1JB0F

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPHLVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEIIIDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 1jb0F00
2WSCF 1JB0F 4Y28F 2WSEF 4XK8F 4L6V6 4RKUF 2O01F 3LW5F 4KT0F 5L8RF 2WSFF
chains in the Genus database with same CATH superfamily
1GLNA 4A3VB 4LGMA 4AW4A 1MJGM 4F1IA 5FTNA 2XLJA 1OIPA 3HKPA 2O25A 1E9RA 3CF0A 3GRYA 3AKZA 4MGKE 1SG9A 3HHXA 3B7QA 4IBBA 2JUJA 2M5ZA 5KQ8A 1JR3E 1L2BA 2BJVA 1D0LA 3FTCA 1Q3CA 1Z59A 3KOYE 3UMMA 4LG2A 1IQPA 3K9PA 3U60B 2QENA 4R7GA 1WGNA 3VLFB 4NXMM 4MGYE 2XEPA 4DR1M 5EQTA 4I5SA 3UJNA 2WSEF 3U6PA 1D0KA 3KOWE 3TWMA 5F3WA 4I8OA 3MHVC 1ORYB 3K2LA 1VQ1A 1IBMM 1IN8A 4DV0M 4IBCA 1OAOC 1JB0F 4FW9A 2QQ8A 3R8FA 4G4QA 1C1KA 2AHMA 2LVNC 3GLGB 3J2PB 1NV9A 3KP0E 2CWBA 3L27A 4RNAA 4YHHM 1HQYE 1YUBA 1Z6TA 2DKLA 2EKKA 2H5XA 4B08A 1XHBA 1XC8A 3CGWA 3MJ5A 2L09A 3JAMS 2B3TA 2QHOB 3HJ8A 5EXPA 1JR3D 3U61B 3U6OA 3SAUA 1WR1B 3I4VA 2XFTA 4LJ5A 4DR2M 4CIZA 1EFUB 2QSFX 5C1BA 1L2CA 1SXJD 4QNRA 1PGYA 1MX0A 4Q7JA 3HHYA 1PM5A 3KSJA 3VDPA 2MGWA 1G8PA 2LVOC 5IZ7D 2VQEM 1FNNA 3GRUA 4IBIA 1LTMA 4HL4A 5EP3A 3C9PA 3KFUG 1UFZA 4B7FA 4LF7M 1G71A 2JXNA 3GPPA 4GMQA 5E26A 4R71A 3GLFE 2DWNA 2DWMA 1R5LA 2DVWB 1FJGM 1IM2A 2UUCM 1YE9A 2FNAA 3THGA 1DO0A 1J09A 4AG5A 2JA2A 1QZEA 1ZV1A 4X66M 3D8LA 2MROB 2QP9X 3RFWA 1K3WA 4LF9M 3FRIA 2Y0TA 4M9SA 1HT2E 5FTJA 1VDDA 2FH0A 2XFSA 3M0EA 1LV7A 4LJAA 3V76A 1XMOM 3ZCBB 4OU7A 4P17A 3T1HM 3SAWA 2K9DA 3GLHE 3GQ4A 1DO2A 1OAIA 4JI8M 2VF8A 4KHPM 2OOAA 4MB7A 2R46A 1NVMA 2KXEA 4GRIA 1AUAA 2EJSA 2F5OA 2KRUA 1VEKA 2E5LM 5DYGA 2F5SA 2UUBM 1XNRM 4QHTA 1ZMUA 4HLQA 1E94E 4KO8A 3L25A 4LF6M 2DAIA 3WHLA 5JI2E 2C99A 4D81A 2YR0A 2XH9A 1N34M 1MN3A 1QVRA 3FD9A 2CV1A 4WURA 4PDIA 3CF2A 1MU5A 2L7HA 4GHAA 3SARA 3SHFA 1K3XA 1HT1E 2QZ4A 3UK6A 4ZPXA 3FUUA 2DAEA 2DHYA 2VF7A 1WXQA 2D7EA 3U6EA 2R4JA 3VKGA 1IY1A 2ZBKB 2R0IA 3K1JA 2QCUA 4LRSA 3FYCA 5EP1A 5LMUM 4JV5M 3FTFA 4KT0F 1Q39A 1R7RA 2X8AA 2V6ZM 1XWIA 3IECA 4LY6A 1VDLA 5EXXA 3KS4A 3U61A 5KPZA 1Z5CA 3J7BA 1YSYA 2P5TA 3IG5A 4X62M 3H4MA 3GO8A 2H1RA 2CHQA 5KQDA 3SMPA 1QANA 2R4EA 2FS1A 3RE8A 3U6QA 3LCUA 4YY3M 1T43A 5KPRA 3E9SA 2DAMA 3SHGB 1GL6A 3QAUA 3T6PA 2JY6B 2KW0A 3M6AA 4L78A 5EXSA 3TL4X 3HU1A 4JI1M 2D7GA 4MGZE 4S12A 2O01F 5EXTA 3VFDA 4P16A 3W68A 4LF4M 1N32M 3KS8A 3JR5A 1IN6A 2JY8A 4DV1M 2JZ0A 4BBAA 4DV4M 4AI6A 3K9OA 2K47A 3Q8XA 1KFVA 3U6DA 1QUTA 2QNJA 3E46A 3RGPA 1SXJA 3ZQJA 4IBJA 4CHTB 3A46A 1X37A 4LJ7A 1GJTA 3NWLA 4CGYB 2R18A 2XZUA 2XSZD 2DENA 3EIHA 4QOSA 2CRUA 4HEOA 2MR9A 1R2ZA 1W5SA 1DGBA 3KXEC 2BJWA 4PT5A 2OPFA 1NV8A 4I81A 1KSFX 4LFBM 2KNAA 4NSOB 4D82A 4XBOA 4OX9M 2G3QA 4Z8XA 4IBEA 1IN5A 2LBCA 2ZANA 3B7ZA 3HU2A 3HY5A 4NRVA 4XGIA 3SYKA 2L2DA 2YQZA 3ILKA 3KOZE 3MMPA 5ITXA 4GHLA 2J7OA 1WIVA 4M9ZA 3GQ5A 1PJIA 3SATA 5FTLA 2CHGA 2KZUA 1OJLA 3BOSA 2LHGA 1VEGA 3GLHA 4DV3M 5DNYA 3ZC7B 3FUVA 2EUCA 2DWLA 5KPTA 2FFJA 3BBZA 2I7PA 2L7IA 2F4VM 3GLIE 4X64M 4GIPA 1G41A 4Z6YA 5FLXS 4JI4M 1TF0B 2CE7A 2HWJA 1QDTA 3TE6A 3GPYA 3SASA 3AOGA 1GL7A 1OIZA 2WSCF 2JNHA 4GC5A 2OO9A 3HHZA 2Y20A 4DR5M 2ZTDA 2JY5A 1KYIA 3I01M 4IJEA 3U6MA 1PJSA 2KHHA 3HU3A 3KDSE 2J7NA 3B89A 5FTKA 3U5ZB 2OOBA 3PNVA 1R2YA 4DR3M 1DGFA 2C9OA 1QUSA 3J80S 4FCVA 1SXJE 2RRUA 4F2LA 2LHCA 3FKEA 2R6FA 3U60A 1XNQM 3DZDA 3T15A 1GO5A 4L8RC 2BWBA 4GKJM 4AZFA 5KO3A 3GP1A 5ITYA 3FTEA 1Q02A 3I51A 5LMNM 3IG8A 2KA6B 4G4RA 2QPAA 1Q3BA 4B3MM 2CEAA 4B7GA 4MGIE 5EP4A 2K0BX 3LCVB 4DV2M 1H6UA 3Q8GA 5IREB 1QZMA 4GH9A 2DHRA 3GLHB 1NJFA 3L29A 1PJJA 1TDHA 4FD2A 3UGJA 2OQ4A 4B3SM 1R4GA 3BXWA 4JI0M 1IXSB 1N75A 3OTOM 2KNVA 1L2DA 2DNAA 3FE3A 2CV2A 2BWEA 3U5ZA 2RKOA 4LFAM 1TH4A 1NNUC 3JR4A 2UUAM 4GC9A 4Y28F 4DUZM 3KW6A 3SC3A 1OFIA 1BVSA 2QBYA 3A98B 3NBIA 4OVZA 1Z5AA 1XXHE 2JWSA 1HR0M 4LGYA 4AKHA 1IXSA 1J5EM 1ZMVA 3AOEC 1HJPA 2O5RA 3LMMA 1I94M 2KEBA 1IY0A 3GLFB 3GQ3A 1HNWM 4KLNA 4LFCM 4DV7M 1N36M 3C58A 4CISA 2HL7A 2DZOB 3AJIB 5ITRA 1HNZM 5C18A 2EO2A 3A42A 4XK8F 2XGNA 1GJSA 2M60A 1WGLA 2X49A 3MK6A 2VIIA 5IWAM 4QNMA 1E9SA 2UXDM 3AV0A 4K0KM 2V1UA 3GLGA 3HJQA 3T1YM 4ITQA 3U6SA 3F92A 3H4JA 1K82A 3LVWA 1Z5BA 4FCWA 1JR3A 3SBJA 1ZAEA 3TWLA 3DFZA 4QHSA 4MGHA 2VDBB 1P3QQ 5ITXE 2UU9M 4AQYM 3IHPA 1TGUA 5ITQA 2VQFM 4DUYM 4LZZA 4JI5M 7CATA 2G8LA 4WW0A 1DGHB 4L6V6 1F4IA 3HGIA 3FYDA 3L28A 3T38A 1VEJA 5L8RF 1SXJB 3J81S 2G5GX 4QOZC 1A5TA 1D2NA 2R62A 1J7KA 1IBKM 3SFZA 3GPXA 2D7HA 5EP2A 4PCZA 1XMQM 1YLAA 2X4AA 5E6JA 3GPUA 1IFYA 4IJFA 2C9CA 3A45A 3GRVA 2CV0A 4DR4M 2MJ5B 2YNMD 4NC6A 2WSFF 2ZTCA 4OVZB 3VK7A 2Z4RA 1IXRC 1IXZA 1OKSA 3AFHA 4UN2B 3VK8A 3FUXA 3NBXX 3KP1E 3FUWA 2APLA 3VDUA 4CJ6A 1W5TA 3K8ZA 1PJQA 4MH0E 3B74A 4L4UA 3QWLA 2RGHA 2JY7A 5ITUA 1S3SA 2LNHC 1VG5A 1UM8A 4JI7M 1QYRA 4M0DA 4LRTA 3KOXE 2JP7A 4M0WA 2UXBM 1IN4A 2ZAMA 5DFLA 3U6LA 1DV0A 3GLFA 4M9XA 4REZA 2Q2EB 2DWZB 2EKFA 2LVAA 2LWXA 2HKJA 4DV6M 2R65A 4DR7M 3TPZA 4AG6A 1DGHA 3KVWA 4FWGA 1N33M 3EIEA 4I4LA 2R45A 1HQCA 1NY5A 4W5WA 2ZM6M 2I7NA 2KRKA 3B9PA 4DV5M 1WHCA 2L6OA 3J27B 1L1TA 2Z3XA 4GITA 5DYIA 2XF3A 1TH2A 2HAKA 1T3TA 4L16A 3D8BA 8CATA 4TUWA 1NNJA 2C98A 3W67A 3HHWA 1Y8GA 4IBDA 1NHGC 4GEWA 1TR8A 5A2QS 1GKIA 4FWDA 4NXNM 3HWSA 4JN6A 4JI3M 3PNYA 3UZUA 4BLCA 3M7GA 3C3DA 2N35A 4FWHA 2UXCM 4LCBA 4JXJA 2C96A 5BPVA 2LVPC 2V1CA 5FTMA 2GNOA 2WZJA 3E4RA 3TQSA 3AOEA 4D80A 1G59A 2DZNB 1N77A 2Z8YM 3E21A 4BB9A 4JI2M 4JYAM 4NOOB 3FRHA 4LJ4A 4ANRA 2DAGA 2DXIA 2XSZA 3J7AS 4AKIA 4LF5M 2R44A 4RF1A 4G4NA 1EIJA 4OW0A 1QAQA 3GLIA 4PDGA 3W0LB 3CTWB 1HNXM 3C3EA 4AKGA 1C7YA 4WP2A 1TH3A 1AIPC 2L4EA 4RF0A 2LTUA 2Y0QA 3L2AA 1NJGA 2ERCA 5EJCA 3U6CA 1QAOA 1ZMWA 1E32A 4X65M 2XZFA 2KZSA 4IIWA 1NSFA 1V34A 1G4AE 3QYEA 2K6BA 1XXHB 1NY6A 3LVVA 3TWKA 5IT9S 4GKKM 4PD2A 1WJ7A 2F5NA 1CUKA 4LJ8A 1PJTA 3I04M 4LJ9A 3AL0C 2JZ1A 1DGGA 2Z4SA 2HHHM 2L4FA 4MM3B 1V92A 3PXGA 4B3TM 3VKHA 1I4WA 3HX3A 3CF6E 3FUTA 3QYBA 4L15A 3KSXA 3R9XB 3B7NA 3DA1A 2CUZA 2F5QA 1NO1A 2MH8A 5GKNA 5H37D 4G3OA 3K92A 1V33A 4DBGB 1L1ZA 2CFOA 1N78A 1D0MA 2NQ8C 2W82A 2EA0A 2DZLA 4B3RM 3GLGE 4LF8M 1QDRA 2LVQD 3SAVA 3GRRA 3RGSA 1IY2A 1R6BX 1XB2B 2ZAOA 1IN7A 4NSRA 1GVNA 1G3IA 2GQFA 2CHVA 2C5RA 2FOIC 2DAKA 1L8QA 3PVSA 2CP8A 1TTEA 2A5YB 2RGOA 4IBGA 4DR6M 5ITTA 1PRBA 3W0FA 1NHWC 3LQRA 4FCTA 1IBLM 1OTRA 4G4OA 4IBKA 3PFIA 1QAMA 1QQWA 3WHKA 2FE8A 5FSWA 2F5PA 1ZQ9A 1T6OA 4KODA 1GABA 1XXHA 1JQJC 2KNZA 4G6ZA 4RKUF 4LJ6A 2DI0A 3ZH9B 3FTDA 4NRWA 2J5YA 4JI6M 2Y21A 2HCBA 1TDZA 3SMSA 4B7HA 3L26A 2KDLA 3LW5F 3HZJA 1OFHA 4NL4H 4II7A 2LH0A 5BR8M 3DOAA 3I4YA 4LZJA 1OQYA 2QBYB 4IBFA 4FVMA 2BNKA 2LXEA 2YFQA 3LQQA 3GLIB 1EE8A 3HJSA 3SYLA 5JI3E 4EIWA 1SXJC 4R3DA 1RU3A 2Z7JA
chains in the Genus database with same CATH topology
2WSCF 1JB0F 4Y28F 2WSEF 4XK8F 4L6V6 4RKUF 2O01F 3LW5F 4KT0F 5L8RF 2WSFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC F;  1JB0 F;  4Y28 F;  2WSE F;  4XK8 F;  4L6V 6;  4RKU F;  2O01 F;  3LW5 F;  4KT0 F;  5L8R F;  2WSF F; 
#chains in the Genus database with same CATH topology
 1GLN A;  4A3V B;  4LGM A;  4AW4 A;  1MJG M;  4F1I A;  5FTN A;  2XLJ A;  1OIP A;  3HKP A;  2O25 A;  1E9R A;  3CF0 A;  3GRY A;  3AKZ A;  4MGK E;  1SG9 A;  3HHX A;  3B7Q A;  4IBB A;  2JUJ A;  2M5Z A;  5KQ8 A;  1JR3 E;  1L2B A;  2BJV A;  1D0L A;  3FTC A;  1Q3C A;  1Z59 A;  3KOY E;  3UMM A;  4LG2 A;  1IQP A;  3K9P A;  3U60 B;  2QEN A;  4R7G A;  1WGN A;  3VLF B;  4NXM M;  4MGY E;  2XEP A;  4DR1 M;  5EQT A;  4I5S A;  3UJN A;  2WSE F;  3U6P A;  1D0K A;  3KOW E;  3TWM A;  5F3W A;  4I8O A;  3MHV C;  1ORY B;  3K2L A;  1VQ1 A;  1IBM M;  1IN8 A;  4DV0 M;  4IBC A;  1OAO C;  1JB0 F;  4FW9 A;  2QQ8 A;  3R8F A;  4G4Q A;  1C1K A;  2AHM A;  2LVN C;  3GLG B;  3J2P B;  1NV9 A;  3KP0 E;  2CWB A;  3L27 A;  4RNA A;  4YHH M;  1HQY E;  1YUB A;  1Z6T A;  2DKL A;  2EKK A;  2H5X A;  4B08 A;  1XHB A;  1XC8 A;  3CGW A;  3MJ5 A;  2L09 A;  3JAM S;  2B3T A;  2QHO B;  3HJ8 A;  5EXP A;  1JR3 D;  3U61 B;  3U6O A;  3SAU A;  1WR1 B;  3I4V A;  2XFT A;  4LJ5 A;  4DR2 M;  4CIZ A;  1EFU B;  2QSF X;  5C1B A;  1L2C A;  1SXJ D;  4QNR A;  1PGY A;  1MX0 A;  4Q7J A;  3HHY A;  1PM5 A;  3KSJ A;  3VDP A;  2MGW A;  1G8P A;  2LVO C;  5IZ7 D;  2VQE M;  1FNN A;  3GRU A;  4IBI A;  1LTM A;  4HL4 A;  5EP3 A;  3C9P A;  3KFU G;  1UFZ A;  4B7F A;  4LF7 M;  1G71 A;  2JXN A;  3GPP A;  4GMQ A;  5E26 A;  4R71 A;  3GLF E;  2DWN A;  2DWM A;  1R5L A;  2DVW B;  1FJG M;  1IM2 A;  2UUC M;  1YE9 A;  2FNA A;  3THG A;  1DO0 A;  1J09 A;  4AG5 A;  2JA2 A;  1QZE A;  1ZV1 A;  4X66 M;  3D8L A;  2MRO B;  2QP9 X;  3RFW A;  1K3W A;  4LF9 M;  3FRI A;  2Y0T A;  4M9S A;  1HT2 E;  5FTJ A;  1VDD A;  2FH0 A;  2XFS A;  3M0E A;  1LV7 A;  4LJA A;  3V76 A;  1XMO M;  3ZCB B;  4OU7 A;  4P17 A;  3T1H M;  3SAW A;  2K9D A;  3GLH E;  3GQ4 A;  1DO2 A;  1OAI A;  4JI8 M;  2VF8 A;  4KHP M;  2OOA A;  4MB7 A;  2R46 A;  1NVM A;  2KXE A;  4GRI A;  1AUA A;  2EJS A;  2F5O A;  2KRU A;  1VEK A;  2E5L M;  5DYG A;  2F5S A;  2UUB M;  1XNR M;  4QHT A;  1ZMU A;  4HLQ A;  1E94 E;  4KO8 A;  3L25 A;  4LF6 M;  2DAI A;  3WHL A;  5JI2 E;  2C99 A;  4D81 A;  2YR0 A;  2XH9 A;  1N34 M;  1MN3 A;  1QVR A;  3FD9 A;  2CV1 A;  4WUR A;  4PDI A;  3CF2 A;  1MU5 A;  2L7H A;  4GHA A;  3SAR A;  3SHF A;  1K3X A;  1HT1 E;  2QZ4 A;  3UK6 A;  4ZPX A;  3FUU A;  2DAE A;  2DHY A;  2VF7 A;  1WXQ A;  2D7E A;  3U6E A;  2R4J A;  3VKG A;  1IY1 A;  2ZBK B;  2R0I A;  3K1J A;  2QCU A;  4LRS A;  3FYC A;  5EP1 A;  5LMU M;  4JV5 M;  3FTF A;  4KT0 F;  1Q39 A;  1R7R A;  2X8A A;  2V6Z M;  1XWI A;  3IEC A;  4LY6 A;  1VDL A;  5EXX A;  3KS4 A;  3U61 A;  5KPZ A;  1Z5C A;  3J7B A;  1YSY A;  2P5T A;  3IG5 A;  4X62 M;  3H4M A;  3GO8 A;  2H1R A;  2CHQ A;  5KQD A;  3SMP A;  1QAN A;  2R4E A;  2FS1 A;  3RE8 A;  3U6Q A;  3LCU A;  4YY3 M;  1T43 A;  5KPR A;  3E9S A;  2DAM A;  3SHG B;  1GL6 A;  3QAU A;  3T6P A;  2JY6 B;  2KW0 A;  3M6A A;  4L78 A;  5EXS A;  3TL4 X;  3HU1 A;  4JI1 M;  2D7G A;  4MGZ E;  4S12 A;  2O01 F;  5EXT A;  3VFD A;  4P16 A;  3W68 A;  4LF4 M;  1N32 M;  3KS8 A;  3JR5 A;  1IN6 A;  2JY8 A;  4DV1 M;  2JZ0 A;  4BBA A;  4DV4 M;  4AI6 A;  3K9O A;  2K47 A;  3Q8X A;  1KFV A;  3U6D A;  1QUT A;  2QNJ A;  3E46 A;  3RGP A;  1SXJ A;  3ZQJ A;  4IBJ A;  4CHT B;  3A46 A;  1X37 A;  4LJ7 A;  1GJT A;  3NWL A;  4CGY B;  2R18 A;  2XZU A;  2XSZ D;  2DEN A;  3EIH A;  4QOS A;  2CRU A;  4HEO A;  2MR9 A;  1R2Z A;  1W5S A;  1DGB A;  3KXE C;  2BJW A;  4PT5 A;  2OPF A;  1NV8 A;  4I81 A;  1KSF X;  4LFB M;  2KNA A;  4NSO B;  4D82 A;  4XBO A;  4OX9 M;  2G3Q A;  4Z8X A;  4IBE A;  1IN5 A;  2LBC A;  2ZAN A;  3B7Z A;  3HU2 A;  3HY5 A;  4NRV A;  4XGI A;  3SYK A;  2L2D A;  2YQZ A;  3ILK A;  3KOZ E;  3MMP A;  5ITX A;  4GHL A;  2J7O A;  1WIV A;  4M9Z A;  3GQ5 A;  1PJI A;  3SAT A;  5FTL A;  2CHG A;  2KZU A;  1OJL A;  3BOS A;  2LHG A;  1VEG A;  3GLH A;  4DV3 M;  5DNY A;  3ZC7 B;  3FUV A;  2EUC A;  2DWL A;  5KPT A;  2FFJ A;  3BBZ A;  2I7P A;  2L7I A;  2F4V M;  3GLI E;  4X64 M;  4GIP A;  1G41 A;  4Z6Y A;  5FLX S;  4JI4 M;  1TF0 B;  2CE7 A;  2HWJ A;  1QDT A;  3TE6 A;  3GPY A;  3SAS A;  3AOG A;  1GL7 A;  1OIZ A;  2WSC F;  2JNH A;  4GC5 A;  2OO9 A;  3HHZ A;  2Y20 A;  4DR5 M;  2ZTD A;  2JY5 A;  1KYI A;  3I01 M;  4IJE A;  3U6M A;  1PJS A;  2KHH A;  3HU3 A;  3KDS E;  2J7N A;  3B89 A;  5FTK A;  3U5Z B;  2OOB A;  3PNV A;  1R2Y A;  4DR3 M;  1DGF A;  2C9O A;  1QUS A;  3J80 S;  4FCV A;  1SXJ E;  2RRU A;  4F2L A;  2LHC A;  3FKE A;  2R6F A;  3U60 A;  1XNQ M;  3DZD A;  3T15 A;  1GO5 A;  4L8R C;  2BWB A;  4GKJ M;  4AZF A;  5KO3 A;  3GP1 A;  5ITY A;  3FTE A;  1Q02 A;  3I51 A;  5LMN M;  3IG8 A;  2KA6 B;  4G4R A;  2QPA A;  1Q3B A;  4B3M M;  2CEA A;  4B7G A;  4MGI E;  5EP4 A;  2K0B X;  3LCV B;  4DV2 M;  1H6U A;  3Q8G A;  5IRE B;  1QZM A;  4GH9 A;  2DHR A;  3GLH B;  1NJF A;  3L29 A;  1PJJ A;  1TDH A;  4FD2 A;  3UGJ A;  2OQ4 A;  4B3S M;  1R4G A;  3BXW A;  4JI0 M;  1IXS B;  1N75 A;  3OTO M;  2KNV A;  1L2D A;  2DNA A;  3FE3 A;  2CV2 A;  2BWE A;  3U5Z A;  2RKO A;  4LFA M;  1TH4 A;  1NNU C;  3JR4 A;  2UUA M;  4GC9 A;  4Y28 F;  4DUZ M;  3KW6 A;  3SC3 A;  1OFI A;  1BVS A;  2QBY A;  3A98 B;  3NBI A;  4OVZ A;  1Z5A A;  1XXH E;  2JWS A;  1HR0 M;  4LGY A;  4AKH A;  1IXS A;  1J5E M;  1ZMV A;  3AOE C;  1HJP A;  2O5R A;  3LMM A;  1I94 M;  2KEB A;  1IY0 A;  3GLF B;  3GQ3 A;  1HNW M;  4KLN A;  4LFC M;  4DV7 M;  1N36 M;  3C58 A;  4CIS A;  2HL7 A;  2DZO B;  3AJI B;  5ITR A;  1HNZ M;  5C18 A;  2EO2 A;  3A42 A;  4XK8 F;  2XGN A;  1GJS A;  2M60 A;  1WGL A;  2X49 A;  3MK6 A;  2VII A;  5IWA M;  4QNM A;  1E9S A;  2UXD M;  3AV0 A;  4K0K M;  2V1U A;  3GLG A;  3HJQ A;  3T1Y M;  4ITQ A;  3U6S A;  3F92 A;  3H4J A;  1K82 A;  3LVW A;  1Z5B A;  4FCW A;  1JR3 A;  3SBJ A;  1ZAE A;  3TWL A;  3DFZ A;  4QHS A;  4MGH A;  2VDB B;  1P3Q Q;  5ITX E;  2UU9 M;  4AQY M;  3IHP A;  1TGU A;  5ITQ A;  2VQF M;  4DUY M;  4LZZ A;  4JI5 M;  7CAT A;  2G8L A;  4WW0 A;  1DGH B;  4L6V 6;  1F4I A;  3HGI A;  3FYD A;  3L28 A;  3T38 A;  1VEJ A;  5L8R F;  1SXJ B;  3J81 S;  2G5G X;  4QOZ C;  1A5T A;  1D2N A;  2R62 A;  1J7K A;  1IBK M;  3SFZ A;  3GPX A;  2D7H A;  5EP2 A;  4PCZ A;  1XMQ M;  1YLA A;  2X4A A;  5E6J A;  3GPU A;  1IFY A;  4IJF A;  2C9C A;  3A45 A;  3GRV A;  2CV0 A;  4DR4 M;  2MJ5 B;  2YNM D;  4NC6 A;  2WSF F;  2ZTC A;  4OVZ B;  3VK7 A;  2Z4R A;  1IXR C;  1IXZ A;  1OKS A;  3AFH A;  4UN2 B;  3VK8 A;  3FUX A;  3NBX X;  3KP1 E;  3FUW A;  2APL A;  3VDU A;  4CJ6 A;  1W5T A;  3K8Z A;  1PJQ A;  4MH0 E;  3B74 A;  4L4U A;  3QWL A;  2RGH A;  2JY7 A;  5ITU A;  1S3S A;  2LNH C;  1VG5 A;  1UM8 A;  4JI7 M;  1QYR A;  4M0D A;  4LRT A;  3KOX E;  2JP7 A;  4M0W A;  2UXB M;  1IN4 A;  2ZAM A;  5DFL A;  3U6L A;  1DV0 A;  3GLF A;  4M9X A;  4REZ A;  2Q2E B;  2DWZ B;  2EKF A;  2LVA A;  2LWX A;  2HKJ A;  4DV6 M;  2R65 A;  4DR7 M;  3TPZ A;  4AG6 A;  1DGH A;  3KVW A;  4FWG A;  1N33 M;  3EIE A;  4I4L A;  2R45 A;  1HQC A;  1NY5 A;  4W5W A;  2ZM6 M;  2I7N A;  2KRK A;  3B9P A;  4DV5 M;  1WHC A;  2L6O A;  3J27 B;  1L1T A;  2Z3X A;  4GIT A;  5DYI A;  2XF3 A;  1TH2 A;  2HAK A;  1T3T A;  4L16 A;  3D8B A;  8CAT A;  4TUW A;  1NNJ A;  2C98 A;  3W67 A;  3HHW A;  1Y8G A;  4IBD A;  1NHG C;  4GEW A;  1TR8 A;  5A2Q S;  1GKI A;  4FWD A;  4NXN M;  3HWS A;  4JN6 A;  4JI3 M;  3PNY A;  3UZU A;  4BLC A;  3M7G A;  3C3D A;  2N35 A;  4FWH A;  2UXC M;  4LCB A;  4JXJ A;  2C96 A;  5BPV A;  2LVP C;  2V1C A;  5FTM A;  2GNO A;  2WZJ A;  3E4R A;  3TQS A;  3AOE A;  4D80 A;  1G59 A;  2DZN B;  1N77 A;  2Z8Y M;  3E21 A;  4BB9 A;  4JI2 M;  4JYA M;  4NOO B;  3FRH A;  4LJ4 A;  4ANR A;  2DAG A;  2DXI A;  2XSZ A;  3J7A S;  4AKI A;  4LF5 M;  2R44 A;  4RF1 A;  4G4N A;  1EIJ A;  4OW0 A;  1QAQ A;  3GLI A;  4PDG A;  3W0L B;  3CTW B;  1HNX M;  3C3E A;  4AKG A;  1C7Y A;  4WP2 A;  1TH3 A;  1AIP C;  2L4E A;  4RF0 A;  2LTU A;  2Y0Q A;  3L2A A;  1NJG A;  2ERC A;  5EJC A;  3U6C A;  1QAO A;  1ZMW A;  1E32 A;  4X65 M;  2XZF A;  2KZS A;  4IIW A;  1NSF A;  1V34 A;  1G4A E;  3QYE A;  2K6B A;  1XXH B;  1NY6 A;  3LVV A;  3TWK A;  5IT9 S;  4GKK M;  4PD2 A;  1WJ7 A;  2F5N A;  1CUK A;  4LJ8 A;  1PJT A;  3I04 M;  4LJ9 A;  3AL0 C;  2JZ1 A;  1DGG A;  2Z4S A;  2HHH M;  2L4F A;  4MM3 B;  1V92 A;  3PXG A;  4B3T M;  3VKH A;  1I4W A;  3HX3 A;  3CF6 E;  3FUT A;  3QYB A;  4L15 A;  3KSX A;  3R9X B;  3B7N A;  3DA1 A;  2CUZ A;  2F5Q A;  1NO1 A;  2MH8 A;  5GKN A;  5H37 D;  4G3O A;  3K92 A;  1V33 A;  4DBG B;  1L1Z A;  2CFO A;  1N78 A;  1D0M A;  2NQ8 C;  2W82 A;  2EA0 A;  2DZL A;  4B3R M;  3GLG E;  4LF8 M;  1QDR A;  2LVQ D;  3SAV A;  3GRR A;  3RGS A;  1IY2 A;  1R6B X;  1XB2 B;  2ZAO A;  1IN7 A;  4NSR A;  1GVN A;  1G3I A;  2GQF A;  2CHV A;  2C5R A;  2FOI C;  2DAK A;  1L8Q A;  3PVS A;  2CP8 A;  1TTE A;  2A5Y B;  2RGO A;  4IBG A;  4DR6 M;  5ITT A;  1PRB A;  3W0F A;  1NHW C;  3LQR A;  4FCT A;  1IBL M;  1OTR A;  4G4O A;  4IBK A;  3PFI A;  1QAM A;  1QQW A;  3WHK A;  2FE8 A;  5FSW A;  2F5P A;  1ZQ9 A;  1T6O A;  4KOD A;  1GAB A;  1XXH A;  1JQJ C;  2KNZ A;  4G6Z A;  4RKU F;  4LJ6 A;  2DI0 A;  3ZH9 B;  3FTD A;  4NRW A;  2J5Y A;  4JI6 M;  2Y21 A;  2HCB A;  1TDZ A;  3SMS A;  4B7H A;  3L26 A;  2KDL A;  3LW5 F;  3HZJ A;  1OFH A;  4NL4 H;  4II7 A;  2LH0 A;  5BR8 M;  3DOA A;  3I4Y A;  4LZJ A;  1OQY A;  2QBY B;  4IBF A;  4FVM A;  2BNK A;  2LXE A;  2YFQ A;  3LQQ A;  3GLI B;  1EE8 A;  3HJS A;  3SYL A;  5JI3 E;  4EIW A;  1SXJ C;  4R3D A;  1RU3 A;  2Z7J A; 
#chains in the Genus database with same CATH homology
 2WSC F;  1JB0 F;  4Y28 F;  2WSE F;  4XK8 F;  4L6V 6;  4RKU F;  2O01 F;  3LW5 F;  4KT0 F;  5L8R F;  2WSF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...