1JB0F

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPHLVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEIIIDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
molecule tags Photosynthesis
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 1jb0F00
1JB0F 4RKUF 4Y28F 3LW5F 4L6V6 4XK8F 2WSCF 2WSEF 2O01F 2WSFF 4KT0F 5L8RF
chains in the Genus database with same CATH superfamily
2G5GX 1K3WA 3KW6A 3LVVA 3VFDA 1G41A 2OOAA 4M9XA 5DFLA 1NNUC 1EE8A 3TWKA 1C7YA 1SXJD 4GIPA 3GPUA 5EP2A 4L6V6 2BNKA 5KPTA 3E4RA 5LMUM 1T43A 3CF6E 2CWBA 1WR1B 5EXTA 4DV2M 4WW0A 2FE8A 3L27A 3J27B 4ZPXA 2DZNB 2K6BA 1QAQA 4AKHA 4LJ8A 4GC9A 2YFQA 3VDPA 3U61B 3KP1E 3L28A 4IBKA 2L7IA 2EA0A 3NBIA 1IBLM 1S3SA 4LJAA 2FS1A 1G71A 4NL4H 1G3IA 1NJGA 3SHFA 2DAMA 3FYCA 3J7BA 3KDSE 4L15A 3GLGA 1Q02A 3H4JA 3W68A 1WIVA 3FRHA 3R9XB 1EIJA 3WHLA 1PJJA 4M9SA 3V76A 2EUCA 3LCUA 3GLIB 3VK8A 2I7PA 3NBXX 3H4MA 1IXZA 3SYKA 1ZMUA 1OKSA 2FH0A 4KT0F 3HHWA 1TF0B 2B3TA 4R3DA 4DV1M 5ITUA 3FE3A 3U6QA 1NY5A 2QZ4A 2Z4SA 2KHHA 4MGIE 4JV5M 4LZZA 1WXQA 4JI7M 3GLFE 3B7QA 4G3OA 4IBCA 1L2BA 2DKLA 3MK6A 3QAUA 3L29A 3GPXA 4JI5M 2Y0QA 3I04M 1IXSA 3KS4A 4LY6A 3GLHB 4Z6YA 1YUBA 3ZCBB 3VLFB 4P17A 2V6ZM 5EXXA 3C3DA 2O25A 2JP7A 2DZLA 3SAVA 2L4EA 4GKKM 3KVWA 1JQJC 2MR9A 1GJTA 1E94E 3A98B 2A5YB 2GNOA 4D82A 2F5NA 3Q8GA 4IBJA 3AOEC 2KZUA 3T15A 1NO1A 3GLHE 1T3TA 4L78A 1NV9A 2LVAA 3CTWB 3U6DA 2ZTCA 3FKEA 5IT9S 4DR1M 1QDRA 1QQWA 2G3QA 3PNVA 2JY8A 4KODA 5FTLA 4JI4M 1QYRA 3B89A 4FD2A 4AG5A 3U60A 1XNQM 3IG5A 2RGOA 4CGYB 1GL6A 1Q39A 3T38A 4PDIA 3HHZA 2JUJA 5LMNM 3VK7A 5EQTA 2UUBM 3FTDA 3K2LA 2QCUA 5ITQA 3T1YM 1N34M 1YSYA 2GQFA 3VKHA 1R2YA 3U6CA 1N77A 4LF4M 2R0IA 4LJ7A 5BPVA 2DXIA 2K47A 5BR8M 5KPZA 3U6MA 3GRVA 1IBKM 2JZ0A 1MN3A 2JY7A 4AKIA 1HR0M 3J81S 3D8BA 3J2PB 4GMQA 3WHKA 1XXHB 4GEWA 8CATA 4NSOB 3UJNA 4GRIA 1IBMM 2OO9A 1GVNA 1G8PA 2DAEA 1OJLA 2C9CA 2BWEA 4DR7M 3U6LA 4FW9A 3KSJA 3L2AA 1K3XA 1I4WA 1QZEA 4LF5M 4JXJA 4MB7A 3SASA 3KSXA 3NWLA 4R7GA 3HHXA 1XXHE 5IWAM 2DWNA 4YHHM 4HL4A 5F3WA 1QVRA 2EJSA 3DFZA 3VKGA 1IN5A 1IY1A 3MJ5A 3L25A 3RGSA 4QNRA 4P16A 4NXNM 1IM2A 2QHOB 2H1RA 1XB2B 1OAOC 2Z7JA 4QHSA 2L7HA 2K9DA 2YQZA 3K9PA 4OVZA 4QHTA 1YLAA 2APLA 2HWJA 2LTUA 3FD9A 1W5SA 4RF0A 2KW0A 5C1BA 2HHHM 4LF7M 4NRVA 5KQDA 1F4IA 3GQ4A 1DGBA 1GABA 1VEGA 4DV5M 5FTKA 1KYIA 2LBCA 1OIPA 1SXJB 3HU2A 4KO8A 3U5ZA 1DV0A 4AQYM 2JY5A 1V34A 1FJGM 1NHGC 4GH9A 4F2LA 4CIZA 2C5RA 2KNZA 3SATA 2LVQD 5FTMA 3E9SA 4NC6A 1XC8A 2CV1A 3DA1A 3L26A 4B3TM 1Q3CA 1K82A 4FCWA 1HT1E 1IN4A 5KPRA 1OTRA 2O5RA 4L4UA 2JA2A 4ANRA 4B3SM 1SXJC 4DR5M 4DV0M 2CV0A 1TH3A 2HAKA 5H37D 5KQ8A 3LW5F 3SHGB 2V1CA 2FNAA 2KEBA 5ITXA 2XLJA 4DR4M 2CFOA 3C9PA 5ITRA 1HQCA 2DWMA 4FWHA 3SYLA 1UM8A 3TE6A 2FOIC 1GJSA 4PCZA 3JAMS 4BLCA 2Z4RA 1L2CA 5DNYA 3FRIA 2WSCF 4AW4A 1ZMWA 3W67A 4LJ9A 4B08A 2VQEM 2F4VM 3F92A 2D7GA 2O01F 4DR6M 2HKJA 5E26A 4EIWA 4JI0M 1N75A 1NJFA 2ZANA 3QWLA 1GO5A 2LXEA 3JR4A 2ZM6M 3I51A 3KOXE 3TWMA 2UUCM 2UXCM 3U6SA 4M9ZA 4CHTB 2D7EA 4DV7M 3GLGB 3GLFA 4DUZM 3GLIE 4LRTA 2ERCA 2DWZB 2R18A 1C1KA 3FUWA 3I01M 5FSWA 1N32M 4WURA 1IN6A 1OFHA 4PT5A 4OX9M 1YE9A 4DR2M 3GLGE 2HL7A 3PNYA 3CF2A 3FYDA 1R4GA 2OQ4A 2QSFX 1WHCA 4GHAA 4LZJA 2QPAA 4LF6M 3IHPA 2RRUA 1JB0F 1GKIA 4IBFA 4IJEA 1H6UA 3W0FA 4LFCM 4KLNA 1PJQA 3ZQJA 1T6OA 2CP8A 4LJ5A 2DI0A 3GQ5A 1IXSB 4FCTA 4MGKE 4D81A 5C18A 4X65M 4B3MM 3RFWA 1ZQ9A 3BXWA 1HQYE 4HEOA 3A42A 1PM5A 3KFUG 3GQ3A 1IXRC 2RKOA 1OIZA 1V92A 3RGPA 2J7OA 4JI1M 3M0EA 3KXEC 2XZFA 1NSFA 2LWXA 1DGHA 1N36M 3IECA 3T6PA 5DYGA 1TDHA 2FFJA 3I4VA 3K1JA 4OW0A 3SAUA 4K0KM 1QANA 3SAWA 4NXMM 2L2DA 2Y20A 5EXPA 2XGNA 1XNRM 2QBYB 2XH9A 3DZDA 3A45A 3BBZA 3ILKA 2Z3XA 1KFVA 3GPYA 1IY2A 2KZSA 2VF7A 2BJWA 5EP3A 2VQFM 4B7HA 2LVOC 2XFTA 3PFIA 3C3EA 4LFBM 1JR3A 1XXHA 1Z6TA 2DHYA 4PDGA 3HKPA 4I5SA 1E32A 4NOOB 5JI2E 3BOSA 3HY5A 5ITTA 2EO2A 4JN6A 4LG2A 4RNAA 3HWSA 4TUWA 2AHMA 2CHVA 2MH8A 2LH0A 1N33M 3U6PA 3HZJA 2CE7A 2KDLA 3AKZA 1L8QA 4LGYA 2XSZA 1E9SA 1UFZA 2WZJA 3SMSA 5ITYA 4CJ6A 3HHYA 4FWGA 3EIEA 3OTOM 3IG8A 2W82A 1AIPC 2X49A 1QZMA 2VF8A 2LNHC 1TR8A 3LCVB 5L8RF 4DV3M 1R2ZA 1TGUA 1Z5CA 3B7NA 3E46A 2M5ZA 2VIIA 3DOAA 3GRRA 3K9OA 5EJCA 2UU9M 1IQPA 2EKKA 4Q7JA 4G4OA 4FCVA 2C9OA 2J5YA 4AZFA 1VG5A 2J7NA 3SARA 4KHPM 2X8AA 4GITA 1JR3D 1KSFX 1EFUB 5IREB 1WJ7A 4CISA 3MHVC 2JNHA 2R45A 4JYAM 3TWLA 2QNJA 1R5LA 2DENA 2KNVA 2Y0TA 3ZH9B 3UGJA 4AI6A 3C58A 1SXJE 4DR3M 2WSFF 4M0WA 3SC3A 3M7GA 2ZTDA 3CGWA 5JI3E 2L09A 3K8ZA 3U5ZB 4IJFA 3GP1A 3FUVA 2HCBA 1XWIA 1OAIA 2L6OA 2R62A 2XSZD 1GL7A 3SBJA 4G4QA 4G6ZA 2DAGA 4HLQA 4S12A 1J7KA 4A3VB 4RF1A 2F5SA 3FUXA 3J80S 2CRUA 3HJQA 2F5QA 4JI3M 1L2DA 2D7HA 2DZOB 4II7A 4F1IA 2CV2A 2OOBA 4JI6M 1R7RA 2LVPC 3AFHA 1ZV1A 4MM3B 2XEPA 2H5XA 1TTEA 2RGHA 3FTCA 2G8LA 1R6BX 3U61A 1PJTA 1HNXM 4I81A 3D8LA 2F5PA 1DGFA 2EKFA 1HNWM 1P3QQ 1E9RA 3EIHA 2QQ8A 4G4NA 4IBBA 3MMPA 4L16A 1X37A 2F5OA 4NRWA 3A46A 4X64M 3GLIA 2UXBM 2LHGA 5ITXE 2LHCA 3QYBA 4AG6A 1I94M 1BVSA 2V1UA 3FTEA 4XGIA 1PRBA 4W5WA 1LTMA 2MROB 2R4EA 2QP9X 3B7ZA 1NNJA 4X66M 2CHGA 4B7FA 5KO3A 1IN8A 3I4YA 1Y8GA 1ZMVA 2JWSA 3GRYA 4MH0E 5GKNA 2ZBKB 3UK6A 3ZC7B 4BBAA 3HGIA 1D0LA 2C96A 4LRSA 4B7GA 1G59A 3KP0E 5EP1A 3SFZA 2QENA 3AOEA 3GLFB 3J7AS 1L1ZA 2I7NA 3TPZA 3GLHA 1QDTA 1OQYA 4Y28F 4GHLA 4AKGA 1A5TA 1V33A 2MGWA 1LV7A 3GRUA 4LJ6A 2WSEF 4G4RA 2ZAMA 3KS8A 4YY3M 3HX3A 1CUKA 1MX0A 4LFAM 1WGNA 2BWBA 2CEAA 2VDBB 3R8FA 1TDZA 3TQSA 1ORYB 2KA6B 1D2NA 2X4AA 3AV0A 1NV8A 4UN2B 4GC5A 4DUYM 3E21A 1RU3A 4BB9A 2YR0A 2R65A 2XF3A 4XK8F 1N78A 3KOWE 1HNZM 3RE8A 1GLNA 1L1TA 1Z5BA 1Z59A 3LQQA 2OPFA 2L4FA 4M0DA 2BJVA 1PJIA 1VEJA 1DO0A 3HJ8A 3LVWA 4D80A 3U60B 1VQ1A 3M6AA 2P5TA 2YNMD 1QAMA 4IIWA 3THGA 3T1HM 1SG9A 1IFYA 2CUZA 4DBGB 1VEKA 1DGHB 4QOSA 2QBYA 1QAOA 1W5TA 1DO2A 4IBDA 3UMMA 1D0MA 4QNMA 4WP2A 3PVSA 2DVWB 3B9PA 4IBIA 1WGLA 4IBEA 3UZUA 1ZAEA 2C99A 3FUTA 7CATA 3TL4X 2LVNC 4LJ4A 2R6FA 4ITQA 4REZA 3KOYE 3W0LB 3PXGA 2N35A 4JI2M 4XBOA 2CHQA 1QUSA 2Y21A 3FTFA 1XMQM 3JR5A 2DAIA 3AL0C 4L8RC 4DV4M 4I4LA 3CF0A 3HU1A 2M60A 1VDDA 1G4AE 4I8OA 3U6EA 3GO8A 4FVMA 2DNAA 3LQRA 2UUAM 4GKJM 1NY6A 4LCBA 3VDUA 1J09A 1TH2A 2R44A 2JXNA 1FNNA 1MU5A 2R46A 3K92A 5EXSA 2JY6B 4JI8M 1JR3E 3HJSA 3U6OA 2E5LM 1IY0A 2Q2EB 3FUUA 2DHRA 3AOGA 2KXEA 1NHWC 4OVZB 2XZUA 1QUTA 1PGYA 2R4JA 1PJSA 2JZ1A 5DYIA 1SXJA 1HT2E 4R71A 2MJ5B 1MJGM 2Z8YM 2C98A 1VDLA 2NQ8C 1XMOM 3SMPA 2UXDM 3QYEA 4DV6M 4NSRA 3Q8XA 4PD2A 4X62M 5IZ7D 4MGHA 3B74A 1J5EM 2KRUA 1Z5AA 4FWDA 1TH4A 4MGYE 5FLXS 1HJPA 1D0KA 4LGMA 2DWLA 4LF9M 1NVMA 2KRKA 1DGGA 1Q3BA 5A2QS 2XFSA 2KNAA 3AJIB 4MGZE 5FTJA 4QOZC 5E6JA 4B3RM 2DAKA 2ZAOA 3HU3A 3LMMA 4OU7A 4IBGA 3GPPA 4Z8XA 1OFIA 1XHBA 1IN7A 2K0BX 3KOZE 5FTNA 4RKUF 4LF8M 5EP4A 1AUAA
chains in the Genus database with same CATH topology
1JB0F 4RKUF 4Y28F 3LW5F 4L6V6 4XK8F 2WSCF 2WSEF 2O01F 2WSFF 4KT0F 5L8RF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 F;  4RKU F;  4Y28 F;  3LW5 F;  4L6V 6;  4XK8 F;  2WSC F;  2WSE F;  2O01 F;  2WSF F;  4KT0 F;  5L8R F; 
#chains in the Genus database with same CATH topology
 2G5G X;  1K3W A;  3KW6 A;  3LVV A;  3VFD A;  1G41 A;  2OOA A;  4M9X A;  5DFL A;  1NNU C;  1EE8 A;  3TWK A;  1C7Y A;  1SXJ D;  4GIP A;  3GPU A;  5EP2 A;  4L6V 6;  2BNK A;  5KPT A;  3E4R A;  5LMU M;  1T43 A;  3CF6 E;  2CWB A;  1WR1 B;  5EXT A;  4DV2 M;  4WW0 A;  2FE8 A;  3L27 A;  3J27 B;  4ZPX A;  2DZN B;  2K6B A;  1QAQ A;  4AKH A;  4LJ8 A;  4GC9 A;  2YFQ A;  3VDP A;  3U61 B;  3KP1 E;  3L28 A;  4IBK A;  2L7I A;  2EA0 A;  3NBI A;  1IBL M;  1S3S A;  4LJA A;  2FS1 A;  1G71 A;  4NL4 H;  1G3I A;  1NJG A;  3SHF A;  2DAM A;  3FYC A;  3J7B A;  3KDS E;  4L15 A;  3GLG A;  1Q02 A;  3H4J A;  3W68 A;  1WIV A;  3FRH A;  3R9X B;  1EIJ A;  3WHL A;  1PJJ A;  4M9S A;  3V76 A;  2EUC A;  3LCU A;  3GLI B;  3VK8 A;  2I7P A;  3NBX X;  3H4M A;  1IXZ A;  3SYK A;  1ZMU A;  1OKS A;  2FH0 A;  4KT0 F;  3HHW A;  1TF0 B;  2B3T A;  4R3D A;  4DV1 M;  5ITU A;  3FE3 A;  3U6Q A;  1NY5 A;  2QZ4 A;  2Z4S A;  2KHH A;  4MGI E;  4JV5 M;  4LZZ A;  1WXQ A;  4JI7 M;  3GLF E;  3B7Q A;  4G3O A;  4IBC A;  1L2B A;  2DKL A;  3MK6 A;  3QAU A;  3L29 A;  3GPX A;  4JI5 M;  2Y0Q A;  3I04 M;  1IXS A;  3KS4 A;  4LY6 A;  3GLH B;  4Z6Y A;  1YUB A;  3ZCB B;  3VLF B;  4P17 A;  2V6Z M;  5EXX A;  3C3D A;  2O25 A;  2JP7 A;  2DZL A;  3SAV A;  2L4E A;  4GKK M;  3KVW A;  1JQJ C;  2MR9 A;  1GJT A;  1E94 E;  3A98 B;  2A5Y B;  2GNO A;  4D82 A;  2F5N A;  3Q8G A;  4IBJ A;  3AOE C;  2KZU A;  3T15 A;  1NO1 A;  3GLH E;  1T3T A;  4L78 A;  1NV9 A;  2LVA A;  3CTW B;  3U6D A;  2ZTC A;  3FKE A;  5IT9 S;  4DR1 M;  1QDR A;  1QQW A;  2G3Q A;  3PNV A;  2JY8 A;  4KOD A;  5FTL A;  4JI4 M;  1QYR A;  3B89 A;  4FD2 A;  4AG5 A;  3U60 A;  1XNQ M;  3IG5 A;  2RGO A;  4CGY B;  1GL6 A;  1Q39 A;  3T38 A;  4PDI A;  3HHZ A;  2JUJ A;  5LMN M;  3VK7 A;  5EQT A;  2UUB M;  3FTD A;  3K2L A;  2QCU A;  5ITQ A;  3T1Y M;  1N34 M;  1YSY A;  2GQF A;  3VKH A;  1R2Y A;  3U6C A;  1N77 A;  4LF4 M;  2R0I A;  4LJ7 A;  5BPV A;  2DXI A;  2K47 A;  5BR8 M;  5KPZ A;  3U6M A;  3GRV A;  1IBK M;  2JZ0 A;  1MN3 A;  2JY7 A;  4AKI A;  1HR0 M;  3J81 S;  3D8B A;  3J2P B;  4GMQ A;  3WHK A;  1XXH B;  4GEW A;  8CAT A;  4NSO B;  3UJN A;  4GRI A;  1IBM M;  2OO9 A;  1GVN A;  1G8P A;  2DAE A;  1OJL A;  2C9C A;  2BWE A;  4DR7 M;  3U6L A;  4FW9 A;  3KSJ A;  3L2A A;  1K3X A;  1I4W A;  1QZE A;  4LF5 M;  4JXJ A;  4MB7 A;  3SAS A;  3KSX A;  3NWL A;  4R7G A;  3HHX A;  1XXH E;  5IWA M;  2DWN A;  4YHH M;  4HL4 A;  5F3W A;  1QVR A;  2EJS A;  3DFZ A;  3VKG A;  1IN5 A;  1IY1 A;  3MJ5 A;  3L25 A;  3RGS A;  4QNR A;  4P16 A;  4NXN M;  1IM2 A;  2QHO B;  2H1R A;  1XB2 B;  1OAO C;  2Z7J A;  4QHS A;  2L7H A;  2K9D A;  2YQZ A;  3K9P A;  4OVZ A;  4QHT A;  1YLA A;  2APL A;  2HWJ A;  2LTU A;  3FD9 A;  1W5S A;  4RF0 A;  2KW0 A;  5C1B A;  2HHH M;  4LF7 M;  4NRV A;  5KQD A;  1F4I A;  3GQ4 A;  1DGB A;  1GAB A;  1VEG A;  4DV5 M;  5FTK A;  1KYI A;  2LBC A;  1OIP A;  1SXJ B;  3HU2 A;  4KO8 A;  3U5Z A;  1DV0 A;  4AQY M;  2JY5 A;  1V34 A;  1FJG M;  1NHG C;  4GH9 A;  4F2L A;  4CIZ A;  2C5R A;  2KNZ A;  3SAT A;  2LVQ D;  5FTM A;  3E9S A;  4NC6 A;  1XC8 A;  2CV1 A;  3DA1 A;  3L26 A;  4B3T M;  1Q3C A;  1K82 A;  4FCW A;  1HT1 E;  1IN4 A;  5KPR A;  1OTR A;  2O5R A;  4L4U A;  2JA2 A;  4ANR A;  4B3S M;  1SXJ C;  4DR5 M;  4DV0 M;  2CV0 A;  1TH3 A;  2HAK A;  5H37 D;  5KQ8 A;  3LW5 F;  3SHG B;  2V1C A;  2FNA A;  2KEB A;  5ITX A;  2XLJ A;  4DR4 M;  2CFO A;  3C9P A;  5ITR A;  1HQC A;  2DWM A;  4FWH A;  3SYL A;  1UM8 A;  3TE6 A;  2FOI C;  1GJS A;  4PCZ A;  3JAM S;  4BLC A;  2Z4R A;  1L2C A;  5DNY A;  3FRI A;  2WSC F;  4AW4 A;  1ZMW A;  3W67 A;  4LJ9 A;  4B08 A;  2VQE M;  2F4V M;  3F92 A;  2D7G A;  2O01 F;  4DR6 M;  2HKJ A;  5E26 A;  4EIW A;  4JI0 M;  1N75 A;  1NJF A;  2ZAN A;  3QWL A;  1GO5 A;  2LXE A;  3JR4 A;  2ZM6 M;  3I51 A;  3KOX E;  3TWM A;  2UUC M;  2UXC M;  3U6S A;  4M9Z A;  4CHT B;  2D7E A;  4DV7 M;  3GLG B;  3GLF A;  4DUZ M;  3GLI E;  4LRT A;  2ERC A;  2DWZ B;  2R18 A;  1C1K A;  3FUW A;  3I01 M;  5FSW A;  1N32 M;  4WUR A;  1IN6 A;  1OFH A;  4PT5 A;  4OX9 M;  1YE9 A;  4DR2 M;  3GLG E;  2HL7 A;  3PNY A;  3CF2 A;  3FYD A;  1R4G A;  2OQ4 A;  2QSF X;  1WHC A;  4GHA A;  4LZJ A;  2QPA A;  4LF6 M;  3IHP A;  2RRU A;  1JB0 F;  1GKI A;  4IBF A;  4IJE A;  1H6U A;  3W0F A;  4LFC M;  4KLN A;  1PJQ A;  3ZQJ A;  1T6O A;  2CP8 A;  4LJ5 A;  2DI0 A;  3GQ5 A;  1IXS B;  4FCT A;  4MGK E;  4D81 A;  5C18 A;  4X65 M;  4B3M M;  3RFW A;  1ZQ9 A;  3BXW A;  1HQY E;  4HEO A;  3A42 A;  1PM5 A;  3KFU G;  3GQ3 A;  1IXR C;  2RKO A;  1OIZ A;  1V92 A;  3RGP A;  2J7O A;  4JI1 M;  3M0E A;  3KXE C;  2XZF A;  1NSF A;  2LWX A;  1DGH A;  1N36 M;  3IEC A;  3T6P A;  5DYG A;  1TDH A;  2FFJ A;  3I4V A;  3K1J A;  4OW0 A;  3SAU A;  4K0K M;  1QAN A;  3SAW A;  4NXM M;  2L2D A;  2Y20 A;  5EXP A;  2XGN A;  1XNR M;  2QBY B;  2XH9 A;  3DZD A;  3A45 A;  3BBZ A;  3ILK A;  2Z3X A;  1KFV A;  3GPY A;  1IY2 A;  2KZS A;  2VF7 A;  2BJW A;  5EP3 A;  2VQF M;  4B7H A;  2LVO C;  2XFT A;  3PFI A;  3C3E A;  4LFB M;  1JR3 A;  1XXH A;  1Z6T A;  2DHY A;  4PDG A;  3HKP A;  4I5S A;  1E32 A;  4NOO B;  5JI2 E;  3BOS A;  3HY5 A;  5ITT A;  2EO2 A;  4JN6 A;  4LG2 A;  4RNA A;  3HWS A;  4TUW A;  2AHM A;  2CHV A;  2MH8 A;  2LH0 A;  1N33 M;  3U6P A;  3HZJ A;  2CE7 A;  2KDL A;  3AKZ A;  1L8Q A;  4LGY A;  2XSZ A;  1E9S A;  1UFZ A;  2WZJ A;  3SMS A;  5ITY A;  4CJ6 A;  3HHY A;  4FWG A;  3EIE A;  3OTO M;  3IG8 A;  2W82 A;  1AIP C;  2X49 A;  1QZM A;  2VF8 A;  2LNH C;  1TR8 A;  3LCV B;  5L8R F;  4DV3 M;  1R2Z A;  1TGU A;  1Z5C A;  3B7N A;  3E46 A;  2M5Z A;  2VII A;  3DOA A;  3GRR A;  3K9O A;  5EJC A;  2UU9 M;  1IQP A;  2EKK A;  4Q7J A;  4G4O A;  4FCV A;  2C9O A;  2J5Y A;  4AZF A;  1VG5 A;  2J7N A;  3SAR A;  4KHP M;  2X8A A;  4GIT A;  1JR3 D;  1KSF X;  1EFU B;  5IRE B;  1WJ7 A;  4CIS A;  3MHV C;  2JNH A;  2R45 A;  4JYA M;  3TWL A;  2QNJ A;  1R5L A;  2DEN A;  2KNV A;  2Y0T A;  3ZH9 B;  3UGJ A;  4AI6 A;  3C58 A;  1SXJ E;  4DR3 M;  2WSF F;  4M0W A;  3SC3 A;  3M7G A;  2ZTD A;  3CGW A;  5JI3 E;  2L09 A;  3K8Z A;  3U5Z B;  4IJF A;  3GP1 A;  3FUV A;  2HCB A;  1XWI A;  1OAI A;  2L6O A;  2R62 A;  2XSZ D;  1GL7 A;  3SBJ A;  4G4Q A;  4G6Z A;  2DAG A;  4HLQ A;  4S12 A;  1J7K A;  4A3V B;  4RF1 A;  2F5S A;  3FUX A;  3J80 S;  2CRU A;  3HJQ A;  2F5Q A;  4JI3 M;  1L2D A;  2D7H A;  2DZO B;  4II7 A;  4F1I A;  2CV2 A;  2OOB A;  4JI6 M;  1R7R A;  2LVP C;  3AFH A;  1ZV1 A;  4MM3 B;  2XEP A;  2H5X A;  1TTE A;  2RGH A;  3FTC A;  2G8L A;  1R6B X;  3U61 A;  1PJT A;  1HNX M;  4I81 A;  3D8L A;  2F5P A;  1DGF A;  2EKF A;  1HNW M;  1P3Q Q;  1E9R A;  3EIH A;  2QQ8 A;  4G4N A;  4IBB A;  3MMP A;  4L16 A;  1X37 A;  2F5O A;  4NRW A;  3A46 A;  4X64 M;  3GLI A;  2UXB M;  2LHG A;  5ITX E;  2LHC A;  3QYB A;  4AG6 A;  1I94 M;  1BVS A;  2V1U A;  3FTE A;  4XGI A;  1PRB A;  4W5W A;  1LTM A;  2MRO B;  2R4E A;  2QP9 X;  3B7Z A;  1NNJ A;  4X66 M;  2CHG A;  4B7F A;  5KO3 A;  1IN8 A;  3I4Y A;  1Y8G A;  1ZMV A;  2JWS A;  3GRY A;  4MH0 E;  5GKN A;  2ZBK B;  3UK6 A;  3ZC7 B;  4BBA A;  3HGI A;  1D0L A;  2C96 A;  4LRS A;  4B7G A;  1G59 A;  3KP0 E;  5EP1 A;  3SFZ A;  2QEN A;  3AOE A;  3GLF B;  3J7A S;  1L1Z A;  2I7N A;  3TPZ A;  3GLH A;  1QDT A;  1OQY A;  4Y28 F;  4GHL A;  4AKG A;  1A5T A;  1V33 A;  2MGW A;  1LV7 A;  3GRU A;  4LJ6 A;  2WSE F;  4G4R A;  2ZAM A;  3KS8 A;  4YY3 M;  3HX3 A;  1CUK A;  1MX0 A;  4LFA M;  1WGN A;  2BWB A;  2CEA A;  2VDB B;  3R8F A;  1TDZ A;  3TQS A;  1ORY B;  2KA6 B;  1D2N A;  2X4A A;  3AV0 A;  1NV8 A;  4UN2 B;  4GC5 A;  4DUY M;  3E21 A;  1RU3 A;  4BB9 A;  2YR0 A;  2R65 A;  2XF3 A;  4XK8 F;  1N78 A;  3KOW E;  1HNZ M;  3RE8 A;  1GLN A;  1L1T A;  1Z5B A;  1Z59 A;  3LQQ A;  2OPF A;  2L4F A;  4M0D A;  2BJV A;  1PJI A;  1VEJ A;  1DO0 A;  3HJ8 A;  3LVW A;  4D80 A;  3U60 B;  1VQ1 A;  3M6A A;  2P5T A;  2YNM D;  1QAM A;  4IIW A;  3THG A;  3T1H M;  1SG9 A;  1IFY A;  2CUZ A;  4DBG B;  1VEK A;  1DGH B;  4QOS A;  2QBY A;  1QAO A;  1W5T A;  1DO2 A;  4IBD A;  3UMM A;  1D0M A;  4QNM A;  4WP2 A;  3PVS A;  2DVW B;  3B9P A;  4IBI A;  1WGL A;  4IBE A;  3UZU A;  1ZAE A;  2C99 A;  3FUT A;  7CAT A;  3TL4 X;  2LVN C;  4LJ4 A;  2R6F A;  4ITQ A;  4REZ A;  3KOY E;  3W0L B;  3PXG A;  2N35 A;  4JI2 M;  4XBO A;  2CHQ A;  1QUS A;  2Y21 A;  3FTF A;  1XMQ M;  3JR5 A;  2DAI A;  3AL0 C;  4L8R C;  4DV4 M;  4I4L A;  3CF0 A;  3HU1 A;  2M60 A;  1VDD A;  1G4A E;  4I8O A;  3U6E A;  3GO8 A;  4FVM A;  2DNA A;  3LQR A;  2UUA M;  4GKJ M;  1NY6 A;  4LCB A;  3VDU A;  1J09 A;  1TH2 A;  2R44 A;  2JXN A;  1FNN A;  1MU5 A;  2R46 A;  3K92 A;  5EXS A;  2JY6 B;  4JI8 M;  1JR3 E;  3HJS A;  3U6O A;  2E5L M;  1IY0 A;  2Q2E B;  3FUU A;  2DHR A;  3AOG A;  2KXE A;  1NHW C;  4OVZ B;  2XZU A;  1QUT A;  1PGY A;  2R4J A;  1PJS A;  2JZ1 A;  5DYI A;  1SXJ A;  1HT2 E;  4R71 A;  2MJ5 B;  1MJG M;  2Z8Y M;  2C98 A;  1VDL A;  2NQ8 C;  1XMO M;  3SMP A;  2UXD M;  3QYE A;  4DV6 M;  4NSR A;  3Q8X A;  4PD2 A;  4X62 M;  5IZ7 D;  4MGH A;  3B74 A;  1J5E M;  2KRU A;  1Z5A A;  4FWD A;  1TH4 A;  4MGY E;  5FLX S;  1HJP A;  1D0K A;  4LGM A;  2DWL A;  4LF9 M;  1NVM A;  2KRK A;  1DGG A;  1Q3B A;  5A2Q S;  2XFS A;  2KNA A;  3AJI B;  4MGZ E;  5FTJ A;  4QOZ C;  5E6J A;  4B3R M;  2DAK A;  2ZAO A;  3HU3 A;  3LMM A;  4OU7 A;  4IBG A;  3GPP A;  4Z8X A;  1OFI A;  1XHB A;  1IN7 A;  2K0B X;  3KOZ E;  5FTN A;  4RKU F;  4LF8 M;  5EP4 A;  1AUA A; 
#chains in the Genus database with same CATH homology
 1JB0 F;  4RKU F;  4Y28 F;  3LW5 F;  4L6V 6;  4XK8 F;  2WSC F;  2WSE F;  2O01 F;  2WSF F;  4KT0 F;  5L8R F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...