2KA6B

Nmr structure of the cbp-taz2/stat1-tad complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
b'GSHMSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural basis for recruitment of CBP/p300 coactivators by STAT1 and STAT2 transactivation domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12162 STAT1_TAZ2bind STAT1 TAZ2 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ka6B00
2KA6B
chains in the Genus database with same CATH superfamily
2FOIC 3QYBA 1Y8GA 3AV0A 1I4WA 4X66M 3U6LA 1HNXM 1R7RA 4NSRA 2KW0A 3GPUA 2EO2A 5C18A 1KYIA 2OOAA 4LJ9A 1OIZA 2QQ8A 2QZ4A 3GLIE 2QHOB 1C1KA 4FWDA 2KNAA 4MGIE 3GLFE 3VK7A 4R7GA 1TR8A 2CHGA 3RGSA 2RGHA 4DV1M 3C3EA 2H5XA 1YSYA 4L15A 3UGJA 4WW0A 3GPXA 3AOEA 3IHPA 4PCZA 2BNKA 4D81A 2OPFA 4OX9M 3FRIA 3SAVA 1XC8A 4LF8M 1W5TA 1ZV1A 4LGYA 2G5GX 4LJAA 4YHHM 1GJTA 1OFHA 4HLQA 2VDBB 1TF0B 2MR9A 5L8RF 4IBJA 4DV5M 5E26A 5KQ8A 1QAMA 1DGGA 3GLHE 1G4AE 1MJGM 3DZDA 1HQYE 2JUJA 4JI3M 4G4RA 3GPPA 1Q02A 4GC9A 5ITUA 1L1TA 4LF9M 2BJWA 3GRRA 3SHFA 2X8AA 2C5RA 1SXJC 1Z5AA 3KP0E 4PDGA 1K3WA 1WIVA 2CHVA 2DAIA 1JR3E 3UK6A 3AFHA 4DV0M 4GHLA 3A98B 2O01F 4NSOB 1V92A 3KDSE 4JI6M 2JA2A 1QAQA 1XMOM 4XGIA 3FKEA 1C7YA 1NJGA 2R65A 4OVZA 4DV4M 5E6JA 4GITA 2NQ8C 2DVWB 4WP2A 3KSXA 1XB2B 1Z5BA 1IN8A 3AKZA 2OQ4A 4LF7M 4DV2M 2DWZB 2DKLA 1L2BA 2YR0A 5ITXE 1MU5A 4M0DA 2QBYA 3B7NA 2ZBKB 1OQYA 3JR4A 4FVMA 4X65M 2DWNA 1VDDA 3A42A 2VQFM 4QHTA 1XWIA 3I4VA 3C3DA 4FCVA 2JY7A 4NRWA 4FWGA 4G4QA 3F92A 1TDZA 5IT9S 3VKHA 3DOAA 1MN3A 2DAEA 1J7KA 3T15A 1GL6A 4UN2B 4G6ZA 5EQTA 2CUZA 2LVQD 1IY2A 1OAOC 3BBZA 1VQ1A 1DO2A 2KEBA 4IBDA 4FCTA 4DR6M 1MX0A 3SAWA 2CE7A 4AQYM 1OAIA 3U6OA 1VEJA 2Q2EB 1GVNA 1PGYA 4MH0E 4QNRA 2Z7JA 1E9RA 3HGIA 4Z6YA 3GLGB 3K1JA 2DAKA 1DV0A 4GRIA 3TPZA 4M9SA 1IN7A 2BJVA 1G8PA 3HZJA 3VKGA 5IREB 3B9PA 2I7NA 2Y21A 4GMQA 4X62M 3SATA 1HNWM 3UZUA 4CGYB 2BWBA 4HL4A 4DBGB 1QDRA 2FH0A 1R6BX 3LVWA 3T38A 2XZUA 4I5SA 1E94E 1IY0A 2C99A 2L4EA 3MJ5A 4M9ZA 3JAMS 5DNYA 3GQ4A 3U6QA 1NJFA 3W68A 1IXSB 4RNAA 2KHHA 4ITQA 1D0MA 1GL7A 1QVRA 1PRBA 3EIEA 3GRUA 5IWAM 1E32A 2UXCM 3TQSA 1X37A 1T6OA 3K8ZA 2Z4SA 2DNAA 1HR0M 4AW4A 2CWBA 3IG5A 2FFJA 3E9SA 3L28A 4D82A 4LF6M 1IM2A 1TH2A 3HKPA 1EE8A 2XSZD 3NBXX 5EP4A 1TDHA 4L8RC 1HJPA 5JI2E 3W0LB 3K9OA 3LCUA 1G71A 3BXWA 2Y0QA 4DR4M 3HY5A 2R45A 4IBBA 1H6UA 5FSWA 3T1HM 4CIZA 3B74A 3GLIB 2Z4RA 3U5ZB 4MGZE 3GLFB 1LTMA 4AKHA 3Q8XA 4FW9A 2YFQA 1FJGM 1GKIA 4MB7A 5LMUM 4EIWA 1ZMWA 4L6V6 2XGNA 1IFYA 3PXGA 3FUXA 2XSZA 2CRUA 1K82A 2XH9A 2Y20A 4LFBM 2DAMA 5ITTA 3U6CA 3ZH9B 4JN6A 5FTJA 1SXJB 1Q39A 1Q3BA 2EKKA 1QQWA 2V1CA 3PNVA 2DAGA 3M6AA 2C9CA 2KZUA 1IY1A 2R44A 4MGKE 2VQEM 4K0KM 1WGNA 5EXXA 2L2DA 3GLHB 2KA6B 3HU3A 1I94M 3UJNA 4NC6A 4B3TM 5ITQA 1JB0F 2DWMA 4R3DA 1IBKM 4LJ4A 2E5LM 4LF4M 2F4VM 2J5YA 1DO0A 2Z8YM 4KLNA 3AOGA 3CTWB 1SXJE 2KZSA 4CHTB 1K3XA 1D0LA 3E21A 1IN4A 1Z59A 4LF5M 4P17A 2XF3A 4Y28F 2MGWA 4JXJA 1AIPC 1GABA 5DYGA 2V6ZM 1TGUA 4I81A 2W82A 3UMMA 5EXSA 2JXNA 3SAUA 1JQJC 5FTLA 2XLJA 1DGFA 1QUTA 3GLGA 2G3QA 3D8BA 3HU2A 5H37D 2WSFF 2K0BX 3HHXA 1BVSA 2QSFX 4MGYE 7CATA 2KRKA 5DFLA 3R8FA 4LJ5A 4LFAM 3WHKA 2B3TA 4M0WA 4LY6A 4B3RM 4TUWA 3KFUG 3L26A 2L4FA 1L1ZA 2DHRA 1GLNA 3U6EA 2QNJA 5LMNM 4JI7M 1P3QQ 3VDPA 3E4RA 2DXIA 4NXMM 1NVMA 4B3SM 1Q3CA 3T6PA 2ZAOA 2LVNC 3HJQA 3U61B 1RU3A 3E46A 3THGA 4DUYM 1N78A 2ZTCA 4HEOA 3CGWA 1XNQM 4IBFA 3LW5F 2XZFA 3FUTA 4AZFA 3GRYA 5IZ7D 2D7HA 1Z6TA 3FE3A 2ZTDA 3HJSA 1XXHE 3B7ZA 1L2DA 2EJSA 3J27B 1DGBA 5GKNA 4QNMA 1ZMUA 2JZ0A 1NO1A 3J2PB 5EP2A 2XFSA 2X49A 3EIHA 1R2YA 3LQRA 3KVWA 1G59A 1HQCA 2ZANA 3KOZE 1WXQA 4NL4H 5DYIA 1AUAA 3SMPA 3GRVA 3GLIA 3U5ZA 2MH8A 3KOYE 1IXZA 3L27A 4QOZC 2XEPA 5A2QS 5EXTA 3WHLA 4GC5A 1G3IA 3RGPA 4DR5M 3IG8A 2J7OA 1W5SA 2CFOA 2JP7A 1LV7A 1OJLA 2LVOC 3C9PA 3L25A 3ZC7B 3TL4X 3HX3A 3U60B 3VDUA 2YNMD 1ZAEA 3LMMA 2EUCA 3CF0A 4FD2A 2QPAA 3L2AA 3J81S 3C58A 4JI1M 5ITRA 4LRSA 4LFCM 4NXNM 1KFVA 4GHAA 1PJQA 3A45A 1OIPA 3SYKA 4M9XA 3GLHA 2LH0A 2JY5A 2JWSA 2ZAMA 2KXEA 3FUVA 3MMPA 2F5NA 1SG9A 2L09A 4L4UA 4D80A 3K9PA 1OTRA 3SMSA 3TWMA 3B7QA 4DR7M 2FS1A 4XBOA 4GKJM 2M5ZA 4WURA 3PNYA 5ITYA 4B7GA 2WSCF 4DUZM 4IBKA 5KPRA 2L7HA 1JR3A 1XHBA 2GQFA 2R18A 4RF1A 3VFDA 2LHCA 4L78A 1VEGA 4B7FA 1IBLM 3GP1A 2O25A 1EIJA 4X64M 2CEAA 4IJEA 1NHWC 2BWEA 5EXPA 2VF7A 4GH9A 1EFUB 3U6PA 4B3MM 4G4NA 4F2LA 2JNHA 2OO9A 2L6OA 3B89A 2K9DA 2LTUA 2HCBA 1N34M 2QENA 1HT1E 2APLA 2FNAA 2LWXA 3KS4A 5ITXA 1J5EM 1L8QA 1QYRA 4IBEA 1GO5A 4IBCA 2OOBA 3VLFB 1TTEA 3AOEC 4AKIA 3HU1A 1XMQM 3I04M 3FYDA 4II7A 2LVAA 3ZCBB 1GJSA 2JZ1A 1QZEA 3KXEC 3V76A 3U6SA 2MJ5B 3J7BA 5KO3A 1PJJA 4KHPM 2DI0A 5FTKA 3FTFA 4RF0A 2R4JA 3HWSA 1L2CA 4LZZA 2QP9X 2LHGA 2KNVA 4MGHA 1NNJA 4PDIA 3M7GA 3KS8A 1E9SA 4B7HA 2CP8A 3FTDA 1DGHB 3QWLA 2DZOB 2QCUA 4OW0A 2P5TA 2C9OA 1NHGC 3TWLA 4CISA 2UXBM 3GO8A 4A3VB 4PT5A 1G41A 3CF6E 2F5PA 4AI6A 3KP1E 5BR8M 4KT0F 4JYAM 3NWLA 1CUKA 2H1RA 3U60A 1HNZM 2X4AA 2DHYA 2R0IA 5C1BA 1D2NA 2HHHM 2D7EA 3RE8A 4DV6M 3LQQA 2RGOA 1VDLA 1NNUC 2LNHC 4KO8A 2KDLA 4W5WA 2FE8A 4DV7M 1YLAA 1VG5A 1PJIA 2JY8A 4L16A 3HJ8A 2A5YB 4LZJA 2G8LA 1NY5A 4KODA 1QDTA 3SARA 2GNOA 2LVPC 3I51A 2HWJA 1N33M 1J09A 5KPZA 2L7IA 4ANRA 4AG5A 1ORYB 4GIPA 1KSFX 1R2ZA 3PVSA 1WJ7A 4LCBA 1IN5A 3HHZA 3OTOM 1XXHB 2M60A 2MROB 2J7NA 1IXSA 1IBMM 2Z3XA 3SBJA 1HT2E 3CF2A 3SHGB 1N77A 2RRUA 2HKJA 3ILKA 1V33A 4G3OA 1PJTA 3JR5A 3QAUA 3I4YA 3TWKA 2DWLA 2O5RA 2DZLA 4REZA 3AJIB 3J7AS 1QAOA 4XK8F 2K47A 2R62A 1OKSA 2CV0A 2HL7A 2UUCM 1XNRM 3GPYA 1QZMA 4R71A 1TH3A 2Y0TA 1SXJD 2JY6B 1V34A 4F1IA 2HAKA 2EA0A 5FTNA 1WR1B 2R4EA 3W67A 1QUSA 3KW6A 3GLFA 1PJSA 1T3TA 4P16A 1NV8A 3U6DA 4LJ7A 2LBCA 2UXDM 2UUBM 1ZMVA 3A46A 4JI0M 4RKUF 1IQPA 3BOSA 2I7PA 3KSJA 3FUUA 4IJFA 4GKKM 1YE9A 4OU7A 1WHCA 1SXJA 1YUBA 4QOSA 1JR3D 1DGHA 3DA1A 3SC3A 1ZQ9A 3U6MA 2UUAM 4QHSA 3FYCA 4CJ6A 4DR3M 4MM3B 4LJ6A 3KOXE 4NRVA 2VIIA 4DV3M 1UFZA 3GQ3A 4FCWA 3SASA 1N32M 1NV9A 2F5SA 3FD9A 4BB9A 4JI5M 2LXEA 4NOOB 4JI4M 4BLCA 2ERCA 1F4IA 4AKGA 3NBIA 3VK8A 2RKOA 3W0FA 1R4GA 5EP1A 3GQ5A 1A5TA 1D0KA 3FUWA 3Q8GA 2R46A 1OFIA 1IXRC 1Z5CA 3SYLA 2V1UA 2XFTA 4G4OA 1T43A 5JI3E 3MHVC 3AL0C 4S12A 3K92A 3KOWE 5F3WA 5FTMA 4ZPXA 3HHYA 2N35A 4B08A 3I01M 2WZJA 4I4LA 2KNZA 3QYEA 1VEKA 3D8LA 3PFIA 1IN6A 2KRUA 4IBGA 2WSEF 2K6BA 3T1YM 2ZM6M 1QANA 3LVVA 4IBIA 1XXHA 2R6FA 2F5OA 3FRHA 3FTCA 1NY6A 2C96A 5EJCA 3HHWA 2DZNB 5EP3A 8CATA 3GLGE 1PM5A 1TH4A 4PD2A 3MK6A 5FLXS 3U61A 3DFZA 2VF8A 4OVZB 1FNNA 1N75A 4IIWA 4LRTA 1UM8A 3RFWA 3K2LA 4YY3M 3IECA 4GEWA 2UU9M 4LGMA 2YQZA 2D7GA 3M0EA 4Z8XA 3H4MA 2C98A 3H4JA 2QBYB 3TE6A 1NSFA 1S3SA 3LCVB 5BPVA 4JI8M 2F5QA 2CV2A 1WGLA 2CV1A 4LJ8A 3ZQJA 4BBAA 2AHMA 1R5LA 2DENA 4DR2M 1N36M 3FTEA 4Q7JA 4DR1M 3L29A 3J80S 4I8OA 3SFZA 5KQDA 2EKFA 5KPTA 4JI2M 4LG2A 2CHQA 4JV5M 4FWHA 3R9XB 4AG6A
chains in the Genus database with same CATH topology
2FOIC 3AV0A 1I4WA 4X66M 3U6LA 1HNXM 1R7RA 4NSRA 2KW0A 3GPUA 2EO2A 5C18A 1KYIA 4LJ9A 2QZ4A 1C1KA 4FWDA 4MGIE 3VK7A 4R7GA 2CHGA 3RGSA 2RGHA 4DV1M 1YSYA 4L15A 3UGJA 4WW0A 3GPXA 3AOEA 4PCZA 2BNKA 4D81A 2OPFA 4OX9M 4LF8M 3SAVA 1XC8A 1W5TA 4LGYA 2G5GX 4LJAA 4YHHM 1OFHA 4HLQA 4IBJA 4DV5M 5E26A 5KQ8A 1QAMA 1DGGA 1G4AE 3DZDA 1HQYE 4JI3M 4G4RA 3GPPA 5ITUA 4GC9A 4LF9M 1L1TA 2BJWA 3GRRA 3SHFA 2X8AA 2C5RA 1SXJC 1Z5AA 3KP0E 4PDGA 1K3WA 2CHVA 3UK6A 3AFHA 4DV0M 4GHLA 3A98B 4NSOB 3KDSE 4JI6M 2JA2A 1QAQA 1XMOM 4XGIA 3FKEA 1NJGA 2R65A 4OVZA 4DV4M 5E6JA 4GITA 2NQ8C 2DVWB 3KSXA 1Z5BA 1IN8A 3AKZA 2OQ4A 4LF7M 4DV2M 2DWZB 1L2BA 2YR0A 5ITXE 1MU5A 4M0DA 2QBYA 2ZBKB 3JR4A 4FVMA 4X65M 2DWNA 1VDDA 3A42A 2VQFM 4QHTA 1XWIA 3I4VA 4FCVA 4NRWA 4FWGA 4G4QA 1TDZA 5IT9S 3VKHA 3DOAA 1J7KA 3T15A 1GL6A 4G6ZA 5EQTA 2CUZA 1IY2A 2KEBA 1DO2A 4IBDA 4FCTA 4DR6M 1MX0A 3SAWA 2CE7A 4AQYM 3U6OA 2Q2EB 1GVNA 4MH0E 4QNRA 2Z7JA 1E9RA 3HGIA 4Z6YA 3GLGB 3K1JA 4GRIA 3TPZA 4M9SA 1IN7A 2BJVA 1G8PA 3VKGA 5IREB 3B9PA 2I7NA 2Y21A 4GMQA 4X62M 3SATA 1HNWM 3UZUA 4CGYB 4HL4A 3T38A 1R6BX 3LVWA 2XZUA 4I5SA 1E94E 1IY0A 2C99A 3MJ5A 4M9ZA 3JAMS 5DNYA 3GQ4A 3U6QA 1NJFA 1IXSB 4RNAA 4ITQA 1GL7A 1QVRA 3GRUA 3EIEA 5IWAM 1E32A 2UXCM 3TQSA 1X37A 3K8ZA 2Z4SA 1HR0M 4AW4A 3IG5A 2FFJA 3E9SA 3L28A 4D82A 4LF6M 1IM2A 1TH2A 3HKPA 1EE8A 2XSZD 5EP4A 1TDHA 4L8RC 5JI2E 3W0LB 4DR4M 2Y0QA 2R45A 4IBBA 1H6UA 5FSWA 3T1HM 3GLIB 2Z4RA 3U5ZB 4MGZE 3GLFB 4AKHA 3Q8XA 4FW9A 2YFQA 1FJGM 1GKIA 4MB7A 5LMUM 4EIWA 2XGNA 3PXGA 3FUXA 2XSZA 1K82A 2XH9A 2Y20A 4LFBM 5ITTA 3U6CA 3ZH9B 4JN6A 5FTJA 1SXJB 1Q39A 1Q3BA 1QQWA 2V1CA 3PNVA 3M6AA 2C9CA 2KZUA 1IY1A 4MGKE 2VQEM 4K0KM 5EXXA 3GLHB 2KA6B 3HU3A 1I94M 3UJNA 4B3TM 5ITQA 2DWMA 4R3DA 1IBKM 4LJ4A 2E5LM 4LF4M 2F4VM 1DO0A 4KLNA 3AOGA 3CTWB 1SXJE 2KZSA 4CHTB 1K3XA 4LF5M 1IN4A 1Z59A 2XF3A 4JXJA 5DYGA 2V6ZM 1TGUA 4I81A 2W82A 3UMMA 5EXSA 3SAUA 1JQJC 5FTLA 2XLJA 1DGFA 3GLGA 3D8BA 3HU2A 5H37D 3HHXA 4MGYE 3R8FA 7CATA 2KRKA 4LJ5A 4LFAM 3WHKA 4M0WA 4LY6A 4B3RM 4TUWA 3KFUG 3L26A 1L1ZA 2DHRA 1GLNA 3U6EA 5LMNM 4JI7M 3VDPA 3E4RA 2DXIA 4NXMM 1NVMA 4B3SM 1Q3CA 2ZAOA 3HJQA 3U61B 3THGA 4DUYM 1N78A 1XNQM 4IBFA 2XZFA 3FUTA 4AZFA 3GRYA 5IZ7D 2D7HA 1Z6TA 3HJSA 1L2DA 3J27B 1DGBA 5GKNA 4QNMA 3J2PB 5EP2A 2XFSA 2X49A 3EIHA 1R2YA 3LQRA 3KVWA 1G59A 1HQCA 2ZANA 3KOZE 1WXQA 4NL4H 5DYIA 3SMPA 3GLIA 3GRVA 3U5ZA 3KOYE 1IXZA 3L27A 4QOZC 2XEPA 5A2QS 5EXTA 3WHLA 4GC5A 1G3IA 3RGPA 4DR5M 3IG8A 2J7OA 1W5SA 2CFOA 1LV7A 1OJLA 3L25A 3ZC7B 3TL4X 3U60B 3VDUA 2YNMD 1ZAEA 3LMMA 2EUCA 3CF0A 4FD2A 2QPAA 3L2AA 3J81S 3C58A 4JI1M 5ITRA 4LRSA 4LFCM 4NXNM 1KFVA 4GHAA 3A45A 3SYKA 4M9XA 3GLHA 2LH0A 2ZAMA 3FUVA 2KXEA 2F5NA 2L09A 4L4UA 4D80A 3SMSA 3TWMA 4DR7M 4XBOA 4GKJM 2M5ZA 4WURA 3PNYA 5ITYA 4B7GA 4DUZM 4IBKA 5KPRA 2L7HA 1JR3A 1XHBA 4RF1A 2R18A 3VFDA 4L78A 4B7FA 1IBLM 3GP1A 4X64M 2CEAA 4IJEA 1NHWC 5EXPA 4GH9A 3U6PA 4B3MM 4G4NA 2L6OA 2HCBA 1N34M 2QENA 1HT1E 2LWXA 2FNAA 3KS4A 5ITXA 1J5EM 1L8QA 1QYRA 4IBEA 4IBCA 3VLFB 3AOEC 4AKIA 3HU1A 1XMQM 3FYDA 4II7A 3ZCBB 3KXEC 3U6SA 3J7BA 5KO3A 1PJJA 4KHPM 5FTKA 3FTFA 4RF0A 2R4JA 3HWSA 1L2CA 4LZZA 2QP9X 4MGHA 1NNJA 4PDIA 3M7GA 3KS8A 1E9SA 4B7HA 3FTDA 3QWLA 1DGHB 2DZOB 2QCUA 4OW0A 2P5TA 2C9OA 1NHGC 3TWLA 4CISA 2UXBM 3GO8A 4A3VB 4PT5A 1G41A 3CF6E 2F5PA 4AI6A 3KP1E 5BR8M 4JYAM 3NWLA 2H1RA 3U60A 1HNZM 2X4AA 5C1BA 1D2NA 2HHHM 2D7EA 3RE8A 4DV6M 3LQQA 2RGOA 4KO8A 1NNUC 2LNHC 4W5WA 4DV7M 2FE8A 1PJIA 4L16A 3HJ8A 2A5YB 4LZJA 2G8LA 1NY5A 4KODA 3SARA 3I51A 1N33M 1J09A 5KPZA 2L7IA 4AG5A 1ORYB 4GIPA 1KSFX 1R2ZA 3PVSA 4LCBA 3HHZA 1IN5A 3OTOM 1XXHB 2M60A 2J7NA 1IBMM 2Z3XA 3SBJA 1HT2E 3CF2A 3SHGB 1N77A 2HKJA 3ILKA 3JR5A 3QAUA 3I4YA 3TWKA 2DWLA 2O5RA 4REZA 3AJIB 3J7AS 1QAOA 2K47A 2R62A 2CV0A 2UUCM 2HL7A 1XNRM 3GPYA 1QZMA 1TH3A 2Y0TA 1SXJD 2EA0A 5FTNA 2R4EA 3KW6A 3GLFA 1T3TA 4P16A 3U6DA 4LJ7A 2UXDM 2UUBM 3A46A 4JI0M 1IQPA 3BOSA 2I7PA 3KSJA 3FUUA 4IJFA 4GKKM 1YE9A 4OU7A 1SXJA 1YUBA 4QOSA 1JR3D 1DGHA 3DA1A 3SC3A 1ZQ9A 3U6MA 2UUAM 4QHSA 3FYCA 4DR3M 4MM3B 4LJ6A 3KOXE 4NRVA 2VIIA 4DV3M 3GQ3A 1N32M 4FCWA 3SASA 2F5SA 4JI5M 3FD9A 4BB9A 2LXEA 4NOOB 4JI4M 4BLCA 2ERCA 4AKGA 3NBIA 3VK8A 2RKOA 3W0FA 5EP1A 3GQ5A 3FUWA 2R46A 1OFIA 1IXRC 1Z5CA 3SYLA 2V1UA 2XFTA 4G4OA 5JI3E 3MHVC 3AL0C 4S12A 3K92A 3KOWE 5F3WA 5FTMA 4ZPXA 3HHYA 4B08A 4I4LA 3D8LA 3PFIA 1IN6A 2KRUA 4IBGA 3T1YM 2ZM6M 1QANA 3LVVA 4IBIA 1XXHA 2F5OA 3FTCA 1NY6A 2C96A 5EJCA 3HHWA 2DZNB 5EP3A 8CATA 1PM5A 1TH4A 4PD2A 3MK6A 5FLXS 3U61A 3DFZA 4OVZB 1FNNA 1N75A 4IIWA 4LRTA 1UM8A 3RFWA 3K2LA 4YY3M 2UU9M 4LGMA 2YQZA 2D7GA 3M0EA 4Z8XA 3H4MA 2C98A 2QBYB 3TE6A 1NSFA 1S3SA 5BPVA 4JI8M 2F5QA 2CV2A 2CV1A 4LJ8A 4BBAA 2AHMA 4DR2M 1N36M 3FTEA 4DR1M 3L29A 3J80S 4I8OA 3SFZA 5KQDA 4LG2A 5KPTA 4JI2M 4JV5M 2CHQA 4FWHA 3R9XB 4AG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KA6 B; 
#chains in the Genus database with same CATH topology
 2FOI C;  3QYB A;  1Y8G A;  3AV0 A;  1I4W A;  4X66 M;  3U6L A;  1HNX M;  1R7R A;  4NSR A;  2KW0 A;  3GPU A;  2EO2 A;  5C18 A;  1KYI A;  2OOA A;  4LJ9 A;  1OIZ A;  2QQ8 A;  2QZ4 A;  3GLI E;  2QHO B;  1C1K A;  4FWD A;  2KNA A;  4MGI E;  3GLF E;  3VK7 A;  4R7G A;  1TR8 A;  2CHG A;  3RGS A;  2RGH A;  4DV1 M;  3C3E A;  2H5X A;  1YSY A;  4L15 A;  3UGJ A;  4WW0 A;  3GPX A;  3AOE A;  3IHP A;  4PCZ A;  2BNK A;  4D81 A;  2OPF A;  4OX9 M;  3FRI A;  3SAV A;  1XC8 A;  4LF8 M;  1W5T A;  1ZV1 A;  4LGY A;  2G5G X;  4LJA A;  4YHH M;  1GJT A;  1OFH A;  4HLQ A;  2VDB B;  1TF0 B;  2MR9 A;  5L8R F;  4IBJ A;  4DV5 M;  5E26 A;  5KQ8 A;  1QAM A;  1DGG A;  3GLH E;  1G4A E;  1MJG M;  3DZD A;  1HQY E;  2JUJ A;  4JI3 M;  4G4R A;  3GPP A;  1Q02 A;  4GC9 A;  5ITU A;  1L1T A;  4LF9 M;  2BJW A;  3GRR A;  3SHF A;  2X8A A;  2C5R A;  1SXJ C;  1Z5A A;  3KP0 E;  4PDG A;  1K3W A;  1WIV A;  2CHV A;  2DAI A;  1JR3 E;  3UK6 A;  3AFH A;  4DV0 M;  4GHL A;  3A98 B;  2O01 F;  4NSO B;  1V92 A;  3KDS E;  4JI6 M;  2JA2 A;  1QAQ A;  1XMO M;  4XGI A;  3FKE A;  1C7Y A;  1NJG A;  2R65 A;  4OVZ A;  4DV4 M;  5E6J A;  4GIT A;  2NQ8 C;  2DVW B;  4WP2 A;  3KSX A;  1XB2 B;  1Z5B A;  1IN8 A;  3AKZ A;  2OQ4 A;  4LF7 M;  4DV2 M;  2DWZ B;  2DKL A;  1L2B A;  2YR0 A;  5ITX E;  1MU5 A;  4M0D A;  2QBY A;  3B7N A;  2ZBK B;  1OQY A;  3JR4 A;  4FVM A;  4X65 M;  2DWN A;  1VDD A;  3A42 A;  2VQF M;  4QHT A;  1XWI A;  3I4V A;  3C3D A;  4FCV A;  2JY7 A;  4NRW A;  4FWG A;  4G4Q A;  3F92 A;  1TDZ A;  5IT9 S;  3VKH A;  3DOA A;  1MN3 A;  2DAE A;  1J7K A;  3T15 A;  1GL6 A;  4UN2 B;  4G6Z A;  5EQT A;  2CUZ A;  2LVQ D;  1IY2 A;  1OAO C;  3BBZ A;  1VQ1 A;  1DO2 A;  2KEB A;  4IBD A;  4FCT A;  4DR6 M;  1MX0 A;  3SAW A;  2CE7 A;  4AQY M;  1OAI A;  3U6O A;  1VEJ A;  2Q2E B;  1GVN A;  1PGY A;  4MH0 E;  4QNR A;  2Z7J A;  1E9R A;  3HGI A;  4Z6Y A;  3GLG B;  3K1J A;  2DAK A;  1DV0 A;  4GRI A;  3TPZ A;  4M9S A;  1IN7 A;  2BJV A;  1G8P A;  3HZJ A;  3VKG A;  5IRE B;  3B9P A;  2I7N A;  2Y21 A;  4GMQ A;  4X62 M;  3SAT A;  1HNW M;  3UZU A;  4CGY B;  2BWB A;  4HL4 A;  4DBG B;  1QDR A;  2FH0 A;  1R6B X;  3LVW A;  3T38 A;  2XZU A;  4I5S A;  1E94 E;  1IY0 A;  2C99 A;  2L4E A;  3MJ5 A;  4M9Z A;  3JAM S;  5DNY A;  3GQ4 A;  3U6Q A;  1NJF A;  3W68 A;  1IXS B;  4RNA A;  2KHH A;  4ITQ A;  1D0M A;  1GL7 A;  1QVR A;  1PRB A;  3EIE A;  3GRU A;  5IWA M;  1E32 A;  2UXC M;  3TQS A;  1X37 A;  1T6O A;  3K8Z A;  2Z4S A;  2DNA A;  1HR0 M;  4AW4 A;  2CWB A;  3IG5 A;  2FFJ A;  3E9S A;  3L28 A;  4D82 A;  4LF6 M;  1IM2 A;  1TH2 A;  3HKP A;  1EE8 A;  2XSZ D;  3NBX X;  5EP4 A;  1TDH A;  4L8R C;  1HJP A;  5JI2 E;  3W0L B;  3K9O A;  3LCU A;  1G71 A;  3BXW A;  2Y0Q A;  4DR4 M;  3HY5 A;  2R45 A;  4IBB A;  1H6U A;  5FSW A;  3T1H M;  4CIZ A;  3B74 A;  3GLI B;  2Z4R A;  3U5Z B;  4MGZ E;  3GLF B;  1LTM A;  4AKH A;  3Q8X A;  4FW9 A;  2YFQ A;  1FJG M;  1GKI A;  4MB7 A;  5LMU M;  4EIW A;  1ZMW A;  4L6V 6;  2XGN A;  1IFY A;  3PXG A;  3FUX A;  2XSZ A;  2CRU A;  1K82 A;  2XH9 A;  2Y20 A;  4LFB M;  2DAM A;  5ITT A;  3U6C A;  3ZH9 B;  4JN6 A;  5FTJ A;  1SXJ B;  1Q39 A;  1Q3B A;  2EKK A;  1QQW A;  2V1C A;  3PNV A;  2DAG A;  3M6A A;  2C9C A;  2KZU A;  1IY1 A;  2R44 A;  4MGK E;  2VQE M;  4K0K M;  1WGN A;  5EXX A;  2L2D A;  3GLH B;  2KA6 B;  3HU3 A;  1I94 M;  3UJN A;  4NC6 A;  4B3T M;  5ITQ A;  1JB0 F;  2DWM A;  4R3D A;  1IBK M;  4LJ4 A;  2E5L M;  4LF4 M;  2F4V M;  2J5Y A;  1DO0 A;  2Z8Y M;  4KLN A;  3AOG A;  3CTW B;  1SXJ E;  2KZS A;  4CHT B;  1K3X A;  1D0L A;  3E21 A;  1IN4 A;  1Z59 A;  4LF5 M;  4P17 A;  2XF3 A;  4Y28 F;  2MGW A;  4JXJ A;  1AIP C;  1GAB A;  5DYG A;  2V6Z M;  1TGU A;  4I81 A;  2W82 A;  3UMM A;  5EXS A;  2JXN A;  3SAU A;  1JQJ C;  5FTL A;  2XLJ A;  1DGF A;  1QUT A;  3GLG A;  2G3Q A;  3D8B A;  3HU2 A;  5H37 D;  2WSF F;  2K0B X;  3HHX A;  1BVS A;  2QSF X;  4MGY E;  7CAT A;  2KRK A;  5DFL A;  3R8F A;  4LJ5 A;  4LFA M;  3WHK A;  2B3T A;  4M0W A;  4LY6 A;  4B3R M;  4TUW A;  3KFU G;  3L26 A;  2L4F A;  1L1Z A;  2DHR A;  1GLN A;  3U6E A;  2QNJ A;  5LMN M;  4JI7 M;  1P3Q Q;  3VDP A;  3E4R A;  2DXI A;  4NXM M;  1NVM A;  4B3S M;  1Q3C A;  3T6P A;  2ZAO A;  2LVN C;  3HJQ A;  3U61 B;  1RU3 A;  3E46 A;  3THG A;  4DUY M;  1N78 A;  2ZTC A;  4HEO A;  3CGW A;  1XNQ M;  4IBF A;  3LW5 F;  2XZF A;  3FUT A;  4AZF A;  3GRY A;  5IZ7 D;  2D7H A;  1Z6T A;  3FE3 A;  2ZTD A;  3HJS A;  1XXH E;  3B7Z A;  1L2D A;  2EJS A;  3J27 B;  1DGB A;  5GKN A;  4QNM A;  1ZMU A;  2JZ0 A;  1NO1 A;  3J2P B;  5EP2 A;  2XFS A;  2X49 A;  3EIH A;  1R2Y A;  3LQR A;  3KVW A;  1G59 A;  1HQC A;  2ZAN A;  3KOZ E;  1WXQ A;  4NL4 H;  5DYI A;  1AUA A;  3SMP A;  3GRV A;  3GLI A;  3U5Z A;  2MH8 A;  3KOY E;  1IXZ A;  3L27 A;  4QOZ C;  2XEP A;  5A2Q S;  5EXT A;  3WHL A;  4GC5 A;  1G3I A;  3RGP A;  4DR5 M;  3IG8 A;  2J7O A;  1W5S A;  2CFO A;  2JP7 A;  1LV7 A;  1OJL A;  2LVO C;  3C9P A;  3L25 A;  3ZC7 B;  3TL4 X;  3HX3 A;  3U60 B;  3VDU A;  2YNM D;  1ZAE A;  3LMM A;  2EUC A;  3CF0 A;  4FD2 A;  2QPA A;  3L2A A;  3J81 S;  3C58 A;  4JI1 M;  5ITR A;  4LRS A;  4LFC M;  4NXN M;  1KFV A;  4GHA A;  1PJQ A;  3A45 A;  1OIP A;  3SYK A;  4M9X A;  3GLH A;  2LH0 A;  2JY5 A;  2JWS A;  2ZAM A;  2KXE A;  3FUV A;  3MMP A;  2F5N A;  1SG9 A;  2L09 A;  4L4U A;  4D80 A;  3K9P A;  1OTR A;  3SMS A;  3TWM A;  3B7Q A;  4DR7 M;  2FS1 A;  4XBO A;  4GKJ M;  2M5Z A;  4WUR A;  3PNY A;  5ITY A;  4B7G A;  2WSC F;  4DUZ M;  4IBK A;  5KPR A;  2L7H A;  1JR3 A;  1XHB A;  2GQF A;  2R18 A;  4RF1 A;  3VFD A;  2LHC A;  4L78 A;  1VEG A;  4B7F A;  1IBL M;  3GP1 A;  2O25 A;  1EIJ A;  4X64 M;  2CEA A;  4IJE A;  1NHW C;  2BWE A;  5EXP A;  2VF7 A;  4GH9 A;  1EFU B;  3U6P A;  4B3M M;  4G4N A;  4F2L A;  2JNH A;  2OO9 A;  2L6O A;  3B89 A;  2K9D A;  2LTU A;  2HCB A;  1N34 M;  2QEN A;  1HT1 E;  2APL A;  2FNA A;  2LWX A;  3KS4 A;  5ITX A;  1J5E M;  1L8Q A;  1QYR A;  4IBE A;  1GO5 A;  4IBC A;  2OOB A;  3VLF B;  1TTE A;  3AOE C;  4AKI A;  3HU1 A;  1XMQ M;  3I04 M;  3FYD A;  4II7 A;  2LVA A;  3ZCB B;  1GJS A;  2JZ1 A;  1QZE A;  3KXE C;  3V76 A;  3U6S A;  2MJ5 B;  3J7B A;  5KO3 A;  1PJJ A;  4KHP M;  2DI0 A;  5FTK A;  3FTF A;  4RF0 A;  2R4J A;  3HWS A;  1L2C A;  4LZZ A;  2QP9 X;  2LHG A;  2KNV A;  4MGH A;  1NNJ A;  4PDI A;  3M7G A;  3KS8 A;  1E9S A;  4B7H A;  2CP8 A;  3FTD A;  1DGH B;  3QWL A;  2DZO B;  2QCU A;  4OW0 A;  2P5T A;  2C9O A;  1NHG C;  3TWL A;  4CIS A;  2UXB M;  3GO8 A;  4A3V B;  4PT5 A;  1G41 A;  3CF6 E;  2F5P A;  4AI6 A;  3KP1 E;  5BR8 M;  4KT0 F;  4JYA M;  3NWL A;  1CUK A;  2H1R A;  3U60 A;  1HNZ M;  2X4A A;  2DHY A;  2R0I A;  5C1B A;  1D2N A;  2HHH M;  2D7E A;  3RE8 A;  4DV6 M;  3LQQ A;  2RGO A;  1VDL A;  1NNU C;  2LNH C;  4KO8 A;  2KDL A;  4W5W A;  2FE8 A;  4DV7 M;  1YLA A;  1VG5 A;  1PJI A;  2JY8 A;  4L16 A;  3HJ8 A;  2A5Y B;  4LZJ A;  2G8L A;  1NY5 A;  4KOD A;  1QDT A;  3SAR A;  2GNO A;  2LVP C;  3I51 A;  2HWJ A;  1N33 M;  1J09 A;  5KPZ A;  2L7I A;  4ANR A;  4AG5 A;  1ORY B;  4GIP A;  1KSF X;  1R2Z A;  3PVS A;  1WJ7 A;  4LCB A;  1IN5 A;  3HHZ A;  3OTO M;  1XXH B;  2M60 A;  2MRO B;  2J7N A;  1IXS A;  1IBM M;  2Z3X A;  3SBJ A;  1HT2 E;  3CF2 A;  3SHG B;  1N77 A;  2RRU A;  2HKJ A;  3ILK A;  1V33 A;  4G3O A;  1PJT A;  3JR5 A;  3QAU A;  3I4Y A;  3TWK A;  2DWL A;  2O5R A;  2DZL A;  4REZ A;  3AJI B;  3J7A S;  1QAO A;  4XK8 F;  2K47 A;  2R62 A;  1OKS A;  2CV0 A;  2HL7 A;  2UUC M;  1XNR M;  3GPY A;  1QZM A;  4R71 A;  1TH3 A;  2Y0T A;  1SXJ D;  2JY6 B;  1V34 A;  4F1I A;  2HAK A;  2EA0 A;  5FTN A;  1WR1 B;  2R4E A;  3W67 A;  1QUS A;  3KW6 A;  3GLF A;  1PJS A;  1T3T A;  4P16 A;  1NV8 A;  3U6D A;  4LJ7 A;  2LBC A;  2UXD M;  2UUB M;  1ZMV A;  3A46 A;  4JI0 M;  4RKU F;  1IQP A;  3BOS A;  2I7P A;  3KSJ A;  3FUU A;  4IJF A;  4GKK M;  1YE9 A;  4OU7 A;  1WHC A;  1SXJ A;  1YUB A;  4QOS A;  1JR3 D;  1DGH A;  3DA1 A;  3SC3 A;  1ZQ9 A;  3U6M A;  2UUA M;  4QHS A;  3FYC A;  4CJ6 A;  4DR3 M;  4MM3 B;  4LJ6 A;  3KOX E;  4NRV A;  2VII A;  4DV3 M;  1UFZ A;  3GQ3 A;  4FCW A;  3SAS A;  1N32 M;  1NV9 A;  2F5S A;  3FD9 A;  4BB9 A;  4JI5 M;  2LXE A;  4NOO B;  4JI4 M;  4BLC A;  2ERC A;  1F4I A;  4AKG A;  3NBI A;  3VK8 A;  2RKO A;  3W0F A;  1R4G A;  5EP1 A;  3GQ5 A;  1A5T A;  1D0K A;  3FUW A;  3Q8G A;  2R46 A;  1OFI A;  1IXR C;  1Z5C A;  3SYL A;  2V1U A;  2XFT A;  4G4O A;  1T43 A;  5JI3 E;  3MHV C;  3AL0 C;  4S12 A;  3K92 A;  3KOW E;  5F3W A;  5FTM A;  4ZPX A;  3HHY A;  2N35 A;  4B08 A;  3I01 M;  2WZJ A;  4I4L A;  2KNZ A;  3QYE A;  1VEK A;  3D8L A;  3PFI A;  1IN6 A;  2KRU A;  4IBG A;  2WSE F;  2K6B A;  3T1Y M;  2ZM6 M;  1QAN A;  3LVV A;  4IBI A;  1XXH A;  2R6F A;  2F5O A;  3FRH A;  3FTC A;  1NY6 A;  2C96 A;  5EJC A;  3HHW A;  2DZN B;  5EP3 A;  8CAT A;  3GLG E;  1PM5 A;  1TH4 A;  4PD2 A;  3MK6 A;  5FLX S;  3U61 A;  3DFZ A;  2VF8 A;  4OVZ B;  1FNN A;  1N75 A;  4IIW A;  4LRT A;  1UM8 A;  3RFW A;  3K2L A;  4YY3 M;  3IEC A;  4GEW A;  2UU9 M;  4LGM A;  2YQZ A;  2D7G A;  3M0E A;  4Z8X A;  3H4M A;  2C98 A;  3H4J A;  2QBY B;  3TE6 A;  1NSF A;  1S3S A;  3LCV B;  5BPV A;  4JI8 M;  2F5Q A;  2CV2 A;  1WGL A;  2CV1 A;  4LJ8 A;  3ZQJ A;  4BBA A;  2AHM A;  1R5L A;  2DEN A;  4DR2 M;  1N36 M;  3FTE A;  4Q7J A;  4DR1 M;  3L29 A;  3J80 S;  4I8O A;  3SFZ A;  5KQD A;  2EKF A;  5KPT A;  4JI2 M;  4LG2 A;  2CHQ A;  4JV5 M;  4FWH A;  3R9X B;  4AG6 A; 
#chains in the Genus database with same CATH homology
 2FOI C;  3AV0 A;  1I4W A;  4X66 M;  3U6L A;  1HNX M;  1R7R A;  4NSR A;  2KW0 A;  3GPU A;  2EO2 A;  5C18 A;  1KYI A;  4LJ9 A;  2QZ4 A;  1C1K A;  4FWD A;  4MGI E;  3VK7 A;  4R7G A;  2CHG A;  3RGS A;  2RGH A;  4DV1 M;  1YSY A;  4L15 A;  3UGJ A;  4WW0 A;  3GPX A;  3AOE A;  4PCZ A;  2BNK A;  4D81 A;  2OPF A;  4OX9 M;  4LF8 M;  3SAV A;  1XC8 A;  1W5T A;  4LGY A;  2G5G X;  4LJA A;  4YHH M;  1OFH A;  4HLQ A;  4IBJ A;  4DV5 M;  5E26 A;  5KQ8 A;  1QAM A;  1DGG A;  1G4A E;  3DZD A;  1HQY E;  4JI3 M;  4G4R A;  3GPP A;  5ITU A;  4GC9 A;  4LF9 M;  1L1T A;  2BJW A;  3GRR A;  3SHF A;  2X8A A;  2C5R A;  1SXJ C;  1Z5A A;  3KP0 E;  4PDG A;  1K3W A;  2CHV A;  3UK6 A;  3AFH A;  4DV0 M;  4GHL A;  3A98 B;  4NSO B;  3KDS E;  4JI6 M;  2JA2 A;  1QAQ A;  1XMO M;  4XGI A;  3FKE A;  1NJG A;  2R65 A;  4OVZ A;  4DV4 M;  5E6J A;  4GIT A;  2NQ8 C;  2DVW B;  3KSX A;  1Z5B A;  1IN8 A;  3AKZ A;  2OQ4 A;  4LF7 M;  4DV2 M;  2DWZ B;  1L2B A;  2YR0 A;  5ITX E;  1MU5 A;  4M0D A;  2QBY A;  2ZBK B;  3JR4 A;  4FVM A;  4X65 M;  2DWN A;  1VDD A;  3A42 A;  2VQF M;  4QHT A;  1XWI A;  3I4V A;  4FCV A;  4NRW A;  4FWG A;  4G4Q A;  1TDZ A;  5IT9 S;  3VKH A;  3DOA A;  1J7K A;  3T15 A;  1GL6 A;  4G6Z A;  5EQT A;  2CUZ A;  1IY2 A;  2KEB A;  1DO2 A;  4IBD A;  4FCT A;  4DR6 M;  1MX0 A;  3SAW A;  2CE7 A;  4AQY M;  3U6O A;  2Q2E B;  1GVN A;  4MH0 E;  4QNR A;  2Z7J A;  1E9R A;  3HGI A;  4Z6Y A;  3GLG B;  3K1J A;  4GRI A;  3TPZ A;  4M9S A;  1IN7 A;  2BJV A;  1G8P A;  3VKG A;  5IRE B;  3B9P A;  2I7N A;  2Y21 A;  4GMQ A;  4X62 M;  3SAT A;  1HNW M;  3UZU A;  4CGY B;  4HL4 A;  3T38 A;  1R6B X;  3LVW A;  2XZU A;  4I5S A;  1E94 E;  1IY0 A;  2C99 A;  3MJ5 A;  4M9Z A;  3JAM S;  5DNY A;  3GQ4 A;  3U6Q A;  1NJF A;  1IXS B;  4RNA A;  4ITQ A;  1GL7 A;  1QVR A;  3GRU A;  3EIE A;  5IWA M;  1E32 A;  2UXC M;  3TQS A;  1X37 A;  3K8Z A;  2Z4S A;  1HR0 M;  4AW4 A;  3IG5 A;  2FFJ A;  3E9S A;  3L28 A;  4D82 A;  4LF6 M;  1IM2 A;  1TH2 A;  3HKP A;  1EE8 A;  2XSZ D;  5EP4 A;  1TDH A;  4L8R C;  5JI2 E;  3W0L B;  4DR4 M;  2Y0Q A;  2R45 A;  4IBB A;  1H6U A;  5FSW A;  3T1H M;  3GLI B;  2Z4R A;  3U5Z B;  4MGZ E;  3GLF B;  4AKH A;  3Q8X A;  4FW9 A;  2YFQ A;  1FJG M;  1GKI A;  4MB7 A;  5LMU M;  4EIW A;  2XGN A;  3PXG A;  3FUX A;  2XSZ A;  1K82 A;  2XH9 A;  2Y20 A;  4LFB M;  5ITT A;  3U6C A;  3ZH9 B;  4JN6 A;  5FTJ A;  1SXJ B;  1Q39 A;  1Q3B A;  1QQW A;  2V1C A;  3PNV A;  3M6A A;  2C9C A;  2KZU A;  1IY1 A;  4MGK E;  2VQE M;  4K0K M;  5EXX A;  3GLH B;  2KA6 B;  3HU3 A;  1I94 M;  3UJN A;  4B3T M;  5ITQ A;  2DWM A;  4R3D A;  1IBK M;  4LJ4 A;  2E5L M;  4LF4 M;  2F4V M;  1DO0 A;  4KLN A;  3AOG A;  3CTW B;  1SXJ E;  2KZS A;  4CHT B;  1K3X A;  4LF5 M;  1IN4 A;  1Z59 A;  2XF3 A;  4JXJ A;  5DYG A;  2V6Z M;  1TGU A;  4I81 A;  2W82 A;  3UMM A;  5EXS A;  3SAU A;  1JQJ C;  5FTL A;  2XLJ A;  1DGF A;  3GLG A;  3D8B A;  3HU2 A;  5H37 D;  3HHX A;  4MGY E;  3R8F A;  7CAT A;  2KRK A;  4LJ5 A;  4LFA M;  3WHK A;  4M0W A;  4LY6 A;  4B3R M;  4TUW A;  3KFU G;  3L26 A;  1L1Z A;  2DHR A;  1GLN A;  3U6E A;  5LMN M;  4JI7 M;  3VDP A;  3E4R A;  2DXI A;  4NXM M;  1NVM A;  4B3S M;  1Q3C A;  2ZAO A;  3HJQ A;  3U61 B;  3THG A;  4DUY M;  1N78 A;  1XNQ M;  4IBF A;  2XZF A;  3FUT A;  4AZF A;  3GRY A;  5IZ7 D;  2D7H A;  1Z6T A;  3HJS A;  1L2D A;  3J27 B;  1DGB A;  5GKN A;  4QNM A;  3J2P B;  5EP2 A;  2XFS A;  2X49 A;  3EIH A;  1R2Y A;  3LQR A;  3KVW A;  1G59 A;  1HQC A;  2ZAN A;  3KOZ E;  1WXQ A;  4NL4 H;  5DYI A;  3SMP A;  3GLI A;  3GRV A;  3U5Z A;  3KOY E;  1IXZ A;  3L27 A;  4QOZ C;  2XEP A;  5A2Q S;  5EXT A;  3WHL A;  4GC5 A;  1G3I A;  3RGP A;  4DR5 M;  3IG8 A;  2J7O A;  1W5S A;  2CFO A;  1LV7 A;  1OJL A;  3L25 A;  3ZC7 B;  3TL4 X;  3U60 B;  3VDU A;  2YNM D;  1ZAE A;  3LMM A;  2EUC A;  3CF0 A;  4FD2 A;  2QPA A;  3L2A A;  3J81 S;  3C58 A;  4JI1 M;  5ITR A;  4LRS A;  4LFC M;  4NXN M;  1KFV A;  4GHA A;  3A45 A;  3SYK A;  4M9X A;  3GLH A;  2LH0 A;  2ZAM A;  3FUV A;  2KXE A;  2F5N A;  2L09 A;  4L4U A;  4D80 A;  3SMS A;  3TWM A;  4DR7 M;  4XBO A;  4GKJ M;  2M5Z A;  4WUR A;  3PNY A;  5ITY A;  4B7G A;  4DUZ M;  4IBK A;  5KPR A;  2L7H A;  1JR3 A;  1XHB A;  4RF1 A;  2R18 A;  3VFD A;  4L78 A;  4B7F A;  1IBL M;  3GP1 A;  4X64 M;  2CEA A;  4IJE A;  1NHW C;  5EXP A;  4GH9 A;  3U6P A;  4B3M M;  4G4N A;  2L6O A;  2HCB A;  1N34 M;  2QEN A;  1HT1 E;  2LWX A;  2FNA A;  3KS4 A;  5ITX A;  1J5E M;  1L8Q A;  1QYR A;  4IBE A;  4IBC A;  3VLF B;  3AOE C;  4AKI A;  3HU1 A;  1XMQ M;  3FYD A;  4II7 A;  3ZCB B;  3KXE C;  3U6S A;  3J7B A;  5KO3 A;  1PJJ A;  4KHP M;  5FTK A;  3FTF A;  4RF0 A;  2R4J A;  3HWS A;  1L2C A;  4LZZ A;  2QP9 X;  4MGH A;  1NNJ A;  4PDI A;  3M7G A;  3KS8 A;  1E9S A;  4B7H A;  3FTD A;  3QWL A;  1DGH B;  2DZO B;  2QCU A;  4OW0 A;  2P5T A;  2C9O A;  1NHG C;  3TWL A;  4CIS A;  2UXB M;  3GO8 A;  4A3V B;  4PT5 A;  1G41 A;  3CF6 E;  2F5P A;  4AI6 A;  3KP1 E;  5BR8 M;  4JYA M;  3NWL A;  2H1R A;  3U60 A;  1HNZ M;  2X4A A;  5C1B A;  1D2N A;  2HHH M;  2D7E A;  3RE8 A;  4DV6 M;  3LQQ A;  2RGO A;  4KO8 A;  1NNU C;  2LNH C;  4W5W A;  4DV7 M;  2FE8 A;  1PJI A;  4L16 A;  3HJ8 A;  2A5Y B;  4LZJ A;  2G8L A;  1NY5 A;  4KOD A;  3SAR A;  3I51 A;  1N33 M;  1J09 A;  5KPZ A;  2L7I A;  4AG5 A;  1ORY B;  4GIP A;  1KSF X;  1R2Z A;  3PVS A;  4LCB A;  3HHZ A;  1IN5 A;  3OTO M;  1XXH B;  2M60 A;  2J7N A;  1IBM M;  2Z3X A;  3SBJ A;  1HT2 E;  3CF2 A;  3SHG B;  1N77 A;  2HKJ A;  3ILK A;  3JR5 A;  3QAU A;  3I4Y A;  3TWK A;  2DWL A;  2O5R A;  4REZ A;  3AJI B;  3J7A S;  1QAO A;  2K47 A;  2R62 A;  2CV0 A;  2UUC M;  2HL7 A;  1XNR M;  3GPY A;  1QZM A;  1TH3 A;  2Y0T A;  1SXJ D;  2EA0 A;  5FTN A;  2R4E A;  3KW6 A;  3GLF A;  1T3T A;  4P16 A;  3U6D A;  4LJ7 A;  2UXD M;  2UUB M;  3A46 A;  4JI0 M;  1IQP A;  3BOS A;  2I7P A;  3KSJ A;  3FUU A;  4IJF A;  4GKK M;  1YE9 A;  4OU7 A;  1SXJ A;  1YUB A;  4QOS A;  1JR3 D;  1DGH A;  3DA1 A;  3SC3 A;  1ZQ9 A;  3U6M A;  2UUA M;  4QHS A;  3FYC A;  4DR3 M;  4MM3 B;  4LJ6 A;  3KOX E;  4NRV A;  2VII A;  4DV3 M;  3GQ3 A;  1N32 M;  4FCW A;  3SAS A;  2F5S A;  4JI5 M;  3FD9 A;  4BB9 A;  2LXE A;  4NOO B;  4JI4 M;  4BLC A;  2ERC A;  4AKG A;  3NBI A;  3VK8 A;  2RKO A;  3W0F A;  5EP1 A;  3GQ5 A;  3FUW A;  2R46 A;  1OFI A;  1IXR C;  1Z5C A;  3SYL A;  2V1U A;  2XFT A;  4G4O A;  5JI3 E;  3MHV C;  3AL0 C;  4S12 A;  3K92 A;  3KOW E;  5F3W A;  5FTM A;  4ZPX A;  3HHY A;  4B08 A;  4I4L A;  3D8L A;  3PFI A;  1IN6 A;  2KRU A;  4IBG A;  3T1Y M;  2ZM6 M;  1QAN A;  3LVV A;  4IBI A;  1XXH A;  2F5O A;  3FTC A;  1NY6 A;  2C96 A;  5EJC A;  3HHW A;  2DZN B;  5EP3 A;  8CAT A;  1PM5 A;  1TH4 A;  4PD2 A;  3MK6 A;  5FLX S;  3U61 A;  3DFZ A;  4OVZ B;  1FNN A;  1N75 A;  4IIW A;  4LRT A;  1UM8 A;  3RFW A;  3K2L A;  4YY3 M;  2UU9 M;  4LGM A;  2YQZ A;  2D7G A;  3M0E A;  4Z8X A;  3H4M A;  2C98 A;  2QBY B;  3TE6 A;  1NSF A;  1S3S A;  5BPV A;  4JI8 M;  2F5Q A;  2CV2 A;  2CV1 A;  4LJ8 A;  4BBA A;  2AHM A;  4DR2 M;  1N36 M;  3FTE A;  4DR1 M;  3L29 A;  3J80 S;  4I8O A;  3SFZ A;  5KQD A;  4LG2 A;  5KPT A;  4JI2 M;  4JV5 M;  2CHQ A;  4FWH A;  3R9X B;  4AG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...