2ZTCA

Mtruva form ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
188
Chain Sequence
GRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 44
structure length 188
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztcA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztcA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztcA01
3ZDAA 2PNHA 5J3BA 4LF8L 5C0XI 3FE3A 4DR6Q 1JT8A 1SMXA 3GILA 3SI8A 3RR8A 4DF4A 4BBRH 1XNQQ 5CB1A 5IIMA 4DR5Q 1HR0W 5C5JA 3CC2A 2NVYH 1ZV1A 1WCNA 4ED2A 1H38A 3JAMc 3BQ1A 3RNUA 4LF7L 4JI3Q 3GTLH 1HT2E 7ICUA 4NXNQ 3U4VA 3PIPA 4NB3A 2HIVA 1SKRA 1SL1A 1VQOA 4IPCA 1ZQGA 1Q12A 1ZMVA 3AQQA 5KFHA 1V1QA 1ZQXA 5HP4A 3I4NG 4YHHL 2DAMA 4G3IA 3T6PA 2C2EA 2UVRA 2FMQA 1VQHA 4DR3L 1T6OA 3CCLA 5LMUL 1VQMA 1AH9A 1COOA 2ZUDA 4RPYA 5IP9H 4J9PA 4DL5A 4YCVA 1HNZL 2EQSA 1W2BA 1XPUA 1JXEA 4A3MG 3CAMA 4MNOA 4A93H 3W5OA 4QZBA 4O3OA 1PH6A 1TXYA 5CA7A 1IM2A 1VG5A 4KLTA 3K7UC 2E2HH 1PH7A 3MXNB 3H4BA 1E1OA 1T3NA 2Y1IA 4GLVB 4C8MA 1D8YA 1ASYA 3RH5A 3GQCA 4O3QA 1JJCB 4Q45A 1QLNA 4PZ8A 3OGUA 2FPMA 1S0VA 4IJLA 4M9LA 3ZD8A 3PX0A 1ZQLA 1PH5A 1VQ6A 4RUAA 3HKZG 4B3SL 4DV6L 2HIXA 2JA5H 2OTLA 5FLMH 2JA8G 3KYHC 5J2EA 2XTIA 5HNKA 2XC9A 4M0AA 2OQKA 4A3EH 3KHGA 5BOLA 3RB0A 3H8JA 1N9WA 2UUAQ 1KYIA 1V9PA 5DDMA 4DOBA 3A5UA 5J2KA 1Q81C 5BR8Q 4JCVE 5DBAA 2NRZA 5J2DA 1YJWA 3PGZA 1B8AA 1JMCA 4A3LG 3V7KA 5DBCA 2ISOA 4DR2Q 4DLEA 2BR0A 3HOWG 4QZDA 4X65Q 5D49A 5J2HA 4UBBA 3K7AH 3GTJH 2BH2A 2W9AA 3UQ2A 2I1QA 1QZGA 4I2IA 1WHCA 3UDFA 2B3TA 3UE1A 2JEAI 5DDYA 2VA3A 4GNXA 3B0YA 1NTGA 2JQOA 5KTQA 4NXMQ 2JA9A 9ICJA 1G4AE 3TREA 5DBBA 3MR3A 3UDXA 1CSQA 4F5QA 3C21A 1S40A 4R8UB 1Y88A 1IM4A 1X9MA 4XRHA 4ECQA 1ZQVA 5KFNA 1XSNA 4DR7Q 2IBKA 4Z6DA 8ICVA 1ZJNA 3T1HL 4GS3A 4POFA 3G4SA 1VQNA 3JC66 2NVTH 1WIVA 8ICZA 7ICNA 5DGAA 4DFKA 3GV7B 3LK9A 5IWAL 1YHQA 1TV9A 3DM3A 4L5QA 3SV3A 3AU2A 2W9BB 4YQWA 4P73A 3AYHB 5DLFA 3GTPH 5BOMA 2N49A 3I4MG 4YHHQ 3GDEA 4GN5A 5KFPA 3NTUA 5KFUA 4DS5A 2WP8J 2FMSA 3K4GA 5M3FH 9ICRA 5J2AA 3ER0A 3H3VH 2GWSA 7ICEA 2KZZA 3N97B 8ICCA 2R6GA 4LUVA 1GD7A 1Z3EB 4ECRA 4TQUS 1N34Q 1A76A 5CWRA 3EWAA 1PVOA 3KLWA 1EWIA 3NENA 1CKMA 3HOYH 2BCVA 1D9FA 5KFXA 2FMPA 4YWLA 3CCMA 1Z00B 1SL0A 4C3JH 5DKWA 3MDCA 4X65L 1K1SA 3NGDA 2IMWP 3MR5A 3PO3H 1RXWA 2VA8A 1L3VA 4K4IA 3GTOH 4DQRA 1ZQCA 1KDHA 8ICUA 2IT1A 2WB1G 4IPGA 1JN3A 1NOMA 3KDFA 4B9TA 1MQ2A 4P4OA 4UBCA 1A5TA 4LF5Q 2I5MX 3Q8SB 1KRSA 2HVIA 5IYBH 2JA5G 4DQSA 2R0IA 1S3OA 4K0KL 4BY7G 2QNJA 4J9SA 1YJNA 3TARA 3HOZH 3K80C 2CCZA 4OX9Q 4RNOA 4PGQA 3CMEA 2HAKA 5IYDG 5HMMA 4P4MA 1N32L 1X56A 3ULLA 4YMNA 3U4ZA 1XS9D 4DSLA 3CCQA 4QQBX 1LM0A 1N8RC 1VS0A 3Q8QB 1OTCA 4BBSG 4IRCA 4B9LA 4DSKA 2K50A 2HHVA 3UDGA 4DUYQ 1KRTA 5GAHC 3H3VI 5DQHA 4NXML 1TWAH 2VS1A 3BJYA 4DV7L 2JP7A 1VQGA 5KT7A 2W8LA 3H8SA 1NKEA 3BDPA 5GADC 3PX4A 1I94Q 4RQ3A 4TVAB 4DV4L 4GLAC 1PH2A 7ICKA 4DLGA 2WAQG 5IP9G 1VQ9A 2UXDQ 1AROP 1S0NA 3F2DA 5L1JA 1V43A 4PH5A 4MF8A 4KLLA 4ECWA 1NJXA 2K9DA 3G6XA 4RQ6A 7ICIA 1TR8A 1E24A 4DR1Q 9ICHA 2HHHL 2R7DA 1VQJA 1XNQL 5KFVA 2DAKA 1ZQKA 3M9BA 4O2DA 2VQEQ 5BPCA 4FS2A 3AFPA 4YN4A 3S1MH 3E9HA 2JZ0A 1ZQFA 4UB5A 1DO2A 4BY1G 2VQFL 4IR1A 1KAWA 1J5EL 3OHBA 3GLGE 3T1HQ 3RTVA 4M2YA 8ICGA 4I27A 4Q8EA 5KFBA 4DUYL 1PFSA 1IBMQ 1K73C 1XO1A 2IHNA 2YV5A 4J9NA 3M8RA 4YR2A 4YMMA 3M4QA 1QZHA 2IY5B 2L4FA 4Y52H 2R92H 1BPZA 1NMFA 1ZETA 2AMCB 2D0OA 3J80c 2ES2A 2WAQE 4NY8A 3HOYG 4YR0A 9ICGA 1OXXK 1ZQZA 2DPJA 5M3MH 3W1GA 1EIYB 5KG0A 2MUTB 1V92A 3BZCA 4F5NA 1XSPA 4YD2A 3FDSA 4DV0L 2AWNA 3T5JA 1HUOA 3HPOA 4JI1L 4LF6L 3HOVG 1E3PA 2ATLA 1QVGA 1LYLA 1LTLA 2JY7A 1T9HA 4GNXC 3PX6A 2K5NA 3UQ0A 4HJ7A 5ELNA 4LF9L 3GD7A 4ECVA 5C0XJ 4DAYB 1LB2B 2R7FA 3BQTA 1ZQSA 9ICAA 4F92B 3K81C 1HR0L 5IIIA 1Q02A 4KHPQ 2MJ5B 1QUQB 4JI0Q 3TS0A 2I5LX 4DR4L 4DPGA 4B9NA 4XA5A 1RIPA 1HNXQ 2F4VQ 3RJHA 8ICPA 5IP7H 4KITB 2UU9L 4I2CA 4BWMA 4P74A 3AFQA 3H0GH 2VUMH 9ICTA 4BXOA 2BGWA 4X62L 4IFDJ 1VCIA 3STBC 3AU6A 3RBEA 3JAMi 2NVQH 5KFDA 3TRZA 4DV2L 4RQ5A 3TI0A 4WJ3M 1KD1C 4EYIB 3MFIA 5IYCG 4L5TA 3OJUA 1ZQMA 1PZNA 1ZQWA 2ZM6L 2V4RA 4P71A 4LFAL 1HZAA 4RQ7A 3AEVA 4DSFA 5KFJA 5DG9A 2FLNA 1NK6A 3L7ZC 4QZ8A 4ED3A 4F5PA 1VQ7A 4DR7L 4YP3A 1ZQJA 4C8KA 2VQEL 1SZPA 4MEXA 3Q8RB 1UE5A 3RRGA 4R4CA 1JMSA 3HOXG 3Q8DA 2ASDA 3KTQA 2JA7G 3PMNA 4BGDA 4F4ZA 4TURA 1XU4A 4BDPA 1ZQIA 4ECUA 3TS2A 1A8VA 3RBDA 2JK8A 4IFDI 1VQ5A 1E94E 1RPLA 1SKWA 2BCQA 4O3RA 1Q8KA 1S97A 1I6HH 2K52A 3JPSA 1OAIA 4R71A 4QWAA 4R65A 2L4EA 3GV5B 1S76D 3ZDEA 1KFDA 9ICPA 3G6EA 1AE3A 1X54A 1PHJA 2R8JA 1ZQNA 1NY4A 4ED7A 1ZQPA 4HJAA 1I3QH 3T5KA 4GC7A 3KF6A 4QZ9A 1N36Q 1ZQTA 2UXDL 3CQZH 2QGQA 2AGOA 3H8WA 1QTMA 4OWWB 2I9GA 2FXQA 4MEYA 4LFCQ 5IINA 4X66L 4YWMA 3IRBA 2HW3A 1IBML 4JWMA 2JEIA 3RH4A 4DV7Q 3T5HA 3GTKH 1S72A 1EQRA 3GLIE 4QZGA 2JEJA 3OSPA 4ED0A 2HVHA 4Q44A 2B21A 1HUZA 4YY3L 5KFMA 2Y1JA 4YXJA 3BU2A 5C3EG 2JJQA 4YCWA 2ZJ8A 4DV0Q 2MR9A 2OTJA 1SN8A 4GOPB 3RAQA 1QVFA 2R93G 1C0AA 5KFWA 4MZ9A 1NK5A 2NZHA 2R8IA 4JC0A 4AYBG 7ICLA 1K9MC 2LYHA 4ELTA 3K0XA 3J7ZC 4A3DH 1RL2A 4M6WB 4M9GA 4X62Q 1KFSA 5C3EH 2JEBI 4F8RA 2BQUA 4GKJL 4QZAA 2KENA 4IPHA 4JI4L 2WZJA 5EOZA 2KCTA 3FYHA 3TANA 2OCEA 4A3MH 3ZDDA 4QJFA 2HHWA 2DPIA 1D8LA 4YCXA 4DO9A 1ZQQA 2ZUBA 1NBWA 4F4KA 4IFDG 4J9RA 5HY6A 5LMUQ 4PPXA 1OXTA 4EBEA 2UVWA 4R4QA 2KZMA 4KLKA 5M5XH 1RXVA 4UN2B 4DFMA 4AIMA 1HNXL 1Q1EA 1L0WA 1QSLA 3H40A 2E8GA 2ZTEA 4HJ9A 2UXCL 2JY5A 2PXIA 1D7QA 4DUZL 1EOVA 5FLXc 5EAYA 5DG7A 2J6SA 1TK8A 2PFQA 1QVCA 3CXCA 2Y0SG 4ALPA 5DB8A 1XSLA 1WGLA 3GTMH 4M9NA 3D31A 2LVQD 2IHMA 3WWVA 4GOPC 8ICMA 4F2SA 3TFSA 2LVPC 1A62A 5KG4A 2JEFA 1U5KA 2QSFX 1SRUA 2Z0SA 3C2KA 4QZEA 4OO1I 3G6YA 3GFKB 1VQFA 4LFAQ 5J0PA 8ICRA 3RJIA 4F1IA 2KTQA 4PG3A 4PHPA 8ICKA 3ULJA 4DR5L 4I2DA 3C23A 4B3SQ 1RYRA 1B7YB 3H15A 3RJGA 4RUCA 1ZJMA 4LZDA 4BWJA 4Q43A 4R66A 4YD1A 3H4JA 1SKSA 4BXXG 4POGA 3V7LA 1VQEA 4I29A 3E46A 4IOCA 2HWJA 4M6WA 2EIFA 1X9WA 4LW1A 2ZTCA 2CWPA 2ID0A 4I2AA 1N48A 7ICHA 1R9TH 1VQDA 2V9WA 1X9SA 4EZ6A 1J6QA 2CFMA 5GAGC 4EZ9A 3K9PA 3UXNA 3C5FA 3CF5A 1MJEA 4JV5Q 1VQ8A 4IRKA 3M4OH 4UB4A 3JPRA 4JI8Q 4YMOA 4J9KA 4RT2A 1XNRQ 5JI2E 3UXOA 1VQAA 3I2ZA 5KFLA 1WCLA 4F91B 1A0IA 4X6AH 3FKIG 1P8LA 3AUOA 4KLEA 5CJ7A 4LF9Q 1EYGA 4KLOA 4C2MH 4LZGA 4QW9A 2C22A 3BBZA 9ICFA 4J15A 2YTVA 2JY6B 2Q2TA 4UPAA 4PZ7A 4UB3A 8ICTA 1JXLA 4MTNA 2CQOA 4BXXH 1PGYA 2JNHA 3RR7A 1L1OB 4HJ8A 3V7JA 4DNIA 3SV4A 1WCMH 4EYHB 4HIMA 3RZOH 3F2BA 3B6YA 4KN7A 1E22A 1JIHA 5KFSA 4TUPA 4QZHA 4A3GH 1L2FA 3OJSA 3BQ2A 4RQ2A 2A8VA 1BPDA 3LWLA 4AQYL 4B3ML 1MIUA 4DOCA 4PGXA 3MGHA 4ED6A 4K0KQ 4TUSA 3PW7A 2XY5A 1IYJB 4OXPA 3E21A 1IL2A 3MEFA 5HHIA 2RDIA 2A1JA 4DV3L 1JR3E 4ELVA 1DGSA 4ELUA 3J80i 3JPPA 2BCSA 1E7ZA 3DLLA 5J0UA 5L1IA 4RNNA 3PO2G 9ICQA 2CKZB 2UUAL 1Y1VG 5DB7A 1TK0A 1X3EA 5L9XA 4LWCA 3MDAA 2JE6I 3RLOA 4QZCA 1L3SA 4KHZA 3RR5A 1S77D 4KLMA 2ISPA 2P66A 4A3EG 1X9NA 1N34L 1QSSA 3GTGH 2C35B 2UUCQ 1WI5A 3T3FA 2G3QA 3SZ2A 2B63G 2R7ZH 1SR3A 5FJ8G 4XIGS 2V1CC 1ZQRA 4O5EA 5DLQE 9ICLA 3F2CA 3MFHA 3GTQH 3RJEA 1NK7A 1NKCA 5DQGA 1BPBA 1WR1B 5M3MG 2BPFA 3Q8PB 1Z00A 1T7PA 5KT3A 1Q86C 4R4IA 4NXZA 2A1JB 4KLIA 4NM2A 4FS1A 1BPEA 4PHAA 4GKKQ 3PF4A 1TKDA 1QUQA 2HHUA 1IXSA 1YIJA 1N32Q 3SYZA 4JUZA 2R93H 4J9LA 3S16H 2AKWB 5J0TA 9ICXA 4EX5A 1WOCA 1TTEA 4RQ4A 1XMQL 5D46A 2KN7A 1SLJA 2J6UA 5JJIA 3QZ7A 2PFOA 4K4HA 3I56A 3HT3A 2ZM6Q 1BPXA 2BWBA 1X2IA 2MAXA 4ECYA 2J6TA 1FL0A 4PMWA 4LF4Q 2Q2HA 1EFWA 4JV5L 2IA6A 5EWEA 2L15A 3E2EA 3GIIA 3RN5A 4B3TQ 1YI2A 4RZRA 2DI0A 2PMZE 3C2MA 4UP8A 4C3IH 2PI4A 5M5YH 2HHXA 4A3GG 2AWOA 4F4YA 7ICMA 3TFRA 1N36L 2EKFA 2IX1A 4RPZA 4C3HH 5J0WA 3VDYA 2CWBA 2HHTA 1Z47A 1WCMG 4DAMA 1TAUA 2PI2E 2C2DA 2F3IA 1KQSA 5HMLA 4NLNA 4YCUA 4JI3L 4DV6Q 3ZD9A 1E1TA 5KFTA 2XGQA 3PV8A 3V6JA 4LNQA 5CHGA 2E5LL 2OQ0A 1DV0A 5KG2A 1UA1A 4BY7H 3ZDBA 3M7NA 2QHOB 4RQ1A 4ECXA 1QZEA 5J0YA 4ED1A 4B9VA 2Z6KC 4QY7A 3L2PA 3FHWA 3FKIH 2Q0ZX 3SGIA 1EUJA 3HWTA 4ECTA 3T1YQ 5IIOA 3I7FA 3JPOA 5J2CA 3S1QH 2AJQA 3NELA 5HGQA 5IYDH 1K8AC 2RHQB 3GIMA 5JUMA 1RYSA 4R63A 5DGBA 1JB7A 2BKEA 4LUZA 4KN4A 3NEMA 2NRWA 1J5EQ 3K9OA 3GV8B 3Q8KA 3KHRA 1N33L 1KC8C 4RNMA 5E7NA 5IYBG 2I0QA 3A0JA 4DV3Q 7ICQA 3HOUG 3C1YA 1S0MA 2UUCL 3UXPA 5KG3A 2WB1E 2UXBQ 2K5VA 1XB2B 4IQVA 4R64A 2UXCQ 3RJKA 4JI5Q 1HNZQ 3PY8A 4B3RL 1NK4A 3U50C 5M3FG 1UA0A 4YG2A 9ICOA 9ICNA 4A3KG 1CEZA 1GM5A 1BBUA 3J81j 4B3TL 3KFUA 4TUQA 5L1LA 4ME3A 1I5FA 4M9JA 1XMOQ 4GKKL 4UAZA 2NRXA 3OYYA 5J2BA 2YTXA 1PV4A 2XGPA 2DHYA 1DOQA 3M9OB 4X64L 4B9MA 3ISBA 1U49A 5LMNL 2BHNA 4KLQA 1SROA 7ICGA 3C2LA 3M9NB 3QEBZ 4GN3B 1XWLA 3L0OA 3PV0A 4QL5A 4A76A 4MF2A 4C8NA 2CWAA 1ZYQA 1S0OA 3TAQA 3PR4A 1K3RA 1KRPA 1L1OA 4QWBA 1S10A 4O0AA 2NRTA 2DNAA 3M85A 3JPTA 4HEOA 1I50H 1PYSB 3TQ1A 3HOUH 3V6KA 4NPSA 3EIVA 1OTRA 2PQAB 3H4DA 5FLMG 2KFZA 5KG1A 3JPNA 1WJ7A 5C4XG 1TWFH 4A3FG 5J0XA 2EXDA 3BQ0A 1YLAA 4B3MQ 2BA0A 2LXJA 4YVZA 1CKNA 4A3IG 4R4TA 7ICSA 4YR3A 2P6RA 3PR5B 1GKHA 4DSIA 2KNVA 1UT5A 2AGPA 4DUZQ 3E9IA 4DV2Q 4DSJA 1IFYA 1AIPC 5JEAG 4YXMA 1UE7A 4LF5L 3PUXA 4O3NA 3UDIA 8ICWA 1HR0Q 1ZQAA 3PUVA 2JEGA 1HQYE 1OXSC 1Y1WG 3G48A 2IX0A 1PH8A 5EWGA 1U45A 2B3GA 5DFLA 4JOIA 3HOWH 4NM1A 2AGQA 2GVAA 2KNAA 1PH9A 4A3CG 2MNAA 4LFBL 4Z6FA 1CSPA 2LVAA 4JOIC 5J0SA 3IHPA 9ICEA 3ISDA 4F4WA 1EXNA 3PW5A 1EIFA 1IBKL 4PGYA 4AH6A 1VQ1A 4A93G 1G51A 3LGJA 4M04A 4P4PA 3HW8A 2M9NA 1NE3A 1G41A 4JI8L 3JPQA 1F4IA 2Z6KA 1N33Q 3ERSX 1Q82C 1FVIA 1TAQA 2ASLA 5KT6A 1VQ4A 5J2IA 2PFPA 2BPGA 8ICJA 2PFNA 5GAEC 1FGUA 8ICIA 5C0XG 1BGXT 5H1SE 2RHSB 3IHQB 4JG2A 4NLZA 1XPOA 4HIDA 1XC9A 5LMNQ 1EQQA 1UWVA 7ICVA 2R8GA 4KLHA 4FBUA 4O5KA 1X65A 4RMFA 5IY0A 1ASZA 3MGIA 3HOXH 7ICTA 3CP0A 5KFRA 3TAPA 2C28A 1ZQEA 1KIXA 1X3GA 2N3SA 1Q1BA 2VQFQ 1WGNA 2L2DA 4DR6L 1L1OC 1G291 5AJ3Q 4A3IH 4DOAA 1VQCA 2YYZA 8ICSA 2RDJA 4JI7L 3CC7A 3S1RH 4RPXA 1YJ9A 1U9LA 5KFOA 1HZ9A 3PSIA 2E5LQ 4JBWA 4C8LA 3MBYA 2HHQA 5ELOA 4A3FH 1JJGA 2YU9H 3UE0A 3OSNA 3CC4A 4DF8A 5KFAA 3ORYA 5KFIA 4JI2L 1UE1A 1HNWQ 1SFOH 4BBRG 4F93B 4QZFA 3V6HA 4GOPA 1XXHE 4O0IA 4LUOA 4FO6A 1TK5A 4TQSA 4B3RQ 2BDPA 3T5LA 1AE2A 2NZOA 3ZJYC 2VANA 2DAIA 4X5VA 2LVNC 5KT2A 2MFIA 3F8TA 3PUZA 5DLGA 2DFLA 4JYAL 1ZQYA 3U58A 3CCJA 1O7IA 4HIKA 5F9LA 1PH1A 3M3YH 4GXJA 1SG9A 3EZ5A 4P72A 2PI5A 3I4MH 4DL4A 2MUTA 2K4KA 4ECZA 3S24A 3KF6B 4L5RC 2DGYA 1Y8GA 3IM1A 1BKBA 1K0RA 4B9UA 5GROA 3FRIA 4I28A 4O9MA 3UPQA 5KT4A 4JV1A 4QGUA 2HHHQ 2OOAA 4DFJA 2BPCA 3KJPA 5JJKA 4OX9L 1R4GA 3EBEA 3CCSA 4M47A 5DQIA 3F1ZA 4OONA 2UUBQ 4DR3Q 1KEJA 1VQIA 1UEBA 9ICMA 2OO9A 2NRVA 2NN6I 3ETLA 1T8EA 5C44H 3RAXA 3MABA 3RB3A 1ZQBA 1HH2P 2W9MA 1TWHH 3CCRA 2RCNA 1CKNB 2ASJA 3B0XA 1ZQHA 4APVA 1G6PA 2ZUCA 5IIJA 3K8AA 2E2JH 1H95A 2BQRA 4O3SA 1NKBA 9ICSA 4C8OA 4Z6CA 2BA1A 4JYAQ 4EEYA 2F52A 2PQAA 5HHHA 2V4QA 4A3LH 1MJCA 4DWIA 1U47A 2UXBL 4KLFA 5J0OA 3PNCA 4YWKA 2MO1A 5DG8A 4J9MA 1NJYA 5IILA 4DFPA 1BBWA 4X66Q 1PYBA 3KHLA 3RN2A 3HKZE 3LDAA 2BCRA 1YHBA 3QZ8A 1VQPA 8ICHA 2A19A 8ICYA 4DK6C 2R8HA 1KSPA 4IQUA 5M5WH 4JI5L 2JA8H 8ICXA 8ICAA 3D0FA 3ICEA 5J0QA 5IIKA 4LFBQ 5JEAJ 4F2LA 1NK0A 5LMNW 3GO5A 2F4VL 1IXRA 4X64Q 3BZKA 3FRHA 1MSWD 4AQYQ 1NJIC 3PUYA 3J81i 1WJJA 5L1KA 2E2IH 1VQLA 1TWGH 4P75A 3W1BA 2OOBA 2GN5A 4MFFA 2XGTA 4F2RA 2AQ0A 4JBJA 2LBCA 2VNUD 3EW9A 5FJ8H 3Q8LA 5GQOA 3G71A 2H5XA 3S14H 1VEJA 1Q46A 2CP8A 4KLSA 8ICBA 4A3DG 5CR0A 1OXUA 1IBLL 1PA6A 1Q7YC 1HT1E 2W9CB 4DV5Q 2XCAA 2NN6G 1NJZA 4UP7A 1VDLA 4IJHA 2KHHA 4DR1L 1SL2A 1YNXA 1I94L 2ZTDA 4J9OA 1P16A 7ICOA 4JI1Q 4BXOB 4IPDA 2DAEA 3K75D 5C4XH 4IO9A 3PW0A 4A4IA 3N4MB 1IZ6A 1TVAA 2DKLA 4KLJA 1VQKA 1G3IA 3Q8MA 2QA4A 4UB1A 5J2JA 4JBMA 1ZQUA 3HFZB 4DK3C 2OWOA 3GLFE 3C1ZA 3S2HH 1KL9A 2N78A 1B43A 2EJSA 1L5UA 1JX4A 4I2EA 3RLFA 4JI7Q 8ICQA 3PMLA 1WYDA 2Q2IA 4G3OA 1U48A 3HP6A 2A1AA 4PHEA 2P6UA 4KI0A 3EN2A 4JK1A 1ZMUA 2UU9Q 3HKSA 1Z9FA 2ATWA 3OTOL 2KNZA 4IRDA 4Z6EA 1HZCA 4DEZA 4KLDA 5J2FA 1OQYA 2K75A 2JZ1A 2W9BA 3PF5A 3GLHE 4DL3A 4GXKA 2LXKA 1S9FA 1YHAA 4DL2A 3STBD 4HIOA 2VZAA 3PO3G 4I2BA 5J29A 3KOJA 4RU9A 1OXVA 1KFTA 3E0EA 1VEGA 5F9NA 2KHJA 2AQ4A 1D9DA 3CW2C 4TQRA 1XNRL 5C44G 1BVSA 4UP9A 2BCUA 4IR9A 2ZJQA 4OO1G 4A3JG 4F3OA 4UAWA 5IE8A 1TFRA 4JV0A 1XMOL 1NK8A 4M9HA 4RQ8A 3GIJA 4F50A 4DV5L 4R1JA 4RT3A 4GEWA 1K83H 1M1KC 2B29A 4J9QA 4RG1A 9ICCA 1NJWA 3ULPA 5TZVA 1U4BA 8ICLA 2EKKA 4IQWA 1PH4A 4A3BG 4GXIA 1L3UA 4KTQA 4LF7Q 4L5SA 4LF6Q 1ZMWA 4PZ6A 4JI4Q 4QWDA 1M90C 4E0DA 1VQBA 3M8SA 4EQ5A 4XUSA 1RZTA 1A77A 2JA6G 2ZJ5A 5KFZA 8ICEA 2MQHA 2WFWA 8ICFA 4F4XA 4F5RA 3V72A 2RRUA 4EBDA 1YBYA 2O25A 2ALYB 4HYKA 5IP7G 3F92A 5KFCA 2KFNA 4A3BH 4WJ4A 4RQ0A 3KDFB 5IYCH 2JZBB 5KT5A 1CUKA 3RLNA 3LWMA 1NMGA 4LFCL 1XMQQ 1W3SA 2UUBL 4QIWE 4A3KH 4XTCS 3A74A 4I2FA 1X55A 2JA6H 2I5HA 3KF8B 4JBKA 4R4OA 2K5HA 3H0GG 2VUMG 2JUJA 1X6OA 1B22A 9ICBA 1HNWL 4DV1L 2R8KA 4UQGA 4BA1I 1NV8A 1MN3A 4ECSA 4JV2A 1TWCH 3CMAA 5KFEA 1K8GA 3CCUA 1N56A 1WFQA 5KFGA 4YFKA 4PHDA 4Y7NH 4DS4A 2XCPA 4EBCA 1A63A 4P2HA 5IT9c 3NBHB 2KHIA 3RB6A 4I2JA 2JZBA 5KG5A 2MO0A 2R92G 2ZJRA 1P3QQ 3M9MB 3LCVB 2AU0A 9ICUA 1UT8A 4FDBA 1MQ3A 1X3FA 3A5ZB 5BR8L 1XJVA 3IECA 5AJ3L 4QWCA 1JJ2A 4XQ8A 2W8KA 2DUDA 2MGWA 1NK9A 2F1HA 4I2GA 4MFAA 1FJGQ 1LV5A 4HJ5A 3KJOA 2F1IA 3I55A 4DQQA 1YVCA 4GKJQ 1C7YA 2UVUA 4NXNL 1NV9A 2B63H 1C9OA 3QE9Y 3GDXA 3PIOA 4R8UA 3MR2A 3RB4A 1B70B 4DR2L 3CCEA 3HX0A 3S1NH 2IHFA 4LF8Q 5KG6A 1EFUB 3FP9A 2GVBA 3PW4A 1Y1VH 3PO2H 5KG7A 5J0RA 3RJJA 2LVOC 3S2DH 1HJPA 3GIKA 1JE5A 4KLUA 8ICNA 2XY7A 1T4GA 4BY1H 4F5OA 4Q8FA 4UY8C 3CPWA 3H7IA 1LUZA 4DQPA 4DL6A 4A3CH 5IWAQ 1UE6A 4DBGB 9ICKA 5CP2A 3J81c 1OKSA 4QZIA 1BPYA 1ZQDA 1XTDA 4DL7A 4FBTA 1IBKQ 4DR4Q 2FPLA 1DO0A 2VL6A 4QW8A 1U0LA 2FPKA 4O3PA 1Y1WH 2K14A 1T43A 1CKOA 3TEHB 3RZDH 3ISCA 5DB6A 3MMPA 3MR6A 1Y14B 3S15H 1YITA 1KTQA 5KFKA 2C2RA 2UVVA 4NLGA 4NLKA 5K36G 4IQTA 2XO7A 4A75A 2DZLA 3G6VA 4KHPL 4JWNA 3PUWA 2WTFA 4GNXB 2Q2UA 3RRHA 1GO5A 2D0PA 9ICIA 2R7ZG 4KMUA 9ICVA 5JJLA 3OTOQ 4BBSH 3PO4A 2VA2A 1PH3A 3T1YL 3CD6A 4KLGA 2Y0SE 5J2GA 2ZJAA 4JI6Q 4DV1Q 4OWTB 1L3TA 3I4OA 2JA7H 1KLNA 4ED8A 2AHOB 3I4NH 2DENA 4UAYA 5KFFA 4BA2I 2KZ3A 3THVA 2ALZA 7ICRA 2K0BX 2KBNA 3HOZG 4JI6L 4LVSA 2VW9A 7ICPA 4GC6A 5D4BA 4H02A 2ASBA 2W9CA 3M4PA 4DKAC 2BWEA 2BQ3A 3C5GA 3PW2A 1XPRA 2IHEA 1YEZA 4GN4B 5KFQA 4WP2A 1ZQOA 1HZBA 2KCMA 4YY3Q 1KXLA 2QEXA 1VEKA 3B89A 3RH6A 4O5CA 4AYBE 4CCHA 2JY8A 4ZH4A 1KHIA 4B9SA 1MKHA 4OWXB 1K1QA 4UB2A 2RF4A 9ICWA 4K4GA 2D62A 3EPIA 1GVPA 4I2HA 2HHSA 2YTYA 2HQLA 3CCVA 2XY6A 5KFYA 1UFZA 2FLPA 1FJGL 2ZJPA 4Q7JA 3OW2A 2MROB 4DQIA 1YZ6A 3J7A5 3QEAZ 1QSYA 3ZDCA 3PCOB 3OHAA 2DAGA 3RJFA 1GO3E 4JI0L 3HOVH 2LSSA 5C4JH 3KHHA 3PVXA 4DSEA 1IBLQ 4DV4Q 2PI2A 3LCUA 3S17H 3EPGA 3CPFA 4LF4L 2N8NA 2LTUA 4IOAA 3BJUA 2BH8A 3TQYA 4JI2Q 4A3JH 4GLXA 4MFCA 2HT1A 2NVXH 3PO5A 8ICOA 7ICJA 1MC8A 1SE8A 2VY3A 7ICFA 5DB9A 2F1JA 3EYZA 2FLLA 5EWFA 4QWEA
chains in the Genus database with same CATH superfamily
4DU9A 3ZDAA 2PNHA 5J3BA 4LF8L 1D1KA 1ICFB 5KO3A 1TKWB 1LKYB 2F0OA 3ONAB 1X6IA 3FE3A 5C0XI 2WAQB 4DR6Q 3MAQA 1JT8A 1SMXA 4DR6M 1DGHB 2ZXIA 3GILA 1W5TA 3SI8A 2HCCA 3NWSA 3RR8A 1KSFX 4DF4A 3SYKA 5AI9A 5CB1A 2RDHA 4H7BA 4BBRH 3GP1A 1XNQQ 1QQ5A 4RF1A 5IIMA 1HHVA 3T38A 1TWHB 1LVHA 4DR5Q 1IV8A 4RWSC 1F9PA 2F0FA 3S14H 4US8A 1HR0W 5C5JA 4LG2A 3CC2A 2MSNA 1OFHA 2EYHA 4X65M 2DXIA 2NVYH 3H0MB 1ZV1A 1WCNA 1D2NA 4ED2A 1LT4D 1TWAB 1H38A 1SYEA 2EYFA 3BQ1A 3QOJA 4RAUC 5IGEA 3JAMc 4GH9A 3RNUA 2ZAMA 3UJNA 3MXPA 4LF7L 3AJIB 1VJ5A 3OWEB 1F44A 4JI3Q 4IJFA 3GTLH 4C3JB 1HT2E 3B7QA 4EGVA 5AKXA 7ICUA 4NXNQ 3U4VA 5HURA 3PIPA 1I4QA 1ZKOA 2NBFA 4NB3A 2MHVA 2A68D 2HIVA 4ICAA 1O7LA 1AUAA 5JPMC 4XT3B 1SKRA 2MP1A 1LTMA 1SL1A 4DV4M 4EQNA 4IPCA 1VQOA 3HOUB 1ZQGA 5KYIA 1Q12A 1ZMVA 1LV9A 3AQQA 5KFHA 4KODA 1Z59A 3U6QA 3D2QA 1V1QA 2F0DA 5EP3A 5C18A 2EVBA 1ZQXA 5HP4A 5C6AA 3U61B 4F7XA 3I4NG 4YHHL 2DAMA 5T1IA 4G3IA 1UEAB 4C7YA 3KBBA 1XO0A 1JQYD 3T6PA 1LTGD 5JVH3 2C2EA 2UVRA 4KMOB 2YTUA 3IP4B 4ZKCB 2KW0A 2FMQA 1VQHA 2C98A 4CDGA 2KVMA 4DR3L 1T6OA 1XNSA 4QOSA 3CCLA 5LMUL 1VQMA 3C46A 1AH9A 1COOA 2B6GA 2ZUDA 1WTVA 4RPYA 1F9QA 4RGNA 4S3SA 5IP9H 1SNCA 4NC6A 4PT5A 4J9PA 1DK2A 4I65A 3X3MA 1N77A 4DL5A 4YCVA 2EQSA 1W2BA 1HNZL 1XPUA 4A3EB 3FVQA 5CGKA 2NN6H 3ICXA 5FO7B 1SBBB 3AOEC 2FOIC 1JXEA 2OHFA 1TT2A 3J7AF 4A3MG 3CAMA 4MNOA 4A93H 1B3QA 3TP5A 5IT9E 4ZKBB 3W5OA 4Z8XA 2KSOA 4QZBA 4O3OA 3TADC 1PTOD 1PH6A 1F0MA 1TXYA 2BOSA 4L4UA 3H09A 4ULLA 5CA7A 1IM2A 2WSEF 1VG5A 4KLTA 4P0PA 3K7UC 5JEAH 2E2HH 4HTHA 1PH7A 2JMGA 3AOGA 3MXNB 5CV9A 3SAHA 3GRRA 4FZNA 3H4BA 3BQ7A 1AFPA 3H4MA 3P7JA 2UUBM 4HSVA 1E1OA 3QYEA 1T3NA 2KEYA 2Y1IA 1Q8IA 4C8MA 4GLVB 4FF1A 1A6XA 1YNJD 1D8YA 1ASYA 4DR2M 1NAPA 3RH5A 2TSSA 3C1FA 2QQ8A 1XXHA 4B9WA 3GQCA 4O3QA 1JJCB 4Q45A 1CTMA 1V1PA 1J97A 1IYUA 1IY1A 1QLNA 4KTAA 3DEOA 4PZ8A 3OGUA 2FPMA 3L3OC 2QB0B 1S0VA 4IJLA 4M9LA 2AQ3B 3ZD8A 3PX0A 1ZQLA 4HEDA 1PH5A 1VQ6A 1BNZA 4RUAA 3HKZG 2D7GA 3HZXA 3BVMA 4B3SL 5M5YB 4DV6L 2HIXA 2JA5H 2PKEA 5FLMH 4ABNA 2OTLA 3H3VC 5JTIA 2JA8G 3KYHC 3R2IA 2W55A 5J2EA 2XTIA 5HNKA 3JR5A 2XC9A 4M0AA 2OQKA 1NVMA 3SMVA 4A3EH 2F0EA 3KHGA 2K6AA 1BBXC 5BOLA 1N5XA 3RB0A 2IWHA 3H8JA 5AK5A 1PFBA 2E76C 3KOWE 4GFJA 1N9WA 1HQMC 3TN2A 3SR6A 1JQJC 3NVWA 1F77A 1TS4A 4QJFB 1DCZA 4DV4Q 1KYIA 1V9PA 5DDMA 4DOBA 3GV3A 3A5UA 1WYGA 2UUAQ 2XEPA 2C9OA 5J2KA 4LFCM 5AFWA 5A2QE 1Q81C 5BR8Q 4JCVE 1FNVA 5DBAA 2NRZA 1ZXTA 4H44C 5J2DA 4M9SA 3SDZA 1YJWA 1WTRA 3PGZA 1B8AA 1SV0A 1JMCA 3KS8A 5ITQA 1STEA 4YY3M 5GTIU 1IY0A 4LF5M 4A3LG 1MU5A 4C7ZA 5ALVA 3HKZF 3V7KA 1B4OA 5DBCA 2ISOA 8CATA 4DR2Q 4B3RM 2NO5A 4DLEA 1IBKM 3J27B 2BR0A 4BWGB 3HOWG 3I3CA 4QZDA 4X65Q 4PDIA 5D49A 5J2HA 4UBBA 3K7AH 3GTJH 2XLJA 1TVXA 2W9AA 1CI4A 3UQ2A 4C1NI 1F9RA 2BH2A 1M8AA 2I1QA 2PZTA 1QZGA 1HNWM 4I2IA 2NTTA 1WHCA 3UDFA 2B3TA 4HMJA 2KDLA 5DDYA 3WKDA 2VA3A 4KMUC 2F8KA 3B0YA 1NTGA 5DNYA 5AK6A 2JQOA 5KTQA 4KY7A 5FK9C 4GNXA 4NXMQ 2JA9A 9ICJA 1G4AE 1TAMA 2OXOA 5ALMA 3TREA 4BB9A 5DBBA 3MR3A 3L9AX 2L7HA 2L12A 3UDXA 1CSQA 4F5QA 5E79U 3C21A 1TF0B 2X6GA 1S40A 2LH0A 3WKAA 4R8UB 1Y88A 5E26A 1IM4A 1X9MA 2KUMA 4XRHA 1A3VA 2G06A 4ECQA 2RVLA 1IQPA 3RUZA 1D1IA 1ZQVA 5KFNA 3WDNA 1XSNA 3DMUA 4DR7Q 2IBKA 3NUQA 4Z6DA 1V8QA 4IUPA 2ZIWB 5D3DA 2K5WA 8ICVA 1ZJNA 3T1HL 2ES6A 4TSSA 3HJ8A 4GS3A 4POFA 3J81L 3G4SA 1V85A 1VQNA 3JC66 2NVTH 1WIVA 8ICZA 1CHPD 1PRTB 7ICNA 5DGAA 4DFKA 3GV7B 2CRXA 3LK9A 1SDFA 3GLHB 3AB9A 2J5YA 4JI4M 1TV9A 3DM3A 4AKGA 4L5QA 1H6UA 4XYOA 4P0QB 3SV3A 3MJ5A 3AU2A 2W9BB 4CJ6A 5AHXA 2Z6BA 3E0FA 4YQWA 3EQLC 4P73A 1BO0A 3AYHB 2UUCM 5DLFA 2F0HA 1IN8A 2ZXHA 1GJXA 3GTPH 3HX3A 5BOMA 2N49A 2VF7A 4DK0A 2WSCF 3I4MG 5AM2A 5ALQA 4YHHQ 4JI3M 4PZOA 3GDEA 5AM3A 4GN5A 4AYBB 5KFPA 3NTUA 5KFUA 1SB3C 1UHUA 4CF4A 4DS5A 1T94A 2FMSA 3I51A 3K4GA 2WP8J 5M3FH 1WUDA 4FF4A 9ICRA 1RQLA 5J2AA 3ER0A 3H3VH 3HOVB 2GWSA 7ICEA 2YB1A 3N97B 2KZZA 8ICCA 2OF1A 2R6GA 4CISA 5ALOA 1GD7A 4LUVA 1Z3EB 4ECRA 3DWPA 1K3WA 1A76A 2HDLA 4TQUS 4KKTA 1N34Q 5CWRA 4H13C 3EWAA 1NZBA 4BJQA 1L0YB 4BY1B 3KLWA 4O42A 1PVOA 1EWIA 5IZ7D 4A3KB 5ELCA 1EYDA 3NENA 4G4OA 1CKMA 5ALWA 3HOYH 2BCVA 1D9FA 1UUPA 5KFXA 2FMMA 2F4VM 3KLSA 2FMPA 4NJ8A 3U5ZA 1NZPA 1TS5A 5ITXE 2K4PA 4YWLA 4WJ3B 3QU4A 4IZ8A 3CCMA 5C3XA 1Z00B 1W5SA 2LM1A 1SL0A 4C3JH 2XRSD 5DKWA 2B2WA 3GTGB 2F0SA 1PFNA 3MDCA 1PJTA 3OPOA 4X65L 1K1SA 3NGDA 1W6JA 4CJ1B 4PZNA 2IMWP 3MR5A 3PO3H 2UXDM 1RXWA 2KVCA 2VA8A 1L3VA 4KT0F 4K4IA 3GTOH 4DQRA 4C3IG 1ZQCA 1QQWA 3DHQA 1RODA 2NYZD 3S1MB 3GTQB 1KDHA 8ICUA 2IT1A 2WB1G 2ZIVA 2HKJA 1JN3A 4IPGA 4LK1C 1F5SA 1NOMA 4B9TA 1HQRD 3C28A 3A7AB 3KDFA 4OELB 3WOEA 1MQ2A 4P4OA 4UBCA 1DGFA 1A5TA 4LF5Q 5CC4A 1N62A 3K0YA 2KZUA 2I5MX 3Q8SB 1K8MA 1KRSA 3BDCA 4ILWA 2HVIA 5IYBH 2JA5G 1NNJA 4DQSA 3CF6E 1KTKA 3E4RA 4NOOB 2R0IA 1S3OA 1FJGM 4RCNA 4K0KL 4BY7G 2HOFA 3V2TA 2QNJA 4J9SA 3BYYB 1YJNA 1JUDA 2LKYA 3TARA 1C4QA 5FP0A 4XYQA 3BDLA 3HOZH 4JK1C 1SE4A 2WAQF 1I50B 1D0MA 3KS4A 3K80C 4XQQA 1J2NA 2CCZA 1K83B 4RNOA 3HHYA 4PGQA 3Q6SA 3U6MA 3CMEA 4OX9Q 2HAKA 5EXPA 5K36H 4GITA 5IYDG 2IX1A 3AKZA 2JRZA 5HMMA 4P4MA 5F2DA 1N32L 2D6FC 5AKEA 1X56A 3ULLA 1XWIA 4YMNA 3U4ZA 1XS9D 2QKIC 4AYBE 1HFNA 1IN5A 4DSLA 2VDBB 1JB0F 3CCQA 4QQBX 2QW7A 2Z7JA 1LM0A 2KIVA 1N8RC 4O3MA 2DN8A 2V4DA 1VS0A 1S8OA 3Q8QB 1OTCA 3N7PD 4IRCA 4BBSG 2W3SA 3L27A 4B9LA 2VF8A 5C1BA 4DSKA 2K50A 3QUBA 2HHVA 1PMRA 1KRTA 5ALYA 1HXYD 5GAHC 5DQHA 4YHHM 5F3WA 4DUYQ 1CK1A 4G7ZC 1XYIA 4NXML 1HNWL 1TWAH 2VS1A 3BJYA 1ZYRD 2JP7A 1VQGA 2F0IA 2D3DA 5KT7A 4DV7L 2E2HB 2W8LA 4FNFA 3H8SA 1NKEA 3BDPA 2VIXA 3B9PA 2I07B 3PX4A 2H3FA 5GADC 3QUTA 1I94Q 5EP4A 4RQ3A 4TVAB 4DV4L 2A3VA 4N8FA 5LL6X 1II3A 4OO1J 4GLAC 1PH2A 3D8LA 7ICKA 1C48A 3GLIA 4DLGA 2EAOA 1AN8A 2WAQG 2ODGA 5IP9G 1PRBA 1VQ9A 2UXDQ 1AROP 3NTHA 1S0NA 3F2DA 5L1JA 1V43A 3RD4A 4ZYSA 2CRUA 2G5GX 4PH5A 4AKIA 3Q8GA 4MF8A 4KLLA 4ECWA 3J81E 1DONA 2LMRA 1NJXA 2K9DA 1EY5A 4OJLA 2F4IA 1G71A 3G6XA 4XQJA 1XNQM 2JXMB 4RQ6A 7ICIA 1KNAA 3GLHA 2PO4A 1TR8A 1DXSA 1E24A 2QILA 4DR1Q 9ICHA 2RGHA 3VA7A 1F9SA 2MPMA 2HHHL 2R7DA 1VQJA 3SK4A 1JR3A 3H0LB 5KFVA 1XNQL 2DAKA 3K8ZA 1XMQM 1D6EC 2ZIWA 4DAVA 2K32A 1ZQKA 3M9BA 4KJNA 1QYRA 4O2DA 4QIWB 2VQEQ 4C4RA 4AQYM 4U673 4GZYC 3A98B 5BPCA 3O13A 1WTXA 1O03A 5A35A 4FS2A 3LYSA 2K7VA 4YN4A 2DZOB 2VXWA 2RSOA 3AFPA 3X3NA 4ZK9B 1LTAD 2C9CA 3KSXA 3SAUA 3F5EA 3E9HA 4IUUA 4ODGA 3S1MH 2JZ0A 3KOZE 4FXGC 3TP6A 4AI6A 4UB5A 1ZQFA 2V1UA 1DO2A 1FGBD 4BY1G 4RGTA 1S3SA 3C3LA 2VQFL 5EE1A 1R9TB 4IR1A 1KAWA 1J5EL 4B7HA 5I4DA 3GLGA 5T1GA 1SMYC 4IBFA 3OHBA 4M9XA 3GLGE 3T1HQ 3RTVA 2QZ4A 4M2YA 3NQIA 2JWSA 8ICGA 2MA1A 4ZCKA 4JI5M 4I27A 4Q8EA 4N8X1 4C4SA 5KFBA 2F0TA 1J7KA 4DUYL 1PFSA 3IRUA 3I72A 1K73C 1IBMQ 1XO1A 2IHNA 2YV5A 4J9NA 1EFID 3IG8A 3M8RA 2J7ZA 4YR2A 5BN5A 4YMMA 3M4QA 1N78A 4LF6M 1R5LA 4DUYM 1QZHA 2IY5B 2L4FA 2XGNA 4Y52H 2V1CA 1BPZA 3D6WA 2R92H 1NMFA 5IGDA 1ZETA 2AMCB 3I04M 2D0OA 3MWYW 4M1UB 2WAQE 3J80c 3NTIA 2ES2A 4NY8A 3HOYG 1EL0A 4YR0A 2R46A 1UQVA 9ICGA 2CV1A 5L1MA 5FOBB 3H91A 1URJA 4JYAM 2ICIA 3GRYA 1C20A 1OXXK 1ZQZA 1Z6TA 2DPJA 3D3RA 3HS0C 2DKZA 5M3MH 3W1GA 1EIYB 2EY1A 3SE0A 5KG0A 4YIJA 2MUTB 1V92A 2QPAA 3F53A 1EQTA 5JVG3 1CM9A 1WWVA 3BZCA 2KHVA 3SYLA 4F5NA 4YD2A 1XSPA 3LW5F 3FDSA 1V97A 5ALLA 3A7LA 2C5CA 5KQDA 4DV0L 2CXYA 1IW7C 2AWNA 4TKOB 3T5JA 1GJTA 1QH9A 2YMQA 4Y2UA 1HUOA 5FO8B 3HPOA 1QAOA 4NKLA 1F2ZA 1QZMA 4B08A 2RQ5A 4JI1L 5ITXA 2G0AA 5KPTA 3NHHA 4F88A 4LF6L 2EJMA 2K4IA 4GHAA 2WB1C 3HOVG 1S5DD 1E3PA 2ATLA 1KW4A 1QVGA 1LYLA 4Y2XA 4C1NK 3Q23A 1LTLA 5AKJA 3PIO3 2JY7A 1T9HA 1IW7D 1SMYD 2WFAA 3PX6A 2K5NA 3UQ0A 4GNXC 4HJ7A 5ELNA 4LF9L 3NWLA 3GD7A 4ECVA 1AW7A 5C0XJ 4DAYB 1LB2B 3H3VI 2R7FA 4BUGA 2I46A 3UI2A 5AI6A 3KSJA 3BQTA 1YSYA 3DOAA 1EY4A 3FPUB 2JA8B 3AM9A 1XXHB 1ZQSA 9ICAA 2DWMA 4F92B 2W7PA 1KKXA 1ZOLA 3GPUA 3K81C 1HR0L 5IIIA 7CATA 1Q02A 2EZYA 5KPZA 1SXJC 1HFGA 1PTOH 2K5DA 2WINB 3CKIB 2MJ5B 1QUQB 3NXWA 3K5NA 1VDZA 2H4OA 1IL8A 1LV7A 2OPFA 2I5LX 2VB3X 4DPGA 4B9NA 4DR4L 3S17H 4XA5A 3T56B 4JI7M 1RIPA 1HNXQ 2F4VQ 3RJHA 8ICPA 1HUMA 1AZPA 5IP7H 4KITB 3T16A 4I2CA 1Y1VB 2UU9L 4BWMA 3U6OA 2KEEA 4P74A 3MC1A 5AM4A 1XC8A 3AFQA 3H0GH 1IN7A 9ICTA 5EKKA 4BXOA 2VUMH 3GQ5A 2BGWA 4X62L 2F5NA 1KDBA 4IFDJ 4Y2JA 1VCIA 2L5TA 3STBC 5FKAC 3AU6A 3KK7A 3RBEA 4I4LA 4QCLA 3JAMi 2NVQH 5KFDA 3TRZA 2ZANA 1B53A 2JXJA 4PQXA 4DV2L 1SNPA 3OHXC 4RQ5A 3TI0A 4WJ3M 1KD1C 3VR6A 1I6HB 4IBBA 4EYIB 4N9PA 3MFIA 1QNKA 5IYCG 4L5TA 1IYVA 2QLTA 3MXGA 3OJUA 4KHPQ 1ZQMA 1PZNA 5A2QS 2JYOA 4U68A 5CV4A 3OOCA 1ZQWA 4NL9C 2ZM6L 3UMCA 2V4RA 4P71A 4LFAL 1HZAA 4RQ7A 4KKSA 1CQVA 3AEVA 4DSFA 4MM3B 1W6KA 5KFJA 3VR3A 3EIEA 5DG9A 4UB8U 3T1HM 2FLNA 4C3IB 1JICA 1A2UA 1NK6A 3HGIA 2CFOA 3L7ZC 4QZ8A 3ED5A 3NUCA 2DZNB 4F5PA 4ED3A 4UHVA 4G7HC 1VQ7A 4DR7L 4YP3A 2KE7A 2EY5A 4DR5M 1B2TA 3N7RC 1QAQA 2A6HD 1ZQJA 2XSCA 1CRXA 4C8KA 3MTSA 2VQEL 3BS1A 5G3LD 1SZPA 4MEXA 1IKLA 3Q8RB 1JOKA 1R2ZA 5EXXA 1UE5A 2JA5B 1RCVD 4RFBA 3RRGA 4R4CA 3KFUG 1JMSA 1J2MA 2K89A 3HOXG 3TADA 2K4HA 3NVYA 5J8YA 3Q8DA 3JAMS 1Z4OA 2ASDA 1G6ZA 3KTQA 2JA7G 1WWUA 2FE9A 4BGDA 3PMNA 4FCVA 4F4ZA 2OH2A 4MB7A 1XU4A 4TURA 4BDPA 4P0PB 1QJOA 4QB4A 1ZQIA 4ECUA 3TS2A 1A8VA 5EPJA 2Y9UA 3RBDA 2JK8A 4IFDI 2W04A 1VQ5A 1E94E 1RPLA 2F76X 1SKWA 2BCQA 4O3RA 3A56A 1Q8KA 5FTKA 2VJ4A 1S97A 2K28A 5FLXL 1I6HH 1BOSA 2K52A 3JPSA 1OAIA 3E58A 4R71A 4QWAA 4R65A 1RDPD 5C0XH 2L4EA 4RQNA 3GV5B 5C3WA 1S76D 3ZDEA 4A3VB 2JR5A 4USAA 2KHSA 3E9SA 1KFDA 1LKYA 9ICPA 2MUYA 3SVMA 3G6EA 1NSFA 5G5HA 2F3NA 2R8JA 1AE3A 3FYDA 4C0ZA 1X54A 4DK1A 1ZQNA 1PHJA 3GPYA 2KJ9A 3A46A 3IV6A 1TDZA 4M9ZA 1NY4A 3OSOA 4ED7A 2HDOA 1ZQPA 3VYSA 1I3QH 3U60B 4HJAA 3B9JA 1X6JA 4PD2A 4GC7A 3T5KA 3KF6A 1GXDC 3BS5B 4QZ9A 3I73A 1N36Q 1ZQTA 2UXDL 3CQZH 2QGQA 2AGOA 3H8WA 4CKEA 2D7EA 3WK9A 1QTMA 2K47A 4OWWB 2I9GA 3FM9A 3S9WA 1TDHA 1HA5A 2FXQA 3GLFB 2F8LA 2K8AA 4DCCA 4MEYA 1FNWA 5A2QL 4LFCQ 5IINA 4OU7A 3R9KA 4X66L 4YWMA 4FW9A 3IRBA 2HW3A 1IBML 4JWMA 3T13A 2JEIA 1D5XC 2CW0D 2P35A 3RH4A 4DV7Q 3T5HA 3GTKH 1PJSA 1X3PA 2G5HB 1EQRA 1S72A 3S2DB 4XK8F 2HCBA 3GLIE 4QZGA 3I8ZA 2MGSA 4CJ0B 3W67A 5FSWA 1QAMA 2NB0A 5ALRA 3V96A 1D2BA 1PUZA 1UM8A 2JEJA 3OSPA 1S5ED 4ED0A 2FFJA 3QOLA 3CYMA 4Q44A 2HVHA 3QWNA 2K01A 5DM63 1D0KA 1K8OA 3JAME 5ITRA 3MC0B 4LJ4A 2R4EA 2B21A 1HUZA 2AH5A 4YY3L 3S2HB 5KFMA 2Y1JA 4YXJA 3BU2A 5C3EG 1WD0A 2JJQA 4YCWA 2ZJ8A 4DV0Q 4ACOA 1K3BC 2MR9A 3VYUA 2EJGC 2OTJA 2LM4A 1Q90A 1SN8A 2F3VA 1Q3CA 4GOPB 1VF5C 3RAQA 1QVFA 4WW0A 4CNQA 1H9RA 3GQBA 2W3RA 2R93G 1C0AA 5KFWA 4MZ9A 3CP8A 1GO3F 2M2LA 3ITPA 1NK5A 2NZHA 2R8IA 1EEFD 4NLBA 2FFKB 2EYJA 2Y20A 4JC0A 4AYBG 4UW9A 2RRDA 7ICLA 5I9OA 1K9MC 2FNAA 2JHDA 2LYHA 2LHGA 4ELTA 2N88A 3CRKC 2ZXOA 3GP7A 3K0XA 3J7ZC 2JH1A 4DV5M 5JJZA 4A3DH 1RL2A 4G4KA 4M6WB 1N75A 3TWMA 4M9GA 1KFSA 4X62Q 2JEBI 5C3EH 1GUWA 3U6SA 1WTWA 4F8RA 4IUTA 2BQUA 4GKJL 4QZAA 2KENA 4IPHA 4JI4L 3HKZC 4EQPA 4G57A 1PZID 5E4WC 2WZJA 3HJQA 4LJ5A 5EOZA 2KCTA 3FYHA 4M0WA 1HIWA 2F0JA 4DV1M 3PZPA 2R18A 3TANA 3IFDA 1DGGA 2OCEA 4A3MH 3TKAA 1XTCD 1PXUA 3ZDDA 2JXNA 5HR7A 4QJFA 4RA8A 3HKPA 2PMZF 2HHWA 5E6JA 2DPIA 1D8LA 4YCXA 4DO9A 4OL7A 5K4LA 3K57A 2DWZB 1ZQQA 4IBCA 2ZUBA 5ALJA 2NWGA 5C4HA 1NBWA 1FFUA 2YMLA 4RGMA 2KVSA 4F4KA 3WU2U 4J9RA 4IFDG 5HY6A 4CKBA 2NVQB 1ENFA 2I6XA 4UAVA 4PPXA 1B9NA 1CHQD 3SC3A 1OXTA 2F0UA 4CDEC 4EBEA 2UVWA 4R4QA 1DGBA 5GQOA 1QANA 2KZMA 2RLTA 1S5FD 4KLKA 1JRPA 5M5XH 2GA4B 5EE9A 4ZOHC 4UN2B 1OIPA 2KD1A 3QX7A 4DFMA 1RXVA 3EFXD 1Q1EA 2ZXRA 4L6TB 1L0WA 4AIMA 1STBA 2CH4A 4AZFA 1PVRA 4G4RA 1QSLA 3H40A 5C5LA 2E8GA 2ZTEA 4HJ9A 2UXCL 2JY5A 2PXIA 3FEWX 1D7QA 4DUZL 1EOVA 2Z9HA 5FLXc 2QB0A 1JROA 2YY6A 5LL6S 2KIWA 5EAYA 5DG7A 2J6SA 1TK8A 2PFQA 1QVCA 4NMZA 3CXCA 1TWCB 3GTMB 2Y0SG 4ALPA 2ZM6M 4AYBC 1ICWA 5DB8A 3DV9A 1XSLA 1STHA 2L11A 1WGLA 3GTMH 3S17B 4K6DA 4M9NA 4KD3A 3D31A 2K03A 2KZSA 2LVQD 2IHMA 2KV2A 4LF7M 3WWVA 4GOPC 8ICMA 4OGQC 4F2SA 3KKAA 3I76A 3TFSA 5JI3E 1QE6A 5LMNM 1ZD5A 2LVPC 1A62A 4ZUJA 5KG4A 4R8IA 2JEFA 1U5KA 3QG1A 1KBUA 1H9SB 2QSFX 1SRUA 2Z0SA 3C2KA 4QZEA 1TE2A 4OO1I 3G6YA 3GFKB 1VQFA 2NTSA 4LFAQ 2NO4A 2X8AA 5J0PA 3K2LA 2IPKD 1D5ZC 3K59A 2KRKA 8ICRA 2FDRA 3RJIA 4F1IA 3HU3A 2KTQA 4PG3A 4PHPA 8ICKA 3ULJA 1SE3A 4LJ6A 3CRLC 4I2DA 3K5LA 4DR5L 4JI0Q 4D81A 3C23A 4DR7M 4B3SQ 1PZJD 1OAOC 3J81S 1RYRA 1B7YB 3SARA 2M60A 2G5IB 5KYLA 1B44D 3H15A 3RJGA 3FD9A 5B66U 4RUCA 3AFHA 1ZJMA 4LZDA 2Z3XA 2KJ8A 3QU5A 4KHVA 4BWJA 4AP9A 1RTNA 4Q43A 4ME5A 5M5XB 4L8JA 5AM1A 4R66A 3UM9A 1SE2A 3R8BA 5FTLA 3H4JA 4YD1A 1SKSA 3NP8A 4BXXG 1Z5CA 4DR1M 2JGAA 3NRZA 4POGA 1Y8PB 4KY5A 3V7LA 1VQEA 3S14B 4I29A 3E46A 2HUGA 4IOCA 4EVOA 2G8LA 3PFIA 1LT5D 2HWJA 3PO3B 4B6JA 4M6WA 1EQVA 2E5LM 1TGUA 3VK7A 3HRDD 1G8PA 2B2VC 1X9WA 2EIFA 3H94A 2ZTCA 2RP5A 2CWPA 4I2AA 2ID0A 3DM1A 4LW1A 1NNXA 1N48A 5E4XA 5AKZA 4K8JA 1ZD4A 7ICHA 1GL7A 1SNMA 1VQDA 1R9TH 2F03A 3A8IE 2V9WA 4DR3M 2IOFK 1X9SA 1U4PA 2QDLA 4EZ6A 1J6QA 2CFMA 5GAGC 4EZ9A 3K9PA 3QR8A 4RH6A 5C44B 3UXNA 1KAAA 3C5FA 5COYA 3J7YW 2KA7A 2JA7B 3CF5A 1G8ZD 1MJEA 4JV5Q 2A74C 1VQ8A 4LGYA 1N60A 2UU9M 3TP7A 4IRKA 4G6ZA 3NS1A 4KK7A 2BCOA 5I2YA 3M4OH 4UB4A 4LZZA 4KD4A 3SAWA 1G91A 3JPRA 2BDOA 2LWXA 2BDUA 4JI8Q 3SHFA 4YMOA 2QP9X 4J9KA 4RT2A 1BCPB 5JI2E 3UXOA 1XNRQ 1VQAA 3PNYA 3I2ZA 5KFLA 2UXBQ 1NJFA 1WCLA 4NSRA 3RFAA 4F91B 1HR0M 1A0IA 4X6AH 1TS3A 4FD2A 2L6OA 3A42A 1LTTD 3FUUA 2Y9TA 3H8MA 3FKIG 3QO2A 2LFNA 1RYUA 1MJGM 2VIIA 4JMUA 1QCKA 2E3TA 3QUQA 4OJ5A 1X40A 5CJ7A 3AUOA 4KLEA 1P8LA 5I2XA 4LF9Q 2L55A 1EYGA 4KLOA 1TY2A 4OJPA 1TH2A 1B50A 4C2MH 4LZGA 1MSGA 4BX9C 4QW9A 2C22A 2GH1A 4IBEA 3BBZA 3KD3A 9ICFA 1T5XD 1L2CA 4J15A 4GC9A 1YE9A 2YTVA 3UMMA 1I4RA 4IS7A 3DUZA 2JY6B 2A6ED 2Q2TA 4UPAA 4MTKA 3P20A 4JI1M 3TQSA 4UB3A 4PZ7A 4X62M 8ICTA 3C3EA 1JXLA 4OO1H 3RFWA 1Y1WB 2C96A 4MTNA 2CQOA 4BXXH 3GRVA 1PGYA 2JNHA 4QMGA 3RR7A 1L1OB 4HJ8A 3V7JA 4DNIA 3SV4A 2WACA 4WFN3 4Y2YA 1WCMH 2O6KA 4EYHB 3A54A 1X37A 3NPPA 4Z6YA 4EELA 3SK5A 4HIMA 3WKEA 3F2BA 1DOKA 3B6YA 3SHLA 1MBYA 2Z4IA 3RZOH 5KNBA 4KN7A 5ALFA 1QG7A 1STYA 2SEBD 5J8YC 3T79A 2XRQD 5ELFA 1E22A 1JIHA 5KFSA 4TUPA 4QZHA 1FO4A 5AIAA 3K6OA 3FTEA 4A3GH 1L2FA 4DR6L 3OJSA 3BQ2A 4RQ2A 5M9OA 2A8VA 1BPDA 3LWLA 4AQYL 4B3ML 1F2MA 4DOCA 1KLGD 1MIUA 4PGXA 3MGHA 4ED6A 3UK6A 4A3IB 2FHTA 4K0KQ 4TUSA 3PW7A 1KDCA 2L0CA 2F2AB 2EYMA 2XY5A 1IYJB 4OXPA 3E21A 1IL2A 3MEFA 1U4MA 2LYAA 1K82A 1Z19A 4QUFA 1DK3A 5HHIA 2RDIA 1QOHA 2B2VA 2A1JA 1S5LU 5EE3A 2E74C 2QF7A 3W68A 4DV3L 3HJSA 1JR3E 4ELVA 1DGSA 4ELUA 3J80i 5KRUA 4IIWA 3JPPA 5ALTA 2BCSA 1E7ZA 5ITYA 4MGIE 2B2UA 3DLLA 5J0UA 3HEJA 5L1IA 2CHQA 4RNNA 1BQQT 3PO2G 9ICQA 2VQFM 2CKZB 2UUAL 3UZUA 1QCBD 3K1ZA 5DB7A 1TK0A 3LQQA 1Y1VG 1X3EA 2XIWA 5L9XA 3NRWA 1LABA 3TPZA 3KFUF 1SNQA 2PNRC 1PK1A 3AQEA 3MDAA 2JE6I 4LWCA 3RLOA 1ECWA 4QZCA 1GJSA 1L3SA 4KHZA 5FTJA 3RR5A 3QYBA 1S77D 1PRTF 1GUOA 3SMPA 2ISPA 2P66A 4KLMA 1ZQ1C 1QNUA 1QSSA 4A3EG 3PQIA 1X9NA 1N34L 3A0HU 3GTGH 2LI6A 1SJHD 2C35B 4I7ZC 2UUCQ 1WI5A 3T3FA 1S5BD 2G3QA 3S1QB 3SZ2A 2B63G 2R7ZH 1YZ7A 1SR3A 5FJ8G 3L5KA 3NBHA 4XIGS 3M3YB 2V1CC 1ZQRA 5IT9L 3M6KA 4O5EA 2X6LA 4MN3A 5DLQE 9ICLA 3F2CA 2WAQC 3MFHA 5CV5A 5C5MA 3GTQH 3HOXB 3J7AV 5E3FA 3RJEA 1NK7A 1NKCA 1RF2D 5DQGA 3Q24A 1DYQA 3CGWA 1BPBA 1NJGA 3DDHA 2OXPA 1WR1B 3GO8A 1N32M 5ALIA 2EPBA 5M3MG 2BPFA 1R7RA 3Q8PB 1JE4A 2YN4A 1DD2A 1Z00A 1T7PA 5AKYA 1ZD3A 5KT3A 2X69A 5K5PA 1Q86C 4R4IA 1Q39A 2A5HA 4NXZA 2X49A 2A1JB 5AM0A 2DL0A 4KLIA 4JXJA 2E2IB 5EBDA 4UASA 4NM2A 4IN3A 2YMMA 1L1TA 1L7PA 2YNMD 4FS1A 1BPEA 4PHAA 1GOZA 5D14A 3PF4A 1NNUC 1BNPA 4H0LC 4GKKQ 2M5ZA 1TKDA 1QUQA 2HHUA 1IXSA 2H1EA 1YIJA 1N32Q 2FJ2A 4D82A 3SYZA 2R62A 4II7A 4JUZA 2R93H 4J9LA 4DXFA 3S16H 3VR5A 4REZA 4MHEA 3JR4A 1LTID 2AKWB 4KN7C 5AI4A 3IFTA 5J0TA 2CHGA 4NXMM 3H6MA 9ICXA 4EX5A 3GRUA 3T1YM 1WOCA 1TTEA 4NRWA 4HSPA 4RQ4A 4JPBW 2WF8A 5D46A 2KN7A 1SLJA 2EY2A 3TMEA 2LKVA 2MJ8A 1XMQL 2J6UA 5JJIA 4IL6U 3QZ7A 2PFOA 3ZH9B 2W54A 4K4HA 2E1EA 1T3QA 1DXMA 1XWEA 5L8RF 4IBIA 5ELBA 3I56A 4NLCA 2MRLA 1TS2A 3HT3A 5IODA 1BPXA 2ZM6Q 2ZG6A 2BWBA 4A93B 4M0DA 5FTMA 1Z1VA 1X2IA 2MAXA 4FCTA 4ECYA 2J6TA 2W43A 1SXJE 2ESEA 4JI2M 3S1RB 1FL0A 4PMWA 3B74A 5ISRA 2Q2HA 1EFWA 4LF4Q 4FF2A 2R45A 2IA6A 4JV5L 3L25A 4Y2PA 2IOFA 5EWEA 1EYAA 3E2EA 1LTRD 5ALNA 1NNLA 1SYGA 4P0QA 2L15A 4LMQD 3GIIA 5CRXA 3T53B 2W82A 1MSHA 2LBOA 1DOMA 3RN5A 1YI2A 4RZRA 2J7OA 4B3TQ 2DI0A 2PMZE 3C2MA 4K8IA 4KO8A 4UP8A 4C3IH 1CA6A 1O08A 4KLNA 3WKCA 2QBYA 2PI4A 2K6BA 5M5YH 5BR8M 2HHXA 4A3GG 2AWOA 4F4YA 2E8PA 4EX6A 4JW0A 7ICMA 3TFRA 2ENBA 3ND8A 3ALRA 3HRZC 2EKFA 3R9XB 1SYCA 4RPZA 2KP7A 4C3HH 4BS9A 3VK8A 4NWIA 4Y2RA 1QDTA 5J0WA 1BR9A 3VDYA 2EANA 1BUVT 2CWBA 2HHTA 2DJFC 1Z47A 3EIHA 5LMUQ 2WF6A 2BZFA 1E0BA 1WCMG 4DAMA 3DEEA 1TAUA 2R44A 2Y0QA 2EDUA 1GVNA 2HQEA 2R93B 2PI2E 4OVZA 2C2DA 2BDNA 2F3IA 4DV3M 1KQSA 5HMLA 4NLNA 4YCUA 4JI3L 1A15A 4DV6Q 5EPKA 4JB3A 2K33A 5KGUA 3HHZA 3ZD9A 1E1TA 1P7DA 3N52A 2PW5A 5E1FA 4EQOA 5KFTA 3TWLA 4K2KA 2XGQA 1BCPF 3PV8A 3FMCA 3V6JA 4LNQA 2VB2X 5CHGA 2E5LL 2OQ0A 1DV0A 5KG2A 1UA1A 2Q2EB 4BY7H 1Z7TA 1R4PB 3ZDBA 3M7NA 4Z9CB 1MX0A 2QHOB 4RQ1A 4ECXA 1QZEA 5J0YA 3GLGB 4ED1A 4B9VA 1IHZA 2Z6KC 4QY7A 3L2PA 3FHWA 2F0GA 3FKIH 2Q0ZX 1L2BA 3SGIA 1EUJA 3GTJB 1IG6A 1ZYRC 3HWTA 3K7AB 4BLCA 4ECTA 5H37D 4U6PA 4DFAA 5LHY1 3T1YQ 4OEMB 1FR3A 4OVZB 2R7ZB 3SEIA 5IIOA 5EJWA 1GUGA 3I7FA 2W11A 5J2CA 3JPOA 1SSOA 3S1QH 2AJQA 3NELA 5HGQA 2DF4B 3FUVA 5IYDH 3FRPB 5EGTA 1UPHA 1K8AC 2XWJB 3AU7A 2RHQB 2G9HD 3GIMA 5IOCA 2JEAI 2RGOA 5JUMA 1TWFB 3A55A 2A69D 1RYSA 2DQNB 4R63A 2RDGA 4ZUIA 1IKMA 5J1ZA 5DGBA 1SYFA 1JB7A 1FNNA 2BKEA 3L3FX 1S4ZA 3KBGA 1EWCA 4LUZA 4BA2I 4KN4A 3NEMA 2NRWA 1J5EQ 3K9OA 3GV8B 3Q8KA 5EP1A 3KHRA 2RKOA 3L26A 3CHBD 4QOZC 1XMOQ 4RNMA 3BXWA 1KC8C 2QDBA 3LNNA 4Q0FA 2QEJC 5E7NA 4GRIA 2KKPA 5IYBG 2I0QA 3I4MB 3A0JA 4Q5VA 3LVVA 4DV3Q 1OXJA 7ICQA 3HOUG 3C1YA 1S0MA 4DAPA 5IGCA 2UUCL 2X4AA 3UXPA 1UAPA 2K04A 2I7PA 5KG3A 2WB1E 2QEXA 5KAIU 3J7AS 1JCKB 4EEKA 1L6NA 2K5VA 5KL8B 5DEHA 3MXUA 1CFMA 3G7LA 1JOQA 1XB2B 5AM5A 4IQVA 3D2SA 4R64A 1L2DA 2KXEA 4FWGA 4GIBA 2AUKA 3FTDA 4FZMA 2EY6A 2UXCQ 2KOBA 4AG6A 3MEHA 3RJKA 4LFBM 4JI5Q 3VKGA 3PY8A 2RSNA 1PJJA 1NK4A 3MZ5A 4DUZM 1UA0A 4YG2A 9ICOA 9ICNA 2LMCB 3U50C 5M3FG 4IBDA 4A3KG 1XHBA 1CEZA 2DNCA 4J8QA 3D4DA 1BBUA 1GM5A 3J81j 5C4JB 4B3TL 3KFUA 4P17A 4AG5A 3E3XA 4TUQA 5L1LA 3OMCA 4ME3A 3ONNA 5EQ0A 3M7GA 1VMCA 2KCCA 4CHTB 1I5FA 2C5RA 4M9JA 1ZQ9A 1HTLD 2AQ2B 2L9HA 2LS01 2XSZD 3R93A 4UAZA 1IXSB 4L78A 1N36L 4GKKL 2NRXA 3OYYA 2YR0A 5J2BA 4LCBA 2XGPA 2YTXA 5CORA 4LJXA 4BBRB 1PV4A 5ELEA 2DHYA 1DOQA 3M9OB 1SIJA 4J1MA 4X64L 4B9MA 3MXNA 3ISBA 1K3XA 4JVZA 4FXKC 3QU2A 1U49A 2B63H 5LMNL 2BHNA 4KLQA 1SROA 7ICGA 2Q8TA 3C2LA 3VCBA 3M9NB 2KSOB 3QEBZ 4GN3B 5DNFA 2DUYA 3MK6A 1XWLA 3L0OA 5ALUA 3PV0A 3V05A 4QL5A 1A2TA 2KCNA 3FUXA 3HKZB 4MF2A 2K4EA 4C8NA 4A76A 4HAEA 4B3SM 2QENA 2YFQA 3J7BA 1ZYQA 2H3IA 3U26A 1CZGA 2CWAA 1S0OA 2XNAC 3TAQA 2OEOA 2JSOA 2Y0SB 4K6LA 3AOEA 1GHJA 3GQ4A 3PR4A 1KRPA 1K3RA 4QWBA 3WK7A 1L1OA 1JALA 1S10A 4ID6A 4O0AA 2NRTA 1GUNA 2DNAA 1QVRA 2PMZB 1PYWD 3M85A 3JPTA 4HEOA 4B7FA 4EX7A 1I4PA 1I50H 1IBLQ 2K60A 2HSZA 1PYSB 2E8MA 3I4LA 2L7IA 3TQ1A 1I6VC 3HOUH 5M3MB 2ZIVB 1E9SA 3V6KA 4NPSA 3EIVA 1OTRA 1EU4A 3H4DA 1KDAA 2PQAB 5FLMG 3GTOB 5FTNA 2KJ5A 2KFZA 5KG1A 1GL6A 1DGJA 3JPNA 1WJ7A 5C4XG 1HEKA 1TWFH 4A3FG 2EYPA 4IUQA 1L7NA 5J0XA 2EXDA 4X3TA 4MGZE 2K8CB 1YLAA 3BQ0A 4ZLTF 2RDFA 4B3MQ 2BA0A 4W5WA 2LXJA 2E1FA 1IXZA 4YVZA 1ESFA 3KKAC 2B39A 1CKNA 1HPCA 2CW0C 4A3IG 1JWMD 1XMOM 4R4TA 7ICSA 5KPRA 4CDDC 1I4HA 4YR3A 2G09A 2P6RA 1EZ6A 4ANRA 1DM0B 3PR5B 1GKHA 3QYPA 3FKIB 4DSIA 3C2PA 2KNVA 4US9A 1UT5A 4GKJM 4PCZA 2AGPA 1PTOC 3EJIA 4DV6M 3VR4A 1MHWC 3BVZA 3GV6A 4DUZQ 3E9IA 4DV2Q 1Y69U 1EIHA 2WHEA 2IJ0A 1Z1BA 3KOYE 4DSJA 5EQTA 1AIPC 1IFYA 1BDOA 5JEAG 2RBMA 2UXCM 3Q22A 4YXMA 3TS0A 1L8LA 2B8FA 1UE7A 4IUNA 4DF7A 3PUXA 4O3NA 3N6RA 5BN3A 4LF5L 4L63B 3UDIA 3MGVA 3KOOA 1HNXM 1ZQAA 8ICWA 1HCZA 1HR0Q 3SK8A 5IGBA 3PUVA 1C8CA 2JEGA 1JOOA 1HQYE 3Q8XA 1OXSC 1Y1WG 4Y2TA 2IX0A 3G48A 5EWGA 4WORA 4XXEA 1PH8A 1U45A 1OUQA 5DFLA 3K92A 2B3GA 2OEHA 4OCZA 3PNVA 4JOIA 2N35A 4NM1A 5IGFA 3HOWH 1DGHA 4B3TM 2AGQA 2ICEC 3KLRA 1CZWA 2XFTA 2GVAA 2KNAA 4RKLA 1PH9A 4A3CG 3HU2A 2MNAA 4LFBL 3D2NA 4QIWC 3QU9A 4QHSA 4Z6FA 2SDFA 1CSPA 2LVAA 4EENA 3VYTA 4C3HG 3I4NB 4WRDA 3GZFA 4JOIC 5J0SA 4EIWA 3WK6A 3IHPA 3NE5B 2LXEA 9ICEA 3ISDA 5ALDA 1CA5A 4F4WA 1EXNA 3PW5A 1I4WA 1EIFA 1N61A 1IBKL 3M6AA 4LJ9A 4PGYA 4AYBF 2PYKA 4AH6A 1VQ1A 5ALZA 5ALXA 4A93G 3KVWA 4XT1B 1G51A 1AEXA 3LGJA 5A0LA 3N28A 5JAVA 4FO2A 3OW7A 1ET9A 2F0QA 1BF4A 3QAUA 4FWHA 4M04A 5CV8A 4P4PA 3HW8A 1WTHA 4D80A 3PSFA 2M9NA 5EKLA 1NE3A 1G41A 3WK5A 1I4GA 4JI8L 5CBAE 3C58A 3JPQA 3BG3A 3THGA 4OIKA 4NSOB 4CJ2C 1F4IA 4LJZC 3BVGA 2Z6KA 2KEBA 3P75A 3I01M 3PO2B 4L16A 1EOTA 1D5MC 1YHQA 1N33Q 2GO7A 3ERSX 1Q82C 2NZ1D 2RQXA 3L28A 1FVIA 1TAQA 2ASLA 3LQRA 5KT6A 5KIXA 1VQ4A 5J2IA 4FF3A 2PFPA 2BPGA 5CR3A 4DGZA 8ICJA 2PFNA 5GAEC 1FGUA 3OTOM 8ICIA 4V0BA 5C0XG 1BGXT 5H1SE 1EYCA 2RHSB 3FYCA 3HWSA 3IHQB 3SR1A 3TL4X 3I1YA 4HAIA 1KQQA 3LWUA 4JG2A 4NLZA 2NUCA 1XPOA 2O4XA 3HOYB 2B2TA 4HIDA 1NCVA 1IBMM 2A68C 1XC9A 1J9OA 5LMNQ 1XNRM 1EQQA 2B63B 4FYDA 4QHTA 1UWVA 4O1NA 2AXTU 5AICA 7ICVA 5AK4A 2D8CA 2R8GA 1SV0C 1KNEA 4X64M 4KLHA 2IL8A 2W03A 4FBUA 2EYLA 4O5KA 1XXGA 3J2PB 4G4NA 4I5SA 3U6EA 4G9BA 3MGIA 1X65A 4HCEA 7ICTA 4RCOA 4RMFA 3HOXH 1ASZA 4LF4M 1SAPA 3CP0A 5ALSA 5KFRA 3TAPA 2C28A 1ZQEA 4I81A 2Z1CA 4K5XA 1K0SA 1KIXA 2G07A 5JPNC 1X3GA 2N3SA 1Q1BA 2VQFQ 1ORYB 1WGNA 2L2DA 1L1OC 2LPEA 2E8NA 1X66A 1G291 1RJTA 2DWNA 5AJ3Q 4A3IH 4FWDA 4DOAA 1VQCA 8ICSA 1Y8OB 2RDJA 2YYZA 3OIPA 4KY6A 4JI7L 3CC7A 3S1RH 3TE6A 2UXBM 4RPXA 1YJ9A 1U9LA 3PSIA 5KFOA 1HZ9A 2E5LQ 4I7AA 4JBWA 3G6JB 2O5JC 3D6JA 4C8LA 3MBYA 1C1KA 4NRVA 2HHQA 3QIAA 2NQ8C 5ELOA 4XQNA 4A3FH 1JJGA 3U6LA 1L1ZA 2CH4W 1B4FA 5IWAL 3LWEA 3UE0A 4RKBA 3OSNA 2YU9H 2BNKA 2Q8IB 4BY7B 1NY5A 2L1BA 2EZVA 3CF2A 4DF8A 3CC4A 5KFAA 3ORYA 1H9SA 2NVTB 3OW2A 2I7NA 2R65A 1ILPA 5KFIA 2WB1B 4JI2L 1Z6HA 1UE1A 1PJQA 3C3DA 4MGKE 3HILA 1SJED 2WV6D 4IQZA 3S16B 1HNWQ 3MVVA 1SFOH 2J7NA 4BBRG 2AUJD 1HNZQ 4F93B 2ZIUA 1N33M 4QZFA 4BBSB 3V6HA 4GOPA 1XXHE 1MD2D 4XDXA 2K1BA 1FIQA 4O0IA 4LUOA 1HRJA 5H2FU 4FO6A 1TK5A 4TQSA 1GUTA 2ZXPA 2EOTA 4B3RQ 2QCUA 2BDPA 3T5LA 3GPPA 1JB3A 5M3FB 1EIJA 1MI2A 1AE2A 2NZOA 2F77X 3TSSA 4K2LA 4A3GB 3ZJYC 2F3WA 1NHGC 5ITTA 2KKVA 2DAIA 1OIZA 1YT3A 2H3QA 2VANA 2XICA 4X5VA 2LVNC 3CQZB 3NWTA 5KT2A 1EE8A 4CE6A 2MFIA 3ETRA 3F8TA 3PUZA 1DZ1A 5DLGA 2CVRA 2UUAM 1PTOF 3I70A 5I6WA 3RZOB 1O7YA 2DFLA 4CKCA 1ZQYA 3SATA 3ZQJA 4JYAL 4OW0A 2LY7A 3U58A 3RZDB 1DOLA 4J6HA 1O7IA 2YX8A 3GLFA 3CTWB 5F9LA 4RHRA 2NV3A 3CCJA 4HIKA 1PH1A 4GXJA 3M3YH 4LY6A 1SG9A 2HI0A 3EZ5A 1COKA 2BJWA 2D7HA 3KOXE 1ML0D 1WTOA 4P72A 2KMDA 2PI5A 1Y8NB 4LF9M 4FP5D 3I4MH 1AP0A 4DL4A 5ALEA 2MUTA 3UMBA 2K4KA 4ECZA 2HHHM 2LNHC 4UB6U 1R4QB 3KF6B 3S24A 4PNYA 1N2XA 4A3FB 2SOBA 3SHGB 1B3AA 2PW7A 5GTHU 4L5RC 2B2UC 2EXZA 2DGYA 1Y8GA 1PM5A 2FH0A 3IM1A 5BPVA 1BKBA 3NK9A 3CRXA 1K0RA 4B9UA 3NTKA 4PL2A 1NSNS 3U9SA 5EXSA 5GROA 2C99A 2KG5A 3FRIA 4FZLA 1H9JA 5CYUA 5G3LF 5KNDA 1B1ZA 4G7OC 4KHPM 1EY0A 2KRUA 5JOBA 4I28A 4O9MA 4CBVA 5ALGA 3C9PA 4GC5A 3UPQA 5KT4A 4JV1A 2B8GA 5D3IB 1LACA 4QGUA 3AN1A 3NASA 2HHHQ 2OOAA 1N36M 4DFJA 4QIWF 3FPPA 2BPCA 3KJPA 5JJKA 4OX9L 3RGSA 1QB5D 1RTOA 1R4GA 3EBEA 3CCSA 4M47A 5DQIA 3F1ZA 1F2LA 4OONA 2XI9A 2UUBQ 1OFIA 3GQ3A 3SD7A 1ZD2P 3GTLB 4FE3A 1LTSD 4DR3Q 2EUCA 4XBOA 1KEJA 1VQIA 2OT2A 3RGPA 1UEBA 4K5VA 2JA6B 3B7ZA 5DM73 3AMUA 2EAPA 3RMHA 9ICMA 2CV2A 3SEBA 4CDCC 2OO9A 2B0CA 2NRVA 3FUTA 4LAAA 2NN6I 1A3UA 3ETLA 1QUTA 1T8EA 2G9DA 5C44H 3RAXA 3MABA 3RB3A 4FCWA 3HJEA 1ZQBA 1BCPD 3MFGA 2W9MA 1HH2P 3NBIA 1TWHH 5C4ZA 4N9TA 4MGYE 2YQEA 3CCRA 3M0EA 5AI5A 2EE1A 2RCNA 1CKNB 3JAML 2ASJA 3B0XA 1SZHA 1ZQHA 5DAUA 2ZUCA 4APVA 1G6PA 4A3BB 2KEDA 2LHCA 3KP1E 5IIJA 3K8AA 5JU5A 4DV0M 2F0PA 2D5DA 2E2JH 1H95A 1JR3D 2BQRA 4O3SA 1NKBA 9ICSA 3I91A 4C8OA 4Z6CA 2BA1A 3T51B 4C3HB 2H3VA 4JYAQ 3SENA 1L7OA 4GMQA 2XF3A 5G5GA 3L29A 2ERCA 4LZJA 4EEYA 4F8MA 3WHKA 4IC9A 5HHHA 2F52A 2PQAA 2V4QA 4HCSA 1SV4A 3SAFA 3H0RB 1MJCA 4A3LH 3K5OA 4DWIA 1U47A 4Y2VA 3U60A 3KP0E 2UXBL 1VDDA 3V76A 3NBXX 3ZCBB 3HU1A 1FYCA 4KLFA 2GOLA 5J0OA 3PNCA 2D9UA 3H0GB 2MO1A 4YWKA 2VUMB 1RG6A 2O01F 2XVSA 1GHKA 2QB1A 4DV7M 5DG8A 2EAMA 4J9MA 4C2MB 1AZQA 2F5PA 1UNSA 1NJYA 2FINB 3F5AA 3A8KE 4R9WA 5IILA 4DFPA 1BBWA 4CGZA 1PYBA 1STAA 5ALPA 5AIBA 1M6YA 3KHLA 1EEID 4X66Q 3D8GA 1AQ6A 2F1MA 2EZZA 4DN4M 3RN2A 3HKZE 3LDAA 2BCRA 1V38A 2G08A 1FNUA 3QZ8A 4QNRA 1YHBA 4CF5A 5CBEE 8ICHA 2HL7A 2P5TA 4NXNM 1VQPA 2A19A 1PTOB 4DA2A 1QUSA 8ICYA 4DK6C 2R8HA 1KSPA 3DFZA 3KDSE 2YQZA 5AKKA 4IQUA 2B2WC 4M8AA 5M5WH 4KX5A 4JI5L 8ICXA 8ICAA 2JA8H 1OJLA 2EYOA 3D0FA 3ICEA 2K8BB 5IIKA 1VLBA 5J0QA 3M4OB 4LFBQ 1F2YA 5JEAJ 4B3MM 4F2LA 1NK0A 5LMNW 3GO5A 2F4VL 1J8IA 1IXRA 4X64Q 3BZKA 3FRHA 1MSWD 4NXNL 4TUWA 4AQYQ 1N5WA 3UE1A 2XVTA 1NJIC 3KLSX 2BJVA 3PUYA 3J81i 1WJJA 1TR5A 1RDFA 2DJGC 2JH7A 5L1KA 2E2IH 3B7NA 3OIQA 2ZIUB 2H1RA 4LRSA 1TWGH 4P75A 5EBCA 4WJWA 1VQLA 4DAYA 2WSFF 4P2CB 3W1BA 2JP1A 1X3QA 3IKJA 5FJ8H 2OOBA 1RU3A 1LO5D 2GN5A 4MFFA 5KNIA 1IXRC 3QB3A 4CF3A 2XGTA 4F71A 4F2RA 4GHLA 1JWSD 2AQ0A 4JBJA 3HHXA 2LBCA 2VNUD 3A45A 1SGGA 2DHRA 3EW9A 3U6PA 1ED1A 4KX3A 3O0FA 3Q8LA 1BCPC 2NVYB 2A5YB 2H5XA 1L8QA 2FJ6A 1VEJA 2KNJA 3CU7A 4RGOS 1NY6A 1Q46A 2CP8A 4KLSA 4WURA 4UATA 8ICBA 4A3DG 3ZC7B 1GKIA 2F5OA 2G5DA 1JI7A 3W0LB 2E2DC 2FS1A 5CR0A 5CEHA 1OXUA 2F0NA 2R3ZA 2NYVA 2N1RA 3MHBA 4XGIA 2F5SA 3IDWA 4B9XA 5F3XB 1PA6A 2Z8LA 1HT1E 2W9CB 1PLFA 1HTPA 2XCAA 4LJ7A 4DV5Q 1Q7YC 4IFDH 2NN6G 1JORA 1O80A 4Y28F 1NJZA 2K05A 2R92B 4UP7A 1VDLA 1D8BA 1MGSA 4IJHA 2PQEA 2KHHA 4DR1L 1SL2A 2FI1A 1LT6D 1YNXA 1I94L 2OQ4A 2ZTDA 4J9OA 5EJCA 1P16A 2F0VA 1VF7A 7ICOA 3BZDB 2KOLA 4JI1Q 4BXOB 4C4TA 2DAEA 3K75D 4IPDA 3TZUA 5C4XH