2ZTCA

Mtruva form ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
188
Chain Sequence
GRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 44
structure length 188
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztcA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztcA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztcA01
3H3VH 4I2EA 1G51A 3MABA 3T6PA 3BBZA 3CP0A 1RXVA 1ZJMA 1NKBA 5JJKA 3K0XA 4ECSA 3J80c 1NV8A 4YVZA 3UDIA 2R93G 4GN5A 1VQHA 4MNOA 2QEXA 4RQ3A 1YLAA 2ASJA 3AFQA 2DI0A 3B0XA 4O3NA 2JA5G 2ZTDA 3JPOA 3T1HQ 3PUVA 2DPJA 4B3MQ 2XY7A 3Q8QB 3ZJYC 2ZJPA 1XMQL 5DB9A 4DFJA 4HIOA 4A3MH 5EWGA 3RJHA 1X6OA 1NKEA 1T7PA 1QSLA 3N97B 1OXUA 3QE9Y 4QZ8A 3BJYA 3I4MG 3RN5A 5IT9c 2F4VL 4YWKA 4O5EA 1Z9FA 3F92A 4J9PA 3L7ZC 2BPCA 2BA0A 4DOAA 4Y7NH 1UA1A 4FDBA 7ICRA 1JT8A 4Z6DA 4HJAA 1E94E 1L1OB 3MGIA 8ICMA 2FXQA 1PVOA 3PNCA 1U48A 5KFSA 1K3RA 4JBKA 2E2HH 4F93B 3H4JA 3CCVA 1RYSA 9ICLA 3PUYA 2M9NA 2BQUA 2GWSA 3GV8B 1S10A 2JEFA 3FRHA 3K4GA 1T43A 2KTQA 4R4TA 1ZQTA 1KXLA 3JPTA 2BQ3A 4ED6A 8ICBA 3C2KA 3FKIG 4OO1I 2OOBA 1N8RC 1U5KA 5C0XI 5CB1A 3T1YQ 1ZQZA 3T1HL 2JK8A 4B3ML 1TWHH 4EYHB 1YHQA 1RIPA 4DL3A 1SL2A 2MNAA 3RNUA 2QSFX 4I2AA 1B7YB 4GLAC 1NV9A 4M9HA 2PQAA 3D0FA 3HOXG 4DV6Q 3T5LA 3F8TA 3WWVA 2A1JB 4ECQA 3HOYG 3K9OA 4JI6Q 4X66L 1E7ZA 2ZM6Q 4R8UA 2R8IA 3GO5A 1JX4A 2Q2HA 4ED7A 1JJ2A 3UE1A 3DM3A 4R64A 4M47A 4GNXB 3RZDH 9ICXA 2MGWA 4Q7JA 1KRSA 5C44G 1KFSA 5KG1A 4E0DA 5M5WH 1N48A 3HKSA 4BA1I 1U49A 4YMMA 3PMLA 5JJIA 3S1MH 1SL1A 1KC8C 2F4VQ 4GLVB 1VG5A 1F4IA 2JUJA 4M2YA 2NVXH 3S2HH 1VQNA 4KLKA 5IP7H 5M5YH 3G48A 3BQ0A 3M9MB 5J0UA 3PVXA 4O2DA 4F8RA 5M5XH 1E22A 2JA8G 4P72A 2KFNA 3GD7A 1BBWA 3GDEA 1VQEA 1XTDA 3PV8A 1IL2A 1OQYA 1O7IA 3PY8A 5FLMH 4ECWA 2A1AA 2L15A 2B21A 1NJXA 2MQHA 4DK6C 1JR3E 1WFQA 4QZBA 4A3KH 3K9PA 5DBAA 1KYIA 4PGQA 3J7A5 4DR6L 3TEHB 1FJGQ 1BPZA 4DOBA 5KFQA 1FL0A 4TQRA 1U47A 1KSPA 1Q86C 4F5RA 1VQBA 1VQOA 2R92G 3JAMc 2AWOA 2DNAA 4I29A 4I2CA 1ZETA 3RRHA 8ICCA 4Q44A 5J2FA 1SLJA 1VQ9A 9ICRA 2IX0A 1NK7A 1Q02A 4ED8A 1K83H 3ERSX 4I28A 3JPSA 3NENA 2MR9A 3MEFA 1SKSA 1IXRA 4L5TA 2ZJ5A 1VQ8A 3RAXA 3M4OH 3GILA 3UQ2A 1A5TA 3MFIA 4UBBA 3OTOL 4LF6L 2UXBQ 3HT3A 2DAEA 2MUTA 2XCAA 2JQOA 1TR8A 5KFIA 1BPXA 3RR7A 4GXKA 2ATLA 4KLGA 2D62A 4WJ4A 4LF4L 9ICGA 1VQFA 1Z47A 2L4EA 3K81C 4A3DG 5M3MG 3GLFE 2JY5A 2DPIA 1NK4A 2E8GA 4ELTA 1OAIA 1RPLA 1VQ5A 5J2EA 3HOWH 3HFZB 1YNXA 5DFLA 2DKLA 1Y14B 2XY6A 1ZQJA 4M9LA 3RLFA 4GEWA 2EKFA 5F9NA 2R6GA 2VNUD 3S14H 4A3FG 2ID0A 3ZD8A 3CMEA 5J0XA 3OYYA 4QZDA 1X54A 3VDYA 1B70B 2BH8A 3J7ZC 4O5KA 1XXHE 4AQYQ 2UXCQ 3PCOB 4P71A 5KFTA 3ZDAA 1ZQYA 5J2DA 4K4IA 1L0WA 4F50A 4Q8FA 3RAQA 4QWCA 3MXNB 3RB6A 2NN6I 4EBCA 1QSYA 5KG5A 2F1JA 4XRHA 5F9LA 2VANA 3KF6A 1HNXQ 1BPDA 4QW8A 2I9GA 8ICZA 4F2SA 1VQJA 4DV4Q 4M9GA 1T3NA 1EQQA 3ETLA 2DUDA 4BXOB 3GTLH 2F52A 2HHSA 1RXWA 1HNWL 4UB5A 3MBYA 3W1GA 1IBMQ 4PHDA 4RQ0A 2UUAQ 4JI1Q 2CFMA 4IPGA 2JP7A 3E9IA 4UP8A 2UVWA 2XGQA 5JEAG 1N34Q 4KLLA 1NE3A 2PXIA 2GVAA 3OJUA 5FJ8H 3GIIA 4OWTB 4XTCS 3CAMA 1NJZA 2FLPA 3D31A 1ZQVA 3T3FA 4DV1L 3CC2A 2DAKA 3M8RA 3J81c 4IFDI 4LFCL 1QVGA 4ECVA 1Q12A 5J2CA 5J2AA 3KJOA 3BU2A 3CCQA 5E7NA 2XY5A 1K73C 2HHQA 1ASZA 3NELA 1OKSA 4FBUA 1OXTA 2H5XA 2NRWA 2OO9A 5FLXc 3PR5B 1NK0A 2MJ5B 1RL2A 3J80i 1Y1VH 3I4NH 2JY7A 3E9HA 2WB1G 5DDMA 4BXXH 9ICUA 3G6VA 4C8NA 4C8MA 3RLNA 3KDFB 1IBLL 4DO9A 1WR1B 2DENA 2IHMA 5KFMA 2N49A 2UUBQ 2B3GA 4X6AH 2IT1A 4LZGA 5DB7A 4J9NA 1VQKA 1T8EA 2FMQA 4LF5L 9ICQA 3GTMH 4DWIA 5CJ7A 1HNWQ 5IP9G 4IRDA 4MF8A 4DS4A 2CQOA 1UE6A 1G6PA 4LF9L 1N33L 3PO2H 1ZMWA 1SL0A 3QEBZ 3RH4A 5HNKA 4BBRG 4JI0L 1HNZL 2LVNC 7ICQA 4F5QA 1TK0A 8ICUA 4DSEA 5IP9H 3C1YA 1MC8A 1SKRA 4AYBE 3UE0A 3C1ZA 8ICAA 3F1ZA 1W2BA 3ULPA 5GADC 4FS1A 4JYAQ 1QZEA 1TFRA 3T5HA 1TKDA 1SR3A 4DR2Q 2KZZA 4NM2A 1D8LA 4EZ6A 1JIHA 2JEJA 1VQPA 3PF4A 3KF8B 4BDPA 1CSQA 3K7UC 1XNRQ 5HHIA 3G71A 8ICPA 3AFPA 3PMNA 1ZMVA 9ICBA 4DV0Q 5J2HA 2AMCB 5KFXA 2A1JA 4L5QA 5C0XJ 4BA2I 2PFOA 1S0VA 5J3BA 4DAYB 1G41A 3CD6A 3M8SA 1K0RA 3MDCA 4JI8Q 1Y1VG 8ICIA 2HHXA 2AGQA 4JI2Q 4K4GA 3UXPA 5KFJA 3K75D 3RJKA 4ECXA 2XGTA 2ZUDA 1TWCH 1NJWA 3SV4A 2HT1A 3GFKB 4JYAL 2JZ1A 2AJQA 4KLJA 4QZEA 4C8LA 2AU0A 3HX0A 3RR5A 2CWAA 2ZJ8A 1EYGA 5IINA 3S15H 3MR6A 5HP4A 5J2KA 2LVOC 3H8WA 4QWDA 9ICFA 4EEYA 1PH8A 7ICLA 3ULLA 7ICMA 4B9VA 1N33Q 4BY1H 2BH2A 4NXZA 1S3OA 4LF6Q 1VQMA 4M9NA 4MFAA 1RZTA 9ICAA 4FBTA 2A19A 4PHAA 5EOZA 1UFZA 4NLKA 2WTFA 1N9WA 3QEAZ 2FPMA 2NRTA 3JPRA 1I94L 1PH2A 1DO2A 4JI4L 1MIUA 4BGDA 1PH3A 4ED0A 1ZQNA 1QUQA 4EQ5A 4YHHQ 1Z3EB 9ICIA 2Z0SA 4B9LA 3PO4A 1BKBA 4DR2L 1IBLQ 1Q8KA 1E3PA 4RNOA 4DL2A 3PF5A 4YFKA 4DF4A 1MN3A 3EIVA 4DUZL 5L1KA 4A3EH 4DR3L 4ME3A 2LVAA 4DR7L 4X62L 2FPLA 2WB1E 4B3RQ 2W9BA 2OOAA 2W9MA 4JV5L 1JXEA 1N32L 1YITA 3GTGH 4A3LH 1WCMH 4P4MA 1V1QA 3S17H 4GLXA 4DR4L 2R8JA 4O0AA 1VQ4A 4GKKQ 4ED1A 4O5CA 1VQCA 5J2BA 5KFRA 4GXJA 2V1CC 4DKAC 5J0TA 9ICMA 5KFKA 3C21A 2N78A 3S1RH 2HW3A 2OTLA 4A3LG 1L1OA 2R8KA 2R8GA 1IXSA 1SROA 4GKJQ 2JA6G 1XSLA 2JA9A 2G3QA 3C5GA 1OXVA 4RT3A 5IY0A 3RB4A 2VS1A 3HOUG 2JA7H 1CSPA 3FP9A 4KN4A 4TUPA 3K7AH 3HOZG 1XPUA 1A8VA 4J15A 1Q7YC 3RH6A 4POFA 1ZQAA 2JNHA 4A3GH 5IIJA 1KDHA 2I1QA 2K4KA 3QZ7A 3MR2A 3UQ0A 1Q81C 9ICNA 4A75A 4KLDA 1KFTA 1AH9A 2WAQE 2HVHA 4PMWA 4OXPA 1W3SA 4LFCQ 2NRXA 1OTCA 4IO9A 3ORYA 4PHPA 1UT5A 1H38A 3PW4A 3PW7A 3GQCA 3CCMA 1ZJNA 3LWLA 1OTRA 5CP2A 3KOJA 4JBWA 1XWLA 3M9OB 4HIKA 3E21A 2LTUA 2R92H 4DL6A 1QLNA 3T5JA 1YVCA 4RPYA 2FMSA 3RH5A 4LVSA 2D0OA 3KF6B 2F1HA 3V7LA 3OGUA 2RHQB 3J81j 4DFMA 4O3OA 4PZ8A 2MROB 4TQUS 2LVPC 3TAQA 4B9NA 4B9UA 2R7DA 1C9OA 4C8KA 1XNQQ 3QZ8A 1JMCA 1X3EA 5HGQA 5KFFA 4NY8A 2Q2TA 5J2JA 1QVFA 4YWLA 2CWPA 1ZQUA 3LCVB 3V6HA 4I2GA 4DR7Q 1WGLA 4DUZQ 1WCLA 2AGOA 3UXOA 9ICOA 5KT5A 3MFHA 4DV1Q 3SV3A 1UE5A 2KHHA 1VQ1A 3U4ZA 5DQGA 3U4VA 1LUZA 1YIJA 1U4BA 4KLHA 2LVQD 4DR1L 5KG4A 1Y88A 4M6WB 2W9AA 4IPCA 1L2FA 2AGPA 3TS0A 4KLEA 3I2ZA 1EOVA 1ZV1A 1DGSA 4DSLA 3SI8A 3HOYH 2W8LA 2UU9Q 3AQQA 4DR4Q 4P2HA 2ALYB 1GVPA 3GIKA 5DB8A 1LYLA 1KIXA 4LF8L 2K50A 3C23A 2W9CA 4JK1A 1ZQDA 1CEZA 4HIMA 4JI5Q 8ICJA 4YQWA 3FE3A 4X65Q 1XSNA 2ZUCA 2LSSA 4OWXB 1ZQMA 4OWWB 8ICSA 4R63A 2HHWA 2VQFQ 2WFWA 1DV0A 3AYHB 3OTOQ 2NRVA 4RQ6A 4NM1A 2Z6KC 4M9JA 1ZQQA 4RNMA 4UAWA 2K9DA 2V4QA 3CCRA 2UXDQ 4DQIA 1BGXT 2ES2A 3I4NG 3T5KA 7ICIA 1KLNA 5JJLA 3A0JA 2I5MX 1PA6A 1TTEA 2JEIA 1QTMA 5J29A 3F2CA 1JXLA 3MMPA 4UB1A 1VQLA 4A3GG 2UXDL 4UP7A 4X5VA 3Q8MA 1S97A 2UUCQ 3HOZH 4R4OA 1Z00A 1KTQA 1A0IA 3ER0A 3HOUH 5DB6A 2ZM6L 5AJ3Q 4IQWA 3EPGA 4X66Q 2AQ4A 1J5EL 3TS2A 2JA6H 1J6QA 1HNZQ 2MAXA 2K5VA 3CCSA 4QWBA 1SMXA 2UU9L 5KFWA 4DL5A 4RQ2A 2O25A 3E2EA 2MO0A 1PH4A 2JA5H 3PR4A 3AUOA 4APVA 4DSKA 1ZQHA 3BJUA 4R65A 5GAGC 4GNXA 2YV5A 1WCMG 5J0SA 2KHJA 4PZ6A 3CMAA 4MFFA 3RJJA 3TARA 4HJ7A 1IYJB 4I2DA 4BXOA 1KFDA 3C2LA 4HJ5A 3ZD9A 1K1SA 7ICEA 3JAMi 3KTQA 3JC66 1NBWA 8ICNA 5KFUA 4IRCA 1VQAA 3GIMA 3TQ1A 2PI5A 1WIVA 1XB2B 4QY7A 3F2BA 3BQ1A 4JI0Q 4F4XA 4GXIA 1YZ6A 3KFUA 2BCSA 8ICFA 4LUVA 5L1LA 5L1JA 4DV6L 4LF9Q 1S0MA 2BKEA 5J2IA 2VUMG 5CHGA 3KJPA 4P73A 2E5LQ 1JJCB 4X64Q 3CC7A 1EQRA 3OHBA 1AE3A 4YMNA 5C5JA 3M85A 3M4PA 3UDXA 1ZQSA 5C0XG 1PH9A 4F91B 3KHRA 2J6UA 2J6TA 3UDFA 7ICPA 2IHEA 2RCNA 4MF2A 4KLOA 1Q46A 2W9BB 1PZNA 4YP3A 4EX5A 2WAQG 1XMQQ 5DBBA 1FGUA 3S1QH 4JG2A 1L3TA 1X65A 1XC9A 5GQOA 3KDFA 4X64L 2E5LL 4JI7L 2HHHQ 3M4QA 2GN5A 7ICSA 5DG8A 4GNXC 4O3RA 4GOPC 4B3RL 2P66A 1GM5A 4QL5A 1EFUB 4GN4B 2C28A 2MUTB 4F4ZA 3LWMA 1NTGA 4RG1A 1PH6A 1U9LA 3AEVA 2BWBA 2R7FA 3L2PA 1JB7A 1MQ2A 4M04A 1JMSA 3M9NB 1EIFA 3RRGA 1PYBA 4DFPA 5KT7A 1XSPA 3UDGA 4JI3L 2J6SA 4UAYA 1CKNB 4RQ7A 4RNNA 4C3HH 3M3YH 1IBML 1WGNA 5JI2E 4MTNA 2XC9A 2PI2A 4TVAB 5J0RA 9ICHA 2Z6KA 4QGUA 3TFRA 1ZQXA 3B6YA 4P74A 3PO2G 3A5UA 3GTJH 2ATWA 5L1IA 3ZDCA 1TWAH 4EBDA 4F5PA 1BPEA 2OCEA 5IP7G 3CCUA 1VDLA 2VQEL 2YTYA 2NZHA 3SYZA 2JY8A 2VA3A 2UVRA 5K36G 1YI2A 4QZGA 2LBCA 2QHOB 4YMOA 3B89A 5IIOA 2QGQA 4LFBQ 3V72A 4GC7A 1TK5A 4O3QA 1HZAA 4P4PA 1D8YA 4R4CA 1NMGA 5EWFA 2YTVA 1UWVA 1DO0A 2EQSA 9ICKA 3RJGA 4BXXG 2N3SA 3PO5A 2C2DA 1N56A 3EYZA 4L5SA 1ZMUA 4KLMA 1L5UA 3RJEA 2QNJA 1TAUA 5BOLA 4IJLA 4F92B 4ELUA 4OX9Q 1DOQA 4PZ7A 4QW9A 4QWEA 2KCMA 3ICEA 4LFBL 2KBNA 4NXML 2CP8A 4UP9A 2B3TA 2KZMA 4XQ8A 4UY8C 1X9SA 4GOPB 3FKIH 5DQHA 4LF4Q 4F4YA 5FJ8G 4C3IH 1X55A 4NLNA 1FJGL 3GLGE 7ICOA 4IPDA 2ASLA 5KFNA 1GO5A 4HJ8A 3KHHA 4IPHA 4YR2A 4ELVA 3Q8DA 4P75A 2ZTEA 1WHCA 5HHHA 3RLOA 5J2GA 1M90C 3RB3A 8ICLA 1ASYA 4WP2A 2PMZE 3OJSA 2VZAA 3FDSA 4DV5L 5KFHA 4ECZA 1HUZA 2OQ0A 1QSSA 1SRUA 2BA1A 3V7KA 4LWCA 4TQSA 1G291 3UXNA 4JI8L 1A62A 1ZQCA 1C0AA 4Z6EA 1V92A 2OTJA 5IIIA 2RRUA 2K75A 3CXCA 2JA7G 3PUZA 1XNRL 4BBSG 1ZQLA 1HT2E 8ICTA 4LFAQ 2R7ZG 4KLQA 4Z6FA 2Y0SE 1PH5A 4RQ4A 3EW9A 2ZJRA 3AU6A 2ZJQA 8ICYA 2Q2UA 3KYHC 1XMOL 1QZGA 2HHVA 1VEJA 4JOIA 4A3FH 5DKWA 1IM2A 2BQRA 3G6XA 3TANA 4DUYQ 3J81i 3KHGA 1HR0W 1ZQIA 5IYBG 2R93H 3Q8SB 5LMNW 3I55A 3HOWG 4NLGA 4ECRA 2V4RA 3IECA 1YJWA 4JC0A 4A3EG 4C3JH 1A77A 3JPQA 1Q1EA 5M3MH 4DV2Q 5KT4A 2JJQA 4JI1L 2NVQH 9ICPA 3TREA 4A3DH 7ICFA 8ICWA 4C2MH 3ISCA 2V9WA 4B9SA 4F4KA 2PI2E 3HKZG 2UUBL 4IFDG 1AIPC 4Q45A 1UA0A 4RQ5A 5DLGA 2I5LX 7ICNA 4K0KL 1C7YA 3BZKA 2YTXA 4DUYL 4AYBG 4JI6L 4ECUA 3GTQH 3B0YA 4QZIA 3S16H 3NBHB 1ZQEA 2JY6B 4F1IA 1K8GA 1NOMA 1Y8GA 4DF8A 1XJVA 5HY6A 3LDAA 4BY1G 3CPFA 2P6RA 1K8AC 1PH1A 1TWGH 4A93H 2CCZA 2C2EA 2ISOA 3T1YL 3MR5A 1KAWA 3H40A 4LF7Q 3BZCA 4QWAA 1IBKQ 4K4HA 1NMFA 3PIPA 1NJIC 1WOCA 1U45A 2Q2IA 2K5HA 2ALZA 1EIYB 2BDPA 3RB0A 4QZHA 4DSIA 4I2HA 4GKJL 4AIMA 2DAIA 2IHNA 2W8KA 1N36Q 4A4IA 4A3KG 1JN3A 1K1QA 4DV5Q 1T6OA 3PW2A 5IILA 1A76A 1BBUA 2EKKA 3SGIA 4KLUA 4A3IH 5KFPA 3CW2C 5D4BA 5KFZA 2FMPA 9ICVA 3LGJA 4Y52H 2UVVA 5KG0A 3EPIA 1TAQA 2JEAI 4F3OA 3DLLA 1L3SA 4M6WA 4IR1A 3RR8A 1A63A 4IQUA 4JI7Q 2BWEA 4Q8EA 4YXJA 4J9QA 4Z6CA 4R66A 4LFAL 4FO6A 4GS3A 5KG2A 7ICHA 1S77D 4DK3C 3CCEA 3M7NA 3RZOH 3KLWA 3ULJA 4F2LA 3ZDBA 4R4IA 2ISPA 2RDJA 2UXCL 5C44H 4BBRH 4AQYL 3OW2A 3NTUA 1HR0Q 5C4JH 1D9FA 2JEGA 1T9HA 1UE1A 4RPZA 4YG2A 3GTOH 5J0YA 1ZQFA 3PIOA 4WJ3M 5KG7A 3N4MB 7ICVA 2Y0SG 4IOAA 1CKMA 3W5OA 1OXSC 4UQGA 1E1OA 2DAGA 4XIGS 9ICWA 5EWEA 1MJCA 3MR3A 3CPWA 4AH6A 3EN2A 1TWFH 3JPPA 2IX1A 4RUAA 1LB2B 1S40A 1HNXL 1CKNA 3IHQB 9ICJA 4YCUA 3NGDA 2OWOA 5GAEC 1D9DA 1VQ7A 4CCHA 1MQ3A 7ICJA 2VQEQ 3CQZH 5D46A 1EFWA 1G4AE 4KHPQ 3EBEA 2UUCL 4B9MA 4J9SA 1WCNA 2JE6I 4NXMQ 1KRPA 4KI0A 5L9XA 4C8OA 3GLHE 4J9KA 2JEBI 3SZ2A 1HZCA 5IWAQ 4F5OA 2K0BX 3ISBA 3I7FA 3A74A 2PNHA 2HAKA 5BR8L 1HQYE 1KRTA 2DFLA 2E2JH 5HMMA 4DLEA 1RYRA 4DQPA 1WJ7A 5DLQE 4R71A 4I2IA 5KFOA 1UT8A 3AU2A 1HH2P 3EWAA 4GC6A 1IFYA 8ICHA 3TAPA 1BPBA 1AE2A 4KHPL 3PX0A 1S76D 4B3SQ 4JWNA 3OSPA 4DAMA 1XPOA 9ICTA 7ICKA 1XNQL 2BHNA 4RQ8A 1YBYA 4BWMA 4B3TL 2KNAA 5KFDA 1EUJA 3I4MH 4PGYA 1YJ9A 4DR6Q 4LUZA 3PW5A 4H02A 3F2DA 3ISDA 4YR3A 3MGHA 1BVSA 1S9FA 3PV0A 4LZDA 4HYKA 4UN2B 5ELNA 5IYDH 2N8NA 5BPCA 4A3MG 5KFEA 3V7JA 4EBEA 1ZQOA 2YYZA 1AROP 5LMNQ 4FS2A 4R1JA 2HQLA 4YY3L 4I2FA 4MFCA 3RBDA 5TZVA 1JJGA 4KTQA 5KFYA 3RN2A 1VQIA 4QZFA 4YR0A 3U50C 5GAHC 3GV5B 1X3FA 4DLGA 4A3JG 3ZDEA 9ICEA 3CCJA 2AHOB 1HJPA 3HWTA 2IMWP 4KLIA 4NXNL 4A3CG 4QZ9A 2EJSA 4DV7Q 1XS9D 3OSNA 3BQ2A 2MFIA 1NKCA 1WYDA 3L0OA 4DQRA 9ICCA 3G6EA 2VY3A 7ICTA 2EXDA 1VEGA 3UPQA 2NZOA 4LF8Q 4J9LA 1Q82C 4J9RA 2KZ3A 1SFOH 1S72A 5D49A 4RQ1A 1VCIA 1SE8A 1NJYA 5J0QA 4DR5L 1X2IA 4DFKA 1CKOA 4RU9A 1GO3E 3G4SA 4KLFA 1I5FA 2W9CB 1N36L 3KHLA 5KFGA 3Q8LA 2BCUA 4JBJA 4DV3Q 1GKHA 3G6YA 1SN8A 2PI4A 4IR9A 3IM1A 1ZQPA 3LCUA 1PHJA 3TRZA 1VQ6A 3H4DA 4I2BA 4HEOA 1XU4A 1NK8A 3GTPH 2I5HA 3MDAA 4QZCA 3V6JA 1H95A 1QVCA 1MSWD 4JV5Q 4RT2A 5GROA 1HUOA 4KN7A 2XCPA 1SZPA 3Q8RB 1S0NA 2LXJA 4DR3Q 2E2IH 4O3PA 2AWNA 5ELOA 4OONA 2PFNA 3OHAA 1NK9A 4UB3A 1I50H 4UB4A 5KFAA 4NXNQ 3LK9A 2D0PA 4DS5A 3H8JA 4RZRA 3CF5A 4JI4Q 8ICGA 1EWIA 1Z00B 1I94Q 2BCRA 8ICEA 4ZH4A 4J9MA 3Q8KA 4YD1A 5M3FG 4KLSA 1L3VA 2LYHA 5FLMG 1PFSA 4YY3Q 1SG9A 4I27A 4M0AA 3E0EA 4DNIA 2IHFA 2JA8H 2XO7A 1D7QA 4JWMA 3BQTA 3E46A 5M3FH 4LW1A 1ZQBA 1J5EQ 2C35B 1N32Q 4BY7H 1YJNA 3H4BA 4POGA 4B3SL 4ALPA 4ECYA 2BGWA 1X9WA 4O3SA 3HOVG 1P16A 2B63H 4IQVA 5KFCA 4QIWE 4TURA 4J9OA 1HZBA 4O0IA 4YN4A 3THVA 8ICXA 1UEBA 5LMUL 4LUOA 2C2RA 4GOPA 4KMUA 4A93G 4ED3A 3FRIA 2ZJAA 3HOXH 3FHWA 2VL6A 2L2DA 1B8AA 1E24A 1FVIA 4QZAA 3NEMA 2L4FA 3TQYA 3H7IA 5LMNL 1MJEA 3PX4A 5KT2A 2F1IA 8ICKA 3RJIA 4DPGA 2KNZA 4G3OA 8ICQA 4X65L 5CA7A 1I6HH 4F2RA 1TVAA 2UVUA 2NVTH 1P3QQ 4JV0A 4F5NA 5DG7A 1KHIA 4YCVA 4JCVE 2B29A 3CCLA 3RBEA 4DQQA 3HKZE 4TUQA 5DQIA 5J0WA 2NN6G 1KQSA 2BR0A 4KITB 5IIMA 3PUWA 5DDYA 4JI2L 1PYSB 4ED2A 4EYIB 1U0LA 4L5RC 5IYBH 4IRKA 2Y1IA 4YCWA 2CKZB 1ZQGA 4DR1Q 5IYCG 3GDXA 1Y1WH 5H1SE 1NY4A 2KCTA 2IBKA 1OXXK 4DL4A 4LF7L 2JZBA 4RUCA 4A3BH 4A3JH 2ASBA 1T4GA 3HW8A 3HPOA 1X3GA 1V43A 4A3BG 2R7ZH 4MEYA 5JUMA 1IZ6A 4YD2A 1NK5A 2GVBA 4BBSH 2VQFL 1TV9A 3PSIA 4DSJA 2I0QA 2HVIA 1UE7A 4NB3A 1ZYQA 1Y1WG 5IYCH 3ZDDA 1YEZA 1SKWA 1LTLA 4JI5L 2HHUA 1ZQWA 3STBC 4YCXA 3I4OA 5IYDG 4IOCA 2PQAB 1TK8A 2XGPA 4JV1A 3PGZA 1YHBA 2HHTA 2IY5B 3GTKH 4R8UB 5J0PA 2UUAL 4DV0L 1IBKL 2OQKA 4UAZA 2HIXA 4JI3Q 5KT6A 3HP6A 5KT3A 4LNQA 3RTVA 1VEKA 4P4OA 5J0OA 4PPXA 2BPGA 4DV3L 4KHZA 1R9TH 2DAMA 3S1NH 1ZQKA 1X9NA 1NK6A 3H0GG 4QQBX 4MEXA 2FLNA 1KEJA 3RJFA 4GKKL 1JE5A 2R0IA 1TXYA 4IQTA 1XMOQ 2AKWB 1LM0A 1S0OA 5CWRA 1L1OC 4YXMA 2FPKA 4K0KQ 4NLZA 2YU9H 5DBCA 2R8HA 5EAYA 3PO3G 3K8AA 2HHHL 4XA5A 9ICSA 7ICUA 3H15A 2EIFA 5IE8A 1B43A 5DGAA 2K52A 8ICVA 4UB2A 3CC4A 4DQSA 2C22A 3IHPA 8ICOA 2RF4A 4XUSA 3IRBA 1QUQB 1G3IA 2VW9A 2LXKA 1QZHA 2P6UA 3GIJA 1GD7A 2K5NA 4LF5Q 2F3IA 4I2JA 5C3EG 2B63G 1IM4A 4DV2L 4RPXA 4RMFA 3HOVH 5DG9A 1N34L 1M1KC 4TUSA 5KG3A 2VA2A 4BY7G 1E1TA 2BPFA 5KG6A 4QJFA 4DSFA 1R4GA 1HZ9A 5DLFA 3A5ZB 4ECTA 2KENA 3K80C 1Q1BA 4HIDA 2KN7A 4DR5Q 4JUZA 1L3UA 1VQGA 5IIKA 2DGYA 2RHSB 2PFPA 3GV7B 4JOIC 1KL9A 2BCVA 4MZ9A 4PH5A 5C4XH 2ASDA 3C2MA 5KFLA 5KFBA 4O9MA 8ICRA 2Q0ZX 4UPAA 2CWBA 4OO1G 4X62Q 1PH7A 4DV7L 7ICGA 2NVYH 1KD1C 3GLIE 2UXBL 1CUKA 2DZLA 4EZ9A 3TI0A 4YWMA 5CR0A 3Q8PB 3PW0A 2NRZA 2JZBB 2HIVA 4HJ9A 4YHHL 4DEZA 2VA8A 2HWJA 2ZTCA 5C4XG 4IJHA 4OX9L 4DBGB 2A8VA 5JEAJ 2AQ0A 2FLLA 5BR8Q 4PHEA 4A3IG 3V6KA 1LV5A 4KLTA 3JPNA 5HMLA 2Y1JA 1BPYA 3C5FA 1X56A 1WI5A 2DHYA 2WZJA 1VQDA 4DV4L 3EZ5A 1XO1A 2BCQA 4DOCA 2RDIA 2KHIA 5AJ3L 2KFZA 4B3TQ 4NPSA 4JV2A 5C3EH 3STBD 1V9PA 4B9TA 3S2DH 1PGYA 2QA4A 5KTQA 3H3VI 1B22A 4UBCA 5DGBA 2K14A 5BOMA 4PGXA 4G3IA 2KNVA 3FYHA 1VS0A 3PO3H 1ZQRA 3H8SA 1HT1E 4Q43A 3TFSA 1I3QH 1K9MC 2JZ0A 4PG3A 4BWJA 2XTIA 3W1BA 4DL7A 1YHAA 2VUMH 2MO1A 3I56A 5IWAL 1P8LA 3H0GH 1WJJA 2WP8J 3U58A 3M9BA 3PUXA 1PV4A 1HR0L 1MKHA 2IA6A 3BDPA 1COOA 4R4QA 5LMUQ 4IFDJ 5KFVA 2ZUBA 1EXNA 4A3CH 3S24A 4GN3B 4F4WA 4A76A 1X9MA 3PX6A 1XPRA 2PFQA 4JBMA
chains in the Genus database with same CATH superfamily
3H3VH 4I2EA 1C48A 1MSHA 3UM9A 1G51A 3MABA 5C1BA 1D1IA 3T6PA 2QQ8A 3BBZA 1A3VA 3CP0A 1RXVA 1ZJMA 2O01F 1NKBA 1PK1B 3K0XA 5JJKA 2KSOA 2AHMA 3NP8A 2Z1CA 4ECSA 2MHVA 3J80c 1NV8A 1STGA 3OOCA 3C9PA 4YVZA 5C5LA 3UDIA 2R93G 2JH1A 4GN5A 1VQHA 4NXMM 4MNOA 4RQ3A 1YLAA 3GU3A 3NE5B 2F0QA 2QEXA 3I4MB 3AFHA 2ASJA 2DI0A 4QHTA 3AFQA 3C1FA 3LVVA 2KICA 2Y0SC 3B0XA 5ALFA 4O3NA 1CQFA 4M8AA 2JA5G 2ZTDA 3JPOA 3T1HQ 3PUVA 2DPJA 2B2YC 4B3MQ 3HKZC 2XY7A 1PTOH 3Q8QB 3ZJYC 1LT6D 2ZJPA 1XMQL 5DB9A 3KLSA 4DFJA 4HIOA 3NWTA 4A3MH 5EWGA 2DBYA 3H0MB 3RJHA 3Q8GA 1NKEA 1T7PA 2HBJA 1X6OA 4KMOB 1NUCA 3FRPB 1QSLA 4V0BA 4BLCA 1GL7A 2BDOA 2C5CA 2K4PA 3N97B 2CHQA 5HR7A 1OXUA 4OIKA 5FLXS 4NSRA 2EY2A 2IX3A 2DY7A 4K5VA 1KDBA 1TQOA 1G8PA 4PDGA 2RCFA 3QE9Y 2CV0A 4QZ8A 3BJYA 3I4MG 5CORA 2HCIA 1T3TA 3RN5A 5IT9c 2F4VL 1SZHA 2L12A 1ENCA 4YWKA 2HOFA 3HILA 3HOUB 1UQVA 4O5EA 1Z9FA 4B9XA 3F92A 4J9PA 3L7ZC 4DV5M 2BPCA 4B3SM 1T94A 2BA0A 1J7KA 4DOAA 2M9VA 4Y7NH 3CKIB 1UA1A 2PCFB 4FDBA 4EEKA 7ICRA 1JT8A 4Z6DA 3L5KA 4HJAA 1U4PA 4NDXA 1E94E 1L1OB 2E8NA 2O5RA 2G0AA 2G5IB 1IXSB 4TUWA 3MGIA 8ICMA 3RGPA 2RQ5A 1QAOA 1EWHA 3IN5A 1K3BC 2FXQA 2WB1B 3PNCA 1U48A 4KT0F 5KFSA 1K3RA 2F0HA 2E2HH 4JBKA 2CV2A 1UM8A 4F93B 2EJGC 3H4JA 2NN6H 1WTPA 1V33A 3CCVA 1RYSA 1ZRNA 2WB1F 9ICLA 5ALQA 5K5PA 5EE9A 3PUYA 4LJZC 1QG7A 2M9NA 2BQUA 3T38A 2GWSA 4H7BA 3GV8B 5T1IA 1TF0B 1IV8A 4US9A 1S10A 2JEFA 3OMGA 5CBEE 3FRHA 3TN2A 4OX9M 1R2YA 2KVSA 1CA5A 3K4GA 1T43A 3NK9A 2ERCA 4IBKA 2KTQA 3BG3A 4R4TA 1ZQTA 5A35A 3GO8A 5IIFA 4IBBA 4LG2A 1L7OA 5D3DA 1WTVA 2K05A 1KXLA 3KOYE 3JPTA 3I72A 4C1NI 3VKHA 4RGTA 2BQ3A 1BNZA 1WD0A 4ED6A 1E9SA 2OT2A 8ICBA 2HDMA 3C2KA 3FKIG 1QDRA 4OO1I 2OOBA 3OPXA 3AOGA 2LHTA 4UB8U 2JA8B 1N8RC 1U5KA 5C0XI 5CB1A 3T1YQ 1ZQZA 2PZUA 2JK8A 3T1HL 4B3ML 2EA0A 3EQLC 1TWHH 4EYHB 2TMPA 1YHQA 2YQEA 3HX3A 1RIPA 4DL3A 3BDOA 1SL2A 2MNAA 5C4JB 3RNUA 2QSFX 1GVNA 2EDUA 4I2AA 5AKXA 1B7YB 2KK0A 2ENBA 1NV9A 1Z6HA 4M9HA 2PQAA 4GLAC 5C4HA 5LMNM 2YTUA 4DXFA 4LCBA 3D0FA 1L1TA 3VCBA 1NSFA 1EY0A 4OHJA 3TWLA 5EPKA 4DR7M 3T5LA 3F8TA 5EXSA 4AG6A 4B7HA 2KIWA 3UMBA 3DEOA 1GJSA 2A1JB 4ECQA 3FKIB 3K9OA 4N9TA 3WWVA 4JI6Q 4X66L 3SC3A 3HOYG 4JV5M 1E7ZA 2ZM6Q 4R8UA 2R8IA 3GO5A 1JX4A 1HNZM 3VA5A 1R5LA 2W04A 3NVYA 5JPNC 2HHHM 2Q2HA 4ED7A 4FCTA 1JJ2A 3UE1A 3W2DA 1OIZA 3DM3A 4YIJA 4R64A 4G4NA 1YE9A 4M47A 3UK6A 4GNXB 3RZDH 1SXDA 2YB1A 3HKPA 4ZPXA 9ICXA 4JPBW 2MGWA 2DWMA 4Q7JA 1KRSA 5C44G 1KFSA 5KG1A 4E0DA 5M5WH 2XSZA 3IAYA 1N48A 2KQ3A 3HKSA 1FJGM 4C80A 4BA1I 2KVMA 3CF6E 1U49A 4YMMA 3S6JA 3M7GA 3HOXB 3PMLA 5JJIA 4FXKC 3S1MH 4RCOA 1B4FA 1SL1A 4MHVA 1LLRD 1GOZA 5J39A 5ITUA 1VG5A 1F4IA 4Y2QA 4GLVB 1KC8C 1DCZA 2JUJA 4I65A 3SYLA 3T15A 1PMRA 4M2YA 5ELEA 2NVXH 5DYGA 3S2HH 1VQNA 2JP1A 2Q4TA 3OSOA 4KLKA 5IP7H 5M5YH 4CJ0B 3LVWA 4JVZA 3G48A 4JI7M 3DEEA 3BQ0A 3SMSA 3M9MB 3VR2A 5J0UA 1IKLA 3PO2B 3KOZE 3PVXA 4O2DA 4F8RA 5M5XH 1E22A 2JA8G 4P72A 3KK7A 4BY1B 2KFNA 5KNBA 5KL1B 3GD7A 1BBWA 2D7EA 3GDEA 1VQEA 2SEBD 1XTDA 3Q6SA 1XPRA 2QENA 4R9WA 4XBOA 3PV8A 2LY7A 1O7YA 3S2DB 2F5QA 2W43A 1IL2A 1OQYA 1O7IA 3PY8A 1TS3A 4JI6M 4EVOA 5IODA 5FLMH 2A1AA 4ECWA 3P20A 2L15A 3KFUF 2B21A 3FC4A 1NJXA 2MQHA 4DK6C 1JR3E 3F5AA 5BR8M 1WFQA 4QZBA 3S1MB 1EY8A 4A3KH 3NQIA 3K9PA 1PH6A 3PQIA 3D2QA 1KYIA 5DBAA 4PGQA 3A8IE 4AYBF 3OWFA 2VQFM 3J7A5 4DR6L 1NNLA 3TEHB 3BVGA 3WK4A 1DRGA 1BPZA 4DOBA 1FJGQ 5KFQA 1FL0A 3I90A 1N5XA 4TQRA 3MC1A 2DKXA 2HBKA 1U47A 1KSPA 2F77X 2RSNA 2XWJB 2R65A 5H2FU 1Q86C 4F5RA 4FNFA 1VQBA 2G9DA 4LJ4A 4OW0A 4DK1A 3JAMc 1VQOA 2AWOA 4IL6U 2R92G 2E2IB 2DNAA 4I29A 4I2CA 1ZETA 3RRHA 1B3QA 3DWAA 2RGHA 3L3OC 1T5EA 8ICCA 1DZ1A 4Q44A 5J2FA 2Y21A 1TDHA 2HCCA 1SLJA 3L9AX 2Q2EB 4RAUC 1VQ9A 9ICRA 2IX0A 1NK7A 3NASA 5ALMA 1W6JA 2DJGC 2A3VA 1Q02A 4OJOA 5GKNA 4ED8A 3B74A 4J6HA 4CKBA 1K83H 3R8BA 3ERSX 4I28A 3JPSA 3HP3A 3NENA 3BZDB 2MR9A 3MEFA 1N5WA 2FFJA 3GRYA 2KV2A 4M1UB 3I91A 1SKSA 4KY7A 3UZUA 1KABA 1IXRA 4ICAA 4L5TA 2ZJ5A 4C56C 1VQ8A 1PYWD 3RAXA 2E76C 3M4OH 4G57A 2HBMA 3GILA 1A5TA 3MFIA 4UBBA 3UQ2A 3OTOL 1A15A 4LF6L 3HT3A 2UXBQ 1TGUA 2DAEA 3J27B 2MUTA 2XCAA 4RF0A 2JQOA 1Z5CA 1PVPA 1TR8A 4IC9A 5KFIA 3J7BA 3QYEA 4NLBA 1BPXA 3SAUA 3QWNA 2A73B 4A3GB 4ID6A 3RR7A 2KEBA 4BUGA 4GXKA 5F2DA 1MX0A 3VFDA 2ATLA 1EY9A 4KLGA 1E2WA 1GUOA 4Y2UA 2V6ZM 1DM0B 2D62A 4WJ4A 4LF4L 9ICGA 5C0XH 5KIXA 1VQFA 1NY6A 1Z47A 2L4EA 5AI9A 3GLIA 3BS5B 3K81C 4FVMA 4B9WA 1NHWC 3X3MA 2JA7B 4K0KM 4A3DG 1RDFA 5CRXA 2L09A 2ICEC 1C20A 1MBYA 5M3MG 4DUYM 3GLFE 3GTPB 3D6WA 2JY5A 2DPIA 1FNNA 1NK4A 4RQNA 2E8GA 4ELTA 1IIPA 2JV3A 5ALVA 4IUNA 3S15B 1QAMA 1OAIA 1ZD3A 2DZOB 5ALKA 2BE5D 3HKZB 4XXEA 1RPLA 1VQ5A 3GZFA 5J2EA 4RGMA 1WTOA 4P16A 4EELA 1RCVD 2VIXA 3HOWH 3HFZB 3L27A 5DFLA 1YNXA 4L6TB 2KHSA 1DK3A 4ULLA 3BVMA 2DKLA 1Y14B 3NPPA 3FMCA 2XY6A 3S1RB 3UGJA 2ZIXB 1ZQJA 4M9LA 2E3TA 4GEWA 2EKFA 3RLFA 5F9NA 3T4AC 4DF7A 3DFZA 5IWAM 2R6GA 2VNUD 3U9OA 3S14H 4Z9CB 4A3FG 3U60B 2DJFC 2ID0A 3GLGA 2XEPA 3ZD8A 3CMEA 3TP8A 5J0XA 2V1UA 4DR4M 1EIJA 3FEWX 4QZDA 1X54A 3OYYA 3K5MA 1PJQA 3VDYA 1XC8A 1B70B 4FWDA 2BH8A 4O5KA 2EAMA 1XXHE 2PFQA 1SAPA 1CI3M 2KUMA 4HR7B 3HGBA 3K1ZA 4B6JA 4AQYQ 5H37D 4JBMA 2UXCQ 3PCOB 3SAVA 3BYYB 4P71A 5KFTA 3ZDAA 1ZD4A 1ZQYA 5J2DA 4K4IA 5EKLA 3SE0A 4A8EA 1L0WA 4C3HB 1HNXM 4F50A 4Q8FA 3RAQA 4LK1C 2QW7A 1WD1A 3MXGA 2JXNA 4Y28F 1Z5AA 4QWCA 2FJ6A 3MXNB 3RB6A 5EJWA 2NN6I 1ZXIA 2WAQC 4EBCA 2R44A 1QSYA 2Z6BA 4MGYE 2QARA 5KG5A 4GITA 2F1JA 4DCCA 4XRHA 2Z4HA 4RCNA 5F9LA 4WORA 4RNAA 4IBEA 2VANA 3KF6A 1HNXQ 1BPDA 2FDRA 5GTIU 4QW8A 2I9GA 1PUZA 1RQNA 8ICZA 1NR2A 4OGQC 1XHBA 4F2SA 2A74C 1VQJA 2K5QA 4DV4Q 4NL4H 2H1EA 2VJ5A 4M9GA 1T3NA 1EQQA 3ETLA 3QUBA 2DUDA 3GPXA 2YB4A 4BXOB 2QEJC 3GTLH 3M3YB 2F52A 2LKYA 2HHSA 1RXWA 1DGFA 1ED1A 3SYKA 3ICXA 4KV6A 1HNWL 2QBYA 4UB5A 3MBYA 2K28A 2X6GA 5AM1A 2EVBA 1L0XB 2WACA 2XFSA 4AKIA 3W1GA 1XNQM 4PHDA 4RQ0A 1IBMQ 1L8QA 2UUAQ 3C58A 4JI1Q 4AI6A 1JOOA 2CFMA 1IY2A 1FFVA 2JP7A 2KA7A 3E9IA 4GHAA 4IPGA 3WOFA 4HL4A 3QAUA 4UP8A 2UVWA 4IBGA 1JORA 3RGSA 2XGQA 1X3PA 4Y2RA 3U26A 1KLUD 1PZID 5JEAG 1N34Q 4KLLA 1PK1A 1NE3A 3WKAA 5EBCA 3QG1A 2H3VA 2P35A 2PXIA 1Q3CA 3OJUA 1PRTB 1STAA 2GVAA 3GIIA 5FJ8H 4C3IG 3S17B 4OWTB 5AI4A 4XTCS 3GTGB 2F0IA 1SXJC 3CAMA 1NJZA 2M0NA 2HUGA 2FLPA 3D31A 1ZQVA 4OJLA 3T3FA 1JICA 2MPMA 3DHQA 1U4LA 4ZLTF 2DAKA 5CV6A 5DM63 4DV1L 3M8RA 3VYTA 3NHHA 3CC2A 1QUTA 3J81c 2KA6B 4IFDI 4LFCL 1QVGA 3TWKA 2F3NA 1KLGD 4ECVA 4GIBA 1Q12A 1BDOA 1VF5C 5AI8A 5LHY1 4ZKBB 2BCOA 5J2CA 2QP9X 2YMPA 5J2AA 3KJOA 4FCVA 3SQIA 3BU2A 3IV6A 2XY5A 5E7NA 3CCQA 2HHQA 1K73C 3UI2A 1ASZA 3NELA 1OKSA 4AZFA 4FBUA 3ND9A 1OXTA 2H5XA 2KD1A 4DXGA 2NRWA 2OO9A 3NVVA 5JU5A 1S8OA 5FLXc 3PR5B 1F9RA 3MK6A 3KS8A 2MJ5B 1NK0A 4GIPA 1RL2A 5DYIA 1Y1VH 3J80i 3I4NH 5K4LA 3RFAA 2JY7A 1SDFA 2A68D 1RF2D 3E9HA 5JPMC 1MU5A 4NV0A 2WB1G 4D81A 5DDMA 2W82A 1N32M 4B3TL 4BXXH 9ICUA 3G6VA 4MN3A 4C8NA 4C8MA 3RLNA 2VXWA 3KDFB 1IBLL 4UATA 1D6EC 4DO9A 3M0EA 2NQ8C 4A3EH 1WR1B 3U61B 2DENA 2NYVA 2IHMA 2E2DC 1SXJE 5EP4A 5KFMA 1HTLD 1G2TA 2N49A 3GQ5A 2FFKB 4JK1C 3HY5A 2UUBQ 2B3GA 1TWFB 3HOZB 4X3KA 4X6AH 3KS4A 4AW4A 2EY6A 2IT1A 1U4MA 4LZGA 5DB7A 4K6LA 4J9NA 2E1EA 3K5OA 3OMCA 2KXEA 1VQKA 2VJ4A 3PNVA 1T8EA 2FMQA 2A69C 4LF5L 2K6BA 9ICQA 3VK8A 4ZCKA 3GTMH 4DWIA 5CJ7A 3CQZB 4LZZA 4C3IB 1NVMA 3JAME 1HNWQ 4D80A 3J7AS 2J7ZA 5IP9G 1J09A 4IRDA 4GZYC 1ECWA 4MF8A 5AKLA 4DS4A 4US8A 3VR4A 4EQNA 3IKJA 1CFMA 1ENFA 2CQOA 1UE6A 1G6PA 4IUVA 3V96A 2DQNB 4LF9L 2F0KA 1X37A 1N33L 3PO2H 1SNOA 3S16B 1V34A 1ZMWA 2EZXA 1H9SA 1SL0A 3C3DA 2F0JA 1D0LA 3QEBZ 2WF7A 3H0LB 5HNKA 3RH4A 2A6EC 4BBRG 5FO8B 1HNZL 2LVNC 4JI0L 7ICQA 4F5QA 1TK0A 5C18A 4DSEA 8ICUA 5IP9H 3C1YA 2F0UA 1MC8A 1SKRA 4CJ1B 1FIQA 1Z1VA 1HFGA 4AYBE 3ED5A 1ORYB 3UE0A 3C1ZA 8ICAA 3F1ZA 2WSFF 3EUB2 1GUGA 1W2BA 3ULPA 5GADC 4FS1A 4JYAQ 1QVRA 2VF7A 4KD4A 1QZEA 1TFRA 3T5HA 1TKDA 1SR3A 4DR2Q 2DZNB 3HZXA 2K4IA 3QXGA 1RJTA 2KZZA 1KN5A 4NM2A 2PYKA 1D8LA 3KZXA 3NUCA 2OPFA 4EZ6A 1JIHA 2JEJA 5A2QL 1VQPA 5AIAA 3QR8A 3PF4A 2C5RA 2JSOA 1VJ5A 3TQ1A 2PI5A 4BDPA 4BX9C 1CSQA 2KJ5A 4R3DA 2LM1A 3K7UC 1XNRQ 2CH4A 2QF7A 5HHIA 3G71A 1PH8A 8ICPA 3AFPA 1MI2A 1UEAB 3PMNA 1ZMVA 1F2LA 9ICBA 4I7AA 4X3UA 4DV0Q 4EENA 2O6KA 5J2HA 5KFXA 2A1JA 2AMCB 3AL0B 4L5QA 5C0XJ 2PFOA 1S0VA 4BA2I 5J3BA 1L0YB 1G41A 4DAYB 3CD6A 3M8SA 1H9KA 5FO7B 1K0RA 3MDCA 4JI8Q 4A3JB 1Y1VG 4USAA 1DGBA 3AOEA 2Y9UA 8ICIA 2HHXA 1B9MA 3B7QA 1ZRMA 1HXYD 2AGQA 1TU2B 3SVMA 4JI2Q 1HPCA 4K4GA 3UXPA 4G6ZA 5KFJA 3EFXD 3K75D 3RJKA 4ECXA 1F2ZA 3NRZA 2XGTA 1ILPA 3W3AA 1TWAB 2ZUDA 1EYDA 1EY6A 2H4OA 5EKKA 3GP1A 1NJWA 1TWCH 3SV4A 4KJNA 2HKJA 3T13A 2HT1A 1GXDC 4K8JA 2NVQB 1KW4A 1L7MA 3NWSA 4IZ8A 3GFKB 4JYAL 2JZ1A 2D6FC 1JWSD 1PRTC 4A3KB 2AJQA 4KLJA 2C9CA 4QZEA 4C8LA 2AU0A 2CHGA 3HX0A 4DR6M 4IBFA 2A6HD 3KFUG 2CWAA 3RR5A 2EZZA 2ZJ8A 1KBUA 3I01M 1ONLA 1EYGA 3J2PB 4GC5A 5ITRA 4KJOA 5IINA 1SV0A 3QYPA 3S15H 3MR6A 5HP4A 3EIHA 4AQYM 3M4OB 5J2KA 2LVOC 3H8WA 4QWDA 4GH9A 4EEYA 1X9XA 9ICFA 7ICLA 3WKDA 3MXUA 4NKLA 7ICMA 1A3UA 4B9VA 3GV6A 3ULLA 5JJZA 4BY1H 1N33Q 4ANRA 3WK5A 2BH2A 2CW0C 3HRDD 2RQXA 3KBBA 4NXZA 1S3OA 4LF6Q 1VDZA 1VQMA 1QNKA 4M9NA 3CHBD 4MFAA 3MHVC 2KOBA 1RZTA 9ICAA 1DJRD 1VF7A 3W67A 1MSGA 1EZ8A 3GRVA 3AOEC 5ALDA 3SK6A 1AN8A 4KKUA 1STBA 3SHGB 4FBTA 5ELDA 2A19A 3R9XB 4PHAA 5EOZA 4KK7A 3J80E 1UFZA 4NLKA 2WTFA 4Y2TA 1N9WA 3QEAZ 3EROA 3F53A 2FPMA 1EZ6A 2NRTA 4OO1J 5KYIA 3JPRA 1I94L 3BQ7A 1K0SA 3A0BU 4LJ5A 5M9OA 1PH2A 2I0QA 1DO2A 4JI4L 1MIUA 2G07A 4BGDA 2KJXA 1PH3A 4ED0A 1D2NA 4LFCM 1ZQNA 4IFDH 1YZ7A 1QUQA 4EQ5A 4YHHQ 2SDFA 3NTIA 1Z7TA 1Z3EB 9ICIA 2Z0SA 4B9LA 3VLFB 4D82A 2B0CA 4JMUA 3PO4A 3HHXA 3GQ3A 1BKBA 4DR2L 1IBLQ 1Q8KA 2YN4A 1E3PA 3HOXG 1K3WA 4RNOA 2EY5A 4DL2A 4HAIA 1WTHA 4YFKA 3VR3A 4DF4A 1MN3A 1FYCA 3EIVA 4J8QA 4XYQA 4U68A 5L1KA 1O78A 4CDCC 2VQEM 4DUZL 2XH9A 3HRZC 2LVAA 1CT1D 4ME3A 4DR3L 4DR7L 4X62L 2FPLA 5EJCA 2WB1E 4B3RQ 3SXHA 3FPUB 4MIUA 1IKMA 5EE1A 4Y2YA 2W9BA 2OOAA 2W9MA 2VF8A 1JXEA 3SEIA 4JV5L 4PDIA 4HEDA 1N32L 1YITA 3GTGH 4A3LH 1WCMH 2E2JB 4P4MA 1JRPA 1V1QA 5IGDA 2R62A 4LJ8A 4GLXA 4HCSA 2LMRA 3S17H 4KO8A 3SDZA 4DR4L 4DV6M 2R8JA 5BN5A 2F44A 5A0LA 4O0AA 3SATA 3MEHA 1I4WA 1LT3D 2QB0A 4BWGB 1VQ4A 4ED1A 5M5XB 4O5CA 4GKKQ 1VQCA 5LL6X 4XQQA 2L5YA 5J2BA 5KFRA 4GXJA 5HR6A 2V1CC 4DKAC 5J0TA 9ICMA 4QB4A 5KFKA 4HN7A 3C21A 1QAQA 1S5BD 2N78A 3S1RH 2HW3A 2OTLA 2BNKA 4QY7A 5KNCA 4A3LG 4IJFA 4X65M 4FFDA 4FXDA 1BUVT 1L1OA 2R8KA 5AK3A 2R8GA 5M3FB 2OYYA 1QQ5A 1IXSA 1SROA 2D5DA 2BOSA 4GKJQ 2JA6G 2F5NA 1J2MA 1Z4OA 1XSLA 1SYCA 2JA9A 3AKZA 3DM1A 4DU9A 2G3QA 5KYLA 1OXJA 2Z4RA 1KFVA 3C5GA 1OXVA 1QE6A 3BS7A 4RT3A 4FO2A 5I9PA 3RB4A 3GLIB 1OO9B 3R3OA 2VS1A 3ILKA 4PMCA 5IY0A 3HOUG 1WG8A 1IHZA 1N33M 3GRUA 2JA7H 3GPYA 1CSPA 1U9RA 3FP9A 4KN4A 4TUPA 4ZYSA 2F4IA 5JOBA 1I4QA 3K7AH 3HOZG 1XPUA 1A8VA 3WKCA 4J15A 2KE7A 4QHSA 4OD0A 1JQYD 1K8MA 1Q7YC 3NBIA 3RH6A 4ZOHC 4I8OA 3HJQA 1ZQAA 4POFA 2JNHA 4A3GH 3PFIA 1DYQA 4C4SA 5IIJA 2FMCA 2K5WA 4QOZC 2A5YB 1KDHA 2I1QA 2K4KA 4BBSG 3QZ7A 3MR2A 1X3QA 3G7LA 3UQ0A 1Q81C 3AMUA 9ICNA 1Z1BA 4A75A 4KLDA 1KFTA 1AH9A 1JCKB 2WAQE 2HVHA 3V2TA 4PMWA 5B5EU 4LF7M 2ODGA 4OXPA 4ODGA 2LMCB 3KF8B 5C3XA 1W3SA 2PO4A 4LFCQ 1QH9A 2NRXA 1OTCA 1DD2A 5ALPA 4IO9A 3ORYA 4PHPA 1UT5A 1H38A 3PW4A 3PW7A 3GQCA 3CCMA 5C4XB 3N52A 1ZJNA 4RA8A 4FWHA 4P0PA 3LWLA 2ATWA 1OTRA 3AQEA 5CP2A 1G91A 3KOJA 4H44C 2AUJD 4JBWA 1XWLA 3E6ZX 3M9OB 4HIKA 3E21A 2Z3XA 4L4UA 2LTUA 1UAPA 5CV4A 2R92H 4DL6A 3MXNA 1QLNA 1PXUA 3T5JA 2W54A 1YVCA 4RPYA 2RKSA 2FMSA 5G5HA 3RH5A 4Z8XA 3TWMA 5AK5A 4LVSA 2WF8A 4UHVA 4XGIA 5AM0A 1UUPA 2D0OA 3KF6B 2F1HA 1ET6A 4PD2A 5AKYA 2B2WC 2WF6A 4O3MA 4WFN3 1CZWA 3V7LA 3OGUA 1KDAA 2RHQB 3VR5A 5M3MB 3J81j 4CGZA 1QJOA 4DFMA 4MB7A 4MHEA 1ZYRD 4O3OA 3K5NA 4KKSA 2PW5A 1BOSA 1TS5A 4PZ8A 2MROB 4F71A 1TE2A 5I2XA 4TQUS 2LVPC 3TAQA 4B9NA 3A56A 2VUMB 3HU1A 4B9UA 2J5YA 5LMUM 2R7DA 1IBKM 1C9OA 4C8KA 1IBMM 1XNQQ 3K0YA 3QZ8A 1SNCA 1JMCA 1X3EA 1TWGB 1XMOM 5HGQA 5KFFA 4NY8A 2Q2TA 5J2JA 1A2UA 4UAUA 1QVFA 2KZUA 3MC0B 4DAVA 1EE8A 3WK9A 4YWLA 2CWPA 1ZQUA 3LCVB 3QO2A 4LZJA 3V6HA 1PFMA 3M7DA 4NMZA 2F0FA 4I2GA 4DR7Q 1MA7A 1WGLA 3GTQB 1DGGA 4I7ZC 4DUZQ 1WCLA 2DXIA 3GPUA 3ZC7B 2AGOA 3CYMA 1H9MA 2MJ8A 4GKKM 3C3LA 3UXOA 9ICOA 4HMIA 3T53B 1EIHA 5KT5A 3MFHA 3HGIA 3SV3A 4DV1Q 1H6UA 2KKPA 2ESEA 1UE5A 1N78A 2KHHA 1B1ZA 1VQ1A 1X32A 5DQGA 3U4ZA 3U4VA 1ESRA 2KSOB 1SWWA 1JR0D 1LUZA 4KKTA 2F0MA 5CV5A 1J8IA 2W3SA 1YIJA 1EQVA 1QQWA 2DKZA 1U4BA 4KLHA 2LVQD 1QB5D 4DR1L 5KG4A 1Y88A 4NWIA 4PL2A 2F0LA 4RKLA 4DR2M 3PO3B 5ALYA 5FO9B 3HHYA 4M6WB 1RHPA 2W9AA 4IPCA 1L2FA 4P17A 2AGPA 3TS0A 4KLEA 4AKHA 3I2ZA 1EOVA 1ZV1A 1TT2A 1DGSA 3FUTA 1SFOB 1WXQA 4LRSA 2K89A 4DSLA 3SI8A 3EVQA 5FKAC 3VR6A 3HOYH 1BNOA 1IXRC 2CQAA 2EE1A 2W8LA 3ND8A 2UU9Q 3C29A 3AQQA 2B2VC 2FMMA 4DR4Q 1HA6A 4P2HA 2ALYB 1EU4A 1GVPA 2W3RA 1D0MA 1GL6A 1MN8A 5DB8A 3GIKA 1LYLA 4JI0M 2N55A 2O2LD 2X49A 1SIJA 3U61A 3FM9A 1KIXA 2K50A 3C23A 2W9CA 1D5XC 4LF8L 4L6V6 4JK1A 1ZQDA 1CEZA 2XIDA 4Q0FA 1DONA 4HIMA 1HR0M 1E0BA 1YNND 8ICJA 2UUBM 4YQWA 4HCEA 4JI5Q 3FE3A 2OEHA 4X65Q 2C96A 1XSNA 2ZUCA 2W7PA 2LSSA 4OWXB 1ZQMA 4OWWB 4IUUA 4CISA 3KW6A 4R63A 2HHWA 8ICSA 4A3DB 2VQFQ 2WFWA 4R8NA 3L2AA 3VYUA 2LBOA 3N7RC 1DV0A 3AYHB 2E2HB 3OTOQ 2NRVA 4BBAA 4RQ6A 5EPJA 3R93A 3RUZA 4NM1A 2Z6KC 1LKYB 2Y0TA 1ZQQA 4RNMA 4OVZB 3A0HU 4UAWA 2K9DA 4M9JA 1LTGD 2V4QA 3WOEA 2PZTA 5IGEA 3CCRA 1M4VA 2E8MA 2UXDQ 4DQIA 1BGXT 2DF4B 1CRXA 3T5KA 7ICIA 1KLNA 1SYDA 4PZOA 5AKEA 1QZMA 1XWIA 2JRZA 2F0EA 2I5MX 3A0JA 3Q0AA 1PA6A 1IY1A 1SE3A 5ALHA 3LQRA 5F3WA 5FLXE 3W68A 2LYAA 1TTEA 2JEIA 2F03A 2B2VA 1QTMA 4G9BA 5J29A 1HCZA 4MH0E 3AB9A 3FUWA 2KIVA 3F2CA 1S5ED 2RVLA 3NSWA 3IDWA 1JXLA 1PRTF 3EIEA 2UUAM 1BCPD 3MMPA 2FE8A 4UB1A 2WF9A 1CI4A 4C2MB 2WKDA 4K5XA 3QX7A 1VQLA 4A3GG 3J7AV 1CM9A 2UXDL 2Q8IB 4DV1M 4F87A 4UP7A 3J80L 4X5VA 3Q8MA 1IN7A 1S97A 5BN4A 2UUCQ 3M85A 3HOZH 4GHLA 1YNJC 4DV7M 4DV3M 2CRUA 1RD9D 2F0GA 5JEAH 3JAML 4R4OA 3K57A 1Z00A 2B2TA 1KTQA 1A0IA 3ER0A 3L4PA 3C3EA 4L16A 3PSPA 5I9OA 3HOUH 2Z8YM 5EP3A 2MRLA 2FOIC 3SD7A 5DB6A 1LABA 4DV0M 4IQWA 5AJ3Q 2ZM6L 3EPGA 4CGYB 2AQ4A 2LKVA 4X66Q 1J5EL 4WW0A 4DAYA 3TS2A 2W7OA 3M1YA 2AQ2B 2JA6H 4M9SA 2E2JH 4JI4M 2RDHA 5DNFA 5EGTA 1J6QA 1JE4A 1HNZQ 4NP5A 3IG5A 2QCUA 1RTNA 2H3QA 2MAXA 2K5VA 2R61A 5JI3E 1IYUA 3CCSA 4QWBA 4G4QA 3R2TA 5AI6A 2NO4A 4CRXA 5AM4A 1SMXA 2UU9L 2WV6D 2NV3A 5KFWA 4S3SA 4DL5A 4RQ2A 2O25A 3T16A 1QYRA 2K4EA 3HJSA 3E2EA 2MO0A 1PH4A 2JA5H 3PR4A 3AUOA 2XLJA 4DSKA 4APVA 1ZQHA 4P2CB 1EEFD 1ZOLA 3BJUA 1JWMD 3H6MA 4DR3M 2KW0A 1SYGA 4R65A 5GAGC 4GNXA 2HBLA 4IUTA 2YV5A 1WCMG 5J0SA 3C2PA 2KHJA 4QNRA 4PZ6A 5D65A 3CMAA 2ZIVA 4FZNA 4MFFA 4DV4M 3RJJA 2EJMA 3F2UA 1XXHB 3TARA 2P5ZX 2TSSA 1IYJB 3LX0A 3RFWA 4I2DA 2NZ1D 4DV6Q 4HJ7A 4BXOA 3K58A 1KFDA 3C2LA 4XDXA 4F7XA 3B9PA 4HJ5A 3OWEB 3ZD9A 1K1SA 2XVTA 7ICEA 1TKWB 1BCPC 2F0DA 3KTQA 1SNDA 3JC66 3JAMi 2R46A 4C0ZA 1NBWA 3LNNA 8ICNA 2A69D 3E58A 5KFUA 4RGNA 2PKEA 4LF9M 4IRCA 4DNTB 4RQ8A 1VQAA 1OFIA 4EIWA 3AQFA 3GIMA 2ZANA 1LTMA 1WIVA 1XB2B 4NSOB 5E6JA 2ZIUA 3F2BA 3BQ1A 1YUBA 4F4XA 1DOLA 4GXIA 4JI0Q 1YT3A 1YZ6A 1QUSA 4G4RA 3KFUA 2BCSA 8ICFA 1RTOA 3H4MA 3SGIA 4LUVA 5EPLA 5L1LA 1LTRD 1N34M 3HS0C 3OIPA 4JI2M 5L1JA 2EYMA 4DV6L 4LF9Q 3A98B 5KQ8A 3AL0C 2BKEA 1S0MA 1Z59A 2OQ4A 2H1RA 5J2IA 2VUMG 5CHGA 3I4NB 2F5OA 3KJPA 2B2UA 4G7ZC 4P73A 2E5LQ 4RGOS 1A0PA 2K33A 1XXGA 5KEEA 1JJCB 4X64Q 3P1HA 3CC7A 3TP5A 1EQRA 3OHBA 3TL4X 3ONNA 4JXJA 3TE6A 1AE3A 2J4XA 2Z9HA 3DUZA 4YMNA 5C5JA 5EKIA 1W5TA 3M4PA 1SB3C 1ZQSA 3WKEA 1BCPF 1CQVA 3UDXA 2XGNA 5C0XG 1PH9A 4F91B 3KHRA 2J6UA 2J6TA 2XF3A 3UDFA 7ICPA 2IHEA 2RCNA 3VYRA 4MF2A 4KLOA 1Q46A 2W9BB 1SSOA 1PZNA 2ZG6A 2F76X 2RA4A 1SGGA 1VLBA 1SYFA 2I46A 4YP3A 4EX5A 5AKGA 1EYCA 2WAQG 1F5SA 2IOFA 1XMQQ 5DBBA 1FGUA 3S1QH 4JG2A 4CJ2C 3A54A 1L3TA 1X65A 1XC9A 3RF9A 5GQOA 3KDFA 2EO2A 4X64L 2GQFA 2CEAA 2E5SA 1GUNA 1X40A 2K6AA 2E5LL 4QUFA 3F5EA 4OONA 2LHGA 4KY6A 2GH1A 3IG8A 4JI7L 2HHHQ 3M4QA 3U5ZA 1V85A 1EYAA 2KKVA 7ICSA 2GN5A 4ZAIA 1Y69U 2EYOA 3TBIB 5DG8A 1UHUA 4CDFC 4NRWA 3B7NA 4O3RA 4GNXC 4GOPC 2DNCA 4B3RL 2P66A 4IBIA 1O80A 4C1NK 4QL5A 2AUKA 1EFUB 1I4HA 2C28A 4GN4B 1GM5A 1ZD5A 3T79A 2KP7A 4DFDA 2MUTB 4F4ZA 3LWMA 1ZQ9A 1NTGA 4RG1A 4H13C 5KL8B 1HQRD 3CU7A 1U9LA 3J81S 2BWBA 1N2XA 3CP8A 3NBXX 3WK7A 3AEVA 2NYZD 2R7FA 3L2PA 1JB7A 3IP4B 2XRQD 4I81A 4B3TM 4FZLA 1KNAA 1MQ2A 4YY3M 4M04A 1JMSA 5JVH3 3M9NB 1EIFA 2EYFA 3I73A 4QIWC 1K83B 3RRGA 1PYBA 2K4HA 5KT7A 4DFPA 1OFHA 1XSPA 1B44D 1R4PB 2KOLA 1F44A 3KZIU 3OPOA 1PJIA 4UAYA 2J6SA 1CKNB 4JI3L 3UDGA 2F0PA 4RQ7A 3SHFA 2W55A 4RNNA 4C3HH 3M3YH 2L7HA 2VB2X 5KAIU 1IBML 1Q39A 4GKJL 3VDPA 2WAQF 1WGNA 4DUZM 1K28A 4CDEC 5JI2E 2F3WA 4X62M 4G7HC 4OO1H 3DOAA 1O08A 3EA6A 1QANA 2PW7A 4MTNA 4FW9A 1MGSA 1V1OA 2XC9A 1V1PA 2K32A 2PI2A 4TKOB 1JQJC 5J0RA 4TVAB 9ICHA 4O42A 2NTSA 1GLNA 4LAAA 5CC4A 2Z6KA 4QGUA 2ZIXA 3TFRA 4WRDA 1ZQXA 3B6YA 4P74A 3PO2G 2I7PA 3SENA 1YBYA 1PJTA 1ET9A 2UXCM 2B2YA 3A5UA 3GTJH 1IL8A 5L1IA 3D2SA 3O0FA 1CK1A 3NRWA 3ZDCA 2K7VA 4IUPA 5NUCA 3E3XA 5HURA 3KP1E 1TWAH 4EBDA 4F5PA 4KY5A 1BPEA 2OCEA 5IP7G 3CCUA 1VDLA 3N6RA 2YTYA 2NZHA 2IOFK 2XSCA 4KN4C 3SYZA 2VQEL 1PJSA 3S1QB 2JY8A 2VA3A 2UVRA 3TZUA 3PIP3 1B9NA 4L5RC 5K36G 3T1HM 4B3MM 2CHBD 1YI2A 3FPPA 3J7YW 4QZGA 1F2MA 2LBCA 2QHOB 5FTNA 5FTKA 4YMOA 3FVQA 3H94A 3B89A 2KHVA 5KNDA 4QNMA 5KQDA 2DUYA 2JR5A 5IIOA 2QGQA 1FR3A 4IALA 3V72A 4LFBQ 4K8IA 4GC7A 1TK5A 4O3QA 1HZAA 2QCPX 2NBFA 3HOVB 4P4PA 1FNUA 1ZKOA 1D8YA 4R4CA 1XNSA 1NMGA 5EWFA 1OIPA 2EJFC 2B39A 1UWVA 2HD3A 1DO0A 1XXHA 2YTVA 2P5TA 3Q22A 3NVZA 4U6PA 2EQSA 9ICKA 3RJGA 2F1MA 4BXXG 1PM5A 3PO5A 4LJXA 2C2DA 2N3SA 1OW5A 1N56A 5IT9E 4GRIA 5ITYA 1TY0A 3EYZA 5IGCA 1ZMUA 2G5GX 4MGIE 1L5UA 4KLMA 4CJ6A 3RJEA 1UCVA 2QNJA 3W0FA 3HJEA 1TAUA 5BOLA 4IJLA 1HIWA 4F92B 4ELUA 3P75A 1S4ZA 4FXGC 2PMZF 3O13A 3SEBA 3J81L 4OX9Q 3DA1A 2UUCM 2WIIB 2KVCA 1DOQA 2NO5A 4NLCA 2L0CA 2B63B 4ZUJA 3GLFB 4PZ7A 4QW9A 1S5LU 4QWEA 2KCMA 2BJWA 2KJ9A 5D14A 3K6OA 5G3LF 3ICEA 4LFBL 2DWZB 2KBNA 1IN4A 3K92A 4NXML 1NR4A 3VYSA 2CP8A 3Q23A 3JAMS 4UP9A 2B3TA 1EIGA 3J7ZC 1TDZA 3GTPH 1HQCA 2NB0A 1UNSA 2KZMA 5FK9C 2IPKD 3C28A 4LF8M 4XQ8A 4UY8C 2SNSA 3QOLA 3SAHA 3BXWA 5KPRA 1I4XA 3AV0A 1X9SA 1Q3LA 4IIWA 4GOPB 3FKIH 5DQHA 4LF4Q 4WJ3B 4F4YA 1KTKA 1HQMC 2MP1A 5CMDA 5FJ8G 1G6ZA 4LMQD 4C3IH 1X55A 2JHDA 4NRVA 3H91A 3NS1A 4NLNA 1FJGL 3GLGE 7ICOA 4IPDA 2ASLA 5KFNA 3U6LA 5AKKA 1GO5A 3I28A 3HHWA 3KOXE 4NL9C 4HJ8A 1BNPA 2F4VQ 3KHHA 2I7NA 4IPHA 3GTOB 4ABNA 4KLNA 1M8AA 3L3FX 1DGHA 4YR2A 4ELVA 2EOTA 3Q8DA 2ZTEA 4P75A 1WHCA 5HHHA 4EX7A 1EEID 1BF4A 3RLOA 5J2GA 1M90C 3RB3A 2X8AA 8ICLA 4WP2A 3KDSE 1ILQA 2X69A 2PMZE 1ASYA 3OJSA 2R4JA 3FDSA 2VZAA 3K59A 3GTKB 4DV5L 5KFHA 4ECZA 1HUZA 3IL8A 2HL7A 2OQ0A 1QSSA 1SRUA 2BA1A 2JA2A 2DHRA 2JXJA 3V7KA 3MXPA 4LWCA 2BZFA 4TQSA 1G291 3I1YA 1K3XA 3UXNA 1URJA 5E79U 4JI8L 4XT1B 3RZOH 3BYTB 5AKHA 1A62A 2ES6A 4CKCA 1ZQCA 1C0AA 4X64M 4Z6EA 1V92A 3E9SA 1XO0A 1DOMA 1R6BX 2OTJA 5IIIA 5CEHA 3IFDA 5EXXA 4LGYA 5KNIA 2RRUA 2K75A 2Q8RE 1I50B 1G59A 3PUZA 5DAUA 3CXCA 1T5XD 1XNRL 2JA7G 1ZQLA 5IGGA 3T51B 1HT2E 8ICTA 1IY0A 1Q3BA 4LFAQ 2Y0QA 2M5ZA 3PNYA 1I6VC 2R7ZG 1RU3A 1I6HB 3HU2A 2CFOA 5ITXE 1AQ6A 1DXSA 4OJ6A 1VMCA 4KLQA 3KLSX 3B9JA 1MHWC 4Z6FA 4CKEA 4NOOB 2Y0SE 3FYCA 4RQ4A 3EW9A 4PV1C 1PH5A 1T3QA 2ZJRA 4FE3A 3AU6A 2CV1A 1QCKA 1J9OA 2ZJQA 1RM6C 5JJLA 8ICYA 4M9ZA 1F2YA 1WWUA 2HQEA 3X3NA 2Q2UA 2BDUA 1L7PA 5C6AA 3KYHC 2BJVA 1C1KA 5AKJA 3WK8A 1TWCB 1XMOL 2KEDA 2HHVA 1QZGA 2JYOA 1VEJA 2YMMA 4Y2XA 1QWYA 4F72A 1YNNC 4JOIA 4ME5A 2KNJA 1ML0D 5DKWA 4A3FH 1IM2A 4AG5A 2BQRA 2YMQA 3G6XA 3TANA 1LACA 4DUYQ 3J81i 4CF5A 3KHGA 1HR0W 2XFTA 1ZQIA 1TVXA 5IYBG 2HMXA 1Y8NB 2FH0A 4FF4A 2R93H 3HZJA 4M9XA 3Q8SB 2EYHA 3I55A 5LMNW 3HOWG 2XI9A 2XN9C 4NLGA 1B4OA 5KPZA 1L2BA 2FHTA 3H8MA 4ECRA 1BO0A 5J8YC 5CV7A 1J97A 1B0XA 1HRJA 2V4RA 1ZEQX 3IECA 3SR1A 1YJWA 1R9TB 4JC0A 3I4VA 4A3EG 3HOYB 5JTIA 4C3JH 1A77A 3JPQA 1Q1EA 5M3MH 2EYPA 3S9WA 5KT4A 2JJQA 1K5OA 3FDTA 9ICPA 4JI1L 2DWQA 3KKAC 3TREA 4A3DH 5G5GA 7ICFA 8ICWA 1Z5BA 1JWUD 2E8PA 4C2MH 4XQJA 1PK3A 1JC7A 1QQ6A 3ISCA 2V9WA 4B9SA 5FTLA 4F4KA 2L5TA 2PI2E 2GA4B 5L37A 1I4RA 2KCNA 3HKZG 2ZXPA 2UUBL 1JR3A 4IFDG 1AIPC 3G6JB 3KF8A 1C8CA 4BBSB 1SYBA 2FI1A 1LVHA 4Q45A 1UA0A 4RQ5A 1PDQA 1CHQD 4QMGA 4DGZA 5DLGA 2I5LX 2ZIWA 7ICNA 3PIO3 1N75A 4K0KL 1C7YA 4FWGA 3BZKA 2SOBA 2YTXA 4DUYL 4AYBG 3I04M 1SMYC 1K82A 2F0NA 3LMMA 1SWVA 4RFBA 1WTXA 4HAEA 4NW2A 4JI6L 5DNYA 4ECUA 1CHPD 3GTQH 2K8BB 1F9QA 3V76A 4KX3A 3B0YA 4QZIA 2D8CA 2RSOA 3NBHB 1ZQEA 3S16H 2MU2A 2JY6B 4F1IA 5ALGA 2QPAA 1K8GA 1NOMA 3MAQA 2F3VA 5KRUA 1Y8GA 4DF8A 1Z19A 1XJVA 5HY6A 3UMGA 2PZWA 3LDAA 2GLEA 4L5SA 1IN5A 4BY1G 3CPFA 2RP5A 2YX8A 2P6RA 5EQ0A 2HCFA 1K8AC 1LTAD 1PH1A 1TWGH 3TZDA 3U6EA 1NNUC 1WUDA 1JR3D 3PSTA 4A93H 2CCZA 2C2EA 7CATA 2ISOA 1Q90A 2MUYA 3A46A 3SAWA 1Q3VA 3T1YL 3MR5A 2F4VM 1KAWA 2AXTU 3H40A 4LF7Q 2LYBA 4PZNA 1E2ZA 1R7RA 1ZAEA 3BZCA 4QWAA 2N35A 3FUUA 3U6DA 4EX6A 1STHA 2KECA 2X6LA 4DA2A 1IBKQ 4K4HA 1NMFA 3SK8A 3PIPA 1NJIC 1WOCA 1U45A 2ZIUB 2Q2IA 3D3RA 2K5HA 2ALZA 1EOTA 1EIYB 1PTOD 1IN8A 3CF2A 4QZHA 3RB0A 2FS1A 2BDPA 4DSIA 4I2HA 1LTSD 2DAIA 4AIMA 3HHZA 2OEOA 2IHNA 3MZ5A 3MJ5A 2W8KA 4AKGA 2Q8TA 1SE4A 2B8GA 1N36Q 1L2CA 2NVTB 4PCZA 4A4IA 1QQ7A 4A3KG 4IQZA 1F77A 3RMHA 4MGKE 3D2NA 2E75C 2KHQA 1JN3A 3U6PA 1K1QA 3H0GB 3KD3A 4DV5Q 4F8MA 3D8LA 4RHRA 4BJQA 1HFNA 2B2UC 1AUAA 1T6OA 2KDLA 2QILA 3PW2A 3BDCA 5IILA 1A76A 2ZBKB 1LT4D 1BBUA 1NY5A 2EKKA 2LXEA 2D3DA 3R9KA 3JR4A 4L15A 4KLUA 1BR9A 5CV8A 4S12A 3D8BA 5IZ7D 3CW2C 5KFPA 5D4BA 1G8ZD 1NAPA 5KFZA 1TH2A 2FMPA 9ICVA 3LGJA 3SBJA 8CATA 1I3QB 4Y52H 2UVVA 5KG0A 3EPIA 1TAQA 2JEAI 3QJYA 4F3OA 3DLLA 4IJEA 1L3SA 4M6WA 1STEA 5DEHA 4IR1A 1X6IA 3RR8A 3PSFA 1A63A 1HNWM 4IQUA 4JI7Q 5FOBB 2BWEA 3I4YA 4Q8EA 4QJFB 4K5WA 4YXJA 2L6OA 4J9QA 4Z6CA 1Z4NA 4ACOA 5TISU 4R66A 3AMZA 3QU7A 4LFAL 4FO6A 4GS3A 2YU9B 5KG2A 1BCPB 2Y0SF 1FO4A 1S77D 7ICHA 5KO3A 3KBGA 4DK3C 2LPEA 3PXGA 3CCEA 3M7NA 2ZT9C 3KLWA 3QU5A 4F2LA 3ZDBA 4R4IA 3ULJA 2ISPA 2F5SA 3QYBA 2EQYA 2RDJA 2UXCL 3NTHA 3DWQA 4M0DA 4C4TA 4AYBC 4HSPA 4RWSC 4UW9A 5AHXA 4BBRH 5C44H 4AQYL 4RH6A 4JI5M 3NTUA 3OW2A 1HR0Q 1N36M 5C4JH 4KHVA 1D9FA 3BS1A 2JEGA 1T9HA 4IBCA 4RPZA 1UE1A 4YG2A 3GTOH 5AM3A 2CPRA 3CNHA 5J0YA 1ZQFA 1D8BA 3D6JA 1DK2A 3QU2A 3PIOA 3LWUA 4WJ3M 2QB0B 4QUCA 5KG7A 5ISRA 3N4MB 7ICVA 3AN1A 2CUZA 2Y0SG 2DWNA 4IOAA 3GTMB 1CKMA 1IQPA 3K2LA 1N62A 3W5OA 1IBLM 1OXSC 4UQGA 4Y2SA 1E1OA 2DAGA 1U4RA 4XIGS 3TQSA 1OUQA 9ICWA 5EWEA 4U7CA 1MJCA 1AP0A 4DV2Q 2ES2A 5ALXA 3MR3A 4X3SA 3CPWA 4II7A 1I94M 4N8X1 4AH6A 2EY1A 4A3IH 3EN2A 1TWFH 5BPVA 3UMMA 3JPPA 2IX1A 4K2KA 4RUAA 3MFGA 1LB2B 2JA5B 4LJ6A 2H3IA 3K7AB 1S40A 2LNHC 1I4GA 1HNXL 2R45A 3IHQB 9ICJA 1CKNA 2XWBB 4YCUA 1JI7A 3NGDA 4G4OA 1D9DA 2OWOA 5GAEC 1VQ7A 4CCHA 2FNAA 2CHVA 5AI0A 1MQ3A 2L9HA 3QIAA 7ICJA 5E4WC 2VQEQ 1PZJD 3CQZH 5D46A 1EFWA 4BY7B 1G4AE 4KHPQ 4QIWB 1L8OA 3EBEA 2UUCL 4B9MA 4J9SA 5IGFA 5AKZA 3A7LA 1L1ZA 1WCNA 2JE6I 4FF2A 1SNPA 1JALA 1KRPA 4KI0A 4NXMQ 5L9XA 4C8OA 1S5DD 2J7NA 3GLHE 3WU2U 4J9KA 2JEBI 3SZ2A 1HZCA 1SNMA 3DZDA 2NUCA 2J7OA 5ALNA 4LF5M 5IWAQ 4F5OA 4P0QB 1FGBD 1KSFX 2K0BX 3L26A 3ISBA 3ALRA 3KOOA 2E5LM 3I7FA 2W11A 3E0FA 2WHEA 3A74A 3D4RA 5EXTA 3E5SA 2DL0A 4KMUC 5JRTA 1II3A 2HAKA 1L2DA 2PNHA 3KUPA 5BR8L 1CZGA 1HQYE 5I4DA 1WCMB 2DFLA 1A6SA 1KRTA 5HMMA 1EY4A 1WVLA 1WTRA 2JGAA 3TACB 1R4QB 2JXMB 5ALZA 4DLEA 1RYRA 1WJ7A 4DQPA 4P0PB 5DLQE 4R71A 2F0VA 4QOSA 4I2IA 4AP9A 5KFOA 1UT8A 3M6KA 3AU2A 5ALWA 5ALEA 1H9JA 3EWAA 4GC6A 1HH2P 4OJ5A 2N88A 1IFYA 8ICHA 4PNYA 3U9SA 3TAPA 1BPBA 1AE2A 4KHPL 2SNMA 3PX0A 1S76D 2WINB 2NTTA 4LY6A 2D9UA 3I8ZA 4B3SQ 4JWNA 3OSPA 2O5JC 3DXJC 4DAMA 1XPOA 1UPHA 1N61A 2IL8A 4IBJA 1A6XA 2G5HB 1X6JA 3FKEA 7ICKA 9ICTA 1BXTA 2BHNA 2K8AA 3SARA 2ZXIA 2KZSA 5EXPA 5L8RF 2KNAA 1VDVA 2G08A 3N7PD 5AK6A 4BWMA 2G8LA 2W03A 5KFDA 1EUJA 3I4MH 1PVOA 2JWSA 4PGYA 5FTMA 1YJ9A 4DR6Q 2D7HA 4J1MA 4LUZA 4FZMA 3PW5A 5IREB 3OHXC 3F2DA 3ISDA 4YR3A 2XRSD 3C1EA 3H09A 4H02A 1GJXA 3MGHA 1BVSA 3U6SA 2CRXA 4KTAA 1S9FA 4REZA 3PV0A 4LZDA 4HYKA 2CH4W 4H0LC 5FLXL 4UN2B 5ELNA 5E1FA 5IYDH 2N8NA 5BPCA 3GLFA 3GLHB 1ZYRC 3M6ZA 4A3MG 5EBDA 5KFEA 1WYGA 2R6FA 3V7JA 4EBEA 1ZQOA 5C5MA 2YYZA 1AROP 5LMNQ 3KVWA 4FS2A 4R1JA 1GKIA 1XTCD 2K60A 1PVQA 2HQLA 4YY3L 3LWEA 4I2FA 4MFCA 4MGZE 2CVRA 1STYA 3RBDA 2PNRC 5ALTA 2VIIA 5TZVA 5AK4A 1PFNA 1JJGA 3VC8A 3I70A 4KTQA 5KFYA 4LJ7A 3ITPA 4LGMA 2OF1A 3RN2A 1RKNA 4X3TA 1VQIA 3CRXA 1PVRA 2LHCA 4QZFA 1AFPA 4YR0A 3U6CA 3U50C 5GAHC 3GV5B 1ZD2P 1X3FA 2NVYB 1AEXA 1XNRM 5IGBA 2ZAOA 3HU3A 4C4RA 4DLGA 4A3JG 2D7GA 3ZDEA 4OL7A 3SAGA 9ICEA 3R8FA 4U673 3CCJA 2AHOB 5CR3A 1HJPA 3TKAA 1NZPA 2KMDA 3KSXA 3HWTA 1DGHB 3BOSA 5J8YA 1SXJB 2VKQA 2IMWP 4KLIA 4NXNL 1LV9A 3NUQA 4A3CG 4QZ9A 2EJSA 4DV7Q 1PJJA 3QU9A 4CF3A 3OSNA 1XS9D 3BQ2A 4BBRB 2MFIA 4GFJA 1NKCA 1WYDA 3L0OA 4DQRA 3EJIA 3BDLA 4CDDC 4R7GA 4JB3A 3LYSA 9ICCA 3G6EA 2MH8A 4UASA 2VY3A 7ICTA 2DY8A 1J2NA 3GV3A 2R7ZB 2R3ZA 4RKBA 2EXDA 3M4YA 1VEGA 2EANA 1O7LA 5COYA 3UPQA 2NZOA 4LF8Q 4ILWA 4J9LA 1FD7D 4ZK9B 5L1MA 3OIQA 1Q82C 3KBXA 4J9RA 2KZ3A 1SFOH 1S72A 2YQZA 3H3VC 3CTWB 5D49A 4RQ1A 1VCIA 4XT3B 1NJYA 3HKZF 5J0QA 1SE8A 2A6ED 5E3FA 1X2IA 5ELBA 4DR5L 3GRRA 2JA6B 4DFKA 3TP6A 1ZQ1C 1CKOA 5C3EB 4A3MB 2GO7A 4RU9A 1GO3E 1S5CD 1XWEA 4M0WA 3G4SA 4KLFA 2Y20A 3BVZA 1I5FA 2W9CB 1N36L 3KHLA 1ICFB 4PQXA 2E8OA 5KFGA 4F88A 3U5ZB 3Q8LA 1SV0C 3ZH9B 2BCUA 1FNWA 3T56B 3S2HB 2NVXB 1R2ZA 4PT5A 4IS7A 3VDUA 4JBJA 4DV3Q 3WK6A 5HGTA 1XYIA 1GKHA 4L8RC 1DOKA 4DV2M 3G6YA 1SN8A 1TH3A 3KOWE 2PI4A 4CDGA 2K04A 3CRKC 2YFQA 4IR9A 5J1ZA 5G3LD 2XVSA 2GNOA 3IM1A 2KRKA 3LCUA 1M6YA 2HOQA 3OTQA 1ZQPA 2XIWA 1PHJA 3TRZA 1VQ6A 3BS5A 1KAAA 3H4DA 1LKYA 2KEYA 4HEOA 1XU4A 4I2BA 2C98A 1NK8A 4OVZA 1Y8PB 3DEPA 2I5HA 3MDAA 1NHGC 2C99A 5ITXA 4QZCA 2BDNA 2M2LA 4OELB 1LTID