4DV3M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv3M02
1Z5BA 4X64M 1MU5A 4DUZM 4JI2M 4PCZA 1Z59A 2HKJA 1TDZA 3TWLA 4LFBM 1MX0A 1Q3CA 1Z5AA 3GP1A 3W0FA 1XMQM 2E5LM 1HNZM 1N34M 2F5NA 4DR1M 4JI0M 4DR7M 5ITXA 5BR8M 1Z5CA 3SAVA 4DV4M 4DR6M 2UXDM 3U6LA 1Q3BA 4DUYM 4DR2M 1I94M 3GQ5A 4DV5M 1IBMM 1KFVA 2VQFM 4YY3M 1PM5A 1R2YA 4LF4M 5ITYA 3DOAA 3GPXA 3SAWA 3SATA 2EA0A 1K3XA 4K0KM 3GPPA 4JV5M 4LF5M 4DV1M 4B3RM 2UU9M 1N33M 5ITTA 4G4NA 2F5OA 4X62M 2F5PA 3J81S 2ZM6M 4G4QA 4JI7M 5IWAM 1IBLM 4JI1M 4PDIA 4NXMM 4JI8M 3GO8A 4DR4M 4CISA 4AQYM 3J80S 5LMUM 4YHHM 4G4OA 3SBJA 5LMNM 4DV3M 3VK8A 1N36M 4JI4M 2ZBKB 4NRVA 2OPFA 2HHHM 4LF8M 4PD2A 4LFAM 4LF9M 1N32M 3U6QA 1PJJA 1HR0M 3JR4A 4DR5M 3U6DA 3SASA 2F4VM 1TDHA 2UXCM 4JYAM 5IT9S 4ITQA 4NXNM 2XZUA 3SARA 3U6EA 2OQ4A 1R2ZA 2UUBM 4JI5M 3VK7A 4LF7M 1FJGM 2UXBM 3U6SA 4B3TM 4X66M 1NNJA 4G4RA 3GQ4A 5ITXE 3SAUA 5FLXS 1L1ZA 4MB7A 5A2QS 5ITUA 3JAMS 2VQEM 3JR5A 3U6MA 3GPUA 3A45A 1XC8A 5ITQA 3U6OA 2UUCM 2F5SA 4OX9M 3OTOM 2UUAM 1Q39A 3C58A 4DV0M 4DV7M 4B3MM 3A46A 2XZFA 4DV6M 4X65M 4LFCM 4PDGA 4KHPM 1L2CA 2Q2EB 1K82A 4LF6M 4JI6M 4DR3M 3J7AS 3TWKA 1XMOM 3TWMA 1K3WA 1IBKM 4GKJM 1J5EM 3U6CA 5ITRA 1PJIA 1XNRM 2F5QA 1HNXM 4B3SM 3GQ3A 4NRWA 4GKKM 1XNQM 4DV2M 1EE8A 3U6PA 1L1TA 1HNWM 1L2BA 4JI3M 3GPYA 3A42A 1L2DA 3T1HM 3T1YM
chains in the Genus database with same CATH superfamily
2R45A 3EIEA 5IREB 2G8LA 1XXHB 1V33A 1IN4A 3GLGE 1Z6TA 1N78A 5E6JA 1IXSB 3TWLA 3FD9A 3T6PA 5FTLA 3W0FA 2V1UA 3H4MA 4PT5A 2XH9A 1EIJA 3M7GA 2H5XA 2QBYB 4HLQA 2Z8YM 3GLHB 1PGYA 2KRKA 3QAUA 4AW4A 1QAQA 3GRYA 1Q3BA 3KOXE 4M9SA 3LVVA 2JNHA 3TQSA 4FVMA 1D0MA 3L27A 3CF6E 3TE6A 5DFLA 4CIZA 1IBMM 3B74A 2VF8A 1YE9A 4B7FA 1KFVA 2D7EA 4MM3B 2L09A 3E21A 1PM5A 1DGBA 5IZ7D 5ITYA 1DGGA 4XBOA 2DAIA 2XFSA 2LVPC 3HHZA 1TH3A 4IJFA 4GMQA 2H1RA 1OAIA 3KFUG 2DWZB 2C99A 3RE8A 1PJQA 1TGUA 1AIPC 3CTWB 3THGA 2OOBA 4JV5M 1C1KA 2CHVA 2Z4SA 3RGPA 2NQ8C 3SFZA 3W67A 2F5OA 1T3TA 3ZQJA 1W5SA 2DI0A 3E4RA 4G4QA 3K2LA 5IWAM 3E46A 4JI1M 2ERCA 1HJPA 4JI8M 1JR3A 3FUTA 3Q8XA 1XHBA 2JY8A 4AQYM 4YHHM 4G4OA 3EIHA 4XGIA 3VK8A 2C5RA 5IT9S 2VDBB 4IBKA 5JI3E 2DHRA 3C9PA 3GRVA 1PJTA 2OPFA 4MGZE 3LMMA 3KSXA 3PNVA 2AHMA 4PD2A 3U61A 3BXWA 4D81A 4AZFA 3GLGA 2R65A 3R9XB 2LH0A 3KP0E 3AOGA 2JY6B 2JA2A 2D7GA 4FWGA 2F4VM 2LHCA 1TDHA 4LRTA 4TUWA 2KA6B 1XXHE 4ITQA 1OFIA 2C9CA 3GRRA 4HL4A 2M5ZA 5KPTA 3U6EA 2RGHA 3VFDA 4JI5M 3VKGA 2UXBM 1WGNA 2QPAA 3IHPA 4LG2A 2JY5A 4BB9A 3AJIB 3GLHE 4MB7A 2FNAA 5A2QS 5EXPA 2I7NA 2QQ8A 4RF1A 1AUAA 2DZOB 2C9OA 3VDPA 2DAMA 5ITQA 3U6OA 4AKIA 1TR8A 4HEOA 4RF0A 4OX9M 3OTOM 1GL6A 2LHGA 3PFIA 1DGHB 5FSWA 4DV0M 3HKPA 4B3MM 3A46A 5EP2A 4MGHA 2GNOA 4LFCM 1QAOA 4WW0A 1DO2A 2Q2EB 4LJ9A 4JI6M 4DR3M 2LVQD 2O01F 1IN7A 1OTRA 3LCUA 1ZAEA 4FW9A 1J7KA 4GEWA 1C7YA 4LY6A 3IG5A 3KOYE 2O25A 2P5TA 1OQYA 3BOSA 1HNXM 1P3QQ 2EUCA 4B3SM 3BBZA 3GLIB 4DV2M 3U6PA 2DKLA 3NWLA 1HNWM 1L2BA 3GPYA 2DZNB 1SXJD 1ZMWA 1WXQA 2R18A 3PNYA 1V92A 4B08A 3T1YM 2O5RA 2Z4RA 2LTUA 3L26A 1Z5BA 1IBLM 4NSOB 4QOZC 2R44A 1MU5A 3SC3A 3ZCBB 4DUZM 4AKHA 1TH2A 1VQ1A 3QYBA 1NNUC 4R3DA 3UK6A 3VKHA 2CV2A 1TDZA 5EXXA 1Z5AA 2BJVA 4M9XA 1MN3A 4QNMA 4CGYB 3J27B 3CGWA 3FUXA 5KQDA 4A3VB 1S3SA 4B7GA 1DO0A 5BR8M 1X37A 1Z5CA 2QBYA 4DR6M 2ZTCA 1OIZA 1R4GA 3GLHA 4GHLA 1QUSA 2QSFX 4DR2M 3KXEC 1I94M 3L28A 3AV0A 4LJAA 4GRIA 3GQ5A 2K6BA 1OKSA 4M0WA 1QANA 4WP2A 3HU1A 1R2YA 3MMPA 1G8PA 2N35A 2KHHA 1T6OA 1WHCA 3H4JA 1KSFX 3SAWA 4LZJA 3SATA 3HU3A 4MGYE 3DA1A 2EKKA 3D8BA 4Q7JA 3RGSA 4LF5M 4DV1M 1N33M 3QWLA 4GH9A 4NC6A 4I4LA 1RU3A 1G4AE 2F5PA 2FH0A 5EQTA 2DXIA 3J81S 1ZMUA 2CRUA 4NOOB 5EXSA 3HJQA 4CISA 2A5YB 1E9SA 2R4JA 3FUWA 3K9OA 3J80S 4GHAA 2DAKA 3TL4X 1N36M 1SG9A 4LRSA 4RNAA 2MROB 2WSEF 3LCVB 3U5ZA 3GLIE 4LFAM 4XK8F 4LF9M 1LV7A 3L29A 2M60A 2CUZA 1PJJA 3CF0A 1N75A 1E32A 4IBGA 3QYEA 4WURA 3FTDA 3L25A 1IY0A 3ZC7B 3K8ZA 1D2NA 2UXCM 1WIVA 2KXEA 1W5TA 4L15A 4I8OA 4CJ6A 1R2ZA 1WJ7A 2XSZD 3K92A 5F3WA 2Y0TA 1J09A 1VEKA 2ZANA 4B3TM 2CFOA 1NV9A 1NJFA 4L78A 1NO1A 1VDLA 2K47A 3U60B 1SXJB 1L1ZA 4BBAA 4KT0F 3I01M 3I04M 4LCBA 5ITUA 2QCUA 2Y21A 1QYRA 3A45A 4IBEA 1XC8A 1ZV1A 3SYKA 1PRBA 2JP7A 3SHFA 2FOIC 4AG5A 4R7GA 3FYCA 4DV7M 1DGHA 4PDGA 2B3TA 1L2CA 4LF6M 2R6FA 4FD2A 2G3QA 3FKEA 3J7AS 1XMOM 2J5YA 2Y0QA 2XGNA 3R8FA 2C98A 2CEAA 2WZJA 1XNRM 4FWHA 4Y28F 2EO2A 3FE3A 4L6V6 3GQ3A 2EKFA 4GKKM 4OW0A 1EE8A 2ZAOA 1VG5A 1WGLA 2DAGA 4M0DA 5EP1A 2VIIA 5DYIA 4IBJA 3IECA 3A42A 2LVOC 2C96A 1L2DA 3HZJA 4FWDA 4R71A 2OO9A 3HX3A 1G41A 3LVWA 4L4UA 4D80A 2R4EA 4ANRA 4PCZA 1GO5A 1V34A 4AG6A 1Z59A 2HKJA 2XF3A 1NNJA 5FTJA 1QZEA 1MX0A 3L2AA 1Q3CA 3GP1A 1XMQM 2E5LM 3HWSA 3KOWE 2K0BX 4LJ8A 2K9DA 4KO8A 2F5NA 4DR1M 3KW6A 1OJLA 3FYDA 3AL0C 1UFZA 4DR7M 5BPVA 1CUKA 2XEPA 1IM2A 2UXDM 4GITA 3FTFA 1NY6A 1OIPA 3RFWA 1H6UA 3KS4A 3GRUA 1QQWA 4DV5M 3J7BA 4GC5A 2KW0A 1BVSA 3A98B 5KPZA 2LNHC 2VQFM 4KODA 1SXJE 1IQPA 2DAEA 2CV0A 3GPXA 3Q8GA 3VDUA 4QHSA 1VEGA 2VF7A 1WR1B 2DZLA 4K0KM 2KEBA 2LVNC 2YQZA 1XXHA 2MGWA 2JZ0A 5EXTA 3GPPA 3SMPA 3PVSA 1IXSA 1R5LA 2WSCF 3UZUA 4P17A 3D8LA 1GVNA 1R6BX 4II7A 5EP4A 4FCWA 3E9SA 2Y20A 4JI7M 3T15A 4NXMM 4DR4M 3KOZE 2J7NA 3KVWA 2X8AA 5H37D 2L4EA 4JI4M 1IN8A 5FTNA 2L7IA 3HHWA 2BNKA 1HT1E 1GLNA 1TF0B 1YLAA 3HJ8A 2RRUA 3ILKA 4G3OA 1GABA 1IN6A 3JR4A 2WSFF 2KDLA 3AOEC 1IXZA 3DZDA 3W68A 2APLA 4MGKE 3SASA 3FUVA 4OVZB 4D82A 3IG8A 4JYAM 4IBDA 1NY5A 3GLIA 1G71A 1OFHA 2V1CA 2W82A 2JZ1A 3AOEA 3F92A 4P16A 4S12A 2OQ4A 1GKIA 2UUBM 3SARA 3VK7A 4LF7M 3FTEA 1FJGM 2V6ZM 4RKUF 4LJ6A 5C1BA 2DNAA 3M0EA 3DFZA 3M6AA 2BWEA 4KLNA 2Z3XA 4G4RA 3GQ4A 5FTKA 2KNZA 1IY2A 5ITXE 3SAUA 1JR3D 5KO3A 2HAKA 2YR0A 3SMSA 3MK6A 3GLFB 2CV1A 1SXJA 2YNMD 1NV8A 2CE7A 1NSFA 2FE8A 2HCBA 2L4FA 3B7ZA 3KSJA 5GKNA 3JR5A 3GPUA 1EFUB 2HWJA 3SHGB 3KP1E 4I81A 3KS8A 2F5SA 3B9PA 2QNJA 5KQ8A 4REZA 1Q39A 1Y8GA 4JXJA 2JWSA 4I5SA 3LQRA 4DV6M 4X65M 2XZFA 3FUUA 2XLJA 2QZ4A 2L6OA 3UGJA 3C3DA 3MJ5A 3B7NA 1IN5A 3TWMA 1IBKM 1A5TA 2YFQA 2QP9X 4GKJM 1T43A 1D0LA 3U6CA 4ZPXA 1PJIA 4B7HA 1G3IA 4MH0E 1E94E 1XNQM 1VEJA 3WHKA 1L1TA 1FNNA 1VDDA 1XB2B 1NJGA 2DENA 2ZTDA 4M9ZA 4JI3M 2L2DA 2X49A 5DYGA 7CATA 1ORYB 4X64M 2MJ5B 4QOSA 1N77A 4JI2M 1GJTA 1QDRA 3I51A 2HL7A 4IBCA 3ZH9B 4F1IA 4LFBM 2EJSA 3MHVC 5KPRA 3B7QA 1HNZM 4F2LA 1N34M 1IXRC 2G5GX 1LTMA 1MJGM 4FCVA 2CWBA 4LGYA 4IJEA 2BJWA 4JI0M 1DV0A 5ITXA 3SAVA 4DV4M 1JB0F 3U6LA 1I4WA 4LGMA 1OAOC 4DUYM 3U5ZB 2DWMA 4LJ7A 2FS1A 2DHYA 1PJSA 2D7HA 2MH8A 2RGOA 3FRHA 3FRIA 4QHTA 4LJ5A 4Z8XA 2KNAA 4YY3M 4LF4M 3GLFE 3DOAA 1QUTA 3SYLA 2EA0A 1K3XA 1R7RA 5L8RF 4JN6A 2X4AA 2KZUA 2UU9M 4B3RM 1HQYE 4LJ4A 2LWXA 5ITTA 4G4NA 1E9RA 2XSZA 4UN2B 4X62M 5DNYA 2ZM6M 1ZMVA 1Q02A 1UM8A 1NHWC 2DVWB 4EIWA 3KDSE 5C18A 4PDIA 2QHOB 3T38A 3PXGA 3HY5A 3GO8A 1HQCA 3NBXX 5LMUM 3SBJA 3B89A 2LXEA 4IIWA 1TH4A 5LMNM 4DV3M 2ZAMA 4Z6YA 4AI6A 3TPZA 2ZBKB 4NRVA 3U61B 1D0KA 2HHHM 4LF8M 1YSYA 3GLGB 4FCTA 1N32M 3LW5F 3U6QA 3CF2A 2JY7A 2KNVA 2BWBA 1HR0M 3HU2A 4IBFA 4DR5M 2R46A 1ZQ9A 3U6DA 2XFTA 4GIPA 2JXNA 5JI2E 1XWIA 4OVZA 2J7OA 3NBIA 4NXNM 2XZUA 2FFJA 3FTCA 3UJNA 2L7HA 2DWNA 1F4IA 4L8RC 4QNRA 3U6SA 3HHYA 3LQQA 3AKZA 1NVMA 2Z7JA 4IBBA 4X66M 2KZSA 4OU7A 1L8QA 1QZMA 2MR9A 3J2PB 4GC9A 3VLFB 4L16A 2I7PA 5FLXS 4MGIE 1QVRA 3GLFA 3WHLA 3JAMS 2VQEM 4DBGB 2QENA 3HGIA 2DWLA 1DGFA 3V76A 2UUCM 5EP3A 8CATA 1QDTA 3UMMA 2UUAM 1HT2E 2RKOA 3C58A 2GQFA 2CHGA 3U6MA 2LBCA 5EJCA 1KYIA 1G59A 3I4VA 4KHPM 1K82A 2R0IA 3C3EA 3TWKA 3HJSA 4IBIA 1K3WA 1QAMA 2CP8A 4NSRA 4CHTB 3AFHA 4G6ZA 1J5EM 2R62A 1IFYA 5ITRA 1JQJC 1IY1A 3I4YA 4NL4H 2F5QA 3HHXA 2JUJA 2KRUA 4AKGA 1GJSA 2OOAA 1SXJC 5FTMA 4NRWA 1GL7A 1YUBA 4W5WA 1TTEA 2LVAA 1NHGC 1JR3E 2CHQA 5E26A 3K9PA 3W0LB 3U60A 4LZZA 3T1HM 3K1JA 4BLCA
chains in the Genus database with same CATH topology
2R45A 3EIEA 5IREB 2G8LA 1XXHB 1IN4A 1Z6TA 1N78A 5E6JA 1IXSB 3TWLA 3FD9A 5FTLA 3W0FA 2V1UA 3H4MA 4PT5A 2XH9A 3M7GA 2QBYB 4HLQA 3GLHB 2KRKA 3QAUA 4AW4A 1QAQA 3GRYA 1Q3BA 3KOXE 4M9SA 3LVVA 3TQSA 4FVMA 3L27A 3CF6E 3TE6A 1IBMM 1YE9A 4B7FA 1KFVA 2D7EA 4MM3B 2L09A 1PM5A 1DGBA 5IZ7D 5ITYA 1DGGA 4XBOA 2XFSA 3HHZA 1TH3A 4IJFA 4GMQA 2H1RA 3KFUG 2DWZB 2C99A 3RE8A 1TGUA 4JV5M 3CTWB 3THGA 1C1KA 2CHVA 2Z4SA 3RGPA 2NQ8C 3SFZA 2F5OA 1T3TA 1W5SA 3E4RA 4G4QA 3K2LA 5IWAM 4JI1M 2ERCA 4JI8M 1JR3A 3FUTA 3Q8XA 1XHBA 4AQYM 4YHHM 4G4OA 3EIHA 4XGIA 3VK8A 2C5RA 4IBKA 5JI3E 2DHRA 3GRVA 2OPFA 4MGZE 3LMMA 3KSXA 3PNVA 2AHMA 4PD2A 3U61A 4D81A 4AZFA 3GLGA 2R65A 3R9XB 2LH0A 3KP0E 3AOGA 2JA2A 2D7GA 4FWGA 2F4VM 1TDHA 4LRTA 4TUWA 2KA6B 4ITQA 1OFIA 2C9CA 3GRRA 4HL4A 2M5ZA 5KPTA 3U6EA 2RGHA 3VFDA 4JI5M 3VKGA 2UXBM 2QPAA 4LG2A 4BB9A 3AJIB 4MB7A 2FNAA 5A2QS 5EXPA 2I7NA 4RF1A 3VDPA 2DZOB 2C9OA 5ITQA 4AKIA 3U6OA 4RF0A 4OX9M 3OTOM 1GL6A 3PFIA 1DGHB 5FSWA 4DV0M 3HKPA 4B3MM 3A46A 5EP2A 4MGHA 4LFCM 1QAOA 4WW0A 1DO2A 2Q2EB 4LJ9A 4JI6M 4DR3M 1IN7A 4FW9A 1ZAEA 1J7KA 4LY6A 3IG5A 3KOYE 2P5TA 1HNXM 4B3SM 3BOSA 2EUCA 3GLIB 4DV2M 3U6PA 3NWLA 1HNWM 1L2BA 3GPYA 2DZNB 1SXJD 1WXQA 2R18A 3PNYA 4B08A 3T1YM 2O5RA 2Z4RA 3L26A 1Z5BA 4NSOB 4QOZC 1MU5A 3SC3A 3ZCBB 4DUZM 4AKHA 1TH2A 1NNUC 4R3DA 3UK6A 3VKHA 2CV2A 1TDZA 5EXXA 1Z5AA 2BJVA 4M9XA 4QNMA 4CGYB 3J27B 3FUXA 5KQDA 4A3VB 1S3SA 4B7GA 1DO0A 5BR8M 1X37A 1Z5CA 2QBYA 4DR6M 3GLHA 4GHLA 4DR2M 3KXEC 1I94M 3L28A 3AV0A 4LJAA 4GRIA 3GQ5A 4M0WA 1QANA 3HU1A 1R2YA 1G8PA 1KSFX 3SAWA 4LZJA 3SATA 3HU3A 4MGYE 3DA1A 3D8BA 3RGSA 4LF5M 4DV1M 1N33M 3QWLA 4GH9A 4I4LA 1G4AE 2F5PA 2DXIA 5EQTA 3J81S 4NOOB 5EXSA 3HJQA 4CISA 2A5YB 1E9SA 2R4JA 3FUWA 3J80S 4GHAA 3TL4X 1N36M 4LRSA 4RNAA 3U5ZA 4LFAM 4LF9M 1LV7A 3L29A 2M60A 2CUZA 1PJJA 3CF0A 1N75A 1E32A 4IBGA 4WURA 3FTDA 3L25A 1IY0A 3ZC7B 3K8ZA 1D2NA 2UXCM 2KXEA 1W5TA 4L15A 4I8OA 1R2ZA 2XSZD 3K92A 5F3WA 2Y0TA 1J09A 2ZANA 4B3TM 2CFOA 1NJFA 4L78A 2K47A 3U60B 1SXJB 1L1ZA 4BBAA 4LCBA 5ITUA 2QCUA 2Y21A 1QYRA 3A45A 4IBEA 1XC8A 3SYKA 3SHFA 2FOIC 4AG5A 4R7GA 3FYCA 4DV7M 1DGHA 4PDGA 1L2CA 4LF6M 4FD2A 3FKEA 3J7AS 1XMOM 2Y0QA 2XGNA 3R8FA 2C98A 2CEAA 1XNRM 4FWHA 2EO2A 3GQ3A 4GKKM 4OW0A 1EE8A 2ZAOA 4M0DA 5EP1A 2VIIA 5DYIA 4IBJA 3A42A 1L2DA 2C96A 4FWDA 1G41A 3LVWA 4L4UA 4D80A 2R4EA 4PCZA 4AG6A 1Z59A 2HKJA 2XF3A 5FTJA 1MX0A 3L2AA 1Q3CA 3GP1A 1XMQM 2E5LM 3HWSA 3KOWE 4LJ8A 4KO8A 2F5NA 4DR1M 3KW6A 1OJLA 3FYDA 3AL0C 4DR7M 5BPVA 2XEPA 1IM2A 2UXDM 4GITA 3FTFA 1NY6A 3RFWA 1H6UA 3KS4A 3GRUA 1QQWA 4DV5M 3J7BA 4GC5A 2KW0A 3A98B 5KPZA 2LNHC 2VQFM 4KODA 1SXJE 1IQPA 2CV0A 3GPXA 3VDUA 4QHSA 4K0KM 2KEBA 2YQZA 3GPPA 1XXHA 5EXTA 3SMPA 3PVSA 3UZUA 3D8LA 1GVNA 1R6BX 4II7A 5EP4A 4FCWA 3E9SA 2Y20A 4JI7M 3T15A 4NXMM 4DR4M 3KOZE 2J7NA 3KVWA 2X8AA 5H37D 4JI4M 1IN8A 5FTNA 2L7IA 3HHWA 2BNKA 1HT1E 1GLNA 3ILKA 3HJ8A 1IN6A 3JR4A 3AOEC 1IXZA 3DZDA 4MGKE 3SASA 3FUVA 4OVZB 4D82A 3IG8A 4JYAM 4IBDA 1NY5A 5IT9S 2V1CA 1OFHA 2W82A 3AOEA 4S12A 3SARA 4P16A 2OQ4A 1GKIA 2UUBM 4LF7M 3VK7A 3FTEA 1FJGM 2V6ZM 5C1BA 4LJ6A 3M0EA 4KLNA 3DFZA 3M6AA 1NNJA 2Z3XA 4G4RA 3GQ4A 5FTKA 5ITXE 1IY2A 3SAUA 1JR3D 5KO3A 2YR0A 3GLFB 3SMSA 3MK6A 2CV1A 1SXJA 2YNMD 2CE7A 2FE8A 1NSFA 2HCBA 3JR5A 3KSJA 5GKNA 3U6MA 3GPUA 3SHGB 3KP1E 4I81A 3KS8A 2F5SA 3B9PA 5KQ8A 4REZA 1Q39A 4JXJA 4I5SA 3LQRA 4DV6M 4X65M 2XZFA 3FUUA 2XLJA 2QZ4A 2L6OA 3UGJA 3MJ5A 1IN5A 3TWMA 1IBKM 2YFQA 2QP9X 4GKJM 3U6CA 4ZPXA 1PJIA 4B7HA 1G3IA 4MH0E 1E94E 1XNQM 3WHKA 1L1TA 1FNNA 1VDDA 1NJGA 4M9ZA 4JI3M 2X49A 5DYGA 7CATA 1ORYB 4X64M 4QOSA 1N77A 4JI2M 3I51A 2HL7A 4IBCA 3ZH9B 4LFBM 3MHVC 5KPRA 1HNZM 1N34M 1IXRC 2G5GX 4JI0M 4FCVA 4LGYA 4IJEA 2BJWA 5ITXA 3SAVA 4DV4M 3U6LA 1I4WA 4LGMA 4DUYM 3U5ZB 2DWMA 4LJ7A 2RGOA 2D7HA 4QHTA 4Z8XA 3GLIA 4LJ5A 4YY3M 4LF4M 3DOAA 3SYLA 2EA0A 1K3XA 1R7RA 4JN6A 2X4AA 2KZUA 2UU9M 4B3RM 1HQYE 4LJ4A 2LWXA 5ITTA 4G4NA 1E9RA 2XSZA 4X62M 5DNYA 2ZM6M 1UM8A 5C18A 1NHWC 2DVWB 4EIWA 3KDSE 1IBLM 4PDIA 3T38A 3PXGA 3GO8A 1HQCA 5LMUM 3SBJA 2LXEA 4IIWA 1TH4A 5LMNM 4DV3M 2ZAMA 4Z6YA 4AI6A 3TPZA 2ZBKB 4NRVA 3U61B 2HHHM 4LF8M 1YSYA 3GLGB 4FCTA 1N32M 3U6QA 3CF2A 1HR0M 3HU2A 4IBFA 4DR5M 2R46A 1ZQ9A 3U6DA 2XFTA 4GIPA 5JI2E 1XWIA 4OVZA 2J7OA 3NBIA 4NXNM 2XZUA 2FFJA 3FTCA 3UJNA 2L7HA 2DWNA 4L8RC 4QNRA 3U6SA 3HHYA 3LQQA 3AKZA 1NVMA 2Z7JA 4IBBA 4X66M 2KZSA 4OU7A 1L8QA 1QZMA 3J2PB 3VLFB 4GC9A 4L16A 2I7PA 5FLXS 4MGIE 1QVRA 3GLFA 3WHLA 3JAMS 2VQEM 2QENA 3HGIA 2DWLA 1DGFA 2UUCM 5EP3A 8CATA 3UMMA 2UUAM 1HT2E 2RKOA 3C58A 2CHGA 5EJCA 1KYIA 1G59A 3I4VA 4KHPM 1K82A 3TWKA 3HJSA 4IBIA 1K3WA 1QAMA 4NSRA 4CHTB 3AFHA 4G6ZA 1J5EM 2R62A 5ITRA 1JQJC 1IY1A 3I4YA 4NL4H 2F5QA 3HHXA 4AKGA 2KRUA 5FTMA 1SXJC 4NRWA 1GL7A 1YUBA 4W5WA 1NHGC 2CHQA 5E26A 3W0LB 3U60A 4LZZA 3T1HM 3K1JA 4BLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5B A;  4X64 M;  1MU5 A;  4DUZ M;  4JI2 M;  4PCZ A;  1Z59 A;  2HKJ A;  1TDZ A;  3TWL A;  4LFB M;  1MX0 A;  1Q3C A;  1Z5A A;  3GP1 A;  3W0F A;  1XMQ M;  2E5L M;  1HNZ M;  1N34 M;  2F5N A;  4DR1 M;  4JI0 M;  4DR7 M;  5ITX A;  5BR8 M;  1Z5C A;  3SAV A;  4DV4 M;  4DR6 M;  2UXD M;  3U6L A;  1Q3B A;  4DUY M;  4DR2 M;  1I94 M;  3GQ5 A;  4DV5 M;  1IBM M;  1KFV A;  2VQF M;  4YY3 M;  1PM5 A;  1R2Y A;  4LF4 M;  5ITY A;  3DOA A;  3GPX A;  3SAW A;  3SAT A;  2EA0 A;  1K3X A;  4K0K M;  3GPP A;  4JV5 M;  4LF5 M;  4DV1 M;  4B3R M;  2UU9 M;  1N33 M;  5ITT A;  4G4N A;  2F5O A;  4X62 M;  2F5P A;  3J81 S;  2ZM6 M;  4G4Q A;  4JI7 M;  5IWA M;  1IBL M;  4JI1 M;  4PDI A;  4NXM M;  4JI8 M;  3GO8 A;  4DR4 M;  4CIS A;  4AQY M;  3J80 S;  5LMU M;  4YHH M;  4G4O A;  3SBJ A;  5LMN M;  4DV3 M;  3VK8 A;  1N36 M;  4JI4 M;  2ZBK B;  4NRV A;  2OPF A;  2HHH M;  4LF8 M;  4PD2 A;  4LFA M;  4LF9 M;  1N32 M;  3U6Q A;  1PJJ A;  1HR0 M;  3JR4 A;  4DR5 M;  3U6D A;  3SAS A;  2F4V M;  1TDH A;  2UXC M;  4JYA M;  5IT9 S;  4ITQ A;  4NXN M;  2XZU A;  3SAR A;  3U6E A;  2OQ4 A;  1R2Z A;  2UUB M;  4JI5 M;  3VK7 A;  4LF7 M;  1FJG M;  2UXB M;  3U6S A;  4B3T M;  4X66 M;  1NNJ A;  4G4R A;  3GQ4 A;  5ITX E;  3SAU A;  5FLX S;  1L1Z A;  4MB7 A;  5A2Q S;  5ITU A;  3JAM S;  2VQE M;  3JR5 A;  3U6M A;  3GPU A;  3A45 A;  1XC8 A;  5ITQ A;  3U6O A;  2UUC M;  2F5S A;  4OX9 M;  3OTO M;  2UUA M;  1Q39 A;  3C58 A;  4DV0 M;  4DV7 M;  4B3M M;  3A46 A;  2XZF A;  4DV6 M;  4X65 M;  4LFC M;  4PDG A;  4KHP M;  1L2C A;  2Q2E B;  1K82 A;  4LF6 M;  4JI6 M;  4DR3 M;  3J7A S;  3TWK A;  1XMO M;  3TWM A;  1K3W A;  1IBK M;  4GKJ M;  1J5E M;  3U6C A;  5ITR A;  1PJI A;  1XNR M;  2F5Q A;  1HNX M;  4B3S M;  3GQ3 A;  4NRW A;  4GKK M;  1XNQ M;  4DV2 M;  1EE8 A;  3U6P A;  1L1T A;  1HNW M;  1L2B A;  4JI3 M;  3GPY A;  3A42 A;  1L2D A;  3T1H M;  3T1Y M; 
#chains in the Genus database with same CATH topology
 2R45 A;  3EIE A;  5IRE B;  2G8L A;  1XXH B;  1V33 A;  1IN4 A;  3GLG E;  1Z6T A;  1N78 A;  5E6J A;  1IXS B;  3TWL A;  3FD9 A;  3T6P A;  5FTL A;  3W0F A;  2V1U A;  3H4M A;  4PT5 A;  2XH9 A;  1EIJ A;  3M7G A;  2H5X A;  2QBY B;  4HLQ A;  2Z8Y M;  3GLH B;  1PGY A;  2KRK A;  3QAU A;  4AW4 A;  1QAQ A;  3GRY A;  1Q3B A;  3KOX E;  4M9S A;  3LVV A;  2JNH A;  3TQS A;  4FVM A;  1D0M A;  3L27 A;  3CF6 E;  3TE6 A;  5DFL A;  4CIZ A;  1IBM M;  3B74 A;  2VF8 A;  1YE9 A;  4B7F A;  1KFV A;  2D7E A;  4MM3 B;  2L09 A;  3E21 A;  1PM5 A;  1DGB A;  5IZ7 D;  5ITY A;  1DGG A;  4XBO A;  2DAI A;  2XFS A;  2LVP C;  3HHZ A;  1TH3 A;  4IJF A;  4GMQ A;  2H1R A;  1OAI A;  3KFU G;  2DWZ B;  2C99 A;  3RE8 A;  1PJQ A;  1TGU A;  1AIP C;  3CTW B;  3THG A;  2OOB A;  4JV5 M;  1C1K A;  2CHV A;  2Z4S A;  3RGP A;  2NQ8 C;  3SFZ A;  3W67 A;  2F5O A;  1T3T A;  3ZQJ A;  1W5S A;  2DI0 A;  3E4R A;  4G4Q A;  3K2L A;  5IWA M;  3E46 A;  4JI1 M;  2ERC A;  1HJP A;  4JI8 M;  1JR3 A;  3FUT A;  3Q8X A;  1XHB A;  2JY8 A;  4AQY M;  4YHH M;  4G4O A;  3EIH A;  4XGI A;  3VK8 A;  2C5R A;  5IT9 S;  2VDB B;  4IBK A;  5JI3 E;  2DHR A;  3C9P A;  3GRV A;  1PJT A;  2OPF A;  4MGZ E;  3LMM A;  3KSX A;  3PNV A;  2AHM A;  4PD2 A;  3U61 A;  3BXW A;  4D81 A;  4AZF A;  3GLG A;  2R65 A;  3R9X B;  2LH0 A;  3KP0 E;  3AOG A;  2JY6 B;  2JA2 A;  2D7G A;  4FWG A;  2F4V M;  2LHC A;  1TDH A;  4LRT A;  4TUW A;  2KA6 B;  1XXH E;  4ITQ A;  1OFI A;  2C9C A;  3GRR A;  4HL4 A;  2M5Z A;  5KPT A;  3U6E A;  2RGH A;  3VFD A;  4JI5 M;  3VKG A;  2UXB M;  1WGN A;  2QPA A;  3IHP A;  4LG2 A;  2JY5 A;  4BB9 A;  3AJI B;  3GLH E;  4MB7 A;  2FNA A;  5A2Q S;  5EXP A;  2I7N A;  2QQ8 A;  4RF1 A;  1AUA A;  2DZO B;  2C9O A;  3VDP A;  2DAM A;  5ITQ A;  3U6O A;  4AKI A;  1TR8 A;  4HEO A;  4RF0 A;  4OX9 M;  3OTO M;  1GL6 A;  2LHG A;  3PFI A;  1DGH B;  5FSW A;  4DV0 M;  3HKP A;  4B3M M;  3A46 A;  5EP2 A;  4MGH A;  2GNO A;  4LFC M;  1QAO A;  4WW0 A;  1DO2 A;  2Q2E B;  4LJ9 A;  4JI6 M;  4DR3 M;  2LVQ D;  2O01 F;  1IN7 A;  1OTR A;  3LCU A;  1ZAE A;  4FW9 A;  1J7K A;  4GEW A;  1C7Y A;  4LY6 A;  3IG5 A;  3KOY E;  2O25 A;  2P5T A;  1OQY A;  3BOS A;  1HNX M;  1P3Q Q;  2EUC A;  4B3S M;  3BBZ A;  3GLI B;  4DV2 M;  3U6P A;  2DKL A;  3NWL A;  1HNW M;  1L2B A;  3GPY A;  2DZN B;  1SXJ D;  1ZMW A;  1WXQ A;  2R18 A;  3PNY A;  1V92 A;  4B08 A;  3T1Y M;  2O5R A;  2Z4R A;  2LTU A;  3L26 A;  1Z5B A;  1IBL M;  4NSO B;  4QOZ C;  2R44 A;  1MU5 A;  3SC3 A;  3ZCB B;  4DUZ M;  4AKH A;  1TH2 A;  1VQ1 A;  3QYB A;  1NNU C;  4R3D A;  3UK6 A;  3VKH A;  2CV2 A;  1TDZ A;  5EXX A;  1Z5A A;  2BJV A;  4M9X A;  1MN3 A;  4QNM A;  4CGY B;  3J27 B;  3CGW A;  3FUX A;  5KQD A;  4A3V B;  1S3S A;  4B7G A;  1DO0 A;  5BR8 M;  1X37 A;  1Z5C A;  2QBY A;  4DR6 M;  2ZTC A;  1OIZ A;  1R4G A;  3GLH A;  4GHL A;  1QUS A;  2QSF X;  4DR2 M;  3KXE C;  1I94 M;  3L28 A;  3AV0 A;  4LJA A;  4GRI A;  3GQ5 A;  2K6B A;  1OKS A;  4M0W A;  1QAN A;  4WP2 A;  3HU1 A;  1R2Y A;  3MMP A;  1G8P A;  2N35 A;  2KHH A;  1T6O A;  1WHC A;  3H4J A;  1KSF X;  3SAW A;  4LZJ A;  3SAT A;  3HU3 A;  4MGY E;  3DA1 A;  2EKK A;  3D8B A;  4Q7J A;  3RGS A;  4LF5 M;  4DV1 M;  1N33 M;  3QWL A;  4GH9 A;  4NC6 A;  4I4L A;  1RU3 A;  1G4A E;  2F5P A;  2FH0 A;  5EQT A;  2DXI A;  3J81 S;  1ZMU A;  2CRU A;  4NOO B;  5EXS A;  3HJQ A;  4CIS A;  2A5Y B;  1E9S A;  2R4J A;  3FUW A;  3K9O A;  3J80 S;  4GHA A;  2DAK A;  3TL4 X;  1N36 M;  1SG9 A;  4LRS A;  4RNA A;  2MRO B;  2WSE F;  3LCV B;  3U5Z A;  3GLI E;  4LFA M;  4XK8 F;  4LF9 M;  1LV7 A;  3L29 A;  2M60 A;  2CUZ A;  1PJJ A;  3CF0 A;  1N75 A;  1E32 A;  4IBG A;  3QYE A;  4WUR A;  3FTD A;  3L25 A;  1IY0 A;  3ZC7 B;  3K8Z A;  1D2N A;  2UXC M;  1WIV A;  2KXE A;  1W5T A;  4L15 A;  4I8O A;  4CJ6 A;  1R2Z A;  1WJ7 A;  2XSZ D;  3K92 A;  5F3W A;  2Y0T A;  1J09 A;  1VEK A;  2ZAN A;  4B3T M;  2CFO A;  1NV9 A;  1NJF A;  4L78 A;  1NO1 A;  1VDL A;  2K47 A;  3U60 B;  1SXJ B;  1L1Z A;  4BBA A;  4KT0 F;  3I01 M;  3I04 M;  4LCB A;  5ITU A;  2QCU A;  2Y21 A;  1QYR A;  3A45 A;  4IBE A;  1XC8 A;  1ZV1 A;  3SYK A;  1PRB A;  2JP7 A;  3SHF A;  2FOI C;  4AG5 A;  4R7G A;  3FYC A;  4DV7 M;  1DGH A;  4PDG A;  2B3T A;  1L2C A;  4LF6 M;  2R6F A;  4FD2 A;  2G3Q A;  3FKE A;  3J7A S;  1XMO M;  2J5Y A;  2Y0Q A;  2XGN A;  3R8F A;  2C98 A;  2CEA A;  2WZJ A;  1XNR M;  4FWH A;  4Y28 F;  2EO2 A;  3FE3 A;  4L6V 6;  3GQ3 A;  2EKF A;  4GKK M;  4OW0 A;  1EE8 A;  2ZAO A;  1VG5 A;  1WGL A;  2DAG A;  4M0D A;  5EP1 A;  2VII A;  5DYI A;  4IBJ A;  3IEC A;  3A42 A;  2LVO C;  2C96 A;  1L2D A;  3HZJ A;  4FWD A;  4R71 A;  2OO9 A;  3HX3 A;  1G41 A;  3LVW A;  4L4U A;  4D80 A;  2R4E A;  4ANR A;  4PCZ A;  1GO5 A;  1V34 A;  4AG6 A;  1Z59 A;  2HKJ A;  2XF3 A;  1NNJ A;  5FTJ A;  1QZE A;  1MX0 A;  3L2A A;  1Q3C A;  3GP1 A;  1XMQ M;  2E5L M;  3HWS A;  3KOW E;  2K0B X;  4LJ8 A;  2K9D A;  4KO8 A;  2F5N A;  4DR1 M;  3KW6 A;  1OJL A;  3FYD A;  3AL0 C;  1UFZ A;  4DR7 M;  5BPV A;  1CUK A;  2XEP A;  1IM2 A;  2UXD M;  4GIT A;  3FTF A;  1NY6 A;  1OIP A;  3RFW A;  1H6U A;  3KS4 A;  3GRU A;  1QQW A;  4DV5 M;  3J7B A;  4GC5 A;  2KW0 A;  1BVS A;  3A98 B;  5KPZ A;  2LNH C;  2VQF M;  4KOD A;  1SXJ E;  1IQP A;  2DAE A;  2CV0 A;  3GPX A;  3Q8G A;  3VDU A;  4QHS A;  1VEG A;  2VF7 A;  1WR1 B;  2DZL A;  4K0K M;  2KEB A;  2LVN C;  2YQZ A;  1XXH A;  2MGW A;  2JZ0 A;  5EXT A;  3GPP A;  3SMP A;  3PVS A;  1IXS A;  1R5L A;  2WSC F;  3UZU A;  4P17 A;  3D8L A;  1GVN A;  1R6B X;  4II7 A;  5EP4 A;  4FCW A;  3E9S A;  2Y20 A;  4JI7 M;  3T15 A;  4NXM M;  4DR4 M;  3KOZ E;  2J7N A;  3KVW A;  2X8A A;  5H37 D;  2L4E A;  4JI4 M;  1IN8 A;  5FTN A;  2L7I A;  3HHW A;  2BNK A;  1HT1 E;  1GLN A;  1TF0 B;  1YLA A;  3HJ8 A;  2RRU A;  3ILK A;  4G3O A;  1GAB A;  1IN6 A;  3JR4 A;  2WSF F;  2KDL A;  3AOE C;  1IXZ A;  3DZD A;  3W68 A;  2APL A;  4MGK E;  3SAS A;  3FUV A;  4OVZ B;  4D82 A;  3IG8 A;  4JYA M;  4IBD A;  1NY5 A;  3GLI A;  1G71 A;  1OFH A;  2V1C A;  2W82 A;  2JZ1 A;  3AOE A;  3F92 A;  4P16 A;  4S12 A;  2OQ4 A;  1GKI A;  2UUB M;  3SAR A;  3VK7 A;  4LF7 M;  3FTE A;  1FJG M;  2V6Z M;  4RKU F;  4LJ6 A;  5C1B A;  2DNA A;  3M0E A;  3DFZ A;  3M6A A;  2BWE A;  4KLN A;  2Z3X A;  4G4R A;  3GQ4 A;  5FTK A;  2KNZ A;  1IY2 A;  5ITX E;  3SAU A;  1JR3 D;  5KO3 A;  2HAK A;  2YR0 A;  3SMS A;  3MK6 A;  3GLF B;  2CV1 A;  1SXJ A;  2YNM D;  1NV8 A;  2CE7 A;  1NSF A;  2FE8 A;  2HCB A;  2L4F A;  3B7Z A;  3KSJ A;  5GKN A;  3JR5 A;  3GPU A;  1EFU B;  2HWJ A;  3SHG B;  3KP1 E;  4I81 A;  3KS8 A;  2F5S A;  3B9P A;  2QNJ A;  5KQ8 A;  4REZ A;  1Q39 A;  1Y8G A;  4JXJ A;  2JWS A;  4I5S A;  3LQR A;  4DV6 M;  4X65 M;  2XZF A;  3FUU A;  2XLJ A;  2QZ4 A;  2L6O A;  3UGJ A;  3C3D A;  3MJ5 A;  3B7N A;  1IN5 A;  3TWM A;  1IBK M;  1A5T A;  2YFQ A;  2QP9 X;  4GKJ M;  1T43 A;  1D0L A;  3U6C A;  4ZPX A;  1PJI A;  4B7H A;  1G3I A;  4MH0 E;  1E94 E;  1XNQ M;  1VEJ A;  3WHK A;  1L1T A;  1FNN A;  1VDD A;  1XB2 B;  1NJG A;  2DEN A;  2ZTD A;  4M9Z A;  4JI3 M;  2L2D A;  2X49 A;  5DYG A;  7CAT A;  1ORY B;  4X64 M;  2MJ5 B;  4QOS A;  1N77 A;  4JI2 M;  1GJT A;  1QDR A;  3I51 A;  2HL7 A;  4IBC A;  3ZH9 B;  4F1I A;  4LFB M;  2EJS A;  3MHV C;  5KPR A;  3B7Q A;  1HNZ M;  4F2L A;  1N34 M;  1IXR C;  2G5G X;  1LTM A;  1MJG M;  4FCV A;  2CWB A;  4LGY A;  4IJE A;  2BJW A;  4JI0 M;  1DV0 A;  5ITX A;  3SAV A;  4DV4 M;  1JB0 F;  3U6L A;  1I4W A;  4LGM A;  1OAO C;  4DUY M;  3U5Z B;  2DWM A;  4LJ7 A;  2FS1 A;  2DHY A;  1PJS A;  2D7H A;  2MH8 A;  2RGO A;  3FRH A;  3FRI A;  4QHT A;  4LJ5 A;  4Z8X A;  2KNA A;  4YY3 M;  4LF4 M;  3GLF E;  3DOA A;  1QUT A;  3SYL A;  2EA0 A;  1K3X A;  1R7R A;  5L8R F;  4JN6 A;  2X4A A;  2KZU A;  2UU9 M;  4B3R M;  1HQY E;  4LJ4 A;  2LWX A;  5ITT A;  4G4N A;  1E9R A;  2XSZ A;  4UN2 B;  4X62 M;  5DNY A;  2ZM6 M;  1ZMV A;  1Q02 A;  1UM8 A;  1NHW C;  2DVW B;  4EIW A;  3KDS E;  5C18 A;  4PDI A;  2QHO B;  3T38 A;  3PXG A;  3HY5 A;  3GO8 A;  1HQC A;  3NBX X;  5LMU M;  3SBJ A;  3B89 A;  2LXE A;  4IIW A;  1TH4 A;  5LMN M;  4DV3 M;  2ZAM A;  4Z6Y A;  4AI6 A;  3TPZ A;  2ZBK B;  4NRV A;  3U61 B;  1D0K A;  2HHH M;  4LF8 M;  1YSY A;  3GLG B;  4FCT A;  1N32 M;  3LW5 F;  3U6Q A;  3CF2 A;  2JY7 A;  2KNV A;  2BWB A;  1HR0 M;  3HU2 A;  4IBF A;  4DR5 M;  2R46 A;  1ZQ9 A;  3U6D A;  2XFT A;  4GIP A;  2JXN A;  5JI2 E;  1XWI A;  4OVZ A;  2J7O A;  3NBI A;  4NXN M;  2XZU A;  2FFJ A;  3FTC A;  3UJN A;  2L7H A;  2DWN A;  1F4I A;  4L8R C;  4QNR A;  3U6S A;  3HHY A;  3LQQ A;  3AKZ A;  1NVM A;  2Z7J A;  4IBB A;  4X66 M;  2KZS A;  4OU7 A;  1L8Q A;  1QZM A;  2MR9 A;  3J2P B;  4GC9 A;  3VLF B;  4L16 A;  2I7P A;  5FLX S;  4MGI E;  1QVR A;  3GLF A;  3WHL A;  3JAM S;  2VQE M;  4DBG B;  2QEN A;  3HGI A;  2DWL A;  1DGF A;  3V76 A;  2UUC M;  5EP3 A;  8CAT A;  1QDT A;  3UMM A;  2UUA M;  1HT2 E;  2RKO A;  3C58 A;  2GQF A;  2CHG A;  3U6M A;  2LBC A;  5EJC A;  1KYI A;  1G59 A;  3I4V A;  4KHP M;  1K82 A;  2R0I A;  3C3E A;  3TWK A;  3HJS A;  4IBI A;  1K3W A;  1QAM A;  2CP8 A;  4NSR A;  4CHT B;  3AFH A;  4G6Z A;  1J5E M;  2R62 A;  1IFY A;  5ITR A;  1JQJ C;  1IY1 A;  3I4Y A;  4NL4 H;  2F5Q A;  3HHX A;  2JUJ A;  2KRU A;  4AKG A;  1GJS A;  2OOA A;  1SXJ C;  5FTM A;  4NRW A;  1GL7 A;  1YUB A;  4W5W A;  1TTE A;  2LVA A;  1NHG C;  1JR3 E;  2CHQ A;  5E26 A;  3K9P A;  3W0L B;  3U60 A;  4LZZ A;  3T1H M;  3K1J A;  4BLC A; 
#chains in the Genus database with same CATH homology
 2R45 A;  3EIE A;  5IRE B;  2G8L A;  1XXH B;  1IN4 A;  1Z6T A;  1N78 A;  5E6J A;  1IXS B;  3TWL A;  3FD9 A;  5FTL A;  3W0F A;  2V1U A;  3H4M A;  4PT5 A;  2XH9 A;  3M7G A;  2QBY B;  4HLQ A;  3GLH B;  2KRK A;  3QAU A;  4AW4 A;  1QAQ A;  3GRY A;  1Q3B A;  3KOX E;  4M9S A;  3LVV A;  3TQS A;  4FVM A;  3L27 A;  3CF6 E;  3TE6 A;  1IBM M;  1YE9 A;  4B7F A;  1KFV A;  2D7E A;  4MM3 B;  2L09 A;  1PM5 A;  1DGB A;  5IZ7 D;  5ITY A;  1DGG A;  4XBO A;  2XFS A;  3HHZ A;  1TH3 A;  4IJF A;  4GMQ A;  2H1R A;  3KFU G;  2DWZ B;  2C99 A;  3RE8 A;  1TGU A;  4JV5 M;  3CTW B;  3THG A;  1C1K A;  2CHV A;  2Z4S A;  3RGP A;  2NQ8 C;  3SFZ A;  2F5O A;  1T3T A;  1W5S A;  3E4R A;  4G4Q A;  3K2L A;  5IWA M;  4JI1 M;  2ERC A;  4JI8 M;  1JR3 A;  3FUT A;  3Q8X A;  1XHB A;  4AQY M;  4YHH M;  4G4O A;  3EIH A;  4XGI A;  3VK8 A;  2C5R A;  4IBK A;  5JI3 E;  2DHR A;  3GRV A;  2OPF A;  4MGZ E;  3LMM A;  3KSX A;  3PNV A;  2AHM A;  4PD2 A;  3U61 A;  4D81 A;  4AZF A;  3GLG A;  2R65 A;  3R9X B;  2LH0 A;  3KP0 E;  3AOG A;  2JA2 A;  2D7G A;  4FWG A;  2F4V M;  1TDH A;  4LRT A;  4TUW A;  2KA6 B;  4ITQ A;  1OFI A;  2C9C A;  3GRR A;  4HL4 A;  2M5Z A;  5KPT A;  3U6E A;  2RGH A;  3VFD A;  4JI5 M;  3VKG A;  2UXB M;  2QPA A;  4LG2 A;  4BB9 A;  3AJI B;  4MB7 A;  2FNA A;  5A2Q S;  5EXP A;  2I7N A;  4RF1 A;  3VDP A;  2DZO B;  2C9O A;  5ITQ A;  4AKI A;  3U6O A;  4RF0 A;  4OX9 M;  3OTO M;  1GL6 A;  3PFI A;  1DGH B;  5FSW A;  4DV0 M;  3HKP A;  4B3M M;  3A46 A;  5EP2 A;  4MGH A;  4LFC M;  1QAO A;  4WW0 A;  1DO2 A;  2Q2E B;  4LJ9 A;  4JI6 M;  4DR3 M;  1IN7 A;  4FW9 A;  1ZAE A;  1J7K A;  4LY6 A;  3IG5 A;  3KOY E;  2P5T A;  1HNX M;  4B3S M;  3BOS A;  2EUC A;  3GLI B;  4DV2 M;  3U6P A;  3NWL A;  1HNW M;  1L2B A;  3GPY A;  2DZN B;  1SXJ D;  1WXQ A;  2R18 A;  3PNY A;  4B08 A;  3T1Y M;  2O5R A;  2Z4R A;  3L26 A;  1Z5B A;  4NSO B;  4QOZ C;  1MU5 A;  3SC3 A;  3ZCB B;  4DUZ M;  4AKH A;  1TH2 A;  1NNU C;  4R3D A;  3UK6 A;  3VKH A;  2CV2 A;  1TDZ A;  5EXX A;  1Z5A A;  2BJV A;  4M9X A;  4QNM A;  4CGY B;  3J27 B;  3FUX A;  5KQD A;  4A3V B;  1S3S A;  4B7G A;  1DO0 A;  5BR8 M;  1X37 A;  1Z5C A;  2QBY A;  4DR6 M;  3GLH A;  4GHL A;  4DR2 M;  3KXE C;  1I94 M;  3L28 A;  3AV0 A;  4LJA A;  4GRI A;  3GQ5 A;  4M0W A;  1QAN A;  3HU1 A;  1R2Y A;  1G8P A;  1KSF X;  3SAW A;  4LZJ A;  3SAT A;  3HU3 A;  4MGY E;  3DA1 A;  3D8B A;  3RGS A;  4LF5 M;  4DV1 M;  1N33 M;  3QWL A;  4GH9 A;  4I4L A;  1G4A E;  2F5P A;  2DXI A;  5EQT A;  3J81 S;  4NOO B;  5EXS A;  3HJQ A;  4CIS A;  2A5Y B;  1E9S A;  2R4J A;  3FUW A;  3J80 S;  4GHA A;  3TL4 X;  1N36 M;  4LRS A;  4RNA A;  3U5Z A;  4LFA M;  4LF9 M;  1LV7 A;  3L29 A;  2M60 A;  2CUZ A;  1PJJ A;  3CF0 A;  1N75 A;  1E32 A;  4IBG A;  4WUR A;  3FTD A;  3L25 A;  1IY0 A;  3ZC7 B;  3K8Z A;  1D2N A;  2UXC M;  2KXE A;  1W5T A;  4L15 A;  4I8O A;  1R2Z A;  2XSZ D;  3K92 A;  5F3W A;  2Y0T A;  1J09 A;  2ZAN A;  4B3T M;  2CFO A;  1NJF A;  4L78 A;  2K47 A;  3U60 B;  1SXJ B;  1L1Z A;  4BBA A;  4LCB A;  5ITU A;  2QCU A;  2Y21 A;  1QYR A;  3A45 A;  4IBE A;  1XC8 A;  3SYK A;  3SHF A;  2FOI C;  4AG5 A;  4R7G A;  3FYC A;  4DV7 M;  1DGH A;  4PDG A;  1L2C A;  4LF6 M;  4FD2 A;  3FKE A;  3J7A S;  1XMO M;  2Y0Q A;  2XGN A;  3R8F A;  2C98 A;  2CEA A;  1XNR M;  4FWH A;  2EO2 A;  3GQ3 A;  4GKK M;  4OW0 A;  1EE8 A;  2ZAO A;  4M0D A;  5EP1 A;  2VII A;  5DYI A;  4IBJ A;  3A42 A;  1L2D A;  2C96 A;  4FWD A;  1G41 A;  3LVW A;  4L4U A;  4D80 A;  2R4E A;  4PCZ A;  4AG6 A;  1Z59 A;  2HKJ A;  2XF3 A;  5FTJ A;  1MX0 A;  3L2A A;  1Q3C A;  3GP1 A;  1XMQ M;  2E5L M;  3HWS A;  3KOW E;  4LJ8 A;  4KO8 A;  2F5N A;  4DR1 M;  3KW6 A;  1OJL A;  3FYD A;  3AL0 C;  4DR7 M;  5BPV A;  2XEP A;  1IM2 A;  2UXD M;  4GIT A;  3FTF A;  1NY6 A;  3RFW A;  1H6U A;  3KS4 A;  3GRU A;  1QQW A;  4DV5 M;  3J7B A;  4GC5 A;  2KW0 A;  3A98 B;  5KPZ A;  2LNH C;  2VQF M;  4KOD A;  1SXJ E;  1IQP A;  2CV0 A;  3GPX A;  3VDU A;  4QHS A;  4K0K M;  2KEB A;  2YQZ A;  3GPP A;  1XXH A;  5EXT A;  3SMP A;  3PVS A;  3UZU A;  3D8L A;  1GVN A;  1R6B X;  4II7 A;  5EP4 A;  4FCW A;  3E9S A;  2Y20 A;  4JI7 M;  3T15 A;  4NXM M;  4DR4 M;  3KOZ E;  2J7N A;  3KVW A;  2X8A A;  5H37 D;  4JI4 M;  1IN8 A;  5FTN A;  2L7I A;  3HHW A;  2BNK A;  1HT1 E;  1GLN A;  3ILK A;  3HJ8 A;  1IN6 A;  3JR4 A;  3AOE C;  1IXZ A;  3DZD A;  4MGK E;  3SAS A;  3FUV A;  4OVZ B;  4D82 A;  3IG8 A;  4JYA M;  4IBD A;  1NY5 A;  5IT9 S;  2V1C A;  1OFH A;  2W82 A;  3AOE A;  4S12 A;  3SAR A;  4P16 A;  2OQ4 A;  1GKI A;  2UUB M;  4LF7 M;  3VK7 A;  3FTE A;  1FJG M;  2V6Z M;  5C1B A;  4LJ6 A;  3M0E A;  4KLN A;  3DFZ A;  3M6A A;  1NNJ A;  2Z3X A;  4G4R A;  3GQ4 A;  5FTK A;  5ITX E;  1IY2 A;  3SAU A;  1JR3 D;  5KO3 A;  2YR0 A;  3GLF B;  3SMS A;  3MK6 A;  2CV1 A;  1SXJ A;  2YNM D;  2CE7 A;  2FE8 A;  1NSF A;  2HCB A;  3JR5 A;  3KSJ A;  5GKN A;  3U6M A;  3GPU A;  3SHG B;  3KP1 E;  4I81 A;  3KS8 A;  2F5S A;  3B9P A;  5KQ8 A;  4REZ A;  1Q39 A;  4JXJ A;  4I5S A;  3LQR A;  4DV6 M;  4X65 M;  2XZF A;  3FUU A;  2XLJ A;  2QZ4 A;  2L6O A;  3UGJ A;  3MJ5 A;  1IN5 A;  3TWM A;  1IBK M;  2YFQ A;  2QP9 X;  4GKJ M;  3U6C A;  4ZPX A;  1PJI A;  4B7H A;  1G3I A;  4MH0 E;  1E94 E;  1XNQ M;  3WHK A;  1L1T A;  1FNN A;  1VDD A;  1NJG A;  4M9Z A;  4JI3 M;  2X49 A;  5DYG A;  7CAT A;  1ORY B;  4X64 M;  4QOS A;  1N77 A;  4JI2 M;  3I51 A;  2HL7 A;  4IBC A;  3ZH9 B;  4LFB M;  3MHV C;  5KPR A;  1HNZ M;  1N34 M;  1IXR C;  2G5G X;  4JI0 M;  4FCV A;  4LGY A;  4IJE A;  2BJW A;  5ITX A;  3SAV A;  4DV4 M;  3U6L A;  1I4W A;  4LGM A;  4DUY M;  3U5Z B;  2DWM A;  4LJ7 A;  2RGO A;  2D7H A;  4QHT A;  4Z8X A;  3GLI A;  4LJ5 A;  4YY3 M;  4LF4 M;  3DOA A;  3SYL A;  2EA0 A;  1K3X A;  1R7R A;  4JN6 A;  2X4A A;  2KZU A;  2UU9 M;  4B3R M;  1HQY E;  4LJ4 A;  2LWX A;  5ITT A;  4G4N A;  1E9R A;  2XSZ A;  4X62 M;  5DNY A;  2ZM6 M;  1UM8 A;  5C18 A;  1NHW C;  2DVW B;  4EIW A;  3KDS E;  1IBL M;  4PDI A;  3T38 A;  3PXG A;  3GO8 A;  1HQC A;  5LMU M;  3SBJ A;  2LXE A;  4IIW A;  1TH4 A;  5LMN M;  4DV3 M;  2ZAM A;  4Z6Y A;  4AI6 A;  3TPZ A;  2ZBK B;  4NRV A;  3U61 B;  2HHH M;  4LF8 M;  1YSY A;  3GLG B;  4FCT A;  1N32 M;  3U6Q A;  3CF2 A;  1HR0 M;  3HU2 A;  4IBF A;  4DR5 M;  2R46 A;  1ZQ9 A;  3U6D A;  2XFT A;  4GIP A;  5JI2 E;  1XWI A;  4OVZ A;  2J7O A;  3NBI A;  4NXN M;  2XZU A;  2FFJ A;  3FTC A;  3UJN A;  2L7H A;  2DWN A;  4L8R C;  4QNR A;  3U6S A;  3HHY A;  3LQQ A;  3AKZ A;  1NVM A;  2Z7J A;  4IBB A;  4X66 M;  2KZS A;  4OU7 A;  1L8Q A;  1QZM A;  3J2P B;  3VLF B;  4GC9 A;  4L16 A;  2I7P A;  5FLX S;  4MGI E;  1QVR A;  3GLF A;  3WHL A;  3JAM S;  2VQE M;  2QEN A;  3HGI A;  2DWL A;  1DGF A;  2UUC M;  5EP3 A;  8CAT A;  3UMM A;  2UUA M;  1HT2 E;  2RKO A;  3C58 A;  2CHG A;  5EJC A;  1KYI A;  1G59 A;  3I4V A;  4KHP M;  1K82 A;  3TWK A;  3HJS A;  4IBI A;  1K3W A;  1QAM A;  4NSR A;  4CHT B;  3AFH A;  4G6Z A;  1J5E M;  2R62 A;  5ITR A;  1JQJ C;  1IY1 A;  3I4Y A;  4NL4 H;  2F5Q A;  3HHX A;  4AKG A;  2KRU A;  5FTM A;  1SXJ C;  4NRW A;  1GL7 A;  1YUB A;  4W5W A;  1NHG C;  2CHQ A;  5E26 A;  3W0L B;  3U60 A;  4LZZ A;  3T1H M;  3K1J A;  4BLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...