1JB0F

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
b'DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPHLVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEIIIDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
molecule tags Photosynthesis
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 1jb0F00
4Y28F 2WSEF 4L6V6 1JB0F 4KT0F 2WSCF 4XK8F 5L8RF 4RKUF 2WSFF 2O01F 3LW5F
chains in the Genus database with same CATH superfamily
1VEGA 2DNAA 1I4WA 2CP8A 2R65A 2ZAMA 4DV2M 2ZBKB 3T1HM 3UZUA 3I04M 4IBIA 1IY0A 2DENA 2DKLA 1GLNA 2RGOA 3HHXA 3LVVA 2D7EA 3TWMA 3U6CA 3U61B 2E5LM 4JI7M 3L2AA 4LF5M 1QAOA 2L09A 2WSCF 1XXHB 1SXJB 1JR3A 1W5TA 2C9OA 2C9CA 3VDPA 3ZQJA 2QCUA 4CJ6A 1LTMA 4DV6M 4IBJA 3RFWA 2F5PA 4AG5A 2CHGA 2JNHA 2QENA 2DWMA 4RF1A 2H5XA 4BBAA 4LGYA 3GLFE 2OO9A 3K8ZA 1OFHA 2VF7A 3BOSA 4OU7A 2JP7A 2N35A 4YY3M 2EJSA 4JN6A 1D0KA 3L26A 4LJ6A 3HHYA 3U6EA 2MGWA 4JI1M 2KEBA 4LFBM 2C5RA 2G8LA 1IQPA 1PRBA 1OIZA 3W68A 4G4QA 1IXSA 4PDIA 3T38A 1IY1A 1K3XA 2R4EA 2L7IA 2HAKA 4L4UA 2DHRA 3GRRA 4D81A 1HQCA 2L7HA 1PGYA 2DWLA 2Y0QA 2X4AA 4GIPA 2FOIC 2KZUA 2O01F 4IJEA 5EP1A 2UU9M 2I7PA 2LHCA 3T6PA 4B7HA 3L27A 4L8RC 1HNZM 1Q3CA 1QANA 4M9XA 2JUJA 4LGMA 4LY6A 4OVZA 2HL7A 2KZSA 3FD9A 1C7YA 2ERCA 2X49A 1OQYA 4CGYB 3U6OA 1CUKA 2RKOA 1QZEA 4MM3B 5ITYA 2CHVA 1NNJA 1G8PA 4DV3M 3AJIB 2VQFM 1QZMA 4LF9M 2LWXA 1GL6A 4FCTA 1G3IA 4M9SA 1IN5A 1DGHB 5ITRA 1HNXM 1IM2A 4JI5M 3BXWA 2A5YB 3GPPA 2C96A 3EIHA 4I81A 2Z3XA 3LCVB 2RRUA 1JB0F 1NVMA 3JAMS 1KFVA 1J7KA 4L15A 4YHHM 4NXMM 1IN7A 1GKIA 3NBIA 3J81S 1XMQM 4LF6M 2MR9A 2Z4RA 3CF2A 1DV0A 1VDLA 2CEAA 1N33M 3QYEA 1QAQA 4GHAA 5KPRA 3KVWA 3SASA 4IBBA 2B3TA 3AV0A 1BVSA 3W67A 3GLFA 3U6SA 1N34M 1XNRM 4LCBA 2DZLA 3KOZE 3JR4A 1T43A 2QBYB 1OAOC 3ZCBB 1P3QQ 4F2LA 3E46A 3U6MA 5EP4A 1J5EM 3FRHA 2JWSA 4LZZA 3PXGA 4G4NA 2GNOA 3Q8XA 1G41A 2QPAA 4XBOA 4GEWA 4HEOA 2BWEA 4QHSA 3RGSA 4DUYM 3GQ4A 4DR7M 1GVNA 5KO3A 3L25A 1PJJA 3DZDA 4FCVA 2UUAM 1DGGA 4GRIA 1GO5A 2LVAA 4JI4M 3ZH9B 2DVWB 2QZ4A 3B7NA 3HZJA 3IHPA 3FKEA 1I94M 4LJAA 2CUZA 7CATA 5JI2E 2C98A 4IBKA 3FUVA 4P16A 1G71A 3LMMA 3U60B 1J09A 2FFJA 2JY5A 2F5QA 3HJ8A 1IXZA 1E94E 3PNVA 1QUSA 3U5ZA 1R5LA 3I4YA 1NNUC 2JY8A 5KQDA 3CTWB 4MGIE 4FVMA 1YLAA 4WP2A 4Z6YA 3GRVA 2EKFA 2XH9A 3HX3A 3SYKA 3GLIB 1L8QA 2BNKA 4DBGB 2R6FA 1L2CA 1N32M 4PDGA 3A46A 3FYDA 2UXDM 4AKGA 3E4RA 1TGUA 2Z8YM 3KFUG 3SFZA 4IBCA 3TL4X 2KXEA 3W0FA 1TF0B 2DAIA 3B7ZA 4IJFA 2NQ8C 4CHTB 3UMMA 1XC8A 3UGJA 3KOXE 4DR1M 4MGHA 3T15A 4LFAM 4LRSA 3AOEC 3J80S 2HHHM 4B3MM 4REZA 5E6JA 4OX9M 1D0MA 2R62A 4DR3M 1PJSA 3OTOM 4I5SA 2K6BA 4M0WA 2ZANA 3A42A 4ITQA 3M6AA 1N77A 4L6V6 4LF7M 4GHLA 4DV0M 2DWZB 3NWLA 1NJFA 1SXJD 3TQSA 1TDZA 4W5WA 1E32A 3NBXX 2QNJA 3GRUA 4JI0M 1NSFA 2LTUA 4RKUF 1K3WA 2Y0TA 2F4VM 3C9PA 1ZQ9A 1E9RA 1QAMA 1N75A 1QUTA 2LH0A 2R44A 3EIEA 4II7A 1GJSA 3VKGA 3MHVC 2LBCA 2K9DA 2XSZA 1R7RA 1DO2A 2YFQA 1S3SA 3KS4A 4LJ7A 4FCWA 1Q39A 2EO2A 1XXHE 1HT2E 1SXJE 4I8OA 4M9ZA 3SMPA 3GLHB 2VF8A 1HQYE 5ITXE 3HHWA 4QOSA 2VQEM 2X8AA 4R3DA 4B3TM 4LF4M 2UXBM 5H37D 2F5OA 1Z6TA 2QP9X 3FRIA 1SXJC 1D0LA 4AW4A 5DYIA 2LHGA 2FE8A 2J7NA 3AOEA 1MU5A 4IBFA 4L16A 3HU1A 5IZ7D 2OOAA 3AL0C 3GLGB 1EE8A 2MJ5B 2OPFA 2M5ZA 5IWAM 3GPYA 3C3EA 4MGKE 4AI6A 4LJ5A 4KHPM 1GJTA 3J2PB 2W82A 2XF3A 1FJGM 1DGBA 1NY6A 1TTEA 3FUTA 4BLCA 3DFZA 2KW0A 3WHLA 3I51A 4DV4M 3VK7A 1XB2B 4Y28F 3CF6E 3SAWA 4G4RA 4F1IA 1A5TA 2L4EA 1WR1B 3AFHA 3QYBA 4BB9A 3L28A 4RNAA 3RE8A 3M7GA 4GMQA 1V92A 2LNHC 4G4OA 4FWDA 5A2QS 5DFLA 3DOAA 3MK6A 3FTFA 3TE6A 1MX0A 2FH0A 5E26A 3J7AS 3KXEC 1YE9A 1VDDA 2CWBA 3FUUA 5EXXA 3HY5A 3HKPA 2MROB 4MGYE 3U61A 4XK8F 3FUXA 4L78A 4HL4A 2AHMA 1YUBA 1XXHA 2F5NA 1SXJA 1ZV1A 1G59A 3QWLA 2DAGA 3SATA 3H4MA 3SC3A 5ITXA 5L8RF 2GQFA 1L2DA 4LRTA 3GO8A 3CF0A 4DV7M 3UK6A 4PD2A 4QHTA 4XGIA 2JA2A 2LVQD 2YNMD 1AUAA 3SHFA 2K47A 1TH3A 3SAVA 4KT0F 1NV9A 2KHHA 1QYRA 4GC9A 2XSZD 3BBZA 3K9PA 4JXJA 3T1YM 1PJIA 3UJNA 4CISA 3MMPA 1AIPC 3FYCA 1VEKA 2J5YA 3IG5A 2DZNB 3HWSA 1TDHA 2C99A 4G6ZA 2DAEA 2JY6B 1E9SA 2J7OA 4NSOB 4QNRA 1L1ZA 2L6OA 1HNWM 2DZOB 3PNYA 1OAIA 3SARA 3KSXA 4X65M 5EXTA 2V1CA 5EJCA 1QDRA 3KW6A 3LCUA 5FSWA 2CV0A 2FNAA 3KS8A 5LMNM 2I7NA 1SG9A 2JZ0A 3J27B 3KOYE 2OQ4A 2WSEF 1TR8A 3F92A 4DR5M 1EIJA 3J7BA 1N36M 3VK8A 4JI8M 3SHGB 3E9SA 3U6DA 1QDTA 4IBEA 1Q3BA 4GKKM 1HT1E 4AZFA 3AOGA 1LV7A 3KP1E 2Y21A 3RGPA 1WJ7A 2K0BX 1IFYA 3GLIE 1R2ZA 1OKSA 2DXIA 4QNMA 1DGHA 2XZUA 2WZJA 4K0KM 2XFSA 1R2YA 1ZMUA 2VIIA 1Q02A 3R8FA 2CFOA 2DWNA 3HGIA 1NHWC 4X62M 2RGHA 1NHGC 1VG5A 3ILKA 3K1JA 2V6ZM 2O5RA 4D82A 2DI0A 3B9PA 1V33A 2LVPC 1IXSB 1IN6A 4RF0A 1NO1A 1ORYB 1WHCA 1IBKM 4AG6A 2R4JA 1IN4A 2CHQA 2G5GX 3THGA 2ZTCA 3U6LA 3B74A 4GITA 4LZJA 1Z5CA 2QBYA 4LG2A 1Z5BA 1TH2A 5FTMA 3AKZA 4DR2M 3LQRA 2M60A 1H6UA 5KPZA 5DYGA 2MH8A 3W0LB 4KLNA 4OVZB 5FTNA 5ITTA 4NOOB 4NSRA 3A45A 2BJWA 5EQTA 3M0EA 2JY7A 1WGNA 4LJ9A 2QHOB 3VKHA 5IREB 3TPZA 4MGZE 3WHKA 1VQ1A 4GC5A 2L2DA 1L2BA 3FTEA 3K9OA 2EKKA 3A98B 2JZ1A 4NXNM 3VLFB 2WSFF 1NY5A 1Z5AA 2OOBA 3TWKA 3U60A 4LF8M 5EP3A 4X64M 1IBLM 1EFUB 1R4GA 3HJQA 1DGFA 1OJLA 1WIVA 3GLHE 3D8LA 2APLA 3TWLA 5FTKA 2UXCM 3ZC7B 4JYAM 3QAUA 5KQ8A 3E21A 3GLIA 2UUBM 5BPVA 1NJGA 2D7HA 3SAUA 3GLFB 3IECA 4X66M 4B7FA 4LJ8A 2BJVA 2ZTDA 4I4LA 3GLGE 4AQYM 3KDSE 1RU3A 3PFIA 1HR0M 3C3DA 1IXRC 4GH9A 3B7QA 5C18A 5KPTA 5FTJA 2H1RA 2R45A 3GQ5A 1R6BX 2CV2A 1HJPA 1L1TA 1YSYA 1NV8A 2HWJA 4WW0A 2L4FA 1C1KA 3K92A 1KYIA 2KA6B 4DV5M 2EUCA 2DHYA 5DNYA 2XEPA 5C1BA 2KNZA 3LW5F 4FD2A 3GPXA 3B89A 4IBDA 2QQ8A 1F4IA 3C58A 5F3WA 2JXNA 3PVSA 1UM8A 1VEJA 2VDBB 3U5ZB 4DUZM 2Q2EB 1PJTA 4FWHA 1MJGM 2HKJA 3Q8GA 2R0IA 4AKIA 2KNVA 2XGNA 1KSFX 5ITQA 2BWBA 3U6QA 1Y8GA 4MB7A 1IN8A 2V1UA 2YR0A 2O25A 1G4AE 3GP1A 3GLHA 2HCBA 2Z4SA 4ZPXA 3I01M 2XZFA 1WXQA 5EXSA 4WURA 2KRUA 3K2LA 1XWIA 2KNAA 2LXEA 3KOWE 3SBJA 3LQQA 4R7GA 5BR8M 1FNNA 3GQ3A 2G3QA 4JV5M 3GPUA 2LVOC 3MJ5A 3LVWA 3HHZA 2CE7A 4ANRA 1N78A 2CRUA 3SMSA 3FUWA 2P5TA 1IY2A 2Y20A 1UFZA 4JI3M 1ZMWA 3GLGA 5LMUM 4B3SM 3R9XB 3VFDA 3I4VA 4FWGA 1GL7A 3CGWA 4HLQA 1JR3D 3U6PA 4P17A 8CATA 2F5SA 5EP2A 4B7GA 4B08A 2FS1A 4Q7JA 4GKJM 4NL4H 4KODA 5FTLA 3VDUA 1OFIA 4NC6A 1GABA 5IT9S 4EIWA 1XHBA 2ZM6M 1T6OA 3DA1A 1PM5A 1MN3A 4MH0E 2KRKA 3H4JA 1JR3E 4QOZC 4G3OA 3SYLA 2KDLA 4KO8A 4JI2M 1X37A 4LJ4A 2UUCM 2R18A 1JQJC 4IBGA 1TH4A 1XMOM 2EA0A 3L29A 5FLXS 1IBMM 1PJQA 1XNQM 1QQWA 1WGLA 4PCZA 4CIZA 4A3VB 2CV1A 4NRVA 4DR4M 1W5SA 3FTDA 4AKHA 4TUWA 1DO0A 5ITUA 3HJSA 4LFCM 1K82A 2R46A 2LVNC 4FW9A 4IIWA 3V76A 1D2NA 1V34A 1ZAEA 3FE3A 2YQZA 2D7GA 4M0DA 2Z7JA 4Z8XA 4S12A 2ZAOA 3D8BA 1OIPA 1Z59A 4DR6M 1T3TA 3IG8A 1QVRA 1ZMVA 3HU3A 3KSJA 4UN2B 3JR5A 2DAKA 3GRYA 1OTRA 4JI6M 4B3RM 3KP0E 4PT5A 4R71A 2XLJA 4NRWA 2XFTA 5EXPA 5JI3E 3FTCA 4OW0A 3HU2A 5GKNA 4D80A 4DV1M 2QSFX 2DAMA
chains in the Genus database with same CATH topology
4Y28F 2WSEF 4L6V6 1JB0F 4KT0F 2WSCF 4XK8F 5L8RF 4RKUF 2WSFF 2O01F 3LW5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 F;  2WSE F;  4L6V 6;  1JB0 F;  4KT0 F;  2WSC F;  4XK8 F;  5L8R F;  4RKU F;  2WSF F;  2O01 F;  3LW5 F; 
#chains in the Genus database with same CATH topology
 1VEG A;  2DNA A;  1I4W A;  2CP8 A;  2R65 A;  2ZAM A;  4DV2 M;  2ZBK B;  3T1H M;  3UZU A;  3I04 M;  4IBI A;  1IY0 A;  2DEN A;  2DKL A;  1GLN A;  2RGO A;  3HHX A;  3LVV A;  2D7E A;  3TWM A;  3U6C A;  3U61 B;  2E5L M;  4JI7 M;  3L2A A;  4LF5 M;  1QAO A;  2L09 A;  2WSC F;  1XXH B;  1SXJ B;  1JR3 A;  1W5T A;  2C9O A;  2C9C A;  3VDP A;  3ZQJ A;  2QCU A;  4CJ6 A;  1LTM A;  4DV6 M;  4IBJ A;  3RFW A;  2F5P A;  4AG5 A;  2CHG A;  2JNH A;  2QEN A;  2DWM A;  4RF1 A;  2H5X A;  4BBA A;  4LGY A;  3GLF E;  2OO9 A;  3K8Z A;  1OFH A;  2VF7 A;  3BOS A;  4OU7 A;  2JP7 A;  2N35 A;  4YY3 M;  2EJS A;  4JN6 A;  1D0K A;  3L26 A;  4LJ6 A;  3HHY A;  3U6E A;  2MGW A;  4JI1 M;  2KEB A;  4LFB M;  2C5R A;  2G8L A;  1IQP A;  1PRB A;  1OIZ A;  3W68 A;  4G4Q A;  1IXS A;  4PDI A;  3T38 A;  1IY1 A;  1K3X A;  2R4E A;  2L7I A;  2HAK A;  4L4U A;  2DHR A;  3GRR A;  4D81 A;  1HQC A;  2L7H A;  1PGY A;  2DWL A;  2Y0Q A;  2X4A A;  4GIP A;  2FOI C;  2KZU A;  2O01 F;  4IJE A;  5EP1 A;  2UU9 M;  2I7P A;  2LHC A;  3T6P A;  4B7H A;  3L27 A;  4L8R C;  1HNZ M;  1Q3C A;  1QAN A;  4M9X A;  2JUJ A;  4LGM A;  4LY6 A;  4OVZ A;  2HL7 A;  2KZS A;  3FD9 A;  1C7Y A;  2ERC A;  2X49 A;  1OQY A;  4CGY B;  3U6O A;  1CUK A;  2RKO A;  1QZE A;  4MM3 B;  5ITY A;  2CHV A;  1NNJ A;  1G8P A;  4DV3 M;  3AJI B;  2VQF M;  1QZM A;  4LF9 M;  2LWX A;  1GL6 A;  4FCT A;  1G3I A;  4M9S A;  1IN5 A;  1DGH B;  5ITR A;  1HNX M;  1IM2 A;  4JI5 M;  3BXW A;  2A5Y B;  3GPP A;  2C96 A;  3EIH A;  4I81 A;  2Z3X A;  3LCV B;  2RRU A;  1JB0 F;  1NVM A;  3JAM S;  1KFV A;  1J7K A;  4L15 A;  4YHH M;  4NXM M;  1IN7 A;  1GKI A;  3NBI A;  3J81 S;  1XMQ M;  4LF6 M;  2MR9 A;  2Z4R A;  3CF2 A;  1DV0 A;  1VDL A;  2CEA A;  1N33 M;  3QYE A;  1QAQ A;  4GHA A;  5KPR A;  3KVW A;  3SAS A;  4IBB A;  2B3T A;  3AV0 A;  1BVS A;  3W67 A;  3GLF A;  3U6S A;  1N34 M;  1XNR M;  4LCB A;  2DZL A;  3KOZ E;  3JR4 A;  1T43 A;  2QBY B;  1OAO C;  3ZCB B;  1P3Q Q;  4F2L A;  3E46 A;  3U6M A;  5EP4 A;  1J5E M;  3FRH A;  2JWS A;  4LZZ A;  3PXG A;  4G4N A;  2GNO A;  3Q8X A;  1G41 A;  2QPA A;  4XBO A;  4GEW A;  4HEO A;  2BWE A;  4QHS A;  3RGS A;  4DUY M;  3GQ4 A;  4DR7 M;  1GVN A;  5KO3 A;  3L25 A;  1PJJ A;  3DZD A;  4FCV A;  2UUA M;  1DGG A;  4GRI A;  1GO5 A;  2LVA A;  4JI4 M;  3ZH9 B;  2DVW B;  2QZ4 A;  3B7N A;  3HZJ A;  3IHP A;  3FKE A;  1I94 M;  4LJA A;  2CUZ A;  7CAT A;  5JI2 E;  2C98 A;  4IBK A;  3FUV A;  4P16 A;  1G71 A;  3LMM A;  3U60 B;  1J09 A;  2FFJ A;  2JY5 A;  2F5Q A;  3HJ8 A;  1IXZ A;  1E94 E;  3PNV A;  1QUS A;  3U5Z A;  1R5L A;  3I4Y A;  1NNU C;  2JY8 A;  5KQD A;  3CTW B;  4MGI E;  4FVM A;  1YLA A;  4WP2 A;  4Z6Y A;  3GRV A;  2EKF A;  2XH9 A;  3HX3 A;  3SYK A;  3GLI B;  1L8Q A;  2BNK A;  4DBG B;  2R6F A;  1L2C A;  1N32 M;  4PDG A;  3A46 A;  3FYD A;  2UXD M;  4AKG A;  3E4R A;  1TGU A;  2Z8Y M;  3KFU G;  3SFZ A;  4IBC A;  3TL4 X;  2KXE A;  3W0F A;  1TF0 B;  2DAI A;  3B7Z A;  4IJF A;  2NQ8 C;  4CHT B;  3UMM A;  1XC8 A;  3UGJ A;  3KOX E;  4DR1 M;  4MGH A;  3T15 A;  4LFA M;  4LRS A;  3AOE C;  3J80 S;  2HHH M;  4B3M M;  4REZ A;  5E6J A;  4OX9 M;  1D0M A;  2R62 A;  4DR3 M;  1PJS A;  3OTO M;  4I5S A;  2K6B A;  4M0W A;  2ZAN A;  3A42 A;  4ITQ A;  3M6A A;  1N77 A;  4L6V 6;  4LF7 M;  4GHL A;  4DV0 M;  2DWZ B;  3NWL A;  1NJF A;  1SXJ D;  3TQS A;  1TDZ A;  4W5W A;  1E32 A;  3NBX X;  2QNJ A;  3GRU A;  4JI0 M;  1NSF A;  2LTU A;  4RKU F;  1K3W A;  2Y0T A;  2F4V M;  3C9P A;  1ZQ9 A;  1E9R A;  1QAM A;  1N75 A;  1QUT A;  2LH0 A;  2R44 A;  3EIE A;  4II7 A;  1GJS A;  3VKG A;  3MHV C;  2LBC A;  2K9D A;  2XSZ A;  1R7R A;  1DO2 A;  2YFQ A;  1S3S A;  3KS4 A;  4LJ7 A;  4FCW A;  1Q39 A;  2EO2 A;  1XXH E;  1HT2 E;  1SXJ E;  4I8O A;  4M9Z A;  3SMP A;  3GLH B;  2VF8 A;  1HQY E;  5ITX E;  3HHW A;  4QOS A;  2VQE M;  2X8A A;  4R3D A;  4B3T M;  4LF4 M;  2UXB M;  5H37 D;  2F5O A;  1Z6T A;  2QP9 X;  3FRI A;  1SXJ C;  1D0L A;  4AW4 A;  5DYI A;  2LHG A;  2FE8 A;  2J7N A;  3AOE A;  1MU5 A;  4IBF A;  4L16 A;  3HU1 A;  5IZ7 D;  2OOA A;  3AL0 C;  3GLG B;  1EE8 A;  2MJ5 B;  2OPF A;  2M5Z A;  5IWA M;  3GPY A;  3C3E A;  4MGK E;  4AI6 A;  4LJ5 A;  4KHP M;  1GJT A;  3J2P B;  2W82 A;  2XF3 A;  1FJG M;  1DGB A;  1NY6 A;  1TTE A;  3FUT A;  4BLC A;  3DFZ A;  2KW0 A;  3WHL A;  3I51 A;  4DV4 M;  3VK7 A;  1XB2 B;  4Y28 F;  3CF6 E;  3SAW A;  4G4R A;  4F1I A;  1A5T A;  2L4E A;  1WR1 B;  3AFH A;  3QYB A;  4BB9 A;  3L28 A;  4RNA A;  3RE8 A;  3M7G A;  4GMQ A;  1V92 A;  2LNH C;  4G4O A;  4FWD A;  5A2Q S;  5DFL A;  3DOA A;  3MK6 A;  3FTF A;  3TE6 A;  1MX0 A;  2FH0 A;  5E26 A;  3J7A S;  3KXE C;  1YE9 A;  1VDD A;  2CWB A;  3FUU A;  5EXX A;  3HY5 A;  3HKP A;  2MRO B;  4MGY E;  3U61 A;  4XK8 F;  3FUX A;  4L78 A;  4HL4 A;  2AHM A;  1YUB A;  1XXH A;  2F5N A;  1SXJ A;  1ZV1 A;  1G59 A;  3QWL A;  2DAG A;  3SAT A;  3H4M A;  3SC3 A;  5ITX A;  5L8R F;  2GQF A;  1L2D A;  4LRT A;  3GO8 A;  3CF0 A;  4DV7 M;  3UK6 A;  4PD2 A;  4QHT A;  4XGI A;  2JA2 A;  2LVQ D;  2YNM D;  1AUA A;  3SHF A;  2K47 A;  1TH3 A;  3SAV A;  4KT0 F;  1NV9 A;  2KHH A;  1QYR A;  4GC9 A;  2XSZ D;  3BBZ A;  3K9P A;  4JXJ A;  3T1Y M;  1PJI A;  3UJN A;  4CIS A;  3MMP A;  1AIP C;  3FYC A;  1VEK A;  2J5Y A;  3IG5 A;  2DZN B;  3HWS A;  1TDH A;  2C99 A;  4G6Z A;  2DAE A;  2JY6 B;  1E9S A;  2J7O A;  4NSO B;  4QNR A;  1L1Z A;  2L6O A;  1HNW M;  2DZO B;  3PNY A;  1OAI A;  3SAR A;  3KSX A;  4X65 M;  5EXT A;  2V1C A;  5EJC A;  1QDR A;  3KW6 A;  3LCU A;  5FSW A;  2CV0 A;  2FNA A;  3KS8 A;  5LMN M;  2I7N A;  1SG9 A;  2JZ0 A;  3J27 B;  3KOY E;  2OQ4 A;  2WSE F;  1TR8 A;  3F92 A;  4DR5 M;  1EIJ A;  3J7B A;  1N36 M;  3VK8 A;  4JI8 M;  3SHG B;  3E9S A;  3U6D A;  1QDT A;  4IBE A;  1Q3B A;  4GKK M;  1HT1 E;  4AZF A;  3AOG A;  1LV7 A;  3KP1 E;  2Y21 A;  3RGP A;  1WJ7 A;  2K0B X;  1IFY A;  3GLI E;  1R2Z A;  1OKS A;  2DXI A;  4QNM A;  1DGH A;  2XZU A;  2WZJ A;  4K0K M;  2XFS A;  1R2Y A;  1ZMU A;  2VII A;  1Q02 A;  3R8F A;  2CFO A;  2DWN A;  3HGI A;  1NHW C;  4X62 M;  2RGH A;  1NHG C;  1VG5 A;  3ILK A;  3K1J A;  2V6Z M;  2O5R A;  4D82 A;  2DI0 A;  3B9P A;  1V33 A;  2LVP C;  1IXS B;  1IN6 A;  4RF0 A;  1NO1 A;  1ORY B;  1WHC A;  1IBK M;  4AG6 A;  2R4J A;  1IN4 A;  2CHQ A;  2G5G X;  3THG A;  2ZTC A;  3U6L A;  3B74 A;  4GIT A;  4LZJ A;  1Z5C A;  2QBY A;  4LG2 A;  1Z5B A;  1TH2 A;  5FTM A;  3AKZ A;  4DR2 M;  3LQR A;  2M60 A;  1H6U A;  5KPZ A;  5DYG A;  2MH8 A;  3W0L B;  4KLN A;  4OVZ B;  5FTN A;  5ITT A;  4NOO B;  4NSR A;  3A45 A;  2BJW A;  5EQT A;  3M0E A;  2JY7 A;  1WGN A;  4LJ9 A;  2QHO B;  3VKH A;  5IRE B;  3TPZ A;  4MGZ E;  3WHK A;  1VQ1 A;  4GC5 A;  2L2D A;  1L2B A;  3FTE A;  3K9O A;  2EKK A;  3A98 B;  2JZ1 A;  4NXN M;  3VLF B;  2WSF F;  1NY5 A;  1Z5A A;  2OOB A;  3TWK A;  3U60 A;  4LF8 M;  5EP3 A;  4X64 M;  1IBL M;  1EFU B;  1R4G A;  3HJQ A;  1DGF A;  1OJL A;  1WIV A;  3GLH E;  3D8L A;  2APL A;  3TWL A;  5FTK A;  2UXC M;  3ZC7 B;  4JYA M;  3QAU A;  5KQ8 A;  3E21 A;  3GLI A;  2UUB M;  5BPV A;  1NJG A;  2D7H A;  3SAU A;  3GLF B;  3IEC A;  4X66 M;  4B7F A;  4LJ8 A;  2BJV A;  2ZTD A;  4I4L A;  3GLG E;  4AQY M;  3KDS E;  1RU3 A;  3PFI A;  1HR0 M;  3C3D A;  1IXR C;  4GH9 A;  3B7Q A;  5C18 A;  5KPT A;  5FTJ A;  2H1R A;  2R45 A;  3GQ5 A;  1R6B X;  2CV2 A;  1HJP A;  1L1T A;  1YSY A;  1NV8 A;  2HWJ A;  4WW0 A;  2L4F A;  1C1K A;  3K92 A;  1KYI A;  2KA6 B;  4DV5 M;  2EUC A;  2DHY A;  5DNY A;  2XEP A;  5C1B A;  2KNZ A;  3LW5 F;  4FD2 A;  3GPX A;  3B89 A;  4IBD A;  2QQ8 A;  1F4I A;  3C58 A;  5F3W A;  2JXN A;  3PVS A;  1UM8 A;  1VEJ A;  2VDB B;  3U5Z B;  4DUZ M;  2Q2E B;  1PJT A;  4FWH A;  1MJG M;  2HKJ A;  3Q8G A;  2R0I A;  4AKI A;  2KNV A;  2XGN A;  1KSF X;  5ITQ A;  2BWB A;  3U6Q A;  1Y8G A;  4MB7 A;  1IN8 A;  2V1U A;  2YR0 A;  2O25 A;  1G4A E;  3GP1 A;  3GLH A;  2HCB A;  2Z4S A;  4ZPX A;  3I01 M;  2XZF A;  1WXQ A;  5EXS A;  4WUR A;  2KRU A;  3K2L A;  1XWI A;  2KNA A;  2LXE A;  3KOW E;  3SBJ A;  3LQQ A;  4R7G A;  5BR8 M;  1FNN A;  3GQ3 A;  2G3Q A;  4JV5 M;  3GPU A;  2LVO C;  3MJ5 A;  3LVW A;  3HHZ A;  2CE7 A;  4ANR A;  1N78 A;  2CRU A;  3SMS A;  3FUW A;  2P5T A;  1IY2 A;  2Y20 A;  1UFZ A;  4JI3 M;  1ZMW A;  3GLG A;  5LMU M;  4B3S M;  3R9X B;  3VFD A;  3I4V A;  4FWG A;  1GL7 A;  3CGW A;  4HLQ A;  1JR3 D;  3U6P A;  4P17 A;  8CAT A;  2F5S A;  5EP2 A;  4B7G A;  4B08 A;  2FS1 A;  4Q7J A;  4GKJ M;  4NL4 H;  4KOD A;  5FTL A;  3VDU A;  1OFI A;  4NC6 A;  1GAB A;  5IT9 S;  4EIW A;  1XHB A;  2ZM6 M;  1T6O A;  3DA1 A;  1PM5 A;  1MN3 A;  4MH0 E;  2KRK A;  3H4J A;  1JR3 E;  4QOZ C;  4G3O A;  3SYL A;  2KDL A;  4KO8 A;  4JI2 M;  1X37 A;  4LJ4 A;  2UUC M;  2R18 A;  1JQJ C;  4IBG A;  1TH4 A;  1XMO M;  2EA0 A;  3L29 A;  5FLX S;  1IBM M;  1PJQ A;  1XNQ M;  1QQW A;  1WGL A;  4PCZ A;  4CIZ A;  4A3V B;  2CV1 A;  4NRV A;  4DR4 M;  1W5S A;  3FTD A;  4AKH A;  4TUW A;  1DO0 A;  5ITU A;  3HJS A;  4LFC M;  1K82 A;  2R46 A;  2LVN C;  4FW9 A;  4IIW A;  3V76 A;  1D2N A;  1V34 A;  1ZAE A;  3FE3 A;  2YQZ A;  2D7G A;  4M0D A;  2Z7J A;  4Z8X A;  4S12 A;  2ZAO A;  3D8B A;  1OIP A;  1Z59 A;  4DR6 M;  1T3T A;  3IG8 A;  1QVR A;  1ZMV A;  3HU3 A;  3KSJ A;  4UN2 B;  3JR5 A;  2DAK A;  3GRY A;  1OTR A;  4JI6 M;  4B3R M;  3KP0 E;  4PT5 A;  4R71 A;  2XLJ A;  4NRW A;  2XFT A;  5EXP A;  5JI3 E;  3FTC A;  4OW0 A;  3HU2 A;  5GKN A;  4D80 A;  4DV1 M;  2QSF X;  2DAM A; 
#chains in the Genus database with same CATH homology
 4Y28 F;  2WSE F;  4L6V 6;  1JB0 F;  4KT0 F;  2WSC F;  4XK8 F;  5L8R F;  4RKU F;  2WSF F;  2O01 F;  3LW5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...