2ZTCA

Mtruva form ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
188
Chain Sequence
GRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 44
structure length 188
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztcA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztcA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztcA01
1LTLA 1WCMG 1S9FA 3UXOA 4LW1A 3K81C 7ICTA 3ER0A 2FPKA 3KHRA 1TKDA 5J2KA 3V6HA 4M9LA 1L5UA 5IIMA 1V1QA 4DAMA 4YR0A 4X65Q 4LVSA 9ICGA 4BBSG 5KFCA 4PHDA 1ZQRA 1J5EQ 3RH5A 3H0GH 2L15A 4OX9L 4ED6A 3T5JA 1KLNA 3EPGA 4DKAC 8ICXA 1E3PA 5KT7A 1Q1EA 5IIJA 2I5HA 4JV5L 2IY5B 5J2FA 4Q44A 2RDIA 1TR8A 2Y1IA 2IX1A 2I9GA 4BWMA 4DPGA 8ICCA 9ICLA 2LXJA 4AIMA 5DQGA 3BJUA 2KTQA 4UB3A 3RR8A 4YXMA 8ICZA 1CKOA 2ZJ5A 5IWAL 4B3TL 1YEZA 2BA1A 1JMSA 1WGNA 4F4ZA 1B22A 1VQ5A 1VQ1A 8ICOA 2GN5A 2LVOC 3GFKB 1S10A 4J9LA 2YTYA 1JJGA 4A3MH 1RIPA 4A3GH 2XGQA 2ASDA 2PI4A 2DENA 2GVBA 9ICCA 4TQUS 1L2FA 4IRDA 4B3SL 3PUXA 5HHIA 3HOUH 5J0XA 3Q8DA 5J2AA 4UB5A 4FBUA 4GOPA 5EAYA 2F4VQ 2PMZE 3PW4A 3C5FA 4P75A 1A0IA 3TANA 3PW0A 4JOIA 2MUTA 4YCUA 3V7JA 2YTXA 4TUPA 2DFLA 3W1BA 4EZ6A 4YFKA 2MR9A 1I5FA 8ICYA 4B3RL 3HOZG 1HZAA 2J6UA 2DAEA 5K36G 4GLXA 2QSFX 2VS1A 4DV6L 3MDAA 1VQBA 1SKRA 3RTVA 3OJSA 8ICNA 2PQAB 3HOXG 4B3SQ 5DLGA 5C5JA 2HAKA 4EZ9A 3TQ1A 4DSIA 4K4HA 1KRSA 4I2IA 2MGWA 3E2EA 1JMCA 3OTOQ 5IYCH 3MXNB 1PA6A 1UA1A 1GD7A 2GVAA 2HT1A 2AGOA 5KFMA 5DBAA 3K8AA 9ICAA 3ZDEA 1NV8A 1W3SA 3RJIA 3J7ZC 4B3RQ 3RN2A 3C5GA 5HY6A 5M3MH 5HGQA 2F1JA 2I5MX 4HJ9A 4F93B 5D4BA 1COOA 1K1QA 4KI0A 2FMSA 2C28A 1ZQYA 1CEZA 7ICLA 2QNJA 7ICRA 4IOCA 4UBCA 4GNXA 2JK8A 4M0AA 5IYDH 2UVUA 2HHQA 2JA6G 3GILA 1WCNA 3GO5A 3RNUA 3PMNA 3I7FA 3PW5A 2ZTCA 9ICEA 2R7FA 7ICGA 4DUZQ 1Q81C 5DGAA 1ZQTA 1PFSA 3GDXA 1S0NA 4JI5Q 3T1YQ 3F2CA 3M85A 2ZUCA 4JV1A 4A93G 1Y88A 1EQRA 1XWLA 3HOYH 4K0KQ 1L0WA 2B63H 1WGLA 3I56A 3IECA 4P74A 3HP6A 5AJ3L 2LBCA 3E9IA 1K8GA 3UDGA 1XPOA 1PVOA 8ICRA 3GV8B 3RBEA 2NZHA 2Z6KC 1MQ3A 4HJ7A 1CSQA 3JPSA 4DFPA 4XA5A 4LF4Q 1QVGA 3S1MH 1V43A 2JEJA 1X3FA 4B3MQ 2ISPA 2NZOA 1WFQA 5J2JA 1X3GA 1VQ6A 2WZJA 1HZCA 4LFBQ 3JPPA 3M4PA 3Q8RB 1L1OB 1UE6A 1MN3A 3K7UC 4DSFA 1NKBA 1K3RA 4DF8A 4DL2A 1VQFA 5HP4A 2OOBA 4LF5Q 2UXBQ 2OQ0A 4LF8Q 4OO1I 4UAWA 2Q2HA 3U50C 3M8SA 3JPQA 2W9CA 5DG7A 1IXSA 4DR6L 2UUCQ 4GC7A 1E22A 2JE6I 4X66L 2KFNA 1X54A 5M3MG 3UQ0A 1Y1WG 1HR0L 4M04A 2Y0SG 1JJCB 4Q7JA 3S2HH 4KHPQ 5JUMA 3EYZA 4R4QA 2OQKA 2HIVA 1F4IA 2R92G 4PZ6A 4IPHA 1KFTA 4RUCA 1NK0A 1CKNA 4RPYA 4UN2B 3PW7A 4HIDA 4DR6Q 3PMLA 5DKWA 1PV4A 4EYIB 3RLOA 8ICGA 3ISCA 4JI1Q 2P66A 4KHZA 4BA1I 8ICFA 3UDIA 2CKZB 4HJ8A 3W1GA 2VUMH 4AQYL 3G71A 3RB4A 2K14A 4NPSA 4RQ3A 2JY5A 1KFSA 4A75A 5CJ7A 5KTQA 1ZQCA 1ZQDA 5J0WA 4DR1L 3GLGE 4YN4A 4YD1A 4I2EA 2KZMA 3RJGA 4JV0A 3C2LA 3KF8B 1WIVA 4NXNL 4A3KG 2ASJA 5EOZA 4IRCA 2QHOB 3TFSA 1VQCA 2MNAA 3S1RH 1VQOA 1N33L 2E8GA 4GKKL 2V4RA 1C7YA 4GN3B 5KFXA 4AQYQ 2RCNA 4F2LA 2AQ0A 3H8SA 2JA7H 3N4MB 4IQTA 3M9OB 1IBML 2YV5A 2E5LQ 4QWBA 4ELUA 4O3NA 2K5NA 1AROP 1D7QA 4NLNA 5DDYA 5FLMG 2OO9A 1TAUA 3NENA 1IBLQ 2N49A 1ZQGA 1PH6A 1PGYA 2B29A 4GKKQ 7ICFA 4R64A 2B3GA 4A3IG 3RR7A 3RZOH 4IFDI 2JA5H 4JG2A 3UE1A 2NRXA 3JPTA 1ZQNA 2AWNA 1N34L 4A3BG 5J0YA 7ICPA 2BPFA 4DV5Q 2R93G 1UT5A 1TWHH 1Q12A 4GLAC 1ZQSA 1EWIA 3M7NA 2BCSA 1HNXQ 3GTJH 4UQGA 1VQHA 2NRZA 1TAQA 2UU9Q 2BWBA 3GTPH 2NRWA 1CKMA 4HEOA 5DLFA 4LF6Q 5IY0A 1RPLA 2BKEA 1P3QQ 5DDMA 4Q8FA 3KOJA 4A3CH 3EW9A 2Z6KA 3JAMi 3CCRA 2J6SA 1ZMUA 2K75A 4M9HA 2ALYB 5DGBA 4PHEA 1VQKA 1OXTA 1ZQWA 1VDLA 1EYGA 3PX4A 4JI7Q 5J0SA 4I2BA 2A8VA 3UQ2A 3OSNA 5KT6A 1N48A 1VQJA 1EIFA 2L4EA 2BPGA 3RRGA 5C44H 4ECSA 2F1HA 4K4GA 1ZQQA 2LSSA 1T3NA 2JA7G 1UA0A 1G3IA 3RZDH 5EWGA 3PO2G 1HH2P 2R8IA 4NM2A 2JEIA 3T5LA 2VW9A 3ETLA 1ZV1A 3THVA 5KG5A 4IJHA 1PH9A 1ZQMA 4NLKA 1OKSA 2CWAA 5IIOA 2JA9A 8ICAA 5CP2A 2AJQA 3ULPA 5KFSA 4A3EH 2DAGA 2BH8A 2ZTEA 3GLHE 4A4IA 4F4WA 4GOPC 2PFQA 4RMFA 9ICFA 4Z6EA 8ICEA 4GKJQ 5JI2E 2DPJA 3KJPA 4JOIC 4DV1L 1Q82C 3LDAA 1G41A 3SV3A 2BHNA 4ECRA 3JAMc 2PXIA 5C4XG 4I2DA 4DF4A 4PG3A 4LFAL 7ICUA 1IL2A 1YHQA 3BQ1A 4XRHA 3G48A 1XMOL 2Z0SA 4YY3L 3GTQH 4YHHL 4NM1A 4POGA 2IX0A 1XSLA 4KLDA 1SN8A 1XMQQ 1SRUA 4DK3C 1JR3E 4O0AA 3HPOA 4DV0Q 3CPFA 3TS2A 4RQ6A 4IQUA 4ECUA 3CP0A 3PIOA 2ZJPA 3ICEA 1XPUA 1VQEA 2KHIA 1YLAA 4GN5A 2FMQA 1JE5A 4DV1Q 4JI2L 4DLEA 4QWAA 1VCIA 3HOVG 4KLQA 9ICPA 4PH5A 4R4TA 4QW8A 3K9OA 5KFUA 2CWPA 1XTDA 1K83H 9ICVA 4YY3Q 4BXOA 3FYHA 1Z00A 4YHHQ 4XIGS 2IHFA 2DNAA 4JWMA 5M5WH 3ISBA 3H40A 5C0XI 4DV4L 4TURA 5C44G 1L3UA 2XGPA 4YMMA 2YU9H 4ECWA 4DR5L 3NGDA 1QVFA 4KLGA 2UUBL 3PO3G 4DV2Q 5KFPA 4F50A 3RR5A 3B0YA 1E1OA 3M9MB 4ED3A 5M5YH 3UDXA 1HNWQ 2DKLA 2JJQA 1UFZA 1VQPA 4YCXA 2RDJA 1IBKL 8ICUA 4IOAA 3RJKA 4A3EG 4KLTA 3K7AH 2PI2E 5CA7A 4GLVB 3MDCA 2WP8J 1NK5A 4DR5Q 5EWFA 5J2HA 1NBWA 4X65L 1MIUA 1NKEA 3BQ2A 5FJ8H 5KG6A 1J5EL 1MJEA 7ICIA 3CW2C 1V9PA 3ULJA 1MQ2A 3VDYA 4RQ1A 3TARA 4DL6A 2R7ZH 4A3LH 2ZJAA 3HFZB 1EUJA 2ATLA 3CCMA 5KFLA 2BH2A 3K80C 4B9LA 1VQNA 3MR5A 4X6AH 1NK6A 5KG1A 1LV5A 4LUOA 4PMWA 4ED8A 4PZ7A 4C3JH 1S72A 1M1KC 3GIJA 1S3OA 4DV7Q 1PH1A 1XNQQ 1X65A 4BBRG 2O25A 4KLIA 1EXNA 5KFAA 1XNRQ 9ICNA 2YYZA 1Y1VG 3M4QA 4LNQA 4JI4Q 3GIMA 7ICEA 1PYSB 1QVCA 4F2SA 2VQFQ 2F52A 4I2CA 2F4VL 2FXQA 2EKFA 1SKSA 3GQCA 4HIKA 1ZQBA 3I2ZA 4JBMA 3IHPA 1S0OA 4KN4A 1E94E 4UP9A 2W8KA 4ECTA 3PF5A 1WJJA 2AU0A 1BBUA 1HZBA 5DB7A 4LFCQ 4P4OA 2XO7A 1MJCA 4DSEA 2NVYH 5KFNA 3RH6A 1GM5A 3I4NG 4RQ4A 5KFQA 4B9VA 3K4GA 1RXVA 3Q8QB 1X3EA 1KXLA 3OTOL 2JZBA 5KFGA 1SKWA 3ZJYC 2DZLA 4UAYA 4A3JG 4P72A 5KFHA 5KFEA 5DBBA 4JYAQ 2EKKA 2FMPA 3C1ZA 7ICOA 4NY8A 2R7ZG 3JPOA 4MTNA 2NVXH 3GDEA 4MEXA 2WTFA 4KLFA 5L1LA 8ICPA 3ZD8A 2ASLA 1Q02A 4YQWA 4HYKA 4DOCA 3NELA 1N36Q 1ZQIA 4UY8C 5KFDA 4AYBE 4L5TA 2FPLA 2UXCQ 3M8RA 3CXCA 2DI0A 3T1HL 4DUZL 2ZUBA 4YWKA 4O5CA 3MGHA 4C3IH 3STBC 2BQUA 5CHGA 4JI5L 2DAIA 3T1YL 4XUSA 2M9NA 3J81j 3H0GG 8ICWA 8ICIA 4IFDG 2MUTB 2HVHA 3CCVA 3MMPA 4K0KL 1FGUA 9ICUA 3N97B 4L5RC 8ICSA 1KFDA 2R8GA 1SMXA 4QZHA 1JXLA 1ZQKA 4DQQA 9ICXA 2FLPA 1ZQXA 5J29A 3GTKH 1K1SA 7ICHA 4QZIA 4RPXA 3AYHB 4LF4L 3EPIA 3GIKA 3STBD 4B3ML 1BPZA 2NN6G 3T1HQ 3IHQB 3T5KA 1SFOH 2JNHA 4R8UB 4RQ2A 4JI3L 4GC6A 1U47A 4LFBL 1QZEA 3S2DH 2CP8A 5KFBA 7ICMA 2I5LX 3D0FA 5GQOA 2WAQG 1G6PA 8ICBA 4O3SA 2DAKA 4J9SA 1Q8KA 2VQEL 5HHHA 4A3MG 1T43A 4A3GG 4BXXH 1X9NA 3TI0A 3ZDAA 5IYBH 1ZQVA 2A1JB 4YVZA 4LF5L 3GLFE 2ASBA 3HOUG 2UXBL 3RB6A 4LF8L 5J2EA 2BR0A 2DAMA 3S1NH 1SL0A 4GNXB 4JI8Q 4KLLA 2W9AA 3E21A 4EYHB 1ZMWA 3ERSX 4IFDJ 4JI3Q 2UUCL 3TEHB 3PUYA 1KC8C 5GADC 2KZZA 2E2HH 1D8YA 1PH7A 2VQEQ 1NJZA 1SZPA 4GXIA 1HT2E 3PUVA 3LK9A 3KHLA 2R8HA 4M9GA 2OCEA 4KHPL 3AFQA 4IPCA 4LUVA 2R6GA 1I50H 3HWTA 4DLGA 1I94Q 3RAXA 3TFRA 3H7IA 4QZGA 5IYCG 2HW3A 4OONA 1DV0A 4KITB 5IP7H 4M6WB 5FLXc 4F5OA 2K52A 3PV0A 4JI1L 5KFYA 4R1JA 5CR0A 4QZ8A 4O9MA 3EBEA 5KFKA 4RU9A 4F92B 1KIXA 3C2KA 8ICVA 3LCVB 3NBHB 5IYDG 3CF5A 1UE1A 1OXXK 2YTVA 4FS2A 4C8OA 3IRBA 4UBBA 3KHHA 1U48A 4YMNA 4A3DH 2CCZA 2ZTDA 3CC4A 2W9CB 4BGDA 2NVQH 2MJ5B 2HHWA 3KYHC 4J9OA 2EXDA 5KT3A 4I2GA 4LWCA 3G6VA 5DB9A 1I3QH 3HOYG 3MABA 3CMAA 2B63G 4CCHA 4ED2A 2A1AA 4BXXG 2IHNA 3OW2A 4RPZA 1A8VA 2AMCB 4IQWA 3TAQA 2VL6A 3L7ZC 1IM2A 5M3FH 2E5LL 1XO1A 4M9NA 4DV3Q 5KFJA 1HNZQ 4QJFA 1ZQFA 2JEFA 2G3QA 3PX6A 4I2HA 1ZQLA 3G4SA 1TVAA 3RH4A 1IBLL 5L1IA 1VQMA 4P4PA 1X6OA 3AEVA 2KNAA 5BOLA 3H4JA 4YR3A 4AH6A 1GO5A 4ALPA 3HW8A 2K50A 4HJAA 4TUQA 2R8KA 3ZDCA 1Y8GA 2LTUA 3RJEA 5KG4A 5IIKA 1YIJA 2OOAA 4F91B 4ECYA 2KN7A 1QTMA 4DR3Q 1UE5A 4F4XA 1PH8A 4DUYQ 4ME3A 4DV5L 1FJGQ 4RNNA 4RQ5A 2XCAA 4QZ9A 2PFPA 3PUZA 3QZ8A 2C22A 2ZJRA 1C9OA 2MO0A 1QUQA 4C3HH 3PX0A 4M47A 1HNXL 3RB3A 4R65A 2UU9L 4UB2A 4EBCA 2FPMA 1E24A 5BOMA 2JP7A 2RHSB 3HKZG 2KNVA 4NLZA 1YI2A 4NXMQ 4O3OA 4JI6L 3B89A 4IQVA 5DBCA 4LF6L 2P6RA 4Z6CA 1U0LA 3OYYA 2NRVA 3OSPA 2NVTH 1JX4A 1D8LA 2BQ3A 1ZYQA 1SL1A 4QIWE 5KFTA 1VEKA 4X5VA 4DOBA 5C0XJ 1QSLA 3M3YH 3RB0A 4AYBG 3MR6A 1SL2A 1DO0A 4KLEA 3T5HA 4F8RA 2EQSA 2CFMA 3KLWA 4JI7L 3MR3A 4BA2I 3BBZA 4IJLA 2BCVA 1NJWA 7ICQA 3KF6A 1ZETA 4JI6Q 3BZKA 2VUMG 3CCSA 3AFPA 4RNOA 2N78A 1YITA 4KMUA 4M9JA 3PCOB 1A76A 3LCUA 3V7KA 4P71A 2BCRA 1IYJB 3T3FA 1XS9D 1BPBA 4DR2L 5J0RA 4LF9L 2FLNA 4BDPA 3OHBA 1GO3E 2IMWP 2AQ4A 2KCTA 3JC66 1XU4A 4X64L 1TWAH 3OHAA 2WB1E 1NJIC 2LXKA 1PYBA 3J81c 4DSKA 5KFWA 1BKBA 4APVA 4EBEA 4GKJL 3FP9A 3G6EA 9ICOA 4JBWA 1FVIA 2HHVA 2E2JH 5KG2A 3GTLH 2IA6A 4IRKA 4A3FH 4DR2Q 4LF9Q 4KLUA 3FKIH 3S16H 4DO9A 4DL7A 3PW2A 1TTEA 1R4GA 2W9MA 1G291 4NB3A 4F4KA 3EZ5A 4X64Q 2JZ1A 3TREA 3GTMH 3H3VI 5BR8Q 3G6YA 2K5HA 3Q8SB 3MGIA 4TQSA 5M5XH 1XMQL 5F9NA 1XSPA 4DV0L 2JA5G 1X9SA 5L9XA 1BBWA 3U4VA 5DLQE 3GTGH 4F4YA 4C8MA 1VQDA 4RUAA 2R0IA 1DOQA 4QZBA 1NKCA 3KDFB 4JK1A 1KEJA 2CWBA 3B0XA 3V6KA 1T8EA 3HKSA 4TVAB 2W9BA 3ZDBA 4TUSA 4IR9A 1K0RA 1G51A 4RQ0A 4RQ7A 9ICTA 3CCEA 9ICBA 3HOWH 4UAZA 4F5RA 4QGUA 8ICHA 2V4QA 1TK0A 1PHJA 2HWJA 4QQBX 1B43A 1XPRA 1ZQUA 5IP9H 4A3CG 3FRIA 4DV2L 2JY6B 4J9MA 1Z9FA 1PH5A 3Q8PB 2UXDQ 2EIFA 1HNWL 1D9DA 2H5XA 2WAQE 4FS1A 5KG0A 1NMGA 1WCMH 2KCMA 5JJIA 2UVVA 1A77A 2HVIA 1AE3A 1HJPA 4C8LA 1OXUA 1VQLA 3J80i 4DQRA 3L2PA 3PIPA 1MKHA 2V9WA 2MROB 4G3IA 4J9NA 2KFZA 4JI0Q 4BBSH 4MEYA 1T4GA 3CMEA 5JEAG 4X62Q 5KFZA 3DM3A 4BY7H 3PUWA 3MBYA 4DFMA 4QWCA 1C0AA 4Q45A 3M9NB 1H95A 1T9HA 5D49A 1A5TA 3FKIG 3B6YA 3JPRA 5ELOA 1Q86C 4ECZA 1NOMA 4UPAA 2UVWA 4EQ5A 2OTJA 3GV5B 1QZHA 4R63A 2Q0ZX 5CWRA 2HHHL 4HJ5A 1KRPA 4BXOB 2N3SA 1Z00B 1OQYA 4IPGA 1X9MA 1OTRA 1L1OC 4YG2A 5KFIA 5LMNQ 2PI5A 3F2DA 2RRUA 5J2BA 2N8NA 3H4BA 1ZQAA 3UXNA 2VY3A 4YP3A 4MF2A 4DBGB 4A76A 5J0TA 4DV7L 3J7A5 1WI5A 2BQRA 4YMOA 4UP8A 4NLGA 4J9PA 2IHEA 1XNQL 9ICIA 4PPXA 4YD2A 3C23A 4KLHA 1S76D 2JA8H 2P6UA 1XNRL 4ELVA 2HHHQ 5JEAJ 5C3EH 4OO1G 4J9RA 3I4OA 4JI4L 3J80c 1ZMVA 4I2JA 2LYHA 1HZ9A 2ZJ8A 4MZ9A 3A5ZB 2VQFL 5DG8A 8ICMA 1IM4A 1VQ4A 4JV2A 3HOZH 2HIXA 3M4OH 2VA8A 8ICTA 4H02A 3RAQA 4RT2A 1M90C 3BQTA 3HOXH 2ZM6L 4DFJA 3BDPA 2B21A 3V7LA 4GXKA 1NE3A 4RQ8A 9ICRA 1ZQZA 2KNZA 4PGQA 4LFCL 4QY7A 4DQSA 1U49A 4JBKA 3PR5B 1EOVA 4I2AA 4O5KA 1WR1B 3JPNA 1TWCH 5J2GA 5L1JA 2JEAI 1X56A 3D31A 1NV9A 4LZGA 4BY7G 3CCUA 4UB4A 3LGJA 2AGQA 1QLNA 4B9MA 3UXPA 5DB6A 1NK8A 2ZM6Q 4ED7A 5DQHA 1ZJNA 1SG9A 4JYAL 5E7NA 5GAHC 1K8AC 4OWXB 2JA6H 3CAMA 4G3OA 4WP2A 4QZAA 5DFLA 4HIOA 4B9UA 3MFHA 5EWEA 3T6PA 4YR2A 9ICQA 2WB1G 2KHJA 2XTIA 4EEYA 4QWDA 3S24A 1P8LA 4P2HA 1N36L 1S0VA 1OTCA 1NK4A 3PNCA 4F1IA 2MQHA 5J0PA 2D62A 4OX9Q 4JUZA 2UXCL 4O2DA 4XTCS 4A93H 4O3QA 3EIVA 5JJKA 3PO4A 5H1SE 3RRHA 2PQAA 1S97A 4JV5Q 5FJ8G 3CCLA 2DGYA 3HKZE 3WWVA 3TAPA 2GWSA 2K9DA 3FRHA 4R4OA 2JA8G 4ZH4A 2MAXA 2VANA 2A19A 4A3LG 2HHSA 5C3EG 1MSWD 4R71A 1WHCA 3RN5A 1PH4A 3EN2A 5GROA 4ELTA 1JJ2A 2BWEA 5IWAQ 4B3TQ 2ZJQA 2F3IA 4K4IA 3H3VH 4YWLA 1V92A 8ICJA 4I2FA 4GOPB 3QEAZ 3GLIE 1UT8A 1OXVA 2JZBB 1G4AE 2XGTA 2AWOA 1QZGA 2BA0A 2L4FA 4KTQA 1PH2A 3OGUA 2BPCA 5JJLA 5DQIA 3FE3A 3KJOA 1KL9A 3KTQA 4I28A 5J3BA 2Q2UA 4R8UA 4DR4L 5KFFA 4J9KA 2JEGA 2LVAA 3F1ZA 5KT4A 4ED1A 1VQGA 4JI8L 1IZ6A 3K75D 1XSNA 5L1KA 1XC9A 4POFA 4YCVA 1TWFH 1XJVA 4DV6Q 1Y1WH 4PGXA 2A1JA 2UUAL 5BPCA 4DQIA 4PZ8A 3PGZA 2PI2A 2ES2A 2D0PA 1B7YB 1LM0A 2K4KA 4MNOA 2R92H 3F8TA 2V1CC 4FO6A 5GAEC 1W2BA 1KQSA 4DR4Q 1QSYA 3K0XA 5KG3A 5DG9A 5ELNA 3RJJA 3ULLA 3MFIA 1L1OA 3MEFA 2AHOB 7ICJA 4ECXA 1I94L 7ICKA 2JY8A 1LYLA 3HT3A 1TFRA 4RNMA 3K9PA 2KENA 2JY7A 2BDPA 2UUAQ 3UE0A 4M2YA 4O3PA 2C35B 3NEMA 3ZD9A 3GV7B 1VQ8A 2QEXA 1O7IA 5LMNW 1Q1BA 3S1QH 1NK7A 4FDBA 1JXEA 8ICQA 2I1QA 3G6XA 2VA3A 4A3KH 3GD7A 1CUKA 2ATWA 2XCPA 3E9HA 4M6WA 3A0JA 1JN3A 4I27A 8ICKA 3RLFA 5AJ3Q 4DOAA 3SV4A 1YNXA 2IBKA 1S0MA 1TWGH 1IXRA 2C2RA 4LUZA 2VA2A 4YCWA 3BU2A 2KZ3A 1R9TH 2HHUA 4GS3A 1DGSA 1BPYA 4UP7A 3E0EA 5FLMH 1UEBA 3FHWA 2CQOA 1ZQEA 3U4ZA 3Q8MA 4DV3L 1HNZL 1BPEA 1YJNA 4L5QA 3C21A 1UE7A 2LVNC 1BVSA 4C2MH 3PR4A 2BGWA 3OJUA 1VQAA 1L3SA 1L3VA 4E0DA 4A3IH 1QSSA 3Q8LA 3PSIA 1ASZA 1PH3A 4KLJA 4JCVE 1Q7YC 2LVPC 3F92A 1PZNA 2R7DA 1J6QA 4L5SA 4B9TA 4A3BH 2R8JA 3KHGA 4O0IA 3I4MH 2R93H 1U4BA 3L0OA 1N8RC 4UB1A 5IYBG 4LZDA 4PHPA 1WCLA 2ISOA 3A74A 4DQPA 4Y7NH 4DR3L 4FBTA 4X66Q 4TQRA 3C1YA 4DUYL 1FJGL 4Y52H 2DHYA 5HNKA 2J6TA 1ZJMA 4IO9A 4GEWA 4QZEA 2C2DA 3AUOA 1CKNB 2JEBI 1AH9A 3H8JA 1HR0Q 5C0XG 1SR3A 9ICSA 2RF4A 4IPDA 1RYRA 2HHXA 4F2RA 2DUDA 5CB1A 4PGYA 1B8AA 3SI8A 3Q8KA 2IHMA 4NXML 1E7ZA 5GAGC 2VNUD 4C8NA 3RJHA 1E1TA 1GKHA 3M9BA 1YHBA 3V72A 1SE8A 9ICMA 3CQZH 4DL5A 2XY7A 1LB2B 3ISDA 1U9LA 3CC7A 2FLLA 7ICNA 3PO5A 1H38A 1K9MC 5KFRA 3BZCA 5C4JH 5IP7G 3J81i 1YHAA 5HMLA 2Q2IA 3CD6A 1BPXA 5J0UA 1RYSA 4OWTB 4OXPA 4DR1Q 2ALZA 1EQQA 1ASYA 3PO2H 4Z6FA 1DO2A 4MF8A 2B3TA 2JUJA 1ZQJA 3H15A 3QZ7A 3CCQA 4DR7L 1MC8A 4NXNQ 4QZDA 2ID0A 5KFVA 3PF4A 1KD1C 3H4DA 2XC9A 1N33Q 4F5QA 1AIPC 4GXJA 4PHAA 2Y1JA 3HX0A 1NJXA 4A3DG 2AKWB 3SGIA 1X2IA 2I0QA 1QUQB 9ICWA 4P4MA 3TRZA 1HUZA 3MR2A 4DS4A 3PV8A 1IBMQ 4OWWB 5KT2A 4F3OA 1FL0A 4DL3A 4R4IA 3I4MG 3RJFA 4DR7Q 1IFYA 1BPDA 5C4XH 4XQ8A 3AQQA 5M3FG 3AU2A 4KLMA 3NTUA 2NN6I 4LF7L 2NRTA 3GTOH 1U5KA 1BGXT 8ICLA 4KN7A 1VEJA 1Q46A 4RG1A 4HIMA 5BR8L 2QA4A 1A63A 4B9NA 5KFOA 3SZ2A 3IM1A 2JZ0A 4QWEA 3S15H 1N34Q 5HMMA 3W5OA 1XB2B 1RXWA 4BY1H 4C8KA 3KF6B 1KSPA 2DPIA 3HOVH 1TK8A 4DWIA 2MFIA 2W8LA 4WJ4A 5KT5A 1YZ6A 1XXHE 2OWOA 4LF7Q 1S77D 3UPQA 3DLLA 2PFNA 5IIIA 4ECVA 1HQYE 1KTQA 4DL4A 2PFOA 4JWNA 2Q2TA 1OXSC 3S17H 1VQIA 2UVRA 1JIHA 4QL5A 4MFAA 5IINA 5KG7A 1HT1E 1YJWA 3I55A 1TXYA 3QE9Y 3PO3H 5DB8A 3EWAA 1T6OA 5LMUL 1YBYA 1EFWA 5J0OA 3KDFA 4DEZA 1KDHA 4JC0A 2KBNA 1K73C 3QEBZ 3F2BA 4YXJA 1KHIA 1Y14B 4J9QA 1A62A 4F5PA 3TS0A 4F5NA 3E46A 1LUZA 4GN4B 4KLKA 4WJ3M 2UXDL 2WFWA 4DAYB 2MO1A 4YWMA 2JQOA 2L2DA 2K5VA 4B9SA 1D9FA 3CCJA 4DSJA 4NXZA 1NMFA 1P16A 2VZAA 1Z3EB 4O3RA 1TK5A 5LMUQ 5IE8A 4JI0L 1WYDA 2AGPA 4Q8EA 4X62L 1ZQPA 1ZQOA 3ZDDA 2F1IA 2QGQA 2LVQD 4QZCA 1U45A 4DS5A 1S40A 1VG5A 1VS0A 4DFKA 1KYIA 4Q43A 1NK9A 3UDFA 1RZTA 4MFCA 3PY8A 3PVXA 4JBJA 1KAWA 2RHQB 5D46A 2HHTA 1N9WA 1KRTA 3KFUA 1B70B 2BCQA 3TQYA 2W9BB 3V6JA 5F9LA 1VEGA 1JB7A 4BY1G 4DNIA 5LMNL 4BBRH 4LFAQ 2XY6A 4ED0A 9ICKA 1XMOQ 1HR0W 3AU6A 4A3FG 1YJ9A 3LWLA 4QW9A 1Y1VH 2BCUA 1JT8A 1CSPA 2C2EA 1SLJA 4GNXC 1N32L 1ZQHA 3BQ0A 4R66A 3A5UA 1SROA 2ZUDA 1OAIA 1RL2A 1NJYA 7ICVA 4EBDA 3LWMA 3H8WA 2OTLA 1WJ7A 3S14H 1AE2A 4I29A 4JI2Q 3CPWA 2D0OA 1X9WA 4EX5A 1NTGA 3BJYA 3ORYA 2PNHA 3RLNA 3C2MA 4O5EA 4MFFA 4DK6C 3FDSA 5TZVA 4DSLA 2KHHA 7ICSA 3I4NH 5J2CA 2E2IH 1N32Q 4DV4Q 4J15A 4RZRA 1X55A 4QZFA 4R4CA 2XY5A 5J2DA 5IILA 3U58A 1T7PA 1UWVA 4KLOA 2K0BX 4IR1A 4ECQA 2UUBQ 3SYZA 3GIIA 3CC2A 3HOWG 5J0QA 1EFUB 1Z47A 1YVCA 9ICHA 1TV9A 1EIYB 4A3JH 2IT1A 1VQ7A 1L3TA 4KLSA 2EJSA 1N56A 1WOCA 9ICJA 1GVPA 5IP9G 1HUOA 4BWJA 2Y0SE 1NY4A 4P73A 3RBDA 2HQLA 1IBKQ 4Z6DA 5IT9c 1I6HH 4RT3A 5J2IA 1VQ9A
chains in the Genus database with same CATH superfamily
1LTLA 1IYVA 4HTHA 4LW1A 3QWNA 3VC8A 1PJIA 1V1QA 5BN4A 4X65Q 4LVSA 3U61B 5KFCA 4LF5M 1D0MA 5JVH3 4OX9L 4C1NK 3T5JA 3EPGA 4Y2SA 8ICXA 1XXHB 1E3PA 1K5OA 2UUCM 1F5SA 2RDIA 2IX1A 3T56B 2I9GA 4DPGA 4G4QA 1ICFB 5DQGA 1RQLA 4CKEA 4KHPM 3U6PA 1JMSA 1WGNA 4F4ZA 2KNJA 2LMCB 1CZGA 1VQ5A 1Z5BA 2GN5A 1S10A 4A3MH 1RIPA 2MHVA 2WSFF 1FD7D 2G9HD 2DENA 1GUTA 3FD9A 2MPMA 3Q8DA 4N8X1 5J2AA 1H9JA 4FWGA 4XGIA 5ALLA 3S6JA 3FUUA 2PCFB 2MUTA 4YCUA 1I5FA 3UK6A 3QOJA 4GLXA 1EY4A 2PQAB 3WKAA 3HOXG 4B3SQ 3WKBA 3GRRA 4EZ9A 4AQYM 1KRSA 4I2IA 2XRSD 2MGWA 1QWYA 5ALXA 3K8AA 5HY6A 1O7ZA 5HGQA 2I5MX 4HJ9A 2MU2A 2C28A 1CEZA 4IOCA 2UVUA 3I04M 2HHQA 3CGWA 3GO5A 4ILWA 7ICGA 4DUZQ 1ZQTA 4JI5Q 3GV3A 2P35A 4JV1A 5GTHU 1NZBA 1XWLA 2CV2A 3IECA 4BS9A 4P74A 3R3OA 3M6ZA 3GV8B 1TDHA 2K32A 4DFPA 1DZ1A 3S1MH 2JEJA 2KHQA 1UCVA 2ISPA 1VQ6A 1HZCA 4LFBQ 1LO5D 3HHXA 1WTQA 1PFNA 1WTXA 2WFAA 1TWFB 1SFOB 4DN4M 1UE6A 4TSSA 3H09A 2Y0SB 1OUQA 2IX3A 2OOBA 2F0WA 4JI7M 1TY2A 2OQ0A 1AP0A 2K03A 3A56A 1C1KA 1IXSA 1AFPA 3OSOA 2V1UA 1B44D 4Y2YA 1X54A 1YE9A 5M3MG 1HR0L 2LYBA 4Q7JA 1DGBA 1PTOH 2FMCA 2Z1CA 2OQKA 5ALWA 1X3PA 3Q0AA 4PZ6A 4IPHA 1CKNA 4IBIA 4UN2B 3DOAA 5EKLA 3PMLA 1PV4A 2LKYA 1SE3A 2Q2EB 3J7AV 4JI1Q 2P66A 3GQ5A 1TWGB 4NPSA 3MHVC 4RQ3A 1S5ED 1O7LA 3FM9A 2L9HA 5KTQA 1ZQCA 1ZXTA 4JB3A 4ULLA 1ZQDA 4YN4A 4I2EA 1A3UA 3C2LA 1QYRA 3SAWA 3TFSA 3R8BA 3UJNA 4IALA 4JN6A 5ALUA 1QZMA 4GKKL 1PK3A 3TN2A 3AFHA 2K60A 2AXTU 1NSNS 3H8SA 4YHHM 4A3BB 2JA7H 4IQTA 3HWSA 3NVWA 4QIWC 3HEJA 3I4MB 2K5NA 4HMJA 2Y20A 3NENA 1IBLQ 1ZQGA 1LACA 1O08A 2WINB 7ICFA 1HNWM 2D9UA 5CRXA 3RR7A 3RZOH 2NBFA 3PVSA 1ZQNA 2VB2X 1X3QA 2N88A 1R6BX 2LWXA 1TWHH 1Q12A 4GLAC 1ZQSA 3M7NA 1L1ZA 4DR5M 1HNXQ 3GTJH 2JHDA 1ZD2P 4UQGA 4XBOA 1TAQA 4HCSA 2Q8TA 3PIO3 1R2YA 3H8MA 5IY0A 4FO2A 3PO2B 1Z5CA 2J6SA 5FLXE 2QBYB 2RGHA 1ZD5A 5DGBA 4PHEA 1OXTA 1ZQWA 2CRUA 4M0DA 1VDLA 1EYGA 4BX9C 4I2BA 4I7ZC 1V97A 5KT6A 1VQJA 1EIFA 5FO7B 5ITTA 2PZUA 4K4GA 1ZQQA 1A3VA 3IN5A 1RD9D 1G3IA 4LMQD 1PXUA 1JI7A 3WKDA 4IJHA 1ZQMA 3PFIA 4UHVA 8ICAA 3ULPA 4WRDA 2XFSA 2DAGA 4A4IA 9ICFA 8ICEA 4GKJQ 5JI2E 3TP8A 3KJPA 4QNLA 4BY1B 2KXEA 3HOVB 3LDAA 2BHNA 4ECRA 3VYUA 4DF4A 1MI2A 4XRHA 3G48A 4YY3L 3SD7A 3A8IE 3DWPA 4POGA 3R93A 1SN8A 1XMQQ 3GTMB 3HPOA 4DV0Q 4MTKA 4PT5A 1L8OA 1YLAA 4GN5A 2FMQA 4DV1Q 4MGHA 4QWAA 3GTGB 1SNCA 2GH1A 4R4TA 2ZIVB 2CWPA 3IG8A 1XTDA 2UXCM 4BXOA 2MP1A 4XIGS 2IJ0A 3ISBA 3H40A 5C44G 2KP7A 4ECWA 1QVFA 3U60B 4DV2Q 2JXMB 5M5YH 2KSOB 3UDXA 4KKTA 3VR2A 3T1HM 1EIHA 8ICUA 2P5ZX 4PDGA 4A3EG 3QYPA 2PI2E 1IN8A 4ODGA 1QVRA 1BQQT 4GLVB 3MDCA 2WP8J 1HPCA 4L6TB 5C5MA 1E2VA 4EQPA 3BQ2A 3GU3A 2Z7JA 3ULJA 3KLSX 3VDYA 2R7ZH 1FEZA 5IODA 1Q3CA 1TT2A 1EUJA 3MXUA 3KLSA 4B9LA 5ITXA 3MR5A 2ZXOA 1HFGA 5ALFA 2E8PA 2K6AA 4ACOA 1JB0F 4C3JH 5K4LA 3ND8A 4CIZA 2KICA 1S3OA 2K05A 2DGZA 1DCZA 5ELEA 3MK6A 4HSVA 1I94M 5KFAA 1KABA 3NWTA 5EE9A 1EYCA 2F52A 4HSPA 3L3OC 1L7PA 1RTOA 1RYUA 3A7LA 2ZIUB 4ECTA 3PF5A 1LTTD 2AU0A 4I7AA 4MN3A 5FOBB 2W43A 1O80A 5KFQA 4FWHA 3QU4A 4LG2A 1SBBB 3HKPA 2J7ZA 2QARB 3HZJA 1FNWA 4OL7A 3E5SA 3C1ZA 4MTNA 3GDEA 2WTFA 4KLFA 2HCFA 3ZD8A 2ASLA 4DOCA 5DYIA 4UY8C 1ZQIA 5EPJA 4AYBE 4XYQA 2R45A 1PRTF 3M8RA 2DI0A 3NTKA 1NNJA 1D6EC 3STBC 1GJTA 2DAIA 5KPZA 4IFDG 2HVHA 3KP1E 3I73A 4K0KL 2WIIB 3WHKA 1JXLA 2B2TA 1ZQXA 5IT9L 2C98A 1K1SA 3VYTA 4LF4L 4NXMM 2FE9A 3STBD 2A69C 1SFOH 4JI3L 2K33A 1LKYA 2I5LX 3J80E 5GQOA 2NV3A 2K4IA 5HHHA 3C2PA 1I4RA 3ZDAA 5IYBH 1G91A 4BB9A 4LF5L 2ASBA 2A69D 2HQEA 5CV7A 5J2EA 2WACA 3K6OA 3J27B 2UUCL 5GADC 5C0XH 2KZZA 3U6QA 2E2HH 1PH7A 5M3MB 1ZYRC 1EYAA 2F0LA 2VQEQ 3TWLA 4GXIA 4P0QA 3KHLA 2R8HA 3ZYYX 4KHPL 4LUVA 2R6GA 2KVSA 4DLGA 2IWHA 2R44A 3RAXA 3SK5A 5IYCG 2HW3A 4OONA 1LTGD 4KITB 2EYHA 1ZYRD 5FLXc 4F5OA 3PV0A 3KW6A 3HHWA 2L5TA 1DK2A 3EBEA 4PL2A 4RU9A 5NUCA 1GUNA 1KIXA 3NBHB 2PZWA 5EP2A 5IYDG 4WW0A 2YTVA 4UBBA 4EGVA 2MJ5B 1F9QA 4L8JA 1WTOA 1MA7A 3SEBA 1Z19A 3BYYB 3KF8A 4CCHA 4IQWA 2VL6A 3PNYA 3QU5A 4DV3Q 2JEFA 3HS0C 5H37D 2G3QA 3PX6A 4I2HA 1EEID 5CV9A 4P4PA 2BE5C 3H4JA 2F0FA 1GO5A 4ALPA 3ZDCA 2RCFA 5AM0A 3GV6A 1YIJA 2YN4A 1PH8A 4ME3A 1FJGQ 3A8JE 2XCAA 3FPPA 2PFPA 2XZUA 2MO0A 4C3HH 5D14A 4PZNA 4XQJA 4JXJA 2H1RA 1OFIA 5BOMA 5EE1A 2KNVA 4NLZA 2H3QA 4KX3A 5AKGA 1U9RA 4GIPA 5KPTA 1U0LA 3OSPA 5FO8B 1JX4A 3QR8A 3FPUB 2I7NA 4X5VA 4DOBA 3MR6A 1QOHA 3QYEA 1DO0A 4KLEA 2EQSA 4JI7L 3SK8A 2RSOA 3D2SA 3QAUA 3NK9A 4RA8A 2VUMG 3HG9A 4RNOA 4PD2A 3TQSA 3V7KA 4B9XA 1IYJB 3GLFB 1FNNA 1EY0A 4DR2L 5ALVA 5J0RA 1UM8A 3AL0C 1GO3E 1MD2D 2L4NA 4X64L 1TWAH 3SR6A 2LXKA 2NWGA 4EBEA 2IA6A 4IRKA 4RGTA 3FKIH 3S16H 1H9KA 3PW2A 4RF0A 2O6KA 1KDCA 1Q90A 2W9MA 1N63A 2J7NA 1KDAA 3GTMH 3GTOB 3G6YA 3C9PA 4TQSA 5F9NA 2ZM6M 2ZIWA 1XYIA 2JA5G 5L9XA 4I81A 3U4VA 3GTGH 1EIGA 4C8MA 1Z4OA 3I8ZA 5AIBA 4NC6A 1SB3C 3TP7A 2X4AA 2CWBA 1T8EA 4M9XA 4K5XA 1DGFA 4JV5M 2IOHA 3PSTA 5C44B 4CDCC 1PUZA 2DNEA 3FTDA 8ICHA 1M8AA 1TK0A 1PHJA 3C58A 1B43A 2NTTA 4KODA 3FRIA 1S4ZA 4J9MA 2DWQA 4B3TM 1HNWL 3OHXC 5KG0A 2C9CA 5KL1B 1A77A 4V190 1OXUA 1VQLA 3J80i 2B2TC 4DQRA 1K82A 4A3EB 2Z6BA 3L2PA 4J9NA 4JI0Q 3Q8XA 1NVMA 4HN7A 4PNYA 4BY7H 3WKCA 4DFMA 1I4QA 1C0AA 2EA0A 1T9HA 1A5TA 1ZKOA 3I3CA 2UVWA 3OMGA 1NR4A 3GV5B 5IREB 2HOFA 1NR2A 1KRPA 1Z00B 1Z1VA 3Q23A 4HLQA 4FXGC 4IPGA 1X9MA 1OTRA 2M9VA 3EIEA 4XT3B 3CRLC 5D65A 2VDBB 2DZNB 5J2BA 3SEIA 3UXNA 3DZDA 5EGTA 4QIWB 1K83B 3C23A 4KLHA 1GVNA 2JA8H 1HTPA 2DWNA 3QU2A 5M5WB 2HHHQ 2UUAM 4J9RA 5I2YA 3HU3A 3J80c 5I9PA 5DG8A 1CZWA 1IM4A 1VQ4A 1PJQA 3HOXH 3M6KA 3BDPA 2PKEA 1SMYC 4RQ8A 2DNCA 3VDUA 2KNZA 1ZRNA 2KG5A 4Z8XA 2B2YC 4C4TA 1EY7A 2DHRA 3K58A 4FD2A 4EEKA 4G4RA 1SE4A 4UB4A 4LJ4A 1F0MA 1LTAD 3UXPA 5DB6A 3W0LB 1JCKB 1SMYD 1ENFA 1SG9A 5GAHC 1DM0B 3KSXA 4G3OA 1I6HB 4QZAA 5DFLA 4B9UA 5EWEA 1D0LA 4YR2A 4EEYA 4IN3A 3K1JA 1SGGA 2UXCL 4Y2JA 4O3QA 5H1SE 1S8OA 3RRHA 1S97A 3HKZE 3FRHA 4IUUA 4ZH4A 2HHSA 1PH4A 5GROA 2ZJQA 5AM3A 4K4IA 4YWLA 4L16A 2EZVA 2QF7A 5KGUA 4PDIA 2AWOA 3NUCA 3VCBA 1PH2A 1YSYA 3OGUA 2BPCA 2EY1A 3I51A 3FE3A 2VJ5A 3WK9A 1J97A 5FP0A 1RQNA 1F2ZA 5J3BA 4R8UA 1QJOA 3GRYA 3AMUA 3L25A 4DR4L 5AKLA 4J9KA 1QANA 3F1ZA 4DR1M 2RDGA 5IGDA 2ZXHA 1XSNA 1XC9A 4POFA 4NXNM 4DV6Q 2C9OA 4PGXA 1FFVA 2KJ9A 2QEJC 3PGZA 2KHVA 1ZD4A 3IFTA 4AP9A 4MNOA 5EXXA 4FO6A 5GAEC 5ALTA 3FUVA 3K0XA 2MSNA 3RJJA 3QJYA 3MFIA 1IBMM 5L1MA 1L1OA 4J03A 3MEFA 2AHOB 7ICJA 1I94L 2JY8A 2LYAA 4DR7M 5ALOA 2DQNB 1SYBA 2TMPA 4AZFA 2D8CA 1I6VC 3NEMA 5AKHA 2QEXA 1O7IA 4FDBA 1JXEA 1L6NA 3E6ZX 1DOKA 2EJGC 1SJHD 3G6XA 2OH2A 4GITA 4C7ZA 4RHSA 2ATWA 1KQQA 4M6WA 2OPFA 1N34M 2SDFA 1CRXA 1JN3A 5AKXA 4OGQC 4GC5A 1TS5A 1W6JA 3VKHA 1YNXA 1SNDA 1S0MA 4LF7M 4XXEA 2C2RA 2VA2A 4ID6A 4YCWA 4H13C 1R5LA 4GS3A 1BPYA 1UEBA 3KBBA 3FHWA 2YR0A 1ZRMA 2IOFK 4KKUA 1YJNA 3C21A 2LVNC 2RDHA 4KKSA 4FF4A 3PR4A 2GLEA 2JMGA 3OJUA 2PW7A 1IXSB 5JOBA 1Q7YC 3SHFA 2LVPC 1PZNA 2R7DA 2YMPA 5F3WA 1U4BA 4GH9A 1N8RC 1KBUA 4PHPA 1WCLA 3NP8A 4LZZA 4DQPA 4FE3A 2Z4SA 1GUWA 3TMEA 5KNCA 4Y52H 1B2TA 2ZAOA 2PZTA 5AM1A 3AUOA 1CKNB 3N7SC 4X3TA 4F2RA 5CB1A 2XEPA 3Q8KA 4NXML 5GAGC 3M9BA 1QDRA 1YHBA 3V72A 9ICMA 1K3BC 3W67A 2XY7A 1U9LA 3CC7A 2FLLA 7ICNA 2NVQB 2HCBA 3SMVA 4LFAM 3CP8A 2Q2IA 1BPXA 4OWTB 4OXPA 4MF8A 2B3TA 2G08A 1MC8A 4GFJA 1SXJE 4CBVA 1N33Q 5KEEA 1NI3A 1VMPA 1AIPC 4GXJA 4JI2M 4OELB 4A3DG 1GUGA 3S1RB 2F2AB 2AKWB 1L2BA 2PYKA 3KXEC 3TRZA 1HUZA 3KBXA 1EY9A 2DVWB 1FL0A 4R4IA 3RJFA 1MN8A 4KLMA 2NN6I 4MIUA 3GTOH 1A3TA 3SHLA 5EBCA 4Z6YA 3V05A 3FUXA 3IM1A 2F5OA 1X37A 4C8KA 2K6BA 1TK8A 3P7JA 2KJXA 1H9RA 4CKCA 1XXHE 1S77D 2EYLA 4X65M 1Y8PB 2PFNA 4OIJA 4JWNA 1OXSC 3S17H 1VQIA 1JIHA 4MFAA 1LVHA 1YJWA 4KX5A 5LMUL 3BS1A 4R8IA 3QEBZ 5AI0A 1EY8A 4YXJA 1Y14B 5C4HA 1V38A 4IURA 1A62A 4F5PA 2Q8RE 1LUZA 4GN4B 4WJ3M 4DAYB 4OCZA 2XRQD 4YWMA 1WTWA 1AEXA 1J9OA 5J39A 3BS7A 1P16A 1Z3EB 4OVZA 4I65A 5IE8A 1WYDA 5AFWA 1ZQOA 2LVQD 2CQAA 1U45A 1NO1A 4Q43A 3UDFA 1RZTA 1KNAA 5I2XA 2A68D 5D46A 2HHTA 2R65A 1L1TA 2X6LA 1YT3A 2RHFA 3AB9A 2X8AA 1B70B 2BCQA 3DUZA 1LT5D 4B3SM 4UARA 2WF9A 4ED0A 3J2PB 4CDDC 1YJ9A 2BCUA 1CSPA 2C2EA 4R66A 4NW2A 1R4QB 3HOWB 2OTLA 1WJ7A 4I29A 5DNYA 3CPWA 2D0OA 1X9WA 2FJ6A 5ELDA 3ORYA 4DUZM 3C2MA 2Y9UA 4JI5M 1N32Q 4J15A 4RGNA 1QE6A 2K0BX 3D4WA 4BBSB 4ECQA 1EFUB 3WKEA 1Z47A 5AI9A 2EJSA 2K1BA 5IP9G 2HD3A 3EQLC 2Y0SE 4IBKA 4Z6DA 4LFBM 1I6HH 1WCMG 1S9FA 4NL9C 3KHRA 1TKDA 1TS2A 5J2KA 3BXWA 3V6HA 2WAQF 4M9LA 5IIMA 3K7AB 2CHVA 5EKKA 2VF7A 2OXOA 4PHDA 2L09A 1J5EQ 3RH5A 3N52A 2L15A 4ED6A 4DKAC 5C4ZA 4C7YA 2F5SA 1F9PA 1Q1EA 1A0PA 1U4RA 4JV5L 2IY5B 3MFYA 8ICCA 3AL0B 9ICLA 2LXJA 3JAME 4AKHA 2KTQA 1GKIA 1CKOA 4KTAA 2OM6A 4B3TL 1YEZA 2KE7A 2BA1A 3RGSA 1VQ1A 3M4OB 2JXNA 8ICOA 1S5CD 2YTYA 4J9LA 1JJGA 4M9ZA 3SASA 2XGQA 4TQUS 4IRDA 1I4HA 2F0DA 4JI1M 3M7GA 4UB5A 4FBUA 2F4VQ 3J7YW 3PW4A 5IT9S 5EBDA 2YQEA 3C5FA 2DUYA 1B4FA 3TANA 4KY5A 2OHFA 2DFLA 4B3RL 1HZAA 5K36G 5ALEA 1V1PA 1VQBA 3RTVA 2G9DA 3FYDA 1PLFA 1F9SA 2HAKA 2APLA 4UB6U 4DSIA 1ZD3A 1Y8NB 5IYCH 3MXNB 2GVAA 1A15A 3J80L 3R2IA 5DBAA 2W11A 2R18A 3RJIA 3LW5F 3RN2A 1VJ5A 1IBLM 3OIPA 1COOA 1K1QA 4KI0A 1TH3A 3I90A 7ICLA 4JPBW 4DGZA 4Y2PA 2QNJA 7ICRA 4GNXA 5IYDH 2EVBA 3GO8A 1WD0A 1WCNA 3PMNA 3I7FA 2R7FA 1Q81C 3NTHA 5ALKA 4N9TA 1S0NA 2ZUCA 1BBXC 3KK7A 1EQRA 4LJ8A 3I56A 1K8GA 3UDGA 1HNXM 2NZHA 4CRXA 3S9WA 2IW3A 1F44A 2Z6KC 2OEOA 5ALNA 1V43A 1X3FA 4FP5D 1ILPA 3W0FA 1MN3A 2W82A 4DSFA 4DF8A 1VQFA 1F2MA 2LM1A 2UXBQ 1G8PA 2C5CA 4LF8Q 4OO1I 4UAWA 1QDTA 2I7PA 4P0QB 3I4VA 4DR6L 4J8QA 3QWLA 4GC7A 1EWCA 2KEYA 3FUWA 3UQ0A 1Y1WG 4PMBA 3H0LB 5JUMA 4R4QA 4MB7A 1KFTA 4RUCA 4P0PA 3PW7A 4GKJM 4EYIB 3SXHA 2Z4RA 1RDFA 3ISCA 4KHZA 3UDIA 1HTLD 2NUCA 2VUMH 3G71A 2JY5A 1KFSA 1FNVA 4OJPA 4LRTA 4DR1L 2FS1A 3GLGE 1XMQM 1J2MA 1PJTA 3KF8B 4DV0M 2PMZB 1WIVA 3CF2A 4NXNL 1K3XA 2KKPA 4IRCA 2CH4W 2QHOB 1VQCA 2MNAA 3S1RH 1VQOA 5ALHA 4DV1M 4A3DB 2V4RA 3LWEA 4QCLA 2K5DA 1BCPC 4ICAA 1IBML 2E5LQ 2KV2A 2G09A 4O3NA 1I4PA 4UDUC 1IQPA 1LTMA 1AROP 4CDFC 1D7QA 2CRXA 4Y7NB 1TAUA 3NRZA 4DV2M 2EYOA 4TUWA 4B7FA 4GKKQ 4GMQA 1XHBA 3KVWA 4R64A 1PK1A 2JA5H 2QENA 2NRXA 3JPTA 2LS01 2AWNA 1N34L 1JRPA 2O4XA 2BPFA 4DV5Q 3CQZB 4G57A 2R93G 4KV6A 3L3FX 1EWIA 2WB1C 1VQHA 2NRZA 2UU9Q 2BWBA 2EO2A 2NRWA 4HEOA 1KTKA 1LABA 2W04A 3FMCA 1RPLA 1QUTA 5DDMA 4Q8FA 3JAMi 1SNPA 4XYOA 4FXDA 2K75A 1VMCA 1VQKA 1SSOA 3IKJA 2C96A 3AKZA 2GQFA 3RRGA 4IBBA 2LSSA 1NSFA 2JA7G 1HH2P 4KLNA 3T5LA 1LT4D 3VK8A 3U9SA 4BUGA 1SXEA 1FFUA 3NASA 3B74A 5JJZA 3HJQA 3SARA 2AJQA 5KFSA 3SHGB 2PFQA 4RMFA 1N61A 2HBLA 2YMMA 2RSNA 1Q82C 4XDXA 3JAMc 3NUQA 4I2DA 3DWQA 4LFAL 7ICUA 1WWVA 4FCVA 5AI6A 3J7AS 4NM1A 4KLDA 1U4PA 3E9SA 4DK3C 3TS2A 4M8AA 4ECUA 1XPUA 1RF2D 1N77A 1JE5A 2LHGA 4FYDA 4JI2L 2CW0C 5A2QS 4DLEA 3C3LA 4PH5A 2YNMD 3NS1A 1T3QA 4QW8A 3K9OA 1S5DD 1SAPA 5KFUA 4YY3Q 2NZ1D 2IHFA 1IY1A 3RFAA 5HGTA 2OEHA 1L3UA 2YU9H 2H3ZA 3NGDA 3OOCA 3PO3G 3B0YA 1E1OA 4ED3A 3K5OA 2DKLA 2WKDA 1UFZA 1VQPA 2GO7A 4IOAA 3RJKA 1A2TA 1V34A 3U6EA 3K7AH 5CA7A 4X65L 3BZDB 1ESFA 5IGFA 1PVPA 5KG6A 4CF5A 1MJEA 2DKXA 3J81E 3A54A 1V9PA 1BUVT 4RQ1A 3LVVA 3TARA 2BOSA 4DL6A 2AQ3B 1VDDA 2ATLA 5F2DA 3K80C 3A7AB 5EP4A 2H4OA 4LUOA 4ED8A 1IIPA 1HIWA 1S72A 4ABNA 4L8RC 2O25A 1XNRQ 1PJJA 9ICNA 4S12A 4US9A 4KJOA 2E2IB 4JI4Q 2EYFA 2VQFQ 3HILA 2EKFA 4HIKA 1ZQBA 4JBMA 1S0OA 4KN4A 2LMRA 1BBUA 1HZBA 1LLRD 1UQVA 5DB7A 1X40A 1GM5A 4AYBC 3MFGA 4B9VA 2EQYA 3AOGA 5KFGA 1SKWA 3C1EA 2AUJD 4P72A 3C46A 4DV3M 4PQXA 4JYAQ 3OW7A 2R7ZG 3JPOA 2BZFA 8ICPA 4B08A 3L5KA 5G3LF 3NELA 1N36Q 5KFDA 3THGA 4R3DA 3MVVA 4DUZL 2NB0A 4LJ9A 1PM5A 3VK7A 3EIHA 2BQUA 4JI5L 4XUSA 5E4WC 3H0GG 8ICWA 8ICIA 1FJGM 5AK3A 3CCVA 3N97B 1XTCD 3T16A 1KFDA 5JTIA 2R8GA 1NY5A 4QZHA 2WKCA 4DQQA 2F44A 3FC4A 2A73B 3GTKH 4KD4A 7ICHA 3AYHB 3E4RA 5JI3E 3EPIA 3GIKA 3FAHA 2NN6G 3T5KA 3IAYA 2JNHA 3GZFA 1S5LU 1DRGA 4R8UB 1H9SA 4LFBL 4NL4H 7ICMA 3L29A 3MAQA 5J8YC 4U6PA 8ICBA 1Q8KA 4BXXH 4A3GG 1T43A 2F0UA 1ZQVA 4EQNA 3GLFE 3HOUG 2EE1A 2BR0A 3WHLA 1JR0D 3ERSX 4JI3Q 5CEHA 1KC8C 3RUZA 1LTSD 3MHBA 4PMCA 2E1FA 3SAGA 1Y1WB 4H7BA 1W6KA 2EJMA 4DFAA 3M4YA 1HT2E 2DJGC 3PUVA 4I5SA 2HBMA 3LNNA 2G5HB 3HWTA 3TFRA 3O0FA 4QZGA 1E9RA 4M6WB 2K52A 4JI1L 2LH0A 3KSJA 4R1JA 4QZ8A 2EXZA 4F92B 2PPBC 5ALDA 3C2KA 8ICVA 4ZRZA 1NNLA 1OXXK 3MA2B 1YZ7A 4FS2A 4C8OA 1U48A 4A3DH 4X3SA 2ZTDA 2W9CB 1YUBA 2JWSA 1EEFD 2EXDA 1N2XA 5KT3A 4LWCA 5ALSA 5DB9A 1JC7A 3HOYG 2B63G 3BVGA 2ZIXA 1L8LA 3ED5A 4ED2A 3OW2A 2AMCB 1SNQA 1B3AA 1XO1A 4QOZC 5KFJA 1ZQFA 3X3NA 1ZQLA 1TVAA 1IBLL 2F0HA 1FO4A 4RFBA 1QNUA 4AH6A 5D3DA 1NNUC 3HW8A 5ITUA 1Y8GA 2K8CB 5KG4A 1W5TA 5IIKA 1QG7A 2OYYA 4ECYA 1JB3A 1UE5A 1N75A 1R2ZA 2R93B 4DUYQ 4Y2RA 4JI0M 3HU2A 3QZ8A 3PZPA 3PX0A 1HNXL 3FTFA 4GZYC 2FJ2A 4RKLA 1SYEA 1YI2A 5AI5A 4RHRA 4JI6L 3V76A 1SWWA 1XX8A 4G4NA 2L7HA 3OYYA 4DXGA 3NRWA 1QQWA 2HDOA 1D8LA 2B2WA 4QIWE 1Z4NA 2DN8A 3M3YH 4AYBG 1DONA 7ICQA 1NJWA 2JN4A 3KF6A 2LI6A 1ZETA 2XZFA 1Z7TA 2QILA 3CCSA 3NSWA 3UMMA 2N78A 3DMUA 2JA7B 1YITA 3QB3A 4KMUA 3PCOB 2HHHM 3SYKA 4P71A 2BCRA 1XS9D 1D5MC 4HMIA 3W68A 4LF9L 3ALRA 2FLNA 3KS8A 2IMWP 2KCTA 3JC66 1XU4A 3H6MA 2KUMA 1DK3A 3PIP3 3NQTA 3J81c 4TKOB 2KW0A 2BJWA 4GKJL 3FP9A 1QB5D 1FVIA 3GTLH 4DR2Q 1TWHB 1ML0D 4KN4C 4DO9A 1TTEA 5ALJA 1R4GA 5ELCA 3GTJB 1G291 4F4KA 3EZ5A 4X64Q 2JZ1A 5AM2A 3H3VI 4FNFA 4RQMA 5BR8Q 1AZPA 2SOBA 2K5HA 1OIPA 4LCBA 1XMQL 2Y21A 4II7A 2K7VA 5KRUA 4DV0L 1CI4A 3SBJA 4XQNA 3AJIB 5DLQE 3EROA 4RUAA 2FDRA 1EQTA 2Z8LA 4JK1A 1KEJA 3B0XA 3V6KA 3JR5A 2RVLA 2M5ZA 5KPRA 4TUSA 2DXIA 3QU7A 4UAZA 4F5RA 1UAPA 1XPRA 1IG6A 5IP9H 4DV2L 4ZKBB 1D9DA 1WCMH 4DNTB 2UVVA 2HVIA 2KA7A 2V9WA 4G3IA 4MEYA 2N35A 5JEAG 5KFZA 2FE8A 3M9NB 2LHCA 3N7RC 3K5NA 3FKIG 3FKEA 2AHMA 5EP3A 2OTJA 4G7ZC 1NJFA 4DV6M 1DYQA 2XICA 1Z5AA 5ELBA 1V33A 5LMNQ 2RRUA 1ZQAA 2VY3A 3K1RB 4D80A 4YP3A 4MF2A 1KSFX 4A76A 5J0TA 1PRTC 1WI5A 1BCPB 4NLGA 4J9PA 2IHEA 4RH6A 9ICIA 4QNRA 3I4LA 3TKAA 3P1HA 4ELVA 2DWZB 5C3EH 4OO1G 1QCKA 4AKGA 4I2JA 4MZ9A 3BOSA 1PRTD 2KECA 2L7IA 1XXHA 2JV3A 8ICMA 2K01A 4JV2A 5K36H 2HIXA 1IXRC 4H02A 3JAML 4GXKA 2XFTA 1ZQZA 4LGYA 2WB1B 1X6IA 4JBKA 4I2AA 1WR1B 2JEAI 1X56A 3D31A 4BY7G 3A42A 1WVLA 1QLNA 1GL6A 7CATA 1PFBA 1NK8A 1NJGA 3GLHA 1ZJNA 3MXGA 2R7ZB 2F03A 1K8AC 2F77X 3Q8GA 3F5AA 2K8AA 1FNUA 4WP2A 2QZ4A 3IG5A 9ICQA 3TSSA 3ITPA 1Q3BA 1OTCA 4C3JB 2MQHA 3ERQA 4JUZA 4O2DA 4EQOA 4XTCS 3EIVA 3KBGA 2B6GA 2PQAA 4ZAIA 1NZPA 2DGYA 3WWVA 3KLRA 3E0FA 2JA8G 3SAUA 2OF1A 3CRXA 4A3LG 2YB4A 3EN2A 2BWEA 5IWAQ 1TKWB 1CK1A 1TIID 3SMPA 2CEAA 2JZBB 1G4AE 2FHTA 4KTQA 4KY7A 5E26A 4A3GB 5DQIA 3T79A 1GUOA 1KL9A 2YQZA 4NMZA 2B2WC 1VQGA 2B2UA 5L1KA 4RGOS 3FUTA 1Y1WH 2A1JA 5BPCA 4PZ8A 2ES2A 1N33M 3MC0B 1ZQ9A 4JVZA 4AG6A 2K4KA 4KMUC 2K8BB 1HQMC 4DR4Q 5DG9A 4RCOA 3ULLA 2E1EA 4EX6A 1EQVA 4ECXA 4LGMA 1LYLA 3HT3A 2KENA 2JY7A 3UE0A 4KD3A 4M2YA 3F5EA 3GV7B 1VQ8A 5LMNW 8ICQA 2VA3A 4U673 1CUKA 3A0JA 5TSSA 3A0HU 2YMLA 4B9WA 4C3IG 1D0KA 3KD3A 5AJ3Q 4AYBF 3ZC7B 1HQRD 4DAVA 4LUZA 4M0WA 3HOYB 1OW5A 4O3MA 3BU2A 2HHUA 1BNZA 3E0EA 1K28A 5C6AA 2G06A 2CQOA 1ZQEA 4LK1C 4JK1C 4DV3L 1BPEA 4RF1A 1BVSA 2QLTA 4C2MH 2G0AA 4USAA 1L3SA 1L3VA 2E2HB 3H4MA 3K5MA 4KLJA 4JCVE 3F92A 5M9OA 5H2FU 4B9TA 4ZPXA 4O0IA 3BG3A 3DM1A 2R93H 1Q3UA 2J0TD 1WTVA 4FBTA 4X66Q 4TQRA 3C1YA 5CC4A 5CGKA 3UMGA 1FJGL 2DHYA 5HNKA 1ZJMA 2LM4A 2KA6B 2JEBI 2B8FA 4P0PB 3CHBD 4RGMA 2RF4A 2HHXA 2DUDA 1T3TA 4PGYA 1N62A 3SI8A 5CV4A 4C8NA 4Y2QA 3BDOA 3S2HB 2CHGA 1LB2B 3ISDA 1JWMD 4AYBB 2ZG6A 4QJFB 4LY6A 1G6ZA 1K9MC 3HJSA 5EXSA 3BZCA 2KEBA 5IP7G 1YHAA 5FO9B 2EYMA 3CD6A 4C1NI 5J0UA 2LFNA 1EQQA 1ASYA 3SDZA 3H15A 4AKIA 4QZDA 5T1IA 3PF4A 2KIVA 3K1ZA 3H4DA 2XC9A 4CDEC 2K04A 2M60A 3HX0A 3BDLA 4IC9A 1QUQB 9ICWA 2BDOA 2B2VA 4DS4A 4Z9CB 3PV8A 2HKJA 1GXDC 4F3OA 1N32M 2QBYA 2RP5A 1IFYA 5IGBA 2H3FA 1DOLA 1ZEQX 2NRTA 2EAPA 2DY8A 1U5KA 8ICLA 4C3HB 2GNOA 2DKZA 4KN7A 4CGYB 1ONLA 1VEJA 4HIMA 2O2LD 2QA4A 3L9AX 3SZ2A 1SXDA 4EX7A 2JZ0A 1LTID 2Y9TA 5KNBA 3S15H 1XB2B 1KSPA 1GHJA 3LYSA 4WJ4A 5KT5A 1YZ6A 3C3DA 5IIIA 4ECVA 1HQYE 1J5EM 4HCEA 2KRUA 4L6V6 1OJLA 5A0LA 2UVRA 5IINA 1TXYA 4HR7B 3PO3H 2I46A 1URJA 3EWAA 1EFWA 1YNJC 4DEZA 4DU9A 2XLJA 4F5NA 3E46A 3FYCA 2WFWA 1TWAB 2MO1A 4CJ0B 4EELA 2JQOA 4UAVA 1PZKD 1YNJD 2KJ5A 1D9FA 3CCJA 4NXZA 3GLGA 4O3RA 5LMUQ 4LJ5A 4JI0L 4LAAA 2ZIVA 3ZDDA 2QGQA 2EZYA 2F4VM 2DY7A 4DS5A 3M7DA 3FKIB 3S16B 1VS0A 4DFKA 2D7HA 1KYIA 1NK9A 3KZXA 1NHWC 4F71A 4LJXA 1QUSA 1N78A 3I01M 1KRTA 1GO3F 4G6ZA 3KFUA 3Q22A 4C4RA 3TQYA 2W9BB 3V6JA 5EKIA 5F9LA 2KSOA 1EZ6A 3AU7A 1JB7A 4DNIA 1FR3A 3BVMA 2XNAC 9ICKA 1XMOQ 2K4PA 4MHVA 5KQDA 1JT8A 1D5XC 1I4WA 2ZBKB 2F0MA 3LWMA 1WG8A 2E8OA 3H8WA 2WF5A 4NSOB 3S14H 5IGEA 3J81L 3WOFA 4K5VA 2QB1A 3VR3A 4EX5A 3ONNA 3HGBA 4O5EA 4O42A 4DK6C 2W54A 2KHHA 4IQZA 5J2CA 1VF5C 4DV4Q 2F76X 3HRDD 2WHEA 4DNRB 3HU1A 4IR1A 3VA7A 3HP3A 2UUBQ 2W3SA 2HMXA 4BY7B 1V8QA 2IT1A 1L3TA 4KLSA 1WOCA 1N56A 1GVPA 1NY6A 5JRTA 4NJ8A 1IBKQ 1VQ9A 3MC1A 3G7LA 3K81C 7ICTA 2FPKA 3I28A 2HDMA 5C5LA 3U26A 4LJZC 2WF7A 3FVQA 2ZIUA 2UXBM 2YFQA 1XO0A 4LF8M 3H0GH 2H1EA 2JA8B 5J2FA 2FFKB 1TR8A 1UPHA 4AIMA 3BJUA 2CV1A 1IN6A 2KZUA 4RAUC 3CTWB 2QARA 3RR8A 2NN6H 3KDSE 4YXMA 8ICZA 1LV9A 2ZJ5A 1JOOA 1B22A 4LJAA 3ZH9B 2LVOC 3TZUA 4A3GH 2ASDA 3HOXB 2BNKA 4CKBA 2GVBA 1WTRA 3PUXA 5HHIA 3HOUH 3SENA 2PMZE 3GP7A 1A0IA 3UZUA 4JOIA 3IFDA 2O5JC 3V7JA 4TUPA 2MR9A 8ICYA 3HOZG 2DAEA 2VS1A 2QSFX 4DV6L 3U6OA 5C5JA 3TQ1A 2RA4A 2HSZA 2DBYA 1J09A 3OTOQ 3R2TA 4B6JA 2GA4B 1PA6A 1UA1A 3E58A 1GD7A 2K47A 2E5LM 2AGOA 2ERCA 4L4UA 3CF0A 9ICAA 3ZDEA 1NV8A 3J7ZC 4B3RQ 3TE6A 1TQOA 5D4BA 3QOLA 1ZQYA 4GKKM 2NVXB 3RNUA 4RCNA 2ZTCA 9ICEA 1M4VA 3FTCA 3D2NA 1PFSA 3AQFA 3T1YQ 3M1YA 3F2CA 3M85A 4DV5M 1Q3LA 2ZXIA 1Y88A 3HOYH 1L0WA 2B63H 1WGLA 2QKQA 5ELFA 2LBCA 3E9IA 1XPOA 1PVOA 8ICRA 2E8MA 3RBEA 1H9SB 1CQFA 2UU9M 4HJ7A 1CSQA 3JPSA 2JXJA 3HKZF 4B3MQ 2NZOA 3D6WA 5J2JA 1X3GA 4RKBA 5DAUA 1D1IA 3JPPA 3M4PA 4G9BA 2F0KA 1JUDA 3K7UC 3TWMA 1K3RA 4D81A 3S2DB 3NBHA 4KK7A 1PRTB 3KOWE 3P20A 3U50C 3GQBA 3S1NB 1E22A 3Q6SA 1IY0A 4M04A 2Y0SG 1JJCB 5B66U 3S2HH 3EYZA 1F9RA 2HIVA 4IUQA 3URYA 3VDPA 3CU7A 1QAQA 4DR6Q 2KVCA 3RLOA 1A2UA 8ICGA 1QILA 2HUGA 3GPYA 3NHHA 8ICFA 5KO3A 4HJ8A 3N6RA 5I4DA 4AQYL 5C18A 3RB4A 2K14A 3NTIA 4A75A 5CJ7A 1J2NA 5ALIA 5J0WA 4K8IA 4YD1A 2KZMA 3GLIA 4JV0A 2ZIXB 1CQVA 4A3KG 2ASJA 5EOZA 1OIZA 2ICEC 1NUCA 1N33L 1TH2A 2E8GA 3TBIB 2F3VA 2RQ5A 2RCNA 4F2LA 1TGUA 4YY3M 5EP1A 4ZQ3A 3N4MB 3M9OB 4QWBA 2QPAA 4ELUA 4DA2A 3N7PD 4FVMA 4UW9A 1LT3D 1L2DA 3ZI4A 2KD1A 1PGYA 2B29A 1TY0A 1ZXIA 2ZT9C 4IFDI 3QX7A 4JG2A 3GLFA 4A3BG 3GQ4A 7ICPA 5FKAC 3GP1A 4A8EA 2BCSA 4CJ1B 3I91A 1DOMA 4OJLA 3GTPH 4OEMB 1XNSA 5DLFA 4LF6Q 5IZ7D 3VR5A 3EW9A 4K2LA 3CCRA 1ZMUA 5BN3A 2KMDA 2NVTB 3D8LA 3PX4A 5J0SA 3OSNA 1N48A 3SAHA 1SV0A 2L4EA 3D2QA 4ECSA 5JEAH 1XNRM 4Y2TA 1T3NA 1WXQA 1QQ7A 4UB8U 3RZDH 5EWGA 3PO2G 4JI4M 2R8IA 2SEBD 2HCIA 1JQJC 3ETLA 2FOIC 2EDUA 2VQFM 4FZLA 1ZV1A 1RJTA 1STBA 1WTHA 1OKSA 1SDFA 1B1ZA 2KHSA 5CP2A 2M00A 2BH8A 4F4WA 1CA5A 2BDUA 2YTUA 4OW0A 3OTQA 2DPJA 4F87A 1DGHB 3K5LA 4JOIC 3QYBA 2WAQC 2Q8IB 5L8RF 1G41A 4LRSA 4PG3A 4AW4A 5K5PA 2Z0SA 4YHHL 1FGBD 1DJRD 2IX0A 1B4OA 1XSLA 3S17B 4OO1H 1SRUA 1JR3E 2JP1A 2BJVA 2WSCF 4JYAM 3CPFA 4IQUA 3CP0A 3PIOA 2ZJPA 1VQEA 3VYRA 1GABA 4FZMA 4CJ2C 3RMHA 1EOTA 4MGKE 1EU4A 3HOVG 1N36M 2E75C 2PO4A 2KOLA 3FYHA 1Z00A 4G4OA 1H6UA 2DNAA 3TADA 1DGJA 1ED1A 5ALGA 1STGA 2SNSA 4GHAA 3ZCBB 2F0SA 1C48A 1HRJA 2XGPA 4YMMA 4DR5L 5KFPA 3OWFA 2KCNA 5IGCA 3T4AC 3K57A 1JOQA 2JJQA 3I1YA 3UMCA 1PMRA 4U68A 2L12A 4KLTA 3AQEA 1L7OA 4IBGA 2EANA 4NLCA 2J4XA 4MGZE 1MIUA 1J5EL 2JA2A 7ICIA 4C56C 1MQ2A 1UUPA 5A2QE 3D3RA 4A3LH 3HFZB 4JI3M 1PRBA 1C4QA 5KFLA 1RDPD 4WJWA 1VQNA 4X6AH 2DWMA 1LV5A 4PMWA 3EUB2 4PZ7A 3GIJA 4DV7Q 4CNQA 1XNQQ 4BBRG 4KLIA 1QH9A 2XVSA 7ICEA 1QVCA 4FF1A 3E0JA 4I2CA 2F4VL 2FXQA 2IL8A 1SKSA 3GQCA 2QDBA 4MM3B 4IBEA 5ALMA 3IHPA 4UP9A 3HOZB 4IBJA 2W8KA 3U6CA 1WJJA 4LFCQ 2XN9C 1MJCA 4DSEA 2O5IC 2NVYH 5KFNA 3I4NG 1Y69U 1EU3A 5E4XA 3GLHB 3Q8QB 1RKNA 2O5RA 2Z4HA 4ANRA 1STEA 5DBBA 3SC3A 5EQ0A 7ICOA 2Y0QA 5CMDA 2NVXH 4MEXA 5EPKA 4YQWA 1AN8A 2Y0SF 2SNMA 3L27A 2FPLA 3CXCA 3T1HL 2ZUBA 1HA5A 4YWKA 3MGHA 4C3IH 5CHGA 2XH9A 2M9NA 4DUYM 2MUTB 3O13A 3BS5A 2W7PA 1FGUA 9ICUA 5ALQA 4WORA 8ICSA 4L5RC 1ZQKA 1TR5A 5J29A 3GPPA 5FK9C 2WF6A 4RPXA 4N8FA 3U9OA 1L7NA 1B3QA 1BPZA 2JH7A 1KDBA 1SEBD 3W3AA 3ILKA 3IHQB 2L11A 1U47A 1WUDA 4F8MA 3V96A 3S2DH 3X3MA 3D0FA 4Q5VA 2WAQG 4O3SA 1MSHA 2RDFA 1X9NA 3TI0A 2A1JB 5IIFA 1JWSD 4J6HA 2UXBL 3RB6A 4LF8L 2DAMA 3S1NH 5E1FA 3WU2U 4JI8Q 2W9AA 3HY5A 3RD4A 2VIXA 1QAOA 1EIJA 1ZMWA 1JICA 4IFDJ 5EJCA 1KFVA 3TEHB 2A6EC 1TS3A 1Y8OB 2EPBA 1SV4A 1SV0C 2E8NA 1X9XA 1C8CA 1RODA 2ZAMA 1SZPA 5FTMA 4L63B 3LK9A 4HL4A 1VLBA 3AFQA 2GOLA 1I50H 5AKEA 3H7IA 2A6ED 4FXKC 5IP7H 2F0JA 5AKYA 4DR2M 5CV8A 5CR0A 3LQRA 1F2YA 2KEDA 5KFKA 2CH4A 4X64M 5BR8M 3LCVB 3EJIA 4J1MA 3CF5A 3K2LA 4A3KB 4BJQA 3KHHA 4YMNA 2CCZA 4AI6A 3CC4A 3KYHC 2F0EA 4CDGA 4I2GA 3G6VA 3MABA 2A1AA 2ODGA 4BXXG 2IHNA 3L7ZC 1R9TB 2E5LL 1X6JA 4QF4A 1HNZQ 3G4SA 3RH4A 5L1IA 1VQMA 2ZANA 2KNAA 3TADC 3IL8A 3CKIB 4HJAA 2R8KA 1OXJA 2AQ2B 1HXYD 3WK8A 2CFOA 3RE8A 1QTMA 4DR3Q 4F4XA 4DV5L 4CISA 1PZID 2C22A 2ZJRA 1C9OA 3SE0A 2UU9L 5FTKA 4EBCA 1K0SA 3A46A 2RHSB 3TL4X 2JP7A 2VUMB 1CTMA 4O3OA 1N5WA 3B89A 5L37A 4Z6CA 4IUPA 2NRVA 2KVMA 2NVTH 2BQ3A 1SL1A 5KFTA 1D2NA 1VEKA 5LMNM 3RB0A 3BQ7A 1SL2A 4F8RA 3KLWA 3MR3A 4BA2I 2X49A 4NSRA 3BBZA 4IJLA 2BCVA 5FLXL 2NO5A 5C4JB 2ES6A 4JI6Q 1QNKA 3AFPA 4Y2XA 4P2CB 5CBAE 2V1CA 4IJEA 3LCUA 1BPBA 1S5BD 4BDPA 1XXGA 2VIIA 3F2UA 3UM9A 2E76C 4DF7A 4BWGB 1ZOLA 4P16A 2WB1E 5C0YA 3K0YA 2A74C 4DSKA 1SNOA 2JA5B 1BKBA 3NBXX 1IW7C 2E2DC 2QCPX 9ICOA 1JOKA 2E2JH 2F5NA 5KNIA 5KG2A 1IY2A 2Y0TA 2O01F 3H91A 1RTNA 4LF9Q 4DAYA 4DL7A 3NWSA 3KFUF 5JU5A 4NB3A 3TREA 2J7OA 3UGJA 1IW7D 1XSPA 4LJ7A 4JW0A 5FTNA 1VQDA 2KQ3A 2R0IA 4GHLA 3KKAA 2PNRC 4S3SA 4G7HC 3HKSA 3ZDBA 1KN5A 1SIJA 2A68C 4X3KA 1K0RA 4RQ0A 4RQ7A 5FTLA 3CCEA 9ICBA 4QGUA 2V4QA 4I8OA 2HWJA 3GQ3A 1IKLA 4A3CG 1AUAA 1VDZA 3J81S 2JY6B 3GLGB 1MSGA 1PH5A 3Q8PB 5AM4A 2UXDQ 5IWAM 2H5XA 3Q24A 4FS1A 4M1UB 5JJIA 1AE3A 4C8LA 4RWSC 3A45A 2RQXA 3NE5B 2MROB 2KFZA 1T4GA 4X62Q 3DM3A 3MBYA 4QWCA 1HCZA 2OQ4A 1VDVA 4Q45A 4PCZA 4OIKA 5D49A 5ELOA 3B6YA 4ECZA 4UPAA 4MGYE 4R63A 2Q0ZX 1KAAA 4HJ5A 2FI1A 4BXOB 2N3SA 3SFZA 3FRPB 1OQYA 1L1OC 4YG2A 5KFIA 2PI5A 3F2DA 3LQQA 2N8NA 3H4BA 4DBGB 2EY6A 3KOYE 2G07A 1EY6A 2ENBA 4DR4M 4BBRB 4UP8A 3DV9A 2FINB 4WFN3 2E5SA 4YD2A 5E79U 2P6UA 1XNRL 2J5YA 2FMMA 4JI4L 1ZMVA 5G3LD 1HZ9A 3H94A 2YU9B 3A5ZB 2VQFL 2R61A 3HOZH 2VA8A 1M90C 4FCWA 3BQTA 2ZM6L 4DFJA 1T94A 3V7LA 2TSSA 1AW7A 4QY7A 3I4NB 3PR5B 1EOVA 4O5KA 5J2GA 5L1JA 2A5HA 1NV9A 4LZGA 3LGJA 2AGQA 4B9MA 2K4EA 4ED7A 5DQHA 4JYAL 3U6LA 4US8A 3KOOA 3R8FA 5ALPA 5ITRA 3CAMA 3MFHA 2WF8A 3T6PA 2XTIA 2KHJA 3S24A 2QB0A 1P8LA 4P2HA 1N36L 3PNCA 4F1IA 4NV0A 5J0PA 2D62A 4OX9Q 3MGVA 1MBYA 5JJKA 5FJ8G 2IPKD 4X66M 3TAPA 2GWSA 2K9DA 1E2ZA 4OU7A 4Q0FA 2VANA 1D5ZC 3MXNA 4V0BA 5C3EG 1MSWD 3H0MB 3RN5A 4E6IA 2JR5A 2F3IA 3H3VH 8ICJA 4I2FA 2EH9A 1UT8A 1EWHA 2XGTA 2L4FA 2WAQB 5JJLA 3KJOA 3KTQA 4I28A 2Q2UA 2F0QA 2JEGA 2LVAA 5KT4A 4ED1A 2ZXPA 3K75D 3U6SA 1TWFH 1T5XD 1XJVA 2UUAL 4FFDA 2F8LA 2L0CA 2PI2A 2R3ZA 1LM0A 2HI0A 4K2KA 3EFXD 2V1CC 4H0LC 1KQSA 5ELNA 5EJWA 3P75A 3HX3A 1Q8IA 3J7BA 3MEHA 3IDWA 1CI3M 2HOIA 3ZD9A 1LKYB 2ESEA 3ETRA 1Q1BA 2Z9HA 2VXWA 1N5XA 3B7QA 5BPVA 4A3KH 3GTKB 4CE6A 1IXZA 1V1OA 4I27A 1X42A 4DFDA 3RLFA 4DOAA 2IBKA 1TWGH 5EXTA 1C20A 2KZ3A 5AKIA 1R9TH 3KUPA 5AHXA 4ZUIA 4UP7A 2B2YA 1ZQ1C 2IOFA 3KKAC 5ALYA 2K89A 3U4ZA 1SYGA 4RNAA 3Q8MA 1UE7A 3FDTA 2BGWA 1QSSA 3PSIA 1PH3A 4ZK9B 3D8GA 5G5GA 3QUQA 1J6QA 4A3BH 2R8JA 2B39A 3I4MH 3L0OA 4UB1A 3VR6A 2EAMA 2ISOA 3A74A 4LJ6A 4DUYL 5LMUM 1KLGD 4PJ0U 4IO9A 4GEWA 3NVZA 2C2DA 5I6YA 1HR0Q 1I4XA 4B7HA 2IHMA 1E7ZA 3RJHA 1E1TA 5LHY1 1WWUA 3JR4A 1SE8A 4F7XA 1IN4A 5KQ8A 4DL5A 2DWLA 2KZSA 1STAA 1TS4A 5F3XB 2X69A 2L1BA 2BE5D 3GLIB 1H38A 4R7GA 5C4JH 3A8KE 1XMOM 1IN5A 2CV0A 4NDXA 1RYSA 5DM73 3PO2H 4Z6FA 1DO2A 1UNSA 1VF7A 2JUJA 3QZ7A 4DR7L 2HBKA 4HEDA 5BN5A 4ZOHC 4F5QA 1PVQA 2QW7A 1BF4A 5AI4A 4IBCA 3SGIA 1X2IA 1XWIA 4P4MA 2YY6A 4OWWB 4DL3A 4DV4M 1BPDA 4XQ8A 3AQQA 1LTRD 5M3FG 3AOEA 3AU2A 3NTUA 2UUBM 4LF7L 5AIAA 1BGXT 1Q46A 4RG1A 5BR8L 2XGNA 5JPNC 1V85A 1IBKM 3W5OA 3C29A 3OPOA 5C1BA 5J1ZA 4BY1H 3HOVH 4DWIA 5CV5A 4KT0F 3M3YB 1KTQA 4FW9A 2PFOA 2F5QA 5EXPA 4UAUA 3SVMA 4GIBA 1K8OA 1HT1E 1GHKA 3QUCA 4JMUA 1YBYA 3KDFA 1KDHA 2KIWA 5KNDA 3F2BA 1KHIA 3CNHA 1HQCA 3TS0A 3D8BA 2EY2A 4IBFA 1JALA 2BDNA 3DFZA 2L2DA 1GJXA 4QIWF 1GLNA 4DSJA 3WK4A 2VZAA 5B5EU 5J22A 4Q8EA 5CR3A 3TDQA 2ZIWB 1TU2B 1E9SA 2F1IA 3GTLB 4QZCA 1S40A 1VG5A 1TH4A 4MFCA 3PY8A 1KAWA 2RHQB 1N9WA 1GJSA 3WDNA 4QUFA 2MRLA 2XWBB 5AK6A 1VEGA 5LMNL 3I72A 4BBRH 4N9PA 2XY6A 1HR0W 3OTOM 5TISU 3AU6A 4A3FG 2EZXA 3ND9A 4GNXC 1COKA 3NVYA 1HUNA 3GTQB 1OAIA 4B3RM 1X66A 1NJYA 7ICVA 4CHTB 2JYOA 1BXTA 4HAIA 1AE2A 5GTIU 1SYCA 5A2QL 1R4PB 1STNA 3BJYA 3M6AA 3L28A 2PNHA 1NNXA 3RLNA 1ORYB 4MFFA 2I6XA 1WCMB 1R7RA 3T1YM 3K59A 3I4NH 5COYA 1X55A 4F88A 1F2LA 4R4CA 5E6JA 4UASA 5J2DA 3U58A 4KLOA 3SYZA 3CC2A 3LVWA 3HOWG 3QUTA 1EY5A 4FZNA 1TV9A 1EIYB 1VQ7A 3AMZA 4K8JA 2QCUA 4B3MM 1NAPA 1HUOA 4BWJA 4P73A 3SAVA 2D2CC 2F0TA 1B50A 4RT3A 5J2IA 5KYLA 3T15A 3UXOA 3ER0A 4ZYSA 3PSPA 2VQEM 1L5UA 4DAMA 4YR0A 9ICGA 4BBSG 5DEHA 1ZQRA 1B0XA 3I4YA 2Z8YM 2RKSA 1GL7A 1KLNA 4D82A 5KT7A 5IIJA 2I5HA 3EVQA 2YX8A 4CJ6A 4Q44A 2Y1IA 4XQQA 2PMZC 4BWMA 2M2LA 3U5ZA 2D7EA 5C3EB 4UB3A 1HFNA 1CHQD 5IWAL 3PQIA 4A3VB 1L7MA 1SNMA 3GFKB 4FWDA 2R4EA 4DR6M 3SATA 1SE2A 2PI4A 9ICCA 1S3SA 1JR3A 1L2FA 5DM63 4B3SL 5FSWA 5J0XA 4GOPA 5EAYA 4P75A 3DDHA 1BR9A 3PW0A 3HJ8A 1N60A 2YTXA 3W1BA 4R9WA 1FIQA 4EZ6A 4YFKA 1RU3A 1TAMA 2J6UA 3MDAA 1SKRA 3OJSA 5EQTA 8ICNA 5DLGA 2QP9X 2VJ4A 4K4HA 3E2EA 1JMCA 2HT1A 5KFMA 3CRKC 3TP6A 1W3SA 4TRDA 2H3VA 4G4KA 3C5GA 5M3MH 2F1JA 2OXPA