HQC A;  5DYI A;  1W5T A;  4LF5 M;  4L8R C;  2F5O A;  3U5Z A;  3SAR A;  2RKO A;  5FTJ A;  1IN6 A;  3VKH A;  4B3T M;  5EQT A;  2M5Z A;  3GRV A;  2F5P A;  3KFU G;  2CV0 A;  1UM8 A;  3CF0 A;  3U6S A;  2DXI A;  4EIW A;  2DWZ B;  4LJ6 A;  4AG6 A;  3BOS A;  2XLJ A;  3L26 A;  3FUV A;  3HHY A;  5ITX A;  3GPY A;  2L6O A;  4LY6 A;  4ITQ A;  1G59 A;  4X65 M;  3JAM S;  1HNW M;  1NHW C;  2I7N A;  5FTK A;  4KOD A;  1ORY B;  5LMN M;  4IBE A;  3GRU A;  4AKH A;  2KZS A;  2UUA M;  3FTF A;  1YUB A;  3VK7 A;  3SAT A;  3SHG B;  4JI4 M;  3AOE A;  4DR3 M;  4MH0 E;  3L27 A;  1R6B X;  3T38 A;  2ZAO A;  4G4R A;  1XMO M;  2YR0 A;  4LF7 M;  3TWL A;  2YNM D;  3GRR A;  4KO8 A;  2V1U A;  3DA1 A;  3SMS A;  5GKN A;  3A46 A;  2ERC A;  2P5T A;  3DOA A;  4FCV A;  1I94 M;  3R9X B;  1NSF A;  3HGI A;  4BLC A;  2DWL A;  3L28 A;  3IG8 A;  4GKJ M;  2OPF A;  4NRW A;  4I81 A;  3J81 S;  4DV2 M;  4JYA M;  1XXH B;  2V6Z M;  3VDP A;  2F5S A;  4MGI E;  1T3T A;  3H4M A;  1G8P A;  2XFT A;  4I5S A;  5A2Q S;  4B3R M;  4YHH M;  4M0W A;  4LZZ A;  1FJG M;  3VK8 A;  4GRI A;  1J09 A;  4D82 A;  4S12 A;  4RF0 A;  3KSJ A;  3EIH A;  3PFI A;  4LGY A;  1KYI A;  1D2N A;  3GLG B;  2ZM6 M;  3TL4 X;  1NY6 A;  3HKP A;  4YY3 M;  2K47 A;  2R18 A;  4P16 A;  1N33 M;  1GL7 A;  1DGG A;  1S3S A;  4JN6 A;  3FYD A;  4DV6 M;  1C1K A;  2KZU A;  3DZD A;  3KOY E;  4BBA A;  2JA2 A;  5IRE B;  3U6C A;  4B3S M;  5JI3 E;  4I4L A;  4LF4 M;  4M9X A;  3GLH B;  2CV1 A;  1OFH A;  4HLQ A;  1KFV A;  1IM2 A;  2C96 A;  3R8F A;  1IY0 A;  1ZAE A;  1L2D A;  1NJG A;  2C9C A;  1Q39 A;  4G4Q A;  5KQD A;  4DR5 M;  1DGB A;  2FFJ A;  4B7H A;  2DZO B;  4FCW A;  3UJN A;  4B3M M;  4IBD A;  3FD9 A;  4LJA A;  1NHG C;  5JI2 E;  1L1T A;  2QPA A;  3U6L A;  1TDZ A;  3M6A A;  2ZAM A;  2O5R A;  3SAV A;  2XFS A;  4DV1 M;  4JI3 M;  4LJ4 A;  3OTO M;  1E9S A;  2NQ8 C;  3THG A;  1L1Z A;  1IQP A;  4DV3 M;  4JI6 M;  2R46 A;  2DZN B;  1Q3B A;  3UK6 A;  2F5Q A;  2XH9 A;  1K3W A;  3HU2 A;  5C18 A;  3U60 B;  3L25 A;  5IWA M;  3RE8 A;  4DV4 M;  4LFC M;  3QWL A;  3FTC A;  3KOW E;  3W0L B;  1XXH A;  1N34 M;  4LFB M;  3PNV A;  2UXD M;  1G4A E;  4X64 M;  2DWN A;  4JV5 M;  3KP1 E;  5IZ7 D;  3AL0 C;  2D7H A;  3CF6 E;  1L2C A;  4GHL A;  3I51 A;  3M0E A;  3GLG A;  4JI5 M;  2XSZ A;  1I4W A;  4IIW A;  5FSW A;  3E9S A;  4MGY E;  3L29 A;  2KRU A;  4FWD A;  4NRV A;  3MK6 A;  1HR0 M;  1HNX M;  5EP3 A;  4AKI A;  2DHR A;  5H37 D;  3SAU A;  4LJ9 A;  4JI7 M;  1TGU A;  5ITY A;  4GC5 A;  4DR4 M;  3GLH A;  2F4V M;  4XBO A;  3GLI B;  3Q8X A;  3SYL A;  4B7G A;  4ZPX A;  3DFZ A;  1E9R A;  3TE6 A;  4FWH A;  4IBG A;  2Z3X A;  3HHX A;  3TPZ A;  2KRK A;  3HJQ A;  1N77 A;  1IN8 A;  2J7O A;  2R4J A;  5E6J A;  1XWI A;  4AW4 A;  1OJL A;  1JR3 D;  2YQZ A;  5KQ8 A;  2R62 A;  3W0F A;  3LVW A;  1GL6 A;  4LF9 M;  4L15 A;  4TUW A;  3FUX A;  1N32 M;  1FNN A;  3K92 A;  1N78 A;  4NXN M;  4DUZ M;  1QAN A;  3U6Q A;  4DV5 M;  4OX9 M;  1OFI A;  2L7I A;  3KOX E;  4CIS A;  4JXJ A;  3LVV A;  3QAU A;  4OW0 A;  3GPP A;  1SXJ D;  5ITQ A;  3WHL A;  4KHP M;  1XC8 A;  2QCU A;  3JR5 A;  3U60 A;  8CAT A;  3U6P A;  1L8Q A;  3J27 B;  4MGH A;  4LCB A;  3GO8 A;  1PJI A;  4M9Z A;  1J7K A;  4GMQ A;  2CV2 A;  3CF2 A;  3ZC7 B;  2Y21 A;  4DV7 M;  2VQE M;  4GIT A;  2FNA A;  3KVW A;  1LV7 A;  3A45 A;  1TH3 A;  3I4Y A;  3LQQ A;  3E4R A;  1TH2 A;  5ITX E;  2EUC A;  2QP9 X;  3FTE A;  4QOZ C;  4QNR A;  3FUW A;  3GLF B;  2CHQ A;  5DYG A;  3T1Y M;  1QAQ A;  3A42 A;  5E26 A;  4AG5 A;  4PD2 A;  4DR7 M;  5FTM A;  3HWS A;  1TH4 A;  3KS4 A;  4LF6 M;  3GQ3 A;  2LWX A;  1QQW A;  1YSY A;  2Q2E B;  2XSZ D;  1N75 A;  3GLI A;  3SAS A;  3HU3 A;  4Z8X A;  2KEB A;  4MGZ E;  7CAT A;  2F5N A;  1EE8 A;  2H1R A;  4XGI A;  3PXG A;  2QBY B;  2UXC M;  1XHB A;  2L09 A;  4DUY M;  3HHZ A;  1NVM A;  1IXZ A;  2HL7 A;  4II7 A;  5KO3 A;  2LH0 A;  4R3D A;  2ZAN A;  2RGH A;  1IXR C;  1JQJ C;  4G6Z A;  3AOG A;  2CFO A;  5EJC A;  5BPV A;  3FYC A;  3UMM A;  1H6U A;  4RF1 A;  3KW6 A;  1WXQ A;  5ITT A;  4MB7 A;  5FTL A;  2LNH C;  4LJ5 A;  4X62 M;  1PJJ A;  4WUR A;  4FCT A;  2G8L A;  2R65 A;  3VLF B;  2UU9 M;  3SMP A;  3I4V A;  4KLN A;  4IBJ A;  2R45 A;  4QOS A;  5ITU A;  4QNM A;  1IXS B;  2X4A A;  1E32 A;  4MGK E;  2A5Y B;  4LJ8 A;  4B7F A;  4WW0 A;  3U6D A;  1IBM M;  1QYR A;  1QAM A;  2Y0Q A;  4CHT B;  3SBJ A;  3RGP A;  3J2P B;  4M9S A;  2XGN A;  3AKZ A;  2DVW B;  3FUU A;  5FTN A;  1DGH B;  3TWM A;  3ZH9 B;  1SXJ C;  4IBI A;  1K82 A;  4PT5 A;  3VFD A;  3GRY A;  4AKG A;  4LGM A;  3KOZ E;  4AI6 A;  1QVR A;  4D81 A;  2BJV A;  2AHM A;  2BJW A;  4PDG A;  3U6E A;  3GP1 A;  5KPR A;  1Z5B A;  2C9O A;  3GLF A;  5F3W A;  2YFQ A;  3M7G A;  2VQF M;  4DV0 M;  4LRS A;  2XZF A;  2XZU A;  1J5E M;  1K3X A;  1IN5 A;  1E94 E;  4GH9 A;  2I7P A;  3VDU A;  4PDI A;  4QHS A;  1HT2 E;  3RGS A;  1HNZ M;  1Z5A A;  1Z59 A;  4IBK A;  3K8Z A;  3SAW A;  2CHV A;  2RGO A;  3B9P A;  3SYK A;  4OVZ B;  3HJS A;  2C5R A;  2QBY A;  1SXJ E;  3RFW A;  4NOO B;  2FOI C;  3C58 A;  4LRT A;  4G4N A;  1R7R A;  1X37 A;  3FKE A;  4LJ7 A;  2LXE A;  1XNQ M;  2ZBK B;  2V1C A;  3TQS A;  2D7G A;  1IY1 A;  1Q3C A;  5EXX A;  1ZQ9 A;  5EXP A;  2M60 A;  5EXS A;  4D80 A;  3FTD A;  1GVN A;  3GPU A;  2UUB M;  4DR6 M;  5DNY A;  5EP1 A;  1W5S A;  3GPX A;  2L7H A;  1DO2 A;  4GC9 A;  2FE8 A;  1NNJ A;  1IBK M;  3KP0 E;  4FW9 A;  4JI2 M;  1GKI A;  2BNK A;  3KSX A;  3K1J A;  2CE7 A;  4NL4 H;  4JI8 M;  1XNR M;  2KA6 B;  2W82 A;  3HJ8 A;  4LZJ A;  2Y0T A;  4BB9 A;  5EP2 A;  1SXJ B;  5ITR A;  3AOE C;  4FWG A;  3JR4 A;  3J7B A;  3HU1 A;  3EIE A;  1KSF X;  2QEN A;  4LFA M;  3FUT A;  1HT1 E;  1DO0 A;  1DGH A;  4L4U A;  3LQR A;  2HKJ A;  1TDH A;  4M0D A;  4RNA A;  3HHW A;  1HQY E;  3KDS E;  4HL4 A;  3UGJ A;  1IN4 A;  3SHF A;  4IBB A;  1GLN A;  1IN7 A;  3LMM A;  4IBF A;  1R2Z A;  2HHH M;  4A3V B;  1XMQ M;  2X8A A;  3GQ5 A;  4AQY M;  3PNY A;  2Z4S A;  3AFH A;  2KXE A;  4GHA A;  3NBI A;  4NSR A;  3AJI B;  4LG2 A;  3U6M A;  1NY5 A;  3U61 B;  5FLX S;  4FD2 A;  1YE9 A;  4L78 A;  1PM5 A;  1L2B A;  1IBL M;  5KPZ A;  3U5Z B;  4IBC A;  5EP4 A;  3UZU A;  4I8O A;  3CTW B;  4AZF A;  3A98 B;  4OVZ A;  3T15 A;  2CUZ A;  5EXT A;  3D8B A;  3U6O A;  2QZ4 A;  4L16 A;  4GKK M;  3MHV C;  3AV0 A;  4QHT A;  3J80 S;  2OQ4 A;  2UUC M;  3KXE C;  1Z5C A;  3SFZ A;  1G41 A;  1JR3 A;  4GIP A;  1N36 M;  2C98 A;  3KS8 A;  4R7G A;  4B08 A;  2CHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...