4IIWA

2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
304
Chain Sequence
SKEKITVEIPAGSSISDISTILEDKKVINNASIFSFYVKYNNDTNLKAGNYELSPAMNTDQIVKKMQEGKTVAPAKLVIPEGYTLDQIADRIVAYQPKLKKADVLKTMDDPEFVASMIKAYPETVTNDVLNKSIKHPLEGYLYPATYTFKGTDVSAEQIITEMVKATDVNIAKYRDELTKQKMSVHKFLTMSSIIEKEATENVDRKMIASVFYNRLAKDMRLQTDPTVLYALGEHKSKTTYKDLEVDSPYNTYKNNGLPPGPISNSGDSSMEAALYPEKSDYLYFLANKVYFSKTLEEHNKLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1499 protein
publication title 2.6 Angstrom Crystal Structure of Putative yceG-like Protein lmo1499 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 83
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02618 YceG YceG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1150 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4iiwA01
4IIWA
chains in the Genus database with same CATH superfamily
1ORYB 3K9PA 3SHFA 1N78A 1WIVA 4B3MM 3GPPA 1WGNA 2GQFA 1GL6A 4PCZA 4LZJA 2WZJA 3LW5F 1T43A 3FKEA 3JR5A 1L2BA 1R7RA 2F5OA 1QZEA 1IN6A 1HNWM 1IXSB 4G6ZA 5EJCA 4DBGB 2LH0A 3BBZA 3RE8A 4IBKA 2VDBB 4LGYA 5C18A 2HL7A 1N75A 2Z8YM 4UN2B 3SARA 1IXRC 1PM5A 4NXMM 4DR3M 5IT9S 3U6EA 2QQ8A 1Z6TA 5ITTA 3I4VA 4D80A 5EP4A 4B7GA 2DWLA 4DV1M 1VDDA 3D8BA 2JA2A 1IQPA 3D8LA 4KODA 4G4NA 1R5LA 5EXSA 2MR9A 2JWSA 3K8ZA 3GQ3A 1K82A 1AUAA 3AFHA 4OVZB 4NRWA 3FUXA 4IBBA 2CUZA 5H37D 3R9XB 3U6DA 2XFSA 3K9OA 4B3SM 2JY7A 5FLXS 3W67A 4JI5M 2I7NA 4QNRA 4KT0F 1IXSA 2WSEF 3HU2A 4AI6A 3L27A 1QAMA 1WR1B 1HT2E 2QZ4A 2OQ4A 1Z5BA 1G41A 2DAIA 2HWJA 5KPZA 3KOZE 3SASA 5ITXE 3QYEA 3GPYA 4LJ9A 3KS8A 3IG8A 4PD2A 1SXJC 2R18A 3UK6A 3FUWA 3EIHA 4IBCA 1ZV1A 4DV6M 4DV2M 2DWMA 1NJFA 4ZPXA 2WSFF 1D0MA 1UFZA 1XHBA 3FTDA 2K6BA 3HHXA 4AG6A 3TWMA 3B7QA 4EIWA 4IBDA 3SC3A 4A3VB 3GLHA 3H4JA 1V34A 1PJSA 4PT5A 1XWIA 1IBLM 2QPAA 1TGUA 2R62A 1IN8A 4OVZA 3GLFB 3J2PB 2DZNB 3FD9A 3JAMS 5JI2E 5FTNA 2QSFX 3PFIA 1VEGA 3I04M 1Q39A 2KA6B 2G5GX 4OU7A 4JXJA 4PDGA 3L2AA 2C98A 4GC5A 3NBIA 5EXPA 1TDHA 3HKPA 1EE8A 3HZJA 4CHTB 2DI0A 2FH0A 3KOWE 3U6CA 3GQ4A 3T38A 2Y21A 2DVWB 4IBEA 5ITXA 1R2ZA 5F3WA 1HNZM 4XGIA 4GHLA 3GLGB 3WHKA 3MJ5A 2N35A 5EP2A 3PNVA 1IY1A 4LG2A 4LJAA 1QYRA 4M9ZA 3SHGB 1W5TA 4Y28F 3GLIE 2QBYA 1TR8A 4WW0A 4LCBA 5E6JA 2ZANA 2LWXA 3B7ZA 3TQSA 1XNRM 1IY2A 4JI6M 2ZM6M 1YSYA 1GJTA 5IZ7D 3A98B 1HT1E 4DV0M 3ZCBB 4M9XA 2F5QA 1TH2A 3WHLA 2R46A 4LF4M 1D0LA 1NV9A 2EKKA 3HU1A 2GNOA 2CV2A 3QAUA 1Q3CA 3NWLA 4DR7M 4NC6A 3THGA 4HLQA 5BR8M 3FRIA 7CATA 4LRTA 4HL4A 1L8QA 3KVWA 1GABA 3AV0A 2CHVA 2JY6B 1OJLA 4LZZA 5DYGA 4NRVA 1H6UA 4IBFA 2DAGA 4YHHM 2CV0A 3KDSE 3FYDA 3GRVA 4FCTA 4LFBM 1IM2A 1KSFX 2L7HA 3M0EA 4KO8A 3HJ8A 5EXTA 4X64M 3SAUA 3U61A 4LF5M 1WGLA 2Z4RA 3L26A 1NY5A 1SXJA 1DO2A 5EP3A 2L2DA 1DGHB 3RGPA 4L78A 2HHHM 4TUWA 2XFTA 1YE9A 1GVNA 4LF7M 2JY5A 5JI3E 2VF8A 4Z6YA 1QANA 5LMUM 5L8RF 2DHYA 1F4IA 2HKJA 4MGZE 2BJWA 1K3WA 4XK8F 2ZTCA 1D2NA 4ITQA 4IBJA 2J7OA 1Z5CA 3GP1A 1NV8A 3I01M 2I7PA 3LVVA 5E26A 3VKGA 4DR4M 4LJ8A 3FE3A 1CUKA 4I5SA 2DAKA 2L4FA 2XSZA 3BXWA 3HWSA 4LJ4A 3VDUA 2VQEM 2BWBA 1MN3A 4P17A 3VLFB 2JZ1A 2BJVA 4ANRA 2OOAA 5ITUA 2XH9A 2D7HA 4XBOA 3KOXE 3TL4X 1DO0A 3VDPA 1OTRA 3AOEC 2EUCA 4KHPM 2YNMD 4MGHA 1XXHA 4CIZA 2XZFA 3KS4A 5BPVA 4NXNM 4NSOB 1E9SA 2LVQD 2F4VM 3GLHE 3TWLA 1I4WA 1T3TA 1AIPC 2R0IA 1VDLA 4L15A 4RKUF 4DR5M 3KW6A 1V92A 2JZ0A 4B08A 1OFHA 5ITQA 3MK6A 4DR6M 1GLNA 2KNVA 1C1KA 2ZBKB 3HHYA 3NBXX 2BWEA 3A45A 3PXGA 3U6MA 1T6OA 1XMQM 1L1TA 3FTEA 3AKZA 1WHCA 1FNNA 3J27B 1R6BX 3I4YA 3KXEC 1JR3E 2LHGA 5KQDA 2UUCM 1Q02A 2LVNC 4JN6A 4LGMA 2KNZA 4MGYE 1IN4A 2RGOA 1HQYE 1QDRA 4IJFA 3SAWA 2UXDM 1Z5AA 4FVMA 2MH8A 3U6OA 1KYIA 4CJ6A 3FTCA 3GO8A 3AL0C 3BOSA 2KZUA 3KSXA 1IN5A 1TH3A 1J09A 3VFDA 2DNAA 4IJEA 4GHAA 4NOOB 3E9SA 5IREB 2Z3XA 3JR4A 1LTMA 1QUTA 2DZLA 3CF2A 1QVRA 3J80S 1HNXM 5KPRA 4AKIA 3QWLA 4L6V6 4X66M 1W5SA 5FTLA 2OPFA 2KDLA 3CGWA 4LJ6A 3GLFE 4L8RC 2FFJA 1DV0A 3LQQA 4G4OA 2DENA 2YQZA 3M6AA 4RNAA 2KHHA 1JR3A 2APLA 2B3TA 1OIZA 4GKJM 3B74A 2OOBA 2X4AA 1GJSA 1IFYA 1Y8GA 1Q3BA 1IY0A 4DV5M 2O25A 4DV3M 3U60B 2DHRA 3E21A 2R45A 3LCVB 1Z59A 2KEBA 1WJ7A 3L25A 1I94M 2XGNA 1XNQM 3HX3A 1NO1A 2YFQA 4I81A 4NSRA 4MB7A 1NSFA 4B7FA 3A42A 2CE7A 2CRUA 3LMMA 1TTEA 3W0LB 1SXJE 2DAMA 3AOEA 2CP8A 4REZA 1G4AE 2R65A 4G4QA 3U5ZB 2LVOC 3GLFA 2FNAA 3B9PA 1S3SA 1E9RA 5ITRA 5EP1A 2UU9M 1VG5A 3TPZA 1NY6A 2UXBM 1TF0B 3E46A 4QHSA 2E5LM 3CF6E 2L4EA 3KP1E 4OX9M 3KFUG 4AKGA 4KLNA 1PJQA 3VK8A 4L4UA 2XZUA 1PJJA 2J5YA 3HGIA 5DNYA 2R6FA 3GLIB 4R71A 1HJPA 1SG9A 2C99A 2VQFM 4Q7JA 4BBAA 3GLGA 2WSCF 2CFOA 5EQTA 3HU3A 2EJSA 4GH9A 1V33A 2JXNA 3B89A 4G3OA 3SATA 2M5ZA 2NQ8C 4I4LA 1OFIA 2XF3A 4GIPA 1PGYA 2V1UA 3UJNA 4BB9A 3C9PA 1RU3A 3ILKA 1MU5A 2KXEA 1SXJD 2X49A 3IECA 5LMNM 4JI7M 3OTOM 3FUUA 2QCUA 3GRUA 4LJ7A 4F2LA 2L6OA 3RGSA 2UUAM 1XXHE 1KFVA 2R44A 5KO3A 1NVMA 5DYIA 3GRYA 4DUZM 4X62M 1N34M 2CWBA 4R3DA 3ZC7B 3SYKA 4AW4A 1OAIA 2R4EA 3GPXA 2A5YB 3PVSA 4MH0E 2FOIC 2F5PA 3J81S 1PJTA 3SAVA 3SMSA 3AJIB 4AQYM 3QYBA 2Y0QA 2KRUA 1VEJA 2QP9X 5KQ8A 1L2CA 3C3DA 3W0FA 2LHCA 4M9SA 5C1BA 1G8PA 4G4RA 3MMPA 1R2YA 3SFZA 1G59A 2DWNA 2RGHA 5GKNA 2ZAOA 1WXQA 4FD2A 2JP7A 3GRRA 4IBGA 4FW9A 1DGHA 4JI2M 2JUJA 3HJSA 2RRUA 3LQRA 2Y0TA 4B7HA 4B3TM 3TWKA 4II7A 2F5NA 2F5SA 4LF8M 4AG5A 1GO5A 4FWHA 1NNUC 1UM8A 4OW0A 2X8AA 1N36M 1E32A 3E4RA 1XB2B 3KOYE 2V1CA 5FTJA 1HR0M 4JI3M 5ITYA 2ERCA 4P16A 3L28A 4QNMA 1TDZA 4D81A 3B7NA 1YLAA 2KRKA 4B3RM 1ZAEA 1DGBA 3CF0A 1XC8A 1FJGM 1VQ1A 2C9OA 3DA1A 4GC9A 4QHTA 3IHPA 4WURA 4JI0M 2Z4SA 1L1ZA 3GLHB 4JI1M 1DGFA 2LNHC 1GKIA 3C58A 2JNHA 2Y20A 3HHWA 3C3EA 2L7IA 4LF6M 2ZAMA 2C5RA 2CHQA 3FRHA 3L29A 4GEWA 2O5RA 4MGKE 3HY5A 3U6LA 1QDTA 5DFLA 3KSJA 4YY3M 1HQCA 2FS1A 4GITA 3K2LA 3W68A 4IBIA 2DWZB 4FCVA 3SMPA 4GRIA 4LJ5A 8CATA 3K1JA 3KP0E 2UUBM 2V6ZM 4QOZC 1QAQA 5FTMA 3MHVC 1IBKM 2J7NA 1JB0F 2G3QA 1ZMUA 2L09A 3ZH9B 1JR3D 2JY8A 3GQ5A 3EIEA 3J7AS 2K0BX 2HAKA 2BNKA 2LXEA 4FWGA 4HEOA 4CGYB 1PRBA 4K0KM 2D7GA 1E94E 3TE6A 3V76A 1L2DA 3VKHA 3Q8XA 2QBYB 5IWAM 3UZUA 2QHOB 4F1IA 2XEPA 3GLGE 2C9CA 4RF1A 1QZMA 3DFZA 1MJGM 1TH4A 4FWDA 2M60A 2QENA 2C96A 1MX0A 4LF9M 3UMMA 1YUBA 1R4GA 3I51A 1IXZA 1LV7A 2MJ5B 1OIPA 1N77A 3VK7A 3FTFA 1J7KA 2D7EA 1ZMVA 1X37A 3HJQA 3FYCA 4R7GA 4JV5M 3U6QA 3T6PA 3FUTA 2R4JA 4FCWA 3U6PA 3K92A 1G71A 1J5EM 2QNJA 3UGJA 2EO2A 1EFUB 1ZMWA 4S12A 1BVSA 3SBJA 2KZSA 2DAEA 2FE8A 3DOAA 1QQWA 3LVWA 3Q8GA 5EXXA 3ZQJA 3HHZA 4GKKM 2K9DA 5FTKA 1D0KA 2G8LA 1GL7A 1QUSA 2RKOA 3U60A 4CISA 4X65M 3U61B 1EIJA 1PJIA 3AOGA 1SXJB 4LRSA 4W5WA 1K3XA 3H4MA 4GMQA 4MM3B 1N32M 4DR2M 3IG5A 4L16A 1NJGA 4DV4M 3CTWB 3PNYA 4LFAM 2UXCM 4DV7M 1A5TA 3RFWA 5A2QS 1QAOA 1OKSA 3GPUA 4D82A 1XMOM 1G3IA 2Z7JA 4LFCM 4LY6A 2DKLA 2DXIA 2O01F 4JYAM 1ZQ9A 3M7GA 4Z8XA 3T1HM 3U5ZA 2W82A 3J7BA 2LVAA 3LCUA 4NL4H 1IBMM 4JI4M 2H1RA 1NHGC 2P5TA 2XLJA 4WP2A 2KW0A 2MROB 4BLCA 4M0DA 2OO9A 1NHWC 1N33M 1NNJA 2LVPC 3U6SA 3F92A 1C7YA 2VF7A 2EKFA 4QOSA 1P3QQ 2KNAA 3SYLA 2DZOB 4PDIA 1DGGA 3DZDA 2YR0A 3GLIA 3FUVA 2EA0A 4DUYM 2VIIA 4JI8M 2ZTDA 5KPTA 4DR1M 3R8FA 2K47A 3A46A 3T15A 2LTUA 2LBCA 2XSZD 3T1YM 2Q2EB 2CV1A 2HCBA 5FSWA 2CHGA 2AHMA 2H5XA 1XXHB 1VEKA 4I8OA 4MGIE 2MGWA 1OAOC 1OQYA 4RF0A 2CEAA 1IN7A 4AKHA 4AZFA 1JQJC 4IIWA 4M0WA
chains in the Genus database with same CATH topology
1ORYB 3SHFA 1N78A 4B3MM 3GPPA 1GL6A 4PCZA 4LZJA 3JR5A 3FKEA 1L2BA 1R7RA 2F5OA 1IN6A 1HNWM 1IXSB 4G6ZA 5EJCA 2LH0A 3RE8A 4IBKA 4LGYA 5C18A 2HL7A 1N75A 3SARA 4NXMM 1IXRC 1PM5A 4DR3M 5IT9S 3U6EA 1Z6TA 5ITTA 3I4VA 4D80A 5EP4A 4B7GA 2DWLA 4DV1M 1VDDA 3D8BA 2JA2A 1IQPA 3D8LA 4KODA 4G4NA 5EXSA 3K8ZA 3GQ3A 1K82A 3AFHA 4OVZB 4NRWA 3FUXA 4IBBA 2CUZA 5H37D 3R9XB 3U6DA 2XFSA 4B3SM 5FLXS 4JI5M 2I7NA 4QNRA 3HU2A 4AI6A 3L27A 1QAMA 1HT2E 2QZ4A 2OQ4A 1Z5BA 1G41A 5KPZA 3KOZE 3SASA 5ITXE 3GPYA 4LJ9A 3KS8A 3IG8A 4PD2A 1SXJC 2R18A 3UK6A 3FUWA 3EIHA 4IBCA 4DV6M 2DWMA 4DV2M 1NJFA 4ZPXA 3FTDA 1XHBA 4AG6A 3TWMA 3HHXA 4EIWA 4IBDA 3SC3A 4A3VB 3GLHA 4PT5A 1XWIA 1IBLM 2QPAA 1TGUA 2R62A 1IN8A 4OVZA 3GLFB 3J2PB 2DZNB 3FD9A 3JAMS 5JI2E 5FTNA 3PFIA 1Q39A 2KA6B 2G5GX 4OU7A 4JXJA 4PDGA 3L2AA 2C98A 4GC5A 3NBIA 5EXPA 1TDHA 3HKPA 1EE8A 4CHTB 3KOWE 3U6CA 3GQ4A 3T38A 2Y21A 2DVWB 4IBEA 5ITXA 1R2ZA 5F3WA 1HNZM 4XGIA 4GHLA 3GLGB 3WHKA 3MJ5A 5EP2A 3PNVA 1IY1A 4LG2A 4LJAA 1QYRA 4M9ZA 3SHGB 1W5TA 2QBYA 4WW0A 4LCBA 5E6JA 2ZANA 2LWXA 3TQSA 1XNRM 1IY2A 4JI6M 2ZM6M 1YSYA 5IZ7D 3A98B 1HT1E 4DV0M 3ZCBB 4M9XA 2F5QA 1TH2A 3WHLA 2R46A 4LF4M 3HU1A 2CV2A 3QAUA 1Q3CA 3NWLA 4DR7M 3THGA 4HLQA 5BR8M 7CATA 4LRTA 4HL4A 1L8QA 3KVWA 3AV0A 2CHVA 1OJLA 4LZZA 5DYGA 4NRVA 1H6UA 4IBFA 2CV0A 4YHHM 3KDSE 3FYDA 3GRVA 4FCTA 4LFBM 1IM2A 1KSFX 2L7HA 3M0EA 4KO8A 3HJ8A 5EXTA 4X64M 3SAUA 3U61A 4LF5M 2Z4RA 3L26A 1NY5A 1SXJA 1DO2A 5EP3A 1DGHB 3RGPA 4L78A 2HHHM 4TUWA 2XFTA 1YE9A 1GVNA 4LF7M 5JI3E 4Z6YA 1QANA 5LMUM 2HKJA 4MGZE 2BJWA 1K3WA 1D2NA 4ITQA 4IBJA 2J7OA 1Z5CA 3GP1A 3LVVA 2I7PA 5E26A 3VKGA 4DR4M 4LJ8A 4I5SA 2XSZA 4LJ4A 3HWSA 3VDUA 2VQEM 3VLFB 2BJVA 5ITUA 2XH9A 2D7HA 4XBOA 3KOXE 3TL4X 1DO0A 3VDPA 3AOEC 2EUCA 4KHPM 2YNMD 4MGHA 1XXHA 2XZFA 3KS4A 5BPVA 4NXNM 4NSOB 1E9SA 2F4VM 3TWLA 1I4WA 1T3TA 4DR5M 4L15A 3KW6A 4B08A 1OFHA 5ITQA 3MK6A 4DR6M 1GLNA 1C1KA 2ZBKB 3HHYA 3U6MA 1XMQM 3A45A 3PXGA 1L1TA 3FTEA 3AKZA 1FNNA 3J27B 1R6BX 3I4YA 3KXEC 5KQDA 2UUCM 4JN6A 4LGMA 4MGYE 1IN4A 2RGOA 1HQYE 3SAWA 4IJFA 2UXDM 1Z5AA 4FVMA 3U6OA 1KYIA 3FTCA 3GO8A 3AL0C 3BOSA 2KZUA 3KSXA 1IN5A 1TH3A 1J09A 3VFDA 4IJEA 4GHAA 4NOOB 3E9SA 5IREB 2Z3XA 3JR4A 3CF2A 1QVRA 3J80S 1HNXM 5KPRA 4AKIA 3QWLA 4X66M 1W5SA 5FTLA 2OPFA 4LJ6A 4L8RC 2FFJA 3LQQA 4G4OA 2YQZA 3M6AA 4RNAA 1JR3A 4GKJM 2X4AA 1Q3BA 1IY0A 4DV5M 4DV3M 3U60B 2DHRA 2R45A 1Z59A 2KEBA 3L25A 2XGNA 1XNQM 2YFQA 4I81A 4NSRA 4MB7A 1NSFA 4B7FA 3A42A 2CE7A 3LMMA 3W0LB 1SXJE 3AOEA 4REZA 1G4AE 2R65A 4G4QA 3U5ZB 3GLFA 2FNAA 3B9PA 1S3SA 1E9RA 5ITRA 5EP1A 2UU9M 3TPZA 1NY6A 2UXBM 4QHSA 2E5LM 3CF6E 3KP1E 4OX9M 3KFUG 4AKGA 4KLNA 3VK8A 4L4UA 2XZUA 1PJJA 3HGIA 5DNYA 3GLIB 2C99A 2VQFM 4BBAA 3GLGA 2CFOA 5EQTA 3HU3A 4GH9A 3SATA 2M5ZA 2NQ8C 4I4LA 1OFIA 2XF3A 4GIPA 2V1UA 3UJNA 4BB9A 3ILKA 1MU5A 2KXEA 1SXJD 2X49A 5LMNM 4JI7M 3OTOM 3FUUA 2QCUA 3GRUA 4LJ7A 2L6OA 3RGSA 2UUAM 1KFVA 5KO3A 1NVMA 5DYIA 3GRYA 4DUZM 4X62M 1N34M 4R3DA 3ZC7B 3SYKA 4AW4A 2R4EA 3GPXA 2A5YB 3PVSA 4MH0E 2FOIC 2F5PA 3J81S 3SAVA 3SMSA 3AJIB 4AQYM 2Y0QA 2KRUA 2QP9X 5KQ8A 1L2CA 3W0FA 4M9SA 5C1BA 1G8PA 4G4RA 1R2YA 1G59A 3SFZA 2DWNA 2RGHA 5GKNA 2ZAOA 1WXQA 4FD2A 3GRRA 4IBGA 4FW9A 1DGHA 4JI2M 3HJSA 3LQRA 2Y0TA 4B7HA 4B3TM 3TWKA 4II7A 2F5NA 2F5SA 4LF8M 4AG5A 4FWHA 1NNUC 1UM8A 4OW0A 2X8AA 1N36M 1E32A 3E4RA 1HR0M 3KOYE 2V1CA 5FTJA 4JI3M 5ITYA 2ERCA 4P16A 3L28A 4QNMA 1TDZA 4D81A 2KRKA 4B3RM 1ZAEA 1DGBA 3CF0A 1XC8A 1FJGM 3DA1A 2C9OA 4GC9A 4QHTA 4WURA 4JI0M 1L1ZA 2Z4SA 3GLHB 4JI1M 1DGFA 2LNHC 1GKIA 3C58A 2Y20A 3HHWA 2L7IA 4LF6M 2ZAMA 2C5RA 2CHQA 3L29A 2O5RA 4MGKE 3U6LA 3KSJA 4YY3M 1HQCA 4GITA 3K2LA 4IBIA 2DWZB 4FCVA 3SMPA 4GRIA 4LJ5A 8CATA 3K1JA 3KP0E 2UUBM 2V6ZM 4QOZC 1QAQA 5FTMA 3MHVC 1IBKM 2J7NA 2L09A 3ZH9B 1JR3D 3GQ5A 3EIEA 3J7AS 2BNKA 2LXEA 4FWGA 4CGYB 4K0KM 2D7GA 1E94E 3TE6A 1L2DA 3VKHA 3Q8XA 2QBYB 5IWAM 3UZUA 2XEPA 2C9CA 4RF1A 1QZMA 3DFZA 1TH4A 4FWDA 2M60A 2QENA 2C96A 1MX0A 4LF9M 3UMMA 1YUBA 3I51A 1IXZA 1LV7A 1N77A 3VK7A 3FTFA 1J7KA 2D7EA 1X37A 3HJQA 3FYCA 4R7GA 4JV5M 3U6QA 3FUTA 2R4JA 4FCWA 3U6PA 3K92A 1J5EM 3UGJA 2EO2A 4S12A 3SBJA 1I94M 2KZSA 3LVWA 2FE8A 3DOAA 1QQWA 5EXXA 4GKKM 3HHZA 5FTKA 2G8LA 1GL7A 2RKOA 3U60A 4CISA 4X65M 3U61B 1PJIA 3AOGA 1SXJB 4LRSA 4W5WA 1K3XA 3H4MA 4GMQA 4MM3B 1N32M 4DR2M 3IG5A 4L16A 1NJGA 4DV4M 3CTWB 3PNYA 4LFAM 2UXCM 4DV7M 5A2QS 3RFWA 1QAOA 3GPUA 1XMOM 4D82A 1G3IA 2Z7JA 4LFCM 4LY6A 2DXIA 4JYAM 1ZQ9A 3M7GA 4Z8XA 3T1HM 3U5ZA 2W82A 3J7BA 4NL4H 1IBMM 4JI4M 2H1RA 1NHGC 2P5TA 2XLJA 2KW0A 4BLCA 4M0DA 1N33M 1NHWC 1NNJA 3U6SA 4QOSA 3SYLA 4PDIA 2EA0A 2DZOB 4DUYM 1DGGA 3DZDA 2YR0A 3GLIA 3FUVA 2VIIA 4JI8M 5KPTA 4DR1M 3R8FA 2K47A 3A46A 3T15A 2XSZD 3T1YM 2Q2EB 2CV1A 2HCBA 5FSWA 2CHGA 2AHMA 1XXHB 4MGIE 4I8OA 4RF0A 2CEAA 1IN7A 4AKHA 4AZFA 1JQJC 4IIWA 4M0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIW A; 
#chains in the Genus database with same CATH topology
 1ORY B;  3K9P A;  3SHF A;  1N78 A;  1WIV A;  4B3M M;  3GPP A;  1WGN A;  2GQF A;  1GL6 A;  4PCZ A;  4LZJ A;  2WZJ A;  3LW5 F;  1T43 A;  3FKE A;  3JR5 A;  1L2B A;  1R7R A;  2F5O A;  1QZE A;  1IN6 A;  1HNW M;  1IXS B;  4G6Z A;  5EJC A;  4DBG B;  2LH0 A;  3BBZ A;  3RE8 A;  4IBK A;  2VDB B;  4LGY A;  5C18 A;  2HL7 A;  1N75 A;  2Z8Y M;  4UN2 B;  3SAR A;  1IXR C;  1PM5 A;  4NXM M;  4DR3 M;  5IT9 S;  3U6E A;  2QQ8 A;  1Z6T A;  5ITT A;  3I4V A;  4D80 A;  5EP4 A;  4B7G A;  2DWL A;  4DV1 M;  1VDD A;  3D8B A;  2JA2 A;  1IQP A;  3D8L A;  4KOD A;  4G4N A;  1R5L A;  5EXS A;  2MR9 A;  2JWS A;  3K8Z A;  3GQ3 A;  1K82 A;  1AUA A;  3AFH A;  4OVZ B;  4NRW A;  3FUX A;  4IBB A;  2CUZ A;  5H37 D;  3R9X B;  3U6D A;  2XFS A;  3K9O A;  4B3S M;  2JY7 A;  5FLX S;  3W67 A;  4JI5 M;  2I7N A;  4QNR A;  4KT0 F;  1IXS A;  2WSE F;  3HU2 A;  4AI6 A;  3L27 A;  1QAM A;  1WR1 B;  1HT2 E;  2QZ4 A;  2OQ4 A;  1Z5B A;  1G41 A;  2DAI A;  2HWJ A;  5KPZ A;  3KOZ E;  3SAS A;  5ITX E;  3QYE A;  3GPY A;  4LJ9 A;  3KS8 A;  3IG8 A;  4PD2 A;  1SXJ C;  2R18 A;  3UK6 A;  3FUW A;  3EIH A;  4IBC A;  1ZV1 A;  4DV6 M;  4DV2 M;  2DWM A;  1NJF A;  4ZPX A;  2WSF F;  1D0M A;  1UFZ A;  1XHB A;  3FTD A;  2K6B A;  3HHX A;  4AG6 A;  3TWM A;  3B7Q A;  4EIW A;  4IBD A;  3SC3 A;  4A3V B;  3GLH A;  3H4J A;  1V34 A;  1PJS A;  4PT5 A;  1XWI A;  1IBL M;  2QPA A;  1TGU A;  2R62 A;  1IN8 A;  4OVZ A;  3GLF B;  3J2P B;  2DZN B;  3FD9 A;  3JAM S;  5JI2 E;  5FTN A;  2QSF X;  3PFI A;  1VEG A;  3I04 M;  1Q39 A;  2KA6 B;  2G5G X;  4OU7 A;  4JXJ A;  4PDG A;  3L2A A;  2C98 A;  4GC5 A;  3NBI A;  5EXP A;  1TDH A;  3HKP A;  1EE8 A;  3HZJ A;  4CHT B;  2DI0 A;  2FH0 A;  3KOW E;  3U6C A;  3GQ4 A;  3T38 A;  2Y21 A;  2DVW B;  4IBE A;  5ITX A;  1R2Z A;  5F3W A;  1HNZ M;  4XGI A;  4GHL A;  3GLG B;  3WHK A;  3MJ5 A;  2N35 A;  5EP2 A;  3PNV A;  1IY1 A;  4LG2 A;  4LJA A;  1QYR A;  4M9Z A;  3SHG B;  1W5T A;  4Y28 F;  3GLI E;  2QBY A;  1TR8 A;  4WW0 A;  4LCB A;  5E6J A;  2ZAN A;  2LWX A;  3B7Z A;  3TQS A;  1XNR M;  1IY2 A;  4JI6 M;  2ZM6 M;  1YSY A;  1GJT A;  5IZ7 D;  3A98 B;  1HT1 E;  4DV0 M;  3ZCB B;  4M9X A;  2F5Q A;  1TH2 A;  3WHL A;  2R46 A;  4LF4 M;  1D0L A;  1NV9 A;  2EKK A;  3HU1 A;  2GNO A;  2CV2 A;  3QAU A;  1Q3C A;  3NWL A;  4DR7 M;  4NC6 A;  3THG A;  4HLQ A;  5BR8 M;  3FRI A;  7CAT A;  4LRT A;  4HL4 A;  1L8Q A;  3KVW A;  1GAB A;  3AV0 A;  2CHV A;  2JY6 B;  1OJL A;  4LZZ A;  5DYG A;  4NRV A;  1H6U A;  4IBF A;  2DAG A;  4YHH M;  2CV0 A;  3KDS E;  3FYD A;  3GRV A;  4FCT A;  4LFB M;  1IM2 A;  1KSF X;  2L7H A;  3M0E A;  4KO8 A;  3HJ8 A;  5EXT A;  4X64 M;  3SAU A;  3U61 A;  4LF5 M;  1WGL A;  2Z4R A;  3L26 A;  1NY5 A;  1SXJ A;  1DO2 A;  5EP3 A;  2L2D A;  1DGH B;  3RGP A;  4L78 A;  2HHH M;  4TUW A;  2XFT A;  1YE9 A;  1GVN A;  4LF7 M;  2JY5 A;  5JI3 E;  2VF8 A;  4Z6Y A;  1QAN A;  5LMU M;  5L8R F;  2DHY A;  1F4I A;  2HKJ A;  4MGZ E;  2BJW A;  1K3W A;  4XK8 F;  2ZTC A;  1D2N A;  4ITQ A;  4IBJ A;  2J7O A;  1Z5C A;  3GP1 A;  1NV8 A;  3I01 M;  2I7P A;  3LVV A;  5E26 A;  3VKG A;  4DR4 M;  4LJ8 A;  3FE3 A;  1CUK A;  4I5S A;  2DAK A;  2L4F A;  2XSZ A;  3BXW A;  3HWS A;  4LJ4 A;  3VDU A;  2VQE M;  2BWB A;  1MN3 A;  4P17 A;  3VLF B;  2JZ1 A;  2BJV A;  4ANR A;  2OOA A;  5ITU A;  2XH9 A;  2D7H A;  4XBO A;  3KOX E;  3TL4 X;  1DO0 A;  3VDP A;  1OTR A;  3AOE C;  2EUC A;  4KHP M;  2YNM D;  4MGH A;  1XXH A;  4CIZ A;  2XZF A;  3KS4 A;  5BPV A;  4NXN M;  4NSO B;  1E9S A;  2LVQ D;  2F4V M;  3GLH E;  3TWL A;  1I4W A;  1T3T A;  1AIP C;  2R0I A;  1VDL A;  4L15 A;  4RKU F;  4DR5 M;  3KW6 A;  1V92 A;  2JZ0 A;  4B08 A;  1OFH A;  5ITQ A;  3MK6 A;  4DR6 M;  1GLN A;  2KNV A;  1C1K A;  2ZBK B;  3HHY A;  3NBX X;  2BWE A;  3A45 A;  3PXG A;  3U6M A;  1T6O A;  1XMQ M;  1L1T A;  3FTE A;  3AKZ A;  1WHC A;  1FNN A;  3J27 B;  1R6B X;  3I4Y A;  3KXE C;  1JR3 E;  2LHG A;  5KQD A;  2UUC M;  1Q02 A;  2LVN C;  4JN6 A;  4LGM A;  2KNZ A;  4MGY E;  1IN4 A;  2RGO A;  1HQY E;  1QDR A;  4IJF A;  3SAW A;  2UXD M;  1Z5A A;  4FVM A;  2MH8 A;  3U6O A;  1KYI A;  4CJ6 A;  3FTC A;  3GO8 A;  3AL0 C;  3BOS A;  2KZU A;  3KSX A;  1IN5 A;  1TH3 A;  1J09 A;  3VFD A;  2DNA A;  4IJE A;  4GHA A;  4NOO B;  3E9S A;  5IRE B;  2Z3X A;  3JR4 A;  1LTM A;  1QUT A;  2DZL A;  3CF2 A;  1QVR A;  3J80 S;  1HNX M;  5KPR A;  4AKI A;  3QWL A;  4L6V 6;  4X66 M;  1W5S A;  5FTL A;  2OPF A;  2KDL A;  3CGW A;  4LJ6 A;  3GLF E;  4L8R C;  2FFJ A;  1DV0 A;  3LQQ A;  4G4O A;  2DEN A;  2YQZ A;  3M6A A;  4RNA A;  2KHH A;  1JR3 A;  2APL A;  2B3T A;  1OIZ A;  4GKJ M;  3B74 A;  2OOB A;  2X4A A;  1GJS A;  1IFY A;  1Y8G A;  1Q3B A;  1IY0 A;  4DV5 M;  2O25 A;  4DV3 M;  3U60 B;  2DHR A;  3E21 A;  2R45 A;  3LCV B;  1Z59 A;  2KEB A;  1WJ7 A;  3L25 A;  1I94 M;  2XGN A;  1XNQ M;  3HX3 A;  1NO1 A;  2YFQ A;  4I81 A;  4NSR A;  4MB7 A;  1NSF A;  4B7F A;  3A42 A;  2CE7 A;  2CRU A;  3LMM A;  1TTE A;  3W0L B;  1SXJ E;  2DAM A;  3AOE A;  2CP8 A;  4REZ A;  1G4A E;  2R65 A;  4G4Q A;  3U5Z B;  2LVO C;  3GLF A;  2FNA A;  3B9P A;  1S3S A;  1E9R A;  5ITR A;  5EP1 A;  2UU9 M;  1VG5 A;  3TPZ A;  1NY6 A;  2UXB M;  1TF0 B;  3E46 A;  4QHS A;  2E5L M;  3CF6 E;  2L4E A;  3KP1 E;  4OX9 M;  3KFU G;  4AKG A;  4KLN A;  1PJQ A;  3VK8 A;  4L4U A;  2XZU A;  1PJJ A;  2J5Y A;  3HGI A;  5DNY A;  2R6F A;  3GLI B;  4R71 A;  1HJP A;  1SG9 A;  2C99 A;  2VQF M;  4Q7J A;  4BBA A;  3GLG A;  2WSC F;  2CFO A;  5EQT A;  3HU3 A;  2EJS A;  4GH9 A;  1V33 A;  2JXN A;  3B89 A;  4G3O A;  3SAT A;  2M5Z A;  2NQ8 C;  4I4L A;  1OFI A;  2XF3 A;  4GIP A;  1PGY A;  2V1U A;  3UJN A;  4BB9 A;  3C9P A;  1RU3 A;  3ILK A;  1MU5 A;  2KXE A;  1SXJ D;  2X49 A;  3IEC A;  5LMN M;  4JI7 M;  3OTO M;  3FUU A;  2QCU A;  3GRU A;  4LJ7 A;  4F2L A;  2L6O A;  3RGS A;  2UUA M;  1XXH E;  1KFV A;  2R44 A;  5KO3 A;  1NVM A;  5DYI A;  3GRY A;  4DUZ M;  4X62 M;  1N34 M;  2CWB A;  4R3D A;  3ZC7 B;  3SYK A;  4AW4 A;  1OAI A;  2R4E A;  3GPX A;  2A5Y B;  3PVS A;  4MH0 E;  2FOI C;  2F5P A;  3J81 S;  1PJT A;  3SAV A;  3SMS A;  3AJI B;  4AQY M;  3QYB A;  2Y0Q A;  2KRU A;  1VEJ A;  2QP9 X;  5KQ8 A;  1L2C A;  3C3D A;  3W0F A;  2LHC A;  4M9S A;  5C1B A;  1G8P A;  4G4R A;  3MMP A;  1R2Y A;  3SFZ A;  1G59 A;  2DWN A;  2RGH A;  5GKN A;  2ZAO A;  1WXQ A;  4FD2 A;  2JP7 A;  3GRR A;  4IBG A;  4FW9 A;  1DGH A;  4JI2 M;  2JUJ A;  3HJS A;  2RRU A;  3LQR A;  2Y0T A;  4B7H A;  4B3T M;  3TWK A;  4II7 A;  2F5N A;  2F5S A;  4LF8 M;  4AG5 A;  1GO5 A;  4FWH A;  1NNU C;  1UM8 A;  4OW0 A;  2X8A A;  1N36 M;  1E32 A;  3E4R A;  1XB2 B;  3KOY E;  2V1C A;  5FTJ A;  1HR0 M;  4JI3 M;  5ITY A;  2ERC A;  4P16 A;  3L28 A;  4QNM A;  1TDZ A;  4D81 A;  3B7N A;  1YLA A;  2KRK A;  4B3R M;  1ZAE A;  1DGB A;  3CF0 A;  1XC8 A;  1FJG M;  1VQ1 A;  2C9O A;  3DA1 A;  4GC9 A;  4QHT A;  3IHP A;  4WUR A;  4JI0 M;  2Z4S A;  1L1Z A;  3GLH B;  4JI1 M;  1DGF A;  2LNH C;  1GKI A;  3C58 A;  2JNH A;  2Y20 A;  3HHW A;  3C3E A;  2L7I A;  4LF6 M;  2ZAM A;  2C5R A;  2CHQ A;  3FRH A;  3L29 A;  4GEW A;  2O5R A;  4MGK E;  3HY5 A;  3U6L A;  1QDT A;  5DFL A;  3KSJ A;  4YY3 M;  1HQC A;  2FS1 A;  4GIT A;  3K2L A;  3W68 A;  4IBI A;  2DWZ B;  4FCV A;  3SMP A;  4GRI A;  4LJ5 A;  8CAT A;  3K1J A;  3KP0 E;  2UUB M;  2V6Z M;  4QOZ C;  1QAQ A;  5FTM A;  3MHV C;  1IBK M;  2J7N A;  1JB0 F;  2G3Q A;  1ZMU A;  2L09 A;  3ZH9 B;  1JR3 D;  2JY8 A;  3GQ5 A;  3EIE A;  3J7A S;  2K0B X;  2HAK A;  2BNK A;  2LXE A;  4FWG A;  4HEO A;  4CGY B;  1PRB A;  4K0K M;  2D7G A;  1E94 E;  3TE6 A;  3V76 A;  1L2D A;  3VKH A;  3Q8X A;  2QBY B;  5IWA M;  3UZU A;  2QHO B;  4F1I A;  2XEP A;  3GLG E;  2C9C A;  4RF1 A;  1QZM A;  3DFZ A;  1MJG M;  1TH4 A;  4FWD A;  2M60 A;  2QEN A;  2C96 A;  1MX0 A;  4LF9 M;  3UMM A;  1YUB A;  1R4G A;  3I51 A;  1IXZ A;  1LV7 A;  2MJ5 B;  1OIP A;  1N77 A;  3VK7 A;  3FTF A;  1J7K A;  2D7E A;  1ZMV A;  1X37 A;  3HJQ A;  3FYC A;  4R7G A;  4JV5 M;  3U6Q A;  3T6P A;  3FUT A;  2R4J A;  4FCW A;  3U6P A;  3K92 A;  1G71 A;  1J5E M;  2QNJ A;  3UGJ A;  2EO2 A;  1EFU B;  1ZMW A;  4S12 A;  1BVS A;  3SBJ A;  2KZS A;  2DAE A;  2FE8 A;  3DOA A;  1QQW A;  3LVW A;  3Q8G A;  5EXX A;  3ZQJ A;  3HHZ A;  4GKK M;  2K9D A;  5FTK A;  1D0K A;  2G8L A;  1GL7 A;  1QUS A;  2RKO A;  3U60 A;  4CIS A;  4X65 M;  3U61 B;  1EIJ A;  1PJI A;  3AOG A;  1SXJ B;  4LRS A;  4W5W A;  1K3X A;  3H4M A;  4GMQ A;  4MM3 B;  1N32 M;  4DR2 M;  3IG5 A;  4L16 A;  1NJG A;  4DV4 M;  3CTW B;  3PNY A;  4LFA M;  2UXC M;  4DV7 M;  1A5T A;  3RFW A;  5A2Q S;  1QAO A;  1OKS A;  3GPU A;  4D82 A;  1XMO M;  1G3I A;  2Z7J A;  4LFC M;  4LY6 A;  2DKL A;  2DXI A;  2O01 F;  4JYA M;  1ZQ9 A;  3M7G A;  4Z8X A;  3T1H M;  3U5Z A;  2W82 A;  3J7B A;  2LVA A;  3LCU A;  4NL4 H;  1IBM M;  4JI4 M;  2H1R A;  1NHG C;  2P5T A;  2XLJ A;  4WP2 A;  2KW0 A;  2MRO B;  4BLC A;  4M0D A;  2OO9 A;  1NHW C;  1N33 M;  1NNJ A;  2LVP C;  3U6S A;  3F92 A;  1C7Y A;  2VF7 A;  2EKF A;  4QOS A;  1P3Q Q;  2KNA A;  3SYL A;  2DZO B;  4PDI A;  1DGG A;  3DZD A;  2YR0 A;  3GLI A;  3FUV A;  2EA0 A;  4DUY M;  2VII A;  4JI8 M;  2ZTD A;  5KPT A;  4DR1 M;  3R8F A;  2K47 A;  3A46 A;  3T15 A;  2LTU A;  2LBC A;  2XSZ D;  3T1Y M;  2Q2E B;  2CV1 A;  2HCB A;  5FSW A;  2CHG A;  2AHM A;  2H5X A;  1XXH B;  1VEK A;  4I8O A;  4MGI E;  2MGW A;  1OAO C;  1OQY A;  4RF0 A;  2CEA A;  1IN7 A;  4AKH A;  4AZF A;  1JQJ C;  4IIW A;  4M0W A; 
#chains in the Genus database with same CATH homology
 1ORY B;  3SHF A;  1N78 A;  4B3M M;  3GPP A;  1GL6 A;  4PCZ A;  4LZJ A;  3JR5 A;  3FKE A;  1L2B A;  1R7R A;  2F5O A;  1IN6 A;  1HNW M;  1IXS B;  4G6Z A;  5EJC A;  2LH0 A;  3RE8 A;  4IBK A;  4LGY A;  5C18 A;  2HL7 A;  1N75 A;  3SAR A;  4NXM M;  1IXR C;  1PM5 A;  4DR3 M;  5IT9 S;  3U6E A;  1Z6T A;  5ITT A;  3I4V A;  4D80 A;  5EP4 A;  4B7G A;  2DWL A;  4DV1 M;  1VDD A;  3D8B A;  2JA2 A;  1IQP A;  3D8L A;  4KOD A;  4G4N A;  5EXS A;  3K8Z A;  3GQ3 A;  1K82 A;  3AFH A;  4OVZ B;  4NRW A;  3FUX A;  4IBB A;  2CUZ A;  5H37 D;  3R9X B;  3U6D A;  2XFS A;  4B3S M;  5FLX S;  4JI5 M;  2I7N A;  4QNR A;  3HU2 A;  4AI6 A;  3L27 A;  1QAM A;  1HT2 E;  2QZ4 A;  2OQ4 A;  1Z5B A;  1G41 A;  5KPZ A;  3KOZ E;  3SAS A;  5ITX E;  3GPY A;  4LJ9 A;  3KS8 A;  3IG8 A;  4PD2 A;  1SXJ C;  2R18 A;  3UK6 A;  3FUW A;  3EIH A;  4IBC A;  4DV6 M;  2DWM A;  4DV2 M;  1NJF A;  4ZPX A;  3FTD A;  1XHB A;  4AG6 A;  3TWM A;  3HHX A;  4EIW A;  4IBD A;  3SC3 A;  4A3V B;  3GLH A;  4PT5 A;  1XWI A;  1IBL M;  2QPA A;  1TGU A;  2R62 A;  1IN8 A;  4OVZ A;  3GLF B;  3J2P B;  2DZN B;  3FD9 A;  3JAM S;  5JI2 E;  5FTN A;  3PFI A;  1Q39 A;  2KA6 B;  2G5G X;  4OU7 A;  4JXJ A;  4PDG A;  3L2A A;  2C98 A;  4GC5 A;  3NBI A;  5EXP A;  1TDH A;  3HKP A;  1EE8 A;  4CHT B;  3KOW E;  3U6C A;  3GQ4 A;  3T38 A;  2Y21 A;  2DVW B;  4IBE A;  5ITX A;  1R2Z A;  5F3W A;  1HNZ M;  4XGI A;  4GHL A;  3GLG B;  3WHK A;  3MJ5 A;  5EP2 A;  3PNV A;  1IY1 A;  4LG2 A;  4LJA A;  1QYR A;  4M9Z A;  3SHG B;  1W5T A;  2QBY A;  4WW0 A;  4LCB A;  5E6J A;  2ZAN A;  2LWX A;  3TQS A;  1XNR M;  1IY2 A;  4JI6 M;  2ZM6 M;  1YSY A;  5IZ7 D;  3A98 B;  1HT1 E;  4DV0 M;  3ZCB B;  4M9X A;  2F5Q A;  1TH2 A;  3WHL A;  2R46 A;  4LF4 M;  3HU1 A;  2CV2 A;  3QAU A;  1Q3C A;  3NWL A;  4DR7 M;  3THG A;  4HLQ A;  5BR8 M;  7CAT A;  4LRT A;  4HL4 A;  1L8Q A;  3KVW A;  3AV0 A;  2CHV A;  1OJL A;  4LZZ A;  5DYG A;  4NRV A;  1H6U A;  4IBF A;  2CV0 A;  4YHH M;  3KDS E;  3FYD A;  3GRV A;  4FCT A;  4LFB M;  1IM2 A;  1KSF X;  2L7H A;  3M0E A;  4KO8 A;  3HJ8 A;  5EXT A;  4X64 M;  3SAU A;  3U61 A;  4LF5 M;  2Z4R A;  3L26 A;  1NY5 A;  1SXJ A;  1DO2 A;  5EP3 A;  1DGH B;  3RGP A;  4L78 A;  2HHH M;  4TUW A;  2XFT A;  1YE9 A;  1GVN A;  4LF7 M;  5JI3 E;  4Z6Y A;  1QAN A;  5LMU M;  2HKJ A;  4MGZ E;  2BJW A;  1K3W A;  1D2N A;  4ITQ A;  4IBJ A;  2J7O A;  1Z5C A;  3GP1 A;  3LVV A;  2I7P A;  5E26 A;  3VKG A;  4DR4 M;  4LJ8 A;  4I5S A;  2XSZ A;  4LJ4 A;  3HWS A;  3VDU A;  2VQE M;  3VLF B;  2BJV A;  5ITU A;  2XH9 A;  2D7H A;  4XBO A;  3KOX E;  3TL4 X;  1DO0 A;  3VDP A;  3AOE C;  2EUC A;  4KHP M;  2YNM D;  4MGH A;  1XXH A;  2XZF A;  3KS4 A;  5BPV A;  4NXN M;  4NSO B;  1E9S A;  2F4V M;  3TWL A;  1I4W A;  1T3T A;  4DR5 M;  4L15 A;  3KW6 A;  4B08 A;  1OFH A;  5ITQ A;  3MK6 A;  4DR6 M;  1GLN A;  1C1K A;  2ZBK B;  3HHY A;  3U6M A;  1XMQ M;  3A45 A;  3PXG A;  1L1T A;  3FTE A;  3AKZ A;  1FNN A;  3J27 B;  1R6B X;  3I4Y A;  3KXE C;  5KQD A;  2UUC M;  4JN6 A;  4LGM A;  4MGY E;  1IN4 A;  2RGO A;  1HQY E;  3SAW A;  4IJF A;  2UXD M;  1Z5A A;  4FVM A;  3U6O A;  1KYI A;  3FTC A;  3GO8 A;  3AL0 C;  3BOS A;  2KZU A;  3KSX A;  1IN5 A;  1TH3 A;  1J09 A;  3VFD A;  4IJE A;  4GHA A;  4NOO B;  3E9S A;  5IRE B;  2Z3X A;  3JR4 A;  3CF2 A;  1QVR A;  3J80 S;  1HNX M;  5KPR A;  4AKI A;  3QWL A;  4X66 M;  1W5S A;  5FTL A;  2OPF A;  4LJ6 A;  4L8R C;  2FFJ A;  3LQQ A;  4G4O A;  2YQZ A;  3M6A A;  4RNA A;  1JR3 A;  4GKJ M;  2X4A A;  1Q3B A;  1IY0 A;  4DV5 M;  4DV3 M;  3U60 B;  2DHR A;  2R45 A;  1Z59 A;  2KEB A;  3L25 A;  2XGN A;  1XNQ M;  2YFQ A;  4I81 A;  4NSR A;  4MB7 A;  1NSF A;  4B7F A;  3A42 A;  2CE7 A;  3LMM A;  3W0L B;  1SXJ E;  3AOE A;  4REZ A;  1G4A E;  2R65 A;  4G4Q A;  3U5Z B;  3GLF A;  2FNA A;  3B9P A;  1S3S A;  1E9R A;  5ITR A;  5EP1 A;  2UU9 M;  3TPZ A;  1NY6 A;  2UXB M;  4QHS A;  2E5L M;  3CF6 E;  3KP1 E;  4OX9 M;  3KFU G;  4AKG A;  4KLN A;  3VK8 A;  4L4U A;  2XZU A;  1PJJ A;  3HGI A;  5DNY A;  3GLI B;  2C99 A;  2VQF M;  4BBA A;  3GLG A;  2CFO A;  5EQT A;  3HU3 A;  4GH9 A;  3SAT A;  2M5Z A;  2NQ8 C;  4I4L A;  1OFI A;  2XF3 A;  4GIP A;  2V1U A;  3UJN A;  4BB9 A;  3ILK A;  1MU5 A;  2KXE A;  1SXJ D;  2X49 A;  5LMN M;  4JI7 M;  3OTO M;  3FUU A;  2QCU A;  3GRU A;  4LJ7 A;  2L6O A;  3RGS A;  2UUA M;  1KFV A;  5KO3 A;  1NVM A;  5DYI A;  3GRY A;  4DUZ M;  4X62 M;  1N34 M;  4R3D A;  3ZC7 B;  3SYK A;  4AW4 A;  2R4E A;  3GPX A;  2A5Y B;  3PVS A;  4MH0 E;  2FOI C;  2F5P A;  3J81 S;  3SAV A;  3SMS A;  3AJI B;  4AQY M;  2Y0Q A;  2KRU A;  2QP9 X;  5KQ8 A;  1L2C A;  3W0F A;  4M9S A;  5C1B A;  1G8P A;  4G4R A;  1R2Y A;  1G59 A;  3SFZ A;  2DWN A;  2RGH A;  5GKN A;  2ZAO A;  1WXQ A;  4FD2 A;  3GRR A;  4IBG A;  4FW9 A;  1DGH A;  4JI2 M;  3HJS A;  3LQR A;  2Y0T A;  4B7H A;  4B3T M;  3TWK A;  4II7 A;  2F5N A;  2F5S A;  4LF8 M;  4AG5 A;  4FWH A;  1NNU C;  1UM8 A;  4OW0 A;  2X8A A;  1N36 M;  1E32 A;  3E4R A;  1HR0 M;  3KOY E;  2V1C A;  5FTJ A;  4JI3 M;  5ITY A;  2ERC A;  4P16 A;  3L28 A;  4QNM A;  1TDZ A;  4D81 A;  2KRK A;  4B3R M;  1ZAE A;  1DGB A;  3CF0 A;  1XC8 A;  1FJG M;  3DA1 A;  2C9O A;  4GC9 A;  4QHT A;  4WUR A;  4JI0 M;  1L1Z A;  2Z4S A;  3GLH B;  4JI1 M;  1DGF A;  2LNH C;  1GKI A;  3C58 A;  2Y20 A;  3HHW A;  2L7I A;  4LF6 M;  2ZAM A;  2C5R A;  2CHQ A;  3L29 A;  2O5R A;  4MGK E;  3U6L A;  3KSJ A;  4YY3 M;  1HQC A;  4GIT A;  3K2L A;  4IBI A;  2DWZ B;  4FCV A;  3SMP A;  4GRI A;  4LJ5 A;  8CAT A;  3K1J A;  3KP0 E;  2UUB M;  2V6Z M;  4QOZ C;  1QAQ A;  5FTM A;  3MHV C;  1IBK M;  2J7N A;  2L09 A;  3ZH9 B;  1JR3 D;  3GQ5 A;  3EIE A;  3J7A S;  2BNK A;  2LXE A;  4FWG A;  4CGY B;  4K0K M;  2D7G A;  1E94 E;  3TE6 A;  1L2D A;  3VKH A;  3Q8X A;  2QBY B;  5IWA M;  3UZU A;  2XEP A;  2C9C A;  4RF1 A;  1QZM A;  3DFZ A;  1TH4 A;  4FWD A;  2M60 A;  2QEN A;  2C96 A;  1MX0 A;  4LF9 M;  3UMM A;  1YUB A;  3I51 A;  1IXZ A;  1LV7 A;  1N77 A;  3VK7 A;  3FTF A;  1J7K A;  2D7E A;  1X37 A;  3HJQ A;  3FYC A;  4R7G A;  4JV5 M;  3U6Q A;  3FUT A;  2R4J A;  4FCW A;  3U6P A;  3K92 A;  1J5E M;  3UGJ A;  2EO2 A;  4S12 A;  3SBJ A;  1I94 M;  2KZS A;  3LVW A;  2FE8 A;  3DOA A;  1QQW A;  5EXX A;  4GKK M;  3HHZ A;  5FTK A;  2G8L A;  1GL7 A;  2RKO A;  3U60 A;  4CIS A;  4X65 M;  3U61 B;  1PJI A;  3AOG A;  1SXJ B;  4LRS A;  4W5W A;  1K3X A;  3H4M A;  4GMQ A;  4MM3 B;  1N32 M;  4DR2 M;  3IG5 A;  4L16 A;  1NJG A;  4DV4 M;  3CTW B;  3PNY A;  4LFA M;  2UXC M;  4DV7 M;  5A2Q S;  3RFW A;  1QAO A;  3GPU A;  1XMO M;  4D82 A;  1G3I A;  2Z7J A;  4LFC M;  4LY6 A;  2DXI A;  4JYA M;  1ZQ9 A;  3M7G A;  4Z8X A;  3T1H M;  3U5Z A;  2W82 A;  3J7B A;  4NL4 H;  1IBM M;  4JI4 M;  2H1R A;  1NHG C;  2P5T A;  2XLJ A;  2KW0 A;  4BLC A;  4M0D A;  1N33 M;  1NHW C;  1NNJ A;  3U6S A;  4QOS A;  3SYL A;  4PDI A;  2EA0 A;  2DZO B;  4DUY M;  1DGG A;  3DZD A;  2YR0 A;  3GLI A;  3FUV A;  2VII A;  4JI8 M;  5KPT A;  4DR1 M;  3R8F A;  2K47 A;  3A46 A;  3T15 A;  2XSZ D;  3T1Y M;  2Q2E B;  2CV1 A;  2HCB A;  5FSW A;  2CHG A;  2AHM A;  1XXH B;  4MGI E;  4I8O A;  4RF0 A;  2CEA A;  1IN7 A;  4AKH A;  4AZF A;  1JQJ C;  4IIW A;  4M0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...