4IIWA

2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
304
Chain Sequence
SKEKITVEIPAGSSISDISTILEDKKVINNASIFSFYVKYNNDTNLKAGNYELSPAMNTDQIVKKMQEGKTVAPAKLVIPEGYTLDQIADRIVAYQPKLKKADVLKTMDDPEFVASMIKAYPETVTNDVLNKSIKHPLEGYLYPATYTFKGTDVSAEQIITEMVKATDVNIAKYRDELTKQKMSVHKFLTMSSIIEKEATENVDRKMIASVFYNRLAKDMRLQTDPTVLYALGEHKSKTTYKDLEVDSPYNTYKNNGLPPGPISNSGDSSMEAALYPEKSDYLYFLANKVYFSKTLEEHNKLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.6 Angstrom Crystal Structure of Putative yceG-like Protein lmo1499 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
molecule keywords Lmo1499 protein
total genus 83
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02618 YceG YceG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1150 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4iiwA01
4IIWA
chains in the Genus database with same CATH superfamily
2F5OA 3MK6A 4GKJM 1JQJC 1YE9A 5IWAM 1HQYE 3JAMS 4LJ6A 1YUBA 2O01F 2ZTDA 4OVZA 5FTJA 1KFVA 1N34M 5ITXE 2L09A 1CUKA 2DAEA 2FH0A 3JR5A 1MX0A 1NVMA 5EXSA 1QUTA 2CHQA 4CHTB 2R46A 3U6OA 5FLXS 4RKUF 4LZZA 2UUBM 2J7NA 3U6SA 4IBFA 4B7HA 3GLHA 3C58A 5ITXA 5ITRA 2CHVA 3KP0E 1IY0A 1W5TA 4I5SA 4OW0A 3VK8A 3B9PA 2LVOC 1TDHA 2L4FA 1IXSB 4IJFA 4IBJA 3EIEA 2L7IA 4Z8XA 3TE6A 4M0DA 4QNRA 4M0WA 1Z6TA 1OTRA 1EFUB 2DNAA 2R4EA 2YR0A 1XXHA 3M7GA 3L2AA 4JN6A 1R2ZA 5FTMA 4GH9A 1ZMUA 3KSXA 3KP1E 3T1YM 5H37D 5LMNM 4JI3M 3IG8A 1SXJE 1NHGC 2CP8A 3LQRA 2Y21A 2XZFA 1N36M 2JY5A 2L7HA 2HAKA 4KLNA 1S3SA 3DFZA 5KPRA 4GRIA 4MB7A 4XBOA 4X62M 3GLFB 2BJWA 3VK7A 3FTEA 3NBIA 4KODA 1H6UA 2XH9A 3AV0A 4Y28F 4D81A 3GPXA 4MGIE 2CRUA 4KT0F 4PDGA 2EO2A 4MGYE 3F92A 3Q8XA 4MH0E 5EP2A 4JI1M 3U5ZB 1TGUA 3ILKA 2C99A 2QCUA 3VDPA 1OJLA 3VLFB 1GVNA 2LTUA 3LCUA 3A46A 3RGPA 2KEBA 1IY2A 2LNHC 2J7OA 3K92A 4RF1A 4LRSA 1XNQM 3LMMA 4FWDA 4JI7M 2XLJA 2FFJA 1AUAA 1YSYA 2RGOA 1GL7A 1NV8A 1V33A 4IJEA 2DWMA 3D8LA 2VQEM 4B3MM 1TH4A 3SHFA 1OKSA 3C3DA 1MU5A 3E9SA 4IIWA 4L16A 3GLFA 4GHLA 4X66M 1GLNA 2HL7A 4QHSA 3GQ4A 1QUSA 4FCWA 1VG5A 4R7GA 2UU9M 2FS1A 1NY6A 2QHOB 3SAVA 2LWXA 1L2CA 2B3TA 1OIPA 1EE8A 2M60A 2P5TA 2O25A 4L8RC 3B7NA 3KOWE 3U6PA 4JI6M 3KSJA 1J7KA 2XFSA 1ZAEA 2K47A 4UN2B 3U6DA 3LW5F 3H4JA 3GLIE 2DWNA 2JY7A 3T15A 4DV1M 2APLA 4KO8A 1XMQM 2QP9X 2VF8A 2LXEA 2VDBB 1NSFA 4OU7A 2WSFF 4FW9A 1OFHA 3THGA 4AKGA 3VKHA 4GC9A 2UXCM 4IBBA 4L4UA 3DZDA 4Q7JA 1V92A 4AZFA 1N78A 4LJ9A 1JR3E 4W5WA 1PGYA 4LJ4A 1ORYB 2CV2A 4LFCM 1A5TA 3SC3A 4XK8F 2M5ZA 4LF8M 4JI0M 4QOZC 5C1BA 2LVPC 1T3TA 4OVZB 3FTDA 1NY5A 3J7BA 5DYIA 1K3XA 2FOIC 3HJQA 3HJSA 2QZ4A 3L29A 2OQ4A 3L25A 1HR0M 4BB9A 3ZC7B 1KSFX 2DAMA 5KPTA 2JXNA 2OOAA 4LF9M 1GO5A 3K9PA 4B3RM 1GJSA 1QAQA 3CF0A 5ITQA 1E9SA 4JI2M 1SXJA 1IN7A 3TWMA 1IBKM 1XB2B 3FTFA 2CE7A 1T6OA 3VFDA 2F5QA 4FWHA 1IN6A 2JA2A 4HEOA 1QVRA 1Q3BA 1DGGA 3CF2A 1IXZA 4ITQA 2N35A 4LZJA 1J09A 4EIWA 2WSEF 1TF0B 4F2LA 2XZUA 3LVWA 5KPZA 3HX3A 3SAWA 2O5RA 3HZJA 3HHWA 4WP2A 4DV6M 5KQ8A 2UUCM 4X64M 1T43A 5EP1A 3J7AS 2JY8A 3A45A 4QNMA 4ZPXA 3KS8A 2V1CA 1I4WA 3CF6E 4NOOB 2OO9A 4XGIA 5ITTA 1F4IA 2R4JA 2X8AA 1GKIA 3SATA 3LQQA 3TWLA 1D0MA 1IBMM 2JUJA 4D80A 4I8OA 2OPFA 1K3WA 2X4AA 2CV0A 4NXMM 4NRVA 1DV0A 5E6JA 3QYEA 4LF4M 1N33M 3GLGA 1VEGA 2Y0QA 3SHGB 1DGHB 1IXRC 2C96A 5ITUA 2LVAA 1TTEA 4B3SM 4DR1M 5EP3A 1XC8A 1TH2A 1N75A 5EQTA 4LF5M 3A98B 2Y0TA 4X65M 4IBKA 4GC5A 2JP7A 2K6BA 2DKLA 3I51A 4DR2M 4GKKM 4GEWA 3AL0C 3GP1A 3SASA 4CIZA 2QNJA 2UUAM 2L6OA 4B7GA 1NNUC 1WGNA 1C1KA 2KZUA 3TL4X 3L26A 4DV5M 2L4EA 4YY3M 3M0EA 2KRKA 4DBGB 4K0KM 4REZA 1PJIA 3UMMA 4B08A 4CJ6A 3MMPA 3KOXE 3SYLA 4D82A 4AG6A 4FWGA 2R44A 2DWZB 3B89A 3LCVB 4DV4M 4HL4A 3IECA 2CWBA 1YLAA 3E46A 4PCZA 1HNWM 3B7ZA 3MHVC 1WGLA 4P17A 3AKZA 1QZEA 2KDLA 3GQ3A 4AW4A 4LRTA 4F1IA 4M9SA 4LF7M 5FTLA 1PJQA 2G5GX 1VQ1A 2KNZA 3GLIA 4JV5M 3I01M 3L28A 2ZAMA 4DR3M 4JI8M 1R6BX 1UM8A 3FKEA 4FCTA 1IM2A 3KVWA 3T1HM 3C3EA 3GO8A 2ZAOA 1HNZM 4AQYM 3PNVA 4LJ5A 2MR9A 1X37A 4IBEA 1OQYA 2W82A 4RF0A 2F4VM 2QENA 3E21A 5FTKA 4JI4M 1SXJD 4L15A 1N32M 1JR3A 1NV9A 2FNAA 3HHXA 4S12A 2KHHA 3PFIA 1NHWC 4I4LA 3UGJA 2XEPA 3R8FA 3GLHE 3HY5A 1XNRM 4G4NA 1D0KA 2RGHA 2R65A 1Q3CA 1R4GA 2ZBKB 1GJTA 1NJFA 1TR8A 1UFZA 2L2DA 4QHTA 2DAKA 4PD2A 4DV7M 1K82A 3U6CA 2E5LM 3HWSA 4FVMA 3KW6A 3KFUG 1KYIA 1E94E 1C7YA 1J5EM 1R7RA 1VDLA 4NC6A 2RRUA 3PVSA 3UZUA 3T38A 4LG2A 3I4VA 1G59A 1G41A 4DR5M 3FD9A 2GNOA 5F3WA 1QDRA 3SFZA 2FE8A 3LVVA 2R62A 2C9OA 1QYRA 1L2BA 2DHYA 1XXHE 3KS4A 4IBGA 2XFTA 3L27A 3RFWA 5KQDA 3GPPA 3AOEC 3I4YA 1HT2E 4IBIA 2LH0A 4NXNM 2ERCA 2XSZA 4NL4H 1MN3A 4LF6M 3B7QA 2H5XA 3SBJA 1IFYA 2DXIA 3R9XB 5BR8M 2EUCA 5BPVA 2XGNA 2CFOA 4CGYB 1WIVA 3V76A 4Z6YA 1JR3D 5IT9S 2KNAA 4GITA 2YFQA 2Y20A 1HNXM 1VEJA 3W0FA 4NRWA 4MGZE 3GRYA 2AHMA 1L1ZA 2I7PA 2DHRA 3IHPA 4LGMA 3D8BA 4AKHA 1P3QQ 3E4RA 1Z5AA 4DV0M 5EXPA 2DENA 2VIIA 4L6V6 3FUTA 2DI0A 3GLIB 2DWLA 1QAMA 1R2YA 4QOSA 4JYAM 3AJIB 3FUUA 3FTCA 1L8QA 3GLHB 2JY6B 3J80S 2KW0A 3TWKA 1IN8A 1R5LA 4LFAM 3U60A 4L78A 2C98A 3KOYE 3QWLA 1SXJB 4LJ8A 3K8ZA 2JZ0A 3BOSA 3U61A 3W67A 2JWSA 1LTMA 2BNKA 2G3QA 2HWJA 4MGHA 4AG5A 2LHCA 3JR4A 1NNJA 3VKGA 4YHHM 1DO2A 1DGHA 2D7HA 1QQWA 3ZH9B 4DR4M 2Q2EB 4NSRA 1GL6A 5EXXA 3QYBA 1D0LA 3H4MA 4G4RA 1OFIA 1DO0A 3GRVA 3UK6A 1G71A 2MH8A 2F5NA 1G3IA 4A3VB 1WJ7A 3TPZA 4GHAA 1PJTA 4OX9M 3SAUA 3Q8GA 4M9ZA 5DNYA 4DR6M 2R45A 3U6QA 2MGWA 1TDZA 1L2DA 2DZLA 4JI5M 2Z4SA 4GMQA 3I04M 3HU2A 3VDUA 2HCBA 4LY6A 5EP4A 2DAGA 2ZTCA 1QANA 4P16A 4BBAA 2Z7JA 3GLGB 3B74A 5L8RF 4R3DA 2QPAA 2CEAA 3KXEC 4LCBA 1VDDA 4WURA 5JI3E 2EKKA 3T6PA 2V1UA 4DV2M 2LVNC 4KHPM 4AI6A 4MM3B 5A2QS 3RGSA 4WW0A 1XXHB 1XHBA 4FCVA 3FUWA 3WHKA 1IBLM 1IQPA 4G4QA 3GPYA 2CUZA 1WHCA 4DV3M 4R71A 2NQ8C 3K1JA 4II7A 4M9XA 3C9PA 3U6MA 4LFBM 3MJ5A 3J27B 3FRIA 5GKNA 3CGWA 2V6ZM 2CV1A 1HT1E 4JXJA 3UJNA 3SYKA 3HGIA 3KOZE 1AIPC 1NJGA 1DGBA 1PM5A 2D7GA 1VEKA 2G8LA 1XMOM 2DZNB 1HQCA 3GRUA 3K9OA 4RNAA 4DUYM 3RE8A 4CISA 1V34A 2DVWB 1I94M 3CTWB 2J5YA 2EA0A 1FNNA 1GABA 5EJCA 3J2PB 4DUZM 2UXBM 4GIPA 3ZCBB 5JI2E 2VF7A 2JZ1A 3KDSE 2D7EA 5DFLA 5E26A 2GQFA 1IN4A 3IG5A 2KZSA 2QSFX 3WHLA 2JNHA 1XWIA 2LVQD 2A5YB 2I7NA 4MGKE 3ZQJA 2ZANA 2R6FA 1OAOC 4B7FA 2Z3XA 1QDTA 8CATA 4G6ZA 2KXEA 3FUVA 3U60B 1Z5CA 3K2LA 1PJSA 3GLGE 1IN5A 3AOEA 3FE3A 3DOAA 3GRRA 1NO1A 3BBZA 5IREB 5KO3A 1SG9A 3J81S 4I81A 2C5RA 3DA1A 2Z8YM 3HHYA 1L1TA 2R18A 1G8PA 4LGYA 1Q02A 2BJVA 4DR7M 2ZM6M 3SMSA 1LV7A 3GQ5A 3W68A 1TH3A 2LBCA 2C9CA 3A42A 3SMPA 3GLFE 4FD2A 2KA6B 2K0BX 2BWEA 4B3TM 5FSWA 4HLQA 1Q39A 3BXWA 1DGFA 3AOGA 2MROB 2WSCF 3HJ8A 2QBYB 2R0IA 1Z5BA 3U6EA 5ITYA 1QAOA 1N77A 1D2NA 1HJPA 1WR1B 1ZQ9A 2YQZA 3QAUA 3GPUA 2QBYA 3U61B 3FUXA 2LHGA 5DYGA 4ANRA 2HHHM 2YNMD 3FYDA 2F5PA 1IXSA 2VQFM 2Z4RA 2QQ8A 3FYCA 4IBDA 1QZMA 3EIHA 1G4AE 1ZV1A 4AKIA 3U5ZA 3SARA 2EJSA 5C18A 2EKFA 2OOBA 4G4OA 2H1RA 1E32A 5IZ7D 3AFHA 3PNYA 2X49A 4LJ7A 2UXDM 1IY1A 3M6AA 1E9RA 1OIZA 1JB0F 4LJAA 2KNVA 2HKJA 3PXGA 5LMUM 3NWLA 1ZMWA 1RU3A 1OAIA 1PRBA 3U6LA 3HKPA 4TUWA 1SXJC 4NSOB 3W0LB 2F5SA 2XSZD 2K9DA 2MJ5B 2WZJA 3NBXX 3HHZA 3FRHA 1MJGM 2RKOA 4BLCA 2XF3A 4PDIA 1EIJA 1Y8GA 1BVSA 3HU3A 5EXTA 1FJGM 4IBCA 3OTOM 1WXQA 5FTNA 2KRUA 1Z59A 2DZOB 4G3OA 2DAIA 4PT5A 1ZMVA 2CHGA 3TQSA 1PJJA 3HU1A 1W5SA 2BWBA 7CATA
chains in the Genus database with same CATH topology
2F5OA 3MK6A 4GKJM 1JQJC 1YE9A 5IWAM 1HQYE 3JAMS 4LJ6A 1YUBA 4OVZA 5FTJA 1KFVA 1N34M 5ITXE 2L09A 3JR5A 1MX0A 1NVMA 5EXSA 2CHQA 4CHTB 2R46A 3U6OA 5FLXS 4LZZA 2UUBM 2J7NA 3U6SA 4IBFA 4B7HA 3GLHA 3C58A 5ITXA 5ITRA 2CHVA 3KP0E 1IY0A 1W5TA 4I5SA 4OW0A 3VK8A 3B9PA 1TDHA 1IXSB 4IJFA 4IBJA 3EIEA 2L7IA 4Z8XA 3TE6A 4M0DA 4QNRA 4M0WA 1Z6TA 2R4EA 2YR0A 1XXHA 3M7GA 3L2AA 4JN6A 1R2ZA 5FTMA 4GH9A 3KSXA 3KP1E 3T1YM 5H37D 5LMNM 4JI3M 3IG8A 1SXJE 3LQRA 1NHGC 2Y21A 2XZFA 1N36M 2L7HA 4KLNA 1S3SA 3DFZA 5KPRA 4GRIA 4MB7A 4XBOA 4X62M 3GLFB 2BJWA 3VK7A 3FTEA 3NBIA 4KODA 1H6UA 2XH9A 3AV0A 4D81A 3GPXA 4MGIE 4PDGA 2EO2A 4MGYE 3Q8XA 4MH0E 5EP2A 4JI1M 3U5ZB 1TGUA 3ILKA 2C99A 2QCUA 3VDPA 1OJLA 3VLFB 1GVNA 3A46A 3RGPA 2KEBA 1IY2A 2LNHC 2J7OA 3K92A 4RF1A 4LRSA 1XNQM 3LMMA 4FWDA 4JI7M 2XLJA 2FFJA 1YSYA 2RGOA 1GL7A 4IJEA 2DWMA 3D8LA 2VQEM 4B3MM 1TH4A 3SHFA 4GHLA 4IIWA 1MU5A 3E9SA 4L16A 3GLFA 4X66M 1GLNA 2HL7A 4QHSA 3GQ4A 4FCWA 4R7GA 2UU9M 1NY6A 3SAVA 2LWXA 1L2CA 1EE8A 2M60A 2P5TA 4L8RC 3KOWE 3U6PA 4JI6M 3KSJA 1J7KA 2XFSA 1ZAEA 2K47A 3U6DA 2DWNA 3T15A 4DV1M 4KO8A 1XMQM 2QP9X 2LXEA 1NSFA 4OU7A 4FW9A 3THGA 1OFHA 4AKGA 3VKHA 4GC9A 2UXCM 4IBBA 4L4UA 3DZDA 1N78A 4AZFA 4LJ9A 4W5WA 4LFCM 4LJ4A 1ORYB 2CV2A 3SC3A 2M5ZA 4LF8M 4JI0M 4QOZC 5C1BA 1T3TA 4OVZB 3FTDA 1NY5A 3J7BA 5DYIA 1K3XA 2FOIC 3HJQA 3HJSA 2QZ4A 3L29A 2OQ4A 3L25A 1HR0M 4BB9A 3ZC7B 1KSFX 5KPTA 4LF9M 4B3RM 1QAQA 3CF0A 5ITQA 1E9SA 4JI2M 1SXJA 1IN7A 3TWMA 1IBKM 3FTFA 2CE7A 3VFDA 2F5QA 4FWHA 1IN6A 2JA2A 1QVRA 1Q3BA 1DGGA 3CF2A 1IXZA 4ITQA 4LZJA 1J09A 4EIWA 2XZUA 3LVWA 5KPZA 3SAWA 2O5RA 3HHWA 4DV6M 5KQ8A 2UUCM 4X64M 3J7AS 5EP1A 3A45A 4QNMA 4ZPXA 3KS8A 2V1CA 1I4WA 3CF6E 4NOOB 4XGIA 5ITTA 2R4JA 2X8AA 1GKIA 3SATA 3LQQA 3TWLA 1IBMM 4D80A 4I8OA 2OPFA 1K3WA 2X4AA 2CV0A 4NXMM 4NRVA 5E6JA 4LF4M 1N33M 3GLGA 2Y0QA 3SHGB 1DGHB 1IXRC 2C96A 5ITUA 4B3SM 4DR1M 5EP3A 1XC8A 1TH2A 1N75A 5EQTA 4LF5M 3A98B 2Y0TA 4X65M 4IBKA 4GC5A 3I51A 4DR2M 4GKKM 3AL0C 3GP1A 3SASA 2UUAM 2L6OA 4B7GA 1NNUC 3TL4X 1C1KA 2KZUA 3L26A 4DV5M 4YY3M 3M0EA 2KRKA 4K0KM 4REZA 1PJIA 3UMMA 4B08A 3KOXE 3SYLA 4D82A 4AG6A 4FWGA 2DWZB 4DV4M 4HL4A 4PCZA 1HNWM 3MHVC 3AKZA 3GQ3A 4AW4A 4LRTA 4M9SA 4LF7M 5FTLA 2G5GX 3GLIA 4JV5M 3L28A 2ZAMA 4DR3M 4JI8M 1R6BX 1UM8A 3FKEA 4FCTA 1IM2A 3KVWA 3T1HM 3GO8A 2ZAOA 1HNZM 4AQYM 3PNVA 4LJ5A 1X37A 4IBEA 2W82A 4RF0A 2F4VM 2QENA 5FTKA 4JI4M 1SXJD 4L15A 1N32M 1JR3A 2FNAA 3HHXA 4S12A 3UGJA 4I4LA 3PFIA 1NHWC 3R8FA 2XEPA 1XNRM 4G4NA 2RGHA 2R65A 1Q3CA 2ZBKB 3U6EA 1NJFA 4QHTA 1K82A 4PD2A 2E5LM 4DV7M 3U6CA 3HWSA 4FVMA 3KW6A 3KFUG 1KYIA 1E94E 1J5EM 1R7RA 4LG2A 3PVSA 3UZUA 3T38A 3I4VA 1G59A 1G41A 4DR5M 3FD9A 5F3WA 3SFZA 2FE8A 3LVVA 2R62A 2C9OA 1QYRA 1L2BA 4IBGA 3KS4A 3RFWA 2XFTA 3L27A 5KQDA 3GPPA 3AOEC 3I4YA 1HT2E 4IBIA 2LH0A 4NXNM 2ERCA 2XSZA 4NL4H 4LF6M 3SBJA 2DXIA 3R9XB 5BR8M 2EUCA 5BPVA 2XGNA 2CFOA 4CGYB 4Z6YA 1JR3D 5IT9S 4GITA 2YFQA 2Y20A 1HNXM 4NRWA 4MGZE 3GRYA 2AHMA 1L1ZA 2I7PA 2DHRA 4LGMA 3D8BA 4AKHA 3E4RA 1Z5AA 4DV0M 5EXPA 2VIIA 3GLIB 2DWLA 3FUTA 4JYAM 1QAMA 1R2YA 4QOSA 3AJIB 3FUUA 3FTCA 1L8QA 3GLHB 3J80S 2KW0A 3TWKA 1IN8A 4LFAM 3U60A 4L78A 2C98A 3KOYE 3QWLA 1SXJB 4LJ8A 3K8ZA 3BOSA 3U61A 2BNKA 4MGHA 4AG5A 3JR4A 1NNJA 3VKGA 4YHHM 1DO2A 1DGHA 2D7HA 1QQWA 3ZH9B 4DR4M 2Q2EB 4NSRA 1GL6A 5EXXA 3H4MA 4G4RA 1OFIA 1DO0A 3GRVA 3UK6A 2F5NA 1G3IA 4A3VB 3TPZA 4GHAA 4OX9M 3SAUA 4M9ZA 5DNYA 4DR6M 2R45A 3U6QA 1TDZA 1L2DA 4JI5M 2Z4SA 4GMQA 3HU2A 3VDUA 2HCBA 4LY6A 5EP4A 4P16A 1QANA 4BBAA 3GLGB 2Z7JA 4R3DA 2QPAA 2CEAA 3KXEC 4LCBA 1VDDA 4WURA 5JI3E 2V1UA 4DV2M 4AI6A 4KHPM 4MM3B 5A2QS 3RGSA 4WW0A 1XXHB 1XHBA 4FCVA 3FUWA 3WHKA 1IBLM 1IQPA 4G4QA 3GPYA 2CUZA 4DV3M 2NQ8C 3K1JA 4II7A 4M9XA 3U6MA 4LFBM 3MJ5A 3J27B 5GKNA 2V6ZM 2CV1A 1HT1E 4JXJA 3UJNA 3SYKA 3HGIA 3KOZE 1NJGA 1DGBA 1PM5A 2D7GA 1XMOM 2G8LA 2DZNB 1HQCA 3GRUA 4RNAA 4DUYM 3RE8A 4CISA 2DVWB 1I94M 3CTWB 2EA0A 1FNNA 5EJCA 3J2PB 4DUZM 2UXBM 4GIPA 3ZCBB 5JI2E 3KDSE 2D7EA 5E26A 1IN4A 3IG5A 2KZSA 3WHLA 1XWIA 4MGKE 2A5YB 2I7NA 4B7FA 2ZANA 2Z3XA 8CATA 4G6ZA 2KXEA 3FUVA 3U60B 1Z5CA 3K2LA 1IN5A 3AOEA 5IREB 3DOAA 3GRRA 2C5RA 5KO3A 3J81S 4I81A 1L1TA 3DA1A 3HHYA 2R18A 1G8PA 4LGYA 2BJVA 4DR7M 2ZM6M 3SMSA 1LV7A 3GQ5A 1TH3A 2C9CA 3A42A 3SMPA 4FD2A 2KA6B 4B3TM 5FSWA 4HLQA 1Q39A 1DGFA 3AOGA 3HJ8A 2QBYB 1Z5BA 5ITYA 1QAOA 1N77A 1D2NA 2YQZA 3QAUA 1ZQ9A 3GPUA 2QBYA 3U61B 3FUXA 5DYGA 2HHHM 2YNMD 3FYDA 2F5PA 2VQFM 2Z4RA 3FYCA 4IBDA 1QZMA 3EIHA 1G4AE 4AKIA 3U5ZA 3SARA 5C18A 4G4OA 2H1RA 1E32A 5IZ7D 3AFHA 3PNYA 2X49A 4LJ7A 2UXDM 1IY1A 3M6AA 1E9RA 4LJAA 5LMUM 2HKJA 3PXGA 3NWLA 3U6LA 4TUWA 3HKPA 1SXJC 4NSOB 3W0LB 2F5SA 2XSZD 3HHZA 2RKOA 4BLCA 2XF3A 4PDIA 3HU3A 1FJGM 5EXTA 4IBCA 3OTOM 1WXQA 5FTNA 2KRUA 1Z59A 2DZOB 4PT5A 1PJJA 2CHGA 3TQSA 3HU1A 1W5SA 3W0FA 7CATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIW A; 
#chains in the Genus database with same CATH topology
 2F5O A;  3MK6 A;  4GKJ M;  1JQJ C;  1YE9 A;  5IWA M;  1HQY E;  3JAM S;  4LJ6 A;  1YUB A;  2O01 F;  2ZTD A;  4OVZ A;  5FTJ A;  1KFV A;  1N34 M;  5ITX E;  2L09 A;  1CUK A;  2DAE A;  2FH0 A;  3JR5 A;  1MX0 A;  1NVM A;  5EXS A;  1QUT A;  2CHQ A;  4CHT B;  2R46 A;  3U6O A;  5FLX S;  4RKU F;  4LZZ A;  2UUB M;  2J7N A;  3U6S A;  4IBF A;  4B7H A;  3GLH A;  3C58 A;  5ITX A;  5ITR A;  2CHV A;  3KP0 E;  1IY0 A;  1W5T A;  4I5S A;  4OW0 A;  3VK8 A;  3B9P A;  2LVO C;  1TDH A;  2L4F A;  1IXS B;  4IJF A;  4IBJ A;  3EIE A;  2L7I A;  4Z8X A;  3TE6 A;  4M0D A;  4QNR A;  4M0W A;  1Z6T A;  1OTR A;  1EFU B;  2DNA A;  2R4E A;  2YR0 A;  1XXH A;  3M7G A;  3L2A A;  4JN6 A;  1R2Z A;  5FTM A;  4GH9 A;  1ZMU A;  3KSX A;  3KP1 E;  3T1Y M;  5H37 D;  5LMN M;  4JI3 M;  3IG8 A;  1SXJ E;  1NHG C;  2CP8 A;  3LQR A;  2Y21 A;  2XZF A;  1N36 M;  2JY5 A;  2L7H A;  2HAK A;  4KLN A;  1S3S A;  3DFZ A;  5KPR A;  4GRI A;  4MB7 A;  4XBO A;  4X62 M;  3GLF B;  2BJW A;  3VK7 A;  3FTE A;  3NBI A;  4KOD A;  1H6U A;  2XH9 A;  3AV0 A;  4Y28 F;  4D81 A;  3GPX A;  4MGI E;  2CRU A;  4KT0 F;  4PDG A;  2EO2 A;  4MGY E;  3F92 A;  3Q8X A;  4MH0 E;  5EP2 A;  4JI1 M;  3U5Z B;  1TGU A;  3ILK A;  2C99 A;  2QCU A;  3VDP A;  1OJL A;  3VLF B;  1GVN A;  2LTU A;  3LCU A;  3A46 A;  3RGP A;  2KEB A;  1IY2 A;  2LNH C;  2J7O A;  3K92 A;  4RF1 A;  4LRS A;  1XNQ M;  3LMM A;  4FWD A;  4JI7 M;  2XLJ A;  2FFJ A;  1AUA A;  1YSY A;  2RGO A;  1GL7 A;  1NV8 A;  1V33 A;  4IJE A;  2DWM A;  3D8L A;  2VQE M;  4B3M M;  1TH4 A;  3SHF A;  1OKS A;  3C3D A;  1MU5 A;  3E9S A;  4IIW A;  4L16 A;  3GLF A;  4GHL A;  4X66 M;  1GLN A;  2HL7 A;  4QHS A;  3GQ4 A;  1QUS A;  4FCW A;  1VG5 A;  4R7G A;  2UU9 M;  2FS1 A;  1NY6 A;  2QHO B;  3SAV A;  2LWX A;  1L2C A;  2B3T A;  1OIP A;  1EE8 A;  2M60 A;  2P5T A;  2O25 A;  4L8R C;  3B7N A;  3KOW E;  3U6P A;  4JI6 M;  3KSJ A;  1J7K A;  2XFS A;  1ZAE A;  2K47 A;  4UN2 B;  3U6D A;  3LW5 F;  3H4J A;  3GLI E;  2DWN A;  2JY7 A;  3T15 A;  4DV1 M;  2APL A;  4KO8 A;  1XMQ M;  2QP9 X;  2VF8 A;  2LXE A;  2VDB B;  1NSF A;  4OU7 A;  2WSF F;  4FW9 A;  1OFH A;  3THG A;  4AKG A;  3VKH A;  4GC9 A;  2UXC M;  4IBB A;  4L4U A;  3DZD A;  4Q7J A;  1V92 A;  4AZF A;  1N78 A;  4LJ9 A;  1JR3 E;  4W5W A;  1PGY A;  4LJ4 A;  1ORY B;  2CV2 A;  4LFC M;  1A5T A;  3SC3 A;  4XK8 F;  2M5Z A;  4LF8 M;  4JI0 M;  4QOZ C;  5C1B A;  2LVP C;  1T3T A;  4OVZ B;  3FTD A;  1NY5 A;  3J7B A;  5DYI A;  1K3X A;  2FOI C;  3HJQ A;  3HJS A;  2QZ4 A;  3L29 A;  2OQ4 A;  3L25 A;  1HR0 M;  4BB9 A;  3ZC7 B;  1KSF X;  2DAM A;  5KPT A;  2JXN A;  2OOA A;  4LF9 M;  1GO5 A;  3K9P A;  4B3R M;  1GJS A;  1QAQ A;  3CF0 A;  5ITQ A;  1E9S A;  4JI2 M;  1SXJ A;  1IN7 A;  3TWM A;  1IBK M;  1XB2 B;  3FTF A;  2CE7 A;  1T6O A;  3VFD A;  2F5Q A;  4FWH A;  1IN6 A;  2JA2 A;  4HEO A;  1QVR A;  1Q3B A;  1DGG A;  3CF2 A;  1IXZ A;  4ITQ A;  2N35 A;  4LZJ A;  1J09 A;  4EIW A;  2WSE F;  1TF0 B;  4F2L A;  2XZU A;  3LVW A;  5KPZ A;  3HX3 A;  3SAW A;  2O5R A;  3HZJ A;  3HHW A;  4WP2 A;  4DV6 M;  5KQ8 A;  2UUC M;  4X64 M;  1T43 A;  5EP1 A;  3J7A S;  2JY8 A;  3A45 A;  4QNM A;  4ZPX A;  3KS8 A;  2V1C A;  1I4W A;  3CF6 E;  4NOO B;  2OO9 A;  4XGI A;  5ITT A;  1F4I A;  2R4J A;  2X8A A;  1GKI A;  3SAT A;  3LQQ A;  3TWL A;  1D0M A;  1IBM M;  2JUJ A;  4D80 A;  4I8O A;  2OPF A;  1K3W A;  2X4A A;  2CV0 A;  4NXM M;  4NRV A;  1DV0 A;  5E6J A;  3QYE A;  4LF4 M;  1N33 M;  3GLG A;  1VEG A;  2Y0Q A;  3SHG B;  1DGH B;  1IXR C;  2C96 A;  5ITU A;  2LVA A;  1TTE A;  4B3S M;  4DR1 M;  5EP3 A;  1XC8 A;  1TH2 A;  1N75 A;  5EQT A;  4LF5 M;  3A98 B;  2Y0T A;  4X65 M;  4IBK A;  4GC5 A;  2JP7 A;  2K6B A;  2DKL A;  3I51 A;  4DR2 M;  4GKK M;  4GEW A;  3AL0 C;  3GP1 A;  3SAS A;  4CIZ A;  2QNJ A;  2UUA M;  2L6O A;  4B7G A;  1NNU C;  1WGN A;  1C1K A;  2KZU A;  3TL4 X;  3L26 A;  4DV5 M;  2L4E A;  4YY3 M;  3M0E A;  2KRK A;  4DBG B;  4K0K M;  4REZ A;  1PJI A;  3UMM A;  4B08 A;  4CJ6 A;  3MMP A;  3KOX E;  3SYL A;  4D82 A;  4AG6 A;  4FWG A;  2R44 A;  2DWZ B;  3B89 A;  3LCV B;  4DV4 M;  4HL4 A;  3IEC A;  2CWB A;  1YLA A;  3E46 A;  4PCZ A;  1HNW M;  3B7Z A;  3MHV C;  1WGL A;  4P17 A;  3AKZ A;  1QZE A;  2KDL A;  3GQ3 A;  4AW4 A;  4LRT A;  4F1I A;  4M9S A;  4LF7 M;  5FTL A;  1PJQ A;  2G5G X;  1VQ1 A;  2KNZ A;  3GLI A;  4JV5 M;  3I01 M;  3L28 A;  2ZAM A;  4DR3 M;  4JI8 M;  1R6B X;  1UM8 A;  3FKE A;  4FCT A;  1IM2 A;  3KVW A;  3T1H M;  3C3E A;  3GO8 A;  2ZAO A;  1HNZ M;  4AQY M;  3PNV A;  4LJ5 A;  2MR9 A;  1X37 A;  4IBE A;  1OQY A;  2W82 A;  4RF0 A;  2F4V M;  2QEN A;  3E21 A;  5FTK A;  4JI4 M;  1SXJ D;  4L15 A;  1N32 M;  1JR3 A;  1NV9 A;  2FNA A;  3HHX A;  4S12 A;  2KHH A;  3PFI A;  1NHW C;  4I4L A;  3UGJ A;  2XEP A;  3R8F A;  3GLH E;  3HY5 A;  1XNR M;  4G4N A;  1D0K A;  2RGH A;  2R65 A;  1Q3C A;  1R4G A;  2ZBK B;  1GJT A;  1NJF A;  1TR8 A;  1UFZ A;  2L2D A;  4QHT A;  2DAK A;  4PD2 A;  4DV7 M;  1K82 A;  3U6C A;  2E5L M;  3HWS A;  4FVM A;  3KW6 A;  3KFU G;  1KYI A;  1E94 E;  1C7Y A;  1J5E M;  1R7R A;  1VDL A;  4NC6 A;  2RRU A;  3PVS A;  3UZU A;  3T38 A;  4LG2 A;  3I4V A;  1G59 A;  1G41 A;  4DR5 M;  3FD9 A;  2GNO A;  5F3W A;  1QDR A;  3SFZ A;  2FE8 A;  3LVV A;  2R62 A;  2C9O A;  1QYR A;  1L2B A;  2DHY A;  1XXH E;  3KS4 A;  4IBG A;  2XFT A;  3L27 A;  3RFW A;  5KQD A;  3GPP A;  3AOE C;  3I4Y A;  1HT2 E;  4IBI A;  2LH0 A;  4NXN M;  2ERC A;  2XSZ A;  4NL4 H;  1MN3 A;  4LF6 M;  3B7Q A;  2H5X A;  3SBJ A;  1IFY A;  2DXI A;  3R9X B;  5BR8 M;  2EUC A;  5BPV A;  2XGN A;  2CFO A;  4CGY B;  1WIV A;  3V76 A;  4Z6Y A;  1JR3 D;  5IT9 S;  2KNA A;  4GIT A;  2YFQ A;  2Y20 A;  1HNX M;  1VEJ A;  3W0F A;  4NRW A;  4MGZ E;  3GRY A;  2AHM A;  1L1Z A;  2I7P A;  2DHR A;  3IHP A;  4LGM A;  3D8B A;  4AKH A;  1P3Q Q;  3E4R A;  1Z5A A;  4DV0 M;  5EXP A;  2DEN A;  2VII A;  4L6V 6;  3FUT A;  2DI0 A;  3GLI B;  2DWL A;  1QAM A;  1R2Y A;  4QOS A;  4JYA M;  3AJI B;  3FUU A;  3FTC A;  1L8Q A;  3GLH B;  2JY6 B;  3J80 S;  2KW0 A;  3TWK A;  1IN8 A;  1R5L A;  4LFA M;  3U60 A;  4L78 A;  2C98 A;  3KOY E;  3QWL A;  1SXJ B;  4LJ8 A;  3K8Z A;  2JZ0 A;  3BOS A;  3U61 A;  3W67 A;  2JWS A;  1LTM A;  2BNK A;  2G3Q A;  2HWJ A;  4MGH A;  4AG5 A;  2LHC A;  3JR4 A;  1NNJ A;  3VKG A;  4YHH M;  1DO2 A;  1DGH A;  2D7H A;  1QQW A;  3ZH9 B;  4DR4 M;  2Q2E B;  4NSR A;  1GL6 A;  5EXX A;  3QYB A;  1D0L A;  3H4M A;  4G4R A;  1OFI A;  1DO0 A;  3GRV A;  3UK6 A;  1G71 A;  2MH8 A;  2F5N A;  1G3I A;  4A3V B;  1WJ7 A;  3TPZ A;  4GHA A;  1PJT A;  4OX9 M;  3SAU A;  3Q8G A;  4M9Z A;  5DNY A;  4DR6 M;  2R45 A;  3U6Q A;  2MGW A;  1TDZ A;  1L2D A;  2DZL A;  4JI5 M;  2Z4S A;  4GMQ A;  3I04 M;  3HU2 A;  3VDU A;  2HCB A;  4LY6 A;  5EP4 A;  2DAG A;  2ZTC A;  1QAN A;  4P16 A;  4BBA A;  2Z7J A;  3GLG B;  3B74 A;  5L8R F;  4R3D A;  2QPA A;  2CEA A;  3KXE C;  4LCB A;  1VDD A;  4WUR A;  5JI3 E;  2EKK A;  3T6P A;  2V1U A;  4DV2 M;  2LVN C;  4KHP M;  4AI6 A;  4MM3 B;  5A2Q S;  3RGS A;  4WW0 A;  1XXH B;  1XHB A;  4FCV A;  3FUW A;  3WHK A;  1IBL M;  1IQP A;  4G4Q A;  3GPY A;  2CUZ A;  1WHC A;  4DV3 M;  4R71 A;  2NQ8 C;  3K1J A;  4II7 A;  4M9X A;  3C9P A;  3U6M A;  4LFB M;  3MJ5 A;  3J27 B;  3FRI A;  5GKN A;  3CGW A;  2V6Z M;  2CV1 A;  1HT1 E;  4JXJ A;  3UJN A;  3SYK A;  3HGI A;  3KOZ E;  1AIP C;  1NJG A;  1DGB A;  1PM5 A;  2D7G A;  1VEK A;  2G8L A;  1XMO M;  2DZN B;  1HQC A;  3GRU A;  3K9O A;  4RNA A;  4DUY M;  3RE8 A;  4CIS A;  1V34 A;  2DVW B;  1I94 M;  3CTW B;  2J5Y A;  2EA0 A;  1FNN A;  1GAB A;  5EJC A;  3J2P B;  4DUZ M;  2UXB M;  4GIP A;  3ZCB B;  5JI2 E;  2VF7 A;  2JZ1 A;  3KDS E;  2D7E A;  5DFL A;  5E26 A;  2GQF A;  1IN4 A;  3IG5 A;  2KZS A;  2QSF X;  3WHL A;  2JNH A;  1XWI A;  2LVQ D;  2A5Y B;  2I7N A;  4MGK E;  3ZQJ A;  2ZAN A;  2R6F A;  1OAO C;  4B7F A;  2Z3X A;  1QDT A;  8CAT A;  4G6Z A;  2KXE A;  3FUV A;  3U60 B;  1Z5C A;  3K2L A;  1PJS A;  3GLG E;  1IN5 A;  3AOE A;  3FE3 A;  3DOA A;  3GRR A;  1NO1 A;  3BBZ A;  5IRE B;  5KO3 A;  1SG9 A;  3J81 S;  4I81 A;  2C5R A;  3DA1 A;  2Z8Y M;  3HHY A;  1L1T A;  2R18 A;  1G8P A;  4LGY A;  1Q02 A;  2BJV A;  4DR7 M;  2ZM6 M;  3SMS A;  1LV7 A;  3GQ5 A;  3W68 A;  1TH3 A;  2LBC A;  2C9C A;  3A42 A;  3SMP A;  3GLF E;  4FD2 A;  2KA6 B;  2K0B X;  2BWE A;  4B3T M;  5FSW A;  4HLQ A;  1Q39 A;  3BXW A;  1DGF A;  3AOG A;  2MRO B;  2WSC F;  3HJ8 A;  2QBY B;  2R0I A;  1Z5B A;  3U6E A;  5ITY A;  1QAO A;  1N77 A;  1D2N A;  1HJP A;  1WR1 B;  1ZQ9 A;  2YQZ A;  3QAU A;  3GPU A;  2QBY A;  3U61 B;  3FUX A;  2LHG A;  5DYG A;  4ANR A;  2HHH M;  2YNM D;  3FYD A;  2F5P A;  1IXS A;  2VQF M;  2Z4R A;  2QQ8 A;  3FYC A;  4IBD A;  1QZM A;  3EIH A;  1G4A E;  1ZV1 A;  4AKI A;  3U5Z A;  3SAR A;  2EJS A;  5C18 A;  2EKF A;  2OOB A;  4G4O A;  2H1R A;  1E32 A;  5IZ7 D;  3AFH A;  3PNY A;  2X49 A;  4LJ7 A;  2UXD M;  1IY1 A;  3M6A A;  1E9R A;  1OIZ A;  1JB0 F;  4LJA A;  2KNV A;  2HKJ A;  3PXG A;  5LMU M;  3NWL A;  1ZMW A;  1RU3 A;  1OAI A;  1PRB A;  3U6L A;  3HKP A;  4TUW A;  1SXJ C;  4NSO B;  3W0L B;  2F5S A;  2XSZ D;  2K9D A;  2MJ5 B;  2WZJ A;  3NBX X;  3HHZ A;  3FRH A;  1MJG M;  2RKO A;  4BLC A;  2XF3 A;  4PDI A;  1EIJ A;  1Y8G A;  1BVS A;  3HU3 A;  5EXT A;  1FJG M;  4IBC A;  3OTO M;  1WXQ A;  5FTN A;  2KRU A;  1Z59 A;  2DZO B;  4G3O A;  2DAI A;  4PT5 A;  1ZMV A;  2CHG A;  3TQS A;  1PJJ A;  3HU1 A;  1W5S A;  2BWB A;  7CAT A; 
#chains in the Genus database with same CATH homology
 2F5O A;  3MK6 A;  4GKJ M;  1JQJ C;  1YE9 A;  5IWA M;  1HQY E;  3JAM S;  4LJ6 A;  1YUB A;  4OVZ A;  5FTJ A;  1KFV A;  1N34 M;  5ITX E;  2L09 A;  3JR5 A;  1MX0 A;  1NVM A;  5EXS A;  2CHQ A;  4CHT B;  2R46 A;  3U6O A;  5FLX S;  4LZZ A;  2UUB M;  2J7N A;  3U6S A;  4IBF A;  4B7H A;  3GLH A;  3C58 A;  5ITX A;  5ITR A;  2CHV A;  3KP0 E;  1IY0 A;  1W5T A;  4I5S A;  4OW0 A;  3VK8 A;  3B9P A;  1TDH A;  1IXS B;  4IJF A;  4IBJ A;  3EIE A;  2L7I A;  4Z8X A;  3TE6 A;  4M0D A;  4QNR A;  4M0W A;  1Z6T A;  2R4E A;  2YR0 A;  1XXH A;  3M7G A;  3L2A A;  4JN6 A;  1R2Z A;  5FTM A;  4GH9 A;  3KSX A;  3KP1 E;  3T1Y M;  5H37 D;  5LMN M;  4JI3 M;  3IG8 A;  1SXJ E;  3LQR A;  1NHG C;  2Y21 A;  2XZF A;  1N36 M;  2L7H A;  4KLN A;  1S3S A;  3DFZ A;  5KPR A;  4GRI A;  4MB7 A;  4XBO A;  4X62 M;  3GLF B;  2BJW A;  3VK7 A;  3FTE A;  3NBI A;  4KOD A;  1H6U A;  2XH9 A;  3AV0 A;  4D81 A;  3GPX A;  4MGI E;  4PDG A;  2EO2 A;  4MGY E;  3Q8X A;  4MH0 E;  5EP2 A;  4JI1 M;  3U5Z B;  1TGU A;  3ILK A;  2C99 A;  2QCU A;  3VDP A;  1OJL A;  3VLF B;  1GVN A;  3A46 A;  3RGP A;  2KEB A;  1IY2 A;  2LNH C;  2J7O A;  3K92 A;  4RF1 A;  4LRS A;  1XNQ M;  3LMM A;  4FWD A;  4JI7 M;  2XLJ A;  2FFJ A;  1YSY A;  2RGO A;  1GL7 A;  4IJE A;  2DWM A;  3D8L A;  2VQE M;  4B3M M;  1TH4 A;  3SHF A;  4GHL A;  4IIW A;  1MU5 A;  3E9S A;  4L16 A;  3GLF A;  4X66 M;  1GLN A;  2HL7 A;  4QHS A;  3GQ4 A;  4FCW A;  4R7G A;  2UU9 M;  1NY6 A;  3SAV A;  2LWX A;  1L2C A;  1EE8 A;  2M60 A;  2P5T A;  4L8R C;  3KOW E;  3U6P A;  4JI6 M;  3KSJ A;  1J7K A;  2XFS A;  1ZAE A;  2K47 A;  3U6D A;  2DWN A;  3T15 A;  4DV1 M;  4KO8 A;  1XMQ M;  2QP9 X;  2LXE A;  1NSF A;  4OU7 A;  4FW9 A;  3THG A;  1OFH A;  4AKG A;  3VKH A;  4GC9 A;  2UXC M;  4IBB A;  4L4U A;  3DZD A;  1N78 A;  4AZF A;  4LJ9 A;  4W5W A;  4LFC M;  4LJ4 A;  1ORY B;  2CV2 A;  3SC3 A;  2M5Z A;  4LF8 M;  4JI0 M;  4QOZ C;  5C1B A;  1T3T A;  4OVZ B;  3FTD A;  1NY5 A;  3J7B A;  5DYI A;  1K3X A;  2FOI C;  3HJQ A;  3HJS A;  2QZ4 A;  3L29 A;  2OQ4 A;  3L25 A;  1HR0 M;  4BB9 A;  3ZC7 B;  1KSF X;  5KPT A;  4LF9 M;  4B3R M;  1QAQ A;  3CF0 A;  5ITQ A;  1E9S A;  4JI2 M;  1SXJ A;  1IN7 A;  3TWM A;  1IBK M;  3FTF A;  2CE7 A;  3VFD A;  2F5Q A;  4FWH A;  1IN6 A;  2JA2 A;  1QVR A;  1Q3B A;  1DGG A;  3CF2 A;  1IXZ A;  4ITQ A;  4LZJ A;  1J09 A;  4EIW A;  2XZU A;  3LVW A;  5KPZ A;  3SAW A;  2O5R A;  3HHW A;  4DV6 M;  5KQ8 A;  2UUC M;  4X64 M;  3J7A S;  5EP1 A;  3A45 A;  4QNM A;  4ZPX A;  3KS8 A;  2V1C A;  1I4W A;  3CF6 E;  4NOO B;  4XGI A;  5ITT A;  2R4J A;  2X8A A;  1GKI A;  3SAT A;  3LQQ A;  3TWL A;  1IBM M;  4D80 A;  4I8O A;  2OPF A;  1K3W A;  2X4A A;  2CV0 A;  4NXM M;  4NRV A;  5E6J A;  4LF4 M;  1N33 M;  3GLG A;  2Y0Q A;  3SHG B;  1DGH B;  1IXR C;  2C96 A;  5ITU A;  4B3S M;  4DR1 M;  5EP3 A;  1XC8 A;  1TH2 A;  1N75 A;  5EQT A;  4LF5 M;  3A98 B;  2Y0T A;  4X65 M;  4IBK A;  4GC5 A;  3I51 A;  4DR2 M;  4GKK M;  3AL0 C;  3GP1 A;  3SAS A;  2UUA M;  2L6O A;  4B7G A;  1NNU C;  3TL4 X;  1C1K A;  2KZU A;  3L26 A;  4DV5 M;  4YY3 M;  3M0E A;  2KRK A;  4K0K M;  4REZ A;  1PJI A;  3UMM A;  4B08 A;  3KOX E;  3SYL A;  4D82 A;  4AG6 A;  4FWG A;  2DWZ B;  4DV4 M;  4HL4 A;  4PCZ A;  1HNW M;  3MHV C;  3AKZ A;  3GQ3 A;  4AW4 A;  4LRT A;  4M9S A;  4LF7 M;  5FTL A;  2G5G X;  3GLI A;  4JV5 M;  3L28 A;  2ZAM A;  4DR3 M;  4JI8 M;  1R6B X;  1UM8 A;  3FKE A;  4FCT A;  1IM2 A;  3KVW A;  3T1H M;  3GO8 A;  2ZAO A;  1HNZ M;  4AQY M;  3PNV A;  4LJ5 A;  1X37 A;  4IBE A;  2W82 A;  4RF0 A;  2F4V M;  2QEN A;  5FTK A;  4JI4 M;  1SXJ D;  4L15 A;  1N32 M;  1JR3 A;  2FNA A;  3HHX A;  4S12 A;  3UGJ A;  4I4L A;  3PFI A;  1NHW C;  3R8F A;  2XEP A;  1XNR M;  4G4N A;  2RGH A;  2R65 A;  1Q3C A;  2ZBK B;  3U6E A;  1NJF A;  4QHT A;  1K82 A;  4PD2 A;  2E5L M;  4DV7 M;  3U6C A;  3HWS A;  4FVM A;  3KW6 A;  3KFU G;  1KYI A;  1E94 E;  1J5E M;  1R7R A;  4LG2 A;  3PVS A;  3UZU A;  3T38 A;  3I4V A;  1G59 A;  1G41 A;  4DR5 M;  3FD9 A;  5F3W A;  3SFZ A;  2FE8 A;  3LVV A;  2R62 A;  2C9O A;  1QYR A;  1L2B A;  4IBG A;  3KS4 A;  3RFW A;  2XFT A;  3L27 A;  5KQD A;  3GPP A;  3AOE C;  3I4Y A;  1HT2 E;  4IBI A;  2LH0 A;  4NXN M;  2ERC A;  2XSZ A;  4NL4 H;  4LF6 M;  3SBJ A;  2DXI A;  3R9X B;  5BR8 M;  2EUC A;  5BPV A;  2XGN A;  2CFO A;  4CGY B;  4Z6Y A;  1JR3 D;  5IT9 S;  4GIT A;  2YFQ A;  2Y20 A;  1HNX M;  4NRW A;  4MGZ E;  3GRY A;  2AHM A;  1L1Z A;  2I7P A;  2DHR A;  4LGM A;  3D8B A;  4AKH A;  3E4R A;  1Z5A A;  4DV0 M;  5EXP A;  2VII A;  3GLI B;  2DWL A;  3FUT A;  4JYA M;  1QAM A;  1R2Y A;  4QOS A;  3AJI B;  3FUU A;  3FTC A;  1L8Q A;  3GLH B;  3J80 S;  2KW0 A;  3TWK A;  1IN8 A;  4LFA M;  3U60 A;  4L78 A;  2C98 A;  3KOY E;  3QWL A;  1SXJ B;  4LJ8 A;  3K8Z A;  3BOS A;  3U61 A;  2BNK A;  4MGH A;  4AG5 A;  3JR4 A;  1NNJ A;  3VKG A;  4YHH M;  1DO2 A;  1DGH A;  2D7H A;  1QQW A;  3ZH9 B;  4DR4 M;  2Q2E B;  4NSR A;  1GL6 A;  5EXX A;  3H4M A;  4G4R A;  1OFI A;  1DO0 A;  3GRV A;  3UK6 A;  2F5N A;  1G3I A;  4A3V B;  3TPZ A;  4GHA A;  4OX9 M;  3SAU A;  4M9Z A;  5DNY A;  4DR6 M;  2R45 A;  3U6Q A;  1TDZ A;  1L2D A;  4JI5 M;  2Z4S A;  4GMQ A;  3HU2 A;  3VDU A;  2HCB A;  4LY6 A;  5EP4 A;  4P16 A;  1QAN A;  4BBA A;  3GLG B;  2Z7J A;  4R3D A;  2QPA A;  2CEA A;  3KXE C;  4LCB A;  1VDD A;  4WUR A;  5JI3 E;  2V1U A;  4DV2 M;  4AI6 A;  4KHP M;  4MM3 B;  5A2Q S;  3RGS A;  4WW0 A;  1XXH B;  1XHB A;  4FCV A;  3FUW A;  3WHK A;  1IBL M;  1IQP A;  4G4Q A;  3GPY A;  2CUZ A;  4DV3 M;  2NQ8 C;  3K1J A;  4II7 A;  4M9X A;  3U6M A;  4LFB M;  3MJ5 A;  3J27 B;  5GKN A;  2V6Z M;  2CV1 A;  1HT1 E;  4JXJ A;  3UJN A;  3SYK A;  3HGI A;  3KOZ E;  1NJG A;  1DGB A;  1PM5 A;  2D7G A;  1XMO M;  2G8L A;  2DZN B;  1HQC A;  3GRU A;  4RNA A;  4DUY M;  3RE8 A;  4CIS A;  2DVW B;  1I94 M;  3CTW B;  2EA0 A;  1FNN A;  5EJC A;  3J2P B;  4DUZ M;  2UXB M;  4GIP A;  3ZCB B;  5JI2 E;  3KDS E;  2D7E A;  5E26 A;  1IN4 A;  3IG5 A;  2KZS A;  3WHL A;  1XWI A;  4MGK E;  2A5Y B;  2I7N A;  4B7F A;  2ZAN A;  2Z3X A;  8CAT A;  4G6Z A;  2KXE A;  3FUV A;  3U60 B;  1Z5C A;  3K2L A;  1IN5 A;  3AOE A;  5IRE B;  3DOA A;  3GRR A;  2C5R A;  5KO3 A;  3J81 S;  4I81 A;  1L1T A;  3DA1 A;  3HHY A;  2R18 A;  1G8P A;  4LGY A;  2BJV A;  4DR7 M;  2ZM6 M;  3SMS A;  1LV7 A;  3GQ5 A;  1TH3 A;  2C9C A;  3A42 A;  3SMP A;  4FD2 A;  2KA6 B;  4B3T M;  5FSW A;  4HLQ A;  1Q39 A;  1DGF A;  3AOG A;  3HJ8 A;  2QBY B;  1Z5B A;  5ITY A;  1QAO A;  1N77 A;  1D2N A;  2YQZ A;  3QAU A;  1ZQ9 A;  3GPU A;  2QBY A;  3U61 B;  3FUX A;  5DYG A;  2HHH M;  2YNM D;  3FYD A;  2F5P A;  2VQF M;  2Z4R A;  3FYC A;  4IBD A;  1QZM A;  3EIH A;  1G4A E;  4AKI A;  3U5Z A;  3SAR A;  5C18 A;  4G4O A;  2H1R A;  1E32 A;  5IZ7 D;  3AFH A;  3PNY A;  2X49 A;  4LJ7 A;  2UXD M;  1IY1 A;  3M6A A;  1E9R A;  4LJA A;  5LMU M;  2HKJ A;  3PXG A;  3NWL A;  3U6L A;  4TUW A;  3HKP A;  1SXJ C;  4NSO B;  3W0L B;  2F5S A;  2XSZ D;  3HHZ A;  2RKO A;  4BLC A;  2XF3 A;  4PDI A;  3HU3 A;  1FJG M;  5EXT A;  4IBC A;  3OTO M;  1WXQ A;  5FTN A;  2KRU A;  1Z59 A;  2DZO B;  4PT5 A;  1PJJ A;  2CHG A;  3TQS A;  3HU1 A;  1W5S A;  3W0F A;  7CAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...