2KA6B

Nmr structure of the cbp-taz2/stat1-tad complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSHMSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords CREB-binding protein
publication title Structural basis for recruitment of CBP/p300 coactivators by STAT1 and STAT2 transactivation domains.
pubmed doi rcsb
source organism Mus musculus
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12162 STAT1_TAZ2bind STAT1 TAZ2 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ka6B00
2KA6B
chains in the Genus database with same CATH superfamily
4DBGB 7CATA 1QZEA 4LZZA 4CJ6A 2LVOC 2CRUA 3KSXA 1R6BX 1G71A 4LGMA 1QUSA 3B7ZA 3I51A 5EXTA 4IJEA 2DVWB 4S12A 5L8RF 2KXEA 1H6UA 1BVSA 2L7IA 1EFUB 2L2DA 5DYIA 4DR3M 2HL7A 1XB2B 2LVPC 2P5TA 4LFAM 4IBBA 4DR7M 2LHCA 1NJGA 3L2AA 3GO8A 1NHWC 2QZ4A 3IECA 4F2LA 5LMUM 1WHCA 2H5XA 4DV6M 1R5LA 4MGHA 3PNYA 1W5SA 3B7NA 1X37A 3KP0E 3IG5A 3ZQJA 4JYAM 1MX0A 1GJSA 4Y28F 2R0IA 2Z4SA 4GC5A 1N36M 4Q7JA 2L7HA 2OOBA 4AZFA 3SHFA 4LF6M 4FWHA 2QCUA 2XH9A 2L6OA 2Z3XA 2XF3A 1XHBA 2CWBA 2JA2A 4MH0E 4W5WA 4R71A 2XLJA 1TDZA 4IBKA 8CATA 2DKLA 1IXSB 3HHXA 2Z8YM 5EP1A 1OKSA 2NQ8C 2XGNA 3U61B 2LHGA 3HZJA 4FWGA 4DR6M 2QPAA 5EQTA 1GL6A 2DWLA 4BB9A 3U60B 3GP1A 3L25A 2XFSA 3W67A 4RKUF 4G4NA 2UUCM 2HCBA 1GKIA 2VQFM 4REZA 3HWSA 3FUUA 3GPPA 1N78A 1N32M 3EIEA 5JI2E 4NOOB 3H4MA 4JI3M 4BBAA 3U6SA 3HY5A 2FE8A 3GRUA 2DZOB 3W0LB 3Q8GA 3CF6E 2HHHM 4NRWA 1NY6A 2QSFX 2FOIC 3GLIB 1N77A 3R8FA 3U6CA 4KHPM 3ZH9B 1HT2E 1F4IA 3KVWA 1CUKA 1VEGA 1I4WA 1G4AE 2RGOA 4Z8XA 2XFTA 3J7AS 3KOZE 1IXZA 3K92A 1L8QA 1PJTA 2JZ0A 2VIIA 2EA0A 3SBJA 2W82A 2ZTDA 4QHSA 2KDLA 4LGYA 4GC9A 2JUJA 2QP9X 1JR3A 3SAUA 1NJFA 4JI1M 4PDGA 5DYGA 5KPRA 3GLFA 2J7NA 1XXHA 3VK8A 4AKGA 2R44A 1IY2A 4GEWA 3UJNA 4LG2A 2RGHA 2KNZA 4QOSA 3T1YM 2KRKA 4I5SA 5C1BA 2VF8A 3KOWE 3TWLA 4B3SM 2OOAA 3VFDA 1AUAA 1OFHA 1QYRA 2QHOB 1NNJA 4RNAA 4LF7M 4AQYM 4QHTA 1ZQ9A 4PD2A 2XSZD 3H4JA 4JI2M 3K1JA 1PJQA 4AW4A 3W0FA 3A46A 1R7RA 2C9CA 2OQ4A 3DOAA 4DV3M 2R45A 3U6OA 5E6JA 4AKIA 1HJPA 1NV9A 1L1ZA 4NL4H 4BLCA 3OTOM 2YQZA 1XXHE 1K3WA 4JN6A 4WP2A 3RGPA 1LV7A 2CFOA 2OO9A 5FLXS 1UFZA 1L2CA 2F5QA 2UXBM 3NWLA 5IZ7D 1FJGM 4QNRA 1E94E 2CV1A 3J27B 5KQDA 1HR0M 3C58A 3GQ4A 3GRVA 4LRTA 4ZPXA 1QZMA 2WSCF 4FCTA 2G5GX 3C9PA 4B7GA 3FD9A 4NXNM 4R7GA 1ZMVA 3I4VA 3KS4A 1E32A 1YSYA 2C96A 1VDDA 1T6OA 2C5RA 4AG6A 4LF4M 1TDHA 4KT0F 2LVNC 5FTMA 2L4FA 3M6AA 3FRIA 3W68A 4L15A 4G4OA 1DO2A 3FE3A 5H37D 1RU3A 2Q2EB 3WHKA 3VLFB 3LW5F 2F5SA 4DV2M 3LVVA 2R4JA 3M0EA 1QUTA 4LJ9A 1R4GA 3E9SA 2GNOA 4FWDA 1HT1E 2KEBA 3K2LA 5FTKA 1J09A 1K82A 2AHMA 3B7QA 3KFUG 3HX3A 4PT5A 1XMOM 2JXNA 4IBJA 1TF0B 3U6EA 3KDSE 2KZSA 2H1RA 1L1TA 4GIPA 4M0WA 3E21A 3HU3A 5A2QS 1OIZA 3L27A 5F3WA 1QDRA 3VDPA 1IM2A 2G3QA 4X65M 4DR5M 3RGSA 2APLA 3CTWB 1G8PA 1SXJC 1DO0A 4MGZE 1JQJC 5ITQA 2DXIA 4KO8A 1T43A 3AFHA 3GLFB 1L2DA 1DGGA 3LCUA 4MGIE 1D2NA 5IWAM 2CP8A 1SXJD 1YUBA 4GITA 2DAMA 4JI6M 3GQ5A 3GLHE 2UU9M 2DHRA 1S3SA 5KO3A 2X8AA 2FNAA 1PJSA 3ILKA 2FH0A 3U6QA 4NXMM 3KSJA 3SFZA 3GLGA 3TE6A 3FRHA 4R3DA 2QNJA 4II7A 4OX9M 3DA1A 2R18A 2MJ5B 2R65A 2Y0QA 1IQPA 4B7HA 3V76A 1IN6A 4B3MM 4DV7M 3FKEA 1IBLM 3HJSA 3IHPA 2V1UA 3RFWA 2DI0A 4AG5A 4IBGA 4RF0A 3T6PA 3KXEC 1E9SA 2XZUA 1VG5A 3HJ8A 4ITQA 2LTUA 3SMSA 4LF8M 2UUBM 2CUZA 3SAWA 4NSOB 5BPVA 4KODA 3U6PA 5JI3E 1J5EM 3I01M 3LMMA 3GLGE 3B9PA 1HNZM 2JWSA 3UGJA 4G6ZA 2DENA 3GRYA 4X64M 2G8LA 1TH3A 1V33A 3E4RA 1TR8A 5EXXA 1XC8A 2LWXA 2CV0A 3AOEC 1Z6TA 4CHTB 4NSRA 3BOSA 4NRVA 3TQSA 4EIWA 1Q3BA 3BBZA 3GPUA 4OVZA 1UM8A 1T3TA 3SAVA 1N33M 1OAIA 2QENA 2HKJA 4DV0M 1EE8A 3MMPA 3THGA 4FCWA 2EJSA 2DAEA 4G3OA 2WSEF 1WXQA 2KA6B 2WZJA 1IN8A 3LVWA 3A45A 3L29A 3KW6A 2R62A 3R9XB 1NO1A 2EUCA 2JY5A 1C7YA 1SXJE 2D7GA 4WW0A 3QWLA 4CGYB 1YE9A 5IREB 3UZUA 1TTEA 3L28A 4JXJA 4MB7A 4B08A 2L09A 2LBCA 2CHQA 3IG8A 5EXSA 3T15A 3SC3A 4L4UA 4Z6YA 2ZAMA 4D81A 4DUZM 2R46A 2EKFA 2JY7A 2RRUA 3I4YA 3PXGA 3MHVC 4HEOA 1G41A 3BXWA 4QNMA 1ZMUA 3TWMA 2CV2A 3SHGB 5EJCA 3SASA 4LF9M 3EIHA 4LY6A 3D8BA 4DV5M 2YNMD 3SMPA 2XZFA 2MH8A 1QAQA 4MGYE 4X66M 1DGHA 4LFBM 5LMNM 3AOGA 3KS8A 4L6V6 5ITXE 3VDUA 1XNQM 3AKZA 2LH0A 2DHYA 4F1IA 2FS1A 3J80S 4AKHA 3NBIA 1Z5CA 3U6LA 2DAKA 4DR1M 3FUWA 2MGWA 4X62M 3U6DA 1N34M 4JI8M 2D7HA 1TH4A 2DWMA 1KYIA 2N35A 2EO2A 5BR8M 1I94M 1D0MA 3MK6A 2E5LM 4P17A 5IT9S 1Y8GA 1GL7A 1Q02A 3KOXE 2DNAA 2JP7A 1IXRC 3ZC7B 5FTNA 4KLNA 1E9RA 1TH2A 1QAOA 4QOZC 1QVRA 3CF2A 2UUAM 4XBOA 2C99A 2O25A 4LFCM 4GMQA 2B3TA 4ANRA 3JR5A 3T1HM 1PGYA 2XSZA 5DNYA 3HJQA 3VK7A 3HHYA 3U5ZA 1QAMA 1VEKA 4WURA 4L78A 4DUYM 1EIJA 4M0DA 4MM3B 1NVMA 3DFZA 3FTCA 2KHHA 1DGFA 2LVQD 3HHWA 1GO5A 1IBKM 1IBMM 4I8OA 4RF1A 1NSFA 3FYCA 5EP4A 2Y21A 5EP2A 3GLHA 1OJLA 1OQYA 1Z5AA 4LJ7A 4OVZB 1FNNA 5FSWA 2M5ZA 3HU2A 3Q8XA 5ITUA 1D0LA 3HGIA 1IFYA 4IJFA 2K47A 2A5YB 1OFIA 4MGKE 3JR4A 4P16A 3J2PB 4LRSA 2ZAOA 3LQRA 2WSFF 1PJIA 1K3XA 1QDTA 1MJGM 4DR4M 4D80A 4LCBA 1NV8A 3GLIE 3GRRA 3C3DA 1VDLA 1XXHB 1Q39A 1JB0F 3K9OA 4D82A 4GKKM 4GRIA 4IBIA 2F4VM 1WGNA 4I81A 3FTFA 5EXPA 4FCVA 1A5TA 3GQ3A 4GH9A 1HNXM 3T38A 1DV0A 2ZM6M 2CEAA 2GQFA 3B74A 2LVAA 3KP1E 3FUTA 4M9SA 2OPFA 4G4QA 3QYBA 3D8LA 3SARA 3FUVA 3I04M 1XMQM 4YY3M 2C98A 5KQ8A 1HQCA 3MJ5A 3HKPA 4IIWA 3QYEA 3ZCBB 2K9DA 3TPZA 4JI5M 1DGHB 2MR9A 4M9XA 2BNKA 2DZLA 3CGWA 1L2BA 1WGLA 2QBYA 5E26A 1R2ZA 5DFLA 4B7FA 1OAOC 1WJ7A 3FTEA 2RKOA 2MROB 2Y20A 2R6FA 1PRBA 2DAGA 3KOYE 4JI4M 1WR1B 3UK6A 2X49A 2JY6B 1ZAEA 3SYLA 2DAIA 2K0BX 1V34A 4DR2M 2XEPA 3PNVA 1IN7A 2C9OA 4B3RM 3AJIB 2UXDM 3K8ZA 1JR3D 2V6ZM 2Z7JA 2ZBKB 1SXJA 4M9ZA 4XGIA 1IN4A 2R4EA 2D7EA 4IBCA 3J7BA 5ITYA 4L16A 1GLNA 3U6MA 4JI7M 2YFQA 4L8RC 4CIZA 3NBXX 1TGUA 2HWJA 4FW9A 2O5RA 4OU7A 2YR0A 4A3VB 2O01F 3E46A 3GPXA 5FTLA 3U5ZB 4JI0M 1AIPC 2DWZB 4NC6A 3CF0A 2CHVA 1V92A 4HL4A 1P3QQ 3LCVB 3TL4X 4YHHM 1VEJA 4FD2A 2M60A 3F92A 5ITRA 3A98B 3K9PA 1Q3CA 1QANA 3WHLA 4JV5M 5ITXA 1NHGC 4LJ6A 1IY1A 1YLAA 3GLHB 5EP3A 2UXCM 2FFJA 2F5PA 2I7NA 1DGBA 3FTDA 4PDIA 1MU5A 1HQYE 3FYDA 5KPZA 3AV0A 1Z5BA 3DZDA 5ITTA 2BWBA 4LF5M 4LJ5A 2LNHC 3J81S 3HU1A 1PM5A 2CHGA 1WIVA 2ZTCA 4OW0A 4UN2B 2J5YA 2ZANA 3AOEA 2BWEA 2KRUA 4GHLA 4LJAA 2KZUA 4IBDA 5FTJA 3AL0C 3LQQA 1IXSA 2QQ8A 1OTRA 1GJTA 1W5TA 2VDBB 3GLGB 3U61A 2KW0A 4IBFA 1NNUC 1ZV1A 2KNVA 3HHZA 3PVSA 4G4RA 1KFVA 3VKGA 1PJJA 4TUWA 4DV4M 1G59A 4LZJA 1C1KA 1G3IA 3B89A 1JR3E 3L26A 2F5OA 1NY5A 3U60A 1LTMA 1XWIA 2L4EA 5KPTA 2F5NA 1ORYB 3GLFE 2JNHA 2KNAA 3TWKA 3SYKA 2JY8A 3SATA 2Z4RA 2V1CA 1J7KA 4GKJM 3M7GA 2QBYB 2VQEM 1OIPA 1XNRM 2DWNA 1SG9A 3FUXA 3PFIA 4PCZA 3VKHA 1KSFX 4XK8F 1IY0A 1D0KA 2HAKA 4CISA 3C3EA 1ZMWA 2CE7A 4K0KM 3UMMA 4AI6A 1QQWA 1GVNA 2K6BA 1VQ1A 2LXEA 4DV1M 3QAUA 5GKNA 1MN3A 3GLIA 2J7OA 3GPYA 2JZ1A 1Z59A 1GABA 4GHAA 1IN5A 4I4LA 2ERCA 1N75A 3A42A 1SXJB 2BJWA 4LJ4A 5C18A 2VF7A 2EKKA 4IBEA 3RE8A 2Y0TA 2X4AA 4B3TM 2DZNB 4LJ8A 4FVMA 2BJVA 1R2YA 1HNWM 2I7PA 4HLQA 3JAMS
chains in the Genus database with same CATH topology
7CATA 4LZZA 3KSXA 1R6BX 5EXTA 4LGMA 3I51A 4IJEA 2DVWB 4S12A 2KXEA 1H6UA 2L7IA 4DR3M 5DYIA 2HL7A 2P5TA 4LFAM 4IBBA 4DR7M 1NJGA 3L2AA 3GO8A 1NHWC 2QZ4A 5LMUM 4DV6M 4MGHA 3PNYA 1W5SA 3KP0E 1X37A 4JYAM 3IG5A 1MX0A 2Z4SA 4GC5A 1N36M 2L7HA 4AZFA 3SHFA 4LF6M 4FWHA 2QCUA 2XH9A 2L6OA 2Z3XA 2XF3A 1XHBA 4W5WA 2JA2A 4MH0E 2XLJA 1TDZA 4IBKA 8CATA 5EP1A 1IXSB 3HHXA 2NQ8C 2XGNA 3U61B 4DR6M 4FWGA 2QPAA 5EQTA 1GL6A 2DWLA 4BB9A 3U60B 3GP1A 3L25A 2XFSA 4G4NA 2UUCM 2HCBA 1GKIA 2VQFM 4REZA 3HWSA 3FUUA 3GPPA 1N78A 1N32M 3EIEA 5JI2E 4NOOB 3H4MA 4JI3M 4BBAA 3U6SA 2FE8A 3GRUA 2DZOB 3W0LB 4NRWA 3CF6E 2HHHM 1NY6A 2FOIC 3GLIB 1N77A 3R8FA 3U6CA 4KHPM 3ZH9B 1HT2E 3KVWA 1I4WA 1G4AE 2RGOA 4Z8XA 2XFTA 3J7AS 3KOZE 1IXZA 3K92A 1L8QA 2VIIA 2EA0A 3SBJA 2W82A 4QHSA 4LGYA 4GC9A 2QP9X 1JR3A 3SAUA 1NJFA 4JI1M 4PDGA 5DYGA 5KPRA 3GLFA 2J7NA 1XXHA 3VK8A 4AKGA 4LG2A 1IY2A 3UJNA 2RGHA 4QOSA 3T1YM 2KRKA 4I5SA 5C1BA 3KOWE 3TWLA 4B3SM 1NNJA 3VFDA 1OFHA 1QYRA 4LF7M 4RNAA 4AQYM 4QHTA 1ZQ9A 4PD2A 2XSZD 4JI2M 3K1JA 4AW4A 3W0FA 3A46A 1R7RA 2C9CA 2OQ4A 3DOAA 4DV3M 2R45A 3U6OA 5E6JA 4AKIA 1L1ZA 4NL4H 4BLCA 3OTOM 2YQZA 1K3WA 4JN6A 2UXBM 3RGPA 1LV7A 2CFOA 5FLXS 1L2CA 2F5QA 3NWLA 5IZ7D 1FJGM 4QNRA 1E94E 2CV1A 3J27B 5KQDA 1HR0M 3C58A 3GQ4A 3GRVA 4LRTA 4ZPXA 1QZMA 4FCTA 2G5GX 4B7GA 3FD9A 4NXNM 4R7GA 3I4VA 3KS4A 1E32A 1YSYA 2C96A 1VDDA 2C5RA 4LF4M 4AG6A 1TDHA 5FTMA 3M6AA 4G4OA 4L15A 1DO2A 5H37D 2Q2EB 3WHKA 3VLFB 2F5SA 4DV2M 3LVVA 2R4JA 3M0EA 4LJ9A 3E9SA 4FWDA 1HT1E 2KEBA 3K2LA 5FTKA 1J09A 1K82A 2AHMA 3KFUG 4PT5A 1XMOM 4IBJA 3U6EA 3KDSE 2KZSA 2H1RA 1L1TA 4GIPA 4M0WA 3HU3A 5A2QS 3L27A 5F3WA 3VDPA 1IM2A 4X65M 4DR5M 3RGSA 3CTWB 1G8PA 1SXJC 1DO0A 4MGZE 1JQJC 5ITQA 2DXIA 4KO8A 3AFHA 3GLFB 1L2DA 1DGGA 4MGIE 1D2NA 5IWAM 1SXJD 1YUBA 4GITA 4JI6M 3GQ5A 2UU9M 2DHRA 1S3SA 5KO3A 2X8AA 2FNAA 3ILKA 3U6QA 4NXMM 3KSJA 3SFZA 3GLGA 3TE6A 4R3DA 4II7A 4OX9M 3DA1A 2R18A 2Y0QA 2R65A 4B7HA 1IQPA 1IN6A 4B3MM 4DV7M 3FKEA 1IBLM 3HJSA 2V1UA 3RFWA 4AG5A 4IBGA 4RF0A 3KXEC 1E9SA 2XZUA 4ITQA 3HJ8A 3SMSA 4LF8M 2UUBM 2CUZA 3SAWA 4NSOB 5BPVA 4KODA 3U6PA 5JI3E 1J5EM 3LMMA 3B9PA 1HNZM 3UGJA 4G6ZA 3GRYA 4X64M 2G8LA 1TH3A 3E4RA 5EXXA 1XC8A 2CV0A 2LWXA 3AOEC 1Z6TA 4CHTB 4NSRA 3BOSA 4NRVA 3TQSA 4EIWA 1Q3BA 3GPUA 4OVZA 1UM8A 1T3TA 3SAVA 1N33M 2QENA 2HKJA 4DV0M 1EE8A 3THGA 4FCWA 1WXQA 2KA6B 3LVWA 1IN8A 3A45A 3L29A 3KW6A 2R62A 3R9XB 2EUCA 1SXJE 2D7GA 4WW0A 3QWLA 4CGYB 1YE9A 5IREB 3UZUA 3L28A 4JXJA 4MB7A 4B08A 2L09A 2CHQA 3IG8A 5EXSA 3T15A 3SC3A 4L4UA 4Z6YA 2ZAMA 4D81A 4DUZM 2R46A 3I4YA 3PXGA 3MHVC 1G41A 4QNMA 3TWMA 2CV2A 3SHGB 5EJCA 3SASA 4LF9M 3EIHA 4LY6A 3D8BA 4DV5M 2YNMD 3SMPA 2XZFA 1QAQA 4MGYE 4X66M 1DGHA 4LFBM 5LMNM 3AOGA 3KS8A 5ITXE 3VDUA 1XNQM 3AKZA 2LH0A 3J80S 4AKHA 3NBIA 1Z5CA 3U6LA 3U6DA 4DR1M 3FUWA 4X62M 1N34M 4JI8M 2D7HA 1TH4A 2DWMA 1KYIA 2EO2A 5BR8M 1I94M 3MK6A 2E5LM 5IT9S 1GL7A 3KOXE 1IXRC 3ZC7B 5FTNA 4KLNA 1E9RA 1TH2A 1QAOA 4QOZC 1QVRA 3CF2A 2UUAM 4XBOA 2C99A 4LFCM 4GMQA 3JR5A 3T1HM 2XSZA 5DNYA 3HJQA 3VK7A 3HHYA 3U5ZA 1QAMA 4WURA 4L78A 4DUYM 4M0DA 4MM3B 1NVMA 3DFZA 3FTCA 1DGFA 3HHWA 1IBKM 1IBMM 4I8OA 4RF1A 1NSFA 3FYCA 5EP4A 2Y21A 5EP2A 3GLHA 1OJLA 1Z5AA 4LJ7A 4OVZB 1FNNA 5FSWA 2M5ZA 3HU2A 3Q8XA 5ITUA 3HGIA 4IJFA 2K47A 2A5YB 1OFIA 4MGKE 3JR4A 4P16A 3J2PB 4LRSA 2ZAOA 3LQRA 1PJIA 1K3XA 4DR4M 4D80A 4LCBA 3GRRA 1XXHB 1Q39A 4D82A 4GKKM 4GRIA 4IBIA 2F4VM 4I81A 3FTFA 5EXPA 4FCVA 3GQ3A 4GH9A 1HNXM 3T38A 2ZM6M 2CEAA 3KP1E 3FUTA 4M9SA 2OPFA 4G4QA 3D8LA 3SARA 3FUVA 1XMQM 4YY3M 2C98A 5KQ8A 1HQCA 3MJ5A 3HKPA 4IIWA 3ZCBB 3TPZA 4JI5M 1DGHB 4M9XA 2BNKA 1L2BA 2QBYA 5E26A 1R2ZA 4B7FA 3FTEA 2RKOA 2Y20A 3KOYE 4JI4M 3UK6A 2X49A 1ZAEA 3SYLA 4DR2M 2XEPA 3PNVA 1IN7A 2C9OA 4B3RM 3AJIB 2UXDM 3K8ZA 1JR3D 2V6ZM 2Z7JA 2ZBKB 1SXJA 4M9ZA 4XGIA 1IN4A 2R4EA 2D7EA 4IBCA 3J7BA 5ITYA 4L16A 1GLNA 3U6MA 4JI7M 2YFQA 4L8RC 1TGUA 4FW9A 4OU7A 2O5RA 2YR0A 4A3VB 3GPXA 5FTLA 3U5ZB 4JI0M 2DWZB 3CF0A 2CHVA 4HL4A 3TL4X 4YHHM 4FD2A 2M60A 5ITRA 3A98B 1Q3CA 1QANA 3WHLA 4JV5M 5ITXA 1NHGC 4LJ6A 1IY1A 3GLHB 5EP3A 2UXCM 2FFJA 2F5PA 2I7NA 1DGBA 3FTDA 4PDIA 1MU5A 1HQYE 3FYDA 5KPZA 3AV0A 1Z5BA 3DZDA 5ITTA 4LF5M 4LJ5A 2LNHC 3J81S 3HU1A 1PM5A 2CHGA 4OW0A 2ZANA 3AOEA 2KRUA 4GHLA 4LJAA 2KZUA 4IBDA 5FTJA 3AL0C 3LQQA 1W5TA 3GLGB 3U61A 2KW0A 4IBFA 1NNUC 3VKGA 4G4RA 3HHZA 3PVSA 1KFVA 1PJJA 4TUWA 4DV4M 1G59A 4LZJA 1C1KA 1G3IA 3L26A 2F5OA 1NY5A 3U60A 1XWIA 5KPTA 2F5NA 1ORYB 3TWKA 3SYKA 3SATA 2Z4RA 2V1CA 1J7KA 4GKJM 3M7GA 2QBYB 2VQEM 1XNRM 2DWNA 3FUXA 3PFIA 4PCZA 3VKHA 1KSFX 1IY0A 4CISA 2CE7A 4K0KM 3UMMA 4AI6A 1QQWA 1GVNA 4DV1M 2LXEA 3QAUA 5GKNA 3GLIA 2J7OA 3GPYA 1Z59A 4GHAA 1IN5A 4I4LA 2ERCA 1N75A 3A42A 1SXJB 2BJWA 4LJ4A 5C18A 4IBEA 3RE8A 2Y0TA 2X4AA 4B3TM 2DZNB 4LJ8A 4FVMA 2BJVA 1R2YA 1HNWM 2I7PA 4HLQA 3JAMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KA6 B; 
#chains in the Genus database with same CATH topology
 4DBG B;  7CAT A;  1QZE A;  4LZZ A;  4CJ6 A;  2LVO C;  2CRU A;  3KSX A;  1R6B X;  1G71 A;  4LGM A;  1QUS A;  3B7Z A;  3I51 A;  5EXT A;  4IJE A;  2DVW B;  4S12 A;  5L8R F;  2KXE A;  1H6U A;  1BVS A;  2L7I A;  1EFU B;  2L2D A;  5DYI A;  4DR3 M;  2HL7 A;  1XB2 B;  2LVP C;  2P5T A;  4LFA M;  4IBB A;  4DR7 M;  2LHC A;  1NJG A;  3L2A A;  3GO8 A;  1NHW C;  2QZ4 A;  3IEC A;  4F2L A;  5LMU M;  1WHC A;  2H5X A;  4DV6 M;  1R5L A;  4MGH A;  3PNY A;  1W5S A;  3B7N A;  1X37 A;  3KP0 E;  3IG5 A;  3ZQJ A;  4JYA M;  1MX0 A;  1GJS A;  4Y28 F;  2R0I A;  2Z4S A;  4GC5 A;  1N36 M;  4Q7J A;  2L7H A;  2OOB A;  4AZF A;  3SHF A;  4LF6 M;  4FWH A;  2QCU A;  2XH9 A;  2L6O A;  2Z3X A;  2XF3 A;  1XHB A;  2CWB A;  2JA2 A;  4MH0 E;  4W5W A;  4R71 A;  2XLJ A;  1TDZ A;  4IBK A;  8CAT A;  2DKL A;  1IXS B;  3HHX A;  2Z8Y M;  5EP1 A;  1OKS A;  2NQ8 C;  2XGN A;  3U61 B;  2LHG A;  3HZJ A;  4FWG A;  4DR6 M;  2QPA A;  5EQT A;  1GL6 A;  2DWL A;  4BB9 A;  3U60 B;  3GP1 A;  3L25 A;  2XFS A;  3W67 A;  4RKU F;  4G4N A;  2UUC M;  2HCB A;  1GKI A;  2VQF M;  4REZ A;  3HWS A;  3FUU A;  3GPP A;  1N78 A;  1N32 M;  3EIE A;  5JI2 E;  4NOO B;  3H4M A;  4JI3 M;  4BBA A;  3U6S A;  3HY5 A;  2FE8 A;  3GRU A;  2DZO B;  3W0L B;  3Q8G A;  3CF6 E;  2HHH M;  4NRW A;  1NY6 A;  2QSF X;  2FOI C;  3GLI B;  1N77 A;  3R8F A;  3U6C A;  4KHP M;  3ZH9 B;  1HT2 E;  1F4I A;  3KVW A;  1CUK A;  1VEG A;  1I4W A;  1G4A E;  2RGO A;  4Z8X A;  2XFT A;  3J7A S;  3KOZ E;  1IXZ A;  3K92 A;  1L8Q A;  1PJT A;  2JZ0 A;  2VII A;  2EA0 A;  3SBJ A;  2W82 A;  2ZTD A;  4QHS A;  2KDL A;  4LGY A;  4GC9 A;  2JUJ A;  2QP9 X;  1JR3 A;  3SAU A;  1NJF A;  4JI1 M;  4PDG A;  5DYG A;  5KPR A;  3GLF A;  2J7N A;  1XXH A;  3VK8 A;  4AKG A;  2R44 A;  1IY2 A;  4GEW A;  3UJN A;  4LG2 A;  2RGH A;  2KNZ A;  4QOS A;  3T1Y M;  2KRK A;  4I5S A;  5C1B A;  2VF8 A;  3KOW E;  3TWL A;  4B3S M;  2OOA A;  3VFD A;  1AUA A;  1OFH A;  1QYR A;  2QHO B;  1NNJ A;  4RNA A;  4LF7 M;  4AQY M;  4QHT A;  1ZQ9 A;  4PD2 A;  2XSZ D;  3H4J A;  4JI2 M;  3K1J A;  1PJQ A;  4AW4 A;  3W0F A;  3A46 A;  1R7R A;  2C9C A;  2OQ4 A;  3DOA A;  4DV3 M;  2R45 A;  3U6O A;  5E6J A;  4AKI A;  1HJP A;  1NV9 A;  1L1Z A;  4NL4 H;  4BLC A;  3OTO M;  2YQZ A;  1XXH E;  1K3W A;  4JN6 A;  4WP2 A;  3RGP A;  1LV7 A;  2CFO A;  2OO9 A;  5FLX S;  1UFZ A;  1L2C A;  2F5Q A;  2UXB M;  3NWL A;  5IZ7 D;  1FJG M;  4QNR A;  1E94 E;  2CV1 A;  3J27 B;  5KQD A;  1HR0 M;  3C58 A;  3GQ4 A;  3GRV A;  4LRT A;  4ZPX A;  1QZM A;  2WSC F;  4FCT A;  2G5G X;  3C9P A;  4B7G A;  3FD9 A;  4NXN M;  4R7G A;  1ZMV A;  3I4V A;  3KS4 A;  1E32 A;  1YSY A;  2C96 A;  1VDD A;  1T6O A;  2C5R A;  4AG6 A;  4LF4 M;  1TDH A;  4KT0 F;  2LVN C;  5FTM A;  2L4F A;  3M6A A;  3FRI A;  3W68 A;  4L15 A;  4G4O A;  1DO2 A;  3FE3 A;  5H37 D;  1RU3 A;  2Q2E B;  3WHK A;  3VLF B;  3LW5 F;  2F5S A;  4DV2 M;  3LVV A;  2R4J A;  3M0E A;  1QUT A;  4LJ9 A;  1R4G A;  3E9S A;  2GNO A;  4FWD A;  1HT1 E;  2KEB A;  3K2L A;  5FTK A;  1J09 A;  1K82 A;  2AHM A;  3B7Q A;  3KFU G;  3HX3 A;  4PT5 A;  1XMO M;  2JXN A;  4IBJ A;  1TF0 B;  3U6E A;  3KDS E;  2KZS A;  2H1R A;  1L1T A;  4GIP A;  4M0W A;  3E21 A;  3HU3 A;  5A2Q S;  1OIZ A;  3L27 A;  5F3W A;  1QDR A;  3VDP A;  1IM2 A;  2G3Q A;  4X65 M;  4DR5 M;  3RGS A;  2APL A;  3CTW B;  1G8P A;  1SXJ C;  1DO0 A;  4MGZ E;  1JQJ C;  5ITQ A;  2DXI A;  4KO8 A;  1T43 A;  3AFH A;  3GLF B;  1L2D A;  1DGG A;  3LCU A;  4MGI E;  1D2N A;  5IWA M;  2CP8 A;  1SXJ D;  1YUB A;  4GIT A;  2DAM A;  4JI6 M;  3GQ5 A;  3GLH E;  2UU9 M;  2DHR A;  1S3S A;  5KO3 A;  2X8A A;  2FNA A;  1PJS A;  3ILK A;  2FH0 A;  3U6Q A;  4NXM M;  3KSJ A;  3SFZ A;  3GLG A;  3TE6 A;  3FRH A;  4R3D A;  2QNJ A;  4II7 A;  4OX9 M;  3DA1 A;  2R18 A;  2MJ5 B;  2R65 A;  2Y0Q A;  1IQP A;  4B7H A;  3V76 A;  1IN6 A;  4B3M M;  4DV7 M;  3FKE A;  1IBL M;  3HJS A;  3IHP A;  2V1U A;  3RFW A;  2DI0 A;  4AG5 A;  4IBG A;  4RF0 A;  3T6P A;  3KXE C;  1E9S A;  2XZU A;  1VG5 A;  3HJ8 A;  4ITQ A;  2LTU A;  3SMS A;  4LF8 M;  2UUB M;  2CUZ A;  3SAW A;  4NSO B;  5BPV A;  4KOD A;  3U6P A;  5JI3 E;  1J5E M;  3I01 M;  3LMM A;  3GLG E;  3B9P A;  1HNZ M;  2JWS A;  3UGJ A;  4G6Z A;  2DEN A;  3GRY A;  4X64 M;  2G8L A;  1TH3 A;  1V33 A;  3E4R A;  1TR8 A;  5EXX A;  1XC8 A;  2LWX A;  2CV0 A;  3AOE C;  1Z6T A;  4CHT B;  4NSR A;  3BOS A;  4NRV A;  3TQS A;  4EIW A;  1Q3B A;  3BBZ A;  3GPU A;  4OVZ A;  1UM8 A;  1T3T A;  3SAV A;  1N33 M;  1OAI A;  2QEN A;  2HKJ A;  4DV0 M;  1EE8 A;  3MMP A;  3THG A;  4FCW A;  2EJS A;  2DAE A;  4G3O A;  2WSE F;  1WXQ A;  2KA6 B;  2WZJ A;  1IN8 A;  3LVW A;  3A45 A;  3L29 A;  3KW6 A;  2R62 A;  3R9X B;  1NO1 A;  2EUC A;  2JY5 A;  1C7Y A;  1SXJ E;  2D7G A;  4WW0 A;  3QWL A;  4CGY B;  1YE9 A;  5IRE B;  3UZU A;  1TTE A;  3L28 A;  4JXJ A;  4MB7 A;  4B08 A;  2L09 A;  2LBC A;  2CHQ A;  3IG8 A;  5EXS A;  3T15 A;  3SC3 A;  4L4U A;  4Z6Y A;  2ZAM A;  4D81 A;  4DUZ M;  2R46 A;  2EKF A;  2JY7 A;  2RRU A;  3I4Y A;  3PXG A;  3MHV C;  4HEO A;  1G41 A;  3BXW A;  4QNM A;  1ZMU A;  3TWM A;  2CV2 A;  3SHG B;  5EJC A;  3SAS A;  4LF9 M;  3EIH A;  4LY6 A;  3D8B A;  4DV5 M;  2YNM D;  3SMP A;  2XZF A;  2MH8 A;  1QAQ A;  4MGY E;  4X66 M;  1DGH A;  4LFB M;  5LMN M;  3AOG A;  3KS8 A;  4L6V 6;  5ITX E;  3VDU A;  1XNQ M;  3AKZ A;  2LH0 A;  2DHY A;  4F1I A;  2FS1 A;  3J80 S;  4AKH A;  3NBI A;  1Z5C A;  3U6L A;  2DAK A;  4DR1 M;  3FUW A;  2MGW A;  4X62 M;  3U6D A;  1N34 M;  4JI8 M;  2D7H A;  1TH4 A;  2DWM A;  1KYI A;  2N35 A;  2EO2 A;  5BR8 M;  1I94 M;  1D0M A;  3MK6 A;  2E5L M;  4P17 A;  5IT9 S;  1Y8G A;  1GL7 A;  1Q02 A;  3KOX E;  2DNA A;  2JP7 A;  1IXR C;  3ZC7 B;  5FTN A;  4KLN A;  1E9R A;  1TH2 A;  1QAO A;  4QOZ C;  1QVR A;  3CF2 A;  2UUA M;  4XBO A;  2C99 A;  2O25 A;  4LFC M;  4GMQ A;  2B3T A;  4ANR A;  3JR5 A;  3T1H M;  1PGY A;  2XSZ A;  5DNY A;  3HJQ A;  3VK7 A;  3HHY A;  3U5Z A;  1QAM A;  1VEK A;  4WUR A;  4L78 A;  4DUY M;  1EIJ A;  4M0D A;  4MM3 B;  1NVM A;  3DFZ A;  3FTC A;  2KHH A;  1DGF A;  2LVQ D;  3HHW A;  1GO5 A;  1IBK M;  1IBM M;  4I8O A;  4RF1 A;  1NSF A;  3FYC A;  5EP4 A;  2Y21 A;  5EP2 A;  3GLH A;  1OJL A;  1OQY A;  1Z5A A;  4LJ7 A;  4OVZ B;  1FNN A;  5FSW A;  2M5Z A;  3HU2 A;  3Q8X A;  5ITU A;  1D0L A;  3HGI A;  1IFY A;  4IJF A;  2K47 A;  2A5Y B;  1OFI A;  4MGK E;  3JR4 A;  4P16 A;  3J2P B;  4LRS A;  2ZAO A;  3LQR A;  2WSF F;  1PJI A;  1K3X A;  1QDT A;  1MJG M;  4DR4 M;  4D80 A;  4LCB A;  1NV8 A;  3GLI E;  3GRR A;  3C3D A;  1VDL A;  1XXH B;  1Q39 A;  1JB0 F;  3K9O A;  4D82 A;  4GKK M;  4GRI A;  4IBI A;  2F4V M;  1WGN A;  4I81 A;  3FTF A;  5EXP A;  4FCV A;  1A5T A;  3GQ3 A;  4GH9 A;  1HNX M;  3T38 A;  1DV0 A;  2ZM6 M;  2CEA A;  2GQF A;  3B74 A;  2LVA A;  3KP1 E;  3FUT A;  4M9S A;  2OPF A;  4G4Q A;  3QYB A;  3D8L A;  3SAR A;  3FUV A;  3I04 M;  1XMQ M;  4YY3 M;  2C98 A;  5KQ8 A;  1HQC A;  3MJ5 A;  3HKP A;  4IIW A;  3QYE A;  3ZCB B;  2K9D A;  3TPZ A;  4JI5 M;  1DGH B;  2MR9 A;  4M9X A;  2BNK A;  2DZL A;  3CGW A;  1L2B A;  1WGL A;  2QBY A;  5E26 A;  1R2Z A;  5DFL A;  4B7F A;  1OAO C;  1WJ7 A;  3FTE A;  2RKO A;  2MRO B;  2Y20 A;  2R6F A;  1PRB A;  2DAG A;  3KOY E;  4JI4 M;  1WR1 B;  3UK6 A;  2X49 A;  2JY6 B;  1ZAE A;  3SYL A;  2DAI A;  2K0B X;  1V34 A;  4DR2 M;  2XEP A;  3PNV A;  1IN7 A;  2C9O A;  4B3R M;  3AJI B;  2UXD M;  3K8Z A;  1JR3 D;  2V6Z M;  2Z7J A;  2ZBK B;  1SXJ A;  4M9Z A;  4XGI A;  1IN4 A;  2R4E A;  2D7E A;  4IBC A;  3J7B A;  5ITY A;  4L16 A;  1GLN A;  3U6M A;  4JI7 M;  2YFQ A;  4L8R C;  4CIZ A;  3NBX X;  1TGU A;  2HWJ A;  4FW9 A;  2O5R A;  4OU7 A;  2YR0 A;  4A3V B;  2O01 F;  3E46 A;  3GPX A;  5FTL A;  3U5Z B;  4JI0 M;  1AIP C;  2DWZ B;  4NC6 A;  3CF0 A;  2CHV A;  1V92 A;  4HL4 A;  1P3Q Q;  3LCV B;  3TL4 X;  4YHH M;  1VEJ A;  4FD2 A;  2M60 A;  3F92 A;  5ITR A;  3A98 B;  3K9P A;  1Q3C A;  1QAN A;  3WHL A;  4JV5 M;  5ITX A;  1NHG C;  4LJ6 A;  1IY1 A;  1YLA A;  3GLH B;  5EP3 A;  2UXC M;  2FFJ A;  2F5P A;  2I7N A;  1DGB A;  3FTD A;  4PDI A;  1MU5 A;  1HQY E;  3FYD A;  5KPZ A;  3AV0 A;  1Z5B A;  3DZD A;  5ITT A;  2BWB A;  4LF5 M;  4LJ5 A;  2LNH C;  3J81 S;  3HU1 A;  1PM5 A;  2CHG A;  1WIV A;  2ZTC A;  4OW0 A;  4UN2 B;  2J5Y A;  2ZAN A;  3AOE A;  2BWE A;  2KRU A;  4GHL A;  4LJA A;  2KZU A;  4IBD A;  5FTJ A;  3AL0 C;  3LQQ A;  1IXS A;  2QQ8 A;  1OTR A;  1GJT A;  1W5T A;  2VDB B;  3GLG B;  3U61 A;  2KW0 A;  4IBF A;  1NNU C;  1ZV1 A;  2KNV A;  3HHZ A;  3PVS A;  4G4R A;  1KFV A;  3VKG A;  1PJJ A;  4TUW A;  4DV4 M;  1G59 A;  4LZJ A;  1C1K A;  1G3I A;  3B89 A;  1JR3 E;  3L26 A;  2F5O A;  1NY5 A;  3U60 A;  1LTM A;  1XWI A;  2L4E A;  5KPT A;  2F5N A;  1ORY B;  3GLF E;  2JNH A;  2KNA A;  3TWK A;  3SYK A;  2JY8 A;  3SAT A;  2Z4R A;  2V1C A;  1J7K A;  4GKJ M;  3M7G A;  2QBY B;  2VQE M;  1OIP A;  1XNR M;  2DWN A;  1SG9 A;  3FUX A;  3PFI A;  4PCZ A;  3VKH A;  1KSF X;  4XK8 F;  1IY0 A;  1D0K A;  2HAK A;  4CIS A;  3C3E A;  1ZMW A;  2CE7 A;  4K0K M;  3UMM A;  4AI6 A;  1QQW A;  1GVN A;  2K6B A;  1VQ1 A;  2LXE A;  4DV1 M;  3QAU A;  5GKN A;  1MN3 A;  3GLI A;  2J7O A;  3GPY A;  2JZ1 A;  1Z59 A;  1GAB A;  4GHA A;  1IN5 A;  4I4L A;  2ERC A;  1N75 A;  3A42 A;  1SXJ B;  2BJW A;  4LJ4 A;  5C18 A;  2VF7 A;  2EKK A;  4IBE A;  3RE8 A;  2Y0T A;  2X4A A;  4B3T M;  2DZN B;  4LJ8 A;  4FVM A;  2BJV A;  1R2Y A;  1HNW M;  2I7P A;  4HLQ A;  3JAM S; 
#chains in the Genus database with same CATH homology
 7CAT A;  4LZZ A;  3KSX A;  1R6B X;  5EXT A;  4LGM A;  3I51 A;  4IJE A;  2DVW B;  4S12 A;  2KXE A;  1H6U A;  2L7I A;  4DR3 M;  5DYI A;  2HL7 A;  2P5T A;  4LFA M;  4IBB A;  4DR7 M;  1NJG A;  3L2A A;  3GO8 A;  1NHW C;  2QZ4 A;  5LMU M;  4DV6 M;  4MGH A;  3PNY A;  1W5S A;  3KP0 E;  1X37 A;  4JYA M;  3IG5 A;  1MX0 A;  2Z4S A;  4GC5 A;  1N36 M;  2L7H A;  4AZF A;  3SHF A;  4LF6 M;  4FWH A;  2QCU A;  2XH9 A;  2L6O A;  2Z3X A;  2XF3 A;  1XHB A;  4W5W A;  2JA2 A;  4MH0 E;  2XLJ A;  1TDZ A;  4IBK A;  8CAT A;  5EP1 A;  1IXS B;  3HHX A;  2NQ8 C;  2XGN A;  3U61 B;  4DR6 M;  4FWG A;  2QPA A;  5EQT A;  1GL6 A;  2DWL A;  4BB9 A;  3U60 B;  3GP1 A;  3L25 A;  2XFS A;  4G4N A;  2UUC M;  2HCB A;  1GKI A;  2VQF M;  4REZ A;  3HWS A;  3FUU A;  3GPP A;  1N78 A;  1N32 M;  3EIE A;  5JI2 E;  4NOO B;  3H4M A;  4JI3 M;  4BBA A;  3U6S A;  2FE8 A;  3GRU A;  2DZO B;  3W0L B;  4NRW A;  3CF6 E;  2HHH M;  1NY6 A;  2FOI C;  3GLI B;  1N77 A;  3R8F A;  3U6C A;  4KHP M;  3ZH9 B;  1HT2 E;  3KVW A;  1I4W A;  1G4A E;  2RGO A;  4Z8X A;  2XFT A;  3J7A S;  3KOZ E;  1IXZ A;  3K92 A;  1L8Q A;  2VII A;  2EA0 A;  3SBJ A;  2W82 A;  4QHS A;  4LGY A;  4GC9 A;  2QP9 X;  1JR3 A;  3SAU A;  1NJF A;  4JI1 M;  4PDG A;  5DYG A;  5KPR A;  3GLF A;  2J7N A;  1XXH A;  3VK8 A;  4AKG A;  4LG2 A;  1IY2 A;  3UJN A;  2RGH A;  4QOS A;  3T1Y M;  2KRK A;  4I5S A;  5C1B A;  3KOW E;  3TWL A;  4B3S M;  1NNJ A;  3VFD A;  1OFH A;  1QYR A;  4LF7 M;  4RNA A;  4AQY M;  4QHT A;  1ZQ9 A;  4PD2 A;  2XSZ D;  4JI2 M;  3K1J A;  4AW4 A;  3W0F A;  3A46 A;  1R7R A;  2C9C A;  2OQ4 A;  3DOA A;  4DV3 M;  2R45 A;  3U6O A;  5E6J A;  4AKI A;  1L1Z A;  4NL4 H;  4BLC A;  3OTO M;  2YQZ A;  1K3W A;  4JN6 A;  2UXB M;  3RGP A;  1LV7 A;  2CFO A;  5FLX S;  1L2C A;  2F5Q A;  3NWL A;  5IZ7 D;  1FJG M;  4QNR A;  1E94 E;  2CV1 A;  3J27 B;  5KQD A;  1HR0 M;  3C58 A;  3GQ4 A;  3GRV A;  4LRT A;  4ZPX A;  1QZM A;  4FCT A;  2G5G X;  4B7G A;  3FD9 A;  4NXN M;  4R7G A;  3I4V A;  3KS4 A;  1E32 A;  1YSY A;  2C96 A;  1VDD A;  2C5R A;  4LF4 M;  4AG6 A;  1TDH A;  5FTM A;  3M6A A;  4G4O A;  4L15 A;  1DO2 A;  5H37 D;  2Q2E B;  3WHK A;  3VLF B;  2F5S A;  4DV2 M;  3LVV A;  2R4J A;  3M0E A;  4LJ9 A;  3E9S A;  4FWD A;  1HT1 E;  2KEB A;  3K2L A;  5FTK A;  1J09 A;  1K82 A;  2AHM A;  3KFU G;  4PT5 A;  1XMO M;  4IBJ A;  3U6E A;  3KDS E;  2KZS A;  2H1R A;  1L1T A;  4GIP A;  4M0W A;  3HU3 A;  5A2Q S;  3L27 A;  5F3W A;  3VDP A;  1IM2 A;  4X65 M;  4DR5 M;  3RGS A;  3CTW B;  1G8P A;  1SXJ C;  1DO0 A;  4MGZ E;  1JQJ C;  5ITQ A;  2DXI A;  4KO8 A;  3AFH A;  3GLF B;  1L2D A;  1DGG A;  4MGI E;  1D2N A;  5IWA M;  1SXJ D;  1YUB A;  4GIT A;  4JI6 M;  3GQ5 A;  2UU9 M;  2DHR A;  1S3S A;  5KO3 A;  2X8A A;  2FNA A;  3ILK A;  3U6Q A;  4NXM M;  3KSJ A;  3SFZ A;  3GLG A;  3TE6 A;  4R3D A;  4II7 A;  4OX9 M;  3DA1 A;  2R18 A;  2Y0Q A;  2R65 A;  4B7H A;  1IQP A;  1IN6 A;  4B3M M;  4DV7 M;  3FKE A;  1IBL M;  3HJS A;  2V1U A;  3RFW A;  4AG5 A;  4IBG A;  4RF0 A;  3KXE C;  1E9S A;  2XZU A;  4ITQ A;  3HJ8 A;  3SMS A;  4LF8 M;  2UUB M;  2CUZ A;  3SAW A;  4NSO B;  5BPV A;  4KOD A;  3U6P A;  5JI3 E;  1J5E M;  3LMM A;  3B9P A;  1HNZ M;  3UGJ A;  4G6Z A;  3GRY A;  4X64 M;  2G8L A;  1TH3 A;  3E4R A;  5EXX A;  1XC8 A;  2CV0 A;  2LWX A;  3AOE C;  1Z6T A;  4CHT B;  4NSR A;  3BOS A;  4NRV A;  3TQS A;  4EIW A;  1Q3B A;  3GPU A;  4OVZ A;  1UM8 A;  1T3T A;  3SAV A;  1N33 M;  2QEN A;  2HKJ A;  4DV0 M;  1EE8 A;  3THG A;  4FCW A;  1WXQ A;  2KA6 B;  3LVW A;  1IN8 A;  3A45 A;  3L29 A;  3KW6 A;  2R62 A;  3R9X B;  2EUC A;  1SXJ E;  2D7G A;  4WW0 A;  3QWL A;  4CGY B;  1YE9 A;  5IRE B;  3UZU A;  3L28 A;  4JXJ A;  4MB7 A;  4B08 A;  2L09 A;  2CHQ A;  3IG8 A;  5EXS A;  3T15 A;  3SC3 A;  4L4U A;  4Z6Y A;  2ZAM A;  4D81 A;  4DUZ M;  2R46 A;  3I4Y A;  3PXG A;  3MHV C;  1G41 A;  4QNM A;  3TWM A;  2CV2 A;  3SHG B;  5EJC A;  3SAS A;  4LF9 M;  3EIH A;  4LY6 A;  3D8B A;  4DV5 M;  2YNM D;  3SMP A;  2XZF A;  1QAQ A;  4MGY E;  4X66 M;  1DGH A;  4LFB M;  5LMN M;  3AOG A;  3KS8 A;  5ITX E;  3VDU A;  1XNQ M;  3AKZ A;  2LH0 A;  3J80 S;  4AKH A;  3NBI A;  1Z5C A;  3U6L A;  3U6D A;  4DR1 M;  3FUW A;  4X62 M;  1N34 M;  4JI8 M;  2D7H A;  1TH4 A;  2DWM A;  1KYI A;  2EO2 A;  5BR8 M;  1I94 M;  3MK6 A;  2E5L M;  5IT9 S;  1GL7 A;  3KOX E;  1IXR C;  3ZC7 B;  5FTN A;  4KLN A;  1E9R A;  1TH2 A;  1QAO A;  4QOZ C;  1QVR A;  3CF2 A;  2UUA M;  4XBO A;  2C99 A;  4LFC M;  4GMQ A;  3JR5 A;  3T1H M;  2XSZ A;  5DNY A;  3HJQ A;  3VK7 A;  3HHY A;  3U5Z A;  1QAM A;  4WUR A;  4L78 A;  4DUY M;  4M0D A;  4MM3 B;  1NVM A;  3DFZ A;  3FTC A;  1DGF A;  3HHW A;  1IBK M;  1IBM M;  4I8O A;  4RF1 A;  1NSF A;  3FYC A;  5EP4 A;  2Y21 A;  5EP2 A;  3GLH A;  1OJL A;  1Z5A A;  4LJ7 A;  4OVZ B;  1FNN A;  5FSW A;  2M5Z A;  3HU2 A;  3Q8X A;  5ITU A;  3HGI A;  4IJF A;  2K47 A;  2A5Y B;  1OFI A;  4MGK E;  3JR4 A;  4P16 A;  3J2P B;  4LRS A;  2ZAO A;  3LQR A;  1PJI A;  1K3X A;  4DR4 M;  4D80 A;  4LCB A;  3GRR A;  1XXH B;  1Q39 A;  4D82 A;  4GKK M;  4GRI A;  4IBI A;  2F4V M;  4I81 A;  3FTF A;  5EXP A;  4FCV A;  3GQ3 A;  4GH9 A;  1HNX M;  3T38 A;  2ZM6 M;  2CEA A;  3KP1 E;  3FUT A;  4M9S A;  2OPF A;  4G4Q A;  3D8L A;  3SAR A;  3FUV A;  1XMQ M;  4YY3 M;  2C98 A;  5KQ8 A;  1HQC A;  3MJ5 A;  3HKP A;  4IIW A;  3ZCB B;  3TPZ A;  4JI5 M;  1DGH B;  4M9X A;  2BNK A;  1L2B A;  2QBY A;  5E26 A;  1R2Z A;  4B7F A;  3FTE A;  2RKO A;  2Y20 A;  3KOY E;  4JI4 M;  3UK6 A;  2X49 A;  1ZAE A;  3SYL A;  4DR2 M;  2XEP A;  3PNV A;  1IN7 A;  2C9O A;  4B3R M;  3AJI B;  2UXD M;  3K8Z A;  1JR3 D;  2V6Z M;  2Z7J A;  2ZBK B;  1SXJ A;  4M9Z A;  4XGI A;  1IN4 A;  2R4E A;  2D7E A;  4IBC A;  3J7B A;  5ITY A;  4L16 A;  1GLN A;  3U6M A;  4JI7 M;  2YFQ A;  4L8R C;  1TGU A;  4FW9 A;  4OU7 A;  2O5R A;  2YR0 A;  4A3V B;  3GPX A;  5FTL A;  3U5Z B;  4JI0 M;  2DWZ B;  3CF0 A;  2CHV A;  4HL4 A;  3TL4 X;  4YHH M;  4FD2 A;  2M60 A;  5ITR A;  3A98 B;  1Q3C A;  1QAN A;  3WHL A;  4JV5 M;  5ITX A;  1NHG C;  4LJ6 A;  1IY1 A;  3GLH B;  5EP3 A;  2UXC M;  2FFJ A;  2F5P A;  2I7N A;  1DGB A;  3FTD A;  4PDI A;  1MU5 A;  1HQY E;  3FYD A;  5KPZ A;  3AV0 A;  1Z5B A;  3DZD A;  5ITT A;  4LF5 M;  4LJ5 A;  2LNH C;  3J81 S;  3HU1 A;  1PM5 A;  2CHG A;  4OW0 A;  2ZAN A;  3AOE A;  2KRU A;  4GHL A;  4LJA A;  2KZU A;  4IBD A;  5FTJ A;  3AL0 C;  3LQQ A;  1W5T A;  3GLG B;  3U61 A;  2KW0 A;  4IBF A;  1NNU C;  3VKG A;  4G4R A;  3HHZ A;  3PVS A;  1KFV A;  1PJJ A;  4TUW A;  4DV4 M;  1G59 A;  4LZJ A;  1C1K A;  1G3I A;  3L26 A;  2F5O A;  1NY5 A;  3U60 A;  1XWI A;  5KPT A;  2F5N A;  1ORY B;  3TWK A;  3SYK A;  3SAT A;  2Z4R A;  2V1C A;  1J7K A;  4GKJ M;  3M7G A;  2QBY B;  2VQE M;  1XNR M;  2DWN A;  3FUX A;  3PFI A;  4PCZ A;  3VKH A;  1KSF X;  1IY0 A;  4CIS A;  2CE7 A;  4K0K M;  3UMM A;  4AI6 A;  1QQW A;  1GVN A;  4DV1 M;  2LXE A;  3QAU A;  5GKN A;  3GLI A;  2J7O A;  3GPY A;  1Z59 A;  4GHA A;  1IN5 A;  4I4L A;  2ERC A;  1N75 A;  3A42 A;  1SXJ B;  2BJW A;  4LJ4 A;  5C18 A;  4IBE A;  3RE8 A;  2Y0T A;  2X4A A;  4B3T M;  2DZN B;  4LJ8 A;  4FVM A;  2BJV A;  1R2Y A;  1HNW M;  2I7P A;  4HLQ A;  3JAM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...