4IIWA

2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
304
Chain Sequence
b'SKEKITVEIPAGSSISDISTILEDKKVINNASIFSFYVKYNNDTNLKAGNYELSPAMNTDQIVKKMQEGKTVAPAKLVIPEGYTLDQIADRIVAYQPKLKKADVLKTMDDPEFVASMIKAYPETVTNDVLNKSIKHPLEGYLYPATYTFKGTDVSAEQIITEMVKATDVNIAKYRDELTKQKMSVHKFLTMSSIIEKEATENVDRKMIASVFYNRLAKDMRLQTDPTVLYALGEHKSKTTYKDLEVDSPYNTYKNNGLPPGPISNSGDSSMEAALYPEKSDYLYFLANKVYFSKTLEEHNKLKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1499 protein
publication title 2.6 Angstrom Crystal Structure of Putative yceG-like Protein lmo1499 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 83
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02618 YceG YceG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1150 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4iiwA01
4IIWA
chains in the Genus database with same CATH superfamily
3T1HM 3ZQJA 1X37A 4R3DA 1NNJA 3M6AA 1ZAEA 3KOYE 1LV7A 3HKPA 4IBGA 4IJEA 2Z4RA 3B7ZA 2DKLA 4D80A 3A45A 3TWLA 1OQYA 4L8RC 5E6JA 1E32A 4P17A 4MGZE 1SXJE 3TE6A 2LHGA 3TQSA 2CEAA 3PVSA 4D81A 1NJGA 1UFZA 1P3QQ 2GQFA 3U6QA 3GLHE 4F2LA 4OW0A 3SAWA 3FUVA 2K6BA 1OIZA 1QDRA 2JUJA 4LJ6A 4PCZA 4DV6M 1N33M 2DAIA 3SMPA 1IN4A 3BOSA 1QAOA 1Q3CA 1R4GA 3EIHA 3MMPA 3SAVA 2LVQD 1S3SA 2R4EA 1GVNA 4LJ5A 4NXMM 4LJ4A 1ZMWA 4L78A 2MH8A 3JAMS 2G3QA 1J5EM 4GEWA 1IXZA 1IXSB 2HL7A 3VLFB 1T3TA 1KYIA 4DBGB 1HR0M 1Q39A 3F92A 4LF7M 2V1UA 1OTRA 1LTMA 2ZAMA 2DXIA 4FCVA 4G4RA 3ILKA 5ITXA 1L1ZA 2GNOA 3FTFA 2BJWA 2VDBB 1Z5CA 2EKKA 1PJTA 2QBYA 4LZZA 2EKFA 1SXJB 1IN7A 4XK8F 4M0WA 3FUXA 3FYCA 1G8PA 3THGA 1NNUC 4KT0F 3GLHB 3GRRA 3GLIA 3SHGB 3UJNA 3E21A 1QZMA 3FYDA 4LFCM 4WP2A 4QOSA 1DGBA 3B9PA 2F5NA 4M9XA 4KLNA 4JYAM 2KA6B 3U61B 4FWDA 2VIIA 3DOAA 1PJQA 4Z6YA 1H6UA 3KFUG 2MR9A 1NY5A 4ANRA 2OO9A 3HX3A 1A5TA 2MJ5B 2ZTDA 5FTKA 3SFZA 5EP1A 3GQ3A 1L1TA 2UXBM 3C9PA 5FTLA 2K9DA 5ITUA 1Q3BA 4GITA 3AFHA 1NSFA 1TDHA 4MGKE 2XLJA 2DWLA 1NO1A 2L7IA 4MH0E 5KQ8A 3FRHA 2FS1A 1IN5A 2CE7A 3I4VA 2OOAA 3FKEA 1XNQM 1IN6A 3GQ4A 4F1IA 4P16A 2J5YA 2C98A 3FUUA 3U6PA 4AKIA 1YSYA 3AV0A 3SATA 2YR0A 3GLFA 3KP0E 1VEJA 2CV0A 2DZNB 1V33A 1GO5A 2HAKA 3UZUA 3CTWB 3U6DA 1ORYB 1GLNA 3HU3A 1PJIA 2F4VM 2KDLA 3B89A 4DV5M 3DFZA 3KDSE 2NQ8C 1HJPA 3W0LB 1VEGA 3GLGA 4DR6M 3CF0A 1D0MA 2Q2EB 4GIPA 4QHSA 1ZQ9A 1GL6A 4FD2A 2YFQA 2QSFX 1XWIA 1EIJA 1WR1B 5L8RF 1QANA 2CFOA 5FTNA 3C3DA 4ITQA 5EQTA 1OKSA 4JI2M 4KO8A 3DZDA 3GPXA 2M5ZA 5C1BA 2XZUA 1GKIA 1YLAA 4DR1M 4LJ7A 1C1KA 1NV9A 3RGSA 4LFAM 1OAIA 3AKZA 2MGWA 1WHCA 5DFLA 2JZ1A 2CRUA 2LVAA 1R6BX 2JNHA 3ZC7B 4LJ9A 3VKHA 2YNMD 1NHGC 2DAMA 2LHCA 1F4IA 3QAUA 1Z6TA 3SARA 4AI6A 1TDZA 2LBCA 4II7A 1FNNA 2CHGA 2G5GX 1IY1A 4AG6A 1OJLA 3WHKA 2KZUA 3OTOM 5KPZA 1FJGM 1DO0A 3I51A 3NBXX 2JA2A 2VQEM 1IY0A 4L6V6 1WXQA 5FTJA 3UMMA 5KPRA 4DV7M 2XF3A 3SHFA 2D7HA 2UUAM 3D8BA 4GH9A 2KEBA 4DV2M 4R7GA 1SG9A 4MGYE 1Z5AA 4DUYM 2QHOB 4DR3M 1N75A 3J7AS 4UN2B 4X64M 4EIWA 1QUSA 4LJ8A 3TPZA 1MU5A 4CHTB 2Y20A 3PFIA 2Z7JA 2KRUA 2J7NA 1E94E 3HJ8A 1VG5A 4AQYM 3U6OA 3W0FA 1SXJC 5BR8M 3KOWE 4HL4A 3GQ5A 1OFIA 1IFYA 4OVZB 2DAEA 4WURA 2DWNA 2ERCA 2BWBA 2R0IA 2LH0A 5KPTA 4MB7A 3SYLA 1L2DA 2JY8A 1IBMM 3IG5A 2F5SA 5BPVA 3FUTA 2R4JA 5EJCA 2CV1A 2KRKA 1J7KA 2MROB 2X8AA 1DGHB 4CGYB 3HHYA 2L2DA 1IM2A 3LW5F 4NXNM 1GJSA 1TTEA 4GC9A 1IXRC 1XHBA 3R9XB 3BXWA 2I7NA 4AKGA 4JI8M 1V92A 5LMNM 1K3XA 2DHRA 3LCUA 3MJ5A 2WSEF 4GRIA 3AOEA 4LY6A 1IN8A 2JY6B 1XMOM 5EP3A 1PJSA 4IBFA 4QNRA 4NC6A 4PT5A 1W5SA 2LTUA 2H1RA 4Y28F 4D82A 5FLXS 5KO3A 4NRWA 1VDLA 3KP1E 3JR4A 3SBJA 1KFVA 1Z59A 3HHXA 3PNYA 2RKOA 4IBIA 4LGMA 2D7GA 2JY5A 4LF6M 3B74A 5ITYA 4LG2A 4FWHA 1D0LA 4G6ZA 5EXXA 5EXPA 1JR3A 3H4JA 3K9PA 1XXHA 3U60B 5EP4A 1IY2A 1OIPA 1J09A 1I4WA 4Z8XA 4W5WA 3W68A 3MHVC 3VKGA 3LVVA 3FRIA 1N34M 3IG8A 3TL4X 3J80S 1G59A 4I4LA 2ZAOA 4XBOA 1UM8A 3FTEA 3LVWA 2R6FA 5ITRA 1YE9A 1IQPA 2O25A 5E26A 1T43A 4Q7JA 4B08A 4B3MM 2F5QA 1QUTA 3HJSA 4IBBA 1T6OA 4CJ6A 4QNMA 4BB9A 1ZMVA 4NSOB 4OX9M 4G4OA 1W5TA 1N36M 3SMSA 3FUWA 4DV0M 1MN3A 4PDGA 2R65A 2YQZA 3FD9A 1IBLM 2XFTA 3J81S 3B7QA 1NVMA 1R7RA 3H4MA 4QHTA 4G3OA 3K9OA 3GLIE 2QPAA 1K82A 3KVWA 1Q02A 2ZM6M 2B3TA 3WHLA 4LCBA 1JR3D 3K1JA 1AIPC 1YUBA 2LXEA 2N35A 2Y0QA 2DNAA 2XZFA 2Y21A 1WGLA 1ZMUA 5IWAM 3U5ZA 2EJSA 2M60A 2QP9X 3W67A 2QCUA 2FNAA 1WJ7A 4LZJA 2OPFA 2EO2A 3KOXE 4DR5M 3AOGA 3B7NA 3JR5A 3LCVB 4B7HA 3GRVA 4MGHA 1TH2A 1G4AE 1NV8A 2UU9M 2O01F 2BNKA 2I7PA 2VF8A 3E46A 1HT1E 1D2NA 3GPUA 1NY6A 3MK6A 3GPPA 2ZBKB 1JB0F 2XSZD 4LGYA 2KNVA 1MJGM 4DV3M 2QBYB 1L2BA 4DR4M 2F5PA 3GLFE 2CHVA 4XGIA 3U6MA 2R46A 2C99A 2G8LA 2JWSA 2Y0TA 2Z4SA 3FTCA 4FW9A 4GHAA 3GLIB 1V34A 1NJFA 3LQQA 4GMQA 4DR2M 1QQWA 4WW0A 3SASA 3GLGE 1GABA 1QYRA 3C3EA 1EFUB 1RU3A 3GO8A 3CF2A 3FE3A 2X4AA 4GC5A 1WIVA 2R45A 3E9SA 4M9ZA 3HY5A 3CF6E 3CGWA 1XB2B 4JI3M 3HJQA 4YY3M 2UXCM 2WZJA 1N77A 4AG5A 3Q8GA 2ZANA 2LVPC 3KW6A 4I81A 4L4UA 2L7HA 1Z5BA 1DV0A 3KS8A 2WSFF 2W82A 5DNYA 4I8OA 3T15A 2DZOB 1IXSA 1K3WA 2FOIC 3RE8A 2HWJA 2P5TA 4B7GA 1G71A 3IECA 3T1YM 1GJTA 3K8ZA 2Z8YM 2L4FA 3VFDA 5EXTA 4LRSA 2HHHM 1E9SA 4LF9M 2JY7A 2DAKA 3GLFB 4M0DA 4M9SA 1R2ZA 5H37D 3LMMA 1HT2E 4HLQA 4FCTA 2R44A 1QDTA 1G41A 1SXJA 3GLGB 2OQ4A 3VDPA 1TR8A 4LF8M 1PJJA 2DI0A 3GLHA 3SAUA 3ZH9B 4X62M 4B3RM 2LVOC 4IBEA 4BBAA 4BLCA 3TWMA 1DGFA 1QAQA 2XGNA 1Y8GA 4JI5M 4PD2A 3FTDA 2E5LM 3EIEA 1I94M 2KNZA 4IBKA 2CWBA 3U61A 4R71A 3L27A 2BWEA 3GRYA 4KHPM 1R2YA 2UXDM 4LJAA 4LRTA 2R62A 2F5OA 2RRUA 3RFWA 4L15A 5GKNA 4JI1M 1MX0A 2DWZB 4GHLA 2RGHA 4JXJA 4IJFA 1VQ1A 2QNJA 4A3VB 1D0KA 2KW0A 2RGOA 3NBIA 2LVNC 2V1CA 4LF4M 1EE8A 4NRVA 4JI7M 2FFJA 2XEPA 4JV5M 4S12A 3T6PA 5FSWA 3A42A 7CATA 1VDDA 1HNWM 3M7GA 5ITTA 3L25A 3J2PB 1SXJD 2VF7A 2WSCF 4CIZA 4AKHA 3U6EA 4IBJA 5IZ7D 3U6SA 1QAMA 3HGIA 4JI0M 3V76A 4GKKM 1KSFX 4JI4M 1QVRA 3I4YA 4X66M 2CUZA 2C5RA 2DAGA 4YHHM 3AOEC 2L09A 3K2LA 1C7YA 1TH3A 2L4EA 1L8QA 3SC3A 4DV1M 1G3IA 4NOOB 2H5XA 4PDIA 1NHWC 1HNXM 2EUCA 5FTMA 2FH0A 1WGNA 5IREB 2EA0A 1QZEA 1OFHA 4G4QA 4K0KM 5IT9S 4JI6M 4I5SA 3SYKA 4NSRA 1XNRM 2J7OA 1E9RA 3BBZA 1ZV1A 3R8FA 1N78A 2QZ4A 4IIWA 4DR7M 2XSZA 2JP7A 5JI2E 3I04M 1JR3E 1BVSA 2V6ZM 4FVMA 3A46A 4FCWA 1PRBA 1XXHE 2DZLA 3QYBA 2BJVA 3QWLA 2A5YB 3M0EA 5C18A 3U6LA 3Q8XA 2CV2A 4QOZC 1XMQM 2K0BX 4OU7A 3VK7A 5DYGA 3D8LA 2UUCM 3HU1A 2O5RA 2C96A 1DGGA 2X49A 4RNAA 4RKUF 3VDUA 3K92A 3KSXA 3HU2A 1CUKA 2QENA 4LF5M 1JQJC 3KS4A 4KODA 4DUZM 3HWSA 4REZA 1R5LA 3GPYA 1IBKM 2HKJA 2LWXA 2KZSA 4AZFA 5ITQA 2VQFM 1HQYE 1OAOC 2OOBA 4X65M 4FWGA 1DO2A 3KXEC 4HEOA 2FE8A 2DVWB 2AHMA 2LNHC 3GRUA 4GKJM 1XXHB 3I01M 3NWLA 3QYEA 2ZTCA 4OVZA 2QQ8A 1HQCA 2KXEA 2UUBM 3AL0C 3E4RA 3LQRA 5F3WA 2D7EA 2XFSA 4LFBM 2C9OA 4B3TM 2KNAA 4B7FA 2KHHA 3C58A 3IHPA 2K47A 3PXGA 3RGPA 5A2QS 3PNVA 5EXSA 1DGHA 3A98B 2XH9A 2C9CA 3KSJA 1TF0B 5EP2A 3TWKA 2R18A 4MGIE 4L16A 5DYIA 1AUAA 3GP1A 2DWMA 4TUWA 1GL7A 3ZCBB 2CHQA 3L28A 2DENA 4DV4M 2DHYA 4RF0A 2CP8A 1PM5A 1PGYA 2APLA 8CATA 2L6OA 5KQDA 3L26A 4CISA 1TGUA 1HNZM 1VEKA 3HHWA 5JI3E 4AW4A 3L2AA 5ITXE 3VK8A 3U5ZB 1TH4A 3DA1A 4JN6A 2JXNA 2Z3XA 1L2CA 4IBDA 4MM3B 4B3SM 3T38A 4NL4H 3J7BA 3U60A 4ZPXA 5LMUM 1XC8A 4IBCA 3AJIB 4G4NA 1N32M 3UK6A 3L29A 3UGJA 3U6CA 3HZJA 4RF1A 2JZ0A 3HHZA 3J27B 3KOZE 2HCBA
chains in the Genus database with same CATH topology
3T1HM 1X37A 4R3DA 1NNJA 3M6AA 1ZAEA 3KOYE 1LV7A 3HKPA 4IBGA 4IJEA 2Z4RA 4D80A 3A45A 3TWLA 4L8RC 5E6JA 1E32A 4MGZE 1SXJE 3TE6A 3TQSA 2CEAA 3PVSA 4D81A 1NJGA 3U6QA 4OW0A 3SAWA 3FUVA 4DV6M 4LJ6A 4PCZA 1N33M 3SMPA 1IN4A 3BOSA 1QAOA 1Q3CA 3SAVA 3EIHA 2R4EA 1S3SA 4NXMM 1GVNA 4LJ5A 4LJ4A 4L78A 3JAMS 1J5EM 1IXZA 1IXSB 2HL7A 3VLFB 1T3TA 1KYIA 1HR0M 1Q39A 4LF7M 2V1UA 2ZAMA 2DXIA 4FCVA 4G4RA 3ILKA 1L1ZA 3FTFA 2BJWA 1Z5CA 2QBYA 4LZZA 1SXJB 1IN7A 4M0WA 3FUXA 3FYCA 1G8PA 3THGA 1NNUC 3GLHB 3GRRA 3GLIA 3SHGB 3UJNA 1QZMA 3FYDA 4LFCM 4QOSA 1DGBA 3B9PA 2F5NA 4M9XA 4KLNA 4JYAM 2KA6B 3U61B 4FWDA 2VIIA 3DOAA 4Z6YA 1H6UA 3KFUG 1NY5A 1L1TA 5FTKA 3GQ3A 3SFZA 5EP1A 2UXBM 5FTLA 5ITUA 1Q3BA 4GITA 3AFHA 1NSFA 1TDHA 4MGKE 2XLJA 2DWLA 2L7IA 4MH0E 5KQ8A 1IN5A 2CE7A 3I4VA 3FKEA 1XNQM 1IN6A 3GQ4A 4P16A 3FUUA 2C98A 3U6PA 4AKIA 1YSYA 3AV0A 3SATA 2YR0A 3GLFA 3KP0E 2CV0A 2DZNB 3UZUA 3CTWB 3U6DA 1ORYB 1GLNA 3HU3A 1PJIA 2F4VM 4DV5M 3DFZA 3KDSE 2NQ8C 3W0LB 3GLGA 4DR6M 3CF0A 2Q2EB 4GIPA 4QHSA 1ZQ9A 1GL6A 4FD2A 2YFQA 1XWIA 1QANA 2CFOA 5FTNA 4ITQA 5EQTA 4JI2M 4KO8A 3DZDA 3GPXA 2M5ZA 5C1BA 2XZUA 1GKIA 4DR1M 4LJ7A 1C1KA 3RGSA 4LFAM 3AKZA 1R6BX 3ZC7B 4LJ9A 3VKHA 2YNMD 1NHGC 3QAUA 1Z6TA 3SARA 4AI6A 1TDZA 4II7A 1FNNA 2CHGA 2G5GX 1IY1A 4AG6A 1OJLA 3WHKA 2KZUA 3OTOM 5KPZA 1FJGM 1DO0A 3I51A 2JA2A 2VQEM 1IY0A 1WXQA 5FTJA 3UMMA 5KPRA 4DV7M 2XF3A 3SHFA 2D7HA 2UUAM 3D8BA 4GH9A 2KEBA 4DV2M 4R7GA 4MGYE 1Z5AA 4DUYM 4DR3M 1N75A 3J7AS 4X64M 4EIWA 4LJ8A 3TPZA 1MU5A 4CHTB 2Y20A 3PFIA 2Z7JA 2KRUA 2J7NA 1E94E 3HJ8A 4AQYM 3U6OA 3W0FA 1SXJC 5BR8M 3KOWE 4HL4A 3GQ5A 1OFIA 4OVZB 4WURA 2DWNA 2ERCA 2LH0A 5KPTA 4MB7A 3SYLA 1L2DA 1IBMM 3IG5A 2F5SA 5BPVA 3FUTA 2R4JA 5EJCA 2CV1A 2KRKA 1J7KA 2X8AA 4CGYB 1DGHB 3HHYA 1IM2A 4NXNM 4GC9A 1IXRC 1XHBA 3R9XB 2I7NA 4AKGA 4JI8M 5LMNM 1K3XA 2DHRA 3MJ5A 4GRIA 3AOEA 4LY6A 1IN8A 1XMOM 5EP3A 4IBFA 4QNRA 4PT5A 1W5SA 4D82A 2H1RA 5FLXS 5KO3A 4NRWA 3KP1E 3JR4A 3SBJA 1KFVA 1Z59A 3HHXA 3PNYA 2RKOA 4IBIA 4LGMA 2D7GA 4LF6M 5ITYA 4LG2A 4FWHA 4G6ZA 5EXXA 5EXPA 1JR3A 1XXHA 3U60B 5EP4A 1IY2A 4Z8XA 1J09A 1I4WA 4W5WA 3VKGA 3MHVC 3LVVA 1N34M 3IG8A 3TL4X 3J80S 1G59A 4I4LA 2ZAOA 4XBOA 1UM8A 3FTEA 3LVWA 5ITRA 1YE9A 1IQPA 5E26A 4B08A 4B3MM 2F5QA 3HJSA 4IBBA 4QNMA 4BB9A 4OX9M 4NSOB 4G4OA 1W5TA 1N36M 3SMSA 3FUWA 4DV0M 4PDGA 1IBLM 2R65A 2YQZA 3FD9A 2XFTA 3J81S 1NVMA 1R7RA 3H4MA 4QHTA 2QPAA 1K82A 3KVWA 2ZM6M 3WHLA 4LCBA 1JR3D 3K1JA 1YUBA 2LXEA 2Y0QA 2XZFA 2Y21A 5IWAM 3U5ZA 2M60A 2QP9X 2QCUA 2FNAA 4LZJA 2OPFA 2EO2A 3KOXE 4DR5M 3AOGA 3JR5A 4B7HA 3GRVA 4MGHA 1TH2A 1G4AE 2UU9M 2BNKA 2I7PA 1HT1E 1D2NA 3GPUA 1NY6A 3MK6A 3GPPA 2ZBKB 4LGYA 2XSZD 4DV3M 2QBYB 1L2BA 4DR4M 2F5PA 2CHVA 4XGIA 3U6MA 2R46A 2C99A 2G8LA 2Y0TA 2Z4SA 3FTCA 4FW9A 4GHAA 3GLIB 1NJFA 3LQQA 4GMQA 4DR2M 1QQWA 4WW0A 3SASA 1QYRA 3GO8A 3CF2A 5EP2A 2X4AA 4GC5A 4M9ZA 2R45A 3E9SA 5ITXA 2UXCM 3CF6E 4YY3M 4JI3M 3HJQA 1N77A 4AG5A 2ZANA 3KW6A 4L4UA 4I81A 2L7HA 1Z5BA 3KS8A 2W82A 5DNYA 4I8OA 3T15A 2DZOB 1K3WA 2FOIC 3RE8A 2P5TA 4B7GA 3T1YM 3K8ZA 3VFDA 5EXTA 4LRSA 2HHHM 1E9SA 4LF9M 3GLFB 4M0DA 4M9SA 1R2ZA 5H37D 3LMMA 1HT2E 4HLQA 4FCTA 1G41A 1SXJA 3GLGB 2OQ4A 3VDPA 4LF8M 1PJJA 3GLHA 3SAUA 3ZH9B 4X62M 4B3RM 4IBEA 4BBAA 4BLCA 3TWMA 1DGFA 1QAQA 2XGNA 4JI5M 4PD2A 3FTDA 2E5LM 3EIEA 1I94M 4IBKA 4KHPM 3U61A 3L27A 3GRYA 2UXDM 1R2YA 4LJAA 4LRTA 2R62A 2F5OA 3RFWA 4L15A 5GKNA 4JI1M 1MX0A 2DWZB 4GHLA 2RGHA 4JXJA 4IJFA 4A3VB 2KW0A 2RGOA 3NBIA 2V1CA 4LF4M 1EE8A 4NRVA 4JI7M 2FFJA 2XEPA 4JV5M 4S12A 5FSWA 3A42A 7CATA 1VDDA 1HNWM 3M7GA 5ITTA 3L25A 3J2PB 1SXJD 4AKHA 3U6EA 4IBJA 5IZ7D 3U6SA 1QAMA 3HGIA 4JI0M 4GKKM 1KSFX 4JI4M 1QVRA 3I4YA 4X66M 2CUZA 2C5RA 4YHHM 3AOEC 2L09A 3K2LA 1TH3A 3SC3A 1L8QA 4DV1M 1G3IA 4NOOB 4PDIA 1NHWC 1HNXM 2EUCA 5FTMA 4G4QA 5IREB 2EA0A 1OFHA 4K0KM 5IT9S 4JI6M 4I5SA 3SYKA 4NSRA 1XNRM 2J7OA 1E9RA 3R8FA 1N78A 2QZ4A 4IIWA 4DR7M 2XSZA 5JI2E 2V6ZM 4FVMA 3A46A 4FCWA 2BJVA 3QWLA 2A5YB 3M0EA 5C18A 3U6LA 3Q8XA 2CV2A 4QOZC 1XMQM 4OU7A 3VK7A 5DYGA 3D8LA 2UUCM 3HU1A 2O5RA 2C96A 1DGGA 2X49A 4RNAA 3VDUA 3K92A 3KSXA 3HU2A 2QENA 4LF5M 1JQJC 3KS4A 4KODA 4DUZM 3HWSA 4REZA 3GPYA 1IBKM 2HKJA 2LWXA 2KZSA 4AZFA 5ITQA 2VQFM 1HQYE 4X65M 4FWGA 1DO2A 3KXEC 2FE8A 2DVWB 2AHMA 2LNHC 3GRUA 4GKJM 1XXHB 3NWLA 4OVZA 1HQCA 2KXEA 2UUBM 3AL0C 3E4RA 3LQRA 5F3WA 2D7EA 2XFSA 4LFBM 2C9OA 4B3TM 4B7FA 3C58A 2K47A 3PXGA 3RGPA 5A2QS 3PNVA 5EXSA 1DGHA 3A98B 2XH9A 2C9CA 3KSJA 3TWKA 2R18A 4MGIE 4L16A 5DYIA 3GP1A 2DWMA 4TUWA 1GL7A 3ZCBB 2CHQA 3L28A 4DV4M 4RF0A 1PM5A 5KQDA 8CATA 2L6OA 3L26A 4CISA 1TGUA 1HNZM 3HHWA 5JI3E 4AW4A 3L2AA 5ITXE 3VK8A 3U5ZB 1TH4A 3DA1A 4JN6A 2Z3XA 1L2CA 4IBDA 4MM3B 4B3SM 3T38A 4NL4H 3J7BA 3U60A 4ZPXA 5LMUM 1XC8A 4IBCA 3AJIB 4G4NA 1N32M 3UK6A 3L29A 3UGJA 3U6CA 4RF1A 3HHZA 3J27B 3KOZE 2HCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIW A; 
#chains in the Genus database with same CATH topology
 3T1H M;  3ZQJ A;  1X37 A;  4R3D A;  1NNJ A;  3M6A A;  1ZAE A;  3KOY E;  1LV7 A;  3HKP A;  4IBG A;  4IJE A;  2Z4R A;  3B7Z A;  2DKL A;  4D80 A;  3A45 A;  3TWL A;  1OQY A;  4L8R C;  5E6J A;  1E32 A;  4P17 A;  4MGZ E;  1SXJ E;  3TE6 A;  2LHG A;  3TQS A;  2CEA A;  3PVS A;  4D81 A;  1NJG A;  1UFZ A;  1P3Q Q;  2GQF A;  3U6Q A;  3GLH E;  4F2L A;  4OW0 A;  3SAW A;  3FUV A;  2K6B A;  1OIZ A;  1QDR A;  2JUJ A;  4LJ6 A;  4PCZ A;  4DV6 M;  1N33 M;  2DAI A;  3SMP A;  1IN4 A;  3BOS A;  1QAO A;  1Q3C A;  1R4G A;  3EIH A;  3MMP A;  3SAV A;  2LVQ D;  1S3S A;  2R4E A;  1GVN A;  4LJ5 A;  4NXM M;  4LJ4 A;  1ZMW A;  4L78 A;  2MH8 A;  3JAM S;  2G3Q A;  1J5E M;  4GEW A;  1IXZ A;  1IXS B;  2HL7 A;  3VLF B;  1T3T A;  1KYI A;  4DBG B;  1HR0 M;  1Q39 A;  3F92 A;  4LF7 M;  2V1U A;  1OTR A;  1LTM A;  2ZAM A;  2DXI A;  4FCV A;  4G4R A;  3ILK A;  5ITX A;  1L1Z A;  2GNO A;  3FTF A;  2BJW A;  2VDB B;  1Z5C A;  2EKK A;  1PJT A;  2QBY A;  4LZZ A;  2EKF A;  1SXJ B;  1IN7 A;  4XK8 F;  4M0W A;  3FUX A;  3FYC A;  1G8P A;  3THG A;  1NNU C;  4KT0 F;  3GLH B;  3GRR A;  3GLI A;  3SHG B;  3UJN A;  3E21 A;  1QZM A;  3FYD A;  4LFC M;  4WP2 A;  4QOS A;  1DGB A;  3B9P A;  2F5N A;  4M9X A;  4KLN A;  4JYA M;  2KA6 B;  3U61 B;  4FWD A;  2VII A;  3DOA A;  1PJQ A;  4Z6Y A;  1H6U A;  3KFU G;  2MR9 A;  1NY5 A;  4ANR A;  2OO9 A;  3HX3 A;  1A5T A;  2MJ5 B;  2ZTD A;  5FTK A;  3SFZ A;  5EP1 A;  3GQ3 A;  1L1T A;  2UXB M;  3C9P A;  5FTL A;  2K9D A;  5ITU A;  1Q3B A;  4GIT A;  3AFH A;  1NSF A;  1TDH A;  4MGK E;  2XLJ A;  2DWL A;  1NO1 A;  2L7I A;  4MH0 E;  5KQ8 A;  3FRH A;  2FS1 A;  1IN5 A;  2CE7 A;  3I4V A;  2OOA A;  3FKE A;  1XNQ M;  1IN6 A;  3GQ4 A;  4F1I A;  4P16 A;  2J5Y A;  2C98 A;  3FUU A;  3U6P A;  4AKI A;  1YSY A;  3AV0 A;  3SAT A;  2YR0 A;  3GLF A;  3KP0 E;  1VEJ A;  2CV0 A;  2DZN B;  1V33 A;  1GO5 A;  2HAK A;  3UZU A;  3CTW B;  3U6D A;  1ORY B;  1GLN A;  3HU3 A;  1PJI A;  2F4V M;  2KDL A;  3B89 A;  4DV5 M;  3DFZ A;  3KDS E;  2NQ8 C;  1HJP A;  3W0L B;  1VEG A;  3GLG A;  4DR6 M;  3CF0 A;  1D0M A;  2Q2E B;  4GIP A;  4QHS A;  1ZQ9 A;  1GL6 A;  4FD2 A;  2YFQ A;  2QSF X;  1XWI A;  1EIJ A;  1WR1 B;  5L8R F;  1QAN A;  2CFO A;  5FTN A;  3C3D A;  4ITQ A;  5EQT A;  1OKS A;  4JI2 M;  4KO8 A;  3DZD A;  3GPX A;  2M5Z A;  5C1B A;  2XZU A;  1GKI A;  1YLA A;  4DR1 M;  4LJ7 A;  1C1K A;  1NV9 A;  3RGS A;  4LFA M;  1OAI A;  3AKZ A;  2MGW A;  1WHC A;  5DFL A;  2JZ1 A;  2CRU A;  2LVA A;  1R6B X;  2JNH A;  3ZC7 B;  4LJ9 A;  3VKH A;  2YNM D;  1NHG C;  2DAM A;  2LHC A;  1F4I A;  3QAU A;  1Z6T A;  3SAR A;  4AI6 A;  1TDZ A;  2LBC A;  4II7 A;  1FNN A;  2CHG A;  2G5G X;  1IY1 A;  4AG6 A;  1OJL A;  3WHK A;  2KZU A;  3OTO M;  5KPZ A;  1FJG M;  1DO0 A;  3I51 A;  3NBX X;  2JA2 A;  2VQE M;  1IY0 A;  4L6V 6;  1WXQ A;  5FTJ A;  3UMM A;  5KPR A;  4DV7 M;  2XF3 A;  3SHF A;  2D7H A;  2UUA M;  3D8B A;  4GH9 A;  2KEB A;  4DV2 M;  4R7G A;  1SG9 A;  4MGY E;  1Z5A A;  4DUY M;  2QHO B;  4DR3 M;  1N75 A;  3J7A S;  4UN2 B;  4X64 M;  4EIW A;  1QUS A;  4LJ8 A;  3TPZ A;  1MU5 A;  4CHT B;  2Y20 A;  3PFI A;  2Z7J A;  2KRU A;  2J7N A;  1E94 E;  3HJ8 A;  1VG5 A;  4AQY M;  3U6O A;  3W0F A;  1SXJ C;  5BR8 M;  3KOW E;  4HL4 A;  3GQ5 A;  1OFI A;  1IFY A;  4OVZ B;  2DAE A;  4WUR A;  2DWN A;  2ERC A;  2BWB A;  2R0I A;  2LH0 A;  5KPT A;  4MB7 A;  3SYL A;  1L2D A;  2JY8 A;  1IBM M;  3IG5 A;  2F5S A;  5BPV A;  3FUT A;  2R4J A;  5EJC A;  2CV1 A;  2KRK A;  1J7K A;  2MRO B;  2X8A A;  1DGH B;  4CGY B;  3HHY A;  2L2D A;  1IM2 A;  3LW5 F;  4NXN M;  1GJS A;  1TTE A;  4GC9 A;  1IXR C;  1XHB A;  3R9X B;  3BXW A;  2I7N A;  4AKG A;  4JI8 M;  1V92 A;  5LMN M;  1K3X A;  2DHR A;  3LCU A;  3MJ5 A;  2WSE F;  4GRI A;  3AOE A;  4LY6 A;  1IN8 A;  2JY6 B;  1XMO M;  5EP3 A;  1PJS A;  4IBF A;  4QNR A;  4NC6 A;  4PT5 A;  1W5S A;  2LTU A;  2H1R A;  4Y28 F;  4D82 A;  5FLX S;  5KO3 A;  4NRW A;  1VDL A;  3KP1 E;  3JR4 A;  3SBJ A;  1KFV A;  1Z59 A;  3HHX A;  3PNY A;  2RKO A;  4IBI A;  4LGM A;  2D7G A;  2JY5 A;  4LF6 M;  3B74 A;  5ITY A;  4LG2 A;  4FWH A;  1D0L A;  4G6Z A;  5EXX A;  5EXP A;  1JR3 A;  3H4J A;  3K9P A;  1XXH A;  3U60 B;  5EP4 A;  1IY2 A;  1OIP A;  1J09 A;  1I4W A;  4Z8X A;  4W5W A;  3W68 A;  3MHV C;  3VKG A;  3LVV A;  3FRI A;  1N34 M;  3IG8 A;  3TL4 X;  3J80 S;  1G59 A;  4I4L A;  2ZAO A;  4XBO A;  1UM8 A;  3FTE A;  3LVW A;  2R6F A;  5ITR A;  1YE9 A;  1IQP A;  2O25 A;  5E26 A;  1T43 A;  4Q7J A;  4B08 A;  4B3M M;  2F5Q A;  1QUT A;  3HJS A;  4IBB A;  1T6O A;  4CJ6 A;  4QNM A;  4BB9 A;  1ZMV A;  4NSO B;  4OX9 M;  4G4O A;  1W5T A;  1N36 M;  3SMS A;  3FUW A;  4DV0 M;  1MN3 A;  4PDG A;  2R65 A;  2YQZ A;  3FD9 A;  1IBL M;  2XFT A;  3J81 S;  3B7Q A;  1NVM A;  1R7R A;  3H4M A;  4QHT A;  4G3O A;  3K9O A;  3GLI E;  2QPA A;  1K82 A;  3KVW A;  1Q02 A;  2ZM6 M;  2B3T A;  3WHL A;  4LCB A;  1JR3 D;  3K1J A;  1AIP C;  1YUB A;  2LXE A;  2N35 A;  2Y0Q A;  2DNA A;  2XZF A;  2Y21 A;  1WGL A;  1ZMU A;  5IWA M;  3U5Z A;  2EJS A;  2M60 A;  2QP9 X;  3W67 A;  2QCU A;  2FNA A;  1WJ7 A;  4LZJ A;  2OPF A;  2EO2 A;  3KOX E;  4DR5 M;  3AOG A;  3B7N A;  3JR5 A;  3LCV B;  4B7H A;  3GRV A;  4MGH A;  1TH2 A;  1G4A E;  1NV8 A;  2UU9 M;  2O01 F;  2BNK A;  2I7P A;  2VF8 A;  3E46 A;  1HT1 E;  1D2N A;  3GPU A;  1NY6 A;  3MK6 A;  3GPP A;  2ZBK B;  1JB0 F;  2XSZ D;  4LGY A;  2KNV A;  1MJG M;  4DV3 M;  2QBY B;  1L2B A;  4DR4 M;  2F5P A;  3GLF E;  2CHV A;  4XGI A;  3U6M A;  2R46 A;  2C99 A;  2G8L A;  2JWS A;  2Y0T A;  2Z4S A;  3FTC A;  4FW9 A;  4GHA A;  3GLI B;  1V34 A;  1NJF A;  3LQQ A;  4GMQ A;  4DR2 M;  1QQW A;  4WW0 A;  3SAS A;  3GLG E;  1GAB A;  1QYR A;  3C3E A;  1EFU B;  1RU3 A;  3GO8 A;  3CF2 A;  3FE3 A;  2X4A A;  4GC5 A;  1WIV A;  2R45 A;  3E9S A;  4M9Z A;  3HY5 A;  3CF6 E;  3CGW A;  1XB2 B;  4JI3 M;  3HJQ A;  4YY3 M;  2UXC M;  2WZJ A;  1N77 A;  4AG5 A;  3Q8G A;  2ZAN A;  2LVP C;  3KW6 A;  4I81 A;  4L4U A;  2L7H A;  1Z5B A;  1DV0 A;  3KS8 A;  2WSF F;  2W82 A;  5DNY A;  4I8O A;  3T15 A;  2DZO B;  1IXS A;  1K3W A;  2FOI C;  3RE8 A;  2HWJ A;  2P5T A;  4B7G A;  1G71 A;  3IEC A;  3T1Y M;  1GJT A;  3K8Z A;  2Z8Y M;  2L4F A;  3VFD A;  5EXT A;  4LRS A;  2HHH M;  1E9S A;  4LF9 M;  2JY7 A;  2DAK A;  3GLF B;  4M0D A;  4M9S A;  1R2Z A;  5H37 D;  3LMM A;  1HT2 E;  4HLQ A;  4FCT A;  2R44 A;  1QDT A;  1G41 A;  1SXJ A;  3GLG B;  2OQ4 A;  3VDP A;  1TR8 A;  4LF8 M;  1PJJ A;  2DI0 A;  3GLH A;  3SAU A;  3ZH9 B;  4X62 M;  4B3R M;  2LVO C;  4IBE A;  4BBA A;  4BLC A;  3TWM A;  1DGF A;  1QAQ A;  2XGN A;  1Y8G A;  4JI5 M;  4PD2 A;  3FTD A;  2E5L M;  3EIE A;  1I94 M;  2KNZ A;  4IBK A;  2CWB A;  3U61 A;  4R71 A;  3L27 A;  2BWE A;  3GRY A;  4KHP M;  1R2Y A;  2UXD M;  4LJA A;  4LRT A;  2R62 A;  2F5O A;  2RRU A;  3RFW A;  4L15 A;  5GKN A;  4JI1 M;  1MX0 A;  2DWZ B;  4GHL A;  2RGH A;  4JXJ A;  4IJF A;  1VQ1 A;  2QNJ A;  4A3V B;  1D0K A;  2KW0 A;  2RGO A;  3NBI A;  2LVN C;  2V1C A;  4LF4 M;  1EE8 A;  4NRV A;  4JI7 M;  2FFJ A;  2XEP A;  4JV5 M;  4S12 A;  3T6P A;  5FSW A;  3A42 A;  7CAT A;  1VDD A;  1HNW M;  3M7G A;  5ITT A;  3L25 A;  3J2P B;  1SXJ D;  2VF7 A;  2WSC F;  4CIZ A;  4AKH A;  3U6E A;  4IBJ A;  5IZ7 D;  3U6S A;  1QAM A;  3HGI A;  4JI0 M;  3V76 A;  4GKK M;  1KSF X;  4JI4 M;  1QVR A;  3I4Y A;  4X66 M;  2CUZ A;  2C5R A;  2DAG A;  4YHH M;  3AOE C;  2L09 A;  3K2L A;  1C7Y A;  1TH3 A;  2L4E A;  1L8Q A;  3SC3 A;  4DV1 M;  1G3I A;  4NOO B;  2H5X A;  4PDI A;  1NHW C;  1HNX M;  2EUC A;  5FTM A;  2FH0 A;  1WGN A;  5IRE B;  2EA0 A;  1QZE A;  1OFH A;  4G4Q A;  4K0K M;  5IT9 S;  4JI6 M;  4I5S A;  3SYK A;  4NSR A;  1XNR M;  2J7O A;  1E9R A;  3BBZ A;  1ZV1 A;  3R8F A;  1N78 A;  2QZ4 A;  4IIW A;  4DR7 M;  2XSZ A;  2JP7 A;  5JI2 E;  3I04 M;  1JR3 E;  1BVS A;  2V6Z M;  4FVM A;  3A46 A;  4FCW A;  1PRB A;  1XXH E;  2DZL A;  3QYB A;  2BJV A;  3QWL A;  2A5Y B;  3M0E A;  5C18 A;  3U6L A;  3Q8X A;  2CV2 A;  4QOZ C;  1XMQ M;  2K0B X;  4OU7 A;  3VK7 A;  5DYG A;  3D8L A;  2UUC M;  3HU1 A;  2O5R A;  2C96 A;  1DGG A;  2X49 A;  4RNA A;  4RKU F;  3VDU A;  3K92 A;  3KSX A;  3HU2 A;  1CUK A;  2QEN A;  4LF5 M;  1JQJ C;  3KS4 A;  4KOD A;  4DUZ M;  3HWS A;  4REZ A;  1R5L A;  3GPY A;  1IBK M;  2HKJ A;  2LWX A;  2KZS A;  4AZF A;  5ITQ A;  2VQF M;  1HQY E;  1OAO C;  2OOB A;  4X65 M;  4FWG A;  1DO2 A;  3KXE C;  4HEO A;  2FE8 A;  2DVW B;  2AHM A;  2LNH C;  3GRU A;  4GKJ M;  1XXH B;  3I01 M;  3NWL A;  3QYE A;  2ZTC A;  4OVZ A;  2QQ8 A;  1HQC A;  2KXE A;  2UUB M;  3AL0 C;  3E4R A;  3LQR A;  5F3W A;  2D7E A;  2XFS A;  4LFB M;  2C9O A;  4B3T M;  2KNA A;  4B7F A;  2KHH A;  3C58 A;  3IHP A;  2K47 A;  3PXG A;  3RGP A;  5A2Q S;  3PNV A;  5EXS A;  1DGH A;  3A98 B;  2XH9 A;  2C9C A;  3KSJ A;  1TF0 B;  5EP2 A;  3TWK A;  2R18 A;  4MGI E;  4L16 A;  5DYI A;  1AUA A;  3GP1 A;  2DWM A;  4TUW A;  1GL7 A;  3ZCB B;  2CHQ A;  3L28 A;  2DEN A;  4DV4 M;  2DHY A;  4RF0 A;  2CP8 A;  1PM5 A;  1PGY A;  2APL A;  8CAT A;  2L6O A;  5KQD A;  3L26 A;  4CIS A;  1TGU A;  1HNZ M;  1VEK A;  3HHW A;  5JI3 E;  4AW4 A;  3L2A A;  5ITX E;  3VK8 A;  3U5Z B;  1TH4 A;  3DA1 A;  4JN6 A;  2JXN A;  2Z3X A;  1L2C A;  4IBD A;  4MM3 B;  4B3S M;  3T38 A;  4NL4 H;  3J7B A;  3U60 A;  4ZPX A;  5LMU M;  1XC8 A;  4IBC A;  3AJI B;  4G4N A;  1N32 M;  3UK6 A;  3L29 A;  3UGJ A;  3U6C A;  3HZJ A;  4RF1 A;  2JZ0 A;  3HHZ A;  3J27 B;  3KOZ E;  2HCB A; 
#chains in the Genus database with same CATH homology
 3T1H M;  1X37 A;  4R3D A;  1NNJ A;  3M6A A;  1ZAE A;  3KOY E;  1LV7 A;  3HKP A;  4IBG A;  4IJE A;  2Z4R A;  4D80 A;  3A45 A;  3TWL A;  4L8R C;  5E6J A;  1E32 A;  4MGZ E;  1SXJ E;  3TE6 A;  3TQS A;  2CEA A;  3PVS A;  4D81 A;  1NJG A;  3U6Q A;  4OW0 A;  3SAW A;  3FUV A;  4DV6 M;  4LJ6 A;  4PCZ A;  1N33 M;  3SMP A;  1IN4 A;  3BOS A;  1QAO A;  1Q3C A;  3SAV A;  3EIH A;  2R4E A;  1S3S A;  4NXM M;  1GVN A;  4LJ5 A;  4LJ4 A;  4L78 A;  3JAM S;  1J5E M;  1IXZ A;  1IXS B;  2HL7 A;  3VLF B;  1T3T A;  1KYI A;  1HR0 M;  1Q39 A;  4LF7 M;  2V1U A;  2ZAM A;  2DXI A;  4FCV A;  4G4R A;  3ILK A;  1L1Z A;  3FTF A;  2BJW A;  1Z5C A;  2QBY A;  4LZZ A;  1SXJ B;  1IN7 A;  4M0W A;  3FUX A;  3FYC A;  1G8P A;  3THG A;  1NNU C;  3GLH B;  3GRR A;  3GLI A;  3SHG B;  3UJN A;  1QZM A;  3FYD A;  4LFC M;  4QOS A;  1DGB A;  3B9P A;  2F5N A;  4M9X A;  4KLN A;  4JYA M;  2KA6 B;  3U61 B;  4FWD A;  2VII A;  3DOA A;  4Z6Y A;  1H6U A;  3KFU G;  1NY5 A;  1L1T A;  5FTK A;  3GQ3 A;  3SFZ A;  5EP1 A;  2UXB M;  5FTL A;  5ITU A;  1Q3B A;  4GIT A;  3AFH A;  1NSF A;  1TDH A;  4MGK E;  2XLJ A;  2DWL A;  2L7I A;  4MH0 E;  5KQ8 A;  1IN5 A;  2CE7 A;  3I4V A;  3FKE A;  1XNQ M;  1IN6 A;  3GQ4 A;  4P16 A;  3FUU A;  2C98 A;  3U6P A;  4AKI A;  1YSY A;  3AV0 A;  3SAT A;  2YR0 A;  3GLF A;  3KP0 E;  2CV0 A;  2DZN B;  3UZU A;  3CTW B;  3U6D A;  1ORY B;  1GLN A;  3HU3 A;  1PJI A;  2F4V M;  4DV5 M;  3DFZ A;  3KDS E;  2NQ8 C;  3W0L B;  3GLG A;  4DR6 M;  3CF0 A;  2Q2E B;  4GIP A;  4QHS A;  1ZQ9 A;  1GL6 A;  4FD2 A;  2YFQ A;  1XWI A;  1QAN A;  2CFO A;  5FTN A;  4ITQ A;  5EQT A;  4JI2 M;  4KO8 A;  3DZD A;  3GPX A;  2M5Z A;  5C1B A;  2XZU A;  1GKI A;  4DR1 M;  4LJ7 A;  1C1K A;  3RGS A;  4LFA M;  3AKZ A;  1R6B X;  3ZC7 B;  4LJ9 A;  3VKH A;  2YNM D;  1NHG C;  3QAU A;  1Z6T A;  3SAR A;  4AI6 A;  1TDZ A;  4II7 A;  1FNN A;  2CHG A;  2G5G X;  1IY1 A;  4AG6 A;  1OJL A;  3WHK A;  2KZU A;  3OTO M;  5KPZ A;  1FJG M;  1DO0 A;  3I51 A;  2JA2 A;  2VQE M;  1IY0 A;  1WXQ A;  5FTJ A;  3UMM A;  5KPR A;  4DV7 M;  2XF3 A;  3SHF A;  2D7H A;  2UUA M;  3D8B A;  4GH9 A;  2KEB A;  4DV2 M;  4R7G A;  4MGY E;  1Z5A A;  4DUY M;  4DR3 M;  1N75 A;  3J7A S;  4X64 M;  4EIW A;  4LJ8 A;  3TPZ A;  1MU5 A;  4CHT B;  2Y20 A;  3PFI A;  2Z7J A;  2KRU A;  2J7N A;  1E94 E;  3HJ8 A;  4AQY M;  3U6O A;  3W0F A;  1SXJ C;  5BR8 M;  3KOW E;  4HL4 A;  3GQ5 A;  1OFI A;  4OVZ B;  4WUR A;  2DWN A;  2ERC A;  2LH0 A;  5KPT A;  4MB7 A;  3SYL A;  1L2D A;  1IBM M;  3IG5 A;  2F5S A;  5BPV A;  3FUT A;  2R4J A;  5EJC A;  2CV1 A;  2KRK A;  1J7K A;  2X8A A;  4CGY B;  1DGH B;  3HHY A;  1IM2 A;  4NXN M;  4GC9 A;  1IXR C;  1XHB A;  3R9X B;  2I7N A;  4AKG A;  4JI8 M;  5LMN M;  1K3X A;  2DHR A;  3MJ5 A;  4GRI A;  3AOE A;  4LY6 A;  1IN8 A;  1XMO M;  5EP3 A;  4IBF A;  4QNR A;  4PT5 A;  1W5S A;  4D82 A;  2H1R A;  5FLX S;  5KO3 A;  4NRW A;  3KP1 E;  3JR4 A;  3SBJ A;  1KFV A;  1Z59 A;  3HHX A;  3PNY A;  2RKO A;  4IBI A;  4LGM A;  2D7G A;  4LF6 M;  5ITY A;  4LG2 A;  4FWH A;  4G6Z A;  5EXX A;  5EXP A;  1JR3 A;  1XXH A;  3U60 B;  5EP4 A;  1IY2 A;  4Z8X A;  1J09 A;  1I4W A;  4W5W A;  3VKG A;  3MHV C;  3LVV A;  1N34 M;  3IG8 A;  3TL4 X;  3J80 S;  1G59 A;  4I4L A;  2ZAO A;  4XBO A;  1UM8 A;  3FTE A;  3LVW A;  5ITR A;  1YE9 A;  1IQP A;  5E26 A;  4B08 A;  4B3M M;  2F5Q A;  3HJS A;  4IBB A;  4QNM A;  4BB9 A;  4OX9 M;  4NSO B;  4G4O A;  1W5T A;  1N36 M;  3SMS A;  3FUW A;  4DV0 M;  4PDG A;  1IBL M;  2R65 A;  2YQZ A;  3FD9 A;  2XFT A;  3J81 S;  1NVM A;  1R7R A;  3H4M A;  4QHT A;  2QPA A;  1K82 A;  3KVW A;  2ZM6 M;  3WHL A;  4LCB A;  1JR3 D;  3K1J A;  1YUB A;  2LXE A;  2Y0Q A;  2XZF A;  2Y21 A;  5IWA M;  3U5Z A;  2M60 A;  2QP9 X;  2QCU A;  2FNA A;  4LZJ A;  2OPF A;  2EO2 A;  3KOX E;  4DR5 M;  3AOG A;  3JR5 A;  4B7H A;  3GRV A;  4MGH A;  1TH2 A;  1G4A E;  2UU9 M;  2BNK A;  2I7P A;  1HT1 E;  1D2N A;  3GPU A;  1NY6 A;  3MK6 A;  3GPP A;  2ZBK B;  4LGY A;  2XSZ D;  4DV3 M;  2QBY B;  1L2B A;  4DR4 M;  2F5P A;  2CHV A;  4XGI A;  3U6M A;  2R46 A;  2C99 A;  2G8L A;  2Y0T A;  2Z4S A;  3FTC A;  4FW9 A;  4GHA A;  3GLI B;  1NJF A;  3LQQ A;  4GMQ A;  4DR2 M;  1QQW A;  4WW0 A;  3SAS A;  1QYR A;  3GO8 A;  3CF2 A;  5EP2 A;  2X4A A;  4GC5 A;  4M9Z A;  2R45 A;  3E9S A;  5ITX A;  2UXC M;  3CF6 E;  4YY3 M;  4JI3 M;  3HJQ A;  1N77 A;  4AG5 A;  2ZAN A;  3KW6 A;  4L4U A;  4I81 A;  2L7H A;  1Z5B A;  3KS8 A;  2W82 A;  5DNY A;  4I8O A;  3T15 A;  2DZO B;  1K3W A;  2FOI C;  3RE8 A;  2P5T A;  4B7G A;  3T1Y M;  3K8Z A;  3VFD A;  5EXT A;  4LRS A;  2HHH M;  1E9S A;  4LF9 M;  3GLF B;  4M0D A;  4M9S A;  1R2Z A;  5H37 D;  3LMM A;  1HT2 E;  4HLQ A;  4FCT A;  1G41 A;  1SXJ A;  3GLG B;  2OQ4 A;  3VDP A;  4LF8 M;  1PJJ A;  3GLH A;  3SAU A;  3ZH9 B;  4X62 M;  4B3R M;  4IBE A;  4BBA A;  4BLC A;  3TWM A;  1DGF A;  1QAQ A;  2XGN A;  4JI5 M;  4PD2 A;  3FTD A;  2E5L M;  3EIE A;  1I94 M;  4IBK A;  4KHP M;  3U61 A;  3L27 A;  3GRY A;  2UXD M;  1R2Y A;  4LJA A;  4LRT A;  2R62 A;  2F5O A;  3RFW A;  4L15 A;  5GKN A;  4JI1 M;  1MX0 A;  2DWZ B;  4GHL A;  2RGH A;  4JXJ A;  4IJF A;  4A3V B;  2KW0 A;  2RGO A;  3NBI A;  2V1C A;  4LF4 M;  1EE8 A;  4NRV A;  4JI7 M;  2FFJ A;  2XEP A;  4JV5 M;  4S12 A;  5FSW A;  3A42 A;  7CAT A;  1VDD A;  1HNW M;  3M7G A;  5ITT A;  3L25 A;  3J2P B;  1SXJ D;  4AKH A;  3U6E A;  4IBJ A;  5IZ7 D;  3U6S A;  1QAM A;  3HGI A;  4JI0 M;  4GKK M;  1KSF X;  4JI4 M;  1QVR A;  3I4Y A;  4X66 M;  2CUZ A;  2C5R A;  4YHH M;  3AOE C;  2L09 A;  3K2L A;  1TH3 A;  3SC3 A;  1L8Q A;  4DV1 M;  1G3I A;  4NOO B;  4PDI A;  1NHW C;  1HNX M;  2EUC A;  5FTM A;  4G4Q A;  5IRE B;  2EA0 A;  1OFH A;  4K0K M;  5IT9 S;  4JI6 M;  4I5S A;  3SYK A;  4NSR A;  1XNR M;  2J7O A;  1E9R A;  3R8F A;  1N78 A;  2QZ4 A;  4IIW A;  4DR7 M;  2XSZ A;  5JI2 E;  2V6Z M;  4FVM A;  3A46 A;  4FCW A;  2BJV A;  3QWL A;  2A5Y B;  3M0E A;  5C18 A;  3U6L A;  3Q8X A;  2CV2 A;  4QOZ C;  1XMQ M;  4OU7 A;  3VK7 A;  5DYG A;  3D8L A;  2UUC M;  3HU1 A;  2O5R A;  2C96 A;  1DGG A;  2X49 A;  4RNA A;  3VDU A;  3K92 A;  3KSX A;  3HU2 A;  2QEN A;  4LF5 M;  1JQJ C;  3KS4 A;  4KOD A;  4DUZ M;  3HWS A;  4REZ A;  3GPY A;  1IBK M;  2HKJ A;  2LWX A;  2KZS A;  4AZF A;  5ITQ A;  2VQF M;  1HQY E;  4X65 M;  4FWG A;  1DO2 A;  3KXE C;  2FE8 A;  2DVW B;  2AHM A;  2LNH C;  3GRU A;  4GKJ M;  1XXH B;  3NWL A;  4OVZ A;  1HQC A;  2KXE A;  2UUB M;  3AL0 C;  3E4R A;  3LQR A;  5F3W A;  2D7E A;  2XFS A;  4LFB M;  2C9O A;  4B3T M;  4B7F A;  3C58 A;  2K47 A;  3PXG A;  3RGP A;  5A2Q S;  3PNV A;  5EXS A;  1DGH A;  3A98 B;  2XH9 A;  2C9C A;  3KSJ A;  3TWK A;  2R18 A;  4MGI E;  4L16 A;  5DYI A;  3GP1 A;  2DWM A;  4TUW A;  1GL7 A;  3ZCB B;  2CHQ A;  3L28 A;  4DV4 M;  4RF0 A;  1PM5 A;  5KQD A;  8CAT A;  2L6O A;  3L26 A;  4CIS A;  1TGU A;  1HNZ M;  3HHW A;  5JI3 E;  4AW4 A;  3L2A A;  5ITX E;  3VK8 A;  3U5Z B;  1TH4 A;  3DA1 A;  4JN6 A;  2Z3X A;  1L2C A;  4IBD A;  4MM3 B;  4B3S M;  3T38 A;  4NL4 H;  3J7B A;  3U60 A;  4ZPX A;  5LMU M;  1XC8 A;  4IBC A;  3AJI B;  4G4N A;  1N32 M;  3UK6 A;  3L29 A;  3UGJ A;  3U6C A;  4RF1 A;  3HHZ A;  3J27 B;  3KOZ E;  2HCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...