2ZTCA

Mtruva form ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
188
Chain Sequence
GRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 44
structure length 188
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztcA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztcA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztcA01
2XC9A 1XMQQ 1B22A 4TUSA 5KFYA 5HGQA 4YXMA 3M8SA 1EXNA 3ZD8A 1JX4A 3NEMA 1LYLA 1U48A 4HJ7A 1Y1VH 4B9VA 5CHGA 1S0VA 4ECXA 3KHHA 5IY0A 1SE8A 2PQAB 2VY3A 5KG0A 5HP4A 4DBGB 1Q86C 3KFUA 3GQCA 4K0KQ 1LM0A 2KCMA 1E1OA 3V6KA 4QIWE 1L3SA 2KTQA 4QZIA 3RN2A 1SFOH 4QW9A 3U58A 2UUBL 2MJ5B 2R8JA 4O3RA 2KZ3A 7ICSA 4LZDA 3PW2A 9ICKA 1KRTA 1XS9D 5D4BA 3RJGA 4KLOA 2VA2A 3NGDA 2ISPA 2D62A 2NRXA 4HJ9A 8ICAA 5TZVA 4QZEA 4LF9Q 1XSLA 2AQ0A 4GOPC 4O3QA 1PGYA 1EQRA 2UXBL 3RLOA 5KFPA 3KF6B 3CMEA 1JMCA 4I2IA 4PHAA 4LWCA 3Q8MA 2AQ4A 5DBCA 4IR9A 3Q8QB 4YMNA 5EOZA 1VQNA 5C0XI 1AE3A 3HP6A 1AE2A 1ZQQA 2VQEQ 4F91B 4P75A 7ICJA 4NXNL 3KJPA 1KXLA 2QNJA 5KG1A 4R4OA 3ZD9A 5DQIA 1NJXA 4RU9A 1W3SA 4X62L 8ICNA 5AJ3L 2XCAA 3FP9A 4IRCA 3RB0A 2XY5A 4A3IG 4RQ7A 4WJ3M 2DHYA 1VDLA 2A19A 1TV9A 3OYYA 5DDYA 2CFMA 1NJIC 1BVSA 4O3OA 9ICLA 7ICMA 1L0WA 5IILA 2YTYA 2YTVA 4BY7H 1OQYA 4BBRH 3CC7A 3GTMH 4NXZA 2UU9Q 3AU2A 5DDMA 8ICVA 2QA4A 3UDGA 4ED1A 3ULJA 3GIIA 4BWJA 3PR4A 2UVVA 4ECYA 3J81j 3PO3G 3FRHA 2UXDL 1YIJA 5DLFA 2ZUDA 2IT1A 2MO1A 4LF4L 4J15A 1PYSB 1UEBA 4KLLA 2BCRA 1UFZA 4NXMQ 4F93B 4OWXB 1DOQA 3KF6A 3ERSX 4JI2L 2K5VA 4F50A 2J6UA 3PO4A 5KFZA 3PNCA 3ER0A 1L1OB 4GN3B 4QZCA 1WFQA 2JJQA 5IE8A 4F4ZA 1AROP 5DQHA 3GTPH 3ZDEA 1TWHH 5C0XJ 1IBKL 2VW9A 3M8RA 2JK8A 3HPOA 4UP7A 1YHQA 2HHUA 3EN2A 4L5TA 4A93H 4AYBE 4YMMA 1JJCB 4KITB 4BBRG 1JXLA 2R93G 4GNXC 2Y0SE 1TR8A 4B3RQ 2IA6A 3W1BA 3PF4A 1HT2E 5DG7A 4QJFA 1IXRA 1OXXK 1IBLQ 4B3TL 5F9NA 1T7PA 1SZPA 2HHHQ 4RUCA 4NM1A 1X54A 3S16H 1Q46A 4CCHA 1P8LA 1FJGQ 3HOYG 1U45A 5C44G 4LUZA 3H8SA 1IZ6A 4E0DA 4YR3A 2B3TA 1LTLA 4QWAA 4FO6A 1S0NA 4DV3L 2I1QA 4IRKA 4LFCQ 5EWEA 3MBYA 4A3KH 4OX9L 4A3BH 4DR7L 2NRTA 1JR3E 5DG9A 9ICGA 3GDEA 3RJFA 5AJ3Q 4A3CH 4KN7A 3CD6A 1KYIA 3CCJA 3KJOA 1XC9A 4LVSA 2E2IH 3AYHB 2I9GA 4MEXA 2J6SA 4DV2Q 1OTCA 4Q8EA 3CW2C 4M9HA 2JEAI 2KHHA 1Q02A 2BKEA 3KTQA 1HH2P 3H3VI 4A3EH 4AH6A 4GC7A 1T3NA 1C0AA 5EWFA 3M9MB 4ED0A 1ZETA 4M47A 2K50A 1XPRA 1FVIA 5IP9G 1PHJA 2R8GA 3G6XA 4QZHA 1YZ6A 1VQMA 2JZ0A 5J0TA 3CPFA 2HHXA 3GFKB 4JUZA 4J9LA 1TWGH 1T43A 4EBCA 1UT5A 5KFXA 4DS4A 1T9HA 1ZQOA 5J2CA 3HKZG 5KFQA 3RB3A 2ALYB 4NB3A 4EQ5A 4DV0Q 3UDIA 4IFDG 5IIIA 5K36G 1PH7A 2A1JA 4IPHA 3V7JA 5C5JA 4DKAC 5J2KA 2HW3A 4I29A 2B21A 4DEZA 2IHEA 3GTQH 2WB1G 3UQ2A 3GIKA 4DSKA 2IY5B 3RLNA 2ZTDA 4EBEA 9ICIA 3JPQA 1SKWA 1ZQTA 5J0WA 1X9SA 8ICEA 4WP2A 4KLTA 2DUDA 2UXCL 4MZ9A 3N4MB 3GILA 2VQEL 1J5EQ 1CKNA 5HMLA 5J0QA 3SV3A 1ASZA 1RYSA 2K9DA 2NRWA 3G4SA 1YLAA 3H4DA 4JV5Q 2BCQA 4DOBA 3MR3A 4DR3Q 4A4IA 1WYDA 4A3JG 1N9WA 1XPUA 5CP2A 2AU0A 1NK6A 2JA5H 4GLVB 5KFKA 5CR0A 1KHIA 4DSJA 5BR8Q 3LK9A 5DBAA 2BQUA 1YJWA 2UUBQ 4A3LH 4IQVA 4XIGS 3T1YQ 2R7ZH 1Q1BA 3HOUG 4LFCL 4GOPA 1N36L 5J0PA 3ISCA 1WGLA 1QUQB 3C2LA 3K9PA 3GTGH 4O3NA 1TWFH 1QZHA 4O0IA 5LMUL 2LVPC 4DSLA 1SLJA 4A3FG 3CCSA 4DFPA 4XTCS 4ED2A 4DR4Q 3FRIA 3GLIE 7ICIA 1S3OA 2IMWP 1Z47A 4A3CG 2UUAL 4P71A 1T6OA 1NKCA 3F1ZA 4BBSG 1G4AE 2UVWA 4O5CA 3UXNA 5BOLA 4LF5Q 1HR0L 5KG6A 1ZQEA 3JPRA 2UXCQ 1E3PA 2ZTCA 4GKJL 2N3SA 4B9SA 4PPXA 3UE1A 2WAQE 4X64Q 2LXKA 1MJCA 1ZQVA 2L4EA 4C8MA 4BXOB 3ETLA 7ICOA 4LUVA 5ELOA 4I2AA 2FMSA 2W9BB 4DSEA 8ICQA 4R4TA 1VQKA 5KT2A 3BBZA 2ASDA 4EZ6A 1HQYE 1K83H 5C0XG 2FPKA 3K0XA 3HOXH 9ICPA 3CC4A 4B9NA 1X6OA 5IIMA 4JBJA 4APVA 2JEIA 4KLKA 1DO0A 4I2GA 4X66L 4UP9A 1PYBA 3RBDA 3STBD 3TANA 2K4KA 3RAQA 4B9UA 1Y1WG 3FHWA 1ZQUA 3J7ZC 1NJWA 4Z6EA 3D0FA 1K0RA 2ZUBA 4DR4L 5DG8A 5JJKA 2JEFA 4KLMA 4BY1G 4RNOA 1NKBA 3EW9A 1CSQA 4GC6A 3CCLA 3B89A 5FJ8G 1E1TA 4DQQA 3TAPA 3FE3A 3MR6A 2F3IA 4RG1A 4HEOA 5M3FH 3F92A 1WCNA 4ECZA 5L1LA 1KEJA 5HHHA 1NV9A 1VQGA 2WTFA 1UE7A 3M3YH 4ALPA 2Q2IA 3DLLA 5E7NA 3TQYA 2VA8A 1XMOL 3T5LA 8ICIA 4YWMA 1ZQNA 4QWEA 4DL3A 1H95A 2BPFA 3H40A 2JEGA 1B8AA 9ICVA 4JBMA 7ICFA 4X62Q 2E5LL 2E2HH 1HNXQ 4DFJA 5D49A 1GO5A 4A3MG 2LBCA 3RNUA 2HVIA 4ELVA 1I5FA 2W9CB 3HOZH 1X3FA 1E7ZA 4JI1Q 2JEJA 2DAEA 1S76D 2R8KA 2HVHA 3RB6A 4IJLA 2PFNA 3NELA 1RIPA 3SZ2A 2ZM6Q 2RF4A 3CAMA 5IYCG 3I4OA 3RH6A 2H5XA 4RQ5A 4JBWA 1I94L 3HW8A 2PFPA 3NENA 4MTNA 2LTUA 5C3EG 5KFFA 4YR2A 5IP9H 1CEZA 3ORYA 4MF2A 4LF5L 4P4PA 1S40A 5DBBA 4EBDA 5CB1A 4HIDA 4GXJA 5KFVA 4DQSA 5KTQA 2PNHA 2FLPA 4EEYA 4B9TA 4LF8L 3PY8A 1TAQA 2HHHL 2F1HA 3LGJA 2JP7A 3W1GA 1N32L 1S10A 4M9NA 4JC0A 3KHLA 4DWIA 1SKSA 1FJGL 3HOWH 1T8EA 1Y88A 5IP7G 4M6WB 3PMLA 1S77D 3PVXA 3GLFE 2DNAA 3QEBZ 2E5LQ 5KFWA 4UP8A 4YP3A 3T3FA 4MNOA 3BZKA 4B3TQ 5KFNA 3PW5A 4JOIC 3FYHA 4IPDA 4POGA 3ZDAA 7ICHA 5J0YA 3LWMA 2ISOA 8ICCA 2ATWA 4XA5A 3CXCA 4DV7Q 4H02A 3JAMi 3H7IA 3NTUA 3PIOA 3T1HQ 4BBSH 4YR0A 3Q8RB 3PO2G 2L15A 2UUCQ 2ATLA 3J81i 4BWMA 3PX6A 3MGHA 4J9NA 1EIFA 1MSWD 1X2IA 3RR8A 3QZ7A 5KG4A 3A5UA 1HR0W 4IRDA 2DAIA 1UE6A 4DPGA 4TURA 3KLWA 2NRZA 4IOCA 1UE1A 4A3DH 2C22A 4R63A 2K5NA 3GV5B 3S14H 3PR5B 2JZBA 4J9QA 4R65A 3JAMc 1ZQCA 4M9JA 4KLJA 4MFCA 3KYHC 2ZJRA 5JI2E 2B3GA 4A3MH 2NZHA 4JI8L 1N32Q 9ICFA 1VQ5A 1ZV1A 2BH2A 4DR2Q 4NLKA 2UVRA 4DUYQ 1HNXL 1OXUA 3E2EA 3JC66 1ZQJA 4YCVA 4C8KA 2ZM6L 1A62A 4YQWA 2AGOA 3IHPA 1EFUB 3QE9Y 4DF4A 1B43A 2V4QA 3T1YL 1S9FA 1QZEA 5KG2A 4TUPA 1ZQBA 1V1QA 1TKDA 3Q8SB 3H8JA 5DB8A 5DGAA 2YYZA 4DV5Q 5M3FG 4DL4A 3U50C 3SV4A 4DK3C 3HOWG 1TTEA 3GTJH 4DL7A 2RHSB 2ALZA 3L2PA 1UE5A 4KLSA 2BWBA 4RQ4A 4A3EG 2ZTEA 5L1KA 4A76A 8ICUA 1PH8A 3ISDA 3CP0A 2KNZA 9ICMA 2F1JA 3GIJA 4F5NA 1HNWL 1NY4A 3M7NA 2Y1IA 5HMMA 4Z6CA 1A0IA 4YY3L 5GAEC 5J2IA 3M4QA 1VQ6A 1LB2B 2ASBA 4O0AA 4WJ4A 5D46A 3C5FA 4M9GA 4P2HA 2LSSA 2BA1A 4YCUA 3MDCA 5KT6A 4GS3A 2DPIA 2CCZA 5J0SA 1KFSA 1WJ7A 1NJZA 4F92B 4RQ8A 2Q2HA 1VQ1A 1EYGA 3LCUA 1MIUA 4JI7L 2JE6I 1ZQRA 4O2DA 4JBKA 5KFAA 4HJ5A 4UQGA 2M9NA 1VQJA 2JY7A 3PCOB 1XMQL 4B3SQ 3IECA 3S24A 1Z00B 4DNIA 2FLNA 4IO9A 5HY6A 2QGQA 1BPXA 8ICXA 3PUWA 1VQ4A 4RPXA 1HJPA 2XGTA 1HNZL 1IBKQ 1QLNA 3B6YA 5IYBG 5IWAL 3CF5A 4XQ8A 4Q43A 4P4OA 9ICAA 1VQAA 2JA5G 2DFLA 3TRZA 3PX4A 3D31A 4K4IA 4PGQA 1BKBA 1YI2A 8ICTA 2OQ0A 4DR5L 2VS1A 4QZ8A 4ED8A 1XMOQ 1ZQKA 5J2AA 1RL2A 1XSPA 4DF8A 3SGIA 4X66Q 5BOMA 3T5KA 2PQAA 5IYCH 2R92H 5DB9A 3B0XA 5L1IA 2JA7H 1NMGA 1G6PA 2BCSA 1YEZA 3F2DA 4DV3Q 4Z6DA 9ICXA 3GTLH 4LF9L 8ICKA 5EAYA 3CPWA 4BY7G 4M04A 2DZLA 2HHVA 3MMPA 4LUOA 3HKZE 5L9XA 1X3EA 4DFMA 1QSSA 1XNQL 2KHIA 3PO2H 1Q8KA 5IIKA 3PUZA 4B3SL 3BQ1A 1VQCA 4DV1Q 1PH3A 3M9NB 4LF7Q 2KFZA 1QUQA 3I4NH 1HZCA 2DAMA 4JWMA 2IX0A 4G3IA 2EQSA 2FPMA 2DI0A 2Q2UA 4O9MA 1JE5A 2GN5A 3EYZA 1ZQIA 5J0UA 1A77A 3SYZA 1MKHA 2I0QA 2BR0A 4DQRA 2RHQB 4C3IH 2PFOA 8ICRA 3BQTA 4J9PA 3MEFA 4C8OA 2ZJ5A 4I2DA 2OCEA 4XUSA 3RH4A 4TVAB 3A74A 1UA0A 3J81c 1B70B 1YHBA 4I2EA 2CP8A 4PGXA 1YBYA 1K9MC 2AWNA 1JT8A 3M85A 4BGDA 5GROA 1CKNB 5KFEA 3RB4A 2BGWA 8ICHA 2W9CA 1X9WA 2K5HA 4NPSA 2IHNA 2YV5A 3W5OA 2D0PA 1VG5A 2JY8A 4YN4A 2R8HA 4DV7L 3OTOQ 2MR9A 2RDIA 2JQOA 4DOCA 1ZQXA 4UB2A 4JI4Q 5FLMH 4AQYL 2A1JB 4IOAA 3K4GA 1Q81C 1TK8A 4J9MA 3T1HL 2VA3A 1JB7A 4M2YA 2JA6G 1E24A 3K7AH 1TVAA 4NLNA 4YHHQ 3S15H 4B9MA 1XB2B 4Y52H 2IHMA 3QEAZ 5J0OA 1OTRA 1B7YB 2KNAA 1VQOA 4YWLA 3H3VH 4HJ8A 1PH5A 2MAXA 3KF8B 3V72A 1VQ7A 2IBKA 1WOCA 5J3BA 3H15A 1V92A 3T6PA 4F4XA 4GKKQ 4ECTA 1SRUA 3TREA 4KTQA 4F5PA 4BY1H 1TK0A 2K0BX 1IYJB 4KMUA 3JPOA 1I6HH 4TQUS 4DK6C 4A3FH 2FPLA 3H4JA 4F8RA 4XRHA 2N78A 5IYDH 4UPAA 2UU9L 5LMUQ 3ZJYC 4R8UA 2IHFA 3OHAA 1EUJA 5FJ8H 5JUMA 1X56A 4A3LG 4GLAC 4ECSA 1BBWA 2YU9H 3G6EA 4F1IA 2Z6KA 4IQWA 4R64A 3G6YA 4POFA 3E0EA 9ICBA 4JI0Q 2R93H 4RPZA 4MF8A 5DLGA 4M6WA 3BQ2A 5J2HA 5LMNQ 3NBHB 4A93G 7ICQA 1FGUA 1HZ9A 4FBTA 1TWAH 1G41A 1RXWA 3EPIA 1PH6A 9ICQA 4A3KG 4A3BG 1NKEA 1NE3A 3SI8A 2AJQA 4QZBA 4DL5A 2Q2TA 3HOXG 3U4ZA 2JNHA 1IM4A 4JCVE 1X55A 5KT5A 1H38A 3ZDBA 4AQYQ 4PHDA 2AMCB 4QL5A 4LF6Q 3AUOA 4DO9A 4NLGA 3CCUA 4YXJA 1BPZA 2CKZB 1I94Q 3F2CA 3UXOA 3L7ZC 3K80C 4YHHL 4C8NA 2K75A 4GNXB 3HX0A 2AWOA 2YTXA 1KQSA 2ES2A 2G3QA 4UB3A 9ICEA 5KFDA 2Q0ZX 2A8VA 1S0MA 1UWVA 3PUXA 4J9SA 1BPDA 3S2DH 5LMNL 4DR6L 1PFSA 1XSNA 2XY6A 2P6UA 3B0YA 2JEBI 3M9OB 4KLFA 4F2RA 1Q1EA 1WHCA 3C23A 3IHQB 2RCNA 3L0OA 3KHRA 2Y1JA 5CA7A 4RQ0A 3ULPA 8ICZA 4BA1I 3S1QH 3RRGA 1TK5A 1MC8A 4YY3Q 3I55A 3JPTA 2BH8A 1NK7A 4UAZA 9ICWA 4DUZQ 4UB5A 4ED6A 3H4BA 3RZDH 5DKWA 1X9NA 1CKMA 1N34Q 1YHAA 4KHPL 3UDXA 5IYDG 4I27A 3RJKA 2C35B 1HZAA 2UUAQ 1N36Q 5KG5A 1GKHA 4IFDI 4QZAA 1G3IA 3K8AA 3I56A 3OJSA 1SL0A 2ZUCA 2LVNC 2NN6G 2WAQG 1VEJA 5KFCA 4F5OA 2JA9A 2NZOA 1NMFA 4MFAA 2R8IA 4RQ3A 4TQSA 2ASLA 4BDPA 3RBEA 1FL0A 4DV1L 2EKFA 2C2EA 2K14A 4NY8A 4R1JA 3G6VA 4F4YA 1IBLL 4RT2A 2BWEA 3BQ0A 5DFLA 1L2FA 4Q8FA 2F4VQ 1TXYA 2JA8H 3CCVA 1J5EL 4X64L 2KHJA 2E8GA 7ICTA 2VNUD 4QWCA 1U5KA 4LFAQ 4Q7JA 2BA0A 4YVZA 4LFBQ 3ZDCA 2XCPA 4ECWA 3PW0A 3TEHB 2VUMH 1Y1WH 1RYRA 2OQKA 5BPCA 5C4JH 3AU6A 4IPGA 3KDFA 3GD7A 3OTOL 2EXDA 4G3OA 4BXXH 1N34L 4RZRA 1ZQWA 1NTGA 9ICJA 4RNMA 3AFQA 4JG2A 4JV0A 4DR7Q 3PO5A 2DAKA 4PZ7A 4QWBA 2ZJAA 1VQDA 1XJVA 1ZQLA 4PH5A 3BU2A 2I5LX 1V9PA 3GIMA 2BCVA 1VEKA 2XGPA 1JIHA 4UAWA 4DS5A 3M4OH 4KI0A 1A63A 1KSPA 4PZ6A 3C2KA 2PMZE 2W9AA 5ELNA 5M5XH 3GO5A 4K0KL 3F8TA 3WWVA 2WFWA 2J6TA 3CCMA 1YITA 3F2BA 3RAXA 2F52A 1N8RC 2WZJA 2FLLA 5J0RA 3MXNB 7ICKA 7ICGA 4DLGA 2DKLA 5KFBA 4LW1A 4O5KA 2OWOA 9ICRA 2PI2A 5JJLA 3TQ1A 5DB7A 1TAUA 1EWIA 3HWTA 5KT7A 4FDBA 3PF5A 4KLUA 2KZZA 1RZTA 1AH9A 3I4MH 4OO1I 2UXBQ 1U9LA 2MGWA 5M3MG 7ICLA 4RMFA 5DLQE 2W8LA 3TFRA 3CC2A 2PFQA 3E9HA 3PUYA 3E21A 4R71A 5HHIA 3HT3A 4RUAA 2XY7A 5EWGA 3H0GG 3AFPA 1ZQMA 1XPOA 9ICTA 1U4BA 4B3MQ 1A76A 1HNZQ 4YD1A 1PH4A 9ICCA 2XTIA 3STBC 2L4FA 1SROA 1K73C 1V43A 2PI4A 4KHZA 4HIMA 4UB4A 8ICSA 2HT1A 1MQ2A 3K81C 2KFNA 1KRSA 4YFKA 2DENA 4Q45A 1A5TA 2MROB 4ELUA 4LFBL 2P6RA 5J2DA 4HIOA 3CMAA 4LZGA 4IFDJ 2HHTA 4IQUA 5KFLA 1X9MA 2GVAA 4LFAL 3LWLA 2V9WA 3J80i 1NK4A 4C2MH 1OXSC 1Q7YC 1XTDA 3GV8B 1SG9A 2OTJA 1RPLA 4GN4B 3HKSA 4DR3L 5IT9c 3N97B 1Y14B 2I5HA 3ULLA 2HIVA 3CCEA 5KFSA 4M9LA 1VQ9A 1WI5A 2VL6A 1N48A 4Q44A 2OTLA 1G291 3JPPA 2GVBA 5GAHC 1IL2A 5H1SE 2UXDQ 3C1ZA 4KHPQ 3MR5A 2W9BA 7ICRA 1NJYA 4YMOA 2JUJA 4OX9Q 1XWLA 1BPYA 2EKKA 4F4KA 1IXSA 2KZMA 1O7IA 2FXQA 4DR1Q 5DB6A 4NXML 4L5QA 4QZDA 1L3VA 4HJAA 1HR0Q 3G71A 5KFRA 2JZ1A 4DV6Q 1EIYB 3ZDDA 2MQHA 5J0XA 4LF4Q 9ICOA 5KFMA 1SL1A 3T5HA 3EWAA 4OO1G 1TWCH 1ZMUA 3I4MG 4Z6FA 2ZJPA 1JN3A 3HOZG 2BCUA 4KLEA 3RN5A 1K3RA 4YWKA 2DPJA 1OXVA 1HT1E 5KFGA 4R66A 1GVPA 4F5RA 9ICNA 2HHWA 4KLGA 4BXOA 8ICMA 3K75D 2OOBA 4GOPB 4HYKA 3GV7B 4C3JH 2LVOC 2WB1E 2Z0SA 5J2BA 4DUYL 4AIMA 4L5RC 1OAIA 4OONA 3IRBA 3UXPA 2BPGA 4DSIA 1M1KC 1ASYA 1ZMWA 1XXHE 4DAYB 3AEVA 1C7YA 4JI7Q 3C21A 4B3ML 1KD1C 1KTQA 4JI5Q 2RDJA 5KFTA 3OGUA 1ZQYA 1XO1A 2D0OA 2N8NA 4ECUA 3K7UC 5C44H 1DO2A 4A3JH 3RTVA 3RJIA 1ZQDA 2NVTH 2BQ3A 1VEGA 4DQIA 2L2DA 1EOVA 4JK1A 3TFSA 2VANA 3S17H 1IFYA 4JI6L 3Q8LA 4PG3A 2DAGA 3MFHA 3V7LA 9ICUA 3A0JA 5KG3A 4ECRA 5C4XH 4DR6Q 2UUCL 8ICJA 1RXVA 4DFKA 3M9BA 4PHEA 4DV2L 3T5JA 5FLXc 1X3GA 4I2HA 1BPBA 4BXXG 4A3DG 2NVQH 3S1RH 1VQEA 4NXNQ 3CQZH 2MUTB 2HIXA 5KG7A 5KFHA 3FKIG 5KFIA 4DR5Q 4YCXA 4QZ9A 1N56A 2C28A 4RQ2A 4GN5A 3GDXA 4F3OA 3KOJA 3PO3H 1K1SA 4JI1L 3PV0A 1KFTA 3OHBA 4PMWA 3GLGE 1WJJA 4RQ6A 1S72A 1K8AC 1D7QA 3RZOH 2NVYH 3JPSA 3GTOH 2BPCA 3MABA 4UAYA 4JYAQ 3H8WA 4IJHA 4DV0L 2B63H 1M90C 2HAKA 3UDFA 1HUZA 1QVGA 3Q8PB 1KL9A 4RQ1A 1C9OA 1U0LA 4I2CA 4JV1A 3PW7A 1MN3A 5IWAQ 1JJ2A 4JV5L 1HUOA 1ZQPA 7ICEA 3A5ZB 5KFUA 8ICGA 3M4PA 2LXJA 2BQRA 9ICSA 4X65Q 2JY6B 1VQ8A 5C3EH 4GKKL 3I2ZA 1KRPA 5IINA 2CWBA 5IIJA 4EYIB 2NRVA 2R7DA 1J6QA 4B3RL 4IPCA 1IBMQ 1L3UA 4A3GG 4GEWA 4P4MA 1WCMH 2R0IA 3IM1A 4UBBA 8ICWA 1YJ9A 1ZQHA 1BBUA 3OW2A 4MFFA 5IIOA 4JI3Q 1WIVA 5J2EA 1PH1A 4R4QA 4QW8A 1LUZA 4LF7L 4YCWA 3RJHA 2Z6KC 1PH9A 1VQLA 1W2BA 1KFDA 1VQFA 1ZYQA 4F5QA 4UBCA 2NN6I 2KBNA 5CJ7A 2CWAA 2DGYA 4AYBG 2VQFL 1PZNA 1DGSA 2V1CC 4KN4A 2KNVA 1K1QA 2Y0SG 4JI6Q 1SKRA 3RRHA 1JMSA 1N33L 3KDFB 1ZJNA 3BZCA 1PA6A 1Z00A 1ZJMA 2CQOA 4GNXA 5DGBA 3RH5A 1KLNA 1NK5A 1KDHA 4DR2L 7ICPA 2PI5A 1SN8A 2JZBB 1EQQA 3FKIH 1I3QH 1QVCA 1JJGA 4K4HA 3PIPA 4I2BA 2VZAA 4L5SA 2JA6H 9ICHA 1E94E 2OO9A 2W9MA 5KT4A 3TAQA 2R7FA 4B9LA 3Q8DA 2BDPA 2KN7A 4ED3A 4I2JA 2FMQA 2CWPA 4UB1A 4RPYA 4JI4L 2JA7G 2W8KA 2N49A 1EFWA 3H0GH 4GLXA 3RJEA 3FDSA 4QY7A 1KC8C 4DV5L 4DR1L 3JPNA 4ME3A 3OSPA 1D9DA 2HHQA 2KCTA 2I5MX 4JWNA 3PMNA 4QZGA 1D9FA 8ICLA 2HQLA 1SMXA 4DV6L 1U49A 4FS1A 5J29A 1VQPA 2R6GA 1X65A 4KLQA 1R9TH 1WR1B 4DL6A 1Y8GA 3OSNA 1ZQAA 2QSFX 3C5GA 1CSPA 4MEYA 3V7KA 3J80c 2MNAA 4QQBX 1NV8A 3TI0A 2QEXA 3ISBA 3GLHE 1K8GA 4ZH4A 2AGQA 5FLMG 1XNRL 4DV4L 1S97A 5M5WH 1S0OA 3RJJA 1VCIA 3C2MA 3V6HA 5F9LA 1OXTA 4J9OA 2IX1A 1COOA 1LV5A 2E2JH 4I2FA 4NLZA 3EBEA 4O3PA 5IP7H 1NK8A 2XO7A 2ZJ8A 1L3TA 5KT3A 4QZFA 3LDAA 4KLIA 2A1AA 4A3IH 3HOVG 4JI2Q 3RR5A 1GD7A 4R4CA 5L1JA 1TFRA 1T4GA 4KLHA 3PX0A 1VQIA 4UN2B 2ZJQA 1KIXA 4C3HH 4RT3A 3OJUA 3MDAA 1QTMA 4X5VA 4FS2A 5J2JA 4RNNA 4R4IA 5J2GA 4Y7NH 1ZMVA 4I28A 2R92G 3TARA 4O3SA 1QSYA 2B29A 3HFZB 1VS0A 1E22A 1D8LA 4OWTB 5LMNW 2V4RA 4F2SA 3U4VA 3BDPA 4A3GH 3THVA 3PUVA 1QZGA 4DQPA 2BHNA 3V6JA 1IM2A 2ASJA 4LNQA 3J7A5 3PSIA 4JI0L 1Z9FA 1R4GA 4DL2A 4J9KA 4IQTA 3PW4A 1U47A 1PVOA 1P16A 3E9IA 2LVAA 2EIFA 3KHGA 5M3MH 2OOAA 1XNRQ 7ICUA 2RRUA 4A75A 8ICFA 2AGPA 1SR3A 1UA1A 4LF8Q 1QVFA 2C2RA 5C4XG 1OKSA 2MUTA 3UE0A 4OXPA 3G48A 1PH2A 5KFOA 2LVQD 1F4IA 4PGYA 4GXIA 4QWDA 3LCVB 2JY5A 1WGNA 1NOMA 1Q82C 4PZ8A 4P72A 3Q8KA 5GADC 5JJIA 1MQ3A 4F2LA 1P3QQ 4ECVA 5CWRA 1QSLA 4YD2A 2PI2E 3CCQA 8ICYA 4PHPA 3PGZA 2MO0A 2JA8G 4OWWB 4TQRA 1YJNA 2UVUA 2EJSA 8ICBA 4EZ9A 1XNQQ 4JYAL 3TS2A 4JI3L 3S2HH 1XU4A 3MR2A 3EIVA 4GXKA 4DOAA 3HOYH 3S1NH 1PV4A 1BPEA 4EYHB 5IYBH 5GAGC 3QZ8A 4NM2A 5DQGA 4FBUA 4O5EA 4DAMA 1ZQGA 4JI5L 4ED7A 2F1IA 4DV4Q 2P66A 2C2DA 2HHSA 5M5YH 1Z3EB 3TS0A 2QHOB 3I7FA 1KAWA 5GQOA 4F4WA 8ICPA 1L1OA 2ID0A 3E46A 4QGUA 2NVXH 4GKJQ 1IBML 3PV8A 3C1YA 3GTKH 1JXEA 3VDYA 5J2FA 5HNKA 2LYHA 2O25A 3DM3A 3MGIA 1VQHA 1Q12A 2AKWB 1NK9A 1WCMG 4YG2A 4J9RA 4C8LA 5JEAG 4JI8Q 1A8VA 4M0AA 4X6AH 1SL2A 3BJUA 8ICOA 2XGQA 4JV2A 3MFIA 2WP8J 3CCRA 1VQBA 3BJYA 4R8UB 4EX5A 5KFJA 4LF6L 4ELTA 1ZQSA 3HOVH 1NBWA 4UY8C 1CKOA 2KENA 1N33Q 4DSFA 1I50H 4IR1A 1HZBA 3UPQA 3AQQA 2F4VL 3UQ0A 2VQFQ 1HNWQ 1L5UA 3EPGA 5JEAJ 4X65L 2B63G 3HOUH 1CUKA 1DV0A 3K9OA 4ECQA 4HIKA 1YVCA 4KLDA 4K4GA 2AHOB 5BR8L 4P74A 1MJEA 2PXIA 4JOIA 1ZQFA 7ICNA 4DLEA 2R7ZG 1NK0A 4P73A 1G51A 4TUQA 3RR7A 7ICVA 1YNXA 3EZ5A 3I4NG 2GWSA 2MFIA 1D8YA 2VUMG 1AIPC 1UT8A 2HWJA 3RLFA 1GM5A 1L1OC 2FMPA 1WCLA 1GO3E 3ICEA 2K52A 4DUZL 1ZQZA 1Y1VG 3S1MH 4BA2I 1BGXT
chains in the Genus database with same CATH superfamily
2XC9A 4G4OA 3KLSX 1XMQQ 1B22A 4O3MA 1T3TA 4OVZA 5ALVA 4TUSA 2QILA 4XT3B 5KFYA 2CW0C 1RDPD 5HGQA 3KFUG 4YXMA 1LT5D 3M8SA 1EXNA 3ZD8A 4C4TA 1JX4A 2F0PA 1EY8A 3NEMA 1N77A 1JOQA 5G5GA 1LYLA 1U48A 2A68C 4HJ7A 4Y28F 1EQVA 4ITQA 3UGJA 3KXEC 4AI6A 4B9VA 1Y1VH 2EYOA 3PZPA 5CHGA 3LWEA 1TS4A 1S0VA 2EE1A 3LMMA 3U60A 3IDWA 5L1MA 4ECXA 2WACA 4TKOB 5ELDA 4LZJA 3KHHA 4YHHM 5IY0A 4MGZE 1LVHA 1SE8A 2RP5A 3I1YA 1STNA 2PQAB 1L0YB 4RHRA 2YN4A 3H0MB 4R7GA 3IKJA 2VY3A 5AKJA 3KOZE 5KG0A 4M1UB 5HP4A 5IT9L 1BQQT 4DBGB 3OPOA 3B7QA 4RGOS 5IGFA 1Q86C 2QCUA 5EE3A 3KFUA 3FMCA 3BS1A 4AKGA 3BS7A 3GQCA 4K0KQ 5FK9C 1LM0A 5EKKA 5AKIA 1CA5A 2DL0A 1TWHB 1E1OA 2KCMA 1OFIA 2FH0A 2C9CA 5AK4A 3V6KA 2KSOB 3KZXA 4QIWE 1L3SA 2KTQA 3FUUA 3HHYA 4LF6M 4QZIA 2JH7A 1Z1BA 1LV7A 3Q24A 3RN2A 4HTHA 1SFOH 4QW9A 3U58A 2UUBL 2MJ5B 2KICA 2R8JA 4O3RA 3GTQB 2KZ3A 5KNIA 7ICSA 4LZDA 3W2DA 1LACA 5IGGA 3AQEA 4RF1A 3PW2A 3NTKA 4KX5A 1TWFB 3TADA 9ICKA 1ZXIA 5E4WC 1KRTA 1HFNA 1XS9D 1V1PA 1Z7TA 5D4BA 2FI1A 1G8ZD 4NL9A 3HJQA 3RJGA 4KLOA 2Y0SB 1AZQA 2VA2A 2K4EA 4N9PA 3WKAA 3NGDA 2ISPA 3GPPA 5A2QE 3S1NB 2D62A 2NRXA 3ICXA 4HJ9A 2CUZA 8ICAA 5TZVA 4QZEA 3VK8A 1N78A 2CXYA 3EUB2 4OGQC 1XSLA 2JRZA 2KK0A 4LF9Q 2AQ0A 4GOPC 4O3QA 4EX7A 1PGYA 1EQRA 2UXBL 2ZIXB 3RLOA 3HX3A 5KFPA 2EYMA 2K5DA 3KF6B 3CMEA 3B74A 4JK1C 1ET9A 1QAMA 2IPKD 1JMCA 1V33A 1IXZA 3GZFA 2ZIUA 3SFZA 2VIIA 5ALZA 4I2IA 1NCVA 5JPMC 4PHAA 2K1BA 2LKYA 2NO4A 3HOWB 2X6GA 4LWCA 3Q8MA 3C3EA 1E9SA 3AL0C 1XNSA 4FF1A 2AQ4A 5AI8A 2MPMA 5DBCA 3P1HA 4IR9A 3NVYA 3Q8QB 4YMNA 2QDBA 3DXJC 5BN3A 3FTDA 1IXRC 5EOZA 5C6AA 1VQNA 3CQZB 5C0XI 3M0EA 1AE3A 3HP6A 4JI0M 1AE2A 2L9HA 3ITPA 3S14B 1ZQQA 3A8IE 3NQIA 2VQEQ 2FOIC 2Z9HA 1B4OA 2N55A 2F0UA 1BCPF 1O80A 2K6AA 1NO1A 3RGPA 4F91B 3VCBA 1AW7A 4P75A 7ICJA 2OH2A 3BVMA 2OQ4A 4NXNL 4CRXA 3KJPA 4LF7M 1KXLA 4IBCA 2QNJA 5KG1A 1GUGA 1Z5AA 3AQFA 4R4OA 4CJ1B 4WJ4A 4CDGA 3ZD9A 5DQIA 1NJXA 1B0XA 4RU9A 1W3SA 8ICNA 3TP8A 5I2XA 2RVLA 2XCAA 4X62L 5HR6A 3FP9A 1X3PA 1PJSA 3RB0A 2XY5A 4IRCA 3KK7A 5CV8A 4A3IG 4RQ7A 2F8KA 4WJ3M 1HPCA 2DHYA 1ZYRD 1VDLA 2A19A 4HSVA 1TV9A 4FCTA 3OYYA 4ZCKA 5DDYA 2PW5A 2CFMA 1NJIC 1BVSA 2F4VM 4O3OA 2JXNA 7ICMA 9ICLA 1L0WA 1W6JA 4R8IA 4Y7NB 5IILA 2YTYA 4MGHA 4LJ6A 2YTVA 4BY7H 1EYCA 1OQYA 4BBRH 3CC7A 3GTMH 4NXZA 2UU9Q 4B3TM 3AU2A 5DDMA 8ICVA 1CZWA 2QA4A 2JA2A 3SAGA 1GUWA 2OXOA 4X66M 5KGUA 2NO5A 4ED1A 3GIIA 5AK5A 3ULJA 3UDGA 3HOYB 4CF5A 2K47A 4BWJA 1NR4A 5ALJA 3PR4A 4J8QA 2UVVA 4ECYA 4KJOA 3J81j 3PO3G 3FRHA 2F2AB 2EDGA 2UXDL 1YIJA 5DLFA 5CYUA 2ZUDA 2IT1A 2MO1A 4LF4L 4J15A 1PYSB 1UEBA 2B2YC 1SXJB 5G5HA 4KLLA 2BCRA 1UFZA 3L28A 4NXMQ 2C5RA 4M9SA 4F93B 4OWXB 1DOQA 2VKQA 4OJ6A 3ERSX 1RKNA 3U6PA 4F50A 1RJTA 2K5VA 3KF6A 4JI2L 2DWQA 2J6UA 2G8LA 4JI2M 2NYZD 4L78A 2XIDA 3R9XB 3PO4A 5KFZA 3SAVA 3PNCA 3ER0A 1L1OB 4GN3B 2YTUA 4QZCA 4DF7A 1WFQA 2JJQA 5CV7A 5IE8A 4F4ZA 2A74C 2VXWA 3QG1A 5ALWA 4F87A 1XHBA 1AROP 5DQHA 4NRWA 4P0PB 2JN4A 1HNXM 3GTPH 2L0CA 1IBKM 4Y2SA 3ZDEA 2F0TA 4IUPA 4IZ8A 1TWHH 4ZUIA 5C0XJ 5CBEE 1IBKL 2VW9A 3M8RA 2JK8A 3HPOA 4UP7A 1YHQA 2HHUA 3EN2A 3HU3A 1NZPA 4L5TA 4C3HG 4A93H 4AYBE 5EPKA 2LWXA 4YMMA 2XI9A 3C29A 1JJCB 2B2VA 3FYDA 2WSEF 3GRVA 4KITB 4IUUA 1N36M 3TPZA 2K8BB 1JXLA 3SR1A 4BBRG 2R93G 4H13C 5C18A 2Y0SE 1TR8A 4GNXC 4B3RQ 2IA6A 3W1BA 1WTPA 1GVNA 1HT2E 1L7NA 3R9KA 4OJ5A 5DG7A 1KNAA 1KBUA 4QJFA 1F9RA 1DOMA 1CFMA 2F0VA 1IXRA 1WXQA 1OXXK 1IBLQ 1EY6A 1UAPA 2F4IA 3WK5A 4B3TL 5F9NA 1T7PA 3SVMA 1SZPA 2HHHQ 5BN4A 4RUCA 4NM1A 3FYCA 1RF2D 2LBOA 1X54A 5JJZA 3OTQA 2IJ0A 4PQXA 3WOFA 4CGYB 4A8EA 3S16H 1Q46A 4CCHA 1P8LA 5AKZA 1FJGQ 1HIWA 3HOYG 2DXIA 3ZC7B 2B2UC 1X6IA 1U45A 2A3VA 4P0QB 2VQEM 4OCZA 4K14A 1GABA 2KEEA 5C44G 1AH9A 4LUZA 2F0IA 5C5MA 2SNSA 3HKZB 3H8SA 1A15A 1ZKOA 1IZ6A 3NPPA 4E0DA 3FM9A 3BS5A 4L8RC 4EX6A 5DAUA 4YR3A 3ED5A 5EE9A 4QCLA 4ZK9B 2B3TA 1LTLA 1J2MA 4QWAA 4FO6A 1S0NA 4MNOA 3J7AF 1EYAA 4DV3L 2MU2A 1A3VA 4JI7L 2W11A 3UE0A 4JI5M 2I1QA 3I76A 4IRKA 2PCFB 1S5DD 4LFCQ 2H1EA 1B44D 5EWEA 3H91A 1X9XA 1TVXA 4BY1B 3WKDA 3MBYA 3QOJA 1NVMA 4A3KH 2RKSA 4OX9L 4QNMA 4A3BH 4DR7L 2NRTA 1JR3E 3A56A 5DG9A 9ICGA 1SAPA 3GDEA 3RJFA 3I3CA 3OIQA 5IOCA 5AJ3Q 2DKXA 4DK1A 4DGZA 4A3CH 4KN7A 3CD6A 2M5ZA 4UAVA 2TMPA 1KYIA 5J8YC 3KJOA 3CCJA 1XC9A 4LVSA 1AEXA 3AYHB 2I9GA 2E2IH 2JA8B 2F5QA 3SMSA 4PL1A 4MEXA 2LS01 2J6SA 5ALDA 3EQLC 4DV2Q 1OTCA 4Q8EA 2YNMD 2CHVA 3CW2C 3QUBA 4M9HA 1ZQ9A 1D0KA 2J7ZA 2EUCA 2JEAI 3HS0C 2KHHA 1Q02A 1JB3A 1EY9A 3HEJA 2BKEA 3KTQA 1HH2P 2FINB 3GTPB 3HZXA 3C28A 3H3VI 4H7BA 4A3EH 4AH6A 4GC7A 1T3NA 1C0AA 2HBLA 5EWFA 3M9MB 2R46A 1VJ5A 3N7SC 2W82A 4ED0A 1ZETA 1NUCA 1STEA 4M47A 4I81A 2XSZA 1DGBA 3NBXX 5C4ZA 3VA7A 1HHVA 2K50A 1IN8A 1XPRA 1FVIA 1ML0D 3KF8A 5IP9G 1PHJA 5ALGA 2EQYA 2R8GA 1TT2A 3G6XA 3T38A 4QZHA 1RODA 1YZ6A 1YT3A 1VQMA 2V4DA 4C4SA 3NBHA 2JZ0A 5J0TA 3GPYA 4EEKA 3CPFA 3TWMA 5ITYA 3GFKB 2HHXA 4JUZA 4J9LA 1EY7A 1TWGH 4ZRZA 1T43A 3U60B 3SASA 4EBCA 1I4XA 1UT5A 5KFXA 4DS4A 1T9HA 3C3DA 1ZQOA 5J2CA 3HKZG 3HJSA 5KFQA 2H3IA 3RB3A 1SB3C 2ALYB 4NB3A 4EQ5A 4DV0Q 3HWSA 3H0LB 3UDIA 4IFDG 5IIIA 3I01M 5FTJA 2JYOA 3HRZC 3AFHA 5K36G 1PH7A 2A1JA 2YB4A 4IPHA 3V7JA 1AUAA 1LT4D 4PD2A 5C5JA 2ES6A 1R5LA 3NBIA 1PRTB 4G9BA 3F5AA 5AHXA 4DKAC 5J2KA 3GTMB 4OX9M 2HW3A 4JMUA 1GJTA 4LFCM 3L9AX 4LJ4A 3NXWA 3NSWA 1PUZA 4I29A 2NTSA 1ZRNA 1DK3A 2J4XA 4G4RA 1MGSA 3DHQA 2B21A 2ZAOA 2QARA 2NN6H 2JA5B 4DEZA 1N61A 2IHEA 2X69A 3NK9A 2WB1G 3GTQH 3UQ2A 3GIKA 4DSKA 2IY5B 1JR3A 3RLNA 2ZTDA 2ZIVB 2LYBA 4EBEA 5CV4A 9ICIA 1SYEA 3JPQA 1S5LU 2JR5A 2KE7A 1UNSA 2D5DA 2L5TA 3KLSA 4X64M 1SKWA 3CKIB 1ZQTA 4PG3A 2E5LM 5J0WA 2CE7A 2QB0A 1Q3BA 1X9SA 1GUNA 8ICEA 5ELBA 4WP2A 4KLTA 2DUDA 1QVRA 4NJ8A 2UXCL 4MZ9A 4MGKE 3WK6A 1G91A 2V6ZM 2F0QA 3N4MB 4XDXA 4LF4M 3CU7A 3GILA 3HGBA 2VQEL 1CKNA 4KT0F 1K3BC 5HMLA 2VB2X 5J0QA 3SV3A 2F0FA 4FP5D 4PMCA 5KYLA 5KRUA 1ASZA 1RYSA 3RD4A 2K9DA 3TP5A 2NRWA 3GLFA 1D5ZC 1YLAA 4HR7B 3H4DA 1VMCA 3A74A 5T1IA 3G4SA 4JV5Q 2BCQA 4DOBA 4DR4M 2A6HD 1D5MC 3M4YA 2ICIA 4QJFB 4DV7M 4XT1B 2PZWA 5I6WA 3LQQA 1KDAA 3MR3A 4DR3Q 3KDSE 3OIPA 4A4IA 1WYDA 5E3FA 2QDLA 4A3JG 1CI3M 1N9WA 1XPUA 1IQPA 1QZMA 5CP2A 5G3LD 2AU0A 4DR1Q 4M8AA 1NK6A 2JA5H 4GLVB 5KFKA 5CR0A 4DSJA 4WJ3B 1KHIA 4ODGA 3VA5A 3LK9A 4HEDA 5BR8Q 4AYBB 5DBAA 3SAHA 2BQUA 1YJWA 2UUBQ 4A3VB 4RH6A 4IQVA 3HOVB 3HJ8A 4A3LH 4XIGS 3T1YQ 1EWCA 1Q1BA 2R7ZH 3HOUG 4C0ZA 4LFCL 4GOPA 1N36L 1F77A 3C46A 5J0PA 3ISCA 2H1RA 4QUCA 1WGLA 2M60A 1QUQB 1GHKA 3C2LA 2JA7B 2LMRA 3K9PA 3TWKA 1IBMM 1RHPA 3GTGH 3VDPA 4CIZA 4O3NA 1TWFH 1QZHA 4O0IA 4IALA 5LMUL 5FLXL 1QAOA 2LVPC 1UUPA 4DSLA 3SQIA 2NVYB 3R93A 3PNYA 4EVOA 3RZOB 4LJ7A 4BBRB 1SLJA 5AKXA 4A3FG 3CCSA 5ITXA 4K5VA 5K4LA 2JHDA 4ED2A 4DFPA 3FRIA 2OM6A 5AICA 2OT2A 4XTCS 3GLIE 4DR4Q 4ZPXA 1OAOC 7ICIA 1S3OA 2HD3A 2F44A 3KOWE 2BE5C 1LKYA 2IMWP 3HHWA 3GQ4A 5CV5A 1Z47A 3SK5A 5KEEA 2B8FA 1SE3A 3KSXA 4P71A 2UUAL 3B9PA 4A3CG 1T6OA 5CGKA 1NKCA 2XVSA 3F1ZA 4MH0E 2KVCA 4BBSG 1G4AE 2UVWA 4O5CA 3UXNA 5BOLA 4A3EB 1KNEA 4A3MB 2PPBC 4JI8M 4LF5Q 4EGVA 3PIO3 5KG6A 4F88A 3AV0A 1HR0L 1ZQEA 2Z6BA 3JPRA 4RA8A 1K28A 2UXCQ 4B7HA 1E3PA 1I4HA 2ZTCA 2ZT9C 4GKJL 2N3SA 4B9SA 2AQ3B 4PPXA 3SYKA 3UE1A 2WAQE 4X64Q 1ECWA 2LXKA 1MJCA 3FAHA 1LLRD 1ZQVA 1IV8A 1GOZA 2L4EA 2E8NA 4C8MA 3ETLA 4BXOB 3WKCA 7ICOA 4LUVA 1GKIA 4I2AA 2FMSA 2W9BB 4DSEA 8ICQA 1Y1VB 4R4TA 1VQKA 1SXDA 2ZM6M 1EFID 1X32A 5KT2A 3BBZA 3WHLA 2B2WA 1TH2A 2ASDA 1AN8A 4EZ6A 1PRTF 1HQCA 2P35A 1HQYE 4RHSA 2IL8A 1QQ5A 1K83H 4O42A 5C0XG 4A3KB 3D4DA 2FPKA 2L09A 3KSJA 5FLXS 3K0XA 4KK7A 2LXEA 2XEPA 1CK1A 9ICPA 3HOXH 3V96A 3CC4A 3WHKA 3ONNA 2EH9A 4B9NA 1X6OA 1RDFA 5IIMA 1NJFA 1HA6A 4JBJA 4APVA 2JEIA 2DNEA 4OIJA 3THGA 4KLKA 4L4UA 3MC0B 1DO0A 4I2GA 4X66L 2CRUA 4FVMA 4UP9A 1PYBA 2WKCA 3SATA 2W55A 3RBDA 4FWHA 2K5WA 3TANA 1DGHB 3STBD 2K4KA 3RAQA 3U26A 4FF3A 4B9UA 5IGEA 1Y1WG 3DA1A 4WJWA 1KTKA 3FHWA 1M6YA 1ZQUA 1TWGB 2W7OA 2F3VA 1JRPA 2BDUA 4W5WA 3J7ZC 1QYRA 3GP1A 1NJWA 4I8OA 1ORYB 4Z6EA 1D2NA 2L4NA 3D0FA 4YIJA 2AHMA 3L27A 2CV2A 1QQ7A 5AI0A 1YZ7A 2ZUBA 1K0RA 3M7DA 4DR4L 1OJLA 5H37D 5DG8A 2FHTA 5JJKA 2JEFA 2I6XA 4KLMA 4BY1G 4RNOA 1NKBA 3EW9A 2EO2A 1CSQA 4GC6A 5EKIA 3B89A 5FJ8G 3CCLA 2K4PA 1N63A 1E1TA 4DQQA 4DV4M 2RA4A 2H3VA 1LT6D 2K7VA 3TAPA 3FE3A 3MR6A 1EY5A 5E1FA 2F3IA 4RG1A 4HEOA 3TZUA 5M3FH 1VDVA 3N28A 3F92A 5ALKA 3AOGA 2DWZB 1WCNA 1HXYD 2KXEA 3H0RB 4RGTA 4EQOA 4ECZA 5L1LA 1KEJA 5HHHA 1NV9A 5AM5A 3ND8A 4BJQA 4FXDA 2F0GA 3X3MA 1F9PA 1VQGA 2XLJA 2WTFA 3A8JE 4CISA 1JQJC 1UE7A 4ALPA 3M3YH 3QAUA 3HGIA 3CP8A 2L11A 2Q2IA 1XMOM 4TUWA 3FDTA 3R2TA 3DLLA 5E7NA 3R8FA 2VA8A 3TQYA 1JOOA 3H8MA 3T5LA 1XMOL 3U9OA 4US9A 2CV1A 2IOFA 8ICIA 4YWMA 4PMBA 1ZQNA 2E2IB 4QWEA 5EQTA 4DL3A 1LTBD 1OW5A 2IWHA 4K2LA 1H95A 2HCCA 2KA7A 2BPFA 3H40A 2JEGA 1B8AA 1SYDA 1WG8A 9ICVA 3A46A 3SMPA 4FO2A 4JBMA 7ICFA 4X62Q 2E5LL 2E2HH 1HNXQ 4DFJA 3SAUA 5D49A 4Y2TA 1GO5A 2CFOA 5JTIA 1II3A 1O7ZA 5CR3A 4A3MG 1MX0A 2XGNA 3PVSA 4MN3A 5L37A 4BUGA 2LBCA 3I72A 3RNUA 3RE8A 2HVIA 4CGZA 4ELVA 2DWMA 1I5FA 2D7HA 2W9CB 3U9SA 3HOZH 1X3FA 1E7ZA 4G7HC 2PZUA 2JEJA 4JI1Q 2DAEA 1PTOF 1X66A 1C1KA 4PL2A 2R8KA 3KD3A 1S76D 3RB6A 2HVHA 1CTMA 2AUJD 4QNRA 4IJLA 5JAVA 2PFNA 3J7AV 4QNLA 2X6LA 3NELA 1R2ZA 1ESRA 4AKHA 3SENA 2PMZF 1RIPA 1U4MA 3SZ2A 3E6ZX 1H9JA 1FFVA 2RF4A 3CAMA 3I4OA 5IYCG 1EWHA 2ZM6Q 1AP0A 4CNQA 3RH6A 2QENA 2HI0A 2H5XA 2L6OA 2XSZD 2CV0A 4RQ5A 4JBWA 3EIEA 1I94L 2I7NA 4DNRB 3HW8A 1UPHA 1SNMA 2QKIC 2DY8A 2MJ8A 2PFPA 4KODA 4DUZM 1KKXA 3NENA 1OIZA 3I8ZA 5ALOA 4MTNA 2LTUA 5C3EG 4B7GA 2QKQA 1RU3A 5KFFA 4XGIA 3P7JA 4MTKA 4YR2A 3PXGA 5C1BA 1CEZA 3ORYA 5IP9H 4MF2A 3L2AA 4LF5L 4B08A 4P4PA 3S6JA 1LO5D 4NOOB 5M3MB 1S40A 5DBBA 3A42A 4EBDA 1IW7D 5G3LF 4C3IB 5AI4A 1PK1B 1RM6C 2EDUA 5CB1A 4GXJA 4HIDA 2YY6A 2XFTA 5KFVA 4DQSA 3CRXA 2KJ9A 4FWDA 5KTQA 2PNHA 2FLPA 4EEYA 4B9TA 3TP7A 5KAIU 3VR2A 2CRXA 5A35A 3PY8A 2HDLA 4LF8L 2EANA 1TAQA 5AK3A 2HHHL 2F1HA 2R61A 3LGJA 3D3RA 4GHAA 2KJXA 2JP7A 4Z6YA 3W1GA 1LTSD 1U4PA 1N32L 1S10A 2RRDA 5KYIA 4M9NA 1ESFA 3KHLA 4JC0A 4DWIA 4HL4A 1SKSA 1FJGL 3HOWH 1T8EA 3BDLA 4K8JA 5ITUA 1Y88A 5IP7G 1ED1A 4M6WB 3PMLA 3PVXA 1S77D 1JQYD 3GLFE 5AM3A 2O4XA 2DNAA 4N9TA 1R9TB 3QEBZ 2E5LQ 2FFJA 3I4YA 2J5YA 4L6V6 2PYKA 1FIQA 5KFWA 4M0DA 3QU4A 1HNZM 4UP8A 1C4QA 1HNWM 3HP3A 5C5LA 1PVRA 3U6OA 4YP3A 4XQQA 3T3FA 1EEID 1FFUA 1QQ6A 2DGZA 3BZKA 3K5OA 2QB0B 5KFNA 2KZUA 4B3TQ 3PW5A 4Y7NH 4JOIC 3FYHA 4IPDA 4POGA 2LH0A 3ZDAA 4YY3M 7ICHA 2WSCF 4LAAA 5J0YA 1I4GA 2PO4A 3MXGA 3LWMA 2ISOA 8ICCA 2E74C 3PF4A 1I94M 1H9SA 2ATWA 4XA5A 3O13A 1TY0A 3CXCA 1I6HB 2YQZA 1LV9A 4JI4M 4DV7Q 4H02A 3JAMi 3LX0A 3H7IA 3NTUA 3PIOA 4IBKA 1GO3F 4MGIE 1KSFX 2KHQA 4AQYQ 4IUNA 3T1HQ 4BBSH 4YR0A 3Q8RB 3D2QA 2L15A 4ID6A 3PO2G 1NNXA 1MA7A 2UUCQ 2ATLA 3J81i 4BWMA 1CI4A 3PX6A 3MGHA 1M8AA 2K32A 1JORA 4J9NA 1EIFA 5E26A 1MSWD 1X2IA 3RR8A 1QWYA 1I3QB 1LABA 3QZ7A 5KG4A 3A5UA 1HR0W 4IRDA 2DAIA 1UE6A 4DPGA 2KV2A 1B50A 4TURA 3KLWA 2NRZA 2OEOA 4KD4A 3X3NA 4IOCA 1HUNA 1UE1A 4A3DH 2ZIUB 2C22A 4R63A 2MSNA 2K5NA 4KV6A 3WDNA 2CHGA 3GV5B 2Q8RE 3PR5B 1KDCA 3NE5B 3S14H 3K1ZA 2JZBA 2W04A 5EQ0A 4J9QA 4JW0A 4R65A 3MA2B 3JAMc 1ZQCA 4M9JA 4KLJA 4MFCA 3O0FA 3AN1A 3KYHC 4CJ6A 3E3XA 2ZJRA 2VJ4A 5A2QL 2G9HD 4ZKBB 5JI2E 1BNOA 3IP4B 2B3GA 1DXSA 4A3MH 2NZHA 4JI8L 1N32Q 9ICFA 3OMCA 2LHTA 2DZOB 1A6XA 2KOLA 3CF2A 1VQ5A 3MFGA 5KNCA 1ZV1A 4M0WA 3UM9A 1STGA 2NN6I 2BH2A 4KO8A 1HQMC 4DR2Q 4NLKA 1ZAEA 1HQRD 2UVRA 4DUYQ 3V76A 3SARA 1F0MA 1HNXL 5KPRA 1OXUA 3E2EA 4DFDA 3JC66 3HKPA 1ZQJA 4KY5A 3I04M 4YCVA 4C8KA 2ZM6L 1XC8A 1A62A 4YQWA 2AGOA 1TS2A 1V1PB 1V38A 3IHPA 3QXGA 1EFUB 3QE9Y 3NWTA 2RKOA 4DF4A 1B43A 2V4QA 3T1YL 1S9FA 1QZEA 5KG2A 4TUPA 1ZQBA 2F8LA 2QB1A 2A68D 1V1QA 1X37A 3FVQA 1RQLA 1TKDA 1U9RA 2QF7A 5DNFA 1H9SB 3Q8SB 3WKEA 3HZJA 5E4XA 1Y1WB 3I73A 3AOEC 1XTCD 1IN6A 5L8RF 3H8JA 2B6GA 4IBEA 3K1JA 5DB8A 5DGAA 2YYZA 3H09A 4DV5Q 5M3FG 4DL4A 3U50C 3C2PA 3SV4A 1WCMB 1CHQD 4DK3C 1TTEA 4ACOA 1XWIA 2BDNA 3HOWG 4US8A 3DV9A 3GTJH 3QWNA 1NNLA 3FUXA 2UXCM 4DL7A 1RQNA 1QB5D 2ALZA 2EVBA 2F0NA 1SWVA 1UE5A 2RHSB 3FKIB 3L2PA 4KLSA 3Q22A 2BWBA 1SNOA 3ONAB 3VFDA 4RQ4A 4A3EG 2ZTEA 5L1KA 2HUGA 8ICUA 4A76A 1PH8A 3WK7A 3ISDA 1JWMD 1TS5A 3CP0A 1C48A 5ELCA 5ELFA 2IX3A 1DOKA 1L8LA 2KNZA 5A0LA 3EVQA 1IKMA 9ICMA 2A6HC 2C96A 2EZXA 2F1JA 1O7YA 4IBJA 4WW0A 2EYHA 3GIJA 2K01A 1G2SA 2YMPA 4F5NA 1ENCA 1HNWL 1NY4A 1JB0F 2Y1IA 2D2CC 3S9WA 2GNOA 5HMMA 3M7NA 3U6SA 4Z6CA 1A0IA 1Q8IA 1RCVD 5ELEA 4YY3L 5GAEC 3WK9A 4KKTA 2GQFA 1BXTA 1MU5A 2HBMA 2KVSA 5J2IA 4FXKC 3M4QA 4HAEA 2YMMA 4IFDH 4MHEA 1VQ6A 1LB2B 3M4OB 3HU2A 1PK1A 1S5CD 3G6JB 3ZQJA 1F9SA 2ASBA 3IFTA 3QU2A 1TIID 3FEWX 4CF4A 4CF3A 1COKA 4O0AA 5D46A 1I4QA 4C80A 4NDXA 2DN8A 3C5FA 1EIGA 1CRXA 2LMCB 4FXGC 2A6EC 2XH9A 2B63B 2GO7A 4M9GA 3QUTA 1E32A 1WYGA 4ICAA 1A6SA 3I70A 4P2HA 4HCSA 3TBIB 2LSSA 2BA1A 4YCUA 2KEBA 3MDCA 5KT6A 4GS3A 2MH8A 2DPIA 5J22A 2CCZA 1SXJC 1DD2A 5J0SA 1D6EC 1KFSA 3QUQA 1FNWA 2R3ZA 1H9MA 1WJ7A 1NJZA 4F92B 4RQ8A 2Q2HA 2RCFA 1VQ1A 3M6AA 1EYGA 3LCUA 1MIUA 2F5SA 3KS4A 2K4IA 1ZQRA 1K3XA 1TE2A 2JE6I 3Q6SA 4OIKA 4O2DA 5F2DA 1SJED 1STYA 4JBKA 3GLFB 5KFAA 3I51A 4HJ5A 4UQGA 2G0AA 2WF9A 1WTOA 4HMIA 2L7HA 2M9NA 2XN9C 2Z3XA 2ENBA 1VQJA 1PJQA 4C7ZA 2KVMA 3MXNA 3I90A 4P2CB 2JY7A 4X3KA 3PCOB 4UB8U 1XMQL 4JYAM 3L4PA 3IECA 4U7CA 3KW6A 1JUDA 1Z00B 3S24A 4CJ0B 1ICWA 5I9PA 1D2BA 4DNIA 2FLNA 4IO9A 5HY6A 2QGQA 1F9QA 2R45A 1BPXA 8ICXA 2A69C 3PUWA 4WRDA 1TQOA 5I9OA 3B9JA 2IW3A 1VQ4A 3S1QB 4DXFA 4RPXA 1HJPA 2AQ1B 2M00A 1J97A 2XGTA 1HNZL 1IBKQ 4U6PA 1QCKA 3KOXE 1QLNA 5AKGA 1F2ZA 3B6YA 2HL7A 4MIUA 5IYBG 5EXTA 3A55A 5ALQA 5IWAL 2AXTU 3CF5A 4IBDA 1M4VA 1URJA 4XQ8A 4Q43A 2B2YA 4P4OA 9ICAA 4RFBA 1VQAA 1PZKD 2JA5G 2DFLA 2L12A 2PZTA 3TRZA 3FTFA 3PX4A 1JICA 2WB1B 3D31A 3U6DA 2XVTA 3F53A 2F3NA 4PGQA 4K4IA 3C1EA 1BKBA 4RKLA 4CHTB 3T56B 1YI2A 1I94Q 1K0SA 3QWLA 2XFSA 2N1RA 8ICTA 2OQ0A 4DR5L 2VS1A 4QZ8A 3ETRA 4ED8A 1S4ZA 4RCNA 1XMOQ 1ZQKA 5J2AA 5KPTA 2L7IA 4LK1C 1RL2A 1XSPA 2RSNA 1I50B 4DF8A 3SGIA 4X66Q 5BOMA 1EQTA 3T5KA 2CW0D 1PXUA 2PQAA 5IYCH 2R92H 5DB9A 3B0XA 2VIXA 5ALFA 2EJGC 3C1FA 2CEAA 5L1IA 2HDMA 1B4FA 1NMGA 2BCSA 4JVZA 2JA7H 3QU7A 1YEZA 1G6PA 3F2DA 2Y0SC 1IHZA 4C56C 3U6QA 2YQEA 2KMDA 4DV3Q 3E58A 4QHSA 4XBOA 4Z6DA 9ICXA 3SEBA 8ICKA 4LF9L 3GTLH 1NZBA 5EAYA 3CPWA 4BLCA 4OEMB 4BY7G 2YB1A 4LF9M 3AMZA 2DZLA 4LRSA 4M04A 2HHVA 3MMPA 1LTAD 1PTOD 4LUOA 1I4WA 4LJ5A 5T1GA 1A3TA 1WTVA 3HKZE 3KBXA 5L9XA 1X3EA 5EBCA 4DFMA 2QP9X 1QSSA 2XRQD 2KHIA 1XNQL 3PO2H 1Q8KA 5IIKA 3PUZA 4B3SL 1XNQM 1S5FD 3BQ1A 3E0FA 4C3JB 2EY2A 1VQCA 1PVPA 2C99A 3C9PA 2F0WA 3M9NB 1FGBD 4DV1Q 5ALSA 5CBAE 1PH3A 2KFZA 4LF7Q 1LTID 1QUQA 4C2MB 3I4NH 5C3EB 2GOLA 1HZCA 3IRUA 2DAMA 4JWMA 3TQSA 1B3QA 2WAQC 2ICEC 2M9VA 2IX0A 1MJGM 4IBGA 4G3IA 2Q8IB 2EQSA 2FPMA 2DI0A 2Q2UA 2D7GA 4O9MA 1JE5A 2GN5A 3EYZA 1ZQIA 5J0UA 1A77A 3SYZA 1MKHA 4AKIA 1B1ZA 4RCOA 2BR0A 2I0QA 2P5TA 4DQRA 2RHQB 2QPAA 5KL1B 5AKEA 2PFOA 3BQTA 8ICRA 4J9PA 4C3IH 3MEFA 4C8OA 4K0KM 2ZJ5A 4I2DA 2F0MA 2OCEA 4XUSA 3J81L 3RH4A 5C4XB 4LF8M 2ERCA 2HSZA 2R18A 4FCVA 4JI7M 1SXEA 3L5KA 1UA0A 1B70B 1T5XD 3F5EA 4I2EA 1YHBA 2CP8A 5EJCA 4PGXA 1YBYA 2Y9UA 4Y2YA 1K9MC 2R93B 4CKCA 2NTTA 3R3OA 2AWNA 1JT8A 3VYUA 2NQ8C 3M85A 4Q5VA 4BGDA 2YMLA 1HTPA 1EZ8A 1ZRMA 5GROA 2Y0TA 1CKNB 5KFEA 3D8BA 3RB4A 2BGWA 5F3WA 8ICHA 2EY5A 3OOCA 2W9CA 1X9WA 4ILWA 3WOEA 2K5HA 5LHY1 3SD7A 4HCEA 2CPRA 2G07A 5CORA 4II7A 4NPSA 1TH4A 2IHNA 3W3AA 4LJXA 2YV5A 1GJXA 3W5OA 5A2QS 2D0PA 1VG5A 3M7GA 1A3UA 4X3TA 5JPNC 2JY8A 5ALPA 4YN4A 4UARA 2R8HA 5FKAC 3UMCA 4DV7L 5KL8B 2FFKB 3OTOQ 1PM5A 4OVZB 1NR2A 1QUSA 2MR9A 3I4MB 2RDIA 2JQOA 4DOCA 1DONA 2KJ8A 3KFUF 3DDHA 3FRPB 1ZQXA 1R4PB 4UB2A 1W5TA 4JI4Q 1A2UA 1GHJA 2XICA 2E8MA 3D6JA 2A1JB 3P75A 1Z59A 4FW9A 3QYEA 5FLMH 4AQYL 4IOAA 3K4GA 4DR1M 5B5EU 1MN8A 2PQEA 4B7FA 5CMDA 1NHGC 1Q81C 5D65A 4LF5M 1TK8A 4J9MA 1WTWA 3T1HL 2VA3A 1JB7A 4M2YA 2Y20A 2JA6G 2ZIWB 3W68A 4K5XA 3U61B 4FZLA 1E24A 3K7AH 2DHRA 1TVAA 2WHEA 5AJ3L 2HDOA 4NLNA 1SNQA 5M5WB 4YHHQ 3S15H 2KA6B 1JI7A 2DKZA 2NVQB 4B9MA 1XB2B 4ZAIA 1CQVA 4Y52H 1SV0C 2IHMA 2YX8A 3QEAZ 1ONLA 5J0OA 2B39A 2G5IB 3SEIA 1B2TA 1BCPC 1LKYB 1OTRA 2FNAA 1B7YB 2KNAA 3IN5A 1VQOA 2R65A 1Y8NB 2F0LA 1SXJA 4YWLA 3GQ3A 4HJ8A 3H3VH 1PH5A 4KHPM 4FZNA 3RF9A 1O78A 3FUTA 4JN6A 3J81E 1J5EQ 2WKDA 3MHVC 2MAXA 1JC7A 3RUZA 5KQDA 3S17B 1H6UA 3KF8B 3V72A 1VQ7A 2UUAM 2IBKA 1WOCA 5J3BA 3SHFA 3H15A 1XX8A 1XMQM 1EEFD 1SDFA 1V92A 3T6PA 4F4XA 1DYQA 4X3UA 4DAYA 4ECTA 3JAME 4GKKQ 4A3JB 1SRUA 1KQQA 3TREA 3QB3A 4KTQA 3ZYYX 4F5PA 3QJYA 4BY1H 1TK0A 2K0BX 2RBMA 4KMUA 1IYJB 4MM3B 2KIWA 3JPOA 1I6HH 2KP7A 4TQUS 2F0JA 4DK6C 4A3FH 3PNVA 1BNZA 4GH9A 3R2IA 5JVG3 5EXXA 1L1ZA 4Y2UA 2FPLA 3H4JA 4F8RA 2AUKA 2KCCA 3NUCA 3VDUA 3T53B 3VLFB 4XRHA 2N78A 5IYDH 4DR3M 4UPAA 2UU9L 3UK6A 5LMUQ 1EY4A 2RDFA 4NP5A 4POFA 3L3FX 3KBGA 5ALEA 3ZJYC 2HBKA 4R8UA 2ZAMA 2IHFA 3OHAA 1EUJA 3KOOA 5FJ8H 3BDOA 5JUMA 1K8MA 4DFAA 1X56A 4Z9CB 4A3LG 1J5EM 4GLAC 4V0BA 1ZXTA 5ITRA 4ECSA 1BBWA 4A3IB 3QIAA 2YU9H 4UAUA 4F71A 1HTLD 3TL4X 3PSFA 3TADC 3R8BA 4MGYE 4BS9A 4F1IA 1SYCA 4IQWA 1KAAA 2Z6KA 3G6EA 5ISRA 4ME5A 1EZ6A 3QYBA 2LM4A 2BOSA 4R64A 1L2BA 4J6HA 3G6YA 1NSFA 2IOFK 4UATA 3E0EA 2G09A 3I4LA 3U6LA 3TN2A 9ICBA 2Z4IA 2UXBM 3TKAA 1L8OA 3GO8A 1SFOB 4JI0Q 5FO9B 1MSHA 2R93H 4AW4A 4RPZA 4MF8A 5DLGA 1JCKB 4M6WA 3BQ2A 5J2HA 1IKLA 5LMNQ 2ZXOA 3NBHB 1O7LA 4A93G 1E9RA 7ICQA 2FS1A 3CTWB 1UM8A 2H3ZA 2VJ5A 1FGUA 2KCNA 1WTRA 4FYDA 1HZ9A 4FBTA 2F5OA 4UASA 4ABNA 1TWAH 2O5JC 4G57A 2KHVA 3K8ZA 5ALHA 2RDGA 3I4VA 3OSOA 2K8CB 1XYIA 1G41A 2WB1F 1RXWA 1NHWC 4LG2A 4NLCA 4GC9A 1IYUA 3EPIA 1PH6A 4Y2JA 9ICQA 3T13A 2A5YB 2R62A 2WAQB 4DV0M 4A3KG 4A3BG 3DEOA 1NKEA 1NE3A 2RGOA 4AQYM 2CVRA 3SI8A 2R4JA 2AJQA 1I4PA 4ANRA 2DWLA 4QZBA 4DL5A 2Q2TA 3HOXG 5C3XA 3GTLB 1UHUA 3K2LA 2JNHA 3U4ZA 3JR5A 1IM4A 2BCOA 5AKYA 1LTTD 1X55A 3F2UA 4JCVE 5KT5A 4G7OC 4AZFA 1H38A 3GQ5A 3ZDBA 2EYLA 1X6JA 4PHDA 1PFBA 2K60A 4GIBA 2MGSA 2AMCB 4QL5A 3GTGB 1QJOA 4LF6Q 3AUOA 2F5NA 4GHLA 3ZH9B 2FMCA 4QB4A 4DO9A 1PJIA 1D0MA 2LHGA 4NLGA 2B2WC 1Q3UA 3CCUA 4CDFC 3AJIB 2E2HB 4FE3A 4YXJA 1BPZA 2CKZB 1TS3A 3F2CA 1PRTC 3UXOA 3BYYB 3L7ZC 2F0HA 2JV3A 4S12A 4IN3A 1PFNA 3K80C 4QF4A 4C8NA 2K75A 4YHHL 3HG9A 3MGVA 2CHQA 3HX0A 2AWOA 2YTXA 4GNXB 1KQSA 1U4LA 3HU1A 4FF4A 1ENFA 1K83B 2C98A 1IY0A 1KLGD 2ES2A 4KLNA 2G3QA 4HSPA 3J7BA 4Q0FA 4CDCC 4UB3A 1NNUC 2N35A 9ICEA 1XXGA 1BOSA 5KFDA 2Q0ZX 2QW7A 4WORA 3UI2A 4C1NI 4RQNA 1Q3LA 1ZD2P 2A73B 2A8VA 1S0MA 1UWVA 3PUXA 2VDBB 4XYQA 4LJAA 1L7OA 4J9SA 3GRRA 1BPDA 3S2DH 5LMNL 2JXMB 1PK3A 3FC4A 4JI6M 4DR6L 1PFSA 4LZZA 1XSNA 2XY6A 4L15A 2RDHA 2P6UA 2B0CA 3B0YA 2B2TC 2JEBI 4GC5A 2E1EA 3M9OB 4KLFA 1CHPD 4DR7M 4F2RA 1Q1EA 1WHCA 1IBLM 3C23A 3IHQB 2RCNA 3L0OA 5FTMA 3KHRA 1FR3A 3VKHA 5AM0A 3NASA 2Y1JA 3ZCBB 5CA7A 4PT5A 3FTCA 4RQ0A 3ULPA 8ICZA 1SYGA 1VF5C 4N8X1 4J1MA 4BA1I 2HQEA 4BX9C 3RRGA 3SXHA 3S1QH 3BZDB 2L1BA 1TK5A 1MC8A 3LYSA 4YY3Q 3I55A 3T79A 2DY7A 3JPTA 2BH8A 1NK7A 4LRTA 4UAZA 5EP3A 9ICWA 4DUZQ 2HHHM 4UB5A 4ED6A 3H4BA 2XZFA 1RYUA 3RZDH 1HEKA 5DKWA 1X9NA 1CKMA 1N34Q 4L16A 1YHAA 4KHPL 3W0FA 3UDXA 5IYDG 4I27A 1HA5A 1QQWA 3EFXD 2C5CA 3RJKA 2C35B 1HZAA 3TE6A 2G06A 2UUAQ 4FF2A 1J09A 1N36Q 1J2NA 2FDRA 5KG5A 5AFWA 1GKHA 2EAPA 4ZKCB 4IFDI 1DRGA 1TH3A 4QZAA 3DM1A 3PO3B 1G3IA 2XIWA 1ZD4A 4RWSC 3K8AA 3QNMA 3MJ5A 3SR6A 3I56A 2WSFF 3OJSA 1SL0A 2ZUCA 2LVNC 2NN6G 2WAQG 1VEJA 5KFCA 3HKZC 4F5OA 1KABA 2JA9A 2NZOA 4JB3A 1NMFA 1NY6A 3GLIA 4MFAA 4LCBA 1KW4A 5GTIU 4RQ3A 4TQSA 2R8IA 2ASLA 1ET6A 1JOKA 3ILKA 4BDPA 1YUBA 3RBEA 1FL0A 1SYFA 1DGJA 2HBJA 4G4KA 1UCVA 4DV1L 2EKFA 5IWAM 3U61A 2C2EA 5NUCA 2TSSA 3DWQA 5F3XB 2K14A 2UUBM 4NY8A 1R6BX 4PDGA 5M9OA 4R1JA 4KJNA 5M5XB 3G6VA 5KNBA 1L2DA 4F4YA 2QCPX 1IBLL 4J03A 2FE9A 2BWEA 3M1YA 5AKLA 5FP0A 4RT2A 5DFLA 3BQ0A 2E75C 4DR5M 1SGGA 1HFGA 5DYGA 1L2FA 4E6IA 4Q8FA 4HMJA 2WAQF 1LTRD 2F4VQ 2OYYA 1TXYA 3SAWA 4OO1H 2N88A 2JA8H 3CCVA 1L6NA 1J5EL 3GRUA 4X64L 4CE6A 2KHJA 2E8GA 1IY2A 1XWEA 5M5YB 7ICTA 2VNUD 5ALNA 4QWCA 1U5KA 3WK4A 4Q7JA 4LFAQ 4KN7C 5K5PA 3DFZA 4QIWF 2BA0A 4PJ0U 4YVZA 4LFBQ 3ZDCA 2XCPA 4ECWA 3PW0A 3TEHB 2VUMH 1Y1WH 1RYRA 4JI1M 2OQKA 2EPBA 5BPCA 3H3VC 2F76X 1X42A 2H3QA 3GU3A 1Z19A 5C4JH 3AU6A 3Q23A 2ZXHA 4IPGA 8CATA 3KDFA 3GD7A 3OTOL 3SMVA 4GIPA 2EXDA 2IOHA 4G3OA 1PRBA 1VDDA 4BXXH 4Y2XA 4RZRA 1ZQWA 1N34L 1N60A 1NTGA 3DMUA 9ICJA 5FOBB 2KIVA 4RNMA 1G71A 3AFQA 1ICFB 4JG2A 4N8FA 3A8KE 4JV0A 1YE9A 2E5SA 4DR7Q 2X4AA 5I6YA 3PO5A 2DAKA 4IBBA 3NTIA 2D8CA 4QWBA 2ZJAA 4PZ7A 1T94A 1HRJA 1VQDA 1XJVA 4Y2VA 4CDEC 3K1RB 1QE6A 1ZQLA 4L6TB 4C7YA 4PH5A 3KP0E 2F0DA 4FCWA 3KS8A 1EU4A 1STBA 4HAIA 2JWSA 5ALIA 2XNAC 3V2TA 5DNYA 3BU2A 2I5LX 1V9PA 3GIMA 3K57A 2BCVA 5CEHA 1VEKA 3U5ZA 1K8OA 1L1TA 1SV0A 2XGPA 3Q8GA 1OUQA 1JIHA 4I65A 3J27B 4DUYM 4UAWA 4DS5A 4CBVA 3M4OH 1V85A 1SNDA 1LT3D 3CRKC 4KI0A 1A63A 1KSPA 4PZ6A 5EE1A 1FNUA 3KBBA 3C2KA 2PMZE 2W9AA 3CGWA 1Z1VA 1STHA 4ZUJA 3JAMS 4P0PA 5EP2A 4KKUA 4R9WA 5ELNA 5M5XH 3GO5A 4K0KL 2F0OA 4RGNA 1CA6A 4OL7A 3HOUB 3F8TA 3WWVA 2NZ1D 2WFWA 5KIXA 2J6TA 1QNKA 5JVH3 3CCMA 1YITA 1JALA 3F2BA 3RAXA 2F52A 2KG5A 1N8RC 4D82A 2WZJA 4RNAA 1A0PA 3CNHA 2SDFA 4K5WA 2FLLA 5J0RA 3MXNB 1DGHA 7ICKA 7ICGA 2M2LA 4UHVA 1XXHB 4DLGA 3SK6A 2ZIXA 4KMUC 3TWLA 4O1NA 2G9DA 4H0LC 2NBFA 2DKLA 1OIPA 4REZA 3EA6A 5KFBA 2K03A 4LW1A 1BUVT 3GPXA 2HOFA 4O5KA 2OWOA 4XQNA 2QBYA 9ICRA 1L2CA 2K04A 2PI2A 4A3GB 5JJLA 2FJ2A 3TQ1A 5DB7A 2EY1A 1TAUA 3SAFA 1EWIA 3HWTA 4CKEA 5KT7A 4KTAA 5IGCA 2DF4B 2MA1A 4NSRA 2UUCM 2W43A 5LMNM 1JR3D 4FDBA 4F8MA 5IIFA 5C44B 4BBSB 3PF5A 2OHFA 4KLUA 3MZ5A 2KZZA 2ZANA 1Z5CA 5AI5A 1RZTA 4XYOA 5BPVA 4FNFA 1F2MA 4OD0A 3I4MH 3U5ZB 4OO1I 2UXBQ 1U9LA 1VMPA 2MGWA 5M3MG 3NP8A 4USAA 7ICLA 4RMFA 5DLQE 3KKAA 2W8LA 3TFRA 3MAQA 1MHWC 1LTGD 2HMXA 3CC2A 2PFQA 3E9HA 3PUYA 3E21A 1KDBA 4R71A 2KQ3A 5HHIA 4UB6U 3LVWA 3HT3A 4RUAA 4A3FB 2WINB 3J7A5 1QG7A 2XY7A 1FYCA 4DCCA 5EWGA 2OXPA 3H0GG 5IREB 3A98B 3AFPA 1ZQMA 1XPOA 1QH9A 1YNJD 9ICTA 5AKHA 1U4BA 3OMGA 4B3MQ 1A76A 1HNZQ 4YD1A 3DZDA 1MBYA 1EE8A 3W67A 3G7LA 3NTHA 1PH4A 2F5PA 2DVWB 5LMUM 9ICCA 2L4FA 2XTIA 3OWEB 3STBC 2KKPA 1SROA 3MFYA 1K73C 1Q90A 2PI4A 1V43A 4KHZA 4AG6A 4UB4A 3VYTA 4HIMA 3GTKB 8ICSA 1TWAB 2HT1A 5ITQA 5ALUA 1MQ2A 2HCFA 1CT1D 3K81C 2KFNA 1KRSA 2NVXB 4YFKA 2YFQA 2Q2EB 2DENA 4JPBW 3S2DB 1F2LA 4Q45A 1SEBD 4KX3A 4LFBM 1A5TA 2MROB 4ELUA 2NV3A 1SXTA 4WFN3 4LFBL 3C3LA 3GLGB 4B9WA 4FWGA 2P6RA 5J2DA 4R8NA 1G59A 3SK8A 3J81c 4HIOA 3S15B 5J39A 3CMAA 4LZGA 2Z7JA 4IFDJ 2Q4TA 4IQUA 2HHTA 2KRKA 5FTKA 1KLUD 1GJSA 5KFLA 1ZD5A 1X9MA 4QOZC 2GVAA 3LWLA 5JI3E 2V9WA 2NB0A 3J80i 4LFAL 1NK4A 4C2MH 3I4NB 1GL6A 2KKVA 4UAIA 5AIBA 1EU3A 1OXSC 4P16A 1Q7YC 1XTDA 3GV8B 1PTOH 1SG9A 2OTJA 1RPLA 3MTSA 3T16A 4GN4B 3HKSA 4GZYC 3OW7A 5IT9c 2QEJC 4DR3L 3N97B 2I5HA 1Y14B 3IAYA 4QMGA 3ULLA 5KAFU 2HIVA 4KY7A 1I6VC 2Z1CA 3QU9A 5KFSA 4M9LA 1ZD3A 2DUYA 3CCEA 3DOAA 2VQFM 1VQ9A 3S2HB 1O03A 1WI5A 5CRXA 3KP1E 3ALRA 1N48A 1H9KA 4Q44A 2VL6A 2OTLA 1G291 4P17A 3JPPA 2GVBA 4CJ2C 4DN4M 5GAHC 1IL2A 4H44C 3CF0A 5H1SE 3FUWA 2UXDQ 3C1ZA 4KHPQ 3MR5A 1KN5A 3JR4A 2W9BA 3GLHA 3S16B 7ICRA 1NJYA 4YMOA 2PMZB 2JUJA 3H0GB 1XWLA 2KW0A 2EKKA 4NXMM 1IXSA 1SV4A 1P7DA 1BPYA 4F4KA 2KZMA 1O7IA 2FXQA 3K6OA 5DB6A 4NXML 2Q8TA 4IUVA 4I4LA 3VYRA 4L5QA 4B9XA 4QZDA 2Z4SA 1L3VA 1IW7C 1W6KA 2DJFC 4HJAA 1HR0Q 3G71A 3B7ZA 2BZFA 5KFRA 2JZ1A 4DV6Q 3DEEA 5EXPA 1EIYB 1PTOB 3ZDDA 2MQHA 5J0XA 3HHZA 3OTOM 2ZXRA 4QIWC 4LF4Q 1AQ6A 9ICOA 3KLRA 5CC4A 5KFMA 1OO9B 4BB9A 1SL1A 3T5HA 1OXJA 3EWAA 4OO1G 1TWCH 5BN5A 1Z4NA 4HN7A 1ZMUA 3I4MG 5DYIA 2KRUA 1UQVA 4Z6FA 1FNNA 1DXMA 1JR0D 2ZJPA 1JN3A 1ILPA 3A54A 1YNND 3HOZG 2BCUA 3FD9A 4KLEA 1DK2A 3BVZA 4EENA 3RN5A 1K3RA 5GTHU 2LNHC 3FUVA 4NXNM 1T3QA 2CHBD 3DEPA 4YWKA 2DPJA 3M6KA 1OXVA 1HT1E 3VK7A 5KFGA 4R66A 2I7PA 2A6ED 2V1UA 2L55A 4BBAA 3K7AB 1GVPA 4EQPA 4F5RA 9ICNA 3DWAA 2HHWA 4KLGA 4KN4C 3GRYA 4BXOA 8ICMA 3K75D 5CV9A 2OOBA 3CF6E 4IJFA 4HYKA 5FTNA 4GOPB 5ALMA 3GV7B 2DBYA 4C3JH 2LVOC 2WB1E 4Z8XA 3W0LB 3HKZF 2Z0SA 5AM4A 2J7NA 5J2BA 4AIMA 4DUYL 4NV0A 1ZYRC 1OFHA 5IT9E 4L5RC 3NRZA 1DGGA 1OAIA 4OONA 1O08A 3UXPA 2BPGA 4DSIA 2RQXA 3IRBA 1M1KC 2QZ4A 1ASYA 4C3HB 3J7YW 1CQFA 1ZMWA 1XXHE 5J1ZA 2HOIA 3IG5A 3S1MB 2EA0A 4DAYB 2ZXPA 3AEVA 3VR6A 1SMYD 2EZZA 1C7YA 4PDIA 1N32M 3FKEA 4JI7Q 3C21A 4B3ML 1KD1C 2X8AA 1Y8OB 4C3IG 1KTQA 1NJGA 4JI5Q 2RDJA 5KFTA 1WVLA 2Z8YM 3N7PD 3OGUA 4BY7B 2R6FA 1ZQYA 1XO1A 2D0OA 2N8NA 4ECUA 5DM73 3IG8A 3K7UC 3PSTA 5C44H 1D8BA 1DO2A 4A3JH 3E0JA 3RTVA 2CQAA 5DEHA 3RJIA 1ZQDA 2NVTH 3BQ7A 2BQ3A 1VEGA 4DQIA 2L2DA 3A0HU 1EOVA 5COYA 4JK1A 3TFSA 1TDZA 4EQNA 2VANA 1DJRD 1C20A 3S17H 1IFYA 4DV3M 2Z4HA 3SK4A 3Q8LA 1ENAA 2DAGA 2AH5A 3V7LA 4AP9A 4D80A 3MFHA 9ICUA 3A0JA 4OHJA 5KG3A 4ECRA 5C4XH 2K05A 2UUCL 8ICJA 4DR6Q 2PKEA 4DV1M 4DV2M 4DFKA 4DR6M 1RXVA 1TR5A 3UMMA 2KEDA 1CM9A 3M9BA 3FPUB 4PHEA 5T14A 3T5JA 5FLXc 4DV2L 1X3GA 1B53A 4DXGA 4I2HA 1BPBA 1QUTA 1PVQA 4MHVA 4V190 4DK0A 2D9UA 4BXXG 4A3DG 5FTLA 2NVQH 3HHXA 3I91A 4IUTA 3J7AS 3T1HM 3S1RH 1VQEA 4NXNQ 1VDZA 3CQZH 4JXJA 2W03A 2MUTB 4Y2PA 3RFWA 2HIXA 1NAPA 5KG7A 2M0NA 1JE4A 4DAVA 5KFHA 2K28A 3OWFA 3FKIG 5KFIA 4QOSA 3KKAC 4DR5Q 4YCXA 4G4QA 3BYTB 4QZ9A 1TY2A 4IC9A 1N56A 4OW0A 2C28A 2WIIB 5EP4A 4F72A 4RQ2A 1DCZA 3GDXA 3ND9A 4GN5A 3RZDB 4F3OA 3KOJA 3PO3H 2PMZC 1K1SA 4JI1L 5I2YA 3PV0A 3TACB 1KFTA 3OHBA 5LL6X 2K6BA 3HY5A 4NWIA 4PMWA 3GLGE 1WTQA 1GL7A 3IV6A 1WJJA 4P0QA 4RQ6A 3EJIA 1IL8A 2QBYB 2ZXIA 2F0EA 1S72A 1K8AC 1D7QA 1SE2A 4DU9A 3N6RA 2V1CA 4Y2RA 2F1MA 3LW5F 2NVYH 5KPZA 3BG3A 3EROA 5K36H 5C4HA 2KEYA 2EYPA 1NI3A 3JPSA 1DOLA 3GTOH 3M6ZA 2BPCA 3MABA 3GLHB 4IBIA 3WU2U 4UAYA 3RMHA 1HCZA 2XWBB 4B3SM 1XNRM 4JYAQ 5JEAH 3H8WA 5EPJA 2R7ZB 2O01F 2Z8LA 1V34A 2W3RA 2Y21A 3FPPA 4IJHA 2LM1A 4FFDA 1V1OA 4DV0L 2B63H 5IGBA 3U6CA 2HAKA 3E4RA 3UDFA 1M90C 4WURA 1PZID 3HOXB 1HUZA 3SBJA 1QVGA 3AOEA 4LMQD