1JB0F

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPHLVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEIIIDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 1jb0F00
2WSEF 5L8RF 3LW5F 1JB0F 4RKUF 4KT0F 4Y28F 2WSFF 4XK8F 2O01F 4L6V6 2WSCF
chains in the Genus database with same CATH superfamily
1PGYA 2MJ5B 2KHHA 3PNYA 4PT5A 4F1IA 5ITRA 1SXJD 3FUVA 2CFOA 2EUCA 2L4FA 1N77A 3SC3A 1SXJC 2FS1A 3HZJA 1VEGA 3KDSE 2Z3XA 4CIZA 2KRUA 4RKUF 5LMNM 1N32M 4G4NA 2Y21A 2CEAA 3SMPA 2DKLA 2Q2EB 4NXNM 1G3IA 4OVZB 3GQ4A 2XH9A 4DV0M 4D82A 2FOIC 3K92A 2L09A 4LRSA 2B3TA 4REZA 4LGMA 4KHPM 4AG6A 3FYDA 4IIWA 4CGYB 5EQTA 4AKGA 2R45A 3GO8A 1NVMA 2XSZA 4B7GA 3I4VA 4B3RM 1EIJA 3FUUA 1GO5A 1G71A 4Q7JA 3CF6E 4G6ZA 2APLA 2G5GX 2OOAA 1ZMWA 3THGA 3VK7A 4PCZA 2C9CA 4FWHA 2KDLA 1T43A 3J7BA 3BBZA 1A5TA 1IN5A 2DZLA 2KNAA 3Q8XA 3D8LA 4G4OA 3MK6A 2JY7A 4DR5M 2KXEA 4DV4M 2K9DA 1PJSA 2UXBM 3FRIA 2RGHA 1EFUB 2L4EA 3HY5A 3SATA 3HKPA 3GRUA 1QUSA 3SHFA 2UU9M 3UGJA 5E26A 3GLFE 2BNKA 2LVPC 3CF2A 4QHSA 3QYBA 3W0FA 3TWKA 2KA6B 5ITYA 1IN6A 4Y28F 4G4QA 3KOYE 1IBKM 1HT1E 1OQYA 2CE7A 1L1ZA 1OTRA 2KZSA 4LZZA 5C1BA 3UJNA 4LJ5A 3SYLA 5EP3A 1IM2A 1V92A 1QAQA 4LJ8A 1G8PA 3UK6A 4BB9A 4DV5M 3T1YM 4CJ6A 1K3XA 3A98B 2XF3A 1IXSA 2QHOB 4JI8M 1DGFA 4PDIA 4FCWA 3GLFA 1XWIA 2GQFA 2UXCM 3I51A 1XMOM 3IG8A 3VDPA 4M9XA 3W0LB 3GLIB 5KQ8A 3ZCBB 3GRYA 3TL4X 1NJFA 3U61A 3H4JA 4NRWA 3AFHA 2N35A 2L7IA 2DHRA 3L29A 4MH0E 1DO2A 2QQ8A 2JA2A 1OFHA 5IT9S 3TQSA 7CATA 1WIVA 3U6CA 3HU1A 2KW0A 4GHLA 2R18A 1WJ7A 2DXIA 1BVSA 2XEPA 3U5ZB 3FKEA 2CP8A 1Z59A 4QOSA 3W68A 2CV0A 1F4IA 1D2NA 3T38A 4IJEA 2JXNA 2BWEA 1H6UA 1L8QA 2ZAOA 4ZPXA 4I8OA 2F5QA 3QAUA 2O25A 3MJ5A 1DV0A 2QENA 3JR5A 2KRKA 3FTEA 4LF6M 2C5RA 1C7YA 2LH0A 3IECA 4AKHA 1GVNA 1GKIA 4B08A 4GKKM 3LQQA 2MR9A 1MX0A 2R44A 4G3OA 1ZAEA 2JY6B 3JR4A 3AL0C 4PD2A 2XLJA 4M0DA 8CATA 3QWLA 4L8RC 4LF5M 4XBOA 1VEKA 2YNMD 4DR2M 1N34M 4AZFA 2CRUA 4R71A 2WZJA 3E46A 1IFYA 1QQWA 5C18A 5ITQA 2DHYA 4GITA 4LZJA 4LCBA 3HHXA 5EJCA 2ZANA 2VQEM 3SAWA 1PM5A 3U6MA 1TH2A 2VIIA 3T6PA 4UN2B 3ZH9B 3GQ5A 4FW9A 5KPZA 1I94M 4LJ6A 5FTLA 4HEOA 3GLGA 1XHBA 2RGOA 4L6V6 2L2DA 3HWSA 2LBCA 3FD9A 3KVWA 4DV7M 1IBMM 4JI7M 5EP2A 2QCUA 2DWNA 1HT2E 4DBGB 4GKJM 4B3MM 1DGGA 1J7KA 2JY5A 3SAUA 3WHKA 4OW0A 2QPAA 4DUYM 5H37D 4QNMA 2WSFF 2EJSA 4JN6A 1NHWC 2XZFA 1JR3E 5FTMA 3I04M 3GLHE 1XNRM 4YY3M 3KP0E 2CWBA 2V1CA 2OOBA 4MGZE 2YQZA 4R3DA 2KNZA 1AUAA 5EXTA 4PDGA 5DYGA 4FWGA 5FTKA 1K3WA 1E32A 1WR1B 1IXSB 4DR3M 3HJ8A 2MGWA 3IHPA 5EP4A 3GLFB 1MU5A 1JR3A 2Z4SA 2LVOC 4WURA 3CGWA 3U6EA 4XGIA 1NHGC 4HLQA 1K82A 3PVSA 3U61B 4IBCA 1TDHA 3L26A 4LJ4A 5FLXS 1OIZA 1VDDA 1UFZA 3RGSA 2CV1A 2A5YB 3R9XB 1G41A 4LFAM 5ITXE 3J27B 5LMUM 1W5TA 3E21A 4EIWA 3A45A 5BPVA 2I7PA 3KOXE 3AJIB 4XK8F 2C9OA 3U6DA 1XMQM 3K9OA 2ZTDA 2HAKA 3LCUA 2LHGA 1SXJE 2L7HA 2LWXA 4QOZC 5IREB 1HNZM 1QDRA 2R6FA 3GPPA 2R46A 3A46A 1NNJA 5L8RF 5KPRA 2C96A 4GIPA 2QP9X 4IBIA 5FTJA 1HR0M 2V1UA 4JI5M 2XGNA 2X8AA 1YE9A 4JI0M 4B3TM 2Z7JA 1TR8A 4LJAA 1OFIA 1TF0B 2UUBM 3B89A 5DYIA 1R6BX 1IN4A 4IBKA 3RFWA 4FVMA 4IBEA 3TWLA 1TGUA 1NJGA 2YR0A 4MGIE 1JQJC 3A42A 2ZBKB 2EKFA 3NWLA 4L16A 1WGLA 4JI6M 3LMMA 1CUKA 3VKGA 1GL7A 3AOGA 2R0IA 5E6JA 4AG5A 3GLGB 2Y0TA 3VFDA 3TWMA 3VKHA 2DWZB 2LHCA 4NSOB 1IY2A 4LF7M 1IQPA 1TH4A 2DAEA 3HGIA 3KSJA 4R7GA 4OX9M 1UM8A 1X37A 2R65A 3B7ZA 3C58A 3GPYA 1W5SA 2BJVA 2JNHA 3V76A 2JZ0A 4D81A 3PNVA 2EO2A 1IN8A 1Z6TA 4GHAA 1XNQM 2YFQA 2Y20A 3L25A 3K9PA 2M60A 4FWDA 3C3DA 3AKZA 4IBDA 1IBLM 1FJGM 4LJ7A 4LF4M 4JV5M 3GPXA 4KODA 1IN7A 3K1JA 4WW0A 1E9RA 3KP1E 2DAMA 4ITQA 2OPFA 3GRRA 4M0WA 2F5NA 2H1RA 2P5TA 2J5YA 1V33A 4GC9A 2F4VM 3I01M 4RNAA 1AIPC 2WSEF 1E94E 4FCVA 3HU3A 4NOOB 5EXSA 2HCBA 5F3WA 1LTMA 3HJSA 2LVNC 4QHTA 1T3TA 4YHHM 3ILKA 2VQFM 2D7HA 4GC5A 4F2LA 2DVWB 1NSFA 2LVAA 3GP1A 1P3QQ 4JI3M 4DV6M 3J81S 1GABA 4D80A 3K2LA 4HL4A 4DV1M 1Z5CA 3JAMS 1DO0A 3WHLA 4IBFA 4AKIA 2FH0A 3GRVA 4JYAM 2BJWA 3FUTA 1Q02A 4DR6M 3B74A 2R4EA 3NBXX 1NNUC 2CHQA 2QZ4A 2LXEA 1C1KA 3U6LA 2D7GA 5GKNA 1DGHA 1PJJA 4FD2A 2QBYA 4GH9A 1HNWM 1ZV1A 1LV7A 3R8FA 1OIPA 3FTCA 4NXMM 2KNVA 2FE8A 2XFTA 1D0MA 2DAKA 3F92A 3NBIA 5DFLA 4MB7A 3FUWA 4OU7A 4B3SM 2QNJA 2VDBB 1QVRA 3W67A 3C9PA 3SASA 2OQ4A 1MN3A 3FYCA 2FFJA 3H4MA 2O01F 1OAOC 2VF7A 4MGHA 4DR1M 2F5OA 1Q3CA 2DAGA 3T15A 1WGNA 2LVQD 2XSZD 1G4AE 3KXEC 3LCVB 4I81A 2HL7A 1R4GA 3GLHA 2DWLA 3L2AA 1R2ZA 1KFVA 1G59A 1TDZA 2F5SA 3MMPA 1EE8A 4I4LA 4B7FA 3FTFA 4MGKE 1GJSA 3BOSA 1TH3A 2V6ZM 2O5RA 1NO1A 1ZMVA 1TTEA 2RRUA 4AQYM 3AOEA 5A2QS 3U6QA 3CTWB 2CV2A 1Q39A 1VG5A 2X49A 2WSCF 1WHCA 2KEBA 3M0EA 4X64M 2UXDM 3U6PA 3RGPA 4AW4A 4KLNA 1DGBA 3U60A 3Q8GA 2GNOA 5ITXA 1L1TA 1Z5AA 1PJTA 3T1HM 1KYIA 3DA1A 3FUXA 2F5PA 3E9SA 3M7GA 5EXPA 5IZ7D 1MJGM 2DZNB 4X66M 4DV3M 2Y0QA 2I7NA 3C3EA 2BWBA 4QNRA 3BXWA 1NY6A 1SXJA 3EIHA 1L2DA 1PJQA 4AI6A 3U6SA 1E9SA 3LVWA 4DR7M 2KZUA 4LF9M 4L15A 5KQDA 5JI2E 1QAOA 1NV9A 4P17A 2EKKA 4DR4M 1N33M 4IBBA 3SAVA 3B9PA 3SYKA 2UUAM 1L2BA 1XXHE 4DUZM 1YLAA 5EP1A 1IY0A 3PXGA 3KOWE 1R2YA 2LTUA 2K0BX 2OO9A 4L4UA 1HQYE 3MHVC 3SMSA 3UMMA 3VDUA 2XFSA 3FTDA 1QAMA 1R7RA 2HKJA 3KOZE 4II7A 1XXHA 1N78A 4IJFA 4A3VB 4MGYE 1DGHB 2DENA 2JZ1A 3AV0A 5IWAM 2QBYB 2MROB 3KS8A 1HQCA 3CF0A 2EA0A 3TE6A 3U6OA 2CUZA 2JUJA 4FCTA 4NC6A 1OAIA 3DZDA 4NRVA 5EXXA 3J80S 5KPTA 3KW6A 2CHGA 1QANA 2ZTCA 2Z4RA 3K8ZA 2Z8YM 1S3SA 4KT0F 4L78A 1GJTA 2DNAA 5ITTA 3ZC7B 1VQ1A 4RF1A 5DNYA 1D0LA 1IXZA 4Z8XA 2D7EA 4M9SA 3SBJA 4CISA 3KFUG 3DOAA 2ZM6M 3TPZA 2E5LM 3VLFB 4OVZA 3GLHB 4CHTB 2FNAA 1VEJA 4IBJA 4BLCA 1Y8GA 1PRBA 3M6AA 4LGYA 4JI4M 3KSXA 5ITUA 2UUCM 2HWJA 3HHYA 4Z6YA 3FE3A 3KS4A 3GPUA 1HJPA 1OJLA 1QZMA 2CHVA 4JXJA 1V34A 1IXRC 2K6BA 3HU2A 4LFCM 4X65M 4LF8M 3D8BA 3L27A 1YUBA 2R62A 2DWMA 4LRTA 1N36M 1N75A 2MH8A 4DV2M 2W82A 2NQ8C 3FRHA 5KO3A 3HHZA 4NL4H 3SFZA 1I4WA 2M5ZA 1ZMUA 2ERCA 3J2PB 1GLNA 4S12A 3U60B 4TUWA 3HHWA 1J09A 4B7HA 1XC8A 2ZAMA 4KO8A 2J7NA 3RE8A 3LW5F 1JB0F 4RF0A 1QYRA 2AHMA 2DAIA 2QSFX 4ANRA 3GLGE 4LG2A 4K0KM 1L2CA 1SXJB 1QDTA 2L6OA 2VF8A 1HNXM 3GLIE 1JR3D 1ZQ9A 3J7AS 1OKSA 3QYEA 1YSYA 5FSWA 4LFBM 2X4AA 4JI2M 1NV8A 4GRIA 3ZQJA 3L28A 4M9ZA 2DZOB 2G8LA 1ORYB 4W5WA 2G3QA 3DFZA 3PFIA 4P16A 4GMQA 3EIEA 2DI0A 4WP2A 1QZEA 1KSFX 3IG5A 4JI1M 4LY6A 1GL6A 2H5XA 3UZUA 3OTOM 1J5EM 1SG9A 3B7QA 3GLIA 3HX3A 2JWSA 2C99A 2JP7A 4GEWA 3AOEC 4IBGA 3I4YA 2R4JA 5JI3E 3LQRA 2J7OA 1XB2B 4LJ9A 1D0KA 1PJIA 3SARA 2RKOA 2K47A 1R5LA 1IY1A 2JY8A 3B7NA 3E4RA 3HJQA 4I5SA 2C98A 4MM3B 4NSRA 5FTNA 5BR8M 3VK8A 4G4RA 1FNNA 2XZUA 1QUTA 1XXHB 1Q3BA 1Z5BA 4BBAA 1WXQA 2HHHM 1NY5A 3SHGB 2LNHC 3GQ3A 1VDLA 3U5ZA 1T6OA 4X62M 3LVVA 1RU3A
chains in the Genus database with same CATH topology
2WSEF 5L8RF 3LW5F 1JB0F 4RKUF 4KT0F 4Y28F 2WSFF 4XK8F 2O01F 4L6V6 2WSCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE F;  5L8R F;  3LW5 F;  1JB0 F;  4RKU F;  4KT0 F;  4Y28 F;  2WSF F;  4XK8 F;  2O01 F;  4L6V 6;  2WSC F; 
#chains in the Genus database with same CATH topology
 1PGY A;  2MJ5 B;  2KHH A;  3PNY A;  4PT5 A;  4F1I A;  5ITR A;  1SXJ D;  3FUV A;  2CFO A;  2EUC A;  2L4F A;  1N77 A;  3SC3 A;  1SXJ C;  2FS1 A;  3HZJ A;  1VEG A;  3KDS E;  2Z3X A;  4CIZ A;  2KRU A;  4RKU F;  5LMN M;  1N32 M;  4G4N A;  2Y21 A;  2CEA A;  3SMP A;  2DKL A;  2Q2E B;  4NXN M;  1G3I A;  4OVZ B;  3GQ4 A;  2XH9 A;  4DV0 M;  4D82 A;  2FOI C;  3K92 A;  2L09 A;  4LRS A;  2B3T A;  4REZ A;  4LGM A;  4KHP M;  4AG6 A;  3FYD A;  4IIW A;  4CGY B;  5EQT A;  4AKG A;  2R45 A;  3GO8 A;  1NVM A;  2XSZ A;  4B7G A;  3I4V A;  4B3R M;  1EIJ A;  3FUU A;  1GO5 A;  1G71 A;  4Q7J A;  3CF6 E;  4G6Z A;  2APL A;  2G5G X;  2OOA A;  1ZMW A;  3THG A;  3VK7 A;  4PCZ A;  2C9C A;  4FWH A;  2KDL A;  1T43 A;  3J7B A;  3BBZ A;  1A5T A;  1IN5 A;  2DZL A;  2KNA A;  3Q8X A;  3D8L A;  4G4O A;  3MK6 A;  2JY7 A;  4DR5 M;  2KXE A;  4DV4 M;  2K9D A;  1PJS A;  2UXB M;  3FRI A;  2RGH A;  1EFU B;  2L4E A;  3HY5 A;  3SAT A;  3HKP A;  3GRU A;  1QUS A;  3SHF A;  2UU9 M;  3UGJ A;  5E26 A;  3GLF E;  2BNK A;  2LVP C;  3CF2 A;  4QHS A;  3QYB A;  3W0F A;  3TWK A;  2KA6 B;  5ITY A;  1IN6 A;  4Y28 F;  4G4Q A;  3KOY E;  1IBK M;  1HT1 E;  1OQY A;  2CE7 A;  1L1Z A;  1OTR A;  2KZS A;  4LZZ A;  5C1B A;  3UJN A;  4LJ5 A;  3SYL A;  5EP3 A;  1IM2 A;  1V92 A;  1QAQ A;  4LJ8 A;  1G8P A;  3UK6 A;  4BB9 A;  4DV5 M;  3T1Y M;  4CJ6 A;  1K3X A;  3A98 B;  2XF3 A;  1IXS A;  2QHO B;  4JI8 M;  1DGF A;  4PDI A;  4FCW A;  3GLF A;  1XWI A;  2GQF A;  2UXC M;  3I51 A;  1XMO M;  3IG8 A;  3VDP A;  4M9X A;  3W0L B;  3GLI B;  5KQ8 A;  3ZCB B;  3GRY A;  3TL4 X;  1NJF A;  3U61 A;  3H4J A;  4NRW A;  3AFH A;  2N35 A;  2L7I A;  2DHR A;  3L29 A;  4MH0 E;  1DO2 A;  2QQ8 A;  2JA2 A;  1OFH A;  5IT9 S;  3TQS A;  7CAT A;  1WIV A;  3U6C A;  3HU1 A;  2KW0 A;  4GHL A;  2R18 A;  1WJ7 A;  2DXI A;  1BVS A;  2XEP A;  3U5Z B;  3FKE A;  2CP8 A;  1Z59 A;  4QOS A;  3W68 A;  2CV0 A;  1F4I A;  1D2N A;  3T38 A;  4IJE A;  2JXN A;  2BWE A;  1H6U A;  1L8Q A;  2ZAO A;  4ZPX A;  4I8O A;  2F5Q A;  3QAU A;  2O25 A;  3MJ5 A;  1DV0 A;  2QEN A;  3JR5 A;  2KRK A;  3FTE A;  4LF6 M;  2C5R A;  1C7Y A;  2LH0 A;  3IEC A;  4AKH A;  1GVN A;  1GKI A;  4B08 A;  4GKK M;  3LQQ A;  2MR9 A;  1MX0 A;  2R44 A;  4G3O A;  1ZAE A;  2JY6 B;  3JR4 A;  3AL0 C;  4PD2 A;  2XLJ A;  4M0D A;  8CAT A;  3QWL A;  4L8R C;  4LF5 M;  4XBO A;  1VEK A;  2YNM D;  4DR2 M;  1N34 M;  4AZF A;  2CRU A;  4R71 A;  2WZJ A;  3E46 A;  1IFY A;  1QQW A;  5C18 A;  5ITQ A;  2DHY A;  4GIT A;  4LZJ A;  4LCB A;  3HHX A;  5EJC A;  2ZAN A;  2VQE M;  3SAW A;  1PM5 A;  3U6M A;  1TH2 A;  2VII A;  3T6P A;  4UN2 B;  3ZH9 B;  3GQ5 A;  4FW9 A;  5KPZ A;  1I94 M;  4LJ6 A;  5FTL A;  4HEO A;  3GLG A;  1XHB A;  2RGO A;  4L6V 6;  2L2D A;  3HWS A;  2LBC A;  3FD9 A;  3KVW A;  4DV7 M;  1IBM M;  4JI7 M;  5EP2 A;  2QCU A;  2DWN A;  1HT2 E;  4DBG B;  4GKJ M;  4B3M M;  1DGG A;  1J7K A;  2JY5 A;  3SAU A;  3WHK A;  4OW0 A;  2QPA A;  4DUY M;  5H37 D;  4QNM A;  2WSF F;  2EJS A;  4JN6 A;  1NHW C;  2XZF A;  1JR3 E;  5FTM A;  3I04 M;  3GLH E;  1XNR M;  4YY3 M;  3KP0 E;  2CWB A;  2V1C A;  2OOB A;  4MGZ E;  2YQZ A;  4R3D A;  2KNZ A;  1AUA A;  5EXT A;  4PDG A;  5DYG A;  4FWG A;  5FTK A;  1K3W A;  1E32 A;  1WR1 B;  1IXS B;  4DR3 M;  3HJ8 A;  2MGW A;  3IHP A;  5EP4 A;  3GLF B;  1MU5 A;  1JR3 A;  2Z4S A;  2LVO C;  4WUR A;  3CGW A;  3U6E A;  4XGI A;  1NHG C;  4HLQ A;  1K82 A;  3PVS A;  3U61 B;  4IBC A;  1TDH A;  3L26 A;  4LJ4 A;  5FLX S;  1OIZ A;  1VDD A;  1UFZ A;  3RGS A;  2CV1 A;  2A5Y B;  3R9X B;  1G41 A;  4LFA M;  5ITX E;  3J27 B;  5LMU M;  1W5T A;  3E21 A;  4EIW A;  3A45 A;  5BPV A;  2I7P A;  3KOX E;  3AJI B;  4XK8 F;  2C9O A;  3U6D A;  1XMQ M;  3K9O A;  2ZTD A;  2HAK A;  3LCU A;  2LHG A;  1SXJ E;  2L7H A;  2LWX A;  4QOZ C;  5IRE B;  1HNZ M;  1QDR A;  2R6F A;  3GPP A;  2R46 A;  3A46 A;  1NNJ A;  5L8R F;  5KPR A;  2C96 A;  4GIP A;  2QP9 X;  4IBI A;  5FTJ A;  1HR0 M;  2V1U A;  4JI5 M;  2XGN A;  2X8A A;  1YE9 A;  4JI0 M;  4B3T M;  2Z7J A;  1TR8 A;  4LJA A;  1OFI A;  1TF0 B;  2UUB M;  3B89 A;  5DYI A;  1R6B X;  1IN4 A;  4IBK A;  3RFW A;  4FVM A;  4IBE A;  3TWL A;  1TGU A;  1NJG A;  2YR0 A;  4MGI E;  1JQJ C;  3A42 A;  2ZBK B;  2EKF A;  3NWL A;  4L16 A;  1WGL A;  4JI6 M;  3LMM A;  1CUK A;  3VKG A;  1GL7 A;  3AOG A;  2R0I A;  5E6J A;  4AG5 A;  3GLG B;  2Y0T A;  3VFD A;  3TWM A;  3VKH A;  2DWZ B;  2LHC A;  4NSO B;  1IY2 A;  4LF7 M;  1IQP A;  1TH4 A;  2DAE A;  3HGI A;  3KSJ A;  4R7G A;  4OX9 M;  1UM8 A;  1X37 A;  2R65 A;  3B7Z A;  3C58 A;  3GPY A;  1W5S A;  2BJV A;  2JNH A;  3V76 A;  2JZ0 A;  4D81 A;  3PNV A;  2EO2 A;  1IN8 A;  1Z6T A;  4GHA A;  1XNQ M;  2YFQ A;  2Y20 A;  3L25 A;  3K9P A;  2M60 A;  4FWD A;  3C3D A;  3AKZ A;  4IBD A;  1IBL M;  1FJG M;  4LJ7 A;  4LF4 M;  4JV5 M;  3GPX A;  4KOD A;  1IN7 A;  3K1J A;  4WW0 A;  1E9R A;  3KP1 E;  2DAM A;  4ITQ A;  2OPF A;  3GRR A;  4M0W A;  2F5N A;  2H1R A;  2P5T A;  2J5Y A;  1V33 A;  4GC9 A;  2F4V M;  3I01 M;  4RNA A;  1AIP C;  2WSE F;  1E94 E;  4FCV A;  3HU3 A;  4NOO B;  5EXS A;  2HCB A;  5F3W A;  1LTM A;  3HJS A;  2LVN C;  4QHT A;  1T3T A;  4YHH M;  3ILK A;  2VQF M;  2D7H A;  4GC5 A;  4F2L A;  2DVW B;  1NSF A;  2LVA A;  3GP1 A;  1P3Q Q;  4JI3 M;  4DV6 M;  3J81 S;  1GAB A;  4D80 A;  3K2L A;  4HL4 A;  4DV1 M;  1Z5C A;  3JAM S;  1DO0 A;  3WHL A;  4IBF A;  4AKI A;  2FH0 A;  3GRV A;  4JYA M;  2BJW A;  3FUT A;  1Q02 A;  4DR6 M;  3B74 A;  2R4E A;  3NBX X;  1NNU C;  2CHQ A;  2QZ4 A;  2LXE A;  1C1K A;  3U6L A;  2D7G A;  5GKN A;  1DGH A;  1PJJ A;  4FD2 A;  2QBY A;  4GH9 A;  1HNW M;  1ZV1 A;  1LV7 A;  3R8F A;  1OIP A;  3FTC A;  4NXM M;  2KNV A;  2FE8 A;  2XFT A;  1D0M A;  2DAK A;  3F92 A;  3NBI A;  5DFL A;  4MB7 A;  3FUW A;  4OU7 A;  4B3S M;  2QNJ A;  2VDB B;  1QVR A;  3W67 A;  3C9P A;  3SAS A;  2OQ4 A;  1MN3 A;  3FYC A;  2FFJ A;  3H4M A;  2O01 F;  1OAO C;  2VF7 A;  4MGH A;  4DR1 M;  2F5O A;  1Q3C A;  2DAG A;  3T15 A;  1WGN A;  2LVQ D;  2XSZ D;  1G4A E;  3KXE C;  3LCV B;  4I81 A;  2HL7 A;  1R4G A;  3GLH A;  2DWL A;  3L2A A;  1R2Z A;  1KFV A;  1G59 A;  1TDZ A;  2F5S A;  3MMP A;  1EE8 A;  4I4L A;  4B7F A;  3FTF A;  4MGK E;  1GJS A;  3BOS A;  1TH3 A;  2V6Z M;  2O5R A;  1NO1 A;  1ZMV A;  1TTE A;  2RRU A;  4AQY M;  3AOE A;  5A2Q S;  3U6Q A;  3CTW B;  2CV2 A;  1Q39 A;  1VG5 A;  2X49 A;  2WSC F;  1WHC A;  2KEB A;  3M0E A;  4X64 M;  2UXD M;  3U6P A;  3RGP A;  4AW4 A;  4KLN A;  1DGB A;  3U60 A;  3Q8G A;  2GNO A;  5ITX A;  1L1T A;  1Z5A A;  1PJT A;  3T1H M;  1KYI A;  3DA1 A;  3FUX A;  2F5P A;  3E9S A;  3M7G A;  5EXP A;  5IZ7 D;  1MJG M;  2DZN B;  4X66 M;  4DV3 M;  2Y0Q A;  2I7N A;  3C3E A;  2BWB A;  4QNR A;  3BXW A;  1NY6 A;  1SXJ A;  3EIH A;  1L2D A;  1PJQ A;  4AI6 A;  3U6S A;  1E9S A;  3LVW A;  4DR7 M;  2KZU A;  4LF9 M;  4L15 A;  5KQD A;  5JI2 E;  1QAO A;  1NV9 A;  4P17 A;  2EKK A;  4DR4 M;  1N33 M;  4IBB A;  3SAV A;  3B9P A;  3SYK A;  2UUA M;  1L2B A;  1XXH E;  4DUZ M;  1YLA A;  5EP1 A;  1IY0 A;  3PXG A;  3KOW E;  1R2Y A;  2LTU A;  2K0B X;  2OO9 A;  4L4U A;  1HQY E;  3MHV C;  3SMS A;  3UMM A;  3VDU A;  2XFS A;  3FTD A;  1QAM A;  1R7R A;  2HKJ A;  3KOZ E;  4II7 A;  1XXH A;  1N78 A;  4IJF A;  4A3V B;  4MGY E;  1DGH B;  2DEN A;  2JZ1 A;  3AV0 A;  5IWA M;  2QBY B;  2MRO B;  3KS8 A;  1HQC A;  3CF0 A;  2EA0 A;  3TE6 A;  3U6O A;  2CUZ A;  2JUJ A;  4FCT A;  4NC6 A;  1OAI A;  3DZD A;  4NRV A;  5EXX A;  3J80 S;  5KPT A;  3KW6 A;  2CHG A;  1QAN A;  2ZTC A;  2Z4R A;  3K8Z A;  2Z8Y M;  1S3S A;  4KT0 F;  4L78 A;  1GJT A;  2DNA A;  5ITT A;  3ZC7 B;  1VQ1 A;  4RF1 A;  5DNY A;  1D0L A;  1IXZ A;  4Z8X A;  2D7E A;  4M9S A;  3SBJ A;  4CIS A;  3KFU G;  3DOA A;  2ZM6 M;  3TPZ A;  2E5L M;  3VLF B;  4OVZ A;  3GLH B;  4CHT B;  2FNA A;  1VEJ A;  4IBJ A;  4BLC A;  1Y8G A;  1PRB A;  3M6A A;  4LGY A;  4JI4 M;  3KSX A;  5ITU A;  2UUC M;  2HWJ A;  3HHY A;  4Z6Y A;  3FE3 A;  3KS4 A;  3GPU A;  1HJP A;  1OJL A;  1QZM A;  2CHV A;  4JXJ A;  1V34 A;  1IXR C;  2K6B A;  3HU2 A;  4LFC M;  4X65 M;  4LF8 M;  3D8B A;  3L27 A;  1YUB A;  2R62 A;  2DWM A;  4LRT A;  1N36 M;  1N75 A;  2MH8 A;  4DV2 M;  2W82 A;  2NQ8 C;  3FRH A;  5KO3 A;  3HHZ A;  4NL4 H;  3SFZ A;  1I4W A;  2M5Z A;  1ZMU A;  2ERC A;  3J2P B;  1GLN A;  4S12 A;  3U60 B;  4TUW A;  3HHW A;  1J09 A;  4B7H A;  1XC8 A;  2ZAM A;  4KO8 A;  2J7N A;  3RE8 A;  3LW5 F;  1JB0 F;  4RF0 A;  1QYR A;  2AHM A;  2DAI A;  2QSF X;  4ANR A;  3GLG E;  4LG2 A;  4K0K M;  1L2C A;  1SXJ B;  1QDT A;  2L6O A;  2VF8 A;  1HNX M;  3GLI E;  1JR3 D;  1ZQ9 A;  3J7A S;  1OKS A;  3QYE A;  1YSY A;  5FSW A;  4LFB M;  2X4A A;  4JI2 M;  1NV8 A;  4GRI A;  3ZQJ A;  3L28 A;  4M9Z A;  2DZO B;  2G8L A;  1ORY B;  4W5W A;  2G3Q A;  3DFZ A;  3PFI A;  4P16 A;  4GMQ A;  3EIE A;  2DI0 A;  4WP2 A;  1QZE A;  1KSF X;  3IG5 A;  4JI1 M;  4LY6 A;  1GL6 A;  2H5X A;  3UZU A;  3OTO M;  1J5E M;  1SG9 A;  3B7Q A;  3GLI A;  3HX3 A;  2JWS A;  2C99 A;  2JP7 A;  4GEW A;  3AOE C;  4IBG A;  3I4Y A;  2R4J A;  5JI3 E;  3LQR A;  2J7O A;  1XB2 B;  4LJ9 A;  1D0K A;  1PJI A;  3SAR A;  2RKO A;  2K47 A;  1R5L A;  1IY1 A;  2JY8 A;  3B7N A;  3E4R A;  3HJQ A;  4I5S A;  2C98 A;  4MM3 B;  4NSR A;  5FTN A;  5BR8 M;  3VK8 A;  4G4R A;  1FNN A;  2XZU A;  1QUT A;  1XXH B;  1Q3B A;  1Z5B A;  4BBA A;  1WXQ A;  2HHH M;  1NY5 A;  3SHG B;  2LNH C;  3GQ3 A;  1VDL A;  3U5Z A;  1T6O A;  4X62 M;  3LVV A;  1RU3 A; 
#chains in the Genus database with same CATH homology
 2WSE F;  5L8R F;  3LW5 F;  1JB0 F;  4RKU F;  4KT0 F;  4Y28 F;  2WSF F;  4XK8 F;  2O01 F;  4L6V 6;  2WSC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...