2KA6B

Nmr structure of the cbp-taz2/stat1-tad complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSHMSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural basis for recruitment of CBP/p300 coactivators by STAT1 and STAT2 transactivation domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12162 STAT1_TAZ2bind STAT1 TAZ2 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ka6B00
2KA6B
chains in the Genus database with same CATH superfamily
2JUJA 2KHHA 3A42A 2JY8A 4MGIE 1OKSA 2C5RA 2Z8YM 2LVOC 2BWBA 4ANRA 2ZAOA 4L6V6 4G4OA 4G6ZA 2XFTA 5EXPA 1UFZA 3KDSE 1IN6A 4PCZA 5LMNM 1NV8A 2EA0A 2CV1A 1QANA 4OX9M 1LV7A 1Z59A 4NOOB 2H1RA 3C3DA 2DVWB 5FTNA 5C1BA 3ZCBB 3TL4X 2I7NA 1XNQM 2RRUA 4GEWA 2QBYA 4B08A 3WHLA 1HQYE 3U6DA 3HX3A 4FCWA 3UGJA 4TUWA 3FE3A 1GO5A 2CHGA 1N78A 2XZFA 1G8PA 2RKOA 3DFZA 4REZA 3W67A 5ITTA 3U6CA 2M60A 3DOAA 3MK6A 3ILKA 3DA1A 3LVVA 3HHYA 3UMMA 3HU3A 1L1TA 2EUCA 2LXEA 2CRUA 2QBYB 2M5ZA 3GLFE 4LF4M 4FW9A 1QYRA 2LHCA 3GPYA 3SYKA 2DAMA 5IWAM 3SATA 1QVRA 1HT1E 3I4YA 5KPTA 1PJSA 1IXZA 1ZV1A 4JN6A 3PXGA 1IY2A 4ZPXA 1NJFA 4A3VB 2XEPA 4JYAM 4RNAA 3U6OA 1D0KA 1VEGA 1SXJE 2KDLA 3HHXA 4PD2A 1QQWA 3KOZE 4LJ6A 1T6OA 4NRWA 4X65M 3AV0A 2ZAMA 2G3QA 2V6ZM 1HT2E 3L25A 3FTFA 3U6PA 3VK8A 1XXHB 4G3OA 1J5EM 3HU1A 1Q3CA 4JI5M 3KP1E 3SC3A 2FFJA 2OOBA 3GRRA 3H4MA 4L16A 3IG8A 3KVWA 2XFSA 2QHOB 2MH8A 3J2PB 1D2NA 5KQ8A 1WHCA 5LMUM 3FUWA 4IBEA 3UK6A 2WSEF 3FRIA 3RGSA 3SASA 3KFUG 2ERCA 4GH9A 4LF6M 4LFBM 1KSFX 5KQDA 2ZM6M 1TF0B 1OIPA 2C98A 4DR4M 4RKUF 1XC8A 1GJTA 4LCBA 3VK7A 1E94E 2HCBA 3U61A 2APLA 5ITXE 1QZEA 3RE8A 1PJQA 1HJPA 1NHGC 3LCUA 3QAUA 1XMOM 3U6LA 2R4EA 2HWJA 3J80S 2MR9A 2LVAA 3SMSA 2DHYA 3FUXA 5JI3E 1HNZM 3AKZA 2CUZA 2FNAA 2O25A 4P16A 1EE8A 2OPFA 5FTLA 3TWMA 3KOWE 1DGGA 3U61B 4QHTA 1V92A 1QDRA 2BNKA 2DAEA 2KEBA 4HLQA 4NSOB 5EP1A 3A98B 2AHMA 2EJSA 3D8BA 5IREB 3HGIA 2VQEM 5ITRA 4IJFA 3B89A 3LVWA 3MJ5A 4JXJA 5KO3A 2LWXA 3U6MA 3AOGA 1XB2B 3OTOM 3Q8XA 2JA2A 4KODA 4AG5A 4MGYE 4S12A 1N77A 3SBJA 2R65A 3CTWB 3E4RA 1DO0A 4IBJA 4NSRA 3ZQJA 2FS1A 2R18A 2W82A 1IN8A 4P17A 4GHAA 1FJGM 3E9SA 2J5YA 5EP4A 1ORYB 2HAKA 2GQFA 4B3TM 2ZANA 4DR2M 3M0EA 2J7OA 3GLHE 5ITUA 1J7KA 1YE9A 3AOEC 3K9PA 3VDUA 1QUTA 4AKIA 1TDHA 1OAOC 2EO2A 3SHFA 3K1JA 4R7GA 3GP1A 2K47A 5IZ7D 2B3TA 3KP0E 3Q8GA 1I94M 2F5QA 4DBGB 5FTJA 3FRHA 3IG5A 4I81A 3GQ5A 3A45A 3GLFB 4BBAA 1PRBA 2L4FA 2Q2EB 2Y20A 5FTKA 1NJGA 2O5RA 1G71A 1V34A 2C9OA 3B7QA 3U5ZA 1Q39A 3TQSA 1XNRM 2HHHM 2CEAA 2QZ4A 3IECA 4GMQA 1QAOA 4LGMA 4M9XA 5EXSA 5IT9S 4Y28F 2LTUA 1MU5A 2D7EA 3M7GA 4BB9A 4B3MM 2L6OA 4LRTA 2O01F 5DFLA 3VKHA 3SMPA 2DWLA 1GKIA 2D7HA 4WW0A 3EIEA 1PJJA 1L8QA 4NXNM 4AZFA 4K0KM 4RF0A 2GNOA 5A2QS 3MHVC 4JI6M 3J7BA 3SAUA 2JY7A 4M9SA 5BR8M 4MGKE 3U5ZB 4BLCA 1Z6TA 1Z5AA 2L7HA 2DZNB 1Z5BA 2DAKA 2UUAM 1DGBA 1TGUA 2JXNA 3JR4A 4R3DA 1UM8A 2BWEA 1L1ZA 4KHPM 4LRSA 1D0LA 2RGHA 4PT5A 1Q02A 3D8LA 4GKJM 2F5SA 2H5XA 5EP2A 4DV0M 4KO8A 1DGHA 3VLFB 3KOYE 3GQ3A 2XGNA 4DV3M 1R4GA 5F3WA 1SG9A 3L27A 4AG6A 1YLAA 5KPZA 1TDZA 2XF3A 1PGYA 1GVNA 2DWZB 3PFIA 2KNAA 4QHSA 1XXHA 3FUUA 1NVMA 4CIZA 1G59A 4NL4H 4DR7M 2CWBA 2UU9M 3W0LB 4RF1A 2QPAA 2VIIA 4LF8M 2EKFA 3B9PA 2F5NA 4DR6M 2N35A 2K9DA 2QQ8A 5DNYA 1XWIA 1VQ1A 3I04M 2X4AA 4IBFA 4PDIA 3GLIA 2HKJA 2DXIA 2VDBB 3RFWA 5E26A 4IBGA 1DGHB 4DV4M 3R8FA 4LJAA 2XLJA 3RGPA 1IBKM 3J27B 3B74A 3W0FA 2QENA 4L8RC 3BOSA 3TWKA 3GLHA 3HHWA 3LCVB 3HU2A 4Q7JA 4FCVA 1W5TA 4JI7M 3HWSA 4II7A 3L2AA 3GLIB 1TH2A 2C96A 1NY5A 2R4JA 3KSJA 1VG5A 2KZSA 3I01M 4JI0M 3GLGA 3AJIB 2UUBM 4GHLA 2P5TA 1E9RA 4JV5M 2UXDM 4M9ZA 2OOAA 4NXMM 3BXWA 3FTDA 3GPPA 1JR3E 2WSCF 3GLHB 3K8ZA 1AIPC 2X49A 3FUTA 3SARA 4OW0A 1T43A 2JY5A 2X8AA 2I7PA 1HNXM 4IBBA 2D7GA 4IBIA 1N32M 1SXJC 3AFHA 5EQTA 4ITQA 4DR5M 3GLGB 1KYIA 3QYBA 2KRUA 2CV0A 4WP2A 2KA6B 3WHKA 2KW0A 4B7HA 4D80A 3L29A 2F5OA 2VF7A 2R6FA 1YSYA 3L28A 3R9XB 3PNYA 3UZUA 3TWLA 5H37D 1GLNA 1BVSA 3VFDA 4LJ8A 5EJCA 1OIZA 2ZBKB 3FYDA 1F4IA 1ZMUA 1R7RA 4JI2M 2QNJA 4GITA 1C7YA 3GQ4A 4LJ7A 8CATA 5EXTA 4AI6A 4Z8XA 2OQ4A 1SXJD 2WZJA 1K82A 1QDTA 2DHRA 3NBIA 4JI8M 2F5PA 2XSZD 3KOXE 1VDDA 4R71A 3FD9A 1IM2A 1HNWM 4GRIA 5DYGA 3GLFA 4B3SM 1N75A 5ITYA 3HJQA 4DV6M 4IBKA 1NHWC 1OJLA 3THGA 4LZZA 1E9SA 3U60A 3FUVA 3V76A 5FSWA 1X37A 3I51A 4I4LA 4KT0F 2FOIC 5L8RF 1SXJA 1N33M 1LTMA 4LF9M 4G4NA 1ZAEA 2ZTDA 2V1CA 1PJIA 4B7GA 1HQCA 2LVNC 2R44A 1E32A 5BPVA 1H6UA 1JR3D 3CF6E 4DR3M 2YR0A 4QOSA 1OFIA 2Z7JA 3U60B 1WIVA 1IXSA 3E21A 3J7AS 1MN3A 1SXJB 2RGOA 1L2BA 3T15A 2L7IA 2CP8A 3KSXA 1RU3A 2Y0TA 1NV9A 2C9CA 2DI0A 4LZJA 2Z4RA 1V33A 1K3XA 4LFAM 5ITXA 3BBZA 2DZOB 2QP9X 3I4VA 1QAMA 5FLXS 1OFHA 3TPZA 4F2LA 2KNZA 1QZMA 1GL6A 1W5SA 4CISA 1R2ZA 1AUAA 1PM5A 2DZLA 3HHZA 1IXSB 1WR1B 2A5YB 4MH0E 1QUSA 3SYLA 1R5LA 2VQFM 1IBLM 1DO2A 1WGLA 2K0BX 3NWLA 3AOEA 2Z4SA 4IBDA 1A5TA 3B7NA 3AL0C 1GABA 2JY6B 4AW4A 1L2CA 2L4EA 2CHQA 1TH3A 4G4RA 1L2DA 2R62A 3F92A 3TE6A 4LJ9A 2MGWA 4LF7M 4I5SA 4NRVA 4L78A 3GRUA 1C1KA 4FCTA 2YQZA 4W5WA 4DV2M 4M0WA 2DNAA 2KZUA 2YFQA 3KXEC 4GIPA 4MGHA 3T38A 2EKKA 3QWLA 4DUZM 4D81A 2K6BA 2MJ5B 4LJ5A 5EXXA 1TR8A 2Z3XA 3FTCA 1I4WA 1J09A 2CV2A 2DKLA 2Y21A 1OTRA 2XH9A 1S3SA 4CHTB 5C18A 1Q3BA 2MROB 3HY5A 1VEKA 2BJWA 2LH0A 2FH0A 2G8LA 4EIWA 1N34M 3HKPA 4XK8F 4X66M 3C3EA 5DYIA 1DV0A 3T1YM 3MMPA 4YY3M 4GC5A 3K9OA 4UN2B 3JR5A 1NO1A 4FWHA 1N36M 1MX0A 1VDLA 4X62M 1JQJC 2LHGA 1NY6A 4OU7A 3A46A 2CE7A 2JNHA 2R45A 1DGFA 3GPXA 4DR1M 4FD2A 1WXQA 4AKGA 2C99A 2JZ1A 3GPUA 1OQYA 4JI4M 3FTEA 3VKGA 3SAVA 3NBXX 5E6JA 3L26A 4QOZC 4JI3M 2BJVA 1G3IA 4MGZE 4QNRA 3KS8A 4FWDA 4IIWA 2DWMA 3HZJA 5EP3A 3GRVA 3QYEA 4IBCA 2L2DA 3UJNA 4YHHM 4DV1M 3E46A 1IN5A 3LW5F 2KNVA 4XBOA 7CATA 5JI2E 1ZMVA 4AQYM 3T1HM 2KRKA 4I8OA 4XGIA 4G4QA 5GKNA 1WJ7A 2V1UA 3SFZA 1WGNA 4JI1M 4B7FA 1PJTA 4GKKM 3LMMA 3DZDA 3HJSA 3B7ZA 5ITQA 2FE8A 1D0MA 1IY0A 2L09A 4CJ6A 2UXCM 1P3QQ 2ZTCA 3KW6A 2LVPC 2XZUA 3FKEA 1ZMWA 3SHGB 4Z6YA 3FYCA 1NNUC 2CHVA 2JWSA 5KPRA 3SAWA 3IHPA 1NSFA 2QCUA 4WURA 1HR0M 2LBCA 5FTMA 3VDPA 3U6SA 1IBMM 1G4AE 2JP7A 3LQQA 4OVZA 4DV7M 4D82A 3KS4A 1ZQ9A 2NQ8C 4PDGA 4LG2A 1T3TA 2R0IA 4FWGA 2HL7A 1TTEA 3CGWA 3H4JA 1TH4A 4L4UA 3K92A 4L15A 1XXHE 3LQRA 4GC9A 2DAIA 4MM3B 3GRYA 1OAIA 3W68A 2QSFX 2JZ0A 1FNNA 2LNHC 2XSZA 1K3WA 3M6AA 1VEJA 3ZC7B 1XMQM 1YUBA 2UXBM 4IJEA 4HEOA 3GLIE 4OVZB 4DV5M 3GO8A 2WSFF 4X64M 3HJ8A 3JAMS 1Z5CA 1R6BX 4M0DA 3PNVA 1JB0F 1EFUB 3CF2A 3K2LA 3EIHA 2UUCM 4QNMA 1R2YA 2KXEA 1MJGM 4LGYA 1IFYA 1GJSA 3C58A 1IN7A 1Y8GA 2VF8A 3C9PA 4F1IA 2R46A 4LF5M 2OO9A 1XHBA 1KFVA 4MB7A 4HL4A 4CGYB 1JR3A 2DENA 1G41A 1EIJA 3GLGE 3U6EA 4B3RM 1IY1A 3J81S 3PVSA 4LFCM 2G5GX 2E5LM 4AKHA 3T6PA 3ZH9B 2F4VM 1NNJA 1GL7A 1QAQA 3CF0A 2J7NA 2YNMD 4KLNA 4LJ4A 2CFOA 4FVMA 1CUKA 2DAGA 4DUYM 4NC6A 4LY6A 2Y0QA 3U6QA 1IQPA 2DWNA 1IN4A 1IXRC 2LVQD
chains in the Genus database with same CATH topology
3A42A 4MGIE 2C5RA 2ZAOA 4G4OA 4G6ZA 2XFTA 5EXPA 3KDSE 1IN6A 4PCZA 5LMNM 2EA0A 2CV1A 1QANA 4OX9M 1LV7A 1Z59A 4NOOB 2H1RA 5FTNA 2DVWB 5C1BA 3ZCBB 3TL4X 2I7NA 1XNQM 2QBYA 4B08A 3WHLA 1HQYE 3U6DA 4FCWA 3UGJA 4TUWA 2CHGA 1N78A 2XZFA 1G8PA 2RKOA 3DFZA 4REZA 5ITTA 3U6CA 2M60A 3DOAA 3MK6A 3ILKA 3DA1A 3LVVA 3HHYA 3UMMA 3HU3A 1L1TA 2EUCA 2LXEA 4LF4M 2QBYB 2M5ZA 4FW9A 1QYRA 3GPYA 3SYKA 5IWAM 3SATA 1QVRA 1HT1E 3I4YA 5KPTA 1IXZA 4JN6A 3PXGA 1IY2A 4ZPXA 1NJFA 4A3VB 2XEPA 4JYAM 4RNAA 3U6OA 4PD2A 1SXJE 3HHXA 1QQWA 3KOZE 4LJ6A 4NRWA 4X65M 3AV0A 2ZAMA 2V6ZM 1HT2E 3L25A 3FTFA 3U6PA 3VK8A 1XXHB 1J5EM 3HU1A 1Q3CA 4JI5M 3KP1E 3SC3A 2FFJA 3GRRA 3H4MA 4L16A 3IG8A 3KVWA 2XFSA 3J2PB 1D2NA 5KQ8A 5LMUM 3FUWA 4IBEA 3UK6A 3RGSA 3SASA 3KFUG 2ERCA 4GH9A 4LF6M 4LFBM 1KSFX 5KQDA 2ZM6M 4DR4M 2C98A 1XC8A 4LCBA 3VK7A 1E94E 2HCBA 3U61A 5ITXE 3RE8A 1NHGC 3QAUA 1XMOM 3U6LA 2R4EA 3J80S 3SMSA 3FUXA 5JI3E 1HNZM 3AKZA 2CUZA 2FNAA 4P16A 1EE8A 2OPFA 5FTLA 3TWMA 3KOWE 1DGGA 3U61B 4QHTA 2BNKA 2KEBA 4HLQA 4NSOB 5EP1A 3A98B 2AHMA 3D8BA 5IREB 3HGIA 2VQEM 5ITRA 4IJFA 3LVWA 3MJ5A 4JXJA 5KO3A 2LWXA 3U6MA 3AOGA 3OTOM 3Q8XA 2JA2A 4KODA 4AG5A 4MGYE 4S12A 1N77A 3SBJA 3E4RA 3CTWB 2R65A 1DO0A 4IBJA 4NSRA 2R18A 2W82A 1IN8A 4GHAA 1FJGM 3E9SA 5EP4A 1ORYB 4B3TM 2ZANA 4DR2M 3M0EA 2J7OA 5ITUA 1J7KA 1YE9A 3AOEC 3VDUA 4AKIA 1TDHA 3SHFA 2EO2A 3K1JA 4R7GA 3GP1A 2K47A 5IZ7D 3KP0E 1I94M 2F5QA 5FTJA 3IG5A 4I81A 3GQ5A 3A45A 3GLFB 4BBAA 2Q2EB 2Y20A 5FTKA 1NJGA 2O5RA 2C9OA 1XNRM 3U5ZA 1Q39A 3TQSA 2HHHM 2CEAA 2QZ4A 4GMQA 4LGMA 1QAOA 4M9XA 5EXSA 5IT9S 1MU5A 2D7EA 3M7GA 4BB9A 4B3MM 2L6OA 4LRTA 3VKHA 3SMPA 2DWLA 1GKIA 2D7HA 4WW0A 3EIEA 1PJJA 1L8QA 4NXNM 4AZFA 4K0KM 4RF0A 4JI6M 5A2QS 3MHVC 3J7BA 3SAUA 4M9SA 5BR8M 4MGKE 3U5ZB 4BLCA 1Z6TA 1Z5AA 2L7HA 2DZNB 1Z5BA 2UUAM 1DGBA 1TGUA 4R3DA 1UM8A 1L1ZA 4KHPM 4LRSA 2RGHA 4PT5A 3D8LA 4GKJM 2F5SA 5EP2A 4DV0M 4KO8A 1DGHA 3VLFB 3KOYE 3GQ3A 2XGNA 4DV3M 5F3WA 4AG6A 3L27A 5KPZA 1TDZA 2XF3A 1GVNA 2DWZB 3PFIA 4QHSA 1XXHA 3FUUA 1NVMA 1G59A 4NL4H 4DR7M 2UU9M 3W0LB 4RF1A 2QPAA 2VIIA 4LF8M 2F5NA 3B9PA 4DR6M 5DNYA 1XWIA 2X4AA 4IBFA 4PDIA 3GLIA 2HKJA 2DXIA 3RFWA 5E26A 4IBGA 1DGHB 4DV4M 3R8FA 4LJAA 2XLJA 3RGPA 1IBKM 3J27B 3W0FA 2QENA 4L8RC 3BOSA 3TWKA 3GLHA 3HHWA 3HU2A 4FCVA 1W5TA 4JI7M 3HWSA 4II7A 3L2AA 3GLIB 1TH2A 2C96A 1NY5A 2R4JA 3KSJA 3GLGA 2KZSA 4JI0M 3AJIB 2UUBM 4GHLA 2P5TA 1E9RA 4JV5M 2UXDM 4M9ZA 4NXMM 3FTDA 3GPPA 3K8ZA 3GLHB 3FUTA 2X49A 3SARA 4OW0A 2X8AA 2I7PA 1HNXM 4IBBA 2D7GA 4IBIA 1N32M 1SXJC 3AFHA 5EQTA 4ITQA 4DR5M 3GLGB 1KYIA 2KRUA 2CV0A 2KA6B 3WHKA 2KW0A 4B7HA 4D80A 3L29A 2F5OA 3L28A 3R9XB 1YSYA 3PNYA 3UZUA 3TWLA 5H37D 1GLNA 3VFDA 4LJ8A 5EJCA 2ZBKB 3FYDA 1R7RA 4JI2M 4GITA 3GQ4A 4LJ7A 8CATA 5EXTA 4AI6A 4Z8XA 2OQ4A 1SXJD 1K82A 2DHRA 3NBIA 4JI8M 2F5PA 2XSZD 3KOXE 1VDDA 3FD9A 1IM2A 1HNWM 4GRIA 5DYGA 3GLFA 4B3SM 1N75A 5ITYA 3HJQA 4DV6M 4IBKA 1NHWC 1OJLA 3THGA 4LZZA 1E9SA 3U60A 3FUVA 5FSWA 1X37A 3I51A 4I4LA 2FOIC 1SXJA 1N33M 4LF9M 4G4NA 1ZAEA 2V1CA 1PJIA 4B7GA 1HQCA 1E32A 5BPVA 1H6UA 1JR3D 3CF6E 4DR3M 2YR0A 4QOSA 1OFIA 2Z7JA 3U60B 3J7AS 1SXJB 2RGOA 1L2BA 3T15A 2L7IA 3KSXA 2Y0TA 2C9CA 4LZJA 2Z4RA 1K3XA 4LFAM 5ITXA 2DZOB 2QP9X 3I4VA 1QAMA 5FLXS 1OFHA 3TPZA 1QZMA 1GL6A 1W5SA 4CISA 1R2ZA 1PM5A 3HHZA 1IXSB 3SYLA 2A5YB 4MH0E 2VQFM 1IBLM 1DO2A 3NWLA 3AOEA 2Z4SA 4IBDA 3AL0C 4AW4A 1L2CA 2CHQA 1TH3A 4G4RA 1L2DA 2R62A 3TE6A 4LJ9A 4LF7M 4I5SA 4NRVA 4L78A 3GRUA 1C1KA 4FCTA 2YQZA 4W5WA 4DV2M 4M0WA 2YFQA 2KZUA 3KXEC 4GIPA 4MGHA 3T38A 3JR4A 4DUZM 3QWLA 4D81A 4LJ5A 5EXXA 2Z3XA 3FTCA 1I4WA 1J09A 2CV2A 2Y21A 2XH9A 1S3SA 4CHTB 5C18A 1Q3BA 2BJWA 2LH0A 1N34M 2G8LA 4EIWA 3HKPA 4X66M 5DYIA 3T1YM 4YY3M 4GC5A 3JR5A 4FWHA 1N36M 1MX0A 4X62M 1JQJC 1NY6A 4OU7A 3A46A 2CE7A 2R45A 1DGFA 3GPXA 4DR1M 4FD2A 1WXQA 4AKGA 2C99A 3GPUA 3FTEA 4JI4M 3VKGA 3SAVA 5E6JA 3L26A 4QOZC 4JI3M 2BJVA 1G3IA 4MGZE 4QNRA 3KS8A 4FWDA 4IIWA 2DWMA 5EP3A 3GRVA 4IBCA 4YHHM 3UJNA 4DV1M 5JI2E 1IN5A 7CATA 4AQYM 4XBOA 3T1HM 2KRKA 4I8OA 4XGIA 4G4QA 5GKNA 2V1UA 3SFZA 4JI1M 4B7FA 4GKKM 3LMMA 3DZDA 3HJSA 5ITQA 2FE8A 1IY0A 2L09A 2UXCM 3KW6A 2XZUA 3FKEA 3SHGB 4Z6YA 3FYCA 1NNUC 2CHVA 5KPRA 3SAWA 1NSFA 2QCUA 4WURA 1HR0M 5FTMA 3VDPA 3U6SA 1IBMM 1G4AE 3LQQA 4OVZA 4DV7M 4D82A 3KS4A 1ZQ9A 2NQ8C 4PDGA 4LG2A 1T3TA 4FWGA 2HL7A 1TH4A 4L4UA 3K92A 4L15A 3LQRA 4MM3B 4GC9A 3GRYA 2LNHC 1FNNA 2XSZA 1K3WA 3M6AA 1XMQM 3ZC7B 2UXBM 1YUBA 4IJEA 4OVZB 4DV5M 3GO8A 4X64M 3HJ8A 3JAMS 1Z5CA 1R6BX 4M0DA 3PNVA 3CF2A 3K2LA 3EIHA 2UUCM 4QNMA 1R2YA 2KXEA 4LGYA 3C58A 1IN7A 4LF5M 2R46A 1XHBA 1KFVA 4MB7A 4HL4A 4CGYB 1JR3A 1G41A 3U6EA 4B3RM 1IY1A 3J81S 3PVSA 4LFCM 2G5GX 2E5LM 4AKHA 3ZH9B 2F4VM 1NNJA 1GL7A 1QAQA 3CF0A 2J7NA 2YNMD 4KLNA 4LJ4A 2CFOA 4FVMA 4DUYM 4LY6A 2Y0QA 3U6QA 1IQPA 2DWNA 1IN4A 1IXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KA6 B; 
#chains in the Genus database with same CATH topology
 2JUJ A;  2KHH A;  3A42 A;  2JY8 A;  4MGI E;  1OKS A;  2C5R A;  2Z8Y M;  2LVO C;  2BWB A;  4ANR A;  2ZAO A;  4L6V 6;  4G4O A;  4G6Z A;  2XFT A;  5EXP A;  1UFZ A;  3KDS E;  1IN6 A;  4PCZ A;  5LMN M;  1NV8 A;  2EA0 A;  2CV1 A;  1QAN A;  4OX9 M;  1LV7 A;  1Z59 A;  4NOO B;  2H1R A;  3C3D A;  2DVW B;  5FTN A;  5C1B A;  3ZCB B;  3TL4 X;  2I7N A;  1XNQ M;  2RRU A;  4GEW A;  2QBY A;  4B08 A;  3WHL A;  1HQY E;  3U6D A;  3HX3 A;  4FCW A;  3UGJ A;  4TUW A;  3FE3 A;  1GO5 A;  2CHG A;  1N78 A;  2XZF A;  1G8P A;  2RKO A;  3DFZ A;  4REZ A;  3W67 A;  5ITT A;  3U6C A;  2M60 A;  3DOA A;  3MK6 A;  3ILK A;  3DA1 A;  3LVV A;  3HHY A;  3UMM A;  3HU3 A;  1L1T A;  2EUC A;  2LXE A;  2CRU A;  2QBY B;  2M5Z A;  3GLF E;  4LF4 M;  4FW9 A;  1QYR A;  2LHC A;  3GPY A;  3SYK A;  2DAM A;  5IWA M;  3SAT A;  1QVR A;  1HT1 E;  3I4Y A;  5KPT A;  1PJS A;  1IXZ A;  1ZV1 A;  4JN6 A;  3PXG A;  1IY2 A;  4ZPX A;  1NJF A;  4A3V B;  2XEP A;  4JYA M;  4RNA A;  3U6O A;  1D0K A;  1VEG A;  1SXJ E;  2KDL A;  3HHX A;  4PD2 A;  1QQW A;  3KOZ E;  4LJ6 A;  1T6O A;  4NRW A;  4X65 M;  3AV0 A;  2ZAM A;  2G3Q A;  2V6Z M;  1HT2 E;  3L25 A;  3FTF A;  3U6P A;  3VK8 A;  1XXH B;  4G3O A;  1J5E M;  3HU1 A;  1Q3C A;  4JI5 M;  3KP1 E;  3SC3 A;  2FFJ A;  2OOB A;  3GRR A;  3H4M A;  4L16 A;  3IG8 A;  3KVW A;  2XFS A;  2QHO B;  2MH8 A;  3J2P B;  1D2N A;  5KQ8 A;  1WHC A;  5LMU M;  3FUW A;  4IBE A;  3UK6 A;  2WSE F;  3FRI A;  3RGS A;  3SAS A;  3KFU G;  2ERC A;  4GH9 A;  4LF6 M;  4LFB M;  1KSF X;  5KQD A;  2ZM6 M;  1TF0 B;  1OIP A;  2C98 A;  4DR4 M;  4RKU F;  1XC8 A;  1GJT A;  4LCB A;  3VK7 A;  1E94 E;  2HCB A;  3U61 A;  2APL A;  5ITX E;  1QZE A;  3RE8 A;  1PJQ A;  1HJP A;  1NHG C;  3LCU A;  3QAU A;  1XMO M;  3U6L A;  2R4E A;  2HWJ A;  3J80 S;  2MR9 A;  2LVA A;  3SMS A;  2DHY A;  3FUX A;  5JI3 E;  1HNZ M;  3AKZ A;  2CUZ A;  2FNA A;  2O25 A;  4P16 A;  1EE8 A;  2OPF A;  5FTL A;  3TWM A;  3KOW E;  1DGG A;  3U61 B;  4QHT A;  1V92 A;  1QDR A;  2BNK A;  2DAE A;  2KEB A;  4HLQ A;  4NSO B;  5EP1 A;  3A98 B;  2AHM A;  2EJS A;  3D8B A;  5IRE B;  3HGI A;  2VQE M;  5ITR A;  4IJF A;  3B89 A;  3LVW A;  3MJ5 A;  4JXJ A;  5KO3 A;  2LWX A;  3U6M A;  3AOG A;  1XB2 B;  3OTO M;  3Q8X A;  2JA2 A;  4KOD A;  4AG5 A;  4MGY E;  4S12 A;  1N77 A;  3SBJ A;  2R65 A;  3CTW B;  3E4R A;  1DO0 A;  4IBJ A;  4NSR A;  3ZQJ A;  2FS1 A;  2R18 A;  2W82 A;  1IN8 A;  4P17 A;  4GHA A;  1FJG M;  3E9S A;  2J5Y A;  5EP4 A;  1ORY B;  2HAK A;  2GQF A;  4B3T M;  2ZAN A;  4DR2 M;  3M0E A;  2J7O A;  3GLH E;  5ITU A;  1J7K A;  1YE9 A;  3AOE C;  3K9P A;  3VDU A;  1QUT A;  4AKI A;  1TDH A;  1OAO C;  2EO2 A;  3SHF A;  3K1J A;  4R7G A;  3GP1 A;  2K47 A;  5IZ7 D;  2B3T A;  3KP0 E;  3Q8G A;  1I94 M;  2F5Q A;  4DBG B;  5FTJ A;  3FRH A;  3IG5 A;  4I81 A;  3GQ5 A;  3A45 A;  3GLF B;  4BBA A;  1PRB A;  2L4F A;  2Q2E B;  2Y20 A;  5FTK A;  1NJG A;  2O5R A;  1G71 A;  1V34 A;  2C9O A;  3B7Q A;  3U5Z A;  1Q39 A;  3TQS A;  1XNR M;  2HHH M;  2CEA A;  2QZ4 A;  3IEC A;  4GMQ A;  1QAO A;  4LGM A;  4M9X A;  5EXS A;  5IT9 S;  4Y28 F;  2LTU A;  1MU5 A;  2D7E A;  3M7G A;  4BB9 A;  4B3M M;  2L6O A;  4LRT A;  2O01 F;  5DFL A;  3VKH A;  3SMP A;  2DWL A;  1GKI A;  2D7H A;  4WW0 A;  3EIE A;  1PJJ A;  1L8Q A;  4NXN M;  4AZF A;  4K0K M;  4RF0 A;  2GNO A;  5A2Q S;  3MHV C;  4JI6 M;  3J7B A;  3SAU A;  2JY7 A;  4M9S A;  5BR8 M;  4MGK E;  3U5Z B;  4BLC A;  1Z6T A;  1Z5A A;  2L7H A;  2DZN B;  1Z5B A;  2DAK A;  2UUA M;  1DGB A;  1TGU A;  2JXN A;  3JR4 A;  4R3D A;  1UM8 A;  2BWE A;  1L1Z A;  4KHP M;  4LRS A;  1D0L A;  2RGH A;  4PT5 A;  1Q02 A;  3D8L A;  4GKJ M;  2F5S A;  2H5X A;  5EP2 A;  4DV0 M;  4KO8 A;  1DGH A;  3VLF B;  3KOY E;  3GQ3 A;  2XGN A;  4DV3 M;  1R4G A;  5F3W A;  1SG9 A;  3L27 A;  4AG6 A;  1YLA A;  5KPZ A;  1TDZ A;  2XF3 A;  1PGY A;  1GVN A;  2DWZ B;  3PFI A;  2KNA A;  4QHS A;  1XXH A;  3FUU A;  1NVM A;  4CIZ A;  1G59 A;  4NL4 H;  4DR7 M;  2CWB A;  2UU9 M;  3W0L B;  4RF1 A;  2QPA A;  2VII A;  4LF8 M;  2EKF A;  3B9P A;  2F5N A;  4DR6 M;  2N35 A;  2K9D A;  2QQ8 A;  5DNY A;  1XWI A;  1VQ1 A;  3I04 M;  2X4A A;  4IBF A;  4PDI A;  3GLI A;  2HKJ A;  2DXI A;  2VDB B;  3RFW A;  5E26 A;  4IBG A;  1DGH B;  4DV4 M;  3R8F A;  4LJA A;  2XLJ A;  3RGP A;  1IBK M;  3J27 B;  3B74 A;  3W0F A;  2QEN A;  4L8R C;  3BOS A;  3TWK A;  3GLH A;  3HHW A;  3LCV B;  3HU2 A;  4Q7J A;  4FCV A;  1W5T A;  4JI7 M;  3HWS A;  4II7 A;  3L2A A;  3GLI B;  1TH2 A;  2C96 A;  1NY5 A;  2R4J A;  3KSJ A;  1VG5 A;  2KZS A;  3I01 M;  4JI0 M;  3GLG A;  3AJI B;  2UUB M;  4GHL A;  2P5T A;  1E9R A;  4JV5 M;  2UXD M;  4M9Z A;  2OOA A;  4NXM M;  3BXW A;  3FTD A;  3GPP A;  1JR3 E;  2WSC F;  3GLH B;  3K8Z A;  1AIP C;  2X49 A;  3FUT A;  3SAR A;  4OW0 A;  1T43 A;  2JY5 A;  2X8A A;  2I7P A;  1HNX M;  4IBB A;  2D7G A;  4IBI A;  1N32 M;  1SXJ C;  3AFH A;  5EQT A;  4ITQ A;  4DR5 M;  3GLG B;  1KYI A;  3QYB A;  2KRU A;  2CV0 A;  4WP2 A;  2KA6 B;  3WHK A;  2KW0 A;  4B7H A;  4D80 A;  3L29 A;  2F5O A;  2VF7 A;  2R6F A;  1YSY A;  3L28 A;  3R9X B;  3PNY A;  3UZU A;  3TWL A;  5H37 D;  1GLN A;  1BVS A;  3VFD A;  4LJ8 A;  5EJC A;  1OIZ A;  2ZBK B;  3FYD A;  1F4I A;  1ZMU A;  1R7R A;  4JI2 M;  2QNJ A;  4GIT A;  1C7Y A;  3GQ4 A;  4LJ7 A;  8CAT A;  5EXT A;  4AI6 A;  4Z8X A;  2OQ4 A;  1SXJ D;  2WZJ A;  1K82 A;  1QDT A;  2DHR A;  3NBI A;  4JI8 M;  2F5P A;  2XSZ D;  3KOX E;  1VDD A;  4R71 A;  3FD9 A;  1IM2 A;  1HNW M;  4GRI A;  5DYG A;  3GLF A;  4B3S M;  1N75 A;  5ITY A;  3HJQ A;  4DV6 M;  4IBK A;  1NHW C;  1OJL A;  3THG A;  4LZZ A;  1E9S A;  3U60 A;  3FUV A;  3V76 A;  5FSW A;  1X37 A;  3I51 A;  4I4L A;  4KT0 F;  2FOI C;  5L8R F;  1SXJ A;  1N33 M;  1LTM A;  4LF9 M;  4G4N A;  1ZAE A;  2ZTD A;  2V1C A;  1PJI A;  4B7G A;  1HQC A;  2LVN C;  2R44 A;  1E32 A;  5BPV A;  1H6U A;  1JR3 D;  3CF6 E;  4DR3 M;  2YR0 A;  4QOS A;  1OFI A;  2Z7J A;  3U60 B;  1WIV A;  1IXS A;  3E21 A;  3J7A S;  1MN3 A;  1SXJ B;  2RGO A;  1L2B A;  3T15 A;  2L7I A;  2CP8 A;  3KSX A;  1RU3 A;  2Y0T A;  1NV9 A;  2C9C A;  2DI0 A;  4LZJ A;  2Z4R A;  1V33 A;  1K3X A;  4LFA M;  5ITX A;  3BBZ A;  2DZO B;  2QP9 X;  3I4V A;  1QAM A;  5FLX S;  1OFH A;  3TPZ A;  4F2L A;  2KNZ A;  1QZM A;  1GL6 A;  1W5S A;  4CIS A;  1R2Z A;  1AUA A;  1PM5 A;  2DZL A;  3HHZ A;  1IXS B;  1WR1 B;  2A5Y B;  4MH0 E;  1QUS A;  3SYL A;  1R5L A;  2VQF M;  1IBL M;  1DO2 A;  1WGL A;  2K0B X;  3NWL A;  3AOE A;  2Z4S A;  4IBD A;  1A5T A;  3B7N A;  3AL0 C;  1GAB A;  2JY6 B;  4AW4 A;  1L2C A;  2L4E A;  2CHQ A;  1TH3 A;  4G4R A;  1L2D A;  2R62 A;  3F92 A;  3TE6 A;  4LJ9 A;  2MGW A;  4LF7 M;  4I5S A;  4NRV A;  4L78 A;  3GRU A;  1C1K A;  4FCT A;  2YQZ A;  4W5W A;  4DV2 M;  4M0W A;  2DNA A;  2KZU A;  2YFQ A;  3KXE C;  4GIP A;  4MGH A;  3T38 A;  2EKK A;  3QWL A;  4DUZ M;  4D81 A;  2K6B A;  2MJ5 B;  4LJ5 A;  5EXX A;  1TR8 A;  2Z3X A;  3FTC A;  1I4W A;  1J09 A;  2CV2 A;  2DKL A;  2Y21 A;  1OTR A;  2XH9 A;  1S3S A;  4CHT B;  5C18 A;  1Q3B A;  2MRO B;  3HY5 A;  1VEK A;  2BJW A;  2LH0 A;  2FH0 A;  2G8L A;  4EIW A;  1N34 M;  3HKP A;  4XK8 F;  4X66 M;  3C3E A;  5DYI A;  1DV0 A;  3T1Y M;  3MMP A;  4YY3 M;  4GC5 A;  3K9O A;  4UN2 B;  3JR5 A;  1NO1 A;  4FWH A;  1N36 M;  1MX0 A;  1VDL A;  4X62 M;  1JQJ C;  2LHG A;  1NY6 A;  4OU7 A;  3A46 A;  2CE7 A;  2JNH A;  2R45 A;  1DGF A;  3GPX A;  4DR1 M;  4FD2 A;  1WXQ A;  4AKG A;  2C99 A;  2JZ1 A;  3GPU A;  1OQY A;  4JI4 M;  3FTE A;  3VKG A;  3SAV A;  3NBX X;  5E6J A;  3L26 A;  4QOZ C;  4JI3 M;  2BJV A;  1G3I A;  4MGZ E;  4QNR A;  3KS8 A;  4FWD A;  4IIW A;  2DWM A;  3HZJ A;  5EP3 A;  3GRV A;  3QYE A;  4IBC A;  2L2D A;  3UJN A;  4YHH M;  4DV1 M;  3E46 A;  1IN5 A;  3LW5 F;  2KNV A;  4XBO A;  7CAT A;  5JI2 E;  1ZMV A;  4AQY M;  3T1H M;  2KRK A;  4I8O A;  4XGI A;  4G4Q A;  5GKN A;  1WJ7 A;  2V1U A;  3SFZ A;  1WGN A;  4JI1 M;  4B7F A;  1PJT A;  4GKK M;  3LMM A;  3DZD A;  3HJS A;  3B7Z A;  5ITQ A;  2FE8 A;  1D0M A;  1IY0 A;  2L09 A;  4CJ6 A;  2UXC M;  1P3Q Q;  2ZTC A;  3KW6 A;  2LVP C;  2XZU A;  3FKE A;  1ZMW A;  3SHG B;  4Z6Y A;  3FYC A;  1NNU C;  2CHV A;  2JWS A;  5KPR A;  3SAW A;  3IHP A;  1NSF A;  2QCU A;  4WUR A;  1HR0 M;  2LBC A;  5FTM A;  3VDP A;  3U6S A;  1IBM M;  1G4A E;  2JP7 A;  3LQQ A;  4OVZ A;  4DV7 M;  4D82 A;  3KS4 A;  1ZQ9 A;  2NQ8 C;  4PDG A;  4LG2 A;  1T3T A;  2R0I A;  4FWG A;  2HL7 A;  1TTE A;  3CGW A;  3H4J A;  1TH4 A;  4L4U A;  3K92 A;  4L15 A;  1XXH E;  3LQR A;  4GC9 A;  2DAI A;  4MM3 B;  3GRY A;  1OAI A;  3W68 A;  2QSF X;  2JZ0 A;  1FNN A;  2LNH C;  2XSZ A;  1K3W A;  3M6A A;  1VEJ A;  3ZC7 B;  1XMQ M;  1YUB A;  2UXB M;  4IJE A;  4HEO A;  3GLI E;  4OVZ B;  4DV5 M;  3GO8 A;  2WSF F;  4X64 M;  3HJ8 A;  3JAM S;  1Z5C A;  1R6B X;  4M0D A;  3PNV A;  1JB0 F;  1EFU B;  3CF2 A;  3K2L A;  3EIH A;  2UUC M;  4QNM A;  1R2Y A;  2KXE A;  1MJG M;  4LGY A;  1IFY A;  1GJS A;  3C58 A;  1IN7 A;  1Y8G A;  2VF8 A;  3C9P A;  4F1I A;  2R46 A;  4LF5 M;  2OO9 A;  1XHB A;  1KFV A;  4MB7 A;  4HL4 A;  4CGY B;  1JR3 A;  2DEN A;  1G41 A;  1EIJ A;  3GLG E;  3U6E A;  4B3R M;  1IY1 A;  3J81 S;  3PVS A;  4LFC M;  2G5G X;  2E5L M;  4AKH A;  3T6P A;  3ZH9 B;  2F4V M;  1NNJ A;  1GL7 A;  1QAQ A;  3CF0 A;  2J7N A;  2YNM D;  4KLN A;  4LJ4 A;  2CFO A;  4FVM A;  1CUK A;  2DAG A;  4DUY M;  4NC6 A;  4LY6 A;  2Y0Q A;  3U6Q A;  1IQP A;  2DWN A;  1IN4 A;  1IXR C;  2LVQ D; 
#chains in the Genus database with same CATH homology
 3A42 A;  4MGI E;  2C5R A;  2ZAO A;  4G4O A;  4G6Z A;  2XFT A;  5EXP A;  3KDS E;  1IN6 A;  4PCZ A;  5LMN M;  2EA0 A;  2CV1 A;  1QAN A;  4OX9 M;  1LV7 A;  1Z59 A;  4NOO B;  2H1R A;  5FTN A;  2DVW B;  5C1B A;  3ZCB B;  3TL4 X;  2I7N A;  1XNQ M;  2QBY A;  4B08 A;  3WHL A;  1HQY E;  3U6D A;  4FCW A;  3UGJ A;  4TUW A;  2CHG A;  1N78 A;  2XZF A;  1G8P A;  2RKO A;  3DFZ A;  4REZ A;  5ITT A;  3U6C A;  2M60 A;  3DOA A;  3MK6 A;  3ILK A;  3DA1 A;  3LVV A;  3HHY A;  3UMM A;  3HU3 A;  1L1T A;  2EUC A;  2LXE A;  4LF4 M;  2QBY B;  2M5Z A;  4FW9 A;  1QYR A;  3GPY A;  3SYK A;  5IWA M;  3SAT A;  1QVR A;  1HT1 E;  3I4Y A;  5KPT A;  1IXZ A;  4JN6 A;  3PXG A;  1IY2 A;  4ZPX A;  1NJF A;  4A3V B;  2XEP A;  4JYA M;  4RNA A;  3U6O A;  4PD2 A;  1SXJ E;  3HHX A;  1QQW A;  3KOZ E;  4LJ6 A;  4NRW A;  4X65 M;  3AV0 A;  2ZAM A;  2V6Z M;  1HT2 E;  3L25 A;  3FTF A;  3U6P A;  3VK8 A;  1XXH B;  1J5E M;  3HU1 A;  1Q3C A;  4JI5 M;  3KP1 E;  3SC3 A;  2FFJ A;  3GRR A;  3H4M A;  4L16 A;  3IG8 A;  3KVW A;  2XFS A;  3J2P B;  1D2N A;  5KQ8 A;  5LMU M;  3FUW A;  4IBE A;  3UK6 A;  3RGS A;  3SAS A;  3KFU G;  2ERC A;  4GH9 A;  4LF6 M;  4LFB M;  1KSF X;  5KQD A;  2ZM6 M;  4DR4 M;  2C98 A;  1XC8 A;  4LCB A;  3VK7 A;  1E94 E;  2HCB A;  3U61 A;  5ITX E;  3RE8 A;  1NHG C;  3QAU A;  1XMO M;  3U6L A;  2R4E A;  3J80 S;  3SMS A;  3FUX A;  5JI3 E;  1HNZ M;  3AKZ A;  2CUZ A;  2FNA A;  4P16 A;  1EE8 A;  2OPF A;  5FTL A;  3TWM A;  3KOW E;  1DGG A;  3U61 B;  4QHT A;  2BNK A;  2KEB A;  4HLQ A;  4NSO B;  5EP1 A;  3A98 B;  2AHM A;  3D8B A;  5IRE B;  3HGI A;  2VQE M;  5ITR A;  4IJF A;  3LVW A;  3MJ5 A;  4JXJ A;  5KO3 A;  2LWX A;  3U6M A;  3AOG A;  3OTO M;  3Q8X A;  2JA2 A;  4KOD A;  4AG5 A;  4MGY E;  4S12 A;  1N77 A;  3SBJ A;  3E4R A;  3CTW B;  2R65 A;  1DO0 A;  4IBJ A;  4NSR A;  2R18 A;  2W82 A;  1IN8 A;  4GHA A;  1FJG M;  3E9S A;  5EP4 A;  1ORY B;  4B3T M;  2ZAN A;  4DR2 M;  3M0E A;  2J7O A;  5ITU A;  1J7K A;  1YE9 A;  3AOE C;  3VDU A;  4AKI A;  1TDH A;  3SHF A;  2EO2 A;  3K1J A;  4R7G A;  3GP1 A;  2K47 A;  5IZ7 D;  3KP0 E;  1I94 M;  2F5Q A;  5FTJ A;  3IG5 A;  4I81 A;  3GQ5 A;  3A45 A;  3GLF B;  4BBA A;  2Q2E B;  2Y20 A;  5FTK A;  1NJG A;  2O5R A;  2C9O A;  1XNR M;  3U5Z A;  1Q39 A;  3TQS A;  2HHH M;  2CEA A;  2QZ4 A;  4GMQ A;  4LGM A;  1QAO A;  4M9X A;  5EXS A;  5IT9 S;  1MU5 A;  2D7E A;  3M7G A;  4BB9 A;  4B3M M;  2L6O A;  4LRT A;  3VKH A;  3SMP A;  2DWL A;  1GKI A;  2D7H A;  4WW0 A;  3EIE A;  1PJJ A;  1L8Q A;  4NXN M;  4AZF A;  4K0K M;  4RF0 A;  4JI6 M;  5A2Q S;  3MHV C;  3J7B A;  3SAU A;  4M9S A;  5BR8 M;  4MGK E;  3U5Z B;  4BLC A;  1Z6T A;  1Z5A A;  2L7H A;  2DZN B;  1Z5B A;  2UUA M;  1DGB A;  1TGU A;  4R3D A;  1UM8 A;  1L1Z A;  4KHP M;  4LRS A;  2RGH A;  4PT5 A;  3D8L A;  4GKJ M;  2F5S A;  5EP2 A;  4DV0 M;  4KO8 A;  1DGH A;  3VLF B;  3KOY E;  3GQ3 A;  2XGN A;  4DV3 M;  5F3W A;  4AG6 A;  3L27 A;  5KPZ A;  1TDZ A;  2XF3 A;  1GVN A;  2DWZ B;  3PFI A;  4QHS A;  1XXH A;  3FUU A;  1NVM A;  1G59 A;  4NL4 H;  4DR7 M;  2UU9 M;  3W0L B;  4RF1 A;  2QPA A;  2VII A;  4LF8 M;  2F5N A;  3B9P A;  4DR6 M;  5DNY A;  1XWI A;  2X4A A;  4IBF A;  4PDI A;  3GLI A;  2HKJ A;  2DXI A;  3RFW A;  5E26 A;  4IBG A;  1DGH B;  4DV4 M;  3R8F A;  4LJA A;  2XLJ A;  3RGP A;  1IBK M;  3J27 B;  3W0F A;  2QEN A;  4L8R C;  3BOS A;  3TWK A;  3GLH A;  3HHW A;  3HU2 A;  4FCV A;  1W5T A;  4JI7 M;  3HWS A;  4II7 A;  3L2A A;  3GLI B;  1TH2 A;  2C96 A;  1NY5 A;  2R4J A;  3KSJ A;  3GLG A;  2KZS A;  4JI0 M;  3AJI B;  2UUB M;  4GHL A;  2P5T A;  1E9R A;  4JV5 M;  2UXD M;  4M9Z A;  4NXM M;  3FTD A;  3GPP A;  3K8Z A;  3GLH B;  3FUT A;  2X49 A;  3SAR A;  4OW0 A;  2X8A A;  2I7P A;  1HNX M;  4IBB A;  2D7G A;  4IBI A;  1N32 M;  1SXJ C;  3AFH A;  5EQT A;  4ITQ A;  4DR5 M;  3GLG B;  1KYI A;  2KRU A;  2CV0 A;  2KA6 B;  3WHK A;  2KW0 A;  4B7H A;  4D80 A;  3L29 A;  2F5O A;  3L28 A;  3R9X B;  1YSY A;  3PNY A;  3UZU A;  3TWL A;  5H37 D;  1GLN A;  3VFD A;  4LJ8 A;  5EJC A;  2ZBK B;  3FYD A;  1R7R A;  4JI2 M;  4GIT A;  3GQ4 A;  4LJ7 A;  8CAT A;  5EXT A;  4AI6 A;  4Z8X A;  2OQ4 A;  1SXJ D;  1K82 A;  2DHR A;  3NBI A;  4JI8 M;  2F5P A;  2XSZ D;  3KOX E;  1VDD A;  3FD9 A;  1IM2 A;  1HNW M;  4GRI A;  5DYG A;  3GLF A;  4B3S M;  1N75 A;  5ITY A;  3HJQ A;  4DV6 M;  4IBK A;  1NHW C;  1OJL A;  3THG A;  4LZZ A;  1E9S A;  3U60 A;  3FUV A;  5FSW A;  1X37 A;  3I51 A;  4I4L A;  2FOI C;  1SXJ A;  1N33 M;  4LF9 M;  4G4N A;  1ZAE A;  2V1C A;  1PJI A;  4B7G A;  1HQC A;  1E32 A;  5BPV A;  1H6U A;  1JR3 D;  3CF6 E;  4DR3 M;  2YR0 A;  4QOS A;  1OFI A;  2Z7J A;  3U60 B;  3J7A S;  1SXJ B;  2RGO A;  1L2B A;  3T15 A;  2L7I A;  3KSX A;  2Y0T A;  2C9C A;  4LZJ A;  2Z4R A;  1K3X A;  4LFA M;  5ITX A;  2DZO B;  2QP9 X;  3I4V A;  1QAM A;  5FLX S;  1OFH A;  3TPZ A;  1QZM A;  1GL6 A;  1W5S A;  4CIS A;  1R2Z A;  1PM5 A;  3HHZ A;  1IXS B;  3SYL A;  2A5Y B;  4MH0 E;  2VQF M;  1IBL M;  1DO2 A;  3NWL A;  3AOE A;  2Z4S A;  4IBD A;  3AL0 C;  4AW4 A;  1L2C A;  2CHQ A;  1TH3 A;  4G4R A;  1L2D A;  2R62 A;  3TE6 A;  4LJ9 A;  4LF7 M;  4I5S A;  4NRV A;  4L78 A;  3GRU A;  1C1K A;  4FCT A;  2YQZ A;  4W5W A;  4DV2 M;  4M0W A;  2YFQ A;  2KZU A;  3KXE C;  4GIP A;  4MGH A;  3T38 A;  3JR4 A;  4DUZ M;  3QWL A;  4D81 A;  4LJ5 A;  5EXX A;  2Z3X A;  3FTC A;  1I4W A;  1J09 A;  2CV2 A;  2Y21 A;  2XH9 A;  1S3S A;  4CHT B;  5C18 A;  1Q3B A;  2BJW A;  2LH0 A;  1N34 M;  2G8L A;  4EIW A;  3HKP A;  4X66 M;  5DYI A;  3T1Y M;  4YY3 M;  4GC5 A;  3JR5 A;  4FWH A;  1N36 M;  1MX0 A;  4X62 M;  1JQJ C;  1NY6 A;  4OU7 A;  3A46 A;  2CE7 A;  2R45 A;  1DGF A;  3GPX A;  4DR1 M;  4FD2 A;  1WXQ A;  4AKG A;  2C99 A;  3GPU A;  3FTE A;  4JI4 M;  3VKG A;  3SAV A;  5E6J A;  3L26 A;  4QOZ C;  4JI3 M;  2BJV A;  1G3I A;  4MGZ E;  4QNR A;  3KS8 A;  4FWD A;  4IIW A;  2DWM A;  5EP3 A;  3GRV A;  4IBC A;  4YHH M;  3UJN A;  4DV1 M;  5JI2 E;  1IN5 A;  7CAT A;  4AQY M;  4XBO A;  3T1H M;  2KRK A;  4I8O A;  4XGI A;  4G4Q A;  5GKN A;  2V1U A;  3SFZ A;  4JI1 M;  4B7F A;  4GKK M;  3LMM A;  3DZD A;  3HJS A;  5ITQ A;  2FE8 A;  1IY0 A;  2L09 A;  2UXC M;  3KW6 A;  2XZU A;  3FKE A;  3SHG B;  4Z6Y A;  3FYC A;  1NNU C;  2CHV A;  5KPR A;  3SAW A;  1NSF A;  2QCU A;  4WUR A;  1HR0 M;  5FTM A;  3VDP A;  3U6S A;  1IBM M;  1G4A E;  3LQQ A;  4OVZ A;  4DV7 M;  4D82 A;  3KS4 A;  1ZQ9 A;  2NQ8 C;  4PDG A;  4LG2 A;  1T3T A;  4FWG A;  2HL7 A;  1TH4 A;  4L4U A;  3K92 A;  4L15 A;  3LQR A;  4MM3 B;  4GC9 A;  3GRY A;  2LNH C;  1FNN A;  2XSZ A;  1K3W A;  3M6A A;  1XMQ M;  3ZC7 B;  2UXB M;  1YUB A;  4IJE A;  4OVZ B;  4DV5 M;  3GO8 A;  4X64 M;  3HJ8 A;  3JAM S;  1Z5C A;  1R6B X;  4M0D A;  3PNV A;  3CF2 A;  3K2L A;  3EIH A;  2UUC M;  4QNM A;  1R2Y A;  2KXE A;  4LGY A;  3C58 A;  1IN7 A;  4LF5 M;  2R46 A;  1XHB A;  1KFV A;  4MB7 A;  4HL4 A;  4CGY B;  1JR3 A;  1G41 A;  3U6E A;  4B3R M;  1IY1 A;  3J81 S;  3PVS A;  4LFC M;  2G5G X;  2E5L M;  4AKH A;  3ZH9 B;  2F4V M;  1NNJ A;  1GL7 A;  1QAQ A;  3CF0 A;  2J7N A;  2YNM D;  4KLN A;  4LJ4 A;  2CFO A;  4FVM A;  4DUY M;  4LY6 A;  2Y0Q A;  3U6Q A;  1IQP A;  2DWN A;  1IN4 A;  1IXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...