1JB0F

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
b'DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPHLVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEIIIDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
molecule tags Photosynthesis
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 1jb0F00
4RKUF 3LW5F 4KT0F 4Y28F 1JB0F 5L8RF 2WSCF 4XK8F 2WSFF 2WSEF 4L6V6 2O01F
chains in the Genus database with same CATH superfamily
4IJFA 1N32M 1D0KA 2RGOA 1VDLA 1X37A 3QYBA 4RF0A 2R4JA 4DV7M 1C1KA 1Y8GA 1HR0M 2ZANA 2FNAA 2APLA 2LXEA 3B89A 2J7NA 2ZAOA 3F92A 3KVWA 5LMUM 4MGZE 4LZZA 4G6ZA 2YFQA 2D7HA 3HKPA 2R4EA 1J09A 3WHLA 4LF6M 1NJGA 1SG9A 4FWGA 2CHGA 4JI8M 3FUVA 2DAEA 4LJ4A 1G3IA 1Z5CA 1NHGC 3GQ3A 3W67A 3U6MA 1L2CA 1IXSA 3T38A 4XGIA 3VK7A 5KPZA 2EKKA 2XSZD 1JR3E 3LQRA 2LVNC 1OFHA 4QNMA 1XXHB 4OVZB 2QQ8A 4BBAA 2YR0A 3VK8A 3NBIA 4MGYE 4JI0M 1VEJA 2FH0A 2XSZA 2CEAA 2JY6B 4DV2M 3U61B 1T3TA 4AZFA 2GNOA 2LH0A 4WURA 4IBBA 3GLHE 3K2LA 1V92A 1XNQM 2M5ZA 2DKLA 4JYAM 1MU5A 4QHTA 3KSJA 4NL4H 3GRVA 4NXMM 2KA6B 2LVQD 1QUTA 2BWEA 4DV3M 1R5LA 1UFZA 1VQ1A 2K47A 4GRIA 4NXNM 3HZJA 4AG6A 1N33M 1EFUB 1WHCA 2Y0QA 4B08A 3J80S 1G8PA 4WW0A 2KRKA 1DO0A 2L4FA 3C9PA 4FCTA 2A5YB 4IBFA 3GLGA 2CHVA 4II7A 1GKIA 2JXNA 1NY6A 5DYIA 1L8QA 1XXHA 2JP7A 2DZLA 4MB7A 1IXRC 3GLFE 1VEGA 4HL4A 3FD9A 1YUBA 3VDPA 2AHMA 1DO2A 2R0IA 1E32A 4P17A 1JQJC 1TH2A 3HHXA 3KOYE 2XF3A 2E5LM 1XXHE 2CWBA 2X4AA 4I5SA 2DHYA 5C1BA 2JY5A 3PNYA 3GQ5A 1IY1A 1R2ZA 3CTWB 4I81A 1IY0A 2VIIA 2VDBB 2R18A 3D8BA 4M9SA 4AW4A 3LVVA 4OU7A 4W5WA 2QHOB 3GLGE 2UXDM 1L2DA 3KW6A 3DOAA 4DR7M 1YSYA 4LF5M 4LJ9A 3A98B 3RE8A 1C7YA 3U61A 8CATA 4OX9M 4D82A 3IECA 1OFIA 2QBYB 1GLNA 1HJPA 1PM5A 3H4MA 4B7GA 1NV8A 1ZAEA 5LMNM 1HT1E 4CISA 1A5TA 4AG5A 3IG5A 2JA2A 2K6BA 3AV0A 1DGBA 3EIHA 3AOGA 3HJQA 3JR4A 1PJIA 3HU1A 2L4EA 5EP3A 1JR3D 1HNWM 2X49A 2KXEA 5ITXE 2DZNB 2BJWA 2DZOB 4RF1A 1PJQA 3GLGB 1WIVA 4OW0A 4X64M 3SHGB 1GJTA 5EQTA 1IN4A 3THGA 5IWAM 3FTEA 1K3WA 4B3MM 1JR3A 4YY3M 1G59A 2F5SA 1AIPC 1QAQA 2UU9M 3AJIB 4PD2A 3SMSA 3GO8A 1TDZA 2RRUA 2UXCM 2V1UA 2CFOA 3AL0C 3L29A 4PDGA 3PNVA 1YE9A 1TH3A 2I7PA 3TPZA 4NRVA 4BLCA 1GO5A 4KO8A 2OO9A 2RGHA 4GITA 4XBOA 2FOIC 3SATA 1BVSA 3IHPA 3E9SA 3U60B 3JR5A 4GHLA 4DR5M 4KODA 2UUBM 2CUZA 3B74A 2JY8A 3BXWA 3I01M 1HQCA 3SYKA 2CV1A 3FYCA 4LRTA 4FD2A 5GKNA 1KYIA 2CHQA 2UUCM 1NSFA 1WR1B 1TGUA 4R7GA 1MJGM 2NQ8C 4LJ7A 3FUTA 3MK6A 3LQQA 2DAMA 4TUWA 2EJSA 2OOBA 3SBJA 1S3SA 4FWHA 3OTOM 4DUZM 3RFWA 2ZBKB 4MGKE 4I8OA 1XB2B 3FKEA 4LFCM 1J5EM 3T6PA 3GPPA 2LHGA 2CV0A 3ZH9B 1V33A 2FS1A 2LVPC 5KPTA 1Q3BA 1XWIA 3PFIA 4GH9A 5EP2A 4G4RA 2D7EA 1H6UA 1QYRA 2DXIA 2XZUA 1QUSA 1Z5AA 4G4QA 4IBEA 4AI6A 1T6OA 2DAIA 2KZSA 2C9OA 3ILKA 2KHHA 4LF9M 2DENA 3KS8A 5ITXA 1DGFA 1OJLA 2CE7A 2DNAA 2LTUA 3DZDA 1AUAA 4FVMA 5JI3E 2HHHM 1EE8A 3LVWA 3KFUG 4B7HA 4DV1M 1WGNA 2YNMD 3D8LA 4LGMA 2R62A 1K3XA 4ZPXA 1OTRA 4FW9A 3I4VA 1TDHA 1XMQM 3HHYA 4JI6M 3CF2A 3GPUA 1E94E 4DR4M 3BOSA 5EXPA 1PJTA 1HNXM 4L15A 4AKHA 3K92A 2O5RA 4RKUF 1PJJA 3B7QA 4IBKA 5FTNA 3TWKA 1IBKM 5EXXA 3IG8A 2R44A 2FFJA 1MN3A 4G3OA 4AQYM 4S12A 5E6JA 3TL4X 1N77A 1NVMA 1HNZM 4X66M 2HL7A 4B3SM 1IN7A 1LV7A 1UM8A 3FUWA 3B9PA 3QYEA 4KLNA 5EP4A 2ZTDA 3T1YM 4IJEA 2JZ0A 2KDLA 4L8RC 2QCUA 4M9ZA 3A42A 2JZ1A 4LY6A 4MGHA 2F5QA 4AKGA 3K9OA 3U60A 4JI7M 4PCZA 1PRBA 1R4GA 2F5OA 4GKJM 3LW5F 3KOXE 4F1IA 1QAMA 2HKJA 4DV6M 4M9XA 3Q8XA 3C3EA 3SAUA 4NSRA 4M0WA 1L1ZA 1E9SA 2G8LA 3HHWA 1VEKA 1L2BA 3GQ4A 1OAIA 4FWDA 1WGLA 2R65A 3DFZA 1Z5BA 2UUAM 2F4VM 5FTKA 2EO2A 1QVRA 3MJ5A 3ZC7B 2C99A 4NOOB 4WP2A 5ITUA 4ITQA 3L2AA 4JI2M 4JI4M 1IFYA 1TTEA 2VF8A 3SMPA 2KZUA 3FRHA 4B3RM 5ITYA 1R2YA 1DGGA 1MX0A 4LJ8A 4RNAA 1NJFA 3L27A 3I51A 1SXJD 2Z8YM 2F5NA 4ANRA 1IY2A 3U6DA 3J81S 1R6BX 1HT2E 3Q8GA 3RGPA 1HQYE 2OPFA 2DWNA 5IZ7D 4G4NA 3SAWA 2QENA 2QPAA 4HLQA 3U6QA 1OAOC 2C98A 3EIEA 4D80A 5ITRA 5H37D 3KXEC 4L78A 4AKIA 2Z3XA 3HGIA 3NWLA 4DR1M 4LG2A 2KRUA 1LTMA 3J2PB 5IREB 3I04M 1V34A 5L8RF 3HHZA 1QQWA 3UZUA 3QAUA 4LF7M 3FTFA 1R7RA 3M7GA 2QNJA 4I4LA 4JN6A 4LF4M 2K0BX 2MGWA 1JB0F 2WZJA 3L28A 3J27B 1OIPA 3GLHB 3NBXX 3K8ZA 4IBGA 1CUKA 1G71A 4DUYM 2C5RA 3U6EA 2JNHA 2K9DA 3U6PA 5DNYA 5KPRA 3KP1E 4JI3M 1W5TA 2XH9A 1QZEA 2HAKA 1IXZA 1P3QQ 1D0LA 3TWLA 3CF0A 4QNRA 3LCVB 3KSXA 3GRRA 3T15A 2ZM6M 1ZMWA 2QSFX 4B3TM 1G41A 1NY5A 1Q02A 3HX3A 4LCBA 2Y21A 1TF0B 4X62M 4CJ6A 3J7AS 3C58A 3CGWA 5EP1A 3UK6A 2N35A 4BB9A 3GLIE 4LRSA 3VDUA 5C18A 3GLIA 3U6SA 3T1HM 3SFZA 1XMOM 5KQDA 4A3VB 1QDTA 1IN5A 3R9XB 4Z6YA 5F3WA 2DWMA 3FUXA 4PT5A 2M60A 4Y28F 3DA1A 1I94M 3H4JA 1VDDA 4GIPA 1GABA 2DWZB 2HCBA 3KOZE 2V6ZM 1GVNA 2LHCA 3WHKA 4LJAA 5KQ8A 3TQSA 1ZMUA 1ZMVA 2XLJA 1N75A 3GPYA 2H5XA 1ZV1A 4LJ6A 3W0FA 3A45A 2JWSA 3GPXA 3FYDA 2MJ5B 3M0EA 4P16A 1OKSA 2ERCA 4F2LA 3E46A 4FCWA 3PXGA 3V76A 5ITTA 2DAGA 1W5SA 1IM2A 3W68A 1IBMM 2L2DA 1DGHB 3FUUA 4DBGB 3UMMA 3VKGA 5FTLA 4JXJA 1SXJC 5EJCA 4GC5A 2Z4RA 5BR8M 1Z59A 2R6FA 3B7NA 1KFVA 5E26A 3E4RA 4D81A 3HU2A 4GKKM 3TE6A 4DV0M 4QOSA 1NNUC 4HEOA 4XK8F 1IN8A 2WSFF 4B7FA 1D2NA 4GC9A 4NC6A 4QHSA 2XGNA 2LBCA 3RGSA 3HWSA 4DR2M 3UJNA 1QDRA 2Z7JA 4JI5M 1SXJE 2EKFA 1TR8A 4GMQA 4IBIA 4PDIA 3U5ZA 3AOEA 4GEWA 4IBCA 7CATA 4G4OA 1FJGM 5A2QS 3W0LB 1L1TA 2JY7A 2B3TA 4IBDA 4R3DA 1NO1A 3AKZA 2QBYA 3E21A 4FCVA 2KEBA 3KS4A 1EIJA 2UXBM 4LGYA 4QOZC 1TH4A 2LVAA 5JI2E 3HJSA 4CGYB 1VG5A 2BJVA 1GJSA 1N34M 3QWLA 4L6V6 1D0MA 2GQFA 2LVOC 4LF8M 2DHRA 1RU3A 2V1CA 5DFLA 3L25A 4MGIE 2Q2EB 2BWBA 2LNHC 2MH8A 3VFDA 1PJSA 3SYLA 1SXJA 5BPVA 1IQPA 2Y0TA 4DR3M 2JUJA 1OIZA 2DAKA 2QP9X 2EUCA 5FTJA 1NHWC 1ORYB 3KOWE 5EXTA 3ZCBB 4DV4M 5FSWA 3GP1A 4EIWA 3UGJA 4DV5M 1OQYA 1QAOA 1ZQ9A 3MMPA 3VLFB 1F4IA 1Q3CA 2L6OA 3LCUA 1FNNA 2R46A 4MH0E 2VQFM 2X8AA 4L16A 1GL6A 4M0DA 1Q39A 2KW0A 2I7NA 2CV2A 3AFHA 1T43A 2KNAA 3HY5A 4UN2B 3L26A 3FTDA 1KSFX 2MR9A 3CF6E 2L09A 1QZMA 2LWXA 2G5GX 1I4WA 4GHAA 4X65M 2ZAMA 2HWJA 2OQ4A 3GLFB 2CP8A 1WJ7A 3K9PA 5DYGA 3GRUA 1E9RA 1PGYA 3KDSE 4CIZA 2G3QA 3R8FA 2F5PA 2KNVA 3A46A 3U6LA 4YHHM 4KT0F 1IBLM 3SAVA 1K82A 1NV9A 2BNKA 3J7BA 2KNZA 2OOAA 3K1JA 1J7KA 3U6CA 3AOEC 1DGHA 2CRUA 1XHBA 2W82A 3TWMA 4NRWA 3B7ZA 3SC3A 4K0KM 3PVSA 4Z8XA 3VKHA 5IT9S 3I4YA 2P5TA 4JI1M 3LMMA 1DV0A 3FE3A 4L4UA 2EA0A 3ZQJA 2ZTCA 3MHVC 4NSOB 2VF7A 3FTCA 1N36M 1NNJA 2C9CA 1IXSB 2J7OA 5FLXS 3GRYA 1N78A 4LFAM 4IIWA 5ITQA 1WXQA 1GL7A 1XC8A 2O01F 2XFTA 1SXJB 1YLAA 3GLHA 2DWLA 3SASA 2R45A 4DR6M 3U6OA 2L7IA 5EXSA 3BBZA 5KO3A 3SHFA 2XFSA 4KHPM 2YQZA 3KP0E 2RKOA 3JAMS 1Z6TA 4R71A 2C96A 4MM3B 2H1RA 2Z4SA 3SARA 2WSEF 3C3DA 4LFBM 2WSCF 3GLFA 2QZ4A 3HJ8A 3GLIB 4LZJA 1IN6A 4CHTB 2XZFA 2VQEM 2MROB 1G4AE 2J5YA 2DI0A 3HU3A 1XNRM 2DVWB 4LJ5A 2D7GA 2O25A 5FTMA 3M6AA 2FE8A 4REZA 2XEPA 2Y20A 4IBJA 4OVZA 2L7HA 3FRIA 1QANA 3U5ZB 4Q7JA 4JV5M
chains in the Genus database with same CATH topology
4RKUF 3LW5F 4KT0F 4Y28F 1JB0F 5L8RF 2WSCF 4XK8F 2WSFF 2WSEF 4L6V6 2O01F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU F;  3LW5 F;  4KT0 F;  4Y28 F;  1JB0 F;  5L8R F;  2WSC F;  4XK8 F;  2WSF F;  2WSE F;  4L6V 6;  2O01 F; 
#chains in the Genus database with same CATH topology
 4IJF A;  1N32 M;  1D0K A;  2RGO A;  1VDL A;  1X37 A;  3QYB A;  4RF0 A;  2R4J A;  4DV7 M;  1C1K A;  1Y8G A;  1HR0 M;  2ZAN A;  2FNA A;  2APL A;  2LXE A;  3B89 A;  2J7N A;  2ZAO A;  3F92 A;  3KVW A;  5LMU M;  4MGZ E;  4LZZ A;  4G6Z A;  2YFQ A;  2D7H A;  3HKP A;  2R4E A;  1J09 A;  3WHL A;  4LF6 M;  1NJG A;  1SG9 A;  4FWG A;  2CHG A;  4JI8 M;  3FUV A;  2DAE A;  4LJ4 A;  1G3I A;  1Z5C A;  1NHG C;  3GQ3 A;  3W67 A;  3U6M A;  1L2C A;  1IXS A;  3T38 A;  4XGI A;  3VK7 A;  5KPZ A;  2EKK A;  2XSZ D;  1JR3 E;  3LQR A;  2LVN C;  1OFH A;  4QNM A;  1XXH B;  4OVZ B;  2QQ8 A;  4BBA A;  2YR0 A;  3VK8 A;  3NBI A;  4MGY E;  4JI0 M;  1VEJ A;  2FH0 A;  2XSZ A;  2CEA A;  2JY6 B;  4DV2 M;  3U61 B;  1T3T A;  4AZF A;  2GNO A;  2LH0 A;  4WUR A;  4IBB A;  3GLH E;  3K2L A;  1V92 A;  1XNQ M;  2M5Z A;  2DKL A;  4JYA M;  1MU5 A;  4QHT A;  3KSJ A;  4NL4 H;  3GRV A;  4NXM M;  2KA6 B;  2LVQ D;  1QUT A;  2BWE A;  4DV3 M;  1R5L A;  1UFZ A;  1VQ1 A;  2K47 A;  4GRI A;  4NXN M;  3HZJ A;  4AG6 A;  1N33 M;  1EFU B;  1WHC A;  2Y0Q A;  4B08 A;  3J80 S;  1G8P A;  4WW0 A;  2KRK A;  1DO0 A;  2L4F A;  3C9P A;  4FCT A;  2A5Y B;  4IBF A;  3GLG A;  2CHV A;  4II7 A;  1GKI A;  2JXN A;  1NY6 A;  5DYI A;  1L8Q A;  1XXH A;  2JP7 A;  2DZL A;  4MB7 A;  1IXR C;  3GLF E;  1VEG A;  4HL4 A;  3FD9 A;  1YUB A;  3VDP A;  2AHM A;  1DO2 A;  2R0I A;  1E32 A;  4P17 A;  1JQJ C;  1TH2 A;  3HHX A;  3KOY E;  2XF3 A;  2E5L M;  1XXH E;  2CWB A;  2X4A A;  4I5S A;  2DHY A;  5C1B A;  2JY5 A;  3PNY A;  3GQ5 A;  1IY1 A;  1R2Z A;  3CTW B;  4I81 A;  1IY0 A;  2VII A;  2VDB B;  2R18 A;  3D8B A;  4M9S A;  4AW4 A;  3LVV A;  4OU7 A;  4W5W A;  2QHO B;  3GLG E;  2UXD M;  1L2D A;  3KW6 A;  3DOA A;  4DR7 M;  1YSY A;  4LF5 M;  4LJ9 A;  3A98 B;  3RE8 A;  1C7Y A;  3U61 A;  8CAT A;  4OX9 M;  4D82 A;  3IEC A;  1OFI A;  2QBY B;  1GLN A;  1HJP A;  1PM5 A;  3H4M A;  4B7G A;  1NV8 A;  1ZAE A;  5LMN M;  1HT1 E;  4CIS A;  1A5T A;  4AG5 A;  3IG5 A;  2JA2 A;  2K6B A;  3AV0 A;  1DGB A;  3EIH A;  3AOG A;  3HJQ A;  3JR4 A;  1PJI A;  3HU1 A;  2L4E A;  5EP3 A;  1JR3 D;  1HNW M;  2X49 A;  2KXE A;  5ITX E;  2DZN B;  2BJW A;  2DZO B;  4RF1 A;  1PJQ A;  3GLG B;  1WIV A;  4OW0 A;  4X64 M;  3SHG B;  1GJT A;  5EQT A;  1IN4 A;  3THG A;  5IWA M;  3FTE A;  1K3W A;  4B3M M;  1JR3 A;  4YY3 M;  1G59 A;  2F5S A;  1AIP C;  1QAQ A;  2UU9 M;  3AJI B;  4PD2 A;  3SMS A;  3GO8 A;  1TDZ A;  2RRU A;  2UXC M;  2V1U A;  2CFO A;  3AL0 C;  3L29 A;  4PDG A;  3PNV A;  1YE9 A;  1TH3 A;  2I7P A;  3TPZ A;  4NRV A;  4BLC A;  1GO5 A;  4KO8 A;  2OO9 A;  2RGH A;  4GIT A;  4XBO A;  2FOI C;  3SAT A;  1BVS A;  3IHP A;  3E9S A;  3U60 B;  3JR5 A;  4GHL A;  4DR5 M;  4KOD A;  2UUB M;  2CUZ A;  3B74 A;  2JY8 A;  3BXW A;  3I01 M;  1HQC A;  3SYK A;  2CV1 A;  3FYC A;  4LRT A;  4FD2 A;  5GKN A;  1KYI A;  2CHQ A;  2UUC M;  1NSF A;  1WR1 B;  1TGU A;  4R7G A;  1MJG M;  2NQ8 C;  4LJ7 A;  3FUT A;  3MK6 A;  3LQQ A;  2DAM A;  4TUW A;  2EJS A;  2OOB A;  3SBJ A;  1S3S A;  4FWH A;  3OTO M;  4DUZ M;  3RFW A;  2ZBK B;  4MGK E;  4I8O A;  1XB2 B;  3FKE A;  4LFC M;  1J5E M;  3T6P A;  3GPP A;  2LHG A;  2CV0 A;  3ZH9 B;  1V33 A;  2FS1 A;  2LVP C;  5KPT A;  1Q3B A;  1XWI A;  3PFI A;  4GH9 A;  5EP2 A;  4G4R A;  2D7E A;  1H6U A;  1QYR A;  2DXI A;  2XZU A;  1QUS A;  1Z5A A;  4G4Q A;  4IBE A;  4AI6 A;  1T6O A;  2DAI A;  2KZS A;  2C9O A;  3ILK A;  2KHH A;  4LF9 M;  2DEN A;  3KS8 A;  5ITX A;  1DGF A;  1OJL A;  2CE7 A;  2DNA A;  2LTU A;  3DZD A;  1AUA A;  4FVM A;  5JI3 E;  2HHH M;  1EE8 A;  3LVW A;  3KFU G;  4B7H A;  4DV1 M;  1WGN A;  2YNM D;  3D8L A;  4LGM A;  2R62 A;  1K3X A;  4ZPX A;  1OTR A;  4FW9 A;  3I4V A;  1TDH A;  1XMQ M;  3HHY A;  4JI6 M;  3CF2 A;  3GPU A;  1E94 E;  4DR4 M;  3BOS A;  5EXP A;  1PJT A;  1HNX M;  4L15 A;  4AKH A;  3K92 A;  2O5R A;  4RKU F;  1PJJ A;  3B7Q A;  4IBK A;  5FTN A;  3TWK A;  1IBK M;  5EXX A;  3IG8 A;  2R44 A;  2FFJ A;  1MN3 A;  4G3O A;  4AQY M;  4S12 A;  5E6J A;  3TL4 X;  1N77 A;  1NVM A;  1HNZ M;  4X66 M;  2HL7 A;  4B3S M;  1IN7 A;  1LV7 A;  1UM8 A;  3FUW A;  3B9P A;  3QYE A;  4KLN A;  5EP4 A;  2ZTD A;  3T1Y M;  4IJE A;  2JZ0 A;  2KDL A;  4L8R C;  2QCU A;  4M9Z A;  3A42 A;  2JZ1 A;  4LY6 A;  4MGH A;  2F5Q A;  4AKG A;  3K9O A;  3U60 A;  4JI7 M;  4PCZ A;  1PRB A;  1R4G A;  2F5O A;  4GKJ M;  3LW5 F;  3KOX E;  4F1I A;  1QAM A;  2HKJ A;  4DV6 M;  4M9X A;  3Q8X A;  3C3E A;  3SAU A;  4NSR A;  4M0W A;  1L1Z A;  1E9S A;  2G8L A;  3HHW A;  1VEK A;  1L2B A;  3GQ4 A;  1OAI A;  4FWD A;  1WGL A;  2R65 A;  3DFZ A;  1Z5B A;  2UUA M;  2F4V M;  5FTK A;  2EO2 A;  1QVR A;  3MJ5 A;  3ZC7 B;  2C99 A;  4NOO B;  4WP2 A;  5ITU A;  4ITQ A;  3L2A A;  4JI2 M;  4JI4 M;  1IFY A;  1TTE A;  2VF8 A;  3SMP A;  2KZU A;  3FRH A;  4B3R M;  5ITY A;  1R2Y A;  1DGG A;  1MX0 A;  4LJ8 A;  4RNA A;  1NJF A;  3L27 A;  3I51 A;  1SXJ D;  2Z8Y M;  2F5N A;  4ANR A;  1IY2 A;  3U6D A;  3J81 S;  1R6B X;  1HT2 E;  3Q8G A;  3RGP A;  1HQY E;  2OPF A;  2DWN A;  5IZ7 D;  4G4N A;  3SAW A;  2QEN A;  2QPA A;  4HLQ A;  3U6Q A;  1OAO C;  2C98 A;  3EIE A;  4D80 A;  5ITR A;  5H37 D;  3KXE C;  4L78 A;  4AKI A;  2Z3X A;  3HGI A;  3NWL A;  4DR1 M;  4LG2 A;  2KRU A;  1LTM A;  3J2P B;  5IRE B;  3I04 M;  1V34 A;  5L8R F;  3HHZ A;  1QQW A;  3UZU A;  3QAU A;  4LF7 M;  3FTF A;  1R7R A;  3M7G A;  2QNJ A;  4I4L A;  4JN6 A;  4LF4 M;  2K0B X;  2MGW A;  1JB0 F;  2WZJ A;  3L28 A;  3J27 B;  1OIP A;  3GLH B;  3NBX X;  3K8Z A;  4IBG A;  1CUK A;  1G71 A;  4DUY M;  2C5R A;  3U6E A;  2JNH A;  2K9D A;  3U6P A;  5DNY A;  5KPR A;  3KP1 E;  4JI3 M;  1W5T A;  2XH9 A;  1QZE A;  2HAK A;  1IXZ A;  1P3Q Q;  1D0L A;  3TWL A;  3CF0 A;  4QNR A;  3LCV B;  3KSX A;  3GRR A;  3T15 A;  2ZM6 M;  1ZMW A;  2QSF X;  4B3T M;  1G41 A;  1NY5 A;  1Q02 A;  3HX3 A;  4LCB A;  2Y21 A;  1TF0 B;  4X62 M;  4CJ6 A;  3J7A S;  3C58 A;  3CGW A;  5EP1 A;  3UK6 A;  2N35 A;  4BB9 A;  3GLI E;  4LRS A;  3VDU A;  5C18 A;  3GLI A;  3U6S A;  3T1H M;  3SFZ A;  1XMO M;  5KQD A;  4A3V B;  1QDT A;  1IN5 A;  3R9X B;  4Z6Y A;  5F3W A;  2DWM A;  3FUX A;  4PT5 A;  2M60 A;  4Y28 F;  3DA1 A;  1I94 M;  3H4J A;  1VDD A;  4GIP A;  1GAB A;  2DWZ B;  2HCB A;  3KOZ E;  2V6Z M;  1GVN A;  2LHC A;  3WHK A;  4LJA A;  5KQ8 A;  3TQS A;  1ZMU A;  1ZMV A;  2XLJ A;  1N75 A;  3GPY A;  2H5X A;  1ZV1 A;  4LJ6 A;  3W0F A;  3A45 A;  2JWS A;  3GPX A;  3FYD A;  2MJ5 B;  3M0E A;  4P16 A;  1OKS A;  2ERC A;  4F2L A;  3E46 A;  4FCW A;  3PXG A;  3V76 A;  5ITT A;  2DAG A;  1W5S A;  1IM2 A;  3W68 A;  1IBM M;  2L2D A;  1DGH B;  3FUU A;  4DBG B;  3UMM A;  3VKG A;  5FTL A;  4JXJ A;  1SXJ C;  5EJC A;  4GC5 A;  2Z4R A;  5BR8 M;  1Z59 A;  2R6F A;  3B7N A;  1KFV A;  5E26 A;  3E4R A;  4D81 A;  3HU2 A;  4GKK M;  3TE6 A;  4DV0 M;  4QOS A;  1NNU C;  4HEO A;  4XK8 F;  1IN8 A;  2WSF F;  4B7F A;  1D2N A;  4GC9 A;  4NC6 A;  4QHS A;  2XGN A;  2LBC A;  3RGS A;  3HWS A;  4DR2 M;  3UJN A;  1QDR A;  2Z7J A;  4JI5 M;  1SXJ E;  2EKF A;  1TR8 A;  4GMQ A;  4IBI A;  4PDI A;  3U5Z A;  3AOE A;  4GEW A;  4IBC A;  7CAT A;  4G4O A;  1FJG M;  5A2Q S;  3W0L B;  1L1T A;  2JY7 A;  2B3T A;  4IBD A;  4R3D A;  1NO1 A;  3AKZ A;  2QBY A;  3E21 A;  4FCV A;  2KEB A;  3KS4 A;  1EIJ A;  2UXB M;  4LGY A;  4QOZ C;  1TH4 A;  2LVA A;  5JI2 E;  3HJS A;  4CGY B;  1VG5 A;  2BJV A;  1GJS A;  1N34 M;  3QWL A;  4L6V 6;  1D0M A;  2GQF A;  2LVO C;  4LF8 M;  2DHR A;  1RU3 A;  2V1C A;  5DFL A;  3L25 A;  4MGI E;  2Q2E B;  2BWB A;  2LNH C;  2MH8 A;  3VFD A;  1PJS A;  3SYL A;  1SXJ A;  5BPV A;  1IQP A;  2Y0T A;  4DR3 M;  2JUJ A;  1OIZ A;  2DAK A;  2QP9 X;  2EUC A;  5FTJ A;  1NHW C;  1ORY B;  3KOW E;  5EXT A;  3ZCB B;  4DV4 M;  5FSW A;  3GP1 A;  4EIW A;  3UGJ A;  4DV5 M;  1OQY A;  1QAO A;  1ZQ9 A;  3MMP A;  3VLF B;  1F4I A;  1Q3C A;  2L6O A;  3LCU A;  1FNN A;  2R46 A;  4MH0 E;  2VQF M;  2X8A A;  4L16 A;  1GL6 A;  4M0D A;  1Q39 A;  2KW0 A;  2I7N A;  2CV2 A;  3AFH A;  1T43 A;  2KNA A;  3HY5 A;  4UN2 B;  3L26 A;  3FTD A;  1KSF X;  2MR9 A;  3CF6 E;  2L09 A;  1QZM A;  2LWX A;  2G5G X;  1I4W A;  4GHA A;  4X65 M;  2ZAM A;  2HWJ A;  2OQ4 A;  3GLF B;  2CP8 A;  1WJ7 A;  3K9P A;  5DYG A;  3GRU A;  1E9R A;  1PGY A;  3KDS E;  4CIZ A;  2G3Q A;  3R8F A;  2F5P A;  2KNV A;  3A46 A;  3U6L A;  4YHH M;  4KT0 F;  1IBL M;  3SAV A;  1K82 A;  1NV9 A;  2BNK A;  3J7B A;  2KNZ A;  2OOA A;  3K1J A;  1J7K A;  3U6C A;  3AOE C;  1DGH A;  2CRU A;  1XHB A;  2W82 A;  3TWM A;  4NRW A;  3B7Z A;  3SC3 A;  4K0K M;  3PVS A;  4Z8X A;  3VKH A;  5IT9 S;  3I4Y A;  2P5T A;  4JI1 M;  3LMM A;  1DV0 A;  3FE3 A;  4L4U A;  2EA0 A;  3ZQJ A;  2ZTC A;  3MHV C;  4NSO B;  2VF7 A;  3FTC A;  1N36 M;  1NNJ A;  2C9C A;  1IXS B;  2J7O A;  5FLX S;  3GRY A;  1N78 A;  4LFA M;  4IIW A;  5ITQ A;  1WXQ A;  1GL7 A;  1XC8 A;  2O01 F;  2XFT A;  1SXJ B;  1YLA A;  3GLH A;  2DWL A;  3SAS A;  2R45 A;  4DR6 M;  3U6O A;  2L7I A;  5EXS A;  3BBZ A;  5KO3 A;  3SHF A;  2XFS A;  4KHP M;  2YQZ A;  3KP0 E;  2RKO A;  3JAM S;  1Z6T A;  4R71 A;  2C96 A;  4MM3 B;  2H1R A;  2Z4S A;  3SAR A;  2WSE F;  3C3D A;  4LFB M;  2WSC F;  3GLF A;  2QZ4 A;  3HJ8 A;  3GLI B;  4LZJ A;  1IN6 A;  4CHT B;  2XZF A;  2VQE M;  2MRO B;  1G4A E;  2J5Y A;  2DI0 A;  3HU3 A;  1XNR M;  2DVW B;  4LJ5 A;  2D7G A;  2O25 A;  5FTM A;  3M6A A;  2FE8 A;  4REZ A;  2XEP A;  2Y20 A;  4IBJ A;  4OVZ A;  2L7H A;  3FRI A;  1QAN A;  3U5Z B;  4Q7J A;  4JV5 M; 
#chains in the Genus database with same CATH homology
 4RKU F;  3LW5 F;  4KT0 F;  4Y28 F;  1JB0 F;  5L8R F;  2WSC F;  4XK8 F;  2WSF F;  2WSE F;  4L6V 6;  2O01 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...