4DV3M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv3M02
2F5PA 2E5LM 3A42A 4DV6M 1L2BA 1IBMM 4DV1M 4JI8M 4PD2A 4LFCM 1Z59A 3GQ3A 4LF7M 3T1HM 1PJIA 1EE8A 1IBLM 4B3MM 3GQ4A 3OTOM 1NNJA 4K0KM 4YY3M 3U6CA 1PJJA 1HNXM 4LF4M 3U6OA 3A46A 4G4QA 1R2YA 4LFBM 3SARA 4MB7A 4DR5M 1Z5BA 4JI2M 3TWLA 5ITXE 2HHHM 4YHHM 3VK7A 1Q39A 4DR6M 1I94M 5LMUM 4DR7M 4DUZM 2VQFM 4DUYM 4LF9M 5ITUA 1TDHA 1J5EM 2UXCM 3VK8A 1TDZA 4B3SM 4JYAM 3U6SA 2UUBM 2UXBM 5ITRA 2F5OA 4DR2M 4DV5M 4DR4M 4JI1M 4JI6M 2UUAM 1HR0M 4JV5M 2OPFA 3U6PA 4NXMM 3TWMA 3GO8A 3GPUA 3SATA 1N32M 1IBKM 1Q3CA 3J81S 3SASA 2F5NA 4DV3M 2VQEM 1HNWM 3TWKA 4G4OA 3GP1A 4OX9M 4G4NA 4DV0M 3JR5A 4KHPM 1N33M 4X66M 5LMNM 4JI0M 3JR4A 1N34M 5BR8M 1L1TA 5A2QS 4JI3M 4DV7M 4ITQA 3U6QA 5IT9S 1R2ZA 4DR1M 3SBJA 3SAWA 3C58A 3U6EA 4PCZA 3GPXA 1L1ZA 5ITQA 1MX0A 3GPPA 3T1YM 4GKKM 2EA0A 2Q2EB 3A45A 4X62M 2XZFA 1XNRM 4LF6M 1Z5AA 4PDGA 1N36M 5IWAM 4LF8M 3GQ5A 1L2CA 4CISA 2UXDM 1K82A 4JI4M 1K3WA 4NRVA 1K3XA 4NRWA 5ITYA 1XC8A 2F5SA 1MU5A 4AQYM 3U6DA 3W0FA 2F5QA 1L2DA 2F4VM 1Z5CA 4GKJM 4X65M 1XMQM 4LF5M 4PDIA 4X64M 4JI7M 4DV4M 4DV2M 1PM5A 1FJGM 4NXNM 4LFAM 4G4RA 3GPYA 1XMOM 3SAUA 3J7AS 5FLXS 1XNQM 3SAVA 2ZBKB 2ZM6M 2HKJA 4B3RM 3JAMS 2XZUA 4DR3M 1KFVA 2UUCM 2OQ4A 3DOAA 3J80S 5ITTA 1HNZM 4B3TM 3U6MA 5ITXA 3U6LA 1Q3BA 4JI5M 2UU9M
chains in the Genus database with same CATH superfamily
2CUZA 5BPVA 4GRIA 2JP7A 2LXEA 1HT1E 4HLQA 5E6JA 5EQTA 3TE6A 2XF3A 1L2BA 2OO9A 1V33A 2JY6B 2DAKA 4PD2A 4IBIA 2L4EA 1WXQA 2DENA 3T1HM 4B3MM 3HGIA 2R46A 2V1CA 2ZAOA 3EIEA 2EO2A 4K0KM 4YY3M 3W67A 3I01M 4TUWA 4MGHA 1HNXM 4GC9A 3A46A 4G4QA 2KZSA 4LJ6A 1E94E 1VEGA 2JUJA 4L16A 2BWBA 3FKEA 5ITXE 2HHHM 3SYKA 4DR6M 1SXJB 1GJTA 1NY6A 2XGNA 4FWDA 1J09A 4BB9A 1J5EM 1WHCA 3PNVA 1VEJA 1TDZA 4OU7A 3UZUA 2KDLA 3U6SA 2DHRA 2UUBM 4NC6A 2F5OA 1TH4A 1ZV1A 4I4LA 2XFTA 4LGMA 2CE7A 4JI1M 3HHWA 3GRRA 2Y20A 2EKKA 1LV7A 2OPFA 4NXMM 3GPUA 1IY1A 2DAEA 3AOEC 1VEKA 1IXSB 4WURA 1VDDA 2F5NA 3RGSA 1G8PA 1QAQA 3GP1A 2C9OA 4G4NA 2L2DA 4IBBA 1NV9A 1W5SA 4M9XA 2MH8A 3WHKA 4F2LA 1IN7A 4JI0M 3JR4A 1OTRA 2K9DA 1YUBA 4OVZA 1IN6A 3T6PA 2KA6B 3ILKA 1T6OA 5EP2A 1OAIA 3GLGE 3U6QA 1VG5A 5JI3E 3SHGB 1WGLA 1T3TA 2LNHC 1E9SA 4MGYE 3T15A 3CTWB 3SAWA 3UJNA 1NJFA 2KNAA 1PJTA 2V6ZM 3GLGB 4PCZA 3GPXA 4XK8F 3H4JA 2FOIC 3W0LB 1VDLA 1IXRC 1XWIA 2Q2EB 2L6OA 2XZFA 1L8QA 2J7NA 2KNZA 4LF6M 3RGPA 4B7FA 4LF8M 1Z6TA 1V92A 2RKOA 4NOOB 4HEOA 4CISA 2DZNB 2UXDM 3VDUA 1HQCA 4JXJA 4AG6A 4LJ9A 2C9CA 4NRVA 4NRWA 3GLFB 5C18A 2F5SA 1OQYA 2KRKA 1MU5A 5EXPA 4AQYM 3VDPA 3HJQA 3FUVA 3IHPA 5IZ7D 2EKFA 1IY2A 8CATA 4P17A 3MMPA 4LF5M 2DZLA 4DV4M 4LZJA 1C1KA 4D81A 4NXNM 4IIWA 2DWLA 1R5LA 4JN6A 3KDSE 1SXJD 3TL4X 2QENA 1G59A 3K8ZA 3HJ8A 4QNRA 2I7NA 4RF0A 1EFUB 1SXJA 2CV2A 3DZDA 3UK6A 3L25A 4M9ZA 4MGKE 2HAKA 1QUTA 1KFVA 4HL4A 1IN8A 3J80S 5FTJA 5ITTA 4B3TM 5ITXA 4Q7JA 1OJLA 2C98A 3D8LA 2DWZB 3IG8A 2BWEA 2F5PA 1DO2A 3E21A 1IBMM 2D7GA 3D8BA 5FTMA 3SFZA 2KEBA 1TF0B 2I7PA 3C3EA 3U61B 1GABA 2APLA 1JR3E 2L7HA 2KRUA 5DYGA 4LF7M 2DWNA 3KP0E 4NSRA 2XH9A 2RGHA 2JZ1A 5GKNA 4QHSA 4RKUF 1IXSA 2L4FA 3ZQJA 2J5YA 3BBZA 2XSZD 4FD2A 3B7NA 2QHOB 3C9PA 1MJGM 3ZH9B 4NSOB 1PJJA 2ERCA 4AI6A 3SARA 1V34A 4JI2M 4KT0F 3TWLA 5DNYA 1LTMA 1PRBA 1QZMA 1I94M 1GL7A 4LJ5A 3UGJA 5LMUM 1C7YA 4DUZM 3SMSA 2CV0A 2Z3XA 4REZA 2LHCA 3AOGA 5H37D 2LVQD 4DUYM 2X4AA 4EIWA 3HWSA 5ITUA 4M0WA 2G8LA 1D2NA 1UFZA 2JWSA 3GLHE 2KZUA 1YE9A 2Z4SA 3FRHA 4FWHA 4KLNA 4RF1A 5ITRA 4D80A 3GLGA 4DR2M 4DV5M 4ANRA 4DR4M 3QAUA 4G3OA 3CGWA 1GLNA 3I4VA 2VF7A 1HR0M 2UUAM 4JV5M 1NO1A 4IBGA 2XFSA 2JNHA 3MK6A 4L15A 2FE8A 3C3DA 3I51A 2QBYB 3SASA 2QQ8A 4DV3M 2VQEM 2YR0A 4IBKA 3TWKA 1N77A 4OX9M 2Y21A 4KHPM 1OAOC 3KS4A 3GLFA 2CV1A 1JB0F 2FFJA 3A98B 3HU3A 4QNMA 5LMNM 1IN4A 3FUUA 1GVNA 4CIZA 4OW0A 5EXXA 3KFUG 4DV7M 4ITQA 1QAMA 3LW5F 3VKHA 4G6ZA 1TTEA 4DR1M 2JY5A 2VF8A 3FUTA 3SBJA 3C58A 4GMQA 4LJ4A 1UM8A 1IFYA 1QAOA 3GPPA 4XGIA 3T1YM 5L8RF 1TH3A 2EA0A 3LMMA 4X62M 1F4IA 3MHVC 2FS1A 3LVVA 1Z5AA 4FCVA 4PDGA 2V1UA 3CF2A 3TQSA 5KPRA 2DKLA 1L2CA 4PT5A 1D0KA 1DGHB 5EXSA 3QYBA 1K3XA 1N78A 4L4UA 2HL7A 3HHYA 3U6DA 2LVNC 3W0FA 3U61A 1WIVA 4L6V6 4X65M 4R3DA 5EP4A 4GC5A 2JY8A 1XMQM 1N75A 2KW0A 4X64M 3LCVB 2BNKA 4LG2A 1FJGM 1H6UA 4I81A 2DAIA 3FD9A 2K6BA 1QDRA 3KS8A 3R9XB 4QHTA 3KP1E 2Z4RA 5FLXS 1XB2B 4S12A 3SAVA 2VIIA 1S3SA 2K0BX 2CHQA 1R7RA 2R6FA 4Y28F 3TPZA 4DR3M 5DYIA 2DVWB 2R4EA 2UUCM 3KOZE 4IBFA 2OQ4A 1P3QQ 2Y0QA 4AW4A 3UMMA 1R6BX 3K1JA 2M60A 2X8AA 1X37A 3A42A 1OIZA 2QZ4A 2CFOA 2K47A 4LRTA 4AKIA 2CP8A 2CWBA 3KSXA 3FE3A 2P5TA 4LFCM 4IJFA 3GQ3A 3FTCA 4LZZA 3HX3A 1T43A 4UN2B 1IBLM 2VDBB 4CGYB 1NVMA 2EJSA 4LGYA 3OTOM 2EUCA 2GNOA 1NNJA 2QBYA 2C96A 4L8RC 4LF4M 4FWGA 3U6OA 4WP2A 1R2YA 2KHHA 2X49A 2MROB 1OFHA 2ZAMA 1Z5BA 3IG5A 4DR5M 1E9RA 2FNAA 4MGIE 2KXEA 3QYEA 1Q39A 3HZJA 2JA2A 3VK7A 4AKGA 2MR9A 1SXJC 3AKZA 2CRUA 2VQFM 3PFIA 2DAGA 3SYLA 1TDHA 2L7IA 3HKPA 4WW0A 3L26A 1SG9A 3MJ5A 3VK8A 2DXIA 1OKSA 1RU3A 2UXCM 1G3IA 1PGYA 2QP9X 1NJGA 2UXBM 3Q8GA 3E4RA 3J2PB 2XLJA 2R4JA 5DFLA 2XEPA 3CF0A 4JI6M 5KPTA 2JXNA 2DAMA 2DI0A 3QWLA 3TWMA 1ZAEA 3GO8A 3U6PA 1N32M 1Q3CA 3J81S 4II7A 2WZJA 2R44A 3AL0C 1IXZA 3M7GA 1HNWM 4CJ6A 4CHTB 1DGHA 3HHXA 1TR8A 3B89A 4LCBA 4DV0M 3JR5A 2C99A 3B9PA 4B08A 2HCBA 1N33M 2NQ8C 5BR8M 3IECA 2OOBA 5EP1A 2YFQA 5A2QS 1L1TA 4JI3M 2O25A 4ZPXA 1JQJC 3SMPA 4A3VB 4GEWA 3HU2A 2Y0TA 5IT9S 2L09A 3FUXA 3V76A 4RNAA 2MJ5B 3VLFB 3PVSA 5EP3A 3SC3A 4Z8XA 3FRIA 2DNAA 2LTUA 1QVRA 5FTNA 3U6EA 1I4WA 3LQRA 3H4MA 1DO0A 3NBXX 3Q8XA 1L1ZA 1GJSA 3KOWE 3GLHB 1KSFX 5KQDA 1WR1B 3K9PA 3A45A 1XNRM 1TGUA 4MGZE 1J7KA 1N36M 2N35A 4P16A 1VQ1A 1HJPA 4IBCA 3FUWA 2WSCF 3I4YA 3GQ5A 2GQFA 3ZC7B 3LCUA 4QOSA 1K82A 4JI4M 1G71A 3KSJA 7CATA 4LJ8A 5ITYA 3L27A 1XC8A 5FTLA 4KO8A 1L2DA 2F4VM 5EJCA 3DA1A 2LHGA 3I04M 1DGBA 4L78A 4PDIA 2OOAA 1PM5A 1QQWA 3W68A 3U60A 4DBGB 1D0MA 4LFAM 3B7QA 1GL6A 3HY5A 1MN3A 1SXJE 1ZMWA 1XMOM 3BOSA 2R18A 3GRVA 1A5TA 1IQPA 4D82A 1ZQ9A 3SAUA 1IY0A 3J7AS 5FTKA 3U5ZB 3GRUA 3J7BA 3R8FA 1GKIA 2CHVA 3LQQA 3JAMS 4B3RM 1W5TA 1NV8A 4LY6A 3GLIE 1HNZM 5EXTA 1YLAA 5IREB 1G4AE 1XXHE 1R4GA 1Q3BA 3U6MA 3K2LA 4FVMA 2UU9M 2YQZA 2E5LM 1PJQA 2DWMA 4DV6M 3GLIB 1IN5A 1QANA 3FTDA 2C5RA 2BJVA 3AV0A 4AZFA 1KYIA 1PJSA 2D7EA 4DV1M 4JI8M 1XXHB 1Z59A 4MH0E 1JR3D 3AOEA 3EIHA 1PJIA 1EE8A 1DGGA 3B74A 3GQ4A 1ZMUA 2WSEF 1Y8GA 3HU1A 3KW6A 1FNNA 1JR3A 1ORYB 1OFIA 1QZEA 2G3QA 3LVWA 5FSWA 3U6CA 4LFBM 4I8OA 4MB7A 4NL4H 1NY5A 2LH0A 1OIPA 4YHHM 3K92A 3FTEA 1XHBA 3F92A 2DZOB 3HJSA 2ZTDA 4DR7M 2H5XA 3THGA 3FTFA 2O5RA 5JI2E 4FCTA 3VKGA 3ZCBB 3FYCA 4I5SA 4LF9M 2JZ0A 2KNVA 4BBAA 3KXEC 1G41A 3FYDA 2LWXA 4B3SM 4AG5A 4JYAM 1Q02A 2YNMD 3PXGA 1QUSA 5KO3A 2J7OA 2Z7JA 4Z6YA 5KPZA 1E32A 1HT2E 4F1IA 1EIJA 4GHLA 2AHMA 3GRYA 5KQ8A 3GLHA 3KOYE 3U60B 2WSFF 4M9SA 1GO5A 3L28A 4KODA 2A5YB 3NBIA 3HHZA 2R0IA 1IBKM 3AFHA 3GLFE 3SATA 5E26A 2HWJA 2RGOA 2M5ZA 2ZTCA 2FH0A 4FW9A 4IBEA 4G4OA 4B7HA 1AIPC 4X66M 4GHAA 2G5GX 3VFDA 1N34M 1NHGC 1QYRA 4LJAA 1WJ7A 3M6AA 4R7GA 3L2AA 4GIPA 1AUAA 2QSFX 2Z8YM 1R2ZA 2R62A 1ZMVA 2RRUA 3E9SA 3PNYA 2LVPC 1WGNA 3K9OA 4QOZC 5ITQA 2R65A 1MX0A 1YSYA 3U5ZA 2R45A 4GKKM 1NSFA 2H1RA 2LVOC 1TH2A 1HQYE 3RFWA 2B3TA 2JY7A 5IWAM 5C1BA 3RE8A 4LJ7A 2D7HA 2QCUA 3J27B 1K3WA 1NNUC 2CEAA 1QDTA 2BJWA 4BLCA 1BVSA 3M0EA 3KVWA 3GLIA 2F5QA 4AKHA 2LBCA 1Z5CA 4GKJM 4OVZB 1XXHA 3B7ZA 4IBDA 1CUKA 4JI7M 4FCWA 3KOXE 4GITA 4DV2M 1D0LA 2DHYA 1NHWC 1DGFA 2ZANA 2LVAA 4XBOA 4B7GA 4G4RA 3GPYA 3E46A 4IBJA 3BXWA 3T38A 3SHFA 3NWLA 1IM2A 2W82A 2MGWA 3L29A 4GH9A 1XNQM 2CHGA 5F3WA 2XSZA 2ZBKB 3AJIB 3CF6E 4IJEA 4LRSA 2HKJA 2QPAA 2ZM6M 2XZUA 4R71A 4MM3B 3DFZA 2QNJA 3DOAA 1DV0A 3WHLA 4M0DA 3U6LA 4JI5M 4W5WA 2O01F
chains in the Genus database with same CATH topology
2CUZA 5BPVA 4GRIA 2LXEA 1HT1E 4HLQA 5E6JA 5EQTA 3TE6A 2XF3A 1L2BA 4PD2A 4IBIA 1WXQA 3T1HM 4B3MM 3HGIA 2R46A 2V1CA 2ZAOA 3EIEA 2EO2A 4K0KM 4YY3M 4TUWA 4MGHA 1HNXM 4GC9A 3A46A 4G4QA 2KZSA 4LJ6A 1E94E 4L16A 3FKEA 5ITXE 2HHHM 3SYKA 4DR6M 1SXJB 1NY6A 2XGNA 4FWDA 1J09A 4BB9A 1J5EM 3PNVA 1TDZA 4OU7A 3UZUA 3U6SA 2DHRA 2UUBM 2F5OA 1TH4A 4I4LA 2XFTA 4LGMA 2CE7A 4JI1M 3HHWA 3GRRA 2Y20A 1LV7A 2OPFA 4NXMM 3GPUA 1IY1A 3AOEC 4WURA 1IXSB 1VDDA 2F5NA 3RGSA 1G8PA 1QAQA 3GP1A 2C9OA 4G4NA 4IBBA 1W5SA 4M9XA 3WHKA 1IN7A 4JI0M 3JR4A 1YUBA 4OVZA 1IN6A 2KA6B 3ILKA 5EP2A 3U6QA 5JI3E 3SHGB 1T3TA 2LNHC 1E9SA 4MGYE 3T15A 3CTWB 3SAWA 3UJNA 1NJFA 2V6ZM 3GLGB 4PCZA 3GPXA 2FOIC 3W0LB 1IXRC 1XWIA 2Q2EB 2L6OA 2XZFA 1L8QA 2J7NA 4LF6M 3RGPA 4B7FA 4LF8M 1Z6TA 2RKOA 4NOOB 4CISA 2UXDM 2DZNB 3VDUA 1HQCA 4JXJA 4AG6A 4LJ9A 2C9CA 4NRVA 4NRWA 3GLFB 5C18A 2F5SA 2KRKA 1MU5A 5EXPA 4AQYM 3VDPA 3HJQA 3FUVA 5IZ7D 1IY2A 8CATA 4LF5M 4DV4M 4LZJA 1C1KA 4D81A 4NXNM 4IIWA 2DWLA 4JN6A 3KDSE 1SXJD 3TL4X 2QENA 1G59A 3K8ZA 3HJ8A 4QNRA 2I7NA 4RF0A 1SXJA 2CV2A 3DZDA 3UK6A 3L25A 4M9ZA 4MGKE 1KFVA 4HL4A 1IN8A 3J80S 5FTJA 5ITTA 4B3TM 5ITXA 1OJLA 3D8LA 2C98A 2DWZB 3IG8A 2F5PA 1DO2A 1IBMM 2D7GA 3D8BA 5FTMA 3SFZA 2KEBA 3U61B 2I7PA 2L7HA 2KRUA 5DYGA 4LF7M 2DWNA 3KP0E 4NSRA 2XH9A 2RGHA 5GKNA 4QHSA 4FD2A 1PJJA 2XSZD 3ZH9B 4NSOB 2ERCA 4AI6A 3SARA 4JI2M 3TWLA 5DNYA 1QZMA 1I94M 1GL7A 4LJ5A 3UGJA 5LMUM 4DUZM 3SMSA 2CV0A 2Z3XA 4REZA 3AOGA 5H37D 4DUYM 2X4AA 4EIWA 3HWSA 5ITUA 4M0WA 2G8LA 1D2NA 2KZUA 1YE9A 2Z4SA 4FWHA 4KLNA 4RF1A 5ITRA 4D80A 3GLGA 4DR2M 4DV5M 4DR4M 3QAUA 1GLNA 3I4VA 2UUAM 1HR0M 4JV5M 4IBGA 2XFSA 3MK6A 4L15A 2FE8A 3I51A 3SASA 2QBYB 4DV3M 2VQEM 2YR0A 4IBKA 3TWKA 1N77A 4OX9M 2Y21A 4KHPM 3KS4A 3GLFA 2CV1A 2FFJA 3A98B 3HU3A 4QNMA 5LMNM 1IN4A 3FUUA 1GVNA 4OW0A 5EXXA 3KFUG 4DV7M 4ITQA 1QAMA 3VKHA 4G6ZA 4DR1M 3FUTA 3SBJA 3C58A 4GMQA 4LJ4A 1UM8A 1QAOA 3GPPA 4XGIA 3T1YM 1TH3A 2EA0A 3LMMA 4X62M 3MHVC 3LVVA 1Z5AA 4FCVA 4PDGA 2V1UA 3CF2A 3TQSA 5KPRA 1L2CA 4PT5A 1DGHB 5EXSA 1N78A 1K3XA 4L4UA 2HL7A 3HHYA 3U6DA 3W0FA 3U61A 4X65M 4R3DA 5EP4A 4GC5A 1XMQM 1N75A 2KW0A 4X64M 2BNKA 4LG2A 1FJGM 1H6UA 4I81A 3FD9A 3KS8A 3R9XB 4QHTA 3KP1E 2Z4RA 5FLXS 4S12A 3SAVA 2VIIA 1S3SA 3TPZA 2CHQA 1R7RA 4DR3M 5DYIA 2DVWB 2R4EA 2UUCM 3KOZE 4IBFA 2OQ4A 2Y0QA 4AW4A 3UMMA 1R6BX 3K1JA 2M60A 2X8AA 1X37A 3A42A 2QZ4A 2CFOA 2K47A 4LRTA 4AKIA 3KSXA 2P5TA 4LFCM 4IJFA 3GQ3A 3FTCA 4LZZA 1IBLM 4CGYB 1NVMA 4LGYA 3OTOM 1NNJA 2EUCA 2QBYA 4L8RC 2C96A 4LF4M 4FWGA 3U6OA 1R2YA 2X49A 1OFHA 2ZAMA 1Z5BA 3IG5A 4DR5M 1E9RA 2FNAA 4MGIE 2KXEA 3VK7A 1Q39A 2JA2A 4AKGA 1SXJC 3AKZA 2VQFM 3PFIA 3SYLA 1TDHA 2L7IA 3HKPA 4WW0A 3L26A 3MJ5A 3VK8A 2UXCM 2DXIA 1G3IA 2QP9X 1NJGA 2UXBM 3E4RA 3J2PB 2XLJA 2R4JA 2XEPA 3CF0A 4JI6M 5KPTA 3QWLA 3U6PA 1N32M 3TWMA 1ZAEA 3GO8A 1Q3CA 3J81S 4II7A 3AL0C 1IXZA 3M7GA 1HNWM 4CHTB 1DGHA 3HHXA 4LCBA 4DV0M 3JR5A 2C99A 3B9PA 4B08A 2HCBA 1N33M 2NQ8C 5BR8M 1L1TA 5EP1A 2YFQA 5A2QS 4JI3M 4ZPXA 3SMPA 1JQJC 4A3VB 3HU2A 2Y0TA 5IT9S 2L09A 3FUXA 4RNAA 3VLFB 3PVSA 5EP3A 3SC3A 4Z8XA 1QVRA 5FTNA 3U6EA 1I4WA 3LQRA 3H4MA 1DO0A 1L1ZA 3Q8XA 3KOWE 3GLHB 1KSFX 5KQDA 3A45A 1XNRM 1TGUA 4MGZE 1J7KA 1N36M 4P16A 4IBCA 3FUWA 3I4YA 3GQ5A 3ZC7B 4QOSA 1K82A 4JI4M 3KSJA 7CATA 4LJ8A 5ITYA 3L27A 1XC8A 5FTLA 4KO8A 1L2DA 2F4VM 5EJCA 3DA1A 1DGBA 4L78A 4PDIA 1PM5A 1QQWA 3U60A 4LFAM 1GL6A 1SXJE 1XMOM 3BOSA 3GRVA 4D82A 1IQPA 1ZQ9A 3SAUA 1IY0A 3J7AS 5FTKA 3U5ZB 3GRUA 3J7BA 3R8FA 1GKIA 2CHVA 3LQQA 3JAMS 4B3RM 1W5TA 4LY6A 1HNZM 5EXTA 5IREB 3U6MA 1G4AE 1Q3BA 3K2LA 4FVMA 2UU9M 2YQZA 2E5LM 2DWMA 4DV6M 3GLIB 1IN5A 1QANA 3FTDA 2C5RA 2BJVA 3AV0A 4AZFA 1KYIA 4DV1M 2D7EA 4JI8M 1XXHB 1Z59A 4MH0E 1JR3D 3AOEA 3EIHA 1PJIA 1EE8A 1DGGA 3GQ4A 3HU1A 3LVWA 3KW6A 1FNNA 1JR3A 1ORYB 1OFIA 3U6CA 5FSWA 4LFBM 4I8OA 4MB7A 4NL4H 1NY5A 2LH0A 4YHHM 3K92A 3FTEA 1XHBA 2DZOB 3HJSA 4DR7M 3THGA 3FTFA 2O5RA 5JI2E 4FCTA 3VKGA 3ZCBB 3FYCA 4I5SA 4LF9M 4BBAA 3KXEC 1G41A 3FYDA 2LWXA 4B3SM 4AG5A 4JYAM 2YNMD 3PXGA 5KO3A 2J7OA 2Z7JA 4Z6YA 5KPZA 1E32A 1HT2E 4GHLA 2AHMA 3GRYA 5KQ8A 3GLHA 3KOYE 3U60B 4M9SA 3L28A 4KODA 2A5YB 3NBIA 3HHZA 3SATA 1IBKM 3AFHA 5E26A 2RGOA 2M5ZA 4FW9A 4G4OA 4IBEA 4B7HA 4X66M 4GHAA 2G5GX 3VFDA 1N34M 1NHGC 1QYRA 4LJAA 3M6AA 4R7GA 3L2AA 4GIPA 1R2ZA 2R62A 3E9SA 3PNYA 4QOZC 5ITQA 2R65A 1MX0A 1YSYA 3U5ZA 2R45A 4GKKM 1NSFA 2H1RA 1TH2A 1HQYE 3RFWA 5IWAM 5C1BA 3RE8A 4LJ7A 2D7HA 2QCUA 3J27B 1K3WA 1NNUC 2CEAA 2BJWA 4BLCA 3M0EA 3KVWA 3GLIA 2F5QA 4AKHA 1Z5CA 4GKJM 4OVZB 1XXHA 4IBDA 4JI7M 4FCWA 3KOXE 4GITA 4DV2M 1NHWC 1DGFA 2ZANA 4G4RA 4XBOA 4B7GA 3GPYA 4IBJA 3SHFA 3T38A 3NWLA 1IM2A 2W82A 3L29A 4GH9A 1XNQM 2CHGA 5F3WA 2XSZA 2ZBKB 3CF6E 3AJIB 4IJEA 4LRSA 2HKJA 2QPAA 2ZM6M 2XZUA 4MM3B 3DFZA 3DOAA 3WHLA 4M0DA 3U6LA 4JI5M 4W5WA 2R18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5P A;  2E5L M;  3A42 A;  4DV6 M;  1L2B A;  1IBM M;  4DV1 M;  4JI8 M;  4PD2 A;  4LFC M;  1Z59 A;  3GQ3 A;  4LF7 M;  3T1H M;  1PJI A;  1EE8 A;  1IBL M;  4B3M M;  3GQ4 A;  3OTO M;  1NNJ A;  4K0K M;  4YY3 M;  3U6C A;  1PJJ A;  1HNX M;  4LF4 M;  3U6O A;  3A46 A;  4G4Q A;  1R2Y A;  4LFB M;  3SAR A;  4MB7 A;  4DR5 M;  1Z5B A;  4JI2 M;  3TWL A;  5ITX E;  2HHH M;  4YHH M;  3VK7 A;  1Q39 A;  4DR6 M;  1I94 M;  5LMU M;  4DR7 M;  4DUZ M;  2VQF M;  4DUY M;  4LF9 M;  5ITU A;  1TDH A;  1J5E M;  2UXC M;  3VK8 A;  1TDZ A;  4B3S M;  4JYA M;  3U6S A;  2UUB M;  2UXB M;  5ITR A;  2F5O A;  4DR2 M;  4DV5 M;  4DR4 M;  4JI1 M;  4JI6 M;  2UUA M;  1HR0 M;  4JV5 M;  2OPF A;  3U6P A;  4NXM M;  3TWM A;  3GO8 A;  3GPU A;  3SAT A;  1N32 M;  1IBK M;  1Q3C A;  3J81 S;  3SAS A;  2F5N A;  4DV3 M;  2VQE M;  1HNW M;  3TWK A;  4G4O A;  3GP1 A;  4OX9 M;  4G4N A;  4DV0 M;  3JR5 A;  4KHP M;  1N33 M;  4X66 M;  5LMN M;  4JI0 M;  3JR4 A;  1N34 M;  5BR8 M;  1L1T A;  5A2Q S;  4JI3 M;  4DV7 M;  4ITQ A;  3U6Q A;  5IT9 S;  1R2Z A;  4DR1 M;  3SBJ A;  3SAW A;  3C58 A;  3U6E A;  4PCZ A;  3GPX A;  1L1Z A;  5ITQ A;  1MX0 A;  3GPP A;  3T1Y M;  4GKK M;  2EA0 A;  2Q2E B;  3A45 A;  4X62 M;  2XZF A;  1XNR M;  4LF6 M;  1Z5A A;  4PDG A;  1N36 M;  5IWA M;  4LF8 M;  3GQ5 A;  1L2C A;  4CIS A;  2UXD M;  1K82 A;  4JI4 M;  1K3W A;  4NRV A;  1K3X A;  4NRW A;  5ITY A;  1XC8 A;  2F5S A;  1MU5 A;  4AQY M;  3U6D A;  3W0F A;  2F5Q A;  1L2D A;  2F4V M;  1Z5C A;  4GKJ M;  4X65 M;  1XMQ M;  4LF5 M;  4PDI A;  4X64 M;  4JI7 M;  4DV4 M;  4DV2 M;  1PM5 A;  1FJG M;  4NXN M;  4LFA M;  4G4R A;  3GPY A;  1XMO M;  3SAU A;  3J7A S;  5FLX S;  1XNQ M;  3SAV A;  2ZBK B;  2ZM6 M;  2HKJ A;  4B3R M;  3JAM S;  2XZU A;  4DR3 M;  1KFV A;  2UUC M;  2OQ4 A;  3DOA A;  3J80 S;  5ITT A;  1HNZ M;  4B3T M;  3U6M A;  5ITX A;  3U6L A;  1Q3B A;  4JI5 M;  2UU9 M; 
#chains in the Genus database with same CATH topology
 2CUZ A;  5BPV A;  4GRI A;  2JP7 A;  2LXE A;  1HT1 E;  4HLQ A;  5E6J A;  5EQT A;  3TE6 A;  2XF3 A;  1L2B A;  2OO9 A;  1V33 A;  2JY6 B;  2DAK A;  4PD2 A;  4IBI A;  2L4E A;  1WXQ A;  2DEN A;  3T1H M;  4B3M M;  3HGI A;  2R46 A;  2V1C A;  2ZAO A;  3EIE A;  2EO2 A;  4K0K M;  4YY3 M;  3W67 A;  3I01 M;  4TUW A;  4MGH A;  1HNX M;  4GC9 A;  3A46 A;  4G4Q A;  2KZS A;  4LJ6 A;  1E94 E;  1VEG A;  2JUJ A;  4L16 A;  2BWB A;  3FKE A;  5ITX E;  2HHH M;  3SYK A;  4DR6 M;  1SXJ B;  1GJT A;  1NY6 A;  2XGN A;  4FWD A;  1J09 A;  4BB9 A;  1J5E M;  1WHC A;  3PNV A;  1VEJ A;  1TDZ A;  4OU7 A;  3UZU A;  2KDL A;  3U6S A;  2DHR A;  2UUB M;  4NC6 A;  2F5O A;  1TH4 A;  1ZV1 A;  4I4L A;  2XFT A;  4LGM A;  2CE7 A;  4JI1 M;  3HHW A;  3GRR A;  2Y20 A;  2EKK A;  1LV7 A;  2OPF A;  4NXM M;  3GPU A;  1IY1 A;  2DAE A;  3AOE C;  1VEK A;  1IXS B;  4WUR A;  1VDD A;  2F5N A;  3RGS A;  1G8P A;  1QAQ A;  3GP1 A;  2C9O A;  4G4N A;  2L2D A;  4IBB A;  1NV9 A;  1W5S A;  4M9X A;  2MH8 A;  3WHK A;  4F2L A;  1IN7 A;  4JI0 M;  3JR4 A;  1OTR A;  2K9D A;  1YUB A;  4OVZ A;  1IN6 A;  3T6P A;  2KA6 B;  3ILK A;  1T6O A;  5EP2 A;  1OAI A;  3GLG E;  3U6Q A;  1VG5 A;  5JI3 E;  3SHG B;  1WGL A;  1T3T A;  2LNH C;  1E9S A;  4MGY E;  3T15 A;  3CTW B;  3SAW A;  3UJN A;  1NJF A;  2KNA A;  1PJT A;  2V6Z M;  3GLG B;  4PCZ A;  3GPX A;  4XK8 F;  3H4J A;  2FOI C;  3W0L B;  1VDL A;  1IXR C;  1XWI A;  2Q2E B;  2L6O A;  2XZF A;  1L8Q A;  2J7N A;  2KNZ A;  4LF6 M;  3RGP A;  4B7F A;  4LF8 M;  1Z6T A;  1V92 A;  2RKO A;  4NOO B;  4HEO A;  4CIS A;  2DZN B;  2UXD M;  3VDU A;  1HQC A;  4JXJ A;  4AG6 A;  4LJ9 A;  2C9C A;  4NRV A;  4NRW A;  3GLF B;  5C18 A;  2F5S A;  1OQY A;  2KRK A;  1MU5 A;  5EXP A;  4AQY M;  3VDP A;  3HJQ A;  3FUV A;  3IHP A;  5IZ7 D;  2EKF A;  1IY2 A;  8CAT A;  4P17 A;  3MMP A;  4LF5 M;  2DZL A;  4DV4 M;  4LZJ A;  1C1K A;  4D81 A;  4NXN M;  4IIW A;  2DWL A;  1R5L A;  4JN6 A;  3KDS E;  1SXJ D;  3TL4 X;  2QEN A;  1G59 A;  3K8Z A;  3HJ8 A;  4QNR A;  2I7N A;  4RF0 A;  1EFU B;  1SXJ A;  2CV2 A;  3DZD A;  3UK6 A;  3L25 A;  4M9Z A;  4MGK E;  2HAK A;  1QUT A;  1KFV A;  4HL4 A;  1IN8 A;  3J80 S;  5FTJ A;  5ITT A;  4B3T M;  5ITX A;  4Q7J A;  1OJL A;  2C98 A;  3D8L A;  2DWZ B;  3IG8 A;  2BWE A;  2F5P A;  1DO2 A;  3E21 A;  1IBM M;  2D7G A;  3D8B A;  5FTM A;  3SFZ A;  2KEB A;  1TF0 B;  2I7P A;  3C3E A;  3U61 B;  1GAB A;  2APL A;  1JR3 E;  2L7H A;  2KRU A;  5DYG A;  4LF7 M;  2DWN A;  3KP0 E;  4NSR A;  2XH9 A;  2RGH A;  2JZ1 A;  5GKN A;  4QHS A;  4RKU F;  1IXS A;  2L4F A;  3ZQJ A;  2J5Y A;  3BBZ A;  2XSZ D;  4FD2 A;  3B7N A;  2QHO B;  3C9P A;  1MJG M;  3ZH9 B;  4NSO B;  1PJJ A;  2ERC A;  4AI6 A;  3SAR A;  1V34 A;  4JI2 M;  4KT0 F;  3TWL A;  5DNY A;  1LTM A;  1PRB A;  1QZM A;  1I94 M;  1GL7 A;  4LJ5 A;  3UGJ A;  5LMU M;  1C7Y A;  4DUZ M;  3SMS A;  2CV0 A;  2Z3X A;  4REZ A;  2LHC A;  3AOG A;  5H37 D;  2LVQ D;  4DUY M;  2X4A A;  4EIW A;  3HWS A;  5ITU A;  4M0W A;  2G8L A;  1D2N A;  1UFZ A;  2JWS A;  3GLH E;  2KZU A;  1YE9 A;  2Z4S A;  3FRH A;  4FWH A;  4KLN A;  4RF1 A;  5ITR A;  4D80 A;  3GLG A;  4DR2 M;  4DV5 M;  4ANR A;  4DR4 M;  3QAU A;  4G3O A;  3CGW A;  1GLN A;  3I4V A;  2VF7 A;  1HR0 M;  2UUA M;  4JV5 M;  1NO1 A;  4IBG A;  2XFS A;  2JNH A;  3MK6 A;  4L15 A;  2FE8 A;  3C3D A;  3I51 A;  2QBY B;  3SAS A;  2QQ8 A;  4DV3 M;  2VQE M;  2YR0 A;  4IBK A;  3TWK A;  1N77 A;  4OX9 M;  2Y21 A;  4KHP M;  1OAO C;  3KS4 A;  3GLF A;  2CV1 A;  1JB0 F;  2FFJ A;  3A98 B;  3HU3 A;  4QNM A;  5LMN M;  1IN4 A;  3FUU A;  1GVN A;  4CIZ A;  4OW0 A;  5EXX A;  3KFU G;  4DV7 M;  4ITQ A;  1QAM A;  3LW5 F;  3VKH A;  4G6Z A;  1TTE A;  4DR1 M;  2JY5 A;  2VF8 A;  3FUT A;  3SBJ A;  3C58 A;  4GMQ A;  4LJ4 A;  1UM8 A;  1IFY A;  1QAO A;  3GPP A;  4XGI A;  3T1Y M;  5L8R F;  1TH3 A;  2EA0 A;  3LMM A;  4X62 M;  1F4I A;  3MHV C;  2FS1 A;  3LVV A;  1Z5A A;  4FCV A;  4PDG A;  2V1U A;  3CF2 A;  3TQS A;  5KPR A;  2DKL A;  1L2C A;  4PT5 A;  1D0K A;  1DGH B;  5EXS A;  3QYB A;  1K3X A;  1N78 A;  4L4U A;  2HL7 A;  3HHY A;  3U6D A;  2LVN C;  3W0F A;  3U61 A;  1WIV A;  4L6V 6;  4X65 M;  4R3D A;  5EP4 A;  4GC5 A;  2JY8 A;  1XMQ M;  1N75 A;  2KW0 A;  4X64 M;  3LCV B;  2BNK A;  4LG2 A;  1FJG M;  1H6U A;  4I81 A;  2DAI A;  3FD9 A;  2K6B A;  1QDR A;  3KS8 A;  3R9X B;  4QHT A;  3KP1 E;  2Z4R A;  5FLX S;  1XB2 B;  4S12 A;  3SAV A;  2VII A;  1S3S A;  2K0B X;  2CHQ A;  1R7R A;  2R6F A;  4Y28 F;  3TPZ A;  4DR3 M;  5DYI A;  2DVW B;  2R4E A;  2UUC M;  3KOZ E;  4IBF A;  2OQ4 A;  1P3Q Q;  2Y0Q A;  4AW4 A;  3UMM A;  1R6B X;  3K1J A;  2M60 A;  2X8A A;  1X37 A;  3A42 A;  1OIZ A;  2QZ4 A;  2CFO A;  2K47 A;  4LRT A;  4AKI A;  2CP8 A;  2CWB A;  3KSX A;  3FE3 A;  2P5T A;  4LFC M;  4IJF A;  3GQ3 A;  3FTC A;  4LZZ A;  3HX3 A;  1T43 A;  4UN2 B;  1IBL M;  2VDB B;  4CGY B;  1NVM A;  2EJS A;  4LGY A;  3OTO M;  2EUC A;  2GNO A;  1NNJ A;  2QBY A;  2C96 A;  4L8R C;  4LF4 M;  4FWG A;  3U6O A;  4WP2 A;  1R2Y A;  2KHH A;  2X49 A;  2MRO B;  1OFH A;  2ZAM A;  1Z5B A;  3IG5 A;  4DR5 M;  1E9R A;  2FNA A;  4MGI E;  2KXE A;  3QYE A;  1Q39 A;  3HZJ A;  2JA2 A;  3VK7 A;  4AKG A;  2MR9 A;  1SXJ C;  3AKZ A;  2CRU A;  2VQF M;  3PFI A;  2DAG A;  3SYL A;  1TDH A;  2L7I A;  3HKP A;  4WW0 A;  3L26 A;  1SG9 A;  3MJ5 A;  3VK8 A;  2DXI A;  1OKS A;  1RU3 A;  2UXC M;  1G3I A;  1PGY A;  2QP9 X;  1NJG A;  2UXB M;  3Q8G A;  3E4R A;  3J2P B;  2XLJ A;  2R4J A;  5DFL A;  2XEP A;  3CF0 A;  4JI6 M;  5KPT A;  2JXN A;  2DAM A;  2DI0 A;  3QWL A;  3TWM A;  1ZAE A;  3GO8 A;  3U6P A;  1N32 M;  1Q3C A;  3J81 S;  4II7 A;  2WZJ A;  2R44 A;  3AL0 C;  1IXZ A;  3M7G A;  1HNW M;  4CJ6 A;  4CHT B;  1DGH A;  3HHX A;  1TR8 A;  3B89 A;  4LCB A;  4DV0 M;  3JR5 A;  2C99 A;  3B9P A;  4B08 A;  2HCB A;  1N33 M;  2NQ8 C;  5BR8 M;  3IEC A;  2OOB A;  5EP1 A;  2YFQ A;  5A2Q S;  1L1T A;  4JI3 M;  2O25 A;  4ZPX A;  1JQJ C;  3SMP A;  4A3V B;  4GEW A;  3HU2 A;  2Y0T A;  5IT9 S;  2L09 A;  3FUX A;  3V76 A;  4RNA A;  2MJ5 B;  3VLF B;  3PVS A;  5EP3 A;  3SC3 A;  4Z8X A;  3FRI A;  2DNA A;  2LTU A;  1QVR A;  5FTN A;  3U6E A;  1I4W A;  3LQR A;  3H4M A;  1DO0 A;  3NBX X;  3Q8X A;  1L1Z A;  1GJS A;  3KOW E;  3GLH B;  1KSF X;  5KQD A;  1WR1 B;  3K9P A;  3A45 A;  1XNR M;  1TGU A;  4MGZ E;  1J7K A;  1N36 M;  2N35 A;  4P16 A;  1VQ1 A;  1HJP A;  4IBC A;  3FUW A;  2WSC F;  3I4Y A;  3GQ5 A;  2GQF A;  3ZC7 B;  3LCU A;  4QOS A;  1K82 A;  4JI4 M;  1G71 A;  3KSJ A;  7CAT A;  4LJ8 A;  5ITY A;  3L27 A;  1XC8 A;  5FTL A;  4KO8 A;  1L2D A;  2F4V M;  5EJC A;  3DA1 A;  2LHG A;  3I04 M;  1DGB A;  4L78 A;  4PDI A;  2OOA A;  1PM5 A;  1QQW A;  3W68 A;  3U60 A;  4DBG B;  1D0M A;  4LFA M;  3B7Q A;  1GL6 A;  3HY5 A;  1MN3 A;  1SXJ E;  1ZMW A;  1XMO M;  3BOS A;  2R18 A;  3GRV A;  1A5T A;  1IQP A;  4D82 A;  1ZQ9 A;  3SAU A;  1IY0 A;  3J7A S;  5FTK A;  3U5Z B;  3GRU A;  3J7B A;  3R8F A;  1GKI A;  2CHV A;  3LQQ A;  3JAM S;  4B3R M;  1W5T A;  1NV8 A;  4LY6 A;  3GLI E;  1HNZ M;  5EXT A;  1YLA A;  5IRE B;  1G4A E;  1XXH E;  1R4G A;  1Q3B A;  3U6M A;  3K2L A;  4FVM A;  2UU9 M;  2YQZ A;  2E5L M;  1PJQ A;  2DWM A;  4DV6 M;  3GLI B;  1IN5 A;  1QAN A;  3FTD A;  2C5R A;  2BJV A;  3AV0 A;  4AZF A;  1KYI A;  1PJS A;  2D7E A;  4DV1 M;  4JI8 M;  1XXH B;  1Z59 A;  4MH0 E;  1JR3 D;  3AOE A;  3EIH A;  1PJI A;  1EE8 A;  1DGG A;  3B74 A;  3GQ4 A;  1ZMU A;  2WSE F;  1Y8G A;  3HU1 A;  3KW6 A;  1FNN A;  1JR3 A;  1ORY B;  1OFI A;  1QZE A;  2G3Q A;  3LVW A;  5FSW A;  3U6C A;  4LFB M;  4I8O A;  4MB7 A;  4NL4 H;  1NY5 A;  2LH0 A;  1OIP A;  4YHH M;  3K92 A;  3FTE A;  1XHB A;  3F92 A;  2DZO B;  3HJS A;  2ZTD A;  4DR7 M;  2H5X A;  3THG A;  3FTF A;  2O5R A;  5JI2 E;  4FCT A;  3VKG A;  3ZCB B;  3FYC A;  4I5S A;  4LF9 M;  2JZ0 A;  2KNV A;  4BBA A;  3KXE C;  1G41 A;  3FYD A;  2LWX A;  4B3S M;  4AG5 A;  4JYA M;  1Q02 A;  2YNM D;  3PXG A;  1QUS A;  5KO3 A;  2J7O A;  2Z7J A;  4Z6Y A;  5KPZ A;  1E32 A;  1HT2 E;  4F1I A;  1EIJ A;  4GHL A;  2AHM A;  3GRY A;  5KQ8 A;  3GLH A;  3KOY E;  3U60 B;  2WSF F;  4M9S A;  1GO5 A;  3L28 A;  4KOD A;  2A5Y B;  3NBI A;  3HHZ A;  2R0I A;  1IBK M;  3AFH A;  3GLF E;  3SAT A;  5E26 A;  2HWJ A;  2RGO A;  2M5Z A;  2ZTC A;  2FH0 A;  4FW9 A;  4IBE A;  4G4O A;  4B7H A;  1AIP C;  4X66 M;  4GHA A;  2G5G X;  3VFD A;  1N34 M;  1NHG C;  1QYR A;  4LJA A;  1WJ7 A;  3M6A A;  4R7G A;  3L2A A;  4GIP A;  1AUA A;  2QSF X;  2Z8Y M;  1R2Z A;  2R62 A;  1ZMV A;  2RRU A;  3E9S A;  3PNY A;  2LVP C;  1WGN A;  3K9O A;  4QOZ C;  5ITQ A;  2R65 A;  1MX0 A;  1YSY A;  3U5Z A;  2R45 A;  4GKK M;  1NSF A;  2H1R A;  2LVO C;  1TH2 A;  1HQY E;  3RFW A;  2B3T A;  2JY7 A;  5IWA M;  5C1B A;  3RE8 A;  4LJ7 A;  2D7H A;  2QCU A;  3J27 B;  1K3W A;  1NNU C;  2CEA A;  1QDT A;  2BJW A;  4BLC A;  1BVS A;  3M0E A;  3KVW A;  3GLI A;  2F5Q A;  4AKH A;  2LBC A;  1Z5C A;  4GKJ M;  4OVZ B;  1XXH A;  3B7Z A;  4IBD A;  1CUK A;  4JI7 M;  4FCW A;  3KOX E;  4GIT A;  4DV2 M;  1D0L A;  2DHY A;  1NHW C;  1DGF A;  2ZAN A;  2LVA A;  4XBO A;  4B7G A;  4G4R A;  3GPY A;  3E46 A;  4IBJ A;  3BXW A;  3T38 A;  3SHF A;  3NWL A;  1IM2 A;  2W82 A;  2MGW A;  3L29 A;  4GH9 A;  1XNQ M;  2CHG A;  5F3W A;  2XSZ A;  2ZBK B;  3AJI B;  3CF6 E;  4IJE A;  4LRS A;  2HKJ A;  2QPA A;  2ZM6 M;  2XZU A;  4R71 A;  4MM3 B;  3DFZ A;  2QNJ A;  3DOA A;  1DV0 A;  3WHL A;  4M0D A;  3U6L A;  4JI5 M;  4W5W A;  2O01 F; 
#chains in the Genus database with same CATH homology
 2CUZ A;  5BPV A;  4GRI A;  2LXE A;  1HT1 E;  4HLQ A;  5E6J A;  5EQT A;  3TE6 A;  2XF3 A;  1L2B A;  4PD2 A;  4IBI A;  1WXQ A;  3T1H M;  4B3M M;  3HGI A;  2R46 A;  2V1C A;  2ZAO A;  3EIE A;  2EO2 A;  4K0K M;  4YY3 M;  4TUW A;  4MGH A;  1HNX M;  4GC9 A;  3A46 A;  4G4Q A;  2KZS A;  4LJ6 A;  1E94 E;  4L16 A;  3FKE A;  5ITX E;  2HHH M;  3SYK A;  4DR6 M;  1SXJ B;  1NY6 A;  2XGN A;  4FWD A;  1J09 A;  4BB9 A;  1J5E M;  3PNV A;  1TDZ A;  4OU7 A;  3UZU A;  3U6S A;  2DHR A;  2UUB M;  2F5O A;  1TH4 A;  4I4L A;  2XFT A;  4LGM A;  2CE7 A;  4JI1 M;  3HHW A;  3GRR A;  2Y20 A;  1LV7 A;  2OPF A;  4NXM M;  3GPU A;  1IY1 A;  3AOE C;  4WUR A;  1IXS B;  1VDD A;  2F5N A;  3RGS A;  1G8P A;  1QAQ A;  3GP1 A;  2C9O A;  4G4N A;  4IBB A;  1W5S A;  4M9X A;  3WHK A;  1IN7 A;  4JI0 M;  3JR4 A;  1YUB A;  4OVZ A;  1IN6 A;  2KA6 B;  3ILK A;  5EP2 A;  3U6Q A;  5JI3 E;  3SHG B;  1T3T A;  2LNH C;  1E9S A;  4MGY E;  3T15 A;  3CTW B;  3SAW A;  3UJN A;  1NJF A;  2V6Z M;  3GLG B;  4PCZ A;  3GPX A;  2FOI C;  3W0L B;  1IXR C;  1XWI A;  2Q2E B;  2L6O A;  2XZF A;  1L8Q A;  2J7N A;  4LF6 M;  3RGP A;  4B7F A;  4LF8 M;  1Z6T A;  2RKO A;  4NOO B;  4CIS A;  2UXD M;  2DZN B;  3VDU A;  1HQC A;  4JXJ A;  4AG6 A;  4LJ9 A;  2C9C A;  4NRV A;  4NRW A;  3GLF B;  5C18 A;  2F5S A;  2KRK A;  1MU5 A;  5EXP A;  4AQY M;  3VDP A;  3HJQ A;  3FUV A;  5IZ7 D;  1IY2 A;  8CAT A;  4LF5 M;  4DV4 M;  4LZJ A;  1C1K A;  4D81 A;  4NXN M;  4IIW A;  2DWL A;  4JN6 A;  3KDS E;  1SXJ D;  3TL4 X;  2QEN A;  1G59 A;  3K8Z A;  3HJ8 A;  4QNR A;  2I7N A;  4RF0 A;  1SXJ A;  2CV2 A;  3DZD A;  3UK6 A;  3L25 A;  4M9Z A;  4MGK E;  1KFV A;  4HL4 A;  1IN8 A;  3J80 S;  5FTJ A;  5ITT A;  4B3T M;  5ITX A;  1OJL A;  3D8L A;  2C98 A;  2DWZ B;  3IG8 A;  2F5P A;  1DO2 A;  1IBM M;  2D7G A;  3D8B A;  5FTM A;  3SFZ A;  2KEB A;  3U61 B;  2I7P A;  2L7H A;  2KRU A;  5DYG A;  4LF7 M;  2DWN A;  3KP0 E;  4NSR A;  2XH9 A;  2RGH A;  5GKN A;  4QHS A;  4FD2 A;  1PJJ A;  2XSZ D;  3ZH9 B;  4NSO B;  2ERC A;  4AI6 A;  3SAR A;  4JI2 M;  3TWL A;  5DNY A;  1QZM A;  1I94 M;  1GL7 A;  4LJ5 A;  3UGJ A;  5LMU M;  4DUZ M;  3SMS A;  2CV0 A;  2Z3X A;  4REZ A;  3AOG A;  5H37 D;  4DUY M;  2X4A A;  4EIW A;  3HWS A;  5ITU A;  4M0W A;  2G8L A;  1D2N A;  2KZU A;  1YE9 A;  2Z4S A;  4FWH A;  4KLN A;  4RF1 A;  5ITR A;  4D80 A;  3GLG A;  4DR2 M;  4DV5 M;  4DR4 M;  3QAU A;  1GLN A;  3I4V A;  2UUA M;  1HR0 M;  4JV5 M;  4IBG A;  2XFS A;  3MK6 A;  4L15 A;  2FE8 A;  3I51 A;  3SAS A;  2QBY B;  4DV3 M;  2VQE M;  2YR0 A;  4IBK A;  3TWK A;  1N77 A;  4OX9 M;  2Y21 A;  4KHP M;  3KS4 A;  3GLF A;  2CV1 A;  2FFJ A;  3A98 B;  3HU3 A;  4QNM A;  5LMN M;  1IN4 A;  3FUU A;  1GVN A;  4OW0 A;  5EXX A;  3KFU G;  4DV7 M;  4ITQ A;  1QAM A;  3VKH A;  4G6Z A;  4DR1 M;  3FUT A;  3SBJ A;  3C58 A;  4GMQ A;  4LJ4 A;  1UM8 A;  1QAO A;  3GPP A;  4XGI A;  3T1Y M;  1TH3 A;  2EA0 A;  3LMM A;  4X62 M;  3MHV C;  3LVV A;  1Z5A A;  4FCV A;  4PDG A;  2V1U A;  3CF2 A;  3TQS A;  5KPR A;  1L2C A;  4PT5 A;  1DGH B;  5EXS A;  1N78 A;  1K3X A;  4L4U A;  2HL7 A;  3HHY A;  3U6D A;  3W0F A;  3U61 A;  4X65 M;  4R3D A;  5EP4 A;  4GC5 A;  1XMQ M;  1N75 A;  2KW0 A;  4X64 M;  2BNK A;  4LG2 A;  1FJG M;  1H6U A;  4I81 A;  3FD9 A;  3KS8 A;  3R9X B;  4QHT A;  3KP1 E;  2Z4R A;  5FLX S;  4S12 A;  3SAV A;  2VII A;  1S3S A;  3TPZ A;  2CHQ A;  1R7R A;  4DR3 M;  5DYI A;  2DVW B;  2R4E A;  2UUC M;  3KOZ E;  4IBF A;  2OQ4 A;  2Y0Q A;  4AW4 A;  3UMM A;  1R6B X;  3K1J A;  2M60 A;  2X8A A;  1X37 A;  3A42 A;  2QZ4 A;  2CFO A;  2K47 A;  4LRT A;  4AKI A;  3KSX A;  2P5T A;  4LFC M;  4IJF A;  3GQ3 A;  3FTC A;  4LZZ A;  1IBL M;  4CGY B;  1NVM A;  4LGY A;  3OTO M;  1NNJ A;  2EUC A;  2QBY A;  4L8R C;  2C96 A;  4LF4 M;  4FWG A;  3U6O A;  1R2Y A;  2X49 A;  1OFH A;  2ZAM A;  1Z5B A;  3IG5 A;  4DR5 M;  1E9R A;  2FNA A;  4MGI E;  2KXE A;  3VK7 A;  1Q39 A;  2JA2 A;  4AKG A;  1SXJ C;  3AKZ A;  2VQF M;  3PFI A;  3SYL A;  1TDH A;  2L7I A;  3HKP A;  4WW0 A;  3L26 A;  3MJ5 A;  3VK8 A;  2UXC M;  2DXI A;  1G3I A;  2QP9 X;  1NJG A;  2UXB M;  3E4R A;  3J2P B;  2XLJ A;  2R4J A;  2XEP A;  3CF0 A;  4JI6 M;  5KPT A;  3QWL A;  3U6P A;  1N32 M;  3TWM A;  1ZAE A;  3GO8 A;  1Q3C A;  3J81 S;  4II7 A;  3AL0 C;  1IXZ A;  3M7G A;  1HNW M;  4CHT B;  1DGH A;  3HHX A;  4LCB A;  4DV0 M;  3JR5 A;  2C99 A;  3B9P A;  4B08 A;  2HCB A;  1N33 M;  2NQ8 C;  5BR8 M;  1L1T A;  5EP1 A;  2YFQ A;  5A2Q S;  4JI3 M;  4ZPX A;  3SMP A;  1JQJ C;  4A3V B;  3HU2 A;  2Y0T A;  5IT9 S;  2L09 A;  3FUX A;  4RNA A;  3VLF B;  3PVS A;  5EP3 A;  3SC3 A;  4Z8X A;  1QVR A;  5FTN A;  3U6E A;  1I4W A;  3LQR A;  3H4M A;  1DO0 A;  1L1Z A;  3Q8X A;  3KOW E;  3GLH B;  1KSF X;  5KQD A;  3A45 A;  1XNR M;  1TGU A;  4MGZ E;  1J7K A;  1N36 M;  4P16 A;  4IBC A;  3FUW A;  3I4Y A;  3GQ5 A;  3ZC7 B;  4QOS A;  1K82 A;  4JI4 M;  3KSJ A;  7CAT A;  4LJ8 A;  5ITY A;  3L27 A;  1XC8 A;  5FTL A;  4KO8 A;  1L2D A;  2F4V M;  5EJC A;  3DA1 A;  1DGB A;  4L78 A;  4PDI A;  1PM5 A;  1QQW A;  3U60 A;  4LFA M;  1GL6 A;  1SXJ E;  1XMO M;  3BOS A;  3GRV A;  4D82 A;  1IQP A;  1ZQ9 A;  3SAU A;  1IY0 A;  3J7A S;  5FTK A;  3U5Z B;  3GRU A;  3J7B A;  3R8F A;  1GKI A;  2CHV A;  3LQQ A;  3JAM S;  4B3R M;  1W5T A;  4LY6 A;  1HNZ M;  5EXT A;  5IRE B;  3U6M A;  1G4A E;  1Q3B A;  3K2L A;  4FVM A;  2UU9 M;  2YQZ A;  2E5L M;  2DWM A;  4DV6 M;  3GLI B;  1IN5 A;  1QAN A;  3FTD A;  2C5R A;  2BJV A;  3AV0 A;  4AZF A;  1KYI A;  4DV1 M;  2D7E A;  4JI8 M;  1XXH B;  1Z59 A;  4MH0 E;  1JR3 D;  3AOE A;  3EIH A;  1PJI A;  1EE8 A;  1DGG A;  3GQ4 A;  3HU1 A;  3LVW A;  3KW6 A;  1FNN A;  1JR3 A;  1ORY B;  1OFI A;  3U6C A;  5FSW A;  4LFB M;  4I8O A;  4MB7 A;  4NL4 H;  1NY5 A;  2LH0 A;  4YHH M;  3K92 A;  3FTE A;  1XHB A;  2DZO B;  3HJS A;  4DR7 M;  3THG A;  3FTF A;  2O5R A;  5JI2 E;  4FCT A;  3VKG A;  3ZCB B;  3FYC A;  4I5S A;  4LF9 M;  4BBA A;  3KXE C;  1G41 A;  3FYD A;  2LWX A;  4B3S M;  4AG5 A;  4JYA M;  2YNM D;  3PXG A;  5KO3 A;  2J7O A;  2Z7J A;  4Z6Y A;  5KPZ A;  1E32 A;  1HT2 E;  4GHL A;  2AHM A;  3GRY A;  5KQ8 A;  3GLH A;  3KOY E;  3U60 B;  4M9S A;  3L28 A;  4KOD A;  2A5Y B;  3NBI A;  3HHZ A;  3SAT A;  1IBK M;  3AFH A;  5E26 A;  2RGO A;  2M5Z A;  4FW9 A;  4G4O A;  4IBE A;  4B7H A;  4X66 M;  4GHA A;  2G5G X;  3VFD A;  1N34 M;  1NHG C;  1QYR A;  4LJA A;  3M6A A;  4R7G A;  3L2A A;  4GIP A;  1R2Z A;  2R62 A;  3E9S A;  3PNY A;  4QOZ C;  5ITQ A;  2R65 A;  1MX0 A;  1YSY A;  3U5Z A;  2R45 A;  4GKK M;  1NSF A;  2H1R A;  1TH2 A;  1HQY E;  3RFW A;  5IWA M;  5C1B A;  3RE8 A;  4LJ7 A;  2D7H A;  2QCU A;  3J27 B;  1K3W A;  1NNU C;  2CEA A;  2BJW A;  4BLC A;  3M0E A;  3KVW A;  3GLI A;  2F5Q A;  4AKH A;  1Z5C A;  4GKJ M;  4OVZ B;  1XXH A;  4IBD A;  4JI7 M;  4FCW A;  3KOX E;  4GIT A;  4DV2 M;  1NHW C;  1DGF A;  2ZAN A;  4G4R A;  4XBO A;  4B7G A;  3GPY A;  4IBJ A;  3SHF A;  3T38 A;  3NWL A;  1IM2 A;  2W82 A;  3L29 A;  4GH9 A;  1XNQ M;  2CHG A;  5F3W A;  2XSZ A;  2ZBK B;  3CF6 E;  3AJI B;  4IJE A;  4LRS A;  2HKJ A;  2QPA A;  2ZM6 M;  2XZU A;  4MM3 B;  3DFZ A;  3DOA A;  3WHL A;  4M0D A;  3U6L A;  4JI5 M;  4W5W A;  2R18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...