2ZTCA

Mtruva form ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
188
Chain Sequence
GRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 44
structure length 188
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztcA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztcA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztcA01
2OQKA 1NE3A 2WAQE 5C0XJ 2HIVA 2ASLA 4ED2A 1ZJNA 3GDXA 3PX6A 5LMUQ 1E24A 1YNXA 1N36Q 4TQUS 2XGQA 2XO7A 4Q43A 1Q7YC 3W1BA 2XC9A 1UFZA 4ED3A 2AWOA 2XY5A 3LWLA 2N8NA 4OWWB 4BBSH 2RRUA 5DB7A 3JAMc 4K0KL 3IHQB 2PFNA 9ICXA 1NKCA 3JPQA 3CAMA 4DR4L 4G3IA 1QSLA 1YJNA 4PGXA 3HOWG 4YCXA 1EUJA 2WP8J 3A0JA 5J2JA 2K4KA 5J2KA 1I3QH 3EBEA 5DKWA 5J0TA 2K5HA 2FPMA 3T1YQ 3V7JA 1ZQCA 2FMQA 1RL2A 2BDPA 1VQ4A 3E46A 3GV5B 3C2KA 1ZQXA 1XSLA 3U4VA 1YLAA 5KFVA 4JG2A 4NLGA 2BHNA 2JA8H 2V4QA 5EWEA 4DS4A 1JN3A 2KCMA 1WCMH 2J6SA 1TTEA 5KG4A 3TFSA 5FLXc 4NLNA 4PHAA 4JV1A 2BA1A 4RQ5A 8ICHA 8ICVA 4GN3B 4A3LG 2R92G 1L3SA 5M5WH 5KFQA 4F1IA 2UVVA 3MR2A 3PX4A 4WJ4A 1JJGA 4DL5A 3HX0A 4LFCL 4C8KA 4KLKA 3EW9A 1T7PA 2OWOA 5IIOA 1VQEA 1IM4A 1VQGA 3T6PA 4UBCA 1YIJA 2MNAA 2AGQA 1X9WA 3HFZB 4BA2I 3TAPA 1ZQTA 3T3FA 3S1MH 4B9TA 5DLGA 3C2LA 5J0PA 1XPOA 1WGLA 3CC7A 2BPCA 1TWFH 3K81C 5DB9A 1J5EQ 1HQYE 2F1IA 1U49A 3TQYA 4LFBQ 5IYDG 4M6WB 2BGWA 4IRKA 3I4OA 1NTGA 1NOMA 3SYZA 1EQQA 4MF2A 1HR0L 2PQAA 4BXXH 9ICFA 5CR0A 3I55A 4KITB 1TK0A 4I2BA 2AWNA 3TANA 4KLTA 2F3IA 3HOZH 4YD2A 2C2EA 2G3QA 3RJGA 2BA0A 3LCUA 5IILA 2AMCB 3PUVA 1MQ2A 2F52A 3GD7A 1T6OA 4A3LH 1E94E 2AHOB 5KG1A 4OO1I 3JPPA 1R4GA 1QSYA 4OO1G 2ID0A 7ICJA 4UB5A 5CJ7A 1Q1BA 5EAYA 4DV5L 4JK1A 1NK4A 4KLEA 4LF8L 1ZQWA 3CCEA 3DM3A 1SL0A 5IT9c 2LBCA 2JE6I 2ZUDA 1PZNA 4GOPC 4BXOB 4MZ9A 4UAYA 5DDMA 1TXYA 3F2BA 2OO9A 4GKKQ 2BCQA 1G51A 4F8RA 4KHZA 1PYSB 9ICNA 3MDAA 3U4ZA 1SZPA 1JMSA 3H8WA 2LXJA 2UVUA 1BVSA 1ZQUA 1KFDA 4YP3A 4AQYL 3M3YH 1XSNA 4LF4Q 4NM1A 2K52A 3UXOA 2P6RA 4DBGB 5GAGC 4EQ5A 1ZQJA 7ICOA 2JA5G 4RNMA 9ICKA 3ZDAA 1VQJA 3CD6A 3I2ZA 8ICLA 4LNQA 1EQRA 4JYAL 4O3OA 3J80i 1M90C 3PW5A 4DSLA 3ICEA 1YJ9A 3UXNA 2PFPA 5JUMA 3J81j 4JC0A 3M8RA 5JJIA 1Q81C 2RDIA 3SI8A 1S0VA 3RRGA 1UT5A 5KFWA 2R8HA 3H4BA 4GOPA 1BPDA 4DS5A 4BGDA 4J9KA 1KQSA 1Q8KA 1KTQA 4ECYA 2UVRA 4RQ8A 2PI4A 2ZUBA 1BPXA 1LTLA 8ICRA 4DL6A 4JI1L 1YHQA 4TUPA 1ZQKA 5KFUA 4JI7L 5CP2A 2NRWA 5DB8A 2FMSA 5LMNQ 1S40A 2DI0A 3QEBZ 1VQFA 1RZTA 3OTOL 2XY6A 2YV5A 2MUTB 2IA6A 1Z00A 1OXVA 3ZJYC 9ICWA 4UN2B 1CUKA 4JV5Q 3EPGA 5FJ8G 5LMNW 4JI2Q 9ICLA 4X66L 3BQ2A 3RB0A 1NJZA 3KHRA 4YVZA 4QWBA 5J0QA 1LV5A 4KLOA 4HJ5A 1XMOQ 4NY8A 4DF8A 5M3FG 3V7KA 3E9IA 2VNUD 2J6UA 4KLSA 3TFRA 3L0OA 4I28A 3U58A 2JA5H 3RJEA 4K4GA 4JBWA 4C8NA 1KFSA 1YJWA 4PGQA 9ICEA 1I50H 4QY7A 4APVA 4Z6FA 3M9OB 1N8RC 2VQEQ 3KTQA 1IBKQ 1ZQGA 1SN8A 1TWAH 4LF7L 4LF6L 4PZ7A 1LB2B 2B3GA 1JJCB 2E8GA 3OSNA 4YCVA 2C22A 2ISPA 1JMCA 1X9NA 5HHHA 3HT3A 2R8GA 4Y7NH 2WZJA 3RN2A 2MGWA 4A3IG 1RXWA 4JBJA 4JI6Q 2BH8A 3RN5A 3KF6B 4JI4Q 4DV6Q 2P66A 5DBAA 1BBWA 1QZEA 4ELVA 2E5LQ 1IL2A 3M8SA 3LDAA 3MFIA 3TREA 4UB3A 4YMMA 1RPLA 2B21A 5KFJA 4HIOA 3TS0A 1PH6A 2JEJA 2EJSA 4P71A 1TKDA 2LVAA 4F4ZA 2QGQA 3C23A 1ZQLA 4LVSA 4L5TA 1SG9A 1U48A 2JEIA 4ELUA 5BPCA 2JEBI 1KHIA 1HUZA 3NTUA 4FO6A 2R0IA 1UA1A 2LTUA 2JA6H 4YWMA 4PHPA 5FJ8H 2FPKA 3GTLH 7ICRA 1BGXT 3H8JA 4QZEA 3I7FA 1MN3A 3F92A 3EWAA 3H0GG 4PGYA 5BOMA 3G6XA 2R7FA 1PHJA 2JZBA 4GC7A 2DAEA 3H4JA 3GLIE 5C4XG 2DNAA 4B9LA 4DUYQ 1JB7A 3JAMi 4A3GG 5KFCA 4DV7Q 5KFSA 4IJLA 1IBMQ 5L1KA 2ALYB 5KG0A 4UB1A 3BZKA 1FL0A 3H8SA 1W2BA 4GN5A 4JI8Q 5C3EG 1B7YB 1ZETA 4WP2A 4YR0A 3M9MB 4UB4A 9ICTA 5IP7G 4DK6C 4ECXA 4JI0L 4DEZA 3QE9Y 2CWBA 1BPYA 2MJ5B 4GC6A 4PPXA 4DSFA 4B3TL 4F3OA 4PZ8A 4XTCS 1N33Q 2VUMG 4A3KG 1NMFA 1DO0A 1QUQA 4GXKA 1WYDA 1VQHA 2KHIA 5IE8A 4IRDA 4J9PA 3RLNA 4R4CA 8ICXA 5EOZA 1A0IA 1HNWQ 4LF5Q 2D62A 3Q8PB 2JA7G 4BXOA 3PVXA 7ICHA 1I94L 4P4PA 4A76A 1HUOA 4DV3Q 4YCWA 3CF5A 3GIMA 1E7ZA 2E2IH 2HHHQ 2XGTA 3NENA 3FRHA 1XS9D 3GTMH 3PO3G 2VZAA 3RJJA 1NKBA 8ICTA 4IQTA 5HY6A 1SKSA 2LXKA 3GDEA 4IJHA 1PH7A 1ZQFA 1AIPC 5C4JH 1UE6A 4YWKA 1ZQVA 5J2CA 4DV0L 4AYBG 2UUAQ 1K0RA 1HZAA 3ISDA 7ICFA 5DDYA 3MDCA 2WFWA 1HNXQ 1MQ3A 3GV7B 4J9NA 4PH5A 2YTYA 2VUMH 3CXCA 2KFNA 4A3KH 3CP0A 1OTCA 1JIHA 3S2HH 1G4AE 1XNRQ 4OX9Q 4XRHA 2F4VQ 1N34L 5EWGA 1VQ5A 2ZM6L 2K50A 5J2EA 1V43A 4DKAC 2A1JB 3RZDH 3S15H 3UDXA 4BY7H 1TAQA 3L7ZC 1A63A 4YY3Q 2JEAI 1PVOA 4P2HA 1PH9A 2VA2A 4KI0A 2JA7H 3C5GA 4IQWA 3HOXG 3RZOH 8ICJA 2JA9A 4NXNQ 5J0UA 4O3QA 2B63G 4Y52H 5KFZA 1PH1A 2EKKA 1PYBA 5FLMG 2IT1A 4DV2L 9ICCA 3TEHB 2YU9H 1VQ8A 4B9SA 1WHCA 2JY6B 2XGPA 1LUZA 4GKJQ 2EIFA 1SKWA 5KTQA 4FBTA 1X9MA 3GTPH 5KT6A 1VEGA 2JQOA 2Y1JA 3NEMA 5KFGA 1CKNA 4DR3L 3W5OA 5GROA 2MAXA 1ZQIA 1XNQL 1X3FA 8ICUA 1XTDA 4TUSA 4ME3A 3GTQH 2KNZA 4MFFA 4ED6A 2BCUA 1L3UA 3B0XA 7ICPA 1MJCA 2Q2HA 5IP9G 1S72A 1ZQDA 4RZRA 3PMLA 3FDSA 4NXML 5IY0A 1NV9A 4ECTA 2DAIA 4DV4L 4QZCA 2R8IA 5C5JA 3UQ0A 4GOPB 2Q2UA 1RXVA 4HIMA 3PW7A 4DO9A 4HYKA 1U47A 4X64L 5TZVA 3CC2A 4I2CA 4KLUA 1UWVA 3C1ZA 4DOBA 4X65L 2B63H 3F2CA 1VS0A 4DUZL 3RTVA 4OXPA 4ECRA 5FLMH 1Z00B 1E3PA 4JUZA 2ATLA 2V9WA 4BDPA 1CKMA 1ZQRA 1X9SA 4JI5Q 4DLGA 1YZ6A 4P75A 2KNAA 1GVPA 2UXDQ 1IXSA 2HW3A 3GILA 2KENA 4KN7A 4DR6Q 2HAKA 3GLHE 3KYHC 1ZQSA 4ED1A 3H7IA 1WOCA 4DR2L 4ELTA 1KL9A 1X55A 4B9VA 2W9BB 1HNZQ 3RNUA 5HMMA 5KFYA 8ICIA 4IOAA 2UXCQ 2YYZA 5IP9H 4F5RA 4JI3L 2UUCL 2RF4A 4BXXG 1S0OA 2KHJA 1N9WA 3V7LA 2L2DA 4A3BH 5IIJA 3HOZG 1EWIA 9ICMA 1Y88A 4IPGA 4I2FA 4M47A 2FLLA 2MQHA 3I4NG 1X54A 3K8AA 1VQBA 2W8LA 1V9PA 1EIYB 4B3SQ 4IOCA 3KOJA 1X65A 1WGNA 4TVAB 7ICQA 1AE2A 1NJYA 1JR3E 1HT1E 3OW2A 3C21A 3W1GA 4UBBA 2W9CA 3GO5A 1WCNA 4AIMA 2HHXA 4DFJA 3TI0A 4YXMA 3S1RH 3G48A 2OTLA 1Q46A 2JZ1A 1YHBA 3K4GA 4AYBE 4XIGS 3A74A 3PW2A 1XPUA 2JZBB 1KSPA 2JUJA 3JPSA 3UDGA 4JV2A 2VA8A 4R63A 9ICAA 4DL3A 5J0OA 4IR9A 2CFMA 2ZJ5A 4Q44A 2CWPA 2PFOA 1XMQL 2I5MX 1Q82C 2VS1A 3Q8QB 4J9SA 2BQRA 4K0KQ 2HIXA 2VW9A 3RLOA 3LCVB 1HT2E 4I2EA 5KFKA 1KXLA 4DR4Q 2NN6I 4R4OA 4A3MG 2A1JA 1NK7A 3HOYG 2NN6G 3QZ8A 5KG7A 2JY7A 3AU6A 1CSQA 2LVNC 4GN4B 1EFWA 5BR8L 3PIOA 5KFOA 5J2HA 2AGPA 4LF9L 3I4NH 1OKSA 3PW0A 4YHHL 4DFKA 4CCHA 3RJKA 3BQ1A 2K9DA 7ICSA 4J15A 1Y14B 4PG3A 2IHFA 3S1NH 1QUQB 4LUOA 4O0IA 2MROB 1COOA 2FLNA 4M2YA 4TQRA 4DR5L 4F2RA 5KFMA 4IFDJ 3KHHA 4F2LA 5HMLA 2IHNA 1IM2A 3S16H 1NY4A 4B3ML 1S10A 3ZD9A 3KJOA 2V1CC 3H15A 3CCLA 5L1LA 3GTGH 5JEAJ 1L2FA 4F93B 4GXIA 3AUOA 4LZGA 4YMNA 5K36G 2XCAA 5DLQE 1T8EA 4I2DA 2HHVA 5KFHA 4P4OA 4C8OA 4MFCA 4LFCQ 1NJXA 5C44H 2L4FA 2D0PA 3CCVA 1VQOA 4QIWE 1UA0A 4YWLA 7ICTA 4O3RA 1RIPA 4NLZA 5DLFA 2F1HA 3ERSX 4BWJA 4AH6A 2BR0A 3C5FA 2NRTA 2I0QA 1MKHA 2DUDA 2ZJAA 3GV8B 3CPFA 2ASJA 4O5CA 2VL6A 4R64A 2DFLA 4J9MA 4UAZA 4IO9A 2PMZE 4UP8A 4A3MH 2CCZA 2KN7A 3HOYH 5JI2E 3V6KA 2QHOB 1SR3A 2K14A 1KRTA 1ZYQA 5IWAL 2BQUA 1BPEA 5J0RA 1NK5A 1VQMA 4EBCA 2KZMA 1TR8A 1IFYA 4R1JA 3Q8MA 1I5FA 4UP7A 2OTJA 1V92A 5CHGA 1HR0Q 4DLEA 1ASYA 1PH4A 2UUBL 2W8KA 2ZJRA 3CCMA 1U4BA 3FE3A 3STBD 3RR7A 2HQLA 4EX5A 1HR0W 4KMUA 2EKFA 3CCJA 2RHQB 4DSKA 2L4EA 4IRCA 4OWTB 4Z6DA 2JA6G 2HVIA 5D46A 1AE3A 2PI2E 5DG9A 2Z0SA 2B3TA 2BPGA 3CCUA 3CPWA 4YN4A 1NK8A 1I6HH 2DAKA 4GS3A 4DV5Q 1K9MC 4K4IA 3J81c 2JNHA 4LF8Q 8ICYA 5JJLA 1S77D 3A5UA 3KJPA 4DL4A 3N97B 5DGBA 4DUYL 1Z47A 4QJFA 2VANA 3PW4A 2WTFA 4DOCA 5EWFA 1NKEA 8ICWA 4LUVA 2ZJQA 4YFKA 2W9BA 8ICSA 3K7AH 4DQQA 3OSPA 1KRPA 3FHWA 2CQOA 4LWCA 2UU9L 3KFUA 1BKBA 3PF5A 3T5JA 1CKNB 4AQYQ 4I2GA 4WJ3M 4HIDA 3RJHA 2GN5A 4LFAL 3E21A 1ZQYA 1L1OC 4KHPL 1K83H 4C8MA 4B3RL 2IY5B 3T5KA 1ZQNA 1DV0A 4DQSA 9ICHA 4YQWA 5J2DA 1G291 4JYAQ 4P72A 4B9MA 2ASDA 4L5SA 3FKIH 1VDLA 5DB6A 4Q45A 4DR7L 5KFFA 1A8VA 2IX0A 2MR9A 1D8YA 4I2JA 2J6TA 3KHGA 5HGQA 1G6PA 4GLAC 5J2AA 4RT3A 4F2SA 2VA3A 3JPNA 2H5XA 4O0AA 3OJSA 3SGIA 4FS1A 2DHYA 5HNKA 2O25A 1KC8C 3F1ZA 3ISCA 5KG2A 4RUCA 4QZDA 1MIUA 3PV0A 4NB3A 4GXJA 5KFLA 4E0DA 4JI1Q 4F4YA 1KAWA 2DGYA 4JI7Q 4MFAA 3PR5B 1P8LA 1X56A 2JY5A 3HW8A 5GAEC 2JJQA 8ICMA 3AFQA 3BJUA 1L1OA 3K9OA 1LM0A 3PUXA 4MEYA 3OGUA 1TWGH 8ICGA 4JBMA 1X3EA 3C2MA 4DAYB 4X66Q 5J2FA 1BBUA 2I5HA 4HEOA 1A76A 4DR1L 1AROP 2UUAL 4KTQA 1H38A 2JP7A 2WAQG 2DAMA 1E1OA 1FJGL 1IBLL 8ICAA 4F5NA 3E9HA 1FGUA 2KZ3A 5IIIA 1SROA 1KRSA 2BKEA 4OWXB 4LF7Q 2A19A 1NK6A 4LF6Q 4QWCA 9ICVA 3BQ0A 3G6YA 4J9QA 5KFTA 4QZAA 3G6VA 4BY7G 2FLPA 2HHTA 4I27A 1P3QQ 4MTNA 3S14H 1T43A 7ICUA 1L3VA 3H3VI 1OXUA 4RPXA 3OYYA 2KFZA 5J0YA 5J2BA 1GO5A 1R9TH 2HWJA 2LVOC 5DQHA 1KDHA 2R93H 7ICGA 8ICQA 1B70B 4XUSA 1DGSA 2OOAA 9ICBA 2R6GA 4RUAA 2YTVA 4QQBX 1GM5A 5F9NA 3RRHA 4EZ6A 4X5VA 1ASZA 2GVBA 2LVQD 4O3PA 2UXBL 1EFUB 5D4BA 4K4HA 3T1HL 2XY7A 4QWEA 3Q8DA 1PA6A 4GLVB 3V6HA 2R7ZH 2W9CB 2I9GA 3E2EA 4QL5A 4DSIA 1OXSC 1YVCA 1QVCA 2K5VA 2IHMA 2LSSA 2NRVA 5J0SA 3MBYA 2C28A 2ISOA 5J29A 1Z3EB 1KIXA 1N32L 4QZHA 1WFQA 5J0XA 4PHEA 1NK0A 3IHPA 2JEGA 5AJ3Q 3FYHA 4QW8A 3RJFA 2CP8A 1JXEA 2R8JA 1ZQPA 3UQ2A 4DV1L 2PNHA 4Q7JA 5GAHC 2HHQA 2IMWP 1IYJB 4R66A 1U45A 2VQFL 3MR5A 2A1AA 4X62L 1EXNA 4C3HH 4JI0Q 1OXTA 1RYRA 4DFMA 3PO4A 1Q12A 1HZBA 5HP4A 4XQ8A 4B3TQ 4EBEA 4IPDA 3H3VH 1A5TA 1C7YA 3RBDA 4J9LA 4DL7A 1NJWA 4Z6CA 2R7DA 2ZTCA 1XSPA 3JC66 2BH2A 2BCSA 4C8LA 1Y1WH 4A3DH 1MJEA 1HH2P 8ICFA 1UE7A 3M9NB 4A4IA 4RG1A 3MFHA 4A3EG 2HT1A 1VQDA 1OTRA 3MR6A 1B43A 5LMUL 9ICQA 1VQCA 3EN2A 4L5QA 1N36L 4A93G 2QA4A 2Y0SG 3JPOA 3RB6A 4EYHB 1PGYA 4R8UA 1A62A 1I94Q 4RMFA 4NLKA 3UDIA 1VG5A 2IHEA 4B9UA 1VQAA 4C3JH 7ICEA 3CCQA 4F5OA 1ZMUA 4JWMA 4F91B 4TURA 2XCPA 3H4DA 3FP9A 2NVYH 4ALPA 5KT2A 1D9DA 3RBEA 1K73C 1C0AA 3PUWA 7ICNA 2PFQA 1YBYA 1JJ2A 3T1YL 3EZ5A 5IYBG 4JV0A 8ICCA 4DV0Q 4O2DA 4DOAA 2UXCL 2EQSA 4F5QA 1JXLA 4A3BG 4R4QA 4BY1G 1IXRA 1S0MA 4I2IA 2W9MA 7ICKA 4LW1A 2NRZA 2KCTA 2LVPC 5KT4A 4KLMA 5KFNA 2AU0A 2GWSA 1JT8A 2BCVA 4MEXA 2K75A 4A3FG 1N34Q 3F2DA 3PY8A 3KDFA 1D7QA 2ZM6Q 3CW2C 1WJ7A 3E0EA 3M4OH 3QZ7A 4O5EA 4A3EH 1TK5A 2NRXA 3S24A 3FRIA 4F92B 3HOVG 4GLXA 3RH5A 2ZJ8A 4A93H 5M5YH 4BBRG 4RNOA 1H95A 4A3JG 3J81i 4POGA 3Q8KA 3A5ZB 3NELA 4RPYA 3DLLA 1PH2A 3BZCA 4J9RA 1W3SA 1WIVA 3HP6A 3CMEA 4R4TA 1TV9A 4ECSA 4JOIC 4QZGA 4DV2Q 7ICIA 2RHSB 3B89A 2E2JH 1NMGA 4LUZA 1J5EL 8ICNA 4LFBL 5IYBH 4HJ7A 3IRBA 5F9LA 2IBKA 3HPOA 5KG3A 1GD7A 2YTXA 5ELNA 1CEZA 4DR3Q 1XNQQ 5D49A 5J2GA 1DOQA 4BY1H 2ZTDA 1N56A 1CSPA 5ELOA 1ZQBA 3PCOB 1UEBA 1MC8A 4UQGA 2JY8A 1AH9A 4BA1I 1XC9A 4PMWA 3G71A 5L1JA 4L5RC 5DGAA 4A3FH 4NXMQ 9ICPA 4R4IA 1XJVA 3MEFA 5KT7A 4DV4Q 4NXZA 4NM2A 4JOIA 3NGDA 3HOVH 5CA7A 2IX1A 1QZHA 4QZBA 4YR3A 3K0XA 4BBRH 4EZ9A 3RAXA 4X64Q 3SV3A 1SE8A 4A3JH 5L1IA 1GO3E 4GKKL 4QZIA 3JPTA 1TVAA 4DSJA 2DPJA 2FPLA 4YR2A 1Q1EA 2DZLA 3CQZH 4X65Q 2HHWA 5IINA 5KFDA 3JPRA 3TQ1A 1VQNA 2NVTH 4DUZQ 4LF4L 5C44G 3S17H 1NK9A 1EYGA 3UE0A 3V72A 3HOUG 1L1OB 2GVAA 3KHLA 3AEVA 4H02A 4ECVA 3LGJA 1QSSA 3OHBA 4Z6EA 1QTMA 4FBUA 7ICLA 4TQSA 1X3GA 1E22A 3MGIA 4C2MH 3IM1A 3MR3A 4IQVA 4RNNA 1ZQQA 1SFOH 3HOWH 5GQOA 2Z6KC 3RR8A 4DR2Q 2BQ3A 2W9AA 1K3RA 1ZMVA 2ZUCA 2HHUA 5DG8A 4QGUA 2LYHA 4RU9A 1X2IA 3MXNB 5CB1A 5GADC 4Q8FA 2UUCQ 4JI3Q 4DQRA 3J7ZC 2C35B 3PNCA 1RYSA 1T9HA 4ZH4A 4O3SA 4I2HA 1JX4A 4DK3C 1S9FA 2Y0SE 1XPRA 5LMNL 2RDJA 1X6OA 1SLJA 1VEJA 3AFPA 2DENA 5DFLA 4DFPA 1Q86C 3HKSA 5BOLA 1D8LA 2R92H 4A3CG 1QVFA 4JV5L 4I29A 1P16A 3TARA 4KLFA 1VQLA 4JI2L 2Q2TA 3AU2A 1ZJMA 4JCVE 1QLNA 1XMOL 4DSEA 2NVQH 3PR4A 2OQ0A 4LZDA 3RB3A 3ZDBA 1YITA 2KHHA 3I4MG 4RQ3A 2NZOA 3D31A 3HOUH 2Z6KA 3ULJA 2P6UA 1YEZA 4DL2A 5JJKA 1ZQZA 8ICKA 4GNXC 2JZ0A 2L15A 1U5KA 5KFXA 1UE1A 1PH5A 5KT3A 3H40A 2VQEL 1VQKA 1IBKL 4RQ7A 2UVWA 5KG5A 1SL2A 4DPGA 9ICOA 3Q8RB 1DO2A 2PXIA 3ZDCA 4JBKA 4UP9A 1WI5A 1YHAA 2Q0ZX 2OCEA 1VQPA 1GKHA 3HKZG 1S76D 2BCRA 4JI6L 1XMQQ 4F4WA 3MGHA 3PF4A 3B6YA 2ASBA 3T5LA 3BBZA 4JI4L 2AJQA 4DV6L 1G41A 3D0FA 4TUQA 5IYDH 3GFKB 2JK8A 2E5LL 2NVXH 3FKIG 3ZD8A 3ZDDA 1TWHH 1TWCH 4YG2A 2Y1IA 4UAWA 1ZV1A 1B8AA 4ED8A 2KZZA 2CKZB 1B22A 4G3OA 1MSWD 5BR8Q 1XO1A 2AQ0A 1BPZA 1XXHE 4LF9Q 4QWAA 1S3OA 2MO1A 4HJAA 4YHHQ 3PO5A 8ICEA 3EYZA 1ZMWA 4IPHA 3WWVA 3GQCA 1XU4A 1VQ1A 2QNJA 4YCUA 4GNXA 4QWDA 2ZTEA 4A3CH 3I56A 1TK8A 3MMPA 3PGZA 1NV8A 4KLLA 4ECZA 3GTKH 4R71A 4OONA 1D9FA 9ICGA 4DR5Q 4RQ6A 3RH6A 4MF8A 2OOBA 7ICVA 2Q2IA 4B3MQ 3K9PA 5IYCG 1ZQMA 3I4MH 1M1KC 4DV7L 2RCNA 3PX0A 4R8UB 1IBML 3EPIA 4UY8C 5J0WA 5DBBA 1KEJA 4RPZA 4JI8L 4YMOA 4X6AH 2NZHA 3BJYA 3TS2A 2CWAA 1U9LA 1EIFA 4DNIA 4B9NA 3RR5A 1WR1B 2K0BX 3M9BA 5J3BA 2A8VA 1XB2B 4KLGA 1S97A 3RJIA 3S2DH 3ER0A 4BWMA 1QVGA 1N33L 2M9NA 5KFAA 7ICMA 1PH8A 1E1TA 3GLFE 1XWLA 4YXJA 1C9OA 4FDBA 1K8GA 4M04A 3GIIA 2AGOA 2I5LX 1CKOA 3ETLA 3TAQA 4UPAA 4J9OA 5KFRA 4EYIB 3UDFA 2QEXA 1HNWL 4LF5L 5IWAQ 1Y8GA 2I1QA 3THVA 4A75A 2R93G 4QW9A 1OAIA 9ICJA 2KNVA 4DV3L 2BPFA 4ED7A 4XA5A 3M7NA 2HHSA 3KDFB 2HHHL 2UUBQ 5C0XI 4PHDA 4M9LA 1KD1C 3V6JA 5C0XG 5HHIA 4M9NA 3BDPA 3RLFA 3K80C 1VEKA 4ECWA 5IYCH 3OTOQ 2R7ZG 2VY3A 1VCIA 4NPSA 2AQ4A 8ICPA 1UE5A 3N4MB 4R65A 3KF8B 1WJJA 5H1SE 3L2PA 2WB1G 9ICRA 4KLDA 4QZ9A 5KFIA 3ORYA 3CCSA 4EBDA 2R8KA 4F50A 2C2RA 3J7A5 5M3FH 5AJ3L 4QZFA 1Y1VG 3M4PA 2PI2A 1U0LA 4QZ8A 1TAUA 1HNXL 4DQIA 1L3TA 1PH3A 1ZQEA 3PV8A 5M5XH 3HWTA 1J6QA 3UPQA 2AKWB 4M6WA 4JWNA 1KYIA 4P74A 1XNRL 5IIMA 2UU9Q 4OX9L 4FS2A 5KFPA 2F4VL 4F5PA 3PUYA 1HJPA 4LFAQ 5L9XA 3AQQA 3GLGE 3RH4A 3M4QA 5M3MG 2ZJPA 4KHPQ 4KLHA 3ISBA 4B3RQ 4YY3L 3RAQA 3G4SA 4A3IH 3UXPA 1VQIA 1VQ6A 2C2DA 1T4GA 5DQGA 3CC4A 1A77A 3C1YA 4O5KA 2V4RA 1O7IA 2DKLA 1PFSA 1Y1WG 4A3DG 1BPBA 4M9GA 1SRUA 3QEAZ 4DAMA 2E2HH 4DQPA 4NXNL 3T5HA 2ATWA 4DR7Q 1HZCA 4KLQA 3U50C 1V1QA 4DF4A 2BWEA 2PI5A 2B29A 3CCRA 4RQ1A 2N3SA 5J2IA 3SZ2A 4GKJL 5KFEA 2QSFX 1UT8A 1ZQHA 2JEFA 1OXXK 1WCLA 1SKRA 3PUZA 3H0GH 3PMNA 3RB4A 1EOVA 1T3NA 2MFIA 3HKZE 5C4XH 1Y1VH 3GTOH 4GEWA 1JE5A 4A3GH 2K5NA 5KFBA 2ALZA 4RQ4A 1KLNA 3KLWA 3NBHB 3PIPA 2N78A 3GTJH 3PO2G 5DBCA 5KT5A 9ICUA 5C3EH 4DR1Q 3LWMA 4O9MA 5IP7H 3GIJA 3B0YA 2XTIA 3TRZA 1K1QA 1QZGA 1SMXA 2DPIA 5M3MH 1FJGQ 3J80c 1IBLQ 9ICIA 4KLIA 1L5UA 3Q8SB 4EEYA 4RT2A 3BU2A 1VQ9A 3UE1A 3OHAA 4KLJA 3OJUA 9ICSA 3VDYA 2PQAB 3PSIA 4IFDI 3STBC 4IFDG 1N48A 2FMPA 3EIVA 3LK9A 3ZDEA 1Q02A 3BQTA 2MUTA 5JEAG 4HJ8A 2KTQA 1YI2A 4M9JA 3AYHB 4IR1A 2BWBA 5KG6A 2ES2A 4JI5L 1Z9FA 3M85A 4PZ6A 4I2AA 2UXBQ 1L0WA 3T1HQ 3PO3H 1F4IA 2UXDL 3F8TA 1TFRA 3S1QH 4DR6L 3SV4A 5DQIA 1ZQOA 1VQ7A 5DG7A 2HVHA 4Q8EA 4C3IH 1K1SA 2DAGA 4IQUA 3G6EA 1HNZL 4BBSG 4YD1A 1G3IA 4P73A 2KBNA 3PO2H 4POFA 3ULPA 1N32Q 1PV4A 1NBWA 3ULLA 4RQ2A 4HJ9A 4ECUA 4F4XA 4DV1Q 5IIKA 1KFTA 8ICBA 4HIKA 3K7UC 3GIKA 3Q8LA 8ICOA 4ED0A 4DWIA 1NJIC 2N49A 3KF6A 2VQFQ 4X62Q 4B3SL 5CWRA 3MABA 3IECA 1IZ6A 1HZ9A 2D0OA 4M9HA 3CMAA 2JA8G 5E7NA 4ECQA 1WCMG 1OQYA 4UB2A 1SL1A 1FVIA 4RQ0A 1ZQAA 4MNOA 1S0NA 4GNXB 4O3NA 3K75D 3HOXH 1K8AC 2EXDA 8ICZA 2WB1E 2F1JA 4M0AA 1LYLA 4IPCA 4KN4A 4P4MA 4F4KA 2MO0A 2FXQA
chains in the Genus database with same CATH superfamily
3WHLA 5LMUQ 3NVYA 1E24A 2XO7A 3J81E 4C0ZA 1Q7YC 4OVZA 2XC9A 2F3NA 2AWOA 2XY5A 4BBSH 1ENAA 1L6NA 1FNWA 4K0KL 3S6JA 1NKCA 3JPQA 1PYWD 4PGXA 2MJ8A 2Z4IA 1RL2A 3E46A 3U4VA 1YLAA 5ALWA 1KLGD 3MAQA 2JA8H 4DS4A 1JN3A 8CATA 1RG6A 3VKGA 8ICHA 8ICVA 3I51A 3VKHA 2QKQA 2PMZB 1Z5CA 4NP5A 3NPPA 1JJGA 1EIGA 1UHUA 4DL5A 5M9OA 4LFCL 4C8KA 3D8LA 4GC9A 3OWFA 2G06A 3J7AV 5I6YA 1KDCA 2LYAA 3T6PA 3O0FA 1YIJA 2C98A 2EOTA 3NS1A 4BA2I 1DGJA 3C28A 4JK1C 3LW5F 3AL0C 5DLGA 3C2LA 5J0PA 1WGLA 2EUCA 2BPCA 2F0SA 1J5EQ 1QE6A 1N77A 4K5VA 4DXGA 4OJOA 2BGWA 4IRKA 1NOMA 5AI9A 5K4LA 3KLRA 5CR0A 1SYFA 2ODGA 1PMRA 4I2BA 3OMGA 2C2EA 2ZXHA 3RJGA 3LCUA 5IILA 4UAVA 2AMCB 4PMCA 5AI8A 4HCEA 1MQ2A 2F52A 1E94E 3TPZA 2AHOB 4LJZC 2WF5A 3P7JA 2K03A 4DV5L 4LF8L 3DM3A 2ZUDA 4BXOB 1SWWA 4XGIA 1SXJB 3N6RA 4UAYA 5DDMA 1WTVA 1OAOC 1G51A 3S16B 3AQFA 1XO0A 9ICNA 1SZPA 1ET6A 3UK6A 4QNLA 4AQYL 3M3YH 4LF4Q 4NM1A 4QHSA 3JAMS 3UXOA 4DBGB 1KW4A 1ZQJA 3Q22A 3I2ZA 5KRUA 1J8IA 2FI1A 3DXJC 1M90C 4DSLA 3ICEA 1YJ9A 3SEIA 3J81j 5JJIA 1S0VA 3A98B 5KIXA 1A2UA 3H4BA 1BPDA 1KQSA 4LF8M 2Z1CA 4H0LC 4JI1L 3RE8A 1C4QA 1ZQKA 4JI7L 3FM9A 2EY2A 3NUCA 2DI0A 2JH7A 2XY6A 2MUTB 4LJXA 2IA6A 3ZJYC 3I4VA 2F0TA 4AQYM 4JV5Q 3SARA 5LMNW 1QDRA 4JI2Q 2J0TD 3KHRA 4QWBA 4KLOA 3K5NA 4KJNA 3V7KA 2VNUD 1R2YA 2J6UA 4KLSA 3LWEA 3TZDA 2RGOA 2F5PA 3RJEA 1V1PA 2JWSA 4QY7A 3M9OB 1U4RA 4LF7L 5ALTA 3GRRA 5KNIA 1I50B 2E8GA 2ISPA 1JMCA 1L2CA 4Y7NH 4A3IG 4JBJA 4JI6Q 1R4QB 3RN5A 4JI4Q 2XZUA 4DV6Q 4JI7M 3SENA 2XFTA 3TREA 2ZIUB 3RGSA 3CF2A 5EXXA 2EJSA 2LVAA 5ALPA 2QGQA 3ZYYX 5BPCA 4IUQA 4FO6A 5ISRA 2LTUA 2OH2A 2JA6H 2KCCA 1Z6TA 5FOBB 2FPKA 3GTLH 1AP0A 3SHFA 1BGXT 1MN3A 3H0GG 3VA5A 4GC7A 3DWQA 1JB7A 4A3GG 1O80A 1T3QA 4I7ZC 4QMGA 3GQ5A 4UB1A 3VFDA 4LFAM 3QYEA 1PZKD 5C3EG 1N75A 1ZETA 4WP2A 3HWSA 4UB4A 9ICTA 2F5QA 1EU3A 2QBYB 2CWBA 5EE1A 2XEPA 4DSFA 4ZK9B 1YNNC 4B3TL 4PZ8A 2VUMG 4QNMA 4FZLA 4A3KG 1N5XA 4RH6A 1VQHA 2KHIA 1H9RA 5C5MA 4UHVA 4PDGA 4USAA 3Q8PB 2JA7G 5L1MA 2RVLA 3I4YA 3THGA 2QQ8A 4KD3A 3CF5A 4AYBF 3GTMH 1HIWA 3RJJA 3U60B 5HY6A 4C3IG 3PNYA 4WRDA 2PQEA 2K47A 1PH7A 2QARA 1ZQFA 1ZQVA 4FO2A 1HZAA 4B3TM 4IUTA 4M1UB 5ALSA 1NY6A 1E0BA 4PH5A 2VUMH 3CXCA 2KFNA 4A3KH 3CP0A 1JIHA 1G4AE 2F0JA 4XRHA 2F4VQ 1N34L 3SMPA 2K50A 5J2EA 1V43A 3S15H 2A1JB 1PRTC 1L7OA 3S2HB 3L7ZC 4U7CA 4P2HA 1PH9A 2Y0SF 2KOLA 1SEBD 1O7LA 2JA7H 4BY7B 1FR3A 1JQYD 4KO8A 3GP1A 1EU4A 3W3AA 2EKKA 1PYBA 2IT1A 1PJSA 2ZIXB 9ICCA 2JY6B 5KTQA 5KT6A 4C1NK 1NAPA 2JQOA 3NTKA 1QQ7A 3VR2A 1N34M 4PZNA 7ICPA 5G5GA 1MJCA 4QUCA 3SK4A 3GTQB 1LTGD 4NXML 4ECTA 4F87A 2R8IA 4IALA 3VYRA 1I4WA 4CKEA 4GOPB 2MH8A 1IY0A 4DO9A 4IUVA 2G5HB 3CC2A 2F0NA 4KLUA 3QUQA 4DOBA 4BDPA 4DAYA 1X9SA 2A68D 2Y0SB 4L6V6 1CTMA 3GILA 2QDLA 4ED1A 1WOCA 2RBMA 4DR2L 5EXTA 3K5OA 3UMMA 5HMMA 4RGOS 2YYZA 2QCPX 3M6AA 3P20A 3L26A 4DAVA 1N9WA 4P16A 4A3BH 3HRZC 2BE5C 2MQHA 1X54A 4FF4A 4BY1B 3NASA 1X65A 1FO4A 3PIP3 2YX8A 1ZXTA 2RQXA 3T53B 1HT1E 1CT1D 2ZXIA 2EYLA 4WW0A 1B53A 4B7FA 1Q46A 2WSCF 3K4GA 4GFJA 2KZUA 3H3VC 1XXHB 4DR2M 3JPSA 2C96A 4JV2A 3L27A 2VA8A 2RKOA 2CH4A 4R63A 9ICAA 1S5LU 2ZJ5A 4BB9A 4Q44A 3MA2B 2PFOA 1YE9A 2VS1A 1SV0C 2BQRA 4K8JA 1DK2A 1BCPF 3LCVB 4A3MG 1NK7A 3HOYG 3H91A 3QZ8A 1CSQA 1EFWA 5BR8L 5KFOA 7ICSA 4CDGA 5FKAC 3I4NB 2MROB 1N78A 4M2YA 4TQRA 2A69D 4GKKM 2IHNA 3S16H 1ONLA 2LH0A 1I4PA 3QIAA 3ZCBB 5K36G 2XCAA 5DLQE 1T8EA 4I2DA 2K28A 1G6ZA 4YWLA 4BX9C 4O3RA 5DLFA 4OIKA 4DN4M 4WJ3B 3C5FA 2C9OA 5ALIA 3ZQJA 2ASJA 2VL6A 2PMZE 4UP8A 4A3MH 2WKCA 3HOYH 3V6KA 1SR3A 1VF5C 2K14A 3R8FA 5ELCA 1BQQT 2BQUA 1M8AA 4EBCA 2J7ZA 3Q8MA 4UP7A 1ASYA 2UUBL 2Z6BA 1U4BA 1SE2A 4L6TB 2OF1A 1BCPB 1TWHB 1HR0W 1HTLD 1TKWB 1QB5D 3H94A 2E76C 2NUCA 3CCJA 1XMOM 4DSKA 4Z6DA 5D46A 4CHTB 1NK8A 3NP8A 2DAKA 2B2UA 4K4IA 8ICYA 1ZXIA 4DUYL 1R4PB 1TGUA 1NKEA 1MSHA 2W9BA 3K7AH 1TS4A 3R9XB 2G8LA 5C1BA 2UU9L 3PF5A 1CKNB 3KW6A 3QWNA 2P5ZX 4UB6U 2EXZA 1SXDA 1WTWA 4B3RL 1DV0A 9ICHA 2OXOA 1K83B 1XC8A 3DV9A 4B9MA 4P72A 3HKZB 4L5SA 4X3TA 1SXJE 2I7PA 3SAHA 5KFFA 2MR9A 2J6TA 4O42A 1XWIA 2IX3A 2LKVA 2VA3A 2X4AA 2KICA 2H5XA 4ZCKA 1JE4A 2O25A 2JGAA 2W3RA 1KC8C 4NB3A 4DUYM 2WB1F 2K33A 4NW2A 4F4YA 5DM73 4DXFA 3HW8A 4LY6A 4IBBA 5GAEC 1S8OA 3AFQA 1L1OA 3Q23A 4JI8M 1LM0A 1TWGH 2ZXRA 1EYDA 3C2MA 2I5HA 2Z8LA 5KL8B 2WAQG 1N33M 1ZKOA 4F5NA 3IAYA 1Y69U 4LF6Q 4QWCA 9ICVA 3BQ0A 1JB0F 3IFDA 4BY7G 2XF3A 2F44A 1NNJA 7ICUA 3KOZE 2KJ8A 2F0VA 1LACA 1NO1A 1KDHA 1B70B 2OOAA 3TDQA 4EZ6A 1GM5A 1ASZA 1R9TB 2GVBA 4O3PA 5D4BA 4K4HA 2NV3A 3T1HL 2G9HD 3Q8DA 3WHKA 5ITXA 2I9GA 3J81S 5KEEA 4QL5A 1RHPA 4NC6A 3QG1A 2K5VA 1GJXA 4RKUF 5J0XA 3T79A 4PHEA 1NK0A 1UNSA 5JTIA 5AJ3Q 3FYHA 2BDOA 1ZQPA 3UQ2A 4Q7JA 2WB1B 3Q6SA 2ZT9C 1XNSA 1D2NA 4B7HA 2EPBA 4B6JA 3WKBA 1SXTA 3QNMA 3FTFA 5EKKA 1HZBA 5HP4A 3K5MA 2I7NA 3L4PA 1NJWA 1R6BX 2R7DA 3JC66 2ZTCA 2BH2A 5M3MB 1JWUD 1Y1WH 4KY6A 3M9NB 1RYUA 4XQNA 4GKJM 1VQDA 4A3DB 1VQCA 2Y0SG 3RB6A 4R8UA 3QAUA 1I94Q 4KV6A 1GJSA 1STYA 3N7RC 3UDIA 2IHEA 4B9UA 4F5OA 3HRDD 1BO0A 3W67A 2XCPA 4C3JB 1BNOA 4ALPA 1D9DA 1VLBA 2X6LA 3T1YL 2F0KA 2K8CB 8ICCA 2ES6A 3I72A 1JXLA 3GU3A 4BY1G 2DWMA 1IKLA 4LW1A 2KCTA 1LTRD 5KT4A 2AU0A 2GWSA 3HEJA 2RSOA 5I9PA 1TK5A 2WSFF 3BQ7A 2F0DA 5CV4A 1JWSD 2OPFA 4WORA 3ONNA 1W3SA 3CMEA 4L16A 3T1YM 4ECSA 4JOIC 4DV2Q 1EEFD 4QJFB 4LUZA 1S5BD 3SAUA 2QENA 4LFBL 1B3AA 2IBKA 3V76A 4FCTA 1GD7A 4AG6A 5GTHU 2EZYA 1CEZA 1XNQQ 1F44A 4BY1H 2KD1A 1PXUA 1GOZA 3MEHA 1UEBA 5ITUA 1V33A 1AH9A 1I3QB 2HKJA 5L1JA 2EVBA 5DGAA 1GUTA 1XJVA 5AM4A 5CA7A 1ICFB 4EZ9A 3AN1A 1SIJA 4MGIE 2EY1A 3K6OA 1SYGA 2FPLA 4YR2A 1Q1EA 1O7YA 4UAUA 5KFDA 3JPRA 2WIIB 1VQNA 4LJAA 2PPBC 2KVMA 4OELB 4LFBM 1EYGA 3UE0A 3HOUG 2BNKA 4XBOA 4BWGB 2GVAA 2NVTB 4H02A 3S17B 3NBHA 3LGJA 3WOEA 4Z6EA 7ICLA 1D0LA 1JROA 1EY8A 4IQVA 1SFOH 4RCOA 3R9KA 1ZMVA 2ZIWA 3CTWB 4C2MB 3I1YA 2BCOA 4Q8FA 4DQRA 3PNCA 2TSSA 3BZDB 3FEWX 1S9FA 2Y0SE 5LMNL 1SLJA 2H3FA 4KY5A 5DFLA 2OYYA 1Q86C 1G71A 2FHTA 4A3CG 1KLUD 2EAOA 1LT3D 3E6ZX 2DWLA 4LZDA 3E9SA 3ZDBA 3HOUH 3ULJA 2P6UA 4DL2A 3CU7A 2L7IA 1PH5A 2VQEL 2FFKB 1IBKL 2F03A 2UVWA 5KG5A 4DPGA 1STAA 2PXIA 4JBKA 1WI5A 1YHAA 2Q0ZX 3EA6A 2XGNA 3HKZG 1A3UA 1DK3A 3GLIB 2NVXH 5LMNM 3ZDDA 1TWHH 1TWCH 1A6SA 4IUNA 2KXEA 4ED8A 2DKZA 2CKZB 1PRTD 4G3OA 2AQ0A 1BPZA 1XXHE 5ALGA 1XU4A 1VQ1A 4A3CH 2F8LA 3MMPA 1NV8A 9ICGA 3GRVA 2F1MA 2Q2IA 4B3MQ 4MGYE 4DV7L 3CP8A 2KRUA 2DJFC 4HMIA 2PMZC 1Q3BA 1TH3A 3TS2A 1EEID 4DNIA 1Z1BA 3V96A 4B9NA 4JYAM 2A8VA 1RM6C 2R46A 5KQDA 4BWMA 1QVGA 5CGKA 2JN4A 3NVVA 2JA5B 1C9OA 2LI6A 4AP9A 3GRYA 1ILPA 2AGOA 3ETLA 3TAQA 4UPAA 3CF0A 2PZWA 2EE1A 1HNWL 4LF5L 5IWAQ 3THVA 1I4QA 4DV3L 3HILA 3HS0C 4M9LA 3E58A 3V6JA 2VDBB 1Q90A 1C8CA 1VEKA 1G91A 1EE8A 2VY3A 4EGVA 4NPSA 3ZI4A 3KOWE 3DDHA 2WB1G 4B7GA 4F50A 4QZFA 1U0LA 1HNXL 1SXJC 2YQEA 5M3FB 3HWTA 2A5YB 3UPQA 4M6WA 1XNRL 3K0YA 4OX9L 2FMMA 2E1EA 5M5XB 5KFPA 1HJPA 4LFAQ 3AQQA 5M3MG 2L9HA 2B2TA 4KLHA 1T4GA 2BE5D 4ZUJA 2YMMA 1O7IA 3KSXA 3C2PA 1PFSA 4A3DG 4NXNL 2W3SA 2A6HD 4DR7Q 1CZWA 1HZCA 4KLQA 3U50C 4F88A 2HBLA 1AQ6A 1V1QA 5EGTA 2PI5A 3KBXA 4HEDA 2AUJD 2B29A 5C4ZA 3KBBA 4U68A 5J2IA 3SZ2A 2XFSA 1ZQHA 4C3JG 5HR6A 1HNXM 1DGFA 2D7HA 1EQTA 5JI3E 2ZXOA 3HKZE 1XNRM 4OX9M 5KFBA 4D80A 2L4NA 2H3QA 2N78A 2IW3A 5DBCA 5C4XB 1PJJA 5KT5A 2HBMA 1L7MA 9ICUA 3LWMA 4O9MA 3B0YA 3GTJB 1QZGA 5M3MH 4RGTA 1BNZA 1B0XA 3I90A 4RT2A 3BU2A 1VQ9A 4G57A 4KLJA 3MGVA 3GLHB 3E3XA 9ICSA 3BXWA 4C4RA 1N48A 3FD9A 2FMPA 1QCBD 2XRQD 1B9MA 1SZHA 2VJ5A 2FDRA 1Q02A 2B2WA 2QB0A 3NBIA 1DOKA 2K6BA 2CW0C 5KG6A 1ZQ9A 1L0WA 2DY8A 3PO3H 1EOTA 4DR6L 3SV4A 3AOGA 5DG7A 4Q8EA 1K1SA 1BBXC 4IQUA 3WKAA 4YD1A 1G3IA 2KBNA 4PJ0U 3ULPA 2X49A 1YZ7A 4KN4C 3OPXA 1NBWA 1ORYB 4KMOB 4ECUA 3D4WA 1F2LA 4IQZA 4GHLA 1NSNS 4ED0A 2ZM6M 4P0QA 4EEKA 4ZKCB 5KYIA 1SE4A 3MABA 4KX5A 3RGPA 3URYA 3KLSX 1OQYA 2L0CA 2LM4A 5H2FU 3KS8A 3EFXD 4G4KA 4GNXB 3DFZA 3HOXH 3A8IE 2WB1E 1LYLA 5B5EU 4FXKC 2FE9A 2FXQA 1NE3A 1ZJNA 1TAMA 1YNXA 4RNAA 2XGQA 2YB4A 3W1BA 5E4XA 4CDDC 4CISA 3JAMc 1ZAEA 3IHQB 2NYVA 4DR4L 1QSLA 2KCNA 1EUJA 2X6GA 3A0JA 3FUTA 2K4KA 5J2KA 1I3QH 2K5HA 2FPMA 2SOBA 4P2CB 2FMQA 4DV4M 3GV5B 1ZQXA 1IIPA 1XSLA 4JG2A 4PT5A 2E5SA 2MSNA 5KG4A 5AKLA 4JV1A 3PSTA 4RQ5A 4X65M 2F0MA 1U4LA 4N9TA 1U4MA 5M5WH 4DUZM 2UVVA 2XH9A 2K5DA 1B50A 4LMQD 4KLKA 1T7PA 2V1UA 2VB3X 1VQEA 2CV2A 1U4PA 5EE3A 4NL9C 4ITQA 4UBCA 1YT3A 3C3EA 2H3VA 1DCZA 3TAPA 1WTPA 3T3FA 1XPOA 5KNCA 5DB9A 1WWUA 4AI6A 1HQYE 2APLA 2F1IA 3S1MB 3A55A 2KDLA 2VF7A 3I4OA 1TDHA 5A2QE 1EQQA 1HR0L 4BXXH 9ICFA 4KITB 1TK0A 4RFBA 3TANA 2F3IA 3HOZH 2KEYA 4P0PB 3K1ZA 4AYBC 1PFBA 4OO1I 4K14A 1R4GA 2KKVA 2RGHA 3BYTB 1HUMA 4KLEA 3U61A 5FTLA 4ZYSA 2JE6I 2IWHA 4GOPC 2I46A 2HOIA 4GKKQ 3D8BA 2C5RA 3OOCA 3FYDA 3MDAA 3U4ZA 1SB3C 2UVUA 3MVVA 2NTSA 1ZQUA 1XMQM 4YP3A 3DEPA 4IBJA 1BDOA 2F2AB 1D5MC 1II3A 2JA5G 2DUYA 3KKAC 1VQJA 1HR0M 2PZUA 2Y0SC 3GZFA 4MGZE 1N60A 5TSSA 1SMYD 5JUMA 3I28A 2ZIVB 5ALJA 2RDIA 4NRWA 1WVLA 1UT5A 2R8HA 1PRBA 4DS5A 4BGDA 1Q8KA 1KTQA 4KKTA 4DK1A 4DR5M 5FLXS 3IG5A 1BPXA 1HXYD 1LTLA 1D8BA 4TUPA 1Y8NB 5KFUA 5CP2A 3U5ZA 5DB8A 2FMSA 3HG9A 3QEBZ 1RZTA 3OTOL 1Z00A 9ICWA 1CUKA 1W6JA 4GZYC 5FJ8G 1H6UA 9ICLA 3BQ2A 1NJZA 1LV5A 1XMOQ 5ALVA 4OHJA 5M3FG 2PZTA 2KEBA 1ZYRD 3L0OA 3U58A 4I65A 2JA5H 4JBWA 3D2SA 4C8NA 1YJWA 3DHQA 4APVA 1LB2B 1JJCB 2L7HA 1PZJD 2DGZA 3AOEC 5C0YA 3VCBA 5T1IA 3GV6A 3E5SA 1L8QA 4G9BA 3KF6B 2P66A 1QZEA 1XHBA 1IL2A 3QR8A 3M8SA 4XXEA 3MFIA 1D5XC 4UB3A 3OTOM 4CBVA 5KFJA 2JEJA 3N7PD 1TKDA 3ONAB 4LVSA 3I4LA 1SG9A 2JEIA 2JEBI 2NYZD 4EX7A 4ZOHC 5IT9S 5ALQA 2ZAMA 5FJ8H 2YMLA 4EX6A 1SXEA 3F92A 5HR7A 4PGYA 3DEOA 5BOMA 3TADC 3G6XA 5EJCA 2R7FA 1PHJA 1DXMA 2DAEA 3H4JA 3GLIE 1H9KA 5C4XG 2DNAA 4DUYQ 4HN7A 3JAMi 5KFCA 4OVZB 5L1KA 1AZQA 1LLRD 1L7PA 3BZKA 1FL0A 2MUYA 4HTHA 1W2BA 4JI8Q 3T4AC 3DMUA 1B7YB 1R5LA 3M9MB 4DK6C 4ECXA 5IGGA 3QE9Y 3U6MA 2PW7A 5IODA 3LX0A 3VYSA 4PPXA 1N33Q 3MJ5A 1MD2D 3ND8A 1DO0A 2E2DC 1KABA 1QUQA 4GXKA 2DWQA 4J9PA 3RLNA 1ILQA 4R4CA 2LY7A 1LV7A 4BXOA 1RODA 3SK6A 4P4PA 2EYMA 4YCWA 2XGTA 3M4YA 3SYKA 1NKBA 1BCPC 1SKSA 1N63A 4P17A 3W2DA 4MM3B 4IJHA 3KVWA 1HA6A 3I04M 1AIPC 3MXPA 1UE6A 4YWKA 5J2CA 1IBLM 5DDYA 3SK5A 3TSSA 3GV7B 1XYIA 4J9NA 2YTYA 3HU3A 3IL8A 2YFQA 4G7HC 4CKBA 4LGYA 5EWGA 2OQ4A 1TAQA 2G09A 2DY7A 3EIHA 2HBKA 4C3HB 5JPNC 2VA2A 3RZDB 1B3QA 4KI0A 5IGFA 3B7NA 4IQWA 5ELBA 3HKZC 3RZOH 1S5FD 2JA9A 2MP1A 4O3QA 2B63G 1B4OA 4Y52H 3KSJA 1LTAD 1PTOF 3TWKA 1N32M 5H37D 4B9SA 4CDFC 4GKJQ 2EIFA 1SKWA 2KHQA 2YU9B 1C48A 4XYQA 5KFGA 1HQRD 3GTPB 3NWTA 3W5OA 5T14A 1X3FA 1XTDA 4ME3A 2MU2A 4ED6A 3W0FA 3B0XA 5IP9G 1ZQDA 4H13C 1RQNA 3FDSA 3QB3A 5IY0A 2DAIA 4QZCA 2KHSA 1WXQA 2F0FA 4X64L 3SHGB 5FO9B 5EKIA 1ET9A 1UWVA 2B63H 3QWLA 2QP9X 1VS0A 3NQIA 3RTVA 4OXPA 2DKXA 3H0MB 1E3PA 4JUZA 5AKZA 2V9WA 5M5YB 4JI5Q 4P75A 4I7AA 1I4XA 2D6FC 5AM5A 2HW3A 4NJ8A 3GLHE 3KYHC 4ELTA 1V1PB 1X55A 4B9VA 1HNZQ 2VIIA 1A0PA 4FW9A 3BYYB 1PTOB 8ICIA 4IOAA 3S9WA 1Q3VA 5IP9H 4JI3L 2UUCL 2RF4A 1S3SA 4LK1C 2KHJA 3V7LA 2B0CA 5IIJA 1G8PA 2QLTA 2WB1C 1HFNA 4B9WA 9ICMA 1Y88A 3LVVA 1D2BA 1VQBA 2E75C 1EIYB 4ACOA 2L11A 1Z19A 4IOCA 1A15A 4TVAB 2VJ4A 4FNFA 2H3ZA 3CYMA 4LZZA 1QZMA 1AE2A 1FD7D 3E4RA 2JSOA 4OEMB 1GVNA 2W9CA 3GO5A 4DF7A 1WCNA 4AIMA 3S1RH 3G48A 2OTLA 4IBGA 1YHBA 4A3JB 3A74A 1J2NA 1KQQA 3T16A 5J0OA 2W55A 3ICXA 2I5MX 1Q82C 2HIXA 3RLOA 5J22A 3I3CA 2FE8A 2HDOA 2A1JA 2NN6G 5KG7A 2LVNC 4GN4B 3PIOA 5J2HA 2AGPA 2L55A 4LF9L 3PW0A 4YHHL 2B2VC 1Y8PB 4J15A 3S1NH 3K58A 1V85A 1COOA 3FPUB 4M9XA 5C18A 4JPBW 3KHHA 1UM8A 4ILWA 3GLFB 2L5TA 1S10A 2R18A 1KNAA 2EYOA 3C1FA 5AKHA 5CV6A 3CCLA 3NE5B 1L2FA 4F93B 4GXIA 3AUOA 4KD4A 5KFHA 5JVG3 3E0JA 3GTGB 4UAIA 1NJXA 2W82A 2L4FA 5C44H 5JAVA 1UA0A 4KMUC 1RIPA 4NLZA 3SR1A 2JR5A 2OT2A 2F0PA 3GV8B 2B2YC 3BDOA 4CJ6A 2RLTA 1GL7A 2G5GX 1MI2A 4O5CA 5CV5A 4LF9M 4R3DA 2DFLA 2NN6H 5CYUA 1KRTA 2V1CA 5GKNA 1ZYQA 4LJ6A 4CGYB 3J80E 2KECA 2Y20A 2L5YA 4R1JA 4DLEA 1L7NA 5AHXA 3TP8A 2HQLA 3A0HU 4GC5A 1VJ5A 4G6ZA 2EKFA 2L4EA 2A5HA 3SMSA 1NZBA 4GS3A 1NZPA 1K9MC 3U6LA 2X8AA 2JNHA 3J81c 1S77D 3A5UA 3KJPA 3N97B 3SFZA 5C4HA 5DGBA 1I6HB 3PW4A 1RTOA 4YFKA 4DQQA 1Q39A 1GUWA 3HHZA 1TS3A 2CQOA 2QPAA 3K5LA 5DEHA 3A45A 1QUTA 2K05A 4HIDA 2G08A 3SASA 3GQ3A 4KHPL 2E5LM 4C8MA 2KW0A 4NV0A 4XQQA 3QYPA 3HGIA 4JYAQ 3FKIH 1VDLA 2DHRA 4Q45A 2IX0A 1D8YA 1S5CD 3KHGA 4RT3A 4IJFA 4NLCA 3J7AF 2KV2A 3OJSA 3SGIA 1G8ZD 3F1ZA 4E0DA 4MFAA 1X56A 3V2TA 3AOEA 3I91A 2JJQA 2WHEA 8ICMA 3PUXA 3ZH9B 8ICGA 1X3EA 4DAYB 4X66Q 1AN8A 1BBUA 3PIO3 4KHPM 2CHQA 4HEOA 1A76A 4DR1L 2UUAL 2CRXA 1TS2A 2WINB 3GQ4A 3NUQA 1XWEA 1FJGL 8ICAA 4TSSA 3E9HA 4L8RC 1SROA 1IXZA 3MXNA 2A19A 2G0AA 2G5IB 4C3HG 2GO7A 5KFTA 1XX8A 2K4EA 3G6VA 2FLPA 2HHTA 3SC3A 4DK0A 4RPXA 2LMCB 2K4PA 1BOSA 5J0YA 2Q8RE 5DQHA 7ICGA 3NWLA 8ICQA 2AQ2B 4K5WA 9ICBA 2R6GA 2YTVA 1QQ6A 3RRHA 4F8MA 2LVQD 2UXBL 2R93B 2XY7A 2E2HB 1STEA 2R7ZH 5AK3A 2UUAM 1YVCA 4ZPXA 2NRVA 5J0SA 2ISOA 5J29A 2B6GA 4QZHA 1WFQA 4B08A 3D4RA 2JEGA 4QW8A 3RJFA 3KD3A 1JXEA 2R8JA 5EPJA 4DV1L 4QNRA 2PNHA 2MPMA 5GAHC 3V05A 1EY9A 3TP7A 4DFDA 1IYJB 3KZIU 2VQFL 4C3HH 2HDLA 4JI0Q 4MGKE 3HJEA 5ALFA 4IJEA 2RQ5A 4IPDA 3H3VH 1C7YA 3RBDA 4J9LA 4DL7A 1R7RA 2BCSA 3QOJA 1MJEA 1UE7A 3QX7A 4A4IA 3SMVA 3MFHA 2Z4RA 4A3EG 2LMRA 5EJWA 2HT1A 1IXRC 3MR6A 1B43A 5LMUL 3EN2A 4L5QA 4NWIA 1F5SA 4EYHB 1A62A 1VG5A 1QH9A 2X69A 1L0YB 4TURA 3H4DA 2VQFM 3KFUG 1K8OA 3PUWA 1YBYA 3EZ5A 2NVYB 1DRGA 4JV0A 4DV0Q 3WK8A 5A2QS 3FUVA 1GL6A 4LGMA 1V38A 4DAPA 1E2VA 1V8QA 4RHSA 1S0MA 2D3DA 2NRZA 4KLMA 5KFNA 1JT8A 5ELFA 3SEBA 2XZFA 2KP7A 1SNOA 2EZXA 2CHGA 3KDFA 2ESEA 2ZM6Q 3QZ7A 4O5EA 5J8YA 4A3EH 3QJYA 3HOVG 1B44D 4GITA 5M5YH 4Y2VA 1CFMA 3T51B 4A3JG 3J81i 2NQ8C 2UXDM 2E8OA 1SNQA 2PKEA 1QWYA 3BZCA 5AK6A 1KKXA 2FNAA 3HP6A 3D6JA 1TV9A 2F77X 1JOOA 1BR9A 2XNAC 2XIDA 1J5EL 8ICNA 2QZ4A 4HJ7A 2E2JB 4RAUC 5AKJA 4N8X1 4DR3Q 4IURA 2QILA 5J2GA 4B3SM 1X3PA 5ELOA 3TMEA 3PCOB 4RF1A 1MC8A 4LRSA 1XC9A 1PFNA 4C4TA 4L5RC 4NOOB 4UDUC 4C1NI 5KT7A 4DV4Q 2EJMA 1F9QA 3NGDA 3HOVH 1X9XA 1QZHA 1Z5BA 3U6QA 1HEKA 4A3JH 1WCMB 1GO3E 3JPTA 1F9PA 3VR3A 4BBRB 4X65Q 5IINA 2GA4B 1HQMC 2BDUA 4KODA 2K1BA 4DUZQ 4LF4L 2N1RA 1NK9A 1L1OB 3VDPA 4K0KM 5J39A 1OFIA 3AEVA 3HY5A 4J8QA 3M6KA 1QSSA 2JMGA 3I01M 3OHBA 4AKHA 3M1YA 3MGIA 4CDEC 3FUXA 5ELDA 5GQOA 2Z6KC 3RR8A 3TE6A 1RJTA 4FZNA 4NMZA 3HOWB 1L8LA 1X2IA 3U9OA 3ZC7B 5CB1A 1TWFB 5GADC 3J7ZC 1VMCA 4ZH4A 1LO5D 4NL4H 3A42A 2BDNA 4DK3C 1XPRA 1I4RA 1CM9A 1X6OA 5LL6S 2O6KA 4DFPA 4CKCA 1EY6A 5HGTA 4LFCM 4PQXA 1T3TA 2RCFA 1QVFA 4JV5L 4LF4M 4JI2L 3AU2A 1ZJMA 4JCVE 3R8BA 2R92B 4DSEA 4X3UA 3I4MG 4CE6A 4RQ3A 2NZOA 1BCPD 1YEZA 2NVQB 2H3IA 8ICKA 2BOSA 4GNXC 5BN5A 1PM5A 1EIHA 1U5KA 1VQKA 1JR3A 4RA8A 4RQ7A 1SL2A 9ICOA 1DO2A 3ZDCA 1MBYA 1VQPA 1GKHA 5CC4A 4JI6L 1XMQQ 4F4WA 1ZD4A 3MGHA 3B6YA 4Y2XA 1KSFX 3T5LA 4JI4L 4DV6L 4R8NA 3D0FA 3GFKB 1A3VA 3L9AX 3ZD8A 3SAWA 2CE7A 1X37A 1G59A 1ESFA 1F9RA 1MSWD 4JI2M 1WUDA 3PO5A 1WYGA 4DV5M 3GQCA 4YCUA 1JC7A 2EYJA 1LVHA 4KLLA 3BVMA 3GTKH 1FFUA 4DR5Q 1JRPA 5I4DA 3I4MH 1M1KC 1QILA 4R8UB 3EPIA 5J0WA 3L25A 1KN5A 5DBBA 1KEJA 4RPZA 1U9LA 1K28A 4IN3A 5KO3A 3M9BA 1T94A 2EY6A 4KJOA 3RJIA 3ER0A 1DGBA 7ICMA 4L63B 1PH8A 1E1TA 5KNBA 3GLFE 1J9OA 4A8EA 4YXJA 3MK6A 3S2DB 2CFOA 2XWJB 4UB8U 1TWAB 3UDFA 1TS5A 4DNTB 3SXHA 4JI1M 2I1QA 4HSPA 3EROA 4A75A 2R93G 1OAIA 3SQIA 2BPFA 4ED7A 4XA5A 4FZMA 3M7NA 2HHSA 1KD1C 5C0XG 4FCVA 4M9NA 2VXWA 1CA5A 1I4GA 4ECWA 1PUZA 2KSOA 3OTOQ 1N61A 4Y2JA 1VCIA 1F2YA 3L5KA 1TF0B 4MB7A 8ICPA 3KF8B 1WJJA 5H1SE 3L2PA 2F5SA 4EBDA 2H4OA 5ALKA 2PI2A 3HX3A 4DQIA 4LF7M 4ZQ3A 1RCVD 4HSVA 2AKWB 1ML0D 5IIMA 4FS2A 3NTIA 2F4VL 4RQNA 3A8KE 2QDBA 3M4QA 3ISBA 3RAQA 3G4SA 4A3IH 3UXPA 3C3LA 1OIZA 1VQIA 1VQ6A 2C2DA 2GOLA 2HOFA 2DKLA 4M9GA 4DAMA 2E2HH 2EDGA 4DQPA 2ATWA 1JOKA 1D0KA 4CNQA 4CRXA 2BWEA 1SAPA 5IGEA 4RQ1A 4C4SA 1CK1A 1RD9D 4IUPA 5KFEA 2QSFX 1UT8A 1WCLA 3PUZA 3Q0AA 3H0GH 1EOVA 4QOZC 1T3NA 1NR4A 3EIEA 1WTHA 1JE5A 4A3GH 5CEHA 2EAPA 1KLNA 3KLWA 3NBHB 3PIPA 3GTOB 3GLIA 5C3EH 1EY5A 2WV6D 1RDPD 1E2ZA 5AICA 1K1QA 5EKLA 1U9RA 1IBLQ 2CVRA 2ZIWB 5FP0A 4KLIA 4EEYA 5I9OA 3UE1A 1GABA 1EZ6A 1JR3D 2M5ZA 3VDYA 2PQAB 1STNA 3PSIA 4IFDI 2R4EA 1JWMD 3EIVA 3LK9A 3ZDEA 1S5ED 5AM3A 2BJWA 4HJ8A 2KTQA 1BUVT 4AZFA 3ITPA 2KA6B 3DWPA 1Z9FA 3B74A 3AM9A 4PZ6A 4I2AA 3UI2A 5IGCA 2F4IA 3F8TA 3S1QH 2F0QA 1VQ7A 4QIWF 4C3IH 2DAGA 3G6EA 4H44C 4WURA 1Z6HA 5FO8B 1N32Q 3LYSA 1LT6D 3ULLA 1TY2A 4FE3A 4RQ2A 1NJFA 8ICBA 3K7UC 3NWSA 3GIKA 4KY7A 4AYBB 3NRWA 4DWIA 4MH0E 1NJIC 1AEXA 2N49A 5DNFA 3WK4A 4X62Q 5CWRA 5BPVA 2F0GA 1OJLA 1WCMG 3AJIB 3OWEB 1E9RA 1SE3A 2OXPA 5D65A 2DZOB 4RQ0A 4MNOA 2HOQA 3TBIB 4Y2UA 5EXPA 4P4MA 2OQKA 3FAHA 2R62A 1N36Q 4Q43A 5A2QL 1HA5A 4ED3A 2N8NA 4OWWB 3A54A 2RRUA 1K5OA 3X3NA 2PFNA 3KBGA 1SNDA 4G3IA 1YJNA 3HOWG 1QVRA 2WP8J 5J2JA 2F0IA 3Q24A 4MHVA 5DKWA 5AK4A 2Z3XA 4XDXA 5J0TA 4OGQC 2DNCA 4QB4A 1QCKA 4NXMM 3V7JA 3J80S 1ZQCA 2BDPA 1VQ4A 4QIWB 1Z7TA 2MHVA 2BHNA 2RHFA 1H9SA 1WCMH 2J6SA 1TTEA 3TFSA 5FLXc 4NLNA 4PHAA 4PV1C 2BA1A 1XXGA 5DM63 4A3LG 4NSOB 2R92G 1JALA 5KFQA 3MR2A 3PX4A 4WJ4A 1SV4A 2ZAOA 2CRUA 2OWOA 1IM4A 3K2LA 1VQGA 4CF5A 1W5TA 3U6CA 3AB9A 2J5YA 2LYBA 1L2DA 2AGQA 1IN6A 1X9WA 3OPOA 1ZQTA 1D0MA 4CGZA 2QKIC 1JB3A 4US8A 1O03A 1TWFH 2W7OA 1U49A 3TQYA 5IYDG 4M6WB 4ICAA 3SYZA 3I55A 1SNMA 1V97A 1H9JA 3PXGA 3QOLA 4YIJA 1B9NA 3PUVA 2HQEA 3GD7A 5E3FA 4A3LH 3JPPA 2ID0A 5CJ7A 2F0EA 4N9PA 5EAYA 4JK1A 1ZQWA 3CCEA 1TIID 1SL0A 5IT9c 2W11A 2LBCA 1PZNA 2OO9A 2NO4A 2YB1A 4KHZA 2L09A 4Y2TA 3H8WA 2LXJA 4IL6U 1KFDA 1XSNA 2R61A 5GAGC 2Y9TA 4EQ5A 7ICOA 3TZUA 3K92A 3ZDAA 2KKPA 3M3YB 5AKIA 8ICLA 3HJQA 3M7DA 4O3OA 3PW5A 5BR8M 3UXNA 3G6JB 1OUQA 4JC0A 3ETRA 5LL6X 3SI8A 3RRGA 2QCUA 4IS7A 4NSRA 4J9KA 4ECYA 2UVRA 4RQ8A 1PTOC 2ZUBA 5IOCA 4G4OA 3MHVC 1YHQA 5EBCA 3A8JE 1CI4A 4C7YA 2YV5A 2QB0B 1OXVA 4UN2B 4MHEA 4F7XA 1A6XA 3QU4A 2WF6A 3LMMA 3JAML 2A68C 2A6EC 5K36H 3VDUA 4YVZA 1IY2A 2B8GA 1CHQD 3TFRA 4L4UA 3QUTA 2HCFA 1SSOA 1KFSA 4PGQA 9ICEA 1I50H 3KTQA 2HMXA 1TWAH 4LF6L 4PZ7A 2NB0A 3GP7A 2B3GA 3OSNA 2D8CA 1GJTA 2J7NA 1X9NA 3HT3A 2R8GA 3RN2A 1RXWA 2ZG6A 4L15A 2JRZA 1QJOA 2BH8A 2UUBM 4P0QB 4IZ8A 4Y7NB 5DBAA 1PFMA 1UQVA 2E5LQ 1NJGA 5ITXE 4YMMA 5DNYA 3GV3A 1PH6A 3VR5A 1AZPA 4F4ZA 3HGBA 3CNHA 4L5TA 5KGUA 4ELUA 1KHIA 1HUZA 3NTUA 2R0IA 4F71A 1LT4D 7ICRA 3EWAA 3TQSA 2JA6B 1FNVA 2JZBA 3GTLB 2UU9M 4IJLA 1IBMQ 2O5JC 2ALYB 5KG0A 4LJ8A 4EIWA 1SJHD 4GN5A 5AKGA 4B3RM 2EY5A 4YR0A 5IP7G 1IXSB 4DEZA 1BPYA 4FF2A 3AV0A 4RCNA 1S4ZA 4GC6A 4XTCS 1PVPA 4MIUA 1IN8A 3H0RB 3L28A 1WYDA 5IE8A 2WF8A 2SNMA 4IRDA 4L78A 5EOZA 1A0IA 2K5WA 2N88A 5AFWA 1DGHA 3PVXA 5AIBA 1I94L 3FUWA 5FLXE 4A76A 5G3LF 2F0UA 3MXUA 3GIMA 1E7ZA 2HHHQ 3FRHA 2XWBB 3SK8A 5KL1B 2EJGC 3LVWA 4RHRA 3KS4A 4LG2A 4AYBG 2UUAQ 1K0RA 3ISDA 1D1IA 2EA0A 7ICFA 3MDCA 2WFWA 1OTCA 4FYDA 3S2HH 5D3DA 1N2XA 1TE2A 4B9XA 3FRPB 3P75A 4A3KB 2HCBA 3WU2U 3UDXA 4BY7H 1A63A 4YY3Q 2JEAI 4OJ5A 3S15B 3C1EA 3C5GA 3HKPA 3T1HM 4ME5A 4KHVA 8ICJA 1D5ZC 5EXSA 2CHVA 2JA7B 5J0UA 2EO2A 3U61B 5FLMG 4DV2L 2EZVA 5IT9E 1WHCA 1LUZA 1J7KA 2NTTA 1X9MA 3W68A 3NEMA 2F3VA 1OIPA 2MAXA 1XNQL 4LAAA 1KBUA 3GTQH 4KLNA 7CATA 2Q2HA 2R65A 3BVZA 4BLCA 3TKAA 4RZRA 3PMLA 2GQFA 1NV9A 3FMCA 1CQVA 5IIFA 2RRDA 2WFAA 5C5JA 3UQ0A 2KUMA 4HYKA 3LNNA 2CH4W 3DM1A 3C1ZA 2NWGA 3VC8A 1F2ZA 3U5ZB 3F2CA 2WACA 5F2DA 4ECRA 5FLMH 1Z00B 3H8MA 1CKMA 2OM6A 4A93B 1XNQM 4DLGA 4KT0F 2KNAA 1GVPA 1PK1A 1JI7A 2UXDQ 3J7YW 1ZQSA 5IZ7D 3H7IA 2CHBD 3Q8GA 3MWYW 5KFYA 4F5RA 3O13A 1S0OA 1RDFA 1IHZA 2DZNB 3QYBA 4DA2A 4IPGA 3BG3A 4M47A 3I4NG 1LTSD 3K8AA 1EIJA 1MN8A 2W8LA 3HHYA 2WSEF 4A3BB 4BJQA 4B3SQ 3KOJA 1YNJC 4G7ZC 4CIZA 2O4XA 3GPUA 2XICA 1EZ8A 5K5PA 3SATA 4A3FB 3PVSA 3W1GA 2F8KA 3KUPA 2FINB 4UBBA 5IGBA 2M0NA 2HHXA 4DFJA 3TI0A 1HUNA 4AYBE 4XIGS 3L29A 3C3DA 4IC9A 3PW2A 2YQZA 4GIPA 1KSPA 3CQZB 1SWVA 3UDGA 3J80L 2BZFA 3VK7A 4IR9A 2CFMA 5KYLA 1RTNA 1VF7A 4J9SA 2LM1A 5ITYA 4K0KQ 3GO8A 2VW9A 1HT2E 4I2EA 5J1ZA 2M60A 5FTJA 5KFKA 1KXLA 3SAFA 4Y28F 2FOIC 1PJTA 1V34A 5IGDA 2M2LA 2K8BB 3I4NH 1OKSA 1YNND 1O78A 3RJKA 1RF2D 1QUQB 2WF9A 4LUOA 4O0IA 1LT5D 5L8RF 5ALLA 5ITQA 5COYA 5KFMA 4F2LA 4B3ML 3NRZA 4AW4A 3H15A 4MN3A 2SNSA 5JEAJ 1SV0A 4XQJA 4LZGA 4YMNA 1LTTD 4EELA 4P4OA 4C8OA 4MFCA 3OHXC 4LFCQ 4MGHA 3HHWA 4KKUA 3L2AA 3J7BA 4QIWE 1JCKB 1IN5A 2AUKA 2F1HA 3ERSX 4M8AA 4BWJA 3ND9A 4AH6A 1MKHA 3KLSA 2HCCA 4OCZA 3GPYA 2LNHC 2B2UC 4R64A 3WK5A 2CCZA 2KN7A 5JI2E 5C3XA 4U6PA 1E32A 1QYRA 2Z9HA 1SYDA 5IWAL 5J0RA 4A3MB 3HOYB 1VQMA 1IN4A 3KOXE 2KZMA 1TR8A 1IFYA 4B3MM 2OTJA 1V92A 5CHGA 3BVGA 1PH4A 2ZJRA 3FE3A 2BJVA 3RR7A 1JQJC 4II7A 4IRCA 4OWTB 2JA6G 1AE3A 5DG9A 3GLGB 3DWAA 2B3TA 2BPGA 3CPWA 3H0LB 4DV5Q 4LF8Q 3U6DA 5JJLA 2E1FA 5E1FA 5ALUA 2VQEM 1Z47A 3HZXA 4K2LA 1IBKM 2WTFA 4DOCA 4LUVA 3OSPA 3KFUA 3MFGA 2CUZA 4AQYQ 3K7AB 5IWAM 1NI3A 3RJHA 4LFAL 1ZQYA 1L1OC 2W43A 1K83H 1ZOLA 1SNPA 2IY5B 1NCVA 1ZQNA 3FDTA 2ASDA 1LKYA 5DB6A 4DR7L 1A8VA 1G6PA 4GLAC 3M7GA 5J2AA 3T15A 3JPNA 2KJ9A 3R2IA 3PNVA 4O0AA 2DHYA 3ISCA 5KG2A 4RUCA 2LHCA 2C99A 5KFLA 4DV7M 4JI1Q 1KAWA 2DGYA 4JI7Q 3PR5B 1LTID 2WAQF 4OL7A 5KAFU 3GPXA 3BJUA 3AMUA 3K9OA 2O5IC 2AH5A 2RP5A 3AQEA 3RD4A 3DEEA 2H1EA 3FTDA 1TWGB 1AROP 2DWNA 1KTKA 5EP3A 4KTQA 2JP7A 4ZKBB 1E1OA 2PYKA 3G7LA 3BDLA 1ZEQX 2MA1A 1QAOA 5JVH3 1OW5A 4DR7M 1FGUA 5IIIA 2FJ6A 2ERCA 4LF7Q 1NK6A 1HNWM 1K0SA 4LF5M 3G6YA 4J9QA 3FKEA 5FK9C 4QZAA 3OW7A 3L3OC 4I27A 1P3QQ 4DV3M 4MTNA 1T43A 3GLFA 1OXUA 3MZ5A 3J7AS 2KFZA 5J2BA 4CF3A 1GO5A 4FP5D 1R9TH 5A35A 2LVOC 4E6IA 1DGSA 4RUAA 4QQBX 4OO1J 3CF6E 4X5VA 4ZLTF 5JRTA 1EFUB 5CBAE 4QWEA 4X3SA 3I70A 3V6HA 5AI0A 2W9CB 2CEAA 3E2EA 2IHMA 3BS1A 2C28A 1NUCA 3IHPA 1VDVA 1DM0B 2CP8A 5F3WA 2DQNB 1MHWC 2WAQB 1Y1VB 1U45A 1L1ZA 2A1AA 1EXNA 4K2KA 1A2TA 2B39A 4DFMA 1X3QA 1Q12A 5L37A 1ICWA 4B3TQ 2NZ1D 4NXNM 2HCIA 1A5TA 3ALRA 1XSPA 4C8LA 4A3DH 5AI4A 3LWUA 1HH2P 8ICFA 3J81L 4RG1A 5D3IB 2HUGA 1QG7A 1QAMA 1Y1WB 1STGA 3C58A 9ICQA 4A93G 3JPOA 1IG6A 1PGYA 5AI5A 4RMFA 5ITRA 1ECWA 1VQAA 4C3JH 5JOBA 3CCQA 4F91B 5KT2A 3DA1A 1C0AA 7ICNA 3BS7A 2KIWA 1JJ2A 1YUBA 4O2DA 2UXCL 3OIPA 4V190 4F5QA 2HI0A 3PO2B 5AKEA 4A3BG 5C6AA 2J4XA 2FH0A 2GLEA 3M6ZA 4I2IA 2LVPC 2K75A 4A3FG 1PTOD 1N34Q 4QF4A 3PY8A 1D7QA 3CW2C 1WJ7A 5BN4A 2LFNA 2NRXA 3S24A 3FRIA 4F92B 4A93H 2WKDA 2KK0A 4RNOA 3WK7A 4HR7B 4OJPA 2R6FA 5JJZA 3Q8KA 3SBJA 3T38A 1NNXA 3TP6A 4AKIA 4DR6M 4U673 4RPYA 2KOBA 2A6ED 3KP0E 4J9RA 2EYPA 4R4TA 3X3MA 1OXJA 7ICIA 1NMGA 3TN2A 2UXCM 2OEHA 1PLFA 2KHVA 1NHWC 4M9SA 2QB1A 3HPOA 5KG3A 1OFHA 3U6OA 2YTXA 3ILKA 5D49A 1E9SA 1DOQA 1L8OA 1ZQBA 3PSFA 4UQGA 1HPCA 2JY8A 4BA1I 2Q4TA 3G71A 2A6HC 4A3FH 1QAQA 4NXMQ 4R4IA 3MEFA 4NM2A 4JOIA 2W04A 3K0XA 3RMHA 1J97A 3RAXA 3SV3A 1SE8A 1MU5A 4GKKL 4QZIA 1TVAA 2DPJA 3CQZH 2HHWA 5DYIA 3TQ1A 2NVTH 3S17H 2O2LD 3V72A 1LABA 4GIBA 3KHLA 4DR4M 5KPZA 3VR4A 3FTEA 4ECVA 5ALMA 2YR0A 1QTMA 2H1RA 4OW0A 1PJQA 1X3GA 1E22A 2CV0A 4C2MH 4RNNA 4OJLA 1ZQQA 2EAMA 4RGMA 4DR2Q 4ANRA 1K3RA 2RDFA 2HHUA 1S5DD 1SYCA 3TACB 4QGUA 3K8ZA 2LYHA 1VDDA 2G07A 1SFOB 4RU9A 3MXNB 1A3TA 2C35B 2XLJA 1JX4A 1EWHA 3AFPA 2DENA 4N8FA 3HKSA 5BOLA 1HRJA 2Y0TA 2V4DA 5C3WA 1RQLA 2E3TA 1JUDA 3TARA 2RA4A 2JHDA 1SYBA 1QLNA 1XMOL 3BS5A 3PR4A 1IV8A 2K04A 4AG5A 3SHLA 2FS1A 3HKZF 4XYOA 5JJKA 1ZQZA 3UMCA 2L15A 1K3XA 5KFXA 1UE1A 5KT3A 3H40A 3VYUA 3HOUB 4PZOA 1UUPA 3M0EA 1CA6A 3Q8RB 1SBBB 2N55A 1S76D 4PNYA 1I4HA 3BBZA 4IBKA 2JK8A 3MXGA 1GUSA 4GMQA 2Y1IA 4UAWA 2ICEC 2NVXB 1TWCB 3CKIB 5BR8Q 3EQLC 4HJAA 2DL0A 8ICEA 4IPHA 1ZMWA 3WWVA 4ABNA 2ZTEA 3NXWA 2VIXA 4QIWC 3PGZA 4ECZA 1D9FA 4RQ6A 3RH6A 7ICVA 3K9PA 5EE9A 1OO9B 1BNPA 2RCNA 3PX0A 1K3WA 1C20A 4G4NA 4JI8L 1UCVA 2CWAA 2RDGA 1EIFA 4FCWA 3RR5A 1WR1B 2K0BX 5J3BA 4IIWA 2KIVA 4KLGA 5KPTA 2F0WA 4KK7A 1N33L 3NTHA 2MRLA 1KAAA 3QXGA 1FFVA 2F0HA 5CV8A 3D2QA 2F0OA 1CKOA 4FXGC 3OIQA 5KFRA 4EYIB 2QEXA 1ZD5A 2XIWA 1Y8GA 1J2MA 1GUGA 2KNVA 3KDFB 2UUBQ 3IP4B 2JP1A 5HHIA 3QO2A 2B2TC 4FF3A 1MJGM 1K8MA 3IKJA 2AQ4A 2L6OA 2HBJA 4PCZA 4R65A 3U6SA 9ICRA 3CCSA 4K6LA 2R8KA 5M3FH 5ALDA 1Y1VG 3M4PA 1CRXA 1TAUA 5DAUA 1L3TA 2Y9UA 1ZQEA 3LQQA 3PV8A 5M5XH 4Y2YA 1J6QA 4JWNA 4P74A 2E74C 2UU9Q 2IPKD 3BDCA 4G4RA 4F5PA 3EUB2 3GLGE 1Q8IA 2ZJPA 1FNNA 3H4MA 4B3RQ 2DJGC 5DQGA 4PMBA 5AKYA 3FVQA 2YTUA 4O5KA 2LS01 1Y1WG 1SRUA 3SDZA 5E6JA 1YNJD 3AU7A 4DF4A 4DNRB 1SXJA 4S12A 5ALOA 4DGZA 2N3SA 5KNDA 4GKJL 3K1RB 2JEFA 1OXXK 1SKRA 2KG5A 3KOOA 4KKSA 2D7EA 3PMNA 3RB4A 3MFYA 4DU9A 2E2IB 2K01A 5C4XH 1GLNA 4GRIA 1Y1VH 4GEWA 2B2WC 4RQ4A 2Q8IB 2YY6A 3GTJH 3PO2G 1NNUC 1SMYC 2KVCA 2XTIA 5C4JB 1F77A 3J80c 1COKA 9ICIA 3E0FA 3FYCA 1L5UA 3Q8SB 1JICA 2PCFB 3OHAA 1T5XD 3OJUA 1K82A 3R3OA 3STBC 1ZRNA 4A3VB 3WOFA 3BQTA 2MUTA 3FUUA 5JEAG 2D9UA 4M9JA 3MC1A 3AYHB 4IR1A 4JI5L 1IY1A 4CJ2C 1KDBA 3T1HQ 5AK5A 1ZYRC 1ZQOA 4FWGA 2HVHA 4F72A 3PO3B 1QUSA 1HNZL 3FPPA 3PO2H 4POFA 1PV4A 2KVSA 2ZXPA 4F4XA 5IIKA 1KFTA 4HIKA 3Q8LA 8ICOA 3KDSE 1X66A 3P1HA 2A3VA 3VK8A 1EYCA 1V1OA 1ED1A 3ERQA 2ZIUA 1IZ6A 1HZ9A 3OTQA 4M9HA 2D0OA 5E7NA 4ODGA 4KN7C 4UB2A 1SL1A 1FVIA 4JI5M 1ZQAA 1URJA 5JEAH 4O3NA 3KF8A 4M0AA 4IPCA 4KN4A 4F4KA 2MO0A 2WAQE 2IL8A 5C0XJ 2HIVA 2ASLA 3HOXB 4ED2A 1HNZM 3GDXA 3PX6A 4TQUS 1SJED 1UFZA 3D2NA 3LWLA 1O7ZA 3SYLA 5DB7A 9ICXA 3CAMA 1PJIA 2QBYA 4YCXA 1IW7C 5CV7A 3EBEA 4JXJA 3C46A 3T1YQ 1T5EA 3C2KA 5KFVA 4NLGA 3J27B 2V4QA 3W0LB 5EWEA 2DXIA 4X64M 1Z59A 2KCMA 4I8OA 4XK8F 4GN3B 1X6IA 3U26A 1L3SA 5B66U 4LCBA 5FTNA 2XSZA 4F1IA 1Z4OA 1HFGA 3HX0A 3WK9A 1QOHA 5M5WB 1AFPA 3U60A 3EW9A 2KSOB 1DXSA 5IIOA 3A46A 2LWXA 3T13A 2MNAA 4Z9CB 4CF4A 1FIQA 3HFZB 3IDWA 3D4DA 3S1MH 4B9TA 1NHGC 3CC7A 3K81C 4W5WA 1SXJD 4JI3M 2UUCM 2SDFA 2WF7A 4LFBQ 2I6XA 4JW0A 2AQ3B 3N52A 1NTGA 4K8IA 2JXJA 4MF2A 2PQAA 2XN9C 4J1MA 4HAEA 3JR4A 2AWNA 4KLTA 3WK6A 2KZSA 4YD2A 2G3QA 2BA0A 1X32A 1W6KA 1T6OA 4NL9A 3HOZB 5KG1A 4UARA 2KNJA 1KDAA 1QSYA 4OO1G 5BN3A 7ICJA 4UB5A 1TY0A 1Q1BA 1NK4A 2DF4B 3DUZA 3OMCA 2ZIXA 4C80A