2ZTCA

Mtruva form ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
188
Chain Sequence
b'GRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 44
structure length 188
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztcA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztcA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztcA01
1XNQQ 4RUAA 8ICGA 3QEBZ 2JA9A 2HW3A 4AYBG 3B89A 4G3IA 1ZQJA 3EIVA 5BOLA 8ICTA 4GNXB 5M3MG 1TWCH 1HQYE 2B63H 5EWGA 4DR7L 3T5KA 1SR3A 2C22A 2CWPA 4LFBL 1TK0A 2F3IA 3S24A 1SKRA 1VQOA 2VANA 4M0AA 3BQ1A 1ASZA 3PO3H 1EXNA 3GFKB 3ZD9A 4GOPB 2VQFL 2BR0A 1XMQQ 2K52A 4IRDA 1Z9FA 2K5VA 1KD1C 2DAEA 4JI5L 4LFCQ 1NK4A 9ICOA 3GO5A 2J6UA 2R8HA 1Z47A 4J9SA 1NY4A 3W1BA 8ICHA 1N36Q 2GWSA 3OJSA 1RYRA 1ZYQA 3RJKA 5KFGA 2HHVA 4RG1A 9ICCA 2K50A 1ZQHA 2ZJRA 1A5TA 4R4TA 1NK6A 1ZQZA 2BCSA 4PGYA 4MFAA 5J2GA 4OWXB 1TXYA 5KFWA 3CPWA 1FVIA 4JK1A 3EPIA 1VQPA 4KN7A 4GXJA 1DGSA 4BDPA 3BBZA 4LF4Q 2CWAA 1NJZA 2JEGA 4F5PA 4QZHA 2Y1JA 1U0LA 1WGLA 4HIOA 4DNIA 2NRZA 4Z6FA 4B9SA 4GKJQ 4DLGA 4FDBA 2UU9Q 1NE3A 2UXDQ 3EN2A 3CCVA 4RQ0A 1Q81C 2K9DA 4HIMA 4KLLA 3G6XA 4A3BG 5GAEC 3F2BA 4Q8FA 4X65L 1Q82C 2CCZA 1TK5A 4MF8A 2XCAA 3GTGH 1PH9A 2KFZA 3S16H 4QWDA 3V72A 1WJJA 3PO4A 5C3EH 4DF8A 4LW1A 4I2FA 2LXKA 4KLTA 5GQOA 1JJ2A 4GNXC 1OQYA 5LMUQ 1VQNA 3C21A 3H4JA 4JBMA 4GXKA 4KLEA 1T3NA 4JCVE 3S1NH 2VY3A 3RN5A 3ZDEA 4YWMA 3C23A 3UQ0A 4MZ9A 4IFDJ 3PSIA 1VQ9A 1U47A 4LF6Q 4GOPC 4GLXA 4QWCA 2ZTEA 5KFCA 3TEHB 4DR5Q 5KFSA 2L4FA 5DG7A 5IIJA 1XPUA 2EJSA 2HVHA 3SI8A 1TFRA 1D9FA 2HHUA 3PUVA 3I2ZA 4AQYL 4YD2A 4JUZA 1YJWA 1YJNA 3LDAA 4FS2A 5IIMA 4OONA 5KFXA 1HNXQ 2MQHA 3BZCA 3HW8A 4RPZA 1VQKA 3GTOH 4DSEA 2IX1A 2YYZA 5DLFA 5FLMH 2KNVA 4P72A 2KCTA 3HOVG 2I5LX 4K0KQ 4DOBA 4QZEA 1L2FA 5J2CA 3CQZH 4KLOA 3C5GA 1B22A 1JJGA 4LVSA 1MJCA 4RPXA 2FPLA 5IP9G 1ZQRA 3M8SA 1T6OA 4YMOA 2D0OA 2QGQA 7ICOA 1SMXA 5D49A 2VA3A 2YTVA 2Q2IA 2F4VL 4B3RL 2OOBA 1HUZA 1XB2B 1JX4A 1VQAA 2Q2UA 9ICRA 4IPDA 1LV5A 3C5FA 1NK5A 3ICEA 3T5JA 5KFQA 1L3SA 4M9LA 1N34L 4KLIA 1Y14B 4B3MQ 1VDLA 2Y0SG 2ISPA 4UB4A 4R4CA 5M3MH 3TAQA 2JEIA 4QGUA 3NBHB 4QWAA 4Y7NH 1JN3A 4NXNL 3S17H 1UE6A 1VEKA 1CKMA 1XPOA 2AJQA 9ICLA 2XCPA 2I9GA 1SG9A 2W9AA 1ZQIA 3RJHA 1Q1EA 3OGUA 2WAQG 3CC7A 4MF2A 2BPCA 2YTXA 4JI2L 1VQ5A 3PGZA 3HOWG 2DZLA 2NN6G 3GIKA 2JZBA 3PW4A 4YR0A 4DV6Q 7ICSA 2JA7G 4PG3A 1ZQFA 3RJIA 3K9OA 4JV5L 4BA1I 1FJGQ 1IL2A 2JY6B 9ICEA 3KDFB 3G6EA 4A3FG 1I3QH 3TANA 2JK8A 4UPAA 4I2CA 3STBD 5KFIA 4GC6A 1PVOA 4DSLA 2P66A 2EIFA 2ZTCA 1QSSA 3CCMA 4UY8C 1HNZQ 3BJUA 2F1IA 1WJ7A 7ICIA 1ZQSA 3CCSA 3IHPA 1S0NA 4A3CH 1SLJA 3GV8B 1WCMG 4QY7A 5HGQA 1A62A 3T1HL 1N32Q 1N33L 3OYYA 4YP3A 4F91B 5DKWA 5DG8A 3RR5A 1ZQYA 2OCEA 8ICMA 4RZRA 2ZJ5A 3V6HA 1TWAH 1VEGA 4K4HA 4DV1Q 4Z6EA 4IFDG 3CF5A 4IQTA 4PGXA 4RT2A 4JOIC 4O3SA 4QWBA 4R66A 3TARA 2WZJA 4A3BH 5IT9c 3T5LA 4EBEA 2AQ4A 5IP7G 2MUTA 1VQ1A 4TVAB 5JJLA 3UPQA 3J80i 7ICMA 8ICOA 2PI4A 4DFJA 5L1LA 4J9NA 1JMSA 3UDGA 4PHEA 3BQ2A 7ICTA 3Q8LA 5KFPA 3PX4A 3M9MB 3LCVB 3H0GG 1L0WA 4DR3L 2R8KA 4R4OA 5E7NA 3U50C 1WIVA 1RZTA 2K4KA 4DR7Q 1KHIA 1ZQAA 4C2MH 1PH4A 4LFBQ 3CPFA 1QVGA 4QZ9A 1KQSA 4DUYQ 3MBYA 4JI7L 1VQHA 2QHOB 2C2RA 2PI2E 3OJUA 3ZDCA 4GKKQ 2VQFQ 3S2HH 5C0XI 1D8LA 2R7ZG 1S0MA 4YCXA 4K4IA 2I0QA 4HJAA 4JI5Q 5J0PA 3TS2A 7ICJA 4IJHA 3A5UA 2VW9A 4DLEA 2O25A 4Q44A 4NXZA 1X9WA 2A1JA 4DV2L 1N36L 3GV7B 5IIIA 2PXIA 2BPFA 4O0AA 4F4YA 1K83H 2KNZA 4DOCA 4F8RA 4LZGA 3HOVH 4C8KA 3ULPA 4L5RC 1UT5A 1J6QA 4RUCA 1GKHA 1LUZA 5J2JA 1B8AA 3FKIG 1G291 2ASDA 3JPOA 5IWAL 4A93G 2Q0ZX 5IP9H 2R7FA 4ECVA 3N97B 3RJFA 3D0FA 4YMMA 3A74A 3M3YH 2ZJQA 1Q7YC 4JI4L 3NGDA 2UVUA 2OWOA 1PH2A 1Q8KA 4X65Q 2QNJA 4I2DA 2UXDL 3RRHA 3CAMA 4ELTA 5F9LA 3Q8KA 1YNXA 3K7UC 2MFIA 4LWCA 2BA0A 5IIOA 4UBCA 7ICGA 3I4NG 2JY7A 2DFLA 1ZQVA 1DV0A 3C2MA 5EWEA 3ISDA 1CSQA 2XY6A 4RQ3A 3MR6A 1XU4A 3HOWH 4MFCA 1HNWL 1DO2A 1Z00B 1K8AC 3GLFE 2JA7H 4PGQA 4BBRG 2KNAA 4A3FH 4I28A 4YY3L 3I4OA 1D9DA 4LF6L 1C0AA 2ISOA 5HY6A 3T1YL 3MDAA 4AQYQ 2HIVA 4X62L 3OHBA 1G4AE 4DAYB 1WCMH 3RJEA 3BQ0A 3LGJA 1JXEA 8ICKA 4EYIB 1HNXL 4JI6Q 3CC2A 5LMNW 1YJ9A 2BH8A 1KTQA 1Y1VG 3Q8RB 2KBNA 3SGIA 3F92A 3Q8DA 5L1JA 3MEFA 5CWRA 5KG6A 3M9NB 1ZJMA 4DQPA 4QIWE 3LK9A 3TQ1A 1UA0A 3PW2A 5HHHA 3A5ZB 1KEJA 2IHEA 1P3QQ 4M9JA 4KLQA 4ELVA 4C3JH 1CKOA 3TQYA 5KFRA 1ZQXA 4R64A 3CC4A 4I2HA 4J9LA 3I7FA 5IIKA 1XPRA 1V1QA 2F4VQ 4P4OA 2BPGA 5IP7H 4L5SA 1X54A 2WB1G 5DDYA 5DB8A 4OO1I 1ZQCA 2UVWA 1EIYB 1A0IA 1ZQPA 4PPXA 2DAKA 1S0OA 2HHHL 3H0GH 1RL2A 1COOA 3KF6B 5DGAA 2UUBL 3J7ZC 3KJOA 3RAQA 2KCMA 3M9BA 1H38A 5CA7A 3UDIA 2LSSA 1X9SA 4NXNQ 5M3FG 4J9PA 2VQEL 3CCLA 4C3IH 4IOAA 3JPPA 4AH6A 8ICIA 5KG7A 3GTQH 3FDSA 3HKZG 2ALYB 3H8WA 1YHQA 2JE6I 2UUAL 4M2YA 1KAWA 2R7ZH 1OXXK 4JI2Q 3H40A 3V6JA 3MMPA 1NKEA 2VA2A 1VQBA 3ZJYC 2NZHA 3M85A 5CB1A 1OXUA 4JV5Q 1TAUA 7ICEA 2AHOB 1M1KC 4HJ9A 1DO0A 2FMPA 3PO2G 8ICSA 9ICPA 4LF5L 5DQGA 4ALPA 2E2HH 1XSLA 2OTJA 5KT2A 4KI0A 1NV9A 3FKIH 3NTUA 2AGOA 3FE3A 2PQAA 1N33Q 1RYSA 4A93H 3HX0A 4Z6DA 2VZAA 4LF9L 4R71A 1TR8A 4L5QA 4NM2A 1N32L 1ZQUA 1TWFH 4JBKA 2C28A 4DOAA 3WWVA 9ICBA 5KFUA 3UXOA 2B29A 3RZOH 4BXXG 4DAMA 2W9BB 1BPZA 4B9MA 4DV7L 1QZHA 1IFYA 3GDEA 4RT3A 1X6OA 4O5CA 2AGQA 2B3GA 4DV1L 3FRIA 1E1TA 2LBCA 5JI2E 3HPOA 5KG0A 1M90C 4GLAC 1HH2P 4M6WA 4PHPA 4KHZA 2IBKA 8ICAA 5BR8L 5KFAA 1EYGA 3I4NH 1WCLA 1S77D 4A3KG 3V7JA 2JEBI 4JBJA 4X64L 3EPGA 1VQGA 4DR3Q 4YMNA 2V4QA 1CKNA 2BQUA 1QLNA 4O3NA 1ZQWA 3TREA 4YWKA 1QTMA 4JI7Q 1VQ4A 4BBRH 2NVXH 1IBKL 4F1IA 1OTCA 4A3GG 5IYCG 1SZPA 5DFLA 9ICVA 9ICNA 1TWGH 4DUYL 1VQFA 2E2JH 3PUXA 3JPSA 7ICUA 3ETLA 3HT3A 4GKKL 3FRHA 4GEWA 5KFJA 1K3RA 3A0JA 5J0XA 3RBEA 2D0PA 4J9KA 5M5YH 1AIPC 1UT8A 3NEMA 4DV2Q 1Y1VH 2BCQA 2CFMA 3HFZB 4RQ8A 4A3LG 4AIMA 1L1OA 2R93G 1K1SA 4DV5L 2IHMA 3PV0A 2ZM6L 4LUZA 3PX6A 1NOMA 5IWAQ 9ICSA 2CP8A 1SFOH 3RB4A 4DUZL 9ICWA 1U9LA 4DS4A 1YVCA 2FMQA 4JI4Q 5KT5A 1G51A 2YU9H 2KTQA 2WFWA 3PW0A 4O0IA 1TWHH 2MGWA 1BPDA 3PUWA 5JUMA 2EKFA 1OXTA 4LUOA 1A8VA 1XSNA 2RF4A 2QSFX 2XGQA 2HIXA 5J2FA 4TUPA 1MQ2A 3GLIE 4DR2L 1G6PA 5LMNL 5M3FH 3PIPA 4B9TA 3HOYG 1U49A 3T5HA 4Y52H 3CCRA 4BGDA 2ATWA 2FLLA 1EFWA 1WI5A 1G41A 4R8UA 4KMUA 3MFHA 1W2BA 2HVIA 4UB2A 7ICPA 3PY8A 2RDJA 1HNWQ 2EXDA 1G3IA 3HOUG 1IYJB 1ZQBA 4DSIA 3JPRA 2HWJA 1X3GA 3QE9Y 1OAIA 4JI8Q 4YY3Q 1NK9A 7ICKA 1JE5A 2A19A 3K75D 2VS1A 4P71A 3RJGA 3T1YQ 2KENA 1X55A 3PO2H 4X62Q 4RNMA 4I2BA 1JIHA 3NELA 1NKBA 2ZJAA 2BKEA 4UAYA 1LTLA 4PMWA 1I94L 2JUJA 2A8VA 8ICRA 3AUOA 3RN2A 5DBAA 2UUCL 3HKSA 4BWJA 1P16A 4NXML 4JI6L 1U45A 1V9PA 2RDIA 3ZD8A 1E3PA 1EFUB 2LVQD 4IR9A 1JJCB 5ELNA 3SYZA 4BXXH 2KHJA 4DQSA 2IY5B 3CD6A 3PW7A 3S15H 1L3TA 4A3DG 1PH5A 2LVNC 2WTFA 4M9NA 1UWVA 1NJIC 4QZCA 3CCJA 3JPQA 4YFKA 4I27A 4A3KH 3G6YA 4LZDA 5KFLA 4ED8A 2Z6KA 2HHHQ 1KFTA 4C8NA 5H1SE 1ZQEA 4A3JG 4B3SL 1NK7A 1HT2E 5J2HA 5J2EA 4EYHB 2UUBQ 2XGTA 1Q46A 2NVYH 1LB2B 2VQEQ 1XMOQ 4JBWA 5DB6A 1J5EQ 1IZ6A 1K73C 4P75A 2JZ1A 2PI2A 4A3GH 5F9NA 4UP9A 5IYCH 4TUSA 1Q12A 2UUAQ 3ZDAA 4RPYA 4ED6A 4DWIA 3ZDBA 2JEFA 2XTIA 4KITB 1JB7A 3ER0A 2JP7A 2FLPA 4UAZA 2JQOA 1WR1B 1L5UA 1X65A 3SV4A 4YHHL 4O3OA 1CSPA 4X5VA 2KN7A 3S2DH 4JWNA 4KLGA 3ISBA 1WFQA 4LF5Q 2HHTA 5HMMA 3K9PA 3PR5B 4A3LH 1S9FA 4HIDA 4YXJA 1VS0A 2GVAA 4PZ8A 2KHHA 4E0DA 2RHQB 2ZUDA 4BXOA 2HHQA 1I6HH 3EYZA 9ICIA 1ZQMA 3ERSX 4LF9Q 5C5JA 3MR3A 1VQDA 1R4GA 5HP4A 3CMAA 2VUMG 5KFEA 1SN8A 1V43A 2IT1A 5J0UA 3W1GA 1C9OA 1E94E 4R4IA 4DV7Q 3E2EA 4OWWB 4JV2A 1K9MC 2OTLA 5KG2A 3QEAZ 3RRGA 1JMCA 4R63A 1E1OA 4JWMA 1X2IA 3BZKA 1S72A 3JC66 1Z3EB 4HYKA 2IA6A 1KLNA 2BQRA 5BR8Q 1YHAA 4F5RA 1AH9A 1B7YB 4MEXA 4LF7L 3GTLH 1YBYA 4X64Q 1VQLA 4I2AA 2MO1A 3U58A 1X3FA 3GLHE 1VG5A 4RQ1A 1EIFA 4EEYA 2JZBB 5C44G 3OTOQ 4RU9A 3RBDA 3MFIA 3RH6A 2ZUBA 5KG5A 4JV1A 4M9GA 3M9OB 4ECQA 1YZ6A 4EX5A 1IBKQ 1WGNA 2LVAA 1YHBA 2MO0A 1NK0A 2W9CA 1KL9A 1NK8A 1EWIA 3RLNA 3Q8QB 2MAXA 3E46A 1U48A 8ICZA 5K36G 4P2HA 4ZH4A 9ICXA 2VL6A 4Q7JA 5KT7A 4TQSA 1XWLA 3NENA 1HR0W 8ICJA 2I5HA 3C2KA 3FP9A 3M7NA 5L1KA 4XIGS 1LM0A 3EBEA 3RH4A 4JG2A 1UFZA 2C35B 5KG1A 1B70B 2QEXA 4DV5Q 5JJIA 2IHNA 2EQSA 4DBGB 2Q2TA 2ZM6Q 4HIKA 5EOZA 2J6TA 3MGIA 5KFHA 3RAXA 3DM3A 1EUJA 2JA8G 4IPGA 2R92G 3C1ZA 3L0OA 4IPCA 4DUZQ 5KTQA 4WJ4A 2Z6KC 3M4PA 4A3DH 4QW8A 2MUTB 5DLGA 4UB3A 2AQ0A 4ECZA 2BHNA 4YCWA 3UE1A 4F4WA 2NRXA 4OXPA 2Y1IA 1QSYA 4DL3A 2V4RA 3UDFA 1IXRA 4B3TL 3U4VA 2XGPA 5KFDA 5KFYA 4OO1G 3MABA 4A3JH 4AYBE 1P8LA 1BPXA 1SROA 4DR2Q 3KFUA 5LMNQ 4TURA 3I55A 4JI0L 3W5OA 3AQQA 5HMLA 2J6SA 5FJ8G 1VQCA 2C2EA 1JR3E 4O5EA 4XUSA 1OKSA 4F5NA 2L15A 3QZ7A 3RB0A 2RCNA 1N8RC 1S40A 1BPEA 2N8NA 4WJ3M 8ICBA 1PH1A 4YD1A 4LFAL 1QUQA 4EBDA 3M4QA 7ICNA 1Y88A 2M9NA 3PVXA 4BBSG 2VNUD 2XY5A 2A1JB 1UE1A 1ASYA 3GD7A 1MC8A 4DL7A 3KTQA 4JI8L 4DEZA 5DQIA 4C3HH 4ECRA 1NV8A 4IJLA 4F4KA 3I56A 1K1QA 5DB9A 5KFZA 1I94Q 1TAQA 2CQOA 3ORYA 2UUCQ 4DF4A 2A1AA 1A76A 1A63A 4NXMQ 4B9NA 2VUMH 2KZZA 3TRZA 5KT6A 1E7ZA 4XTCS 4DR4L 3THVA 4BY7G 9ICHA 4B9LA 4A3EG 2ZJPA 2JA6G 4I2JA 1Y8GA 1ZQDA 4DL2A 4LUVA 2K5NA 4ED3A 1D7QA 4O9MA 1IBML 4RNOA 3CW2C 4P73A 3SV3A 3S1MH 4RQ4A 3BQTA 4GS3A 4B3SQ 4DK3C 4QZBA 3HOZG 3OSPA 1BPYA 3H3VH 4F5QA 4PH5A 5C44H 2AMCB 3GTKH 1T43A 5J2KA 2DAMA 4A3MG 2BH2A 1MJEA 5IE8A 1RPLA 9ICTA 4O3PA 3I4MG 8ICPA 1XMOL 4YR3A 2JA5G 5M5WH 2BA1A 1J5EL 4Q43A 3RJJA 2UXBL 4DR1L 1HT1E 2GVBA 4UB5A 4M47A 3AU2A 4YG2A 1NJWA 1BBWA 1T9HA 3KF8B 5AJ3L 4GC7A 2V1CC 8ICNA 1GO3E 3GIJA 4PHDA 1PH8A 3AFPA 4YHHQ 4DSJA 2OQKA 3ULLA 5J0OA 4ED2A 1E24A 2PI5A 4I2GA 3PIOA 2KZ3A 1ZQGA 4F3OA 2UVRA 5DBCA 3K81C 3KJPA 2ES2A 3V7KA 4WP2A 4JC0A 4DFMA 2JA8H 2R92H 3L7ZC 2ZUCA 3E9HA 3U4ZA 4ED1A 3S14H 2DNAA 2IX0A 4DS5A 5J0YA 3RB3A 5KFNA 2JEAI 2AKWB 3JAMi 1Y1WG 3KLWA 4RNNA 1QSLA 1NMGA 4TQRA 1HZAA 3UQ2A 3M8RA 4GOPA 2W9MA 1ZQQA 1CUKA 2DHYA 4GLVB 1OXSC 1UEBA 1VQEA 1HR0L 3M4OH 3FYHA 2Y0SE 4GXIA 3K80C 4UP8A 5EAYA 5JJKA 3BU2A 4JI3Q 7ICFA 3LCUA 4ED7A 2R0IA 1EOVA 5J2DA 5FJ8H 4LF7Q 1ZQKA 1IM4A 1WOCA 2DI0A 4DKAC 1SE8A 4NPSA 2WAQE 3KHLA 3RTVA 4IRKA 4ECTA 3J81c 1N9WA 1FL0A 2UVVA 9ICAA 1ZQTA 3OTOL 5BOMA 1PYBA 4EZ6A 4BBSH 2IHFA 1KSPA 3PMNA 1XSPA 1RXVA 2BWBA 3E21A 4IQWA 4F92B 4J9MA 1H95A 1BKBA 4Q8EA 2UXCL 3V7LA 8ICWA 3PUYA 3IM1A 1E22A 2BGWA 4H02A 2CWBA 2PQAB 4YQWA 5KG4A 1UA1A 1PV4A 4R1JA 4UBBA 4J9RA 2MROB 1X9MA 1JXLA 4HEOA 3Q8PB 3PO5A 4KLJA 4BY7H 1GVPA 5DQHA 4FO6A 5J29A 4IRCA 4A3EH 2JA6H 4M6WB 5KG3A 3RR7A 5C0XJ 3H15A 3AEVA 4IPHA 5EWFA 2XC9A 1PHJA 2AU0A 5C4JH 1RIPA 4XQ8A 4RQ5A 1YLAA 2MJ5B 1BGXT 3PV8A 4KHPQ 3RR8A 4HJ8A 4F4ZA 1T4GA 1KRSA 4B3TQ 2R8IA 2B21A 3HOZH 5KT3A 1N56A 1CKNB 4KLHA 3CCQA 4A3CG 4ECSA 1X56A 2K0BX 2E5LQ 1BPBA 4A3MH 4JYAL 1KFSA 1SKSA 4JI0Q 9ICKA 4DR6Q 1ZQLA 2DPJA 4NY8A 1OTRA 5DGBA 4P4PA 3I4MH 1KDHA 2JA5H 2C2DA 4BA2I 5ELOA 1IXSA 2JNHA 5KFFA 2ASJA 3RH5A 1TK8A 5IINA 1VQJA 2CKZB 3CP0A 4O5KA 3GDXA 3PF5A 3AU6A 4G3OA 4O3QA 4Q45A 4LFAQ 2BWEA 4DV4L 1KC8C 4KN4A 2XY7A 1WYDA 1XNRL 2P6RA 1HJPA 4EBCA 1QZGA 3GTPH 4FBUA 3K7AH 4DV3L 2D62A 5J0QA 4GN5A 4DQRA 2DPIA 1S76D 1YI2A 4XRHA 4JOIA 1L1OB 4F2LA 4EZ9A 4EQ5A 1GO5A 5FLXc 3G6VA 3IHQB 3PF4A 7ICQA 3H8JA 4IQUA 1NMFA 4KLKA 2FPKA 4MEYA 3E9IA 2IMWP 5GAGC 1XS9D 2DKLA 1ZJNA 1R9TH 2NRWA 4XA5A 1LYLA 4IO9A 4DR4Q 4ECUA 3S1QH 3UDXA 1NJXA 1Y1WH 9ICQA 3DLLA 1WHCA 1ZETA 1SL1A 4UQGA 4MTNA 2VA8A 2DGYA 1BBUA 2LTUA 3H4BA 4A3IG 4C8MA 1MN3A 5D46A 2OOAA 3RB6A 2HHXA 1C7YA 1IBMQ 1KXLA 4X66L 9ICUA 3KDFA 3HOXG 4R8UB 3MDCA 4RQ2A 2HHWA 4QQBX 1O7IA 2EKKA 4QJFA 5KFKA 3T6PA 4NB3A 2L2DA 2F1HA 1XXHE 5M5XH 3H7IA 2XO7A 3OSNA 1K0RA 1YEZA 4C8LA 1SL0A 3KHRA 5CR0A 2WP8J 3GV5B 3PW5A 2LVPC 5J2AA 4I29A 5KFOA 3JPNA 2UXBQ 2YTYA 3B6YA 4DR1Q 3Q8MA 3RZDH 5DDMA 2PFNA 5AJ3Q 1X9NA 3RNUA 2YV5A 5C0XG 4CCHA 1B43A 9ICJA 3KHHA 4ME3A 4F50A 4OWTB 4A76A 2OQ0A 1U5KA 1YIJA 3BJYA 5HHIA 2ASLA 4UP7A 1L1OC 4L5TA 1ZQOA 3JAMc 1N48A 1FGUA 4DL5A 1SKWA 5CHGA 1X3EA 5J2IA 1L3UA 2FXQA 1MKHA 2QA4A 4OX9L 2K75A 2W8LA 4PZ6A 3S1RH 1PGYA 4ECYA 5D4BA 2R93H 1JT8A 4LF8Q 3CXCA 4F4XA 8ICYA 2HHSA 4JV0A 5DB7A 4GN3B 2BCVA 4DL6A 5DBBA 3J7A5 2JZ0A 1U4BA 4NLZA 2HAKA 4O2DA 3T3FA 4JI1Q 2F52A 2WB1E 3K0XA 2R7DA 4ECXA 1VQ6A 1HR0Q 3SZ2A 1PZNA 2P6UA 2DAGA 4KTQA 1HZBA 2NRTA 5DG9A 4QZAA 1D8YA 3QZ8A 1EQQA 2PFOA 4KLUA 4UN2B 3GTJH 3E0EA 3HOYH 4JI3L 5CJ7A 2AGPA 3GIIA 4IOCA 2K14A 3HKZE 4KLFA 1XJVA 4DV0Q 3F2CA 3G4SA 2ASBA 1TTEA 3TAPA 4QZGA 5J2BA 3MR2A 3HOUH 2E2IH 2ID0A 1AE3A 3FHWA 1IBLL 4MFFA 4NLNA 1S0VA 2N3SA 4B9VA 2JJQA 2F1JA 4DSFA 2E8GA 8ICFA 2UXCQ 2G3QA 5IY0A 8ICUA 3Q8SB 1UE5A 1XNQL 3L2PA 4BXOB 3D31A 1YITA 1BVSA 3HP6A 2RHSB 1VQMA 8ICXA 4F2RA 5GAHC 3J81i 4DQIA 2W8KA 1KRPA 4DQQA 4DFKA 2KZMA 7ICVA 1CEZA 3B0XA 4BWMA 3ZDDA 4RQ7A 3UXNA 4M9HA 7ICRA 1SL2A 2NN6I 4QW9A 5J3BA 1XMQL 1HZCA 2DAIA 1NBWA 3PMLA 4A3IH 4LFCL 2ZJ8A 4UAWA 1Z00A 3K4GA 5CP2A 1I50H 1XO1A 3IRBA 1MSWD 4BY1G 4YN4A 4O3RA 3HOXH 4KHPL 1EQRA 2BDPA 5IYBG 1L3VA 1S97A 1TKDA 2JEJA 3PCOB 4F5OA 3STBC 4RMFA 2PMZE 3HWTA 1KYIA 4JYAQ 1XTDA 1NJYA 1GM5A 5C4XG 3F1ZA 3VDYA 2E5LL 2W9CB 4FS1A 2I1QA 3CMEA 2MR9A 3TI0A 5JEAJ 4DR6L 1T8EA 4KLSA 1Q86C 5J0TA 4J9QA 4DK6C 5IYDG 1QZEA 4LF4L 1KRTA 4DL4A 5TZVA 4YR2A 4IFDI 5KFVA 4DV4Q 4DO9A 2ALZA 4GKJL 3B0YA 2H5XA 4KLMA 4RQ6A 2UU9L 3GTMH 4YXMA 1XNRQ 1DOQA 3MGHA 1UE7A 3AFQA 2N78A 4DV3Q 4HJ7A 3H8SA 3GIMA 2PFQA 3V6KA 2KFNA 3H3VI 3KHGA 1Q1BA 2FMSA 1GD7A 1IM2A 2Z0SA 5LMUL 1Q02A 4QZDA 2NRVA 3BDPA 3PUZA 3PNCA 2B63G 3KF6A 1TV9A 3C1YA 2KHIA 2DENA 3PO3G 3C2LA 2K5HA 4R4QA 4FBTA 3AYHB 4TUQA 3G48A 4DR5L 3IECA 9ICMA 3F8TA 1NKCA 4J9OA 3GILA 3PX0A 2N49A 8ICCA 9ICFA 1VEJA 3CCEA 5KFTA 3KOJA 5BPCA 4A4IA 4X66Q 4P4MA 1OXVA 2AWNA 4POGA 2OO9A 2HT1A 2PNHA 4IQVA 1ZMWA 3H4DA 4DSKA 5J0RA 2ATLA 8ICVA 5KT4A 1QUQB 7ICLA 4K0KL 4B9UA 1PYSB 1S10A 4GN4B 3OHAA 2DUDA 3TFRA 4C8OA 4QL5A 1F4IA 1KIXA 1MQ3A 2PFPA 2BCUA 4F93B 3EWAA 1AE2A 4B3RQ 2HQLA 2NZOA 8ICEA 1AROP 1NTGA 1VQ7A 5L1IA 3UXPA 4KLDA 3JPTA 1HUOA 4IR1A 3GLGE 8ICLA 5J0SA 3EZ5A 2NVQH 3RLOA 1N34Q 2W9BA 8ICQA 1K8GA 2JY5A 4QZIA 2NVTH 7ICHA 5J0WA 4APVA 1ZQNA 1TVAA 4B3ML 2JY8A 2R8GA 4K4GA 4OX9Q 3G71A 4F2SA 1VCIA 3EW9A 5C3EG 4ECWA 1PFSA 1ZMVA 3CCUA 2RRUA 2LYHA 3MR5A 3ISCA 2MNAA 3KYHC 3RLFA 2AWOA 1I5FA 1VQIA 1QVFA 3K8AA 4P74A 4YCUA 3TS0A 4NLKA 1ZMUA 2R6GA 4PZ7A 5JEAG 4LF8L 4DV6L 3PR4A 4GNXA 3TFSA 4YCVA 4MNOA 1HZ9A 5HNKA 1FJGL 4DFPA 4TQUS 4BY1H 5GADC 4UB1A 3F2DA 5IILA 2V9WA 1W3SA 1VQ8A 1KFDA 1PH3A 5IYBH 5KFBA 2B3TA 1PA6A 4QZFA 2LVOC 4M04A 4JI1L 2BCRA 1HNZL 1PH7A 1T7PA 3LWLA 4NLGA 5KFMA 3T1HQ 4QZ8A 5C4XH 4I2EA 3J80c 5L9XA 2L4EA 3ULJA 5DLQE 4J15A 4YWLA 1PH6A 1RXWA 3MXNB 2FLNA 2BQ3A 4ED0A 5FLMG 4LNQA 2GN5A 4NM1A 5IYDH 2FPMA 1XC9A 1WCNA 3J81j 4QWEA 1V92A 3LWMA 4I2IA 4POFA 4DPGA 2Q2HA 4DV0L 4YVZA 3GQCA 3N4MB 1ZV1A 2ZTDA 2LXJA 4ELUA 3OW2A 1S3OA 1IBLQ 4R65A 4X6AH 9ICGA 2I5MX 1MIUA 4Z6CA 3UE0A 4A75A 2R8JA 1QVCA 1A77A 5GROA 1SRUA 4PHAA 4HJ5A
chains in the Genus database with same CATH superfamily
8ICGA 1SYBA 2HW3A 2YQEA 4FCTA 4G3IA 1N61A 3EIVA 2RBMA 1URJA 5M3MG 2RQXA 3NWTA 2IOFA 2D9UA 4N9PA 2C22A 4IZ8A 2KZUA 4P0QB 2QB1A 1EXNA 2F0EA 3GFKB 5ELBA 3TE6A 5FLXS 4IRDA 2K5VA 2DAEA 3K1ZA 2KKVA 1Z47A 4BLCA 1NHWC 3W1BA 4J6HA 8ICHA 3KDSE 1TAMA 4RG1A 9ICCA 3SXHA 2K50A 3NQTA 2ZJRA 5C18A 4NJ8A 4MFAA 5FOBB 3Q8GA 5J2GA 4OWXB 5KFWA 3KOOA 1QDRA 1VQPA 4KN7A 4GXJA 1L8LA 4BDPA 3TWMA 4JPBW 4LMQD 2Y1JA 4DNIA 4B9SA 1JALA 2RGHA 4DLGA 4FDBA 2AHMA 1JCKB 2Y21A 4A93B 4RQ0A 4HIMA 5FTKA 4A3BG 3F2BA 4X65L 1TY2A 5F2DA 5ITYA 4QWDA 4G4NA 2E5SA 3PO4A 5C3EH 2LXKA 5GQOA 1OQYA 4GXKA 4L63B 2VY3A 3ZDEA 4G7OC 1J97A 4MZ9A 4LF6Q 5I4DA 4QWCA 3J81L 3JR4A 2YMMA 3L25A 2F44A 3U26A 3BS5A 4UDUC 5IIJA 2HVHA 2HSZA 1LTGD 1YJWA 3P1HA 5ALVA 4BBRB 4KHPM 3GTOH 2CXYA 4CISA 3FYCA 4UB6U 2BDUA 2IX1A 1HCZA 3PO3B 2KNVA 2KXEA 3AL0B 2I5LX 2E5LM 3L4PA 1QANA 1UUPA 4QZEA 2JSOA 1B22A 1Y1VB 4LVSA 1JJGA 4RPXA 5IP9G 2KKPA 1T6OA 1ED1A 4C0ZA 1PLFA 3K58A 2UU9M 9ICRA 1EIJA 1LV5A 1L3SA 4M9LA 2RHFA 4GITA 1N34L 2Z8YM 1VDLA 2Y0SG 4R4CA 2CV0A 2JEIA 4NXNL 4LJZC 1TWHB 1XPOA 3GP7A 3RFAA 2WAQG 3CC7A 4PV1C 4OIKA 2KV2A 3K9OA 2JK8A 4I2CA 3STBD 3NP8A 4GC6A 4QJFB 1PVOA 3M0EA 3WK9A 2EIFA 4Y28F 1HNZQ 5C6AA 2EUCA 2O5RA 3ICXA 3KOZE 2JRZA 1A62A 3FRPB 3AL0C 5ALIA 4YP3A 5DEHA 4F91B 3SAHA 1RD9D 1TVXA 2OCEA 2JXNA 1I4XA 4ME5A 4RZRA 3V6HA 1TWAH 4P17A 2E1FA 4IQTA 3HU1A 4JOIC 4QWBA 1VF7A 1TKWB 5IP7G 2MUTA 2JXJA 4TVAB 1N77A 4B9WA 5ALSA 7ICMA 8ICOA 1ILPA 3UDGA 4PHEA 1IN8A 3U50C 1WIVA 2K4KA 4IUPA 2W7OA 2VJ5A 1OFHA 4QZ9A 1KQSA 3MBYA 1VQHA 4A3KB 4GKKQ 3N52A 5AKZA 4HJAA 1IN5A 2VDBB 1G8ZD 1FJGM 2BPFA 4C1NK 4DOCA 5JVG3 2D7EA 4EVOA 2E1EA 3ULPA 4L5RC 1J6QA 1DXSA 3JPOA 3N28A 3E5SA 3ND8A 2DY8A 2CHGA 4ECVA 1H9JA 4YMMA 2ZJQA 3D4RA 4XT1B 3I4VA 3AOGA 2K5QA 3H94A 1L8QA 1TGUA 1I6HB 2A68D 2KECA 2OWOA 3M7GA 4X65Q 2O01F 4ELTA 2EYPA 3K7UC 2MFIA 5AI5A 4LWCA 1JI7A 3I4NG 1ZQVA 3HGBA 2EY1A 1K3XA 3W67A 5EWEA 1HRJA 4DR7M 3HOWH 4LFBM 1PZKD 2I7PA 2WF9A 1G91A 4G57A 1K8AC 4JVZA 1M8AA 3IDWA 1TQOA 4JI5M 4AZFA 3T1YL 2Z9HA 4X62L 2SEBD 1E9SA 1AZQA 2ZIUA 4DAYB 3WKCA 3BQ0A 2KOLA 3LGJA 1Q3BA 4YIJA 1HNXL 2BH8A 1KTQA 3U6CA 3F92A 5L1JA 5KG6A 3M9NB 4FO2A 5ELDA 3TQ1A 1UA0A 2HI0A 5KRUA 1CI4A 2B2YC 1L7PA 2HDLA 2IHEA 1P3QQ 2GOLA 2J5YA 4M9JA 2C99A 4Y2XA 5KFRA 3CC4A 2EDUA 4Y2UA 5IIKA 3OOCA 1B50A 1AUAA 2WB1G 2KHSA 3Q6SA 3I91A 1VF5C 3B7QA 3KW6A 1J2NA 4UAUA 4PPXA 1S0OA 3H0GH 2R4EA 3KP0E 3KF6B 3KJOA 2MUYA 1YNNC 4NXNQ 2VQEL 1SGGA 5KG7A 1N78A 2BDOA 3HKZG 2E8OA 4M2YA 1KAWA 4CDGA 3V6JA 2Y0SB 3MMPA 3ZJYC 2BJVA 2Z4SA 2NZHA 1GXDC 3M85A 3HKZF 1K3WA 3MK6A 1M1KC 4AQYM 3PO2G 2JV3A 1XSLA 4KI0A 3FKIH 3CRKC 3NTUA 1WTPA 3SQIA 1D6EC 4DN4M 1A6XA 2VIXA 4LF9L 1TR8A 4NM2A 2CW0C 1ZQUA 2EZZA 4JBKA 4DOAA 9ICBA 3RZOH 3SAUA 4DAMA 1JR0D 3HRZC 1X6OA 4DV1L 2LBCA 1M90C 2F4VM 4CKEA 1GUNA 2LMRA 2VF8A 1X66A 4RGTA 2KUMA 2OEHA 2A69D 2TSSA 2OT2A 5J8YC 1CKNA 3DV9A 2QLTA 3QJYA 1IBKL 3T13A 1YT3A 4A3GG 2Y0SC 1J2MA 4JI2M 2EOTA 9ICVA 1TWGH 4DUYL 3JPSA 1SAPA 5C44B 1QCKA 2K8BB 2F0FA 1J8IA 2JP1A 4JV5M 1K3RA 4XYQA 5J0XA 5EPLA 1UT8A 4B9XA 3NEMA 4GHLA 5L37A 3HFZB 2Z7JA 4M0DA 5D3DA 1L1OA 4DV5L 3A56A 2QCUA 9ICSA 3RB4A 2KVSA 1A3UA 1BOSA 4G6ZA 3VA5A 3G6JB 5KYLA 2KTQA 3KUPA 1DYQA 2WFWA 5C5LA 2MGWA 2G8LA 3PUWA 3SYKA 3M6AA 4LUOA 1A8VA 4DAVA 4TUPA 1MQ2A 4DR2L 1G6PA 2F8KA 3HOYG 1U49A 2ATWA 5KEEA 3J80L 1AQ6A 1G41A 1EQTA 1W2BA 2EAOA 1G3IA 3PIO3 2X4AA 1ENFA 4PNYA 1ZQBA 4DSIA 4ICAA 1X3GA 3QE9Y 2D7GA 2KP7A 3VFDA 4FXDA 2D5DA 1NK9A 7ICKA 3K75D 3T1YQ 3E58A 1B9MA 4X62Q 3PSTA 4CRXA 1JIHA 3HHXA 1QUSA 5KNIA 2BKEA 1PVRA 4UAYA 5ALTA 3TZDA 2XI9A 3Q22A 3HKSA 3ZD8A 1A2UA 1F2LA 1EFUB 2D7HA 2LVQD 3SYZA 4BXXH 5IWAM 1V1PB 3RD4A 3UMGA 4ZK9B 3PW7A 3S15H 1L3TA 2MJ8A 4JI4M 1PH5A 2XFTA 4M9NA 3TMEA 4YFKA 4I27A 3QO2A 4ED8A 3BQ7A 1I4WA 4C8NA 5H1SE 4A3JG 3U61A 2RLTA 1I4HA 4EYHB 5C4JB 2XGTA 1LB2B 2VQEQ 5A2QL 1J5EQ 1K73C 2C5CA 2WB1B 2N1RA 5F9NA 4UP9A 1I6VC 4RPYA 3P20A 2JEFA 4A3MB 1BXTA 1YNJC 4FZLA 4NRWA 5ALOA 4YY3M 4LF6M 4UAZA 3H6MA 4LZJA 1GABA 4G4KA 3HKZB 2KN7A 1PZID 4IUQA 1WFQA 4C3HG 5HMMA 2CRUA 3K9PA 1JICA 3PR5B 4A3LH 4S12A 2KHHA 1MA7A 1D0MA 2RHQB 3MEHA 3MC1A 3VR3A 3ERSX 4LF9Q 2JXMB 3QU2A 3MR3A 1R4GA 1RTOA 1SN8A 1C9OA 2JMGA 2Q2EB 4QB4A 1K9MC 2OTLA 3QEAZ 4NMZA 4MHVA 1S72A 1Z3EB 4HYKA 4MB7A 4Z6YA 3TP5A 2Z8LA 1AH9A 1HQRD 2MO1A 3GLHE 3DEEA 2Q8RE 3IP4B 3RBDA 3MFIA 3RH6A 2WB1C 5KG5A 2D2CC 2KNJA 3M9OB 3MAQA 1IBKQ 3S6JA 2K47A 2LVAA 1IG6A 2W9CA 4GH9A 1NK8A 1EWIA 5CV8A 3E46A 1DGHB 4C7ZA 1U48A 8ICZA 2VL6A 2G5GX 4HCSA 5KT7A 4EELA 2ZIXB 3HKZC 3NENA 3MWYW 4QUCA 5EP1A 2E8NA 2I5HA 3FP9A 3R9XB 3QUTA 1NHGC 4A3GB 5AI6A 5KG1A 4X3TA 2QEXA 4KV6A 4DAPA 4DV5Q 2EQSA 4DBGB 1STBA 4HIKA 2J6TA 2E74C 3MGIA 1II3A 1EUJA 2R92G 4IPCA 2Z6KC 4A3DH 2L11A 2BHNA 4HMJA 1QQ6A 2N35A 2ICEC 2YFQA 4DL3A 4FXKC 3Q8XA 1IXRA 5KFYA 4OO1G 4FNFA 4DR2Q 2W04A 3H0LB 3I55A 4FF1A 4X64M 4RHRA 4QF4A 1VQCA 5G5GA 3KZXA 4F5NA 2L9HA 1QQ7A 1BPEA 1K28A 4WJ3M 4U68A 1PH1A 4YD1A 2HOFA 2HCCA 7ICNA 3HOYB 3PVXA 1OIPA 2XY5A 3GD7A 4GKKM 1X6JA 1NNJA 4HAEA 4F4KA 1RU3A 5GTIU 1TAQA 2CW0D 4ZKBB 4LZZA 2EXZA 5LL6X 2DJGC 3MFGA 1E7ZA 3U6SA 4BY7G 2FI1A 2G08A 2KCCA 1PJTA 4A3EG 5ITXE 1O78A 2KEYA 1EL0A 3J80S 2XZFA 2K5NA 4LJ7A 4IALA 4RQ4A 4CF5A 2LHCA 1GUTA 5J2KA 2BH2A 4K2LA 1MJEA 1RPLA 2EY2A 9ICTA 3FTEA 1XMOL 2UXBL 4M47A 3HU2A 1AN8A 2AQ1B 3THGA 1GO3E 2H4OA 2E3TA 3GIJA 4PHDA 1PH8A 3KKAC 3QNMA 5J0OA 4ED2A 2RKOA 4I2GA 3PIOA 2HDOA 1LKYB 3QYBA 2ES2A 2UUCM 4WP2A 4ED1A 2DNAA 2IX0A 3BS7A 2AKWB 2CHVA 4HMIA 2Y9UA 2KEBA 2W9MA 2DHYA 1VQEA 1D1KA 1B9NA 1GJSA 4UP8A 2YB4A 3LCUA 5CRXA 2KW0A 5J2DA 1QUTA 4J1MA 3EIHA 1WOCA 3K5MA 4NPSA 3E9SA 1S5FD 3A45A 4L4UA 3J81c 3SR1A 2I6XA 2UVVA 2M0NA 3I4LA 3OTOL 1PYBA 4EZ6A 2L6OA 1IL8A 2QBYB 3E21A 2EYHA 3DA1A 4F92B 2CPRA 4RWSC 3PSFA 2ZIVA 2BGWA 4LK1C 3CHBD 1F9PA 2LM4A 1GVPA 5C3XA 2JA6H 4M6WB 3AEVA 4IPHA 5EWFA 2XC9A 2AU0A 1RIPA 4XQ8A 2JH7A 5FTNA 2PO4A 2R8IA 2KSOA 3HP3A 4HR7B 1N56A 1EQVA 1UCVA 1AP0A 3CCQA 1BPBA 1SKSA 9ICKA 4DR6Q 4NY8A 3I4MH 4MTKA 3ZC7B 2JA5H 5KFFA 5EJCA 1TK8A 5IINA 4L78A 2CKZB 4QOSA 3PF5A 4RNAA 2WSCF 4O3QA 1SZHA 4DV4L 4KN4A 5B5EU 1B3QA 4B08A 3FD9A 3FUXA 1XNRL 2P6RA 1HJPA 3URYA 3K7AH 4GN5A 5AKIA 1S8OA 3MTSA 4FF2A 4EQ5A 3CYMA 3IHQB 7ICQA 4IQUA 5EXSA 2JN4A 3SD7A 4FW9A 2C9OA 1R9TH 2X69A 4HLQA 1LYLA 2KICA 1WHCA 3O0FA 2LTUA 4PMCA 4A3IG 2DWZB 1R2ZA 1KNAA 2HBLA 3RB6A 1GJTA 4B3TM 2ODGA 1GO3F 4RQ2A 4BY7B 1O7IA 2EKKA 1PK3A 5L1MA 1XXHE 5IZ7D 4JI0M 5M5XH 2XO7A 5C4ZA 2BZFA 1YZ7A 1K0RA 5J39A 3KHRA 2WP8J 5J2AA 4I29A 2HUGA 5KFOA 2UXBQ 3LX0A 2V4DA 4LFAM 4K5XA 2PFNA 2B2TA 2DJFC 5C0XG 4CCHA 2HD3A 1N5WA 1B43A 9ICJA 3VR2A 2RKSA 4UP7A 3KS8A 1ZRNA 4DL5A 5ELEA 1SKWA 4K8JA 1L3UA 2FXQA 5G3LD 1MKHA 4PZ6A 1QQWA 5AK5A 1JT8A 4LF8Q 2RRDA 5ALNA 5I2XA 5DB7A 3SAGA 3J7A5 2JZ0A 1U4BA 3AOEC 3NRZA 3T3FA 2QKIC 3A8IE 1SYGA 4JI1Q 3K0XA 2MA1A 4KMOB 1VLBA 1VQ6A 1PZNA 4KTQA 2DAGA 2I46A 4AKGA 1QNUA 4QZAA 2OPFA 1IBMM 1ECWA 1EQQA 4KLUA 3S1QB 3E0EA 4I5SA 2AGPA 4F8MA 2K14A 1KBUA 4QZGA 3FUTA 4IBKA 2R3ZA 1J5EM 3FHWA 1IBLL 3GO8A 4WURA 3DM1A 4I81A 3A7LA 2WF5A 3I8ZA 4LJ5A 1YITA 2WF8A 8ICXA 1KABA 1F9RA 1S5BD 3EIEA 1SV0C 3J81i 3BXWA 7ICVA 1SMYD 4QNMA 3FDTA 3ZDDA 2QARB 2AUJD 3MGVA 3J7BA 4NP5A 2BCOA 1CT1D 4UAWA 2F0QA 3SAVA 3IRBA 1MSWD 2B8GA 3S1RB 4BY1G 2YTUA 1TKDA 2JEJA 4CKBA 4MGYE 1SXJA 3SAWA 2PMZE 5CYUA 2XF3A 5C4XG 5AIAA 3FKEA 4FS1A 1D8BA 5JEAJ 1JOOA 2MU2A 5J0TA 1KRTA 5TZVA 2L4NA 4DV4Q 1EOTA 2ALZA 4KLMA 1XNRQ 1UE7A 3AFQA 2F0PA 4QUFA 1NY6A 3TADA 3X3MA 4OVZB 4GHAA 5LMUL 2TMPA 4QZDA 2E2IB 2NRVA 5EXPA 3PNCA 2B2VA 3C1YA 3KXEC 3OWFA 2K8CB 4ZUIA 4DR5L 3H4MA 3F8TA 3PX0A 3TKAA 1VEJA 3CCEA 4A4IA 2I7NA 4P4MA 4EX7A 2HT1A 2PNHA 1ZMWA 4JYAM 1VDZA 5KQDA 2ATLA 3FMCA 4A3IB 7ICLA 4GN4B 1CZWA 1F4IA 5H2FU 1MQ3A 3A46A 1AROP 1F5SA 2RCFA 5L1IA 5IT9E 5CV9A 4KLDA 1HUOA 3GLGE 1RDFA 3RLOA 3TL4X 2EYOA 1K8GA 3UK6A 4QZIA 2NVTH 2H1RA 3R3OA 2JY8A 1XYIA 3K59A 5C3EG 2LH0A 5KQ8A 1PFSA 3O13A 4U6PA 4YCUA 2CFOA 2A3VA 4RCOA 3L2AA 3AMZA 3TWLA 4U673 5GADC 4UB1A 4FCVA 5IILA 1Z4NA 3A42A 1KFDA 1PH3A 1RG6A 2K8AA 2LVOC 2BCRA 3LWLA 1SE4A 5KFMA 3C1FA 4X66M 3T1HQ 3VK7A 3J80c 2PPBC 4A3FB 3ULJA 4ANRA 5EE1A 4YWLA 1RXWA 2ESEA 4LNQA 4B6JA 1EU4A 2GN5A 1XC9A 4QWEA 4I2IA 4DPGA 2Q2HA 1TH2A 1ZV1A 3T53B 3OW2A 4XYOA 1IBLQ 2ENBA 4R65A 2JWSA 4PHAA 4HJ5A 5KNDA 2ZXHA 2R45A 1SIJA 2EAMA 3QEBZ 2JA9A 3M6KA 4AYBG 3B89A 4C3JB 5BOLA 3AU7A 5EWGA 3T5KA 2CWPA 3AV0A 3A98B 2PMZF 1TK0A 2F1MA 2IWHA 1SKRA 3S24A 4GOPB 2K52A 1KD1C 4I8OA 2RSOA 9ICOA 4ZRZA 4J9SA 4AG6A 1N36Q 2GWSA 3HZJA 4PDGA 3SDZA 1A5TA 4R4TA 1NK6A 1ZQZA 2BCSA 3HHZA 3SK5A 3CPWA 1FVIA 2FE8A 2M2LA 1EZ8A 3BBZA 1PK1A 4HN7A 2E2HB 4F5PA 1UQVA 4HIOA 2NRZA 4Z6FA 3MC0B 1NE3A 2UXDQ 5C4XB 4RKBA 2K9DA 3K57A 4KLLA 1ESRA 1DONA 1TWFB 3FM9A 1JOQA 3KP1E 1XNQM 3SEBA 4LW1A 3NPPA 1STYA 1FNWA 2W7PA 1XO0A 5LMUQ 1T3NA 3S1NH 2DZNB 1ZXIA 3C23A 4IFDJ 2GO7A 3PSIA 3KFUG 5BN4A 4GOPC 4GLXA 2CHQA 5KFCA 3TEHB 4DR5Q 5KFSA 5DG7A 1XMQM 3A54A 2EJSA 3SI8A 1D9FA 4LFCM 4QHSA 3I2ZA 4YD2A 2PW5A 4FS2A 1J09A 2MQHA 2F77X 4DSEA 1IXSB 1V34A 5DLFA 5AK3A 2KCTA 3E3XA 3MXGA 5KAIU 1FFVA 4DR6M 2HBJA 1L2FA 1S4ZA 1NNLA 1R4QB 2F0DA 4KLOA 4IBEA 3C5GA 2XZUA 4LF4M 1ZQRA 3M8SA 3NQIA 2W55A 2QGQA 2YTVA 4B3RL 4GKJM 2OOBA 1VQAA 1JX4A 5AI8A 4FF3A 1IN4A 4IPDA 5AKGA 3ICEA 1SFOB 5KFQA 1SNCA 2F0TA 1Y14B 3FAHA 4UB4A 4NSRA 5AIBA 2VB3X 4Y7NH 2YU9B 1Q3LA 2EY5A 1JN3A 3S17H 2Z4HA 2AJQA 1ZQIA 3RJHA 5F3XB 4MF2A 5BN5A 1VQ5A 3HOWG 4G7ZC 5ALRA 3PW4A 3QIAA 5M3FB 4PG3A 2F0NA 1IL2A 1I3QH 4UPAA 1LT4D 1QSSA 3CCMA 4UY8C 4FZMA 3BJUA 2F1IA 3FEWX 1NY5A 5D3IB 4A3CH 3GV8B 4QY7A 5AM5A 1T3TA 1N33L 3OYYA 3D6CA 3K0YA 2XWBB 4K0KM 3KS4A 1BO0A 1STAA 8ICMA 3LQQA 2YNMD 4K4HA 4RT2A 4O3SA 3GTOB 4R66A 4OU7A 3L3FX 2MHVA 2L09A 1JROA 3T4AC 3J80i 2R65A 4DFJA 3KLRA 1JMSA 2E8MA 4B3MM 2V1UA 3Q8LA 7ICTA 3PX4A 3LCVB 3H0GG 4DR3L 2K4PA 3C3EA 1RZTA 4RA8A 1EIHA 1KHIA 4C2MH 3M6ZA 3CNHA 4PZNA 1WD1A 2QHOB 2C2RA 5DNFA 3GRUA 3OJUA 3ZDCA 3S2HH 2EDGA 1YSYA 1D8LA 4LF8M 2EH9A 1S0MA 4DV6M 1KDAA 3A5UA 2VW9A 2VKQA 2O25A 1MU5A 4Q44A 4NXZA 2A1JA 2V1CA 4JI1M 4R3DA 5F3WA 4DV2L 3GZFA 4O0AA 1K83H 3ZQJA 2KNZA 3JAML 1E2VA 2KOBA 4Q5VA 1X42A 2PW7A 5TSSA 3FKIG 4UB8U 3A74A 2NO5A 3C46A 5E79U 1DXMA 2KE7A 3ALRA 4HEDA 1PJSA 3NGDA 5HR7A 1PH2A 2QNJA 2IOHA 4NDXA 5F9LA 1H9SA 1TF0B 5IIOA 4WFN3 1DJRD 2L5TA 1TWAB 1DV0A 4Y2SA 2OM6A 3MR6A 4MFCA 4XBOA 2JA7H 3LVWA 1K8OA 3GTLB 2VQFM 1OUQA 4C4RA 3QAUA 1AEXA 5DYGA 3U6OA 3QU4A 1EY8A 5HY6A 3IFTA 1ZOLA 3MDAA 2HIVA 1OXJA 1HFNA 1V97A 1WCMH 4CGYB 1JXEA 4EYIB 2LFNA 4JI6Q 1BF4A 3CC2A 5LMNW 4F71A 5CWRA 4QIWE 1TH3A 1PVQA 1PTOF 5HHHA 3IRUA 5ELFA 3ZYYX 2GQFA 4DFDA 3B74A 1CKOA 1Q3UA 3TQYA 1WD0A 3PNYA 4J9LA 3I7FA 1V1QA 2BPGA 4HCEA 1CA5A 5IGCA 4OO1I 1ZQCA 2UVWA 1A0IA 1LO5D 3QU5A 2DAKA 1RL2A 3SK4A 4K6DA 3J7ZC 3RAQA 1Z1VA 3UDIA 4C3IH 4AH6A 8ICIA 2O5IC 3NVVA 2UUAL 2R7ZH 1OXXK 1E0BA 3RUZA 3TP6A 1DGBA 2LXEA 4JB3A 5AM3A 1NKEA 4D81A 4K5WA 1K0SA 5CB1A 4FCWA 2EYFA 2G09A 1TAUA 2OQ4A 2P5ZX 4G4OA 3F5EA 2QILA 5KO3A 2OH2A 1P7DA 2FMPA 2FINB 8ICSA 2NWGA 5KT2A 2AGOA 2PQAA 1L0XB 1N33Q 3LYSA 1DM0B 4A93H 3HX0A 3NE5B 3TWKA 1N32L 3WWVA 5HGTA 5KFUA 3TN2A 3WHKA 3UXOA 3DWAA 4BXXG 4DV7L 1QZHA 4RT3A 4LJ9A 1D5ZC 3FRIA 1E1TA 2EYMA 5AK4A 1GVNA 2HMXA 4G7HC 2EZYA 3ILKA 4KHZA 2IBKA 5BR8L 4QHTA 3R2TA 1WCLA 1S77D 4KKUA 3KOYE 3EPGA 2DN8A 4DR3Q 3NK9A 2V4QA 2W11A 3KZIU 3V76A 1LT6D 4DXGA 1ZQWA 3TREA 5CV4A 4BBRH 2NVXH 1CQVA 3JR5A 1FNNA 1HPCA 2NZ1D 2Y20A 3PUXA 7ICUA 3HT3A 1ZKOA 3LWUA 4ZOHC 1STHA 3LNNA 1AIPC 1NZPA 4DV2Q 4C4TA 1Y1VH 3ONNA 2HBMA 4OIJA 4A3LG 3J7AS 1D2NA 3BDOA 3T1HM 2IHMA 4XQJA 2ZM6L 4LUZA 3PX6A 3T38A 1NOMA 2CP8A 1S5LU 4FWDA 4DUZL 9ICWA 1U9LA 3WK4A 2CRXA 1CI3M 3PW0A 3NTIA 1TWHH 2PNRC 2EKFA 1SYEA 1V1PA 3U60B 4C80A 5J2FA 5LMNL 3PIPA 1DGGA 3CCRA 2FLLA 3WKAA 1WI5A 1PUZA 4R8UA 2W3RA 2HVIA 3SHGB 5ALWA 4EEKA 2EXDA 5ALHA 4JI7M 3B7NA 3OHXC 4ZKCB 1K5OA 3SARA 4N8FA 2A19A 1FIQA 2KENA 1X55A 2K5WA 4I2BA 4AI6A 1SV4A 2ZJAA 5EQ0A 2JUJA 8ICRA 3RN2A 5IGFA 4BWJA 1GUGA 2Z4IA 5E4WC 1V9PA 2KVCA 2PZTA 4IR9A 1JJCB 5ELNA 1BR9A 4QNLA 1IXZA 2KHJA 5CMDA 1PTOB 4DQSA 2IY5B 2LY7A 2OXOA 3CD6A 1F0MA 4A3DG 3C1EA 3KSJA 1JQJC 1CM9A 2O4XA 1UWVA 1NJIC 1ZQ9A 4QZCA 4I65A 4A3KH 3G6YA 2G06A 3U6EA 1CHPD 2UXDM 2Z6KA 4IURA 1NK7A 4AG5A 4DA2A 3UJNA 4ITQA 3DWPA 3E4RA 1XNSA 4JBWA 1FNVA 2G07A 2QENA 1ZD4A 1IZ6A 2J4XA 3SVMA 5EKLA 1HTLD 5IYCH 2UUAQ 3HJQA 1K8MA 3HOZB 2G5DA 1HNWM 3A55A 4DWIA 1WWVA 3ZDBA 2KJXA 2VXWA 2XTIA 2L7IA 3ER0A 2FNAA 2JQOA 1L5UA 4YHHL 4O3OA 1FEZA 3KOWE 4JWNA 3VC8A 1GKIA 3D6JA 1SXDA 1VS0A 4PZ8A 1LTAD 4KN7C 1BNPA 2ZUDA 4BXOA 2H3VA 1I6HH 5JRTA 3GTPB 1QYRA 3W1GA 1PTOC 1N62A 4DV7Q 1DCZA 2AUKA 5I9OA 1ONLA 1JMCA 3BZKA 3JC66 1KLNA 1QH9A 2BQRA 1Q3CA 5BR8Q 1YHAA 1B7YB 1IV8A 3ED5A 4MEXA 2HHHM 1YBYA 3CU7A 3FUVA 2UUBM 5I6YA 3U58A 1X3FA 1LT3D 4IC9A 4EEYA 4RAUC 3R8BA 4M9GA 4ECQA 1YHBA 3HS0C 1COKA 1JR3D 2MAXA 3TSSA 5K36G 5D65A 9ICXA 3K6OA 2HOQA 3VCBA 3HG9A 4LF5M 3RH4A 2ZXRA 1UFZA 3RZDB 4LJ8A 2IHNA 2GLEA 2ZM6Q 1TS4A 4PMBA 5KFHA 3DM3A 4IPGA 1R7RA 4DUZQ 5KTQA 2MUTB 2FE9A 2AQ0A 4YCWA 4F4WA 1QSYA 1FO4A 1QG7A 2XGPA 3MABA 2X6GA 1Y69U 4Z9CB 1SBBB 2FJ2A 1QWYA 3KFUA 5LMNQ 3AQQA 4R7GA 2F0KA 4R8NA 4OL7A 2C2EA 4O5EA 4XUSA 4C1NI 3D6WA 2RCNA 1ET6A 8ICBA 1QUQA 4EBDA 3M4QA 1Y88A 1UE1A 2KG5A 1MC8A 2HDMA 4JI8L 4ECRA 1ORYB 5IT9L 2ZANA 5DB9A 3U9OA 1GUSA 4G9BA 1GL7A 2M5ZA 4Q0FA 1A2TA 4DF4A 4P0PA 3SK8A 2VUMH 2F0GA 1PXUA 2IW3A 1OFIA 3UMMA 3HRDD 9ICHA 2F0UA 2R6FA 3SMVA 2JA6G 4I2JA 1ZQDA 4DL2A 4LUVA 5H37D 4ED3A 1D7QA 1UPHA 2K6AA 3MFYA 3CW2C 3QU9A 4H7BA 4OCZA 4DK3C 3OSPA 1BPYA 4F5QA 1F9SA 3C29A 5C44H 2AMCB 2RSNA 1XX8A 4R9WA 4A3DB 2DAMA 1Z19A 1I50B 3UMBA 3I4MG 3HOXB 2CUZA 2JA5G 5M5WH 4Q43A 3MXNA 4IBGA 1GJXA 1HT1E 4UB5A 3U6LA 3AU2A 2ZIUB 3KF8B 4KJOA 2A68C 4YHHQ 4DSJA 1LTID 2PI5A 2KZ3A 1ZQGA 1KLGD 4UW9A 1I94M 5NUCA 4DFMA 2JA8H 2CQAA 5GTHU 2ZUCA 4NXMM 4IBDA 3E9HA 4IJEA 3S14H 2JGAA 2A5HA 4DS5A 5KFNA 2JEAI 1L2DA 4RNNA 1QSLA 1NMGA 4US8A 1OO9B 3M8RA 1ZQQA 1S5DD 1CUKA 1OXSC 4FP5D 3FYHA 2Y0SE 4JI3Q 4ED7A 1EY0A 1EOVA 2K4EA 3QWNA 4B3SM 5FSWA 1IM4A 2XIDA 2DI0A 1SE8A 3K1RB 2WAQE 3RTVA 1N9WA 9ICAA 2AH5A 4BBSH 4W5WA 2EAPA 1XSPA 1RXVA 1BNOA 1BKBA 4Q8EA 4IUUA 4UATA 3L28A 3PUYA 2CWBA 5KG4A 4RF1A 1AFPA 4KY5A 3BDLA 2MROB 4HEOA 3Q8PB 1X3PA 4FO6A 3QU7A 5KG3A 2K05A 5C4JH 2N55A 2LNHC 1BGXT 3RR8A 4GC9A 3QUQA 1QAOA 2RDFA 2B21A 2VB2X 1CKNB 3LQRA 2HCIA 2K0BX 4PT5A 1RYUA 4A3MH 4LF7M 2DPJA 3MXUA 2L55A 1RDPD 2KJ8A 4ZYSA 2ASJA 3RH5A 3SC3A 4O5KA 4CDFC 4NLBA 3AU6A 4G3OA 5A0LA 3D4DA 4G4QA 1WYDA 4EBCA 3D8BA 4DQRA 5JU5A 2DPIA 5ALDA 1L1OB 1GO5A 1LACA 2FMMA 2A69C 4MEYA 2HL7A 3E9IA 1PTOD 2DKLA 1VDDA 3NBHA 2NRWA 4IO9A 3UDXA 1Y1WH 3MVVA 9ICQA 3DLLA 1ML0D 1XXGA 1SL1A 4HL4A 4UQGA 4LGYA 1TWCB 2B39A 2DWMA 2DL0A 1MN3A 3D2QA 1L8OA 2ZT9C 3PMFA 1KXLA 3KDFA 4QQBX 3GLHA 1FYCA 4L6V6 1ENAA 3GRRA 4C8LA 2LVPC 3VDUA 3MA2B 3JPNA 2BJWA 1SXTA 5DDMA 1X9NA 1STEA 1OJLA 2YV5A 3FC4A 3WHLA 2DWQA 3KHHA 2NBFA 4A76A 1EIGA 2OF1A 1U4PA 1YIJA 2ASLA 1L1OC 1ZQOA 3JAMc 1N48A 5IOCA 5CHGA 2Y0SF 2W8LA 2B2UA 4ECYA 1R2YA 1DK2A 1JB3A 1W5TA 2XVSA 3GTGB 3S16B 4F4XA 1NI3A 2MSNA 2HHSA 4DR4M 2WAQF 4GN3B 3GU3A 2HAKA 1HEKA 4O2DA 1MD2D 4F87A 4FYDA 2WB1E 3U61B 4KKTA 1HZBA 1KNEA 1W6JA 2PFOA 3AN1A 3HOYH 3CRXA 3MZ5A 2LBOA 3GIIA 4IOCA 3HKZE 1ZD5A 1XJVA 4DV0Q 1TTEA 5J2BA 1NAPA 4DR1M 1S0VA 2FOIC 1SWVA 2N3SA 4B9VA 3RE8A 1NSFA 4DSFA 1TT2A 2EVBA 4XQQA 3EFXD 4FF4A 3D31A 4EENA 4TRDA 3CQZB 1B0XA 1RJTA 1L7NA 3AQEA 4NW2A 5GAHC 4KLNA 2W8KA 4RQMA 4DQQA 4FFDA 4BWMA 3W3AA 1SL2A 5M3MB 5J3BA 2DAIA 1Z5CA 3K92A 2ZJ8A 1Z00A 4O3RA 3D2SA 4KHPL 1EQRA 3P75A 1HR0M 3I76A 4OJOA 1S97A 1ICWA 4RMFA 3HWTA 1TS2A 2G9DA 1Y8OB 4IBCA 3L9AX 5J22A 1GM5A 2E5LL 2W9CB 2I1QA 3CMEA 4KLSA 3KBGA 5DNYA 4J9QA 4DK6C 1QZEA 4YR2A 4M8AA 2OXPA 2UU9L 1LTBD 4YXMA 3MGHA 2DVWB 2UXCM 4TUWA 3V6KA 1WTOA 2KFNA 4LJ4A 4DNTB 2Z0SA 4A3BB 3EUB2 5T14A 1T5EA 4QOZC 3NTHA 1NR2A 4DCCA 1ESFA 3WDNA 4FBTA 3AYHB 4KO8A 4TUQA 1IKLA 1ENCA 3GQ4A 2QW7A 5KNBA 3GILA 4JXJA 2N49A 5E26A 2AWNA 2OO9A 1RQNA 4IQVA 3H4DA 4DSKA 4CE6A 3FYDA 5J0RA 1SE2A 1GL6A 2XSZA 5GKNA 3HEJA 1PYSB 1S10A 2DUDA 5JAVA 4Y2TA 4ODGA 2BCUA 4F93B 3SHFA 2HQLA 1NTGA 3UXPA 3JPTA 4KD3A 1N34Q 2W9BA 8ICQA 3KLSX 3J81S 5J0WA 4DV3M 4APVA 4KD4A 2XSZD 3R2IA 2WB1F 2DWLA 3M3YB 3I01M 4NLCA 2R8GA 1LTTD 3G71A 1VCIA 2XNAC 3EW9A 1RTNA 4ECWA 4GIBA 3X3NA 4LJXA 3KYHC 1I5FA 1QVFA 3OW7A 4P74A 3TS0A 2BOSA 5AKJA 2KHQA 1IXRC 3PR4A 1TR5A 1WVLA 3WK6A 3DEPA 5HNKA 1FJGL 4DFPA 4TQUS 2WAQB 4QZFA 5G3LF 4NLGA 3N7RC 3HJSA 4BUGA 1QAMA 5AK6A 3HGIA 5DLQE 4M1UB 4J15A 2HQEA 1J9OA 1PH6A 2JA2A 3W68A 3GV3A 2K32A 4ED0A 4NM1A 5IYDH 2FPMA 4AW4A 3GQCA 4ELUA 3NWSA 1GOZA 4X6AH 1BDOA 1MIUA 4A75A 3DZDA 1QVCA 1A77A 1E2ZA 2EJMA 2LKVA 2DWNA 1ZQJA 4FD2A 4OX9M 2B63H 4DR7L 3U6MA 4D80A 1SR3A 3FUUA 4LFBL 2F3IA 1HFGA 2VANA 3BQ1A 2C96A 4LJAA 3QWLA 3ZD9A 2F5QA 2BR0A 1PRTD 4WJ3B 1Z9FA 1IYVA 4JI5L 5KAFU 2QZ4A 2WAQC 3GTQB 2SOBA 3RJKA 3U5ZA 2Z1CA 1QQ5A 2E76C 4WRDA 1XXHA 3GRYA 5FKAC 4N9TA 4JI3M 5JPMC 4JK1A 3EPIA 3VK8A 3HY5A 1NJZA 4QZHA 3H8MA 2ZIVB 5G5HA 1WGLA 3HZXA 4PD2A 4KX5A 2UU9Q 3SMSA 1TDHA 3WOEA 3EN2A 1Q81C 2C9CA 3G6XA 2ZG6A 5GAEC 4Q8FA 3I90A 2XCAA 2KFZA 3V72A 3VKGA 2LPEA 4DF8A 4KLTA 5IGEA 4WORA 3DDHA 4YWMA 5JEAH 4RKLA 3NS1A 1EEFD 3EQLC 4V190 1CQFA 3I4NB 3SAFA 2KSOB 1XPUA 5COYA 1TFRA 3PUVA 1NJFA 1V85A 5AM4A 4AQYL 5K5PA 4JUZA 3AQFA 5KFXA 1HNXQ 3HW8A 3VDPA 1XWEA 2E2DC 2L1BA 3GP1A 3FPUB 5FLMH 4P72A 3IV6A 2WIIB 3K8ZA 4IL6U 4P16A 3EJIA 5M5YB 4DOBA 1SB3C 2FPLA 4YMOA 2D0OA 2F0WA 7ICOA 3K5OA 1SMXA 5D49A 2VA3A 2F4VL 2Q2IA 5ALEA 1XB2B 4NL9A 3T5JA 5C3WA 4KLIA 5HR6A 5HURA 1ZXTA 3PNVA 4QGUA 2ZIWA 4QWAA 5JI3E 1VEKA 2G0AA 1CKMA 2W9AA 1Q1EA 3OGUA 2F3WA 4JI2L 1PJQA 2X8AA 3PGZA 3OPOA 2JZBA 4YR0A 2JA7G 1ZQFA 4JV5L 4BA1I 1FJGQ 9ICEA 3G6EA 2JH1A 1YUBA 5KFIA 3WKBA 2P66A 2WSFF 3RF9A 1WJ7A 3IHPA 1S0NA 4F7XA 1WCMG 3GRVA 5HGQA 5FLXL 5EXTA 4BJQA 4BS9A 4KN4C 3PO2B 4FWGA 5DG8A 1WTWA 2MRLA 1ZQYA 3CF0A 2Y0TA 4DV1Q 3CF5A 4R8IA 1KKXA 3TARA 2WZJA 4Y2RA 5IT9c 3M7DA 2H3QA 2AQ4A 1VQ1A 2GNOA 5T1IA 4J9NA 3BQ2A 1FFUA 4CJ0B 3IAYA 1V8QA 2R8KA 3GLFA 3ONAB 5E7NA 4DR7Q 3IN5A 5BPVA 1PH4A 4LFBQ 3CPFA 4C3IG 1L2BA 4DUYQ 2PI2E 2ZXIA 1WXQA 2R7ZG 4YCXA 3WOFA 2I0QA 2X6LA 1L0YB 4JI5Q 5J0PA 2QB0B 3TS2A 1LTRD 2NVYB 1LVHA 3LVVA 4NV0A 4OEMB 1X9WA 1PVPA 1C20A 1HNZM 3GV7B 5IIIA 4OHJA 3HOVH 1UT5A 1GKHA 3C3LA 2F3NA 5J2JA 1B8AA 1T5XD 1G291 3QOLA 5IWAL 2B2TC 4A93G 1I3QB 4EIWA 2R7FA 3N97B 4DV0M 1V1OA 4JI4L 3GLGA 2VF7A 1CRXA 1IYUA 2NQ8C 2Y9TA 3R8FA 2O5JC 3RRHA 1VJ5A 4UBCA 2ZXOA 3Q23A 2JY7A 1RKNA 2FHTA 1STNA 2KRUA 4GMQA 1IHZA 2DXIA 2XY6A 4RQ3A 1XU4A 3OMGA 3C9PA 2NN6H 1D5MC 4BBRG 3NASA 2KNAA 4A3FH 2R46A 4I28A 4YY3L 3I4OA 4LF6L 2F76X 3V05A 2CVRA 4NRVA 3JAME 1F77A 1ET9A 1NR4A 4AQYQ 4OJLA 3OHBA 2C98A 3FTFA 1UHUA 1MSHA 3MHBA 3QYEA 5ALKA 1Y1VG 2KRKA 3S2HB 1PMRA 3Q8DA 3MEFA 1L7MA 4KTAA 1ZJMA 3DOAA 1PJJA 3LK9A 2QF7A 1SMYC 3N6RA 3A5ZB 4IFDH 1SDFA 2B6GA 1Q39A 4LG2A 4KLQA 4C3JH 4R64A 1ZQXA 2F0JA 4I2HA 1XPRA 2F4VQ 1NNXA 5DDYA 1YE9A 4X65M 3ERQA 2J7ZA 5DM73 1COOA 1Z4OA 5DGAA 2KCMA 1H38A 5CA7A 1X9SA 4J9PA 3JPPA 3FDSA 4NOOB 2ALYB 4ZUJA 3H8WA 1YHQA 2EJFC 2JE6I 4A3JB 4JI2Q 3H40A 3HX3A 4IUVA 1MHWC 1VQBA 3TQSA 1SE3A 1OXUA 4JV5Q 3K5LA 2XGNA 4XGIA 4KX3A 1Z5BA 1H9RA 9ICPA 2KVMA 2B2WC 2E2HH 2OTJA 3GQ3A 3FE3A 2NUCA 2EANA 4C3HB 4F88A 1TWFH 3J2PB 4X3KA 5A2QS 1IFYA 3GDEA 2AQ2B 5ALJA 5EGTA 2AGQA 3TADC 2B3GA 5JI2E 3GLIA 5KG0A 4GLAC 2K01A 3BS1A 3PSPA 4PHPA 8ICAA 2B2VC 4X3SA 4A3KG 1N34M 1CHQD 3BVMA 4X64L 1VQGA 2F0VA 2BQUA 4NXNM 1X3QA 3U60A 1QTMA 4KY6A 4CBVA 3S1MB 5IYCG 1SZPA 2E2JH 1TY0A 2G5IB 4GKKL 3GTKB 4GEWA 1H6UA 3A0JA 4A8EA 1SWWA 4C3IB 5K4LA 2CFMA 1A3VA 4RQ8A 2R7ZB 3WK7A 4WJWA 1I4RA 4AIMA 4KHVA 2R93G 1JORA 5IWAQ 1SFOH 1JB0F 4LGMA 4DS4A 3Q24A 4JI4Q 1G51A 3U6QA 2YU9H 1F44A 1NJGA 3D4WA 3BVGA 4QMGA 3GPXA 2R92B 5JUMA 1XSNA 3CKIB 3F5AA 5ALQA 4NWIA 5M3FH 3T5HA 4BGDA 4DXFA 1Q3VA 4KMUA 5BN3A 3M4OB 4UB2A 7ICPA 2RDJA 3SK6A 2RA4A 1IN6A 1R5LA 3HOUG 1XHBA 3H3VC 4YY3Q 1DOMA 4L16A 2VS1A 1Q90A 1HXYD 4EX6A 3NELA 5EBCA 1NKBA 5DYIA 4PMWA 3RGPA 3AB9A 3L26A 5DBAA 2UUCL 2NVXB 1DOKA 1PK1B 1P16A 1U45A 3K1JA 2RDIA 2H3ZA 5CV6A 2DBYA 5KL1B 1SSOA 2LVNC 3A0HU 3CCJA 4PL1A 1ZEQX 4A3EB 3C2PA 1HT2E 5J2HA 1B4OA 1EY4A 4NC6A 4XQNA 1XMOQ 4CDCC 2HCBA 5DB6A 1BCPF 4P75A 4TUSA 4ULLA 1QNKA 1VMCA 3VR4A 2FH0A 2XEPA 1JB7A 5AI9A 1A0PA 2JP7A 4OO1J 1WR1B 3L3OC 2B8FA 3SV4A 1F2MA 3T1YM 4X5VA 4X62M 3E6ZX 3S2DH 2HHTA 4L6TB 4O3MA 1S9FA 4RH6A 2GVAA 4AKIA 3IG8A 1HNXM 1X6IA 1ZQMA 2EE1A 5C5JA 1Y8NB 1IN7A 3U9SA 2VUMG 5KFEA 1V43A 2IT1A 1ZRMA 1RHPA 2XIWA 5ITRA 4R4IA 3PXGA 4OWWB 4JV2A 1PDQA 3RRGA 3T16A 1R4PB 4R63A 3TBIB 1GUWA 1X2IA 2DKXA 2IA6A 3E0JA 3H09A 3GTLH 4X64Q 1D0KA 1VG5A 1EIFA 4IIWA 1KTKA 5C44G 3OTOQ 2VQEM 1J7KA 2H3FA 1W5SA 4EQPA 1YZ6A 4EX5A 2NB0A 3A8KE 1NK0A 5JTIA 1V38A 3RLNA 2PKEA 4OGQC 4ZH4A 3NUCA 1ZYRD 4TQSA 1XWLA 3C2KA 3M7NA 5L1KA 2K03A 1LM0A 3TP8A 4JG2A 2PYKA 3WK5A 1EYDA 2QEJC 2KIVA 5JJIA 2Q2TA 4LF9M 3RAXA 2JA8G 1WTRA 1IY1A 2L7HA 1XC8A 3L0OA 4CJ2C 4WJ4A 3M4PA 4UB3A 3UE1A 2NRXA 3C58A 2Y1IA 2R93B 4DV1M 3NXWA 3UDFA 4B3TL 5KFDA 2A6ED 4AYBE 3GPPA 1P8LA 4ZAIA 1BPXA 3KSXA 4JI0L 3W5OA 3ND9A 1JR3E 1Q8IA 2CH4W 2YQZA 2L15A 3QZ7A 3UM9A 1N8RC 1CK1A 2N8NA 4LRSA 1IBKM 1SXJD 4LFAL 3L29A 4CF3A 3FTDA 4DUYM 5ALYA 4BBSG 5ELCA 2A1JB 1ASYA 2Y0QA 3KTQA 4II7A 4DEZA 4IJLA 1K1QA 4REZA 5KFZA 3HOUB 3ORYA 3KF8A 1I4PA 2UUCQ 2DF4B 2A1AA 1A76A 1A63A 2F8LA 4B9NA 2KZZA 3TRZA 3ITPA 4DV5M 5KT6A 3DEOA 4B7HA 4XTCS 3THVA 3CF6E 4UASA 2RGOA 3PQIA 2BE5D 3MHVC 1Y8GA 2L0CA 1H9SB 2JR5A 1MJGM 1PM5A 1IBML 4P73A 3SV3A 4QNRA 1HUNA 3BQTA 2N88A 4QZBA 4GRIA 4DR2M 4PH5A 1T43A 1BUVT 4A3MG 5IE8A 4RKUF 4O3PA 8ICPA 4YR3A 2QQ8A 1J5EL 1BCPB 2ZAMA 5J1ZA 2GVBA 4YG2A 5AJ3L 2V1CC 3EROA 8ICNA 3PZPA 1JOKA 3AFPA 2YMPA 3ULLA 4IUNA 4F3OA 2M60A 2UVRA 5DBCA 4FVMA 3V7KA 3GTMB 3OPXA 4JC0A 3L7ZC 3U4ZA 4MGZE 1RCVD 1GHJA 3RB3A 1Y1WG 3I4YA 3KLWA 4P0QA 1HQMC 3CF2A 2V6ZM 4GXIA 5EAYA 1VDVA 2KD1A 2VUMB 3BU2A 1Y8PB 1HQCA 1SJED 3ETRA 5FJ8H 1B1ZA 1AZPA 4IRKA 3NVYA 1K82A 5EPKA 1FL0A 2R61A 2OYYA 3T15A 4I7AA 1BCPC 4RGNA 2F0HA 2LHGA 3I28A 4U7CA 1SNDA 1H95A 3V7LA 1KQQA 3HU3A 3LWEA 3IM1A 1E22A 3BDCA 2PQAB 3OIPA 5AKYA 1PV4A 2XFSA 4R1JA 5EXXA 1ZD2P 2DHRA 5M5WB 1PTOH 4AYBF 2CHBD 2KQ3A 4CJ6A 2NVQB 1DZ1A 1X9MA 3T51B 4KLJA 5DQHA 1SNOA 5J29A 4GIPA 3K5NA 3RR7A 5C0XJ 1PHJA 4ID6A 1DGFA 1YLAA 5CV7A 5FO9B 3VLFB 1T4GA 1KRSA 4LAAA 4B3TQ 5ALUA 4JMUA 3HOZH 4OJ5A 2JA8B 5KT3A 2HBKA 4KLHA 3S14B 4ECSA 4CNQA 4JYAL 2CV2A 4JI0Q 1M6YA 1ZQLA 1OTRA 2WKCA 5I2YA 4BY1B 2C2DA 5ELOA 2JNHA 2QP9X 3DXJC 3U6DA 1VQJA 3CP0A 3GDXA 4LFAQ 4Q45A 2BWEA 1FGBD 1QZGA 3GTPH 4FBUA 1I4GA 2D62A 5J0QA 1JWMD 4JOIA 1MBYA 4F2LA 3NSWA 5FLXc 4NSOB 3PF4A 1NMFA 4BBSB 5FO7B 4M0WA 5C0YA 1XS9D 2SNSA 4XA5A 1TIID 4ECUA 5AICA 1NJXA 3KFUF 3NBXX 2VA8A 1BBUA 1O03A 4RHSA 3NVZA 2PZWA 5D46A 1C7YA 1IBMQ 4DF7A 4X66L 1QB5D 4R8UB 4E6IA 4QJFA 1KDCA 4CIZA 4NB3A 3BYYB 2F1HA 3H7IA 3OSNA 1YEZA 3W0FA 4BB9A 1SL0A 3VR5A 3GV5B 1HTPA 3Q8MA 1HHVA 2I07B 1PZJD 3RZDH 5AJ3Q 5KIXA 4IBBA 2KEEA 1JE4A 4F50A 4OWTB 4NKLA 3FTCA 4TSSA 2OQ0A 1U5KA 3BJYA 3HHWA 1KDBA 4L5TA 1FGUA 4RF0A 1X3EA 1WTHA 2K75A 4UAVA 2EA0A 5D4BA 1WUDA 1CTMA 3OMCA 3NBIA 3CXCA 1XWIA 3CRLC 5C3EB 2BCVA 4DL6A 5DBBA 4NLZA 1S5CD 1KAAA 5IGGA 2R62A 5AKEA 2R7DA 4IBIA 1WTVA 5DG9A 1RF2D 2LM1A 4PCZA 2F0IA 1D2BA 3GTJH 1IIPA 1LTMA 1Y1WB 1NVMA 5CJ7A 3L5KA 3I73A 4K6LA 3F2CA 3G4SA 1UAPA 2ASBA 3VYSA 3PIP3 1LABA 1XMOM 1QE6A 1SYCA 4MFFA 4NLNA 2UXBM 2B2YA 5TISU 2E8GA 8ICFA 2G3QA 5EPJA 5IY0A 1JC7A 8ICUA 1NNUC 3Q8SB 1XNQL 3L2PA 4BXOB 2A6HC 2EYJA 1BVSA 1N75A 2D3DA 4C4SA 1MN8A 2R4JA 2K33A 5FP0A 4DQIA 2ZXPA 4G4RA 2KZMA 1CEZA 4AYBB 2A5YB 4RQ7A 7ICRA 4MGKE 3N7PD 4QW9A 4MHEA 1XMQL 1UNSA 1NBWA 2Q8IB 1RM6C 4LFCL 2HCFA 3K4GA 5CP2A 1I50H 3KBBA 1XO1A 4YN4A 3HOXH 5KPTA 4NL4H 1G6ZA 3PCOB 4F5OA 4JYAQ 3VA7A 1QCBD 1XTDA 1YNND 4DAYA 5LHY1 4DR6L 1T8EA 1Q86C 1U4MA 5IYDG 3NRWA 4LF4L 3FPPA 3OTOM 2WHEA 1Z6TA 5KFVA 4DO9A 1ICFB 4GKJL 3B0YA 2SNMA 3BYTB 2N78A 5EE9A 1E32A 2J0TD 3SASA 2WFAA 3H3VI 1IM2A 1Q02A 2F0LA 3T79A 3PUZA 2B63G 3KF6A 4AYBC 2IOFK 4RCNA 2KDLA 5J8YA 3AMUA 1TV9A 2KHIA 2WSEF 1EZ6A 4XXEA 4ACOA 3I1YA 4ZPXA 4RFBA 9ICMA 1EY6A 8ICCA 9ICFA 3KOJA 4KJNA 4X66Q 1DD2A 1NSNS 2G9HD 4CDEC 1BCPD 5KT4A 3D2NA 1QUQB 4K0KL 3EA6A 4B9UA 3OHAA 4C8OA 4QL5A 5CV5A 3EWAA 1IY0A 4B3RQ 2NZOA 8ICEA 1VQ7A 3GQBA 1VMPA 4DV4M 4IR1A 5K36H 2HOIA 5J0SA 1XNRM 2JY5A 3SATA 2H3IA 7ICHA 4P0PB 1ZQNA 1TVAA 2YN4A 1IW7C 4B3ML 5AKLA 4N8X1 2CV1A 4K4GA 4F2SA 3GV6A 1QILA 2RRUA 2EY6A 3ISCA 1AW7A 2AWOA 3VKHA 4NLKA 1ZMUA 4PZ7A 5JEAG 4LF8L 4DV6L 1C8CA 2LYAA 1CFMA 4MNOA 1HZ9A 4OD0A 2WKDA 3F2DA 1VQ8A 1U9RA 2NTTA 5IYBH 5KFBA 1PA6A 4M04A 3HOWB 4JI1L 3TACB 1PH7A 1JWUD 1B2TA 4QZ8A 3BVZA 4I2EA 2L4EA 3MXNB 5FLMG 3GQ5A 1V92A 3LWMA 4POFA 3QR8A 4YVZA 3N4MB 5E3FA 2ZTDA 5AKXA 4J8QA 1S3OA 1E9RA 9ICGA 3G7LA 2QKQA 2D6FC 3UE0A 3V96A 2R8JA 5AFWA 3H0RB 5GROA 1SRUA 3J7AF 2RDHA 1XNQQ 4RUAA 8ICTA 4MM3B 4GNXB 1TWCH 1HQYE 1SXEA 1VQOA 4M0AA 1IKMA 1ASZA 3PO3H 2K4IA 3H0GB 3M4YA 2VQFL 4M9ZA 1G71A 1XMQQ 5FK9C 4LFCQ 1NK4A 2LHTA 3GO5A 2J6UA 1KFVA 3J7AV 2R8HA 1OW5A 1NY4A 3OJSA 1RYRA 5IIFA 1EWHA 4KY7A 1ZYQA 5KFGA 2HHVA 1ZQHA 3AFHA 2ERCA 4PGYA 5AM1A 1D0LA 3W2DA 1PRBA 2FMCA 1GLNA 1TXYA 1DGSA 3C28A 3HWSA 4LF4Q 2CWAA 2JEGA 1YNJD 2KHVA 1U0LA 1IBLM 3FKIB 4GKJQ 3L27A 3CCVA 2CCZA 1Q82C 1TK5A 4MF8A 3GTGH 1PH9A 3S16H 1X9XA 4Y2YA 5E1FA 1WJJA 3QX7A 3RZOB 4I2FA 1C1KA 4GNXC 1JJ2A 1VQNA 2CE7A 3H4JA 3C21A 4JBMA 4KLEA 3QG1A 4JCVE 3RN5A 2O2LD 2E75C 3UQ0A 3KOXE 3QYPA 1VQ9A 1U47A 4BWGB 3JAMS 2ZTEA 2XN9C 2DUYA 2L4FA 2HHUA 2EJGC 3I04M 1DGJA 3SHLA 5D14A 1YJNA 3LDAA 2B63B 1KSFX 5IIMA 1N36M 4OONA 3QUCA 2DGZA 3BZCA 1O80A 5I6WA 4RPZA 1VQKA 1C48A 1TWGB 2YYZA 3UZUA 3SMPA 1BQQT 4RGMA 3J7YW 3HOVG 3UGJA 4K0KQ 5AM2A 4JW0A 3RGSA 5J2CA 3CQZH 4AP9A 3SYLA 1MJCA 5CEHA 1HA6A 1RQLA 3P7JA 2A6HD