4DV3M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv3M02
4JV5M 1L2BA 4B3TM 4B3SM 2UUAM 1N33M 3DOAA 1XMQM 4DV0M 3TWKA 1L1ZA 3SAVA 2VQFM 1I94M 3GQ4A 1Z5AA 5FLXS 4YHHM 2UUBM 4AQYM 1HNWM 3A45A 3U6MA 2F5NA 4GKJM 4PDGA 1Z59A 3JAMS 4DR3M 3U6LA 5ITUA 1K82A 2E5LM 4DV5M 3U6PA 4JI0M 3GQ5A 4ITQA 3SBJA 1XNQM 3GQ3A 2OQ4A 4X65M 4PCZA 3GPXA 3GP1A 3JR4A 4JI7M 5ITXA 1KFVA 3GO8A 1TDZA 4GKKM 1R2YA 2ZM6M 2F5PA 3TWMA 4LFCM 4LFAM 4YY3M 5ITRA 3JR5A 2UU9M 4JI4M 4NXMM 3T1YM 2XZUA 1HR0M 5ITQA 3SARA 1PJIA 1MX0A 4JI5M 4X64M 3U6QA 4LF8M 4JI8M 4NRVA 4PDIA 2VQEM 4LF9M 1XC8A 4G4RA 1J5EM 4X66M 4JI6M 4DV1M 3U6CA 1EE8A 3U6DA 1K3WA 4DV2M 5ITTA 1Q3BA 2HHHM 1IBMM 4CISA 1N36M 3SATA 4DR4M 1N32M 5IWAM 3J81S 2UXBM 4DR2M 4NXNM 3U6OA 2F5QA 3TWLA 4G4QA 2HKJA 2F5OA 3J7AS 1MU5A 4DR7M 4DV7M 4KHPM 3GPPA 1XNRM 1HNZM 4DV6M 4JI2M 1K3XA 3U6EA 2ZBKB 5IT9S 1PM5A 4X62M 4NRWA 1Q3CA 3GPYA 3A46A 1PJJA 2XZFA 4PD2A 1IBKM 2F5SA 5BR8M 4JYAM 4LF4M 2UUCM 4DUYM 5LMNM 1FJGM 1Z5CA 4B3MM 3GPUA 4JI3M 3SASA 1Z5BA 4OX9M 1NNJA 3A42A 3VK7A 1IBLM 4DV3M 4DR5M 3U6SA 2Q2EB 4B3RM 4G4NA 3C58A 2OPFA 4DV4M 4LFBM 4JI1M 4G4OA 5LMUM 3VK8A 3SAUA 4DUZM 1XMOM 3OTOM 4MB7A 2F4VM 3T1HM 1HNXM 4K0KM 2UXDM 3J80S 2EA0A 4DR1M 1N34M 3W0FA 1L2CA 1Q39A 1TDHA 5ITXE 1L1TA 2UXCM 5ITYA 4LF5M 1R2ZA 3SAWA 4LF7M 4DR6M 5A2QS 1L2DA 4LF6M
chains in the Genus database with same CATH superfamily
3B7ZA 2QENA 4QNMA 1MJGM 2QPAA 1OQYA 4PT5A 2CV0A 3GLHB 4LGMA 2YFQA 2D7GA 2VQFM 1I94M 4Q7JA 3HZJA 3SFZA 3MMPA 4AKGA 4GIPA 1JR3A 3MHVC 1SG9A 4L8RC 2QHOB 4QOSA 1K82A 2LVQD 1T43A 4L78A 5FTMA 2C96A 4M0DA 2DAGA 2XSZA 4II7A 1G3IA 4RNAA 3HKPA 5JI3E 4ITQA 2HWJA 3D8BA 2OQ4A 3AFHA 3HHWA 3JR4A 3HX3A 1JR3D 1TTEA 1TDZA 1VEGA 2CP8A 2WSCF 2LWXA 3PNVA 3J2PB 4NSOB 3FRHA 4L15A 1X37A 2ZTCA 2UU9M 2XSZD 2DZLA 2QBYA 2EKFA 1HR0M 1OIZA 4TUWA 2QSFX 1PJIA 1AIPC 2X4AA 4IBJA 3I51A 1G8PA 4M9SA 1D2NA 1PJSA 4B7GA 3PVSA 4JI8M 2AHMA 4XK8F 2LBCA 4LJAA 4FCWA 1PRBA 1IXSA 3M7GA 3GLHE 2ZANA 3KXEC 4JI6M 2QZ4A 4Z6YA 2KHHA 4GC5A 4DV1M 2RKOA 3U6CA 3U6DA 3ZC7B 3B7NA 2Y0TA 3I04M 1IBMM 1IY0A 2C9OA 1OAIA 3SATA 2VF8A 5IWAM 2C5RA 4DR2M 1G71A 1IN7A 2DI0A 1R4GA 3VDUA 3L25A 3L2AA 2DAMA 2F5QA 1NSFA 4UN2B 1GO5A 3Q8GA 2R45A 4B7HA 1XNRM 1E32A 4JI2M 3UMMA 1GL6A 4MGHA 4WW0A 1K3XA 2WSFF 3B74A 2APLA 2DWLA 4LRTA 2JUJA 3HU3A 3J27B 3HU2A 4R71A 3GLGB 3DZDA 1LTMA 3EIHA 2XH9A 1IBKM 5BR8M 2QQ8A 1NY5A 3KDSE 3DFZA 1OKSA 3T15A 4BBAA 5LMNM 3UGJA 1T6OA 1E9SA 4HLQA 3THGA 4AKIA 1PJTA 1NVMA 2V6ZM 1QANA 2MR9A 2OO9A 3FE3A 3VK7A 3LW5F 2XLJA 4MGZE 3GRUA 4G6ZA 3HU1A 1R6BX 1XHBA 4QHTA 4AI6A 1RU3A 3K1JA 3UZUA 1GJSA 3SAUA 2LH0A 3DA1A 3PNYA 3FTCA 3K9OA 1XMOM 2DXIA 1QZMA 1JQJC 5IZ7D 1ZAEA 2F4VM 3T1HM 4K0KM 2CFOA 1EFUB 3J80S 2CRUA 1N34M 3GLGE 1QAQA 3FYDA 1ZMVA 2C98A 1SXJC 5ITXE 3KP0E 1DGFA 5DNYA 3GLIB 3LVVA 2UXCM 5FTJA 4ANRA 2MH8A 3HY5A 2QBYB 2Z4SA 3QAUA 3AJIB 2VDBB 3E9SA 4IJEA 4MGYE 4XGIA 3QYBA 1QAMA 1XXHA 2LTUA 2R46A 3C9PA 3CF0A 3KOZE 3Q8XA 3CF2A 2BJWA 4I5SA 4RKUF 4AG6A 2G5GX 1H6UA 4LF6M 2P5TA 1TR8A 5C1BA 1IXSB 4KO8A 3L27A 4OVZA 1L2BA 2L7IA 5DFLA 1QVRA 4LY6A 1C7YA 1GKIA 4FWHA 5EXXA 1NJGA 4LZJA 1XMQM 2EUCA 1JR3E 2X49A 3SAVA 3HJSA 3SMPA 3GQ4A 2QCUA 4YHHM 2DHYA 2UUBM 1FNNA 2L7HA 1R5LA 2C99A 3A45A 5KPRA 3U6MA 4PDGA 2CHQA 4DR3M 2A5YB 3U6LA 2Y21A 1GLNA 5KQDA 3KFUG 2O01F 1NV9A 3TQSA 7CATA 3SBJA 4JI7M 3HJQA 1OAOC 2LXEA 2KRKA 3IG5A 4W5WA 5ITXA 2ERCA 2K9DA 1NO1A 2BWEA 3B9PA 5KQ8A 2VIIA 2F5PA 2JY7A 3FUVA 4LFCM 4NXMM 3JR5A 2XFTA 1JB0F 4A3VB 3H4JA 3AOEC 1MX0A 1BVSA 1LV7A 4M9ZA 4X64M 2J7OA 1D0MA 4LGYA 1ZMWA 1IFYA 2YNMD 1C1KA 4WURA 3LQRA 5DYIA 4R3DA 2KNZA 1E94E 4X66M 2GNOA 4NC6A 1EE8A 1P3QQ 2DENA 1DGGA 2BJVA 2DZOB 5JI2E 4DV2M 5KPZA 4IJFA 4NRWA 2LVAA 4JN6A 1F4IA 1VDLA 4JXJA 2KNAA 2V1CA 1DGBA 5BPVA 2UXBM 3K92A 1G4AE 1L8QA 5E26A 4KODA 4XBOA 3FTDA 2Z8YM 1MU5A 4MM3B 4P17A 3GPPA 2QNJA 3AOEA 3KP1E 4DV6M 2KEBA 4B08A 4IBCA 2RGOA 2ZBKB 5IT9S 1TF0B 3LCVB 1IY1A 3KOXE 3L28A 3A46A 4L16A 4RF0A 4IBBA 4PD2A 4JYAM 1XXHB 2QP9X 1WIVA 4Z8XA 1CUKA 1ZV1A 5F3WA 3CGWA 3VKHA 4FCTA 1I4WA 1Z5CA 2KNVA 4OVZB 3B89A 2JY8A 2H1RA 2JP7A 1NNJA 2HAKA 4CHTB 3I4YA 3TPZA 4AW4A 2N35A 3IG8A 2FS1A 1E9RA 2Q2EB 4B3RM 2CUZA 3NBIA 3UK6A 4B7FA 3C58A 3I01M 3C3DA 4JI1M 5LMUM 2RGHA 3CF6E 3AOGA 2K47A 2LHCA 1D0LA 3VLFB 3U61A 2X8AA 2J5YA 3M6AA 3LQQA 1DO2A 4DR1M 2FE8A 1OFHA 1Q39A 2CWBA 2O5RA 2OOAA 4AKHA 1VQ1A 3M0EA 1XXHE 2DAKA 2R6FA 3U5ZB 4IIWA 4LF7M 5L8RF 2K6BA 3FUXA 5EXTA 2WSEF 3HJ8A 4I81A 1QAOA 1HT1E 1R7RA 3MJ5A 2LVNC 1N75A 1HQYE 4B3SM 2L6OA 2UUAM 3EIEA 3W67A 2R44A 3RFWA 1DV0A 4Y28F 4F1IA 1IY2A 1L1ZA 1SXJE 4NSRA 2B3TA 4WP2A 3GLFE 1XWIA 4FD2A 1IXRC 2DAEA 1VDDA 2HL7A 2R65A 4FWDA 4GMQA 5FTKA 3ZQJA 4AQYM 3FTEA 4GKJM 3JAMS 1Y8GA 2R62A 1KYIA 4LJ9A 4DV5M 5EP3A 2C9CA 4NL4H 3GQ5A 4HEOA 1YLAA 5KPTA 1XNQM 3GQ3A 2CV2A 4X65M 1W5SA 3GPXA 4GH9A 4GKKM 1KFVA 3GO8A 4MGIE 2YQZA 2ZM6M 4GC9A 4CGYB 3TWMA 4LFAM 4YY3M 5ITRA 4CIZA 4LJ5A 4JI4M 3FTFA 2DZNB 3WHKA 3T1YM 1ZQ9A 3SMSA 4KLNA 2BWBA 3BOSA 1QUSA 4JI5M 3U6QA 1VG5A 2RRUA 1N77A 4KT0F 1XC8A 1J5EM 1G59A 4L6V6 2JZ1A 3PFIA 2KDLA 5H37D 1SXJA 2VF7A 2Y0QA 1V34A 3FKEA 3IECA 2KA6B 4LJ4A 4M9XA 5ITTA 3GLFA 3SYLA 3GLIA 3U60A 2MGWA 3KVWA 3W68A 4LZZA 1YUBA 1ZMUA 1VEJA 2GQFA 2R4EA 1YSYA 4QHSA 5FTLA 1OJLA 1SXJD 1TGUA 1QQWA 3PXGA 2EJSA 3U6OA 1PJQA 3U61B 3K8ZA 4G4QA 2HKJA 4P16A 1J09A 2XFSA 4DV7M 3AL0C 3HGIA 2EKKA 1HNZM 1VEKA 4DBGB 2Z4RA 3HWSA 3U6EA 2YR0A 3MK6A 1NV8A 4FW9A 2JA2A 1HQCA 3BXWA 2CEAA 1IM2A 1Q3CA 3I4VA 5EQTA 3ZCBB 4BLCA 4F2LA 2DWMA 1PJJA 2XZFA 2NQ8C 4LCBA 2ZTDA 3LCUA 2F5SA 1DGHA 2OOBA 2KXEA 4DUYM 1FJGM 2D7HA 3GRRA 2CV1A 3F92A 3GPUA 2LHGA 4ZPXA 2I7NA 4IBIA 3A42A 1WGNA 4GHAA 1T3TA 1WGLA 4QNRA 4R7GA 2FNAA 3U6SA 3R8FA 4G4NA 3L29A 2OPFA 4LFBM 1QDTA 4S12A 2FH0A 3ZH9B 4G4OA 3R9XB 1GVNA 2L4EA 5FTNA 4IBDA 3VK8A 1NNUC 3KOYE 1WXQA 1D0KA 1W5TA 1QUTA 5E6JA 4MB7A 2KW0A 2LVOC 4NOOB 4AG5A 1HNXM 3FUTA 5EXPA 3RGSA 3SC3A 3W0FA 2CHGA 1L2CA 1DO0A 1EIJA 1TDHA 1QZEA 3AKZA 1N33M 2JZ0A 3C3EA 1Q02A 3K2LA 3LMMA 3LVWA 2I7PA 2HCBA 1R2ZA 4D80A 5A2QS 2JY5A 1OFIA 4JV5M 2KZSA 5EP2A 4OU7A 4L4UA 1NY6A 5EP4A 4B3TM 4IBKA 3KS8A 2EO2A 1MN3A 4RF1A 3DOAA 3FYCA 3VFDA 1OTRA 4MGKE 3HHYA 1IN6A 1SXJB 3T38A 4DV0M 1OIPA 3NBXX 8CATA 3U60B 1UM8A 3GLFB 4BB9A 2H5XA 3TWKA 2KRUA 2FFJA 2ZAMA 2MJ5B 1IN4A 3GRVA 1Z5AA 2XF3A 5FSWA 1QDRA 5FLXS 2R0IA 1HJPA 1HT2E 3TE6A 3E46A 1HNWM 1V33A 1NHGC 4M0WA 2F5NA 2DHRA 2CE7A 1Z59A 4I8OA 3T6PA 3UJNA 1GL7A 5ITUA 2E5LM 3U6PA 4JI0M 2R4JA 4PCZA 3GP1A 4QOZC 5C18A 1R2YA 2M60A 1GJTA 5GKNA 1G41A 4FCVA 3FD9A 2Z3XA 3VKGA 1AUAA 1J7KA 2XZUA 5EP1A 5ITQA 3SARA 1IXZA 1DGHB 3KSXA 3NWLA 4GITA 4LF8M 2DWZB 4IBFA 3VDPA 4NRVA 1IQPA 3FUUA 1V92A 2MROB 5IREB 4PDIA 2VQEM 2CHVA 4G4RA 1WJ7A 2XGNA 4LF9M 3KOWE 2JNHA 3GLIE 4REZA 3GLHA 1K3WA 1Q3BA 2JXNA 3IHPA 4OW0A 2HHHM 1S3SA 4EIWA 1N36M 3KW6A 4CISA 2ZAOA 4DR4M 1N32M 1IN8A 1UFZA 2LVPC 1PGYA 1WR1B 4MH0E 5EJCA 2R18A 3WHLA 3J81S 2O25A 4NXNM 3AV0A 2L09A 1TH2A 2DNAA 1A5TA 3TWLA 3U5ZA 1TH3A 2F5OA 3J7AS 4DR7M 4KHPM 4HL4A 2G8LA 3CTWB 3SYKA 4FVMA 3GRYA 2J7NA 3KSJA 4D81A 3H4MA 4G3OA 2D7EA 5EXSA 2BNKA 3TL4X 4X62M 1NJFA 4D82A 1PM5A 2V1UA 2FOIC 2JY6B 1XB2B 3GPYA 1KSFX 1ORYB 2DKLA 3HHXA 3RE8A 2DVWB 3W0LB 4CJ6A 1WHCA 3BBZA 4LJ6A 1QYRA 4LF4M 2UUCM 3K9PA 2DAIA 4AZFA 1TH4A 4B3MM 5DYGA 3D8LA 4JI3M 3SHGB 3L26A 4GRIA 2WZJA 1Z5BA 3ILKA 4I4LA 2Z7JA 3SASA 3SHFA 4OX9M 2DWNA 4GHLA 3QYEA 1IBLM 1Z6TA 3QWLA 4DV3M 3KS4A 3FRIA 3FUWA 4DR5M 1N78A 4DV4M 2Y20A 4IBGA 2M5ZA 2W82A 3J7BA 2G3QA 1GABA 1NHWC 2L4FA 1YE9A 3RGPA 4LJ7A 4DUZM 3OTOM 1IN5A 4LG2A 2K0BX 3V76A 3HHZA 2UXDM 3A98B 2EA0A 2LNHC 4FWGA 5KO3A 2L2DA 4LRSA 4IBEA 1L1TA 5ITYA 4LJ8A 3GLGA 3E21A 2XEPA 4LF5M 3B7QA 3E4RA 3SAWA 2KZUA 2JWSA 4DR6M 1L2DA 4GEWA
chains in the Genus database with same CATH topology
4QNMA 2QENA 2QPAA 2CV0A 4PT5A 3GLHB 4LGMA 2YFQA 2D7GA 2VQFM 1I94M 3SFZA 4AKGA 4GIPA 1JR3A 3MHVC 4L8RC 4QOSA 1K82A 3U5ZB 4L78A 5FTMA 2C96A 4M0DA 4ITQA 2XSZA 4II7A 1G3IA 4RNAA 3HKPA 5JI3E 3D8BA 2OQ4A 3AFHA 3HHWA 3JR4A 1JR3D 1TDZA 2LWXA 3PNVA 3J2PB 4NSOB 2UU9M 4L15A 1X37A 2XSZD 2QBYA 1HR0M 4TUWA 1PJIA 2X4AA 4IBJA 3I51A 1G8PA 4M9SA 1D2NA 4B7GA 3PVSA 4JI8M 2AHMA 4LJAA 4FCWA 3M7GA 2ZANA 3KXEC 4JI6M 2QZ4A 4Z6YA 4GC5A 4DV1M 2RKOA 3U6CA 3U6DA 3ZC7B 2Y0TA 1IBMM 1IY0A 2C9OA 3SATA 5IWAM 2C5RA 4DR2M 1IN7A 3L25A 3VDUA 3L2AA 2F5QA 1NSFA 2R45A 4B7HA 1XNRM 1E32A 4JI2M 3UMMA 1GL6A 4MGHA 4WW0A 1K3XA 4LRTA 3HU3A 3J27B 3HU2A 3GLGB 3DZDA 3EIHA 2XH9A 1IBKM 5BR8M 4BBAA 1NY5A 3KDSE 3DFZA 3T15A 5LMNM 3UGJA 1E9SA 4HLQA 3THGA 4AKIA 2V6ZM 1NVMA 1QANA 3VK7A 2XLJA 4MGZE 3GRUA 4G6ZA 3HU1A 1R6BX 1XHBA 4QHTA 4AI6A 3K1JA 3UZUA 3SAUA 2LH0A 3DA1A 3PNYA 3FTCA 2DXIA 1XMOM 1QZMA 1JQJC 5IZ7D 1ZAEA 2F4VM 3T1HM 4K0KM 2CFOA 3J80S 1N34M 1QAQA 3FYDA 2C98A 1SXJC 5ITXE 3KP0E 1DGFA 5DNYA 2UXCM 3LVVA 5FTJA 2QBYB 2Z4SA 3QAUA 3AJIB 3E9SA 4IJEA 4MGYE 4XGIA 1QAMA 1XXHA 2R46A 3CF0A 4I5SA 3Q8XA 3KOZE 3UK6A 3CF2A 2BJWA 4AG6A 2G5GX 1H6UA 4LF6M 2P5TA 5C1BA 1IXSB 4KO8A 3L27A 4OVZA 1L2BA 2L7IA 1QVRA 4LY6A 1GKIA 4FWHA 5EXXA 1NJGA 4LZJA 1XMQM 2EUCA 2X49A 3SAVA 3HJSA 3SMPA 3GQ4A 2QCUA 4YHHM 2UUBM 1FNNA 2L7HA 2C99A 3A45A 3U6MA 5KPRA 4PDGA 2CHQA 4DR3M 2A5YB 3U6LA 2Y21A 1GLNA 5KQDA 3KFUG 3TQSA 7CATA 3SBJA 4JI7M 3HJQA 2LXEA 3IG5A 2KRKA 4W5WA 5ITXA 2ERCA 3B9PA 5KQ8A 2VIIA 2F5PA 3FUVA 4LFCM 4NXMM 3JR5A 2XFTA 4A3VB 3AOEC 1MX0A 1LV7A 4M9ZA 4X64M 2J7OA 4LGYA 2YNMD 1C1KA 4WURA 3LQRA 5DYIA 4R3DA 1E94E 4X66M 1EE8A 1DGGA 2BJVA 2DZOB 5JI2E 4DV2M 5KPZA 4IJFA 4NRWA 4JN6A 4JXJA 2V1CA 1DGBA 5BPVA 2UXBM 3K92A 1G4AE 1L8QA 5E26A 4KODA 4XBOA 3FTDA 1MU5A 4MM3B 3GPPA 3AOEA 3KP1E 4DV6M 2KEBA 4B08A 4IBCA 2RGOA 2ZBKB 5IT9S 1IY1A 3KOXE 3L28A 3A46A 4L16A 4RF0A 4IBBA 4PD2A 4JYAM 1XXHB 2QP9X 4Z8XA 5F3WA 3VKHA 4FCTA 1I4WA 1Z5CA 4OVZB 2H1RA 1NNJA 4CHTB 3I4YA 3TPZA 4AW4A 3IG8A 1E9RA 2Q2EB 4B3RM 2CUZA 3NBIA 4B7FA 3C58A 4JI1M 5LMUM 2RGHA 3CF6E 3AOGA 2K47A 3VLFB 3U61A 2X8AA 3M6AA 3LQQA 1DO2A 4DR1M 2FE8A 1OFHA 1Q39A 2O5RA 4AKHA 3M0EA 4IIWA 4LF7M 3FUXA 5EXTA 3HJ8A 4I81A 1QAOA 1HT1E 1R7RA 3MJ5A 1N75A 1HQYE 4B3SM 2L6OA 2UUAM 3EIEA 3RFWA 1IY2A 1L1ZA 1SXJE 4NSRA 1XWIA 4FD2A 1IXRC 2R65A 1VDDA 2HL7A 4FWDA 4GMQA 5FTKA 4AQYM 3FTEA 4GKJM 3JAMS 4LJ9A 2R62A 1KYIA 4DV5M 5EP3A 2C9CA 4NL4H 3GQ5A 5KPTA 1XNQM 3GQ3A 2CV2A 4X65M 1W5SA 3GPXA 4GH9A 4GKKM 1KFVA 3GO8A 4MGIE 2YQZA 2ZM6M 4GC9A 4CGYB 3TWMA 4LFAM 4YY3M 5ITRA 4JI4M 4LJ5A 2DZNB 3WHKA 3T1YM 1ZQ9A 3SMSA 4KLNA 3BOSA 4JI5M 3U6QA 1N77A 1XC8A 1J5EM 1G59A 3PFIA 5H37D 1SXJA 2Y0QA 3FKEA 4M9XA 5ITTA 2KA6B 4LJ4A 3GLFA 3U60A 3SYLA 3GLIA 3KVWA 4LZZA 1YUBA 2R4EA 1YSYA 4QHSA 5FTLA 1OJLA 1SXJD 1TGUA 1QQWA 3PXGA 3U6OA 3U61B 3K8ZA 4G4QA 2HKJA 4P16A 1J09A 2XFSA 4DV7M 3AL0C 3HGIA 1HNZM 2Z4RA 3HWSA 3U6EA 2YR0A 3MK6A 3VFDA 4FW9A 2JA2A 1HQCA 3I4VA 2CEAA 1IM2A 1Q3CA 5EQTA 3ZCBB 4BLCA 2DWMA 1PJJA 2XZFA 2NQ8C 4LCBA 2F5SA 1DGHA 2KXEA 4DUYM 1FJGM 2D7HA 3GRRA 2CV1A 3GPUA 4ZPXA 2I7NA 4IBIA 3A42A 4GHAA 1T3TA 4QNRA 3U6SA 4R7GA 2FNAA 3R8FA 4G4NA 3L29A 2OPFA 4LFBM 4S12A 4G4OA 3ZH9B 3R9XB 1GVNA 5FTNA 4IBDA 3VK8A 1NNUC 3KOYE 1WXQA 1W5TA 5E6JA 4MB7A 2KW0A 4NOOB 4AG5A 1HNXM 3FUTA 5EXPA 3RGSA 3SC3A 3W0FA 2CHGA 1L2CA 1DO0A 1TDHA 3AKZA 3K2LA 3LMMA 3LVWA 2I7PA 2HCBA 1R2ZA 4D80A 5A2QS 1OFIA 4JV5M 2KZSA 5EP2A 4OU7A 4L4UA 1NY6A 5EP4A 4B3TM 4IBKA 3KS8A 2EO2A 4RF1A 1N33M 3DOAA 3FYCA 4MGKE 3HHYA 1IN6A 1SXJB 3T38A 4DV0M 8CATA 3U60B 1UM8A 3GLFB 4BB9A 3TWKA 2KRUA 2FFJA 2ZAMA 3GRVA 1IN4A 3GLIB 1Z5AA 2XF3A 5FSWA 5FLXS 3TE6A 1HT2E 1HNWM 1NHGC 4M0WA 2F5NA 2DHRA 2CE7A 1Z59A 4I8OA 3UJNA 2E5LM 1GL7A 5ITUA 3U6PA 4JI0M 2R4JA 4PCZA 3GP1A 4QOZC 5C18A 1R2YA 2M60A 5GKNA 1G41A 4FCVA 3FD9A 2Z3XA 3VKGA 1J7KA 2XZUA 5EP1A 5ITQA 3SARA 1IXZA 1DGHB 3KSXA 3NWLA 4GITA 4LF8M 2DWZB 4IBFA 3VDPA 4NRVA 1IQPA 3FUUA 4PDIA 5IREB 2VQEM 2DWLA 4LF9M 2CHVA 4G4RA 2XGNA 3KOWE 4REZA 3GLHA 1K3WA 1Q3BA 4OW0A 2HHHM 1S3SA 4EIWA 1N36M 3KW6A 4CISA 2ZAOA 4DR4M 1N32M 1IN8A 5EJCA 3WHLA 3FTFA 4MH0E 3J81S 2R18A 4NXNM 3AV0A 2L09A 1TH2A 3TWLA 3U5ZA 2F5OA 1TH3A 3J7AS 4DR7M 4KHPM 4HL4A 2G8LA 3CTWB 3SYKA 4FVMA 3GRYA 2J7NA 3KSJA 4D81A 3H4MA 5EXSA 2D7EA 3TL4X 2BNKA 4X62M 1PM5A 1NJFA 4D82A 2V1UA 2FOIC 3GPYA 1KSFX 1ORYB 3RE8A 3HHXA 3W0LB 2DVWB 4LJ6A 1QYRA 4LF4M 2UUCM 4AZFA 1TH4A 4B3MM 5DYGA 3D8LA 4JI3M 3SHGB 3L26A 4GRIA 4I4LA 1Z5BA 3ILKA 3SASA 2Z7JA 4OX9M 3SHFA 4GHLA 2DWNA 1IBLM 1Z6TA 3QWLA 4DV3M 3KS4A 3FUWA 4DR5M 1N78A 4DV4M 2Y20A 4IBGA 2M5ZA 2W82A 3J7BA 1NHWC 1YE9A 3RGPA 4LJ7A 4DUZM 3OTOM 1IN5A 4LG2A 3HHZA 2UXDM 3A98B 2EA0A 2LNHC 4FWGA 5KO3A 4LRSA 1L1TA 4IBEA 5ITYA 4LJ8A 3GLGA 4LF5M 2XEPA 3E4RA 3SAWA 2KZUA 4DR6M 1L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 M;  1L2B A;  4B3T M;  4B3S M;  2UUA M;  1N33 M;  3DOA A;  1XMQ M;  4DV0 M;  3TWK A;  1L1Z A;  3SAV A;  2VQF M;  1I94 M;  3GQ4 A;  1Z5A A;  5FLX S;  4YHH M;  2UUB M;  4AQY M;  1HNW M;  3A45 A;  3U6M A;  2F5N A;  4GKJ M;  4PDG A;  1Z59 A;  3JAM S;  4DR3 M;  3U6L A;  5ITU A;  1K82 A;  2E5L M;  4DV5 M;  3U6P A;  4JI0 M;  3GQ5 A;  4ITQ A;  3SBJ A;  1XNQ M;  3GQ3 A;  2OQ4 A;  4X65 M;  4PCZ A;  3GPX A;  3GP1 A;  3JR4 A;  4JI7 M;  5ITX A;  1KFV A;  3GO8 A;  1TDZ A;  4GKK M;  1R2Y A;  2ZM6 M;  2F5P A;  3TWM A;  4LFC M;  4LFA M;  4YY3 M;  5ITR A;  3JR5 A;  2UU9 M;  4JI4 M;  4NXM M;  3T1Y M;  2XZU A;  1HR0 M;  5ITQ A;  3SAR A;  1PJI A;  1MX0 A;  4JI5 M;  4X64 M;  3U6Q A;  4LF8 M;  4JI8 M;  4NRV A;  4PDI A;  2VQE M;  4LF9 M;  1XC8 A;  4G4R A;  1J5E M;  4X66 M;  4JI6 M;  4DV1 M;  3U6C A;  1EE8 A;  3U6D A;  1K3W A;  4DV2 M;  5ITT A;  1Q3B A;  2HHH M;  1IBM M;  4CIS A;  1N36 M;  3SAT A;  4DR4 M;  1N32 M;  5IWA M;  3J81 S;  2UXB M;  4DR2 M;  4NXN M;  3U6O A;  2F5Q A;  3TWL A;  4G4Q A;  2HKJ A;  2F5O A;  3J7A S;  1MU5 A;  4DR7 M;  4DV7 M;  4KHP M;  3GPP A;  1XNR M;  1HNZ M;  4DV6 M;  4JI2 M;  1K3X A;  3U6E A;  2ZBK B;  5IT9 S;  1PM5 A;  4X62 M;  4NRW A;  1Q3C A;  3GPY A;  3A46 A;  1PJJ A;  2XZF A;  4PD2 A;  1IBK M;  2F5S A;  5BR8 M;  4JYA M;  4LF4 M;  2UUC M;  4DUY M;  5LMN M;  1FJG M;  1Z5C A;  4B3M M;  3GPU A;  4JI3 M;  3SAS A;  1Z5B A;  4OX9 M;  1NNJ A;  3A42 A;  3VK7 A;  1IBL M;  4DV3 M;  4DR5 M;  3U6S A;  2Q2E B;  4B3R M;  4G4N A;  3C58 A;  2OPF A;  4DV4 M;  4LFB M;  4JI1 M;  4G4O A;  5LMU M;  3VK8 A;  3SAU A;  4DUZ M;  1XMO M;  3OTO M;  4MB7 A;  2F4V M;  3T1H M;  1HNX M;  4K0K M;  2UXD M;  3J80 S;  2EA0 A;  4DR1 M;  1N34 M;  3W0F A;  1L2C A;  1Q39 A;  1TDH A;  5ITX E;  1L1T A;  2UXC M;  5ITY A;  4LF5 M;  1R2Z A;  3SAW A;  4LF7 M;  4DR6 M;  5A2Q S;  1L2D A;  4LF6 M; 
#chains in the Genus database with same CATH topology
 3B7Z A;  2QEN A;  4QNM A;  1MJG M;  2QPA A;  1OQY A;  4PT5 A;  2CV0 A;  3GLH B;  4LGM A;  2YFQ A;  2D7G A;  2VQF M;  1I94 M;  4Q7J A;  3HZJ A;  3SFZ A;  3MMP A;  4AKG A;  4GIP A;  1JR3 A;  3MHV C;  1SG9 A;  4L8R C;  2QHO B;  4QOS A;  1K82 A;  2LVQ D;  1T43 A;  4L78 A;  5FTM A;  2C96 A;  4M0D A;  2DAG A;  2XSZ A;  4II7 A;  1G3I A;  4RNA A;  3HKP A;  5JI3 E;  4ITQ A;  2HWJ A;  3D8B A;  2OQ4 A;  3AFH A;  3HHW A;  3JR4 A;  3HX3 A;  1JR3 D;  1TTE A;  1TDZ A;  1VEG A;  2CP8 A;  2WSC F;  2LWX A;  3PNV A;  3J2P B;  4NSO B;  3FRH A;  4L15 A;  1X37 A;  2ZTC A;  2UU9 M;  2XSZ D;  2DZL A;  2QBY A;  2EKF A;  1HR0 M;  1OIZ A;  4TUW A;  2QSF X;  1PJI A;  1AIP C;  2X4A A;  4IBJ A;  3I51 A;  1G8P A;  4M9S A;  1D2N A;  1PJS A;  4B7G A;  3PVS A;  4JI8 M;  2AHM A;  4XK8 F;  2LBC A;  4LJA A;  4FCW A;  1PRB A;  1IXS A;  3M7G A;  3GLH E;  2ZAN A;  3KXE C;  4JI6 M;  2QZ4 A;  4Z6Y A;  2KHH A;  4GC5 A;  4DV1 M;  2RKO A;  3U6C A;  3U6D A;  3ZC7 B;  3B7N A;  2Y0T A;  3I04 M;  1IBM M;  1IY0 A;  2C9O A;  1OAI A;  3SAT A;  2VF8 A;  5IWA M;  2C5R A;  4DR2 M;  1G71 A;  1IN7 A;  2DI0 A;  1R4G A;  3VDU A;  3L25 A;  3L2A A;  2DAM A;  2F5Q A;  1NSF A;  4UN2 B;  1GO5 A;  3Q8G A;  2R45 A;  4B7H A;  1XNR M;  1E32 A;  4JI2 M;  3UMM A;  1GL6 A;  4MGH A;  4WW0 A;  1K3X A;  2WSF F;  3B74 A;  2APL A;  2DWL A;  4LRT A;  2JUJ A;  3HU3 A;  3J27 B;  3HU2 A;  4R71 A;  3GLG B;  3DZD A;  1LTM A;  3EIH A;  2XH9 A;  1IBK M;  5BR8 M;  2QQ8 A;  1NY5 A;  3KDS E;  3DFZ A;  1OKS A;  3T15 A;  4BBA A;  5LMN M;  3UGJ A;  1T6O A;  1E9S A;  4HLQ A;  3THG A;  4AKI A;  1PJT A;  1NVM A;  2V6Z M;  1QAN A;  2MR9 A;  2OO9 A;  3FE3 A;  3VK7 A;  3LW5 F;  2XLJ A;  4MGZ E;  3GRU A;  4G6Z A;  3HU1 A;  1R6B X;  1XHB A;  4QHT A;  4AI6 A;  1RU3 A;  3K1J A;  3UZU A;  1GJS A;  3SAU A;  2LH0 A;  3DA1 A;  3PNY A;  3FTC A;  3K9O A;  1XMO M;  2DXI A;  1QZM A;  1JQJ C;  5IZ7 D;  1ZAE A;  2F4V M;  3T1H M;  4K0K M;  2CFO A;  1EFU B;  3J80 S;  2CRU A;  1N34 M;  3GLG E;  1QAQ A;  3FYD A;  1ZMV A;  2C98 A;  1SXJ C;  5ITX E;  3KP0 E;  1DGF A;  5DNY A;  3GLI B;  3LVV A;  2UXC M;  5FTJ A;  4ANR A;  2MH8 A;  3HY5 A;  2QBY B;  2Z4S A;  3QAU A;  3AJI B;  2VDB B;  3E9S A;  4IJE A;  4MGY E;  4XGI A;  3QYB A;  1QAM A;  1XXH A;  2LTU A;  2R46 A;  3C9P A;  3CF0 A;  3KOZ E;  3Q8X A;  3CF2 A;  2BJW A;  4I5S A;  4RKU F;  4AG6 A;  2G5G X;  1H6U A;  4LF6 M;  2P5T A;  1TR8 A;  5C1B A;  1IXS B;  4KO8 A;  3L27 A;  4OVZ A;  1L2B A;  2L7I A;  5DFL A;  1QVR A;  4LY6 A;  1C7Y A;  1GKI A;  4FWH A;  5EXX A;  1NJG A;  4LZJ A;  1XMQ M;  2EUC A;  1JR3 E;  2X49 A;  3SAV A;  3HJS A;  3SMP A;  3GQ4 A;  2QCU A;  4YHH M;  2DHY A;  2UUB M;  1FNN A;  2L7H A;  1R5L A;  2C99 A;  3A45 A;  5KPR A;  3U6M A;  4PDG A;  2CHQ A;  4DR3 M;  2A5Y B;  3U6L A;  2Y21 A;  1GLN A;  5KQD A;  3KFU G;  2O01 F;  1NV9 A;  3TQS A;  7CAT A;  3SBJ A;  4JI7 M;  3HJQ A;  1OAO C;  2LXE A;  2KRK A;  3IG5 A;  4W5W A;  5ITX A;  2ERC A;  2K9D A;  1NO1 A;  2BWE A;  3B9P A;  5KQ8 A;  2VII A;  2F5P A;  2JY7 A;  3FUV A;  4LFC M;  4NXM M;  3JR5 A;  2XFT A;  1JB0 F;  4A3V B;  3H4J A;  3AOE C;  1MX0 A;  1BVS A;  1LV7 A;  4M9Z A;  4X64 M;  2J7O A;  1D0M A;  4LGY A;  1ZMW A;  1IFY A;  2YNM D;  1C1K A;  4WUR A;  3LQR A;  5DYI A;  4R3D A;  2KNZ A;  1E94 E;  4X66 M;  2GNO A;  4NC6 A;  1EE8 A;  1P3Q Q;  2DEN A;  1DGG A;  2BJV A;  2DZO B;  5JI2 E;  4DV2 M;  5KPZ A;  4IJF A;  4NRW A;  2LVA A;  4JN6 A;  1F4I A;  1VDL A;  4JXJ A;  2KNA A;  2V1C A;  1DGB A;  5BPV A;  2UXB M;  3K92 A;  1G4A E;  1L8Q A;  5E26 A;  4KOD A;  4XBO A;  3FTD A;  2Z8Y M;  1MU5 A;  4MM3 B;  4P17 A;  3GPP A;  2QNJ A;  3AOE A;  3KP1 E;  4DV6 M;  2KEB A;  4B08 A;  4IBC A;  2RGO A;  2ZBK B;  5IT9 S;  1TF0 B;  3LCV B;  1IY1 A;  3KOX E;  3L28 A;  3A46 A;  4L16 A;  4RF0 A;  4IBB A;  4PD2 A;  4JYA M;  1XXH B;  2QP9 X;  1WIV A;  4Z8X A;  1CUK A;  1ZV1 A;  5F3W A;  3CGW A;  3VKH A;  4FCT A;  1I4W A;  1Z5C A;  2KNV A;  4OVZ B;  3B89 A;  2JY8 A;  2H1R A;  2JP7 A;  1NNJ A;  2HAK A;  4CHT B;  3I4Y A;  3TPZ A;  4AW4 A;  2N35 A;  3IG8 A;  2FS1 A;  1E9R A;  2Q2E B;  4B3R M;  2CUZ A;  3NBI A;  3UK6 A;  4B7F A;  3C58 A;  3I01 M;  3C3D A;  4JI1 M;  5LMU M;  2RGH A;  3CF6 E;  3AOG A;  2K47 A;  2LHC A;  1D0L A;  3VLF B;  3U61 A;  2X8A A;  2J5Y A;  3M6A A;  3LQQ A;  1DO2 A;  4DR1 M;  2FE8 A;  1OFH A;  1Q39 A;  2CWB A;  2O5R A;  2OOA A;  4AKH A;  1VQ1 A;  3M0E A;  1XXH E;  2DAK A;  2R6F A;  3U5Z B;  4IIW A;  4LF7 M;  5L8R F;  2K6B A;  3FUX A;  5EXT A;  2WSE F;  3HJ8 A;  4I81 A;  1QAO A;  1HT1 E;  1R7R A;  3MJ5 A;  2LVN C;  1N75 A;  1HQY E;  4B3S M;  2L6O A;  2UUA M;  3EIE A;  3W67 A;  2R44 A;  3RFW A;  1DV0 A;  4Y28 F;  4F1I A;  1IY2 A;  1L1Z A;  1SXJ E;  4NSR A;  2B3T A;  4WP2 A;  3GLF E;  1XWI A;  4FD2 A;  1IXR C;  2DAE A;  1VDD A;  2HL7 A;  2R65 A;  4FWD A;  4GMQ A;  5FTK A;  3ZQJ A;  4AQY M;  3FTE A;  4GKJ M;  3JAM S;  1Y8G A;  2R62 A;  1KYI A;  4LJ9 A;  4DV5 M;  5EP3 A;  2C9C A;  4NL4 H;  3GQ5 A;  4HEO A;  1YLA A;  5KPT A;  1XNQ M;  3GQ3 A;  2CV2 A;  4X65 M;  1W5S A;  3GPX A;  4GH9 A;  4GKK M;  1KFV A;  3GO8 A;  4MGI E;  2YQZ A;  2ZM6 M;  4GC9 A;  4CGY B;  3TWM A;  4LFA M;  4YY3 M;  5ITR A;  4CIZ A;  4LJ5 A;  4JI4 M;  3FTF A;  2DZN B;  3WHK A;  3T1Y M;  1ZQ9 A;  3SMS A;  4KLN A;  2BWB A;  3BOS A;  1QUS A;  4JI5 M;  3U6Q A;  1VG5 A;  2RRU A;  1N77 A;  4KT0 F;  1XC8 A;  1J5E M;  1G59 A;  4L6V 6;  2JZ1 A;  3PFI A;  2KDL A;  5H37 D;  1SXJ A;  2VF7 A;  2Y0Q A;  1V34 A;  3FKE A;  3IEC A;  2KA6 B;  4LJ4 A;  4M9X A;  5ITT A;  3GLF A;  3SYL A;  3GLI A;  3U60 A;  2MGW A;  3KVW A;  3W68 A;  4LZZ A;  1YUB A;  1ZMU A;  1VEJ A;  2GQF A;  2R4E A;  1YSY A;  4QHS A;  5FTL A;  1OJL A;  1SXJ D;  1TGU A;  1QQW A;  3PXG A;  2EJS A;  3U6O A;  1PJQ A;  3U61 B;  3K8Z A;  4G4Q A;  2HKJ A;  4P16 A;  1J09 A;  2XFS A;  4DV7 M;  3AL0 C;  3HGI A;  2EKK A;  1HNZ M;  1VEK A;  4DBG B;  2Z4R A;  3HWS A;  3U6E A;  2YR0 A;  3MK6 A;  1NV8 A;  4FW9 A;  2JA2 A;  1HQC A;  3BXW A;  2CEA A;  1IM2 A;  1Q3C A;  3I4V A;  5EQT A;  3ZCB B;  4BLC A;  4F2L A;  2DWM A;  1PJJ A;  2XZF A;  2NQ8 C;  4LCB A;  2ZTD A;  3LCU A;  2F5S A;  1DGH A;  2OOB A;  2KXE A;  4DUY M;  1FJG M;  2D7H A;  3GRR A;  2CV1 A;  3F92 A;  3GPU A;  2LHG A;  4ZPX A;  2I7N A;  4IBI A;  3A42 A;  1WGN A;  4GHA A;  1T3T A;  1WGL A;  4QNR A;  4R7G A;  2FNA A;  3U6S A;  3R8F A;  4G4N A;  3L29 A;  2OPF A;  4LFB M;  1QDT A;  4S12 A;  2FH0 A;  3ZH9 B;  4G4O A;  3R9X B;  1GVN A;  2L4E A;  5FTN A;  4IBD A;  3VK8 A;  1NNU C;  3KOY E;  1WXQ A;  1D0K A;  1W5T A;  1QUT A;  5E6J A;  4MB7 A;  2KW0 A;  2LVO C;  4NOO B;  4AG5 A;  1HNX M;  3FUT A;  5EXP A;  3RGS A;  3SC3 A;  3W0F A;  2CHG A;  1L2C A;  1DO0 A;  1EIJ A;  1TDH A;  1QZE A;  3AKZ A;  1N33 M;  2JZ0 A;  3C3E A;  1Q02 A;  3K2L A;  3LMM A;  3LVW A;  2I7P A;  2HCB A;  1R2Z A;  4D80 A;  5A2Q S;  2JY5 A;  1OFI A;  4JV5 M;  2KZS A;  5EP2 A;  4OU7 A;  4L4U A;  1NY6 A;  5EP4 A;  4B3T M;  4IBK A;  3KS8 A;  2EO2 A;  1MN3 A;  4RF1 A;  3DOA A;  3FYC A;  3VFD A;  1OTR A;  4MGK E;  3HHY A;  1IN6 A;  1SXJ B;  3T38 A;  4DV0 M;  1OIP A;  3NBX X;  8CAT A;  3U60 B;  1UM8 A;  3GLF B;  4BB9 A;  2H5X A;  3TWK A;  2KRU A;  2FFJ A;  2ZAM A;  2MJ5 B;  1IN4 A;  3GRV A;  1Z5A A;  2XF3 A;  5FSW A;  1QDR A;  5FLX S;  2R0I A;  1HJP A;  1HT2 E;  3TE6 A;  3E46 A;  1HNW M;  1V33 A;  1NHG C;  4M0W A;  2F5N A;  2DHR A;  2CE7 A;  1Z59 A;  4I8O A;  3T6P A;  3UJN A;  1GL7 A;  5ITU A;  2E5L M;  3U6P A;  4JI0 M;  2R4J A;  4PCZ A;  3GP1 A;  4QOZ C;  5C18 A;  1R2Y A;  2M60 A;  1GJT A;  5GKN A;  1G41 A;  4FCV A;  3FD9 A;  2Z3X A;  3VKG A;  1AUA A;  1J7K A;  2XZU A;  5EP1 A;  5ITQ A;  3SAR A;  1IXZ A;  1DGH B;  3KSX A;  3NWL A;  4GIT A;  4LF8 M;  2DWZ B;  4IBF A;  3VDP A;  4NRV A;  1IQP A;  3FUU A;  1V92 A;  2MRO B;  5IRE B;  4PDI A;  2VQE M;  2CHV A;  4G4R A;  1WJ7 A;  2XGN A;  4LF9 M;  3KOW E;  2JNH A;  3GLI E;  4REZ A;  3GLH A;  1K3W A;  1Q3B A;  2JXN A;  3IHP A;  4OW0 A;  2HHH M;  1S3S A;  4EIW A;  1N36 M;  3KW6 A;  4CIS A;  2ZAO A;  4DR4 M;  1N32 M;  1IN8 A;  1UFZ A;  2LVP C;  1PGY A;  1WR1 B;  4MH0 E;  5EJC A;  2R18 A;  3WHL A;  3J81 S;  2O25 A;  4NXN M;  3AV0 A;  2L09 A;  1TH2 A;  2DNA A;  1A5T A;  3TWL A;  3U5Z A;  1TH3 A;  2F5O A;  3J7A S;  4DR7 M;  4KHP M;  4HL4 A;  2G8L A;  3CTW B;  3SYK A;  4FVM A;  3GRY A;  2J7N A;  3KSJ A;  4D81 A;  3H4M A;  4G3O A;  2D7E A;  5EXS A;  2BNK A;  3TL4 X;  4X62 M;  1NJF A;  4D82 A;  1PM5 A;  2V1U A;  2FOI C;  2JY6 B;  1XB2 B;  3GPY A;  1KSF X;  1ORY B;  2DKL A;  3HHX A;  3RE8 A;  2DVW B;  3W0L B;  4CJ6 A;  1WHC A;  3BBZ A;  4LJ6 A;  1QYR A;  4LF4 M;  2UUC M;  3K9P A;  2DAI A;  4AZF A;  1TH4 A;  4B3M M;  5DYG A;  3D8L A;  4JI3 M;  3SHG B;  3L26 A;  4GRI A;  2WZJ A;  1Z5B A;  3ILK A;  4I4L A;  2Z7J A;  3SAS A;  3SHF A;  4OX9 M;  2DWN A;  4GHL A;  3QYE A;  1IBL M;  1Z6T A;  3QWL A;  4DV3 M;  3KS4 A;  3FRI A;  3FUW A;  4DR5 M;  1N78 A;  4DV4 M;  2Y20 A;  4IBG A;  2M5Z A;  2W82 A;  3J7B A;  2G3Q A;  1GAB A;  1NHW C;  2L4F A;  1YE9 A;  3RGP A;  4LJ7 A;  4DUZ M;  3OTO M;  1IN5 A;  4LG2 A;  2K0B X;  3V76 A;  3HHZ A;  2UXD M;  3A98 B;  2EA0 A;  2LNH C;  4FWG A;  5KO3 A;  2L2D A;  4LRS A;  4IBE A;  1L1T A;  5ITY A;  4LJ8 A;  3GLG A;  3E21 A;  2XEP A;  4LF5 M;  3B7Q A;  3E4R A;  3SAW A;  2KZU A;  2JWS A;  4DR6 M;  1L2D A;  4GEW A; 
#chains in the Genus database with same CATH homology
 4QNM A;  2QEN A;  2QPA A;  2CV0 A;  4PT5 A;  3GLH B;  4LGM A;  2YFQ A;  2D7G A;  2VQF M;  1I94 M;  3SFZ A;  4AKG A;  4GIP A;  1JR3 A;  3MHV C;  4L8R C;  4QOS A;  1K82 A;  3U5Z B;  4L78 A;  5FTM A;  2C96 A;  4M0D A;  4ITQ A;  2XSZ A;  4II7 A;  1G3I A;  4RNA A;  3HKP A;  5JI3 E;  3D8B A;  2OQ4 A;  3AFH A;  3HHW A;  3JR4 A;  1JR3 D;  1TDZ A;  2LWX A;  3PNV A;  3J2P B;  4NSO B;  2UU9 M;  4L15 A;  1X37 A;  2XSZ D;  2QBY A;  1HR0 M;  4TUW A;  1PJI A;  2X4A A;  4IBJ A;  3I51 A;  1G8P A;  4M9S A;  1D2N A;  4B7G A;  3PVS A;  4JI8 M;  2AHM A;  4LJA A;  4FCW A;  3M7G A;  2ZAN A;  3KXE C;  4JI6 M;  2QZ4 A;  4Z6Y A;  4GC5 A;  4DV1 M;  2RKO A;  3U6C A;  3U6D A;  3ZC7 B;  2Y0T A;  1IBM M;  1IY0 A;  2C9O A;  3SAT A;  5IWA M;  2C5R A;  4DR2 M;  1IN7 A;  3L25 A;  3VDU A;  3L2A A;  2F5Q A;  1NSF A;  2R45 A;  4B7H A;  1XNR M;  1E32 A;  4JI2 M;  3UMM A;  1GL6 A;  4MGH A;  4WW0 A;  1K3X A;  4LRT A;  3HU3 A;  3J27 B;  3HU2 A;  3GLG B;  3DZD A;  3EIH A;  2XH9 A;  1IBK M;  5BR8 M;  4BBA A;  1NY5 A;  3KDS E;  3DFZ A;  3T15 A;  5LMN M;  3UGJ A;  1E9S A;  4HLQ A;  3THG A;  4AKI A;  2V6Z M;  1NVM A;  1QAN A;  3VK7 A;  2XLJ A;  4MGZ E;  3GRU A;  4G6Z A;  3HU1 A;  1R6B X;  1XHB A;  4QHT A;  4AI6 A;  3K1J A;  3UZU A;  3SAU A;  2LH0 A;  3DA1 A;  3PNY A;  3FTC A;  2DXI A;  1XMO M;  1QZM A;  1JQJ C;  5IZ7 D;  1ZAE A;  2F4V M;  3T1H M;  4K0K M;  2CFO A;  3J80 S;  1N34 M;  1QAQ A;  3FYD A;  2C98 A;  1SXJ C;  5ITX E;  3KP0 E;  1DGF A;  5DNY A;  2UXC M;  3LVV A;  5FTJ A;  2QBY B;  2Z4S A;  3QAU A;  3AJI B;  3E9S A;  4IJE A;  4MGY E;  4XGI A;  1QAM A;  1XXH A;  2R46 A;  3CF0 A;  4I5S A;  3Q8X A;  3KOZ E;  3UK6 A;  3CF2 A;  2BJW A;  4AG6 A;  2G5G X;  1H6U A;  4LF6 M;  2P5T A;  5C1B A;  1IXS B;  4KO8 A;  3L27 A;  4OVZ A;  1L2B A;  2L7I A;  1QVR A;  4LY6 A;  1GKI A;  4FWH A;  5EXX A;  1NJG A;  4LZJ A;  1XMQ M;  2EUC A;  2X49 A;  3SAV A;  3HJS A;  3SMP A;  3GQ4 A;  2QCU A;  4YHH M;  2UUB M;  1FNN A;  2L7H A;  2C99 A;  3A45 A;  3U6M A;  5KPR A;  4PDG A;  2CHQ A;  4DR3 M;  2A5Y B;  3U6L A;  2Y21 A;  1GLN A;  5KQD A;  3KFU G;  3TQS A;  7CAT A;  3SBJ A;  4JI7 M;  3HJQ A;  2LXE A;  3IG5 A;  2KRK A;  4W5W A;  5ITX A;  2ERC A;  3B9P A;  5KQ8 A;  2VII A;  2F5P A;  3FUV A;  4LFC M;  4NXM M;  3JR5 A;  2XFT A;  4A3V B;  3AOE C;  1MX0 A;  1LV7 A;  4M9Z A;  4X64 M;  2J7O A;  4LGY A;  2YNM D;  1C1K A;  4WUR A;  3LQR A;  5DYI A;  4R3D A;  1E94 E;  4X66 M;  1EE8 A;  1DGG A;  2BJV A;  2DZO B;  5JI2 E;  4DV2 M;  5KPZ A;  4IJF A;  4NRW A;  4JN6 A;  4JXJ A;  2V1C A;  1DGB A;  5BPV A;  2UXB M;  3K92 A;  1G4A E;  1L8Q A;  5E26 A;  4KOD A;  4XBO A;  3FTD A;  1MU5 A;  4MM3 B;  3GPP A;  3AOE A;  3KP1 E;  4DV6 M;  2KEB A;  4B08 A;  4IBC A;  2RGO A;  2ZBK B;  5IT9 S;  1IY1 A;  3KOX E;  3L28 A;  3A46 A;  4L16 A;  4RF0 A;  4IBB A;  4PD2 A;  4JYA M;  1XXH B;  2QP9 X;  4Z8X A;  5F3W A;  3VKH A;  4FCT A;  1I4W A;  1Z5C A;  4OVZ B;  2H1R A;  1NNJ A;  4CHT B;  3I4Y A;  3TPZ A;  4AW4 A;  3IG8 A;  1E9R A;  2Q2E B;  4B3R M;  2CUZ A;  3NBI A;  4B7F A;  3C58 A;  4JI1 M;  5LMU M;  2RGH A;  3CF6 E;  3AOG A;  2K47 A;  3VLF B;  3U61 A;  2X8A A;  3M6A A;  3LQQ A;  1DO2 A;  4DR1 M;  2FE8 A;  1OFH A;  1Q39 A;  2O5R A;  4AKH A;  3M0E A;  4IIW A;  4LF7 M;  3FUX A;  5EXT A;  3HJ8 A;  4I81 A;  1QAO A;  1HT1 E;  1R7R A;  3MJ5 A;  1N75 A;  1HQY E;  4B3S M;  2L6O A;  2UUA M;  3EIE A;  3RFW A;  1IY2 A;  1L1Z A;  1SXJ E;  4NSR A;  1XWI A;  4FD2 A;  1IXR C;  2R65 A;  1VDD A;  2HL7 A;  4FWD A;  4GMQ A;  5FTK A;  4AQY M;  3FTE A;  4GKJ M;  3JAM S;  4LJ9 A;  2R62 A;  1KYI A;  4DV5 M;  5EP3 A;  2C9C A;  4NL4 H;  3GQ5 A;  5KPT A;  1XNQ M;  3GQ3 A;  2CV2 A;  4X65 M;  1W5S A;  3GPX A;  4GH9 A;  4GKK M;  1KFV A;  3GO8 A;  4MGI E;  2YQZ A;  2ZM6 M;  4GC9 A;  4CGY B;  3TWM A;  4LFA M;  4YY3 M;  5ITR A;  4JI4 M;  4LJ5 A;  2DZN B;  3WHK A;  3T1Y M;  1ZQ9 A;  3SMS A;  4KLN A;  3BOS A;  4JI5 M;  3U6Q A;  1N77 A;  1XC8 A;  1J5E M;  1G59 A;  3PFI A;  5H37 D;  1SXJ A;  2Y0Q A;  3FKE A;  4M9X A;  5ITT A;  2KA6 B;  4LJ4 A;  3GLF A;  3U60 A;  3SYL A;  3GLI A;  3KVW A;  4LZZ A;  1YUB A;  2R4E A;  1YSY A;  4QHS A;  5FTL A;  1OJL A;  1SXJ D;  1TGU A;  1QQW A;  3PXG A;  3U6O A;  3U61 B;  3K8Z A;  4G4Q A;  2HKJ A;  4P16 A;  1J09 A;  2XFS A;  4DV7 M;  3AL0 C;  3HGI A;  1HNZ M;  2Z4R A;  3HWS A;  3U6E A;  2YR0 A;  3MK6 A;  3VFD A;  4FW9 A;  2JA2 A;  1HQC A;  3I4V A;  2CEA A;  1IM2 A;  1Q3C A;  5EQT A;  3ZCB B;  4BLC A;  2DWM A;  1PJJ A;  2XZF A;  2NQ8 C;  4LCB A;  2F5S A;  1DGH A;  2KXE A;  4DUY M;  1FJG M;  2D7H A;  3GRR A;  2CV1 A;  3GPU A;  4ZPX A;  2I7N A;  4IBI A;  3A42 A;  4GHA A;  1T3T A;  4QNR A;  3U6S A;  4R7G A;  2FNA A;  3R8F A;  4G4N A;  3L29 A;  2OPF A;  4LFB M;  4S12 A;  4G4O A;  3ZH9 B;  3R9X B;  1GVN A;  5FTN A;  4IBD A;  3VK8 A;  1NNU C;  3KOY E;  1WXQ A;  1W5T A;  5E6J A;  4MB7 A;  2KW0 A;  4NOO B;  4AG5 A;  1HNX M;  3FUT A;  5EXP A;  3RGS A;  3SC3 A;  3W0F A;  2CHG A;  1L2C A;  1DO0 A;  1TDH A;  3AKZ A;  3K2L A;  3LMM A;  3LVW A;  2I7P A;  2HCB A;  1R2Z A;  4D80 A;  5A2Q S;  1OFI A;  4JV5 M;  2KZS A;  5EP2 A;  4OU7 A;  4L4U A;  1NY6 A;  5EP4 A;  4B3T M;  4IBK A;  3KS8 A;  2EO2 A;  4RF1 A;  1N33 M;  3DOA A;  3FYC A;  4MGK E;  3HHY A;  1IN6 A;  1SXJ B;  3T38 A;  4DV0 M;  8CAT A;  3U60 B;  1UM8 A;  3GLF B;  4BB9 A;  3TWK A;  2KRU A;  2FFJ A;  2ZAM A;  3GRV A;  1IN4 A;  3GLI B;  1Z5A A;  2XF3 A;  5FSW A;  5FLX S;  3TE6 A;  1HT2 E;  1HNW M;  1NHG C;  4M0W A;  2F5N A;  2DHR A;  2CE7 A;  1Z59 A;  4I8O A;  3UJN A;  2E5L M;  1GL7 A;  5ITU A;  3U6P A;  4JI0 M;  2R4J A;  4PCZ A;  3GP1 A;  4QOZ C;  5C18 A;  1R2Y A;  2M60 A;  5GKN A;  1G41 A;  4FCV A;  3FD9 A;  2Z3X A;  3VKG A;  1J7K A;  2XZU A;  5EP1 A;  5ITQ A;  3SAR A;  1IXZ A;  1DGH B;  3KSX A;  3NWL A;  4GIT A;  4LF8 M;  2DWZ B;  4IBF A;  3VDP A;  4NRV A;  1IQP A;  3FUU A;  4PDI A;  5IRE B;  2VQE M;  2DWL A;  4LF9 M;  2CHV A;  4G4R A;  2XGN A;  3KOW E;  4REZ A;  3GLH A;  1K3W A;  1Q3B A;  4OW0 A;  2HHH M;  1S3S A;  4EIW A;  1N36 M;  3KW6 A;  4CIS A;  2ZAO A;  4DR4 M;  1N32 M;  1IN8 A;  5EJC A;  3WHL A;  3FTF A;  4MH0 E;  3J81 S;  2R18 A;  4NXN M;  3AV0 A;  2L09 A;  1TH2 A;  3TWL A;  3U5Z A;  2F5O A;  1TH3 A;  3J7A S;  4DR7 M;  4KHP M;  4HL4 A;  2G8L A;  3CTW B;  3SYK A;  4FVM A;  3GRY A;  2J7N A;  3KSJ A;  4D81 A;  3H4M A;  5EXS A;  2D7E A;  3TL4 X;  2BNK A;  4X62 M;  1PM5 A;  1NJF A;  4D82 A;  2V1U A;  2FOI C;  3GPY A;  1KSF X;  1ORY B;  3RE8 A;  3HHX A;  3W0L B;  2DVW B;  4LJ6 A;  1QYR A;  4LF4 M;  2UUC M;  4AZF A;  1TH4 A;  4B3M M;  5DYG A;  3D8L A;  4JI3 M;  3SHG B;  3L26 A;  4GRI A;  4I4L A;  1Z5B A;  3ILK A;  3SAS A;  2Z7J A;  4OX9 M;  3SHF A;  4GHL A;  2DWN A;  1IBL M;  1Z6T A;  3QWL A;  4DV3 M;  3KS4 A;  3FUW A;  4DR5 M;  1N78 A;  4DV4 M;  2Y20 A;  4IBG A;  2M5Z A;  2W82 A;  3J7B A;  1NHW C;  1YE9 A;  3RGP A;  4LJ7 A;  4DUZ M;  3OTO M;  1IN5 A;  4LG2 A;  3HHZ A;  2UXD M;  3A98 B;  2EA0 A;  2LNH C;  4FWG A;  5KO3 A;  4LRS A;  1L1T A;  4IBE A;  5ITY A;  4LJ8 A;  3GLG A;  4LF5 M;  2XEP A;  3E4R A;  3SAW A;  2KZU A;  4DR6 M;  1L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...