2ZM6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 24
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2zm6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2zm6M02
4LF9M 4NXNM 3W0FA 4JYAM 3GO8A 1HR0M 4DUZM 1XC8A 5ITXA 3SAWA 3J7AS 3GPXA 4DV2M 1XNRM 4YHHM 4DR1M 4PD2A 4DV1M 1K3WA 3J80S 4PDGA 5ITRA 2UUBM 4X64M 1TDZA 2F4VM 5IT9S 4DR3M 4DR5M 3U6SA 1IBLM 4PCZA 1Q3CA 1R2YA 3GP1A 2F5QA 2UXDM 2UU9M 1J5EM 2OPFA 3JR4A 4B3TM 1IBMM 4JI2M 4DR6M 4DV4M 3U6QA 1N36M 4ITQA 3U6PA 1PM5A 2UUAM 2HKJA 1L2CA 1L1TA 1EE8A 2VQFM 4CISA 4GKKM 4LFCM 3GPUA 3SATA 4DV0M 2ZM6M 1Z5BA 3TWMA 4DUYM 3U6MA 2ZBKB 4B3MM 4DR7M 3GPYA 4NXMM 5ITQA 5ITTA 2UXBM 1MX0A 1L1ZA 4OX9M 2Q2EB 5FLXS 2F5PA 3DOAA 4JI7M 4LF7M 1Z59A 4G4NA 4G4RA 4DR2M 4KHPM 4LF5M 1L2BA 3VK7A 1PJJA 4NRWA 3T1HM 4DV5M 1MU5A 2EA0A 3SAVA 1N34M 2E5LM 4G4QA 3VK8A 2OQ4A 4DV7M 1N32M 3SBJA 3SASA 1HNZM 1K3XA 1NNJA 1I94M 3JR5A 4JI4M 2UXCM 1PJIA 3U6LA 5LMNM 1TDHA 4DV6M 4PDIA 2F5NA 4MB7A 5ITXE 3A45A 4LF8M 4X65M 1Z5CA 5A2QS 3GQ4A 4G4OA 1XMQM 3SAUA 4JI6M 3J81S 5ITYA 4NRVA 4YY3M 5ITUA 2VQEM 3T1YM 3OTOM 5LMUM 4GKJM 4AQYM 1XNQM 1K82A 2F5SA 4DV3M 2UUCM 4JI0M 4JI1M 3U6EA 4JI3M 4DR4M 1XMOM 4JV5M 3U6DA 2HHHM 1L2DA 4LF6M 1Q39A 1N33M 5BR8M 1Q3BA 5IWAM 2XZUA 1HNXM 3SARA 4X62M 3GQ3A 3TWLA 4B3RM 3A42A 1KFVA 3U6CA 3U6OA 4B3SM 1IBKM 4JI5M 4K0KM 1Z5AA 1HNWM 3GQ5A 4LF4M 3TWKA 4LFBM 2F5OA 3C58A 1R2ZA 4JI8M 3A46A 1FJGM 4X66M 3GPPA 4LFAM 3JAMS 2XZFA
chains in the Genus database with same CATH superfamily
3K9PA 3HJSA 2ZAMA 3CF2A 2L4FA 4MM3B 1ZMVA 1YSYA 2C99A 1HT2E 4REZA 5ITXA 1T6OA 2NQ8C 5IZ7D 3I4VA 3SAWA 4DV2M 4DR1M 4RNAA 3ZCBB 1K3WA 2QENA 2CV2A 1I4WA 2X49A 3U61A 4I8OA 2F4VM 3IECA 1G59A 2LVNC 4DR5M 2YR0A 1YUBA 2J7OA 3U6SA 1CUKA 1IBLM 1R2YA 1P3QQ 2JP7A 3FYCA 1QAMA 2EUCA 2UXDM 3LCVB 2UU9M 1R4GA 4LY6A 5EP1A 4LJ6A 3FTCA 4B3TM 1IBMM 4JI2M 1D2NA 2KDLA 3GLHE 4ITQA 1OAOC 3FRHA 1DV0A 1NSFA 5DFLA 2K0BX 1IY0A 2FS1A 2V1UA 3FTEA 1D0LA 1OJLA 1R7RA 2M60A 3Q8GA 3QAUA 4XBOA 2VQFM 4CISA 4FW9A 4IBBA 4II7A 1Q02A 2R18A 3TWMA 1OIPA 2HCBA 4DUYM 4TUWA 3GPYA 2EKKA 3UJNA 1OFHA 2D7EA 5ITTA 1BVSA 2Z7JA 1WR1B 2VIIA 1T3TA 2Q2EB 3LQQA 4LF7M 5C18A 2DXIA 1Z59A 4G4NA 4A3VB 2JZ1A 4AKHA 1TH3A 4KODA 5H37D 4R3DA 3FD9A 3K1JA 2C9OA 3MK6A 3GLHB 4IBEA 1G8PA 3SAVA 5E6JA 2G5GX 8CATA 4M0DA 2MH8A 3U60B 3VK8A 4DV7M 2L7HA 2QSFX 3RGPA 3SBJA 1SXJB 3SASA 2L4EA 2R45A 5DYIA 2WZJA 2KZUA 1K3XA 4IBIA 3E46A 4AG5A 3AFHA 3U6LA 2BWEA 2CE7A 4ZPXA 5LMNM 3SMSA 3C3DA 3SHFA 2L09A 3I4YA 1ORYB 4QOSA 3GLHA 4LF8M 3VKGA 3MMPA 5A2QS 3EIHA 4G4OA 4FWDA 1IN4A 3FUUA 3U60A 3T1YM 3HGIA 3OTOM 3SMPA 2HAKA 3K92A 3M7GA 1SXJA 1IY2A 2ZTCA 4FCVA 3Q8XA 4JI0M 2DENA 3PNVA 1QZMA 4R71A 1C1KA 4IBDA 3GRRA 1NV9A 2DZNB 2XSZA 2GQFA 2OO9A 4M9ZA 4DR6M 5BR8M 4GIPA 3I01M 1Q3BA 1V33A 2O5RA 3DZDA 3GLGA 1VG5A 4AZFA 3SARA 3UGJA 3NBXX 3QWLA 3U6OA 2WSEF 1QDRA 1IXSB 3LVWA 4JI5M 4WURA 4KLNA 3F92A 5EP3A 2DWNA 3L25A 1UM8A 3VDPA 2LWXA 1V34A 4LG2A 2F5OA 1GJSA 2KHHA 4D80A 3B7NA 2R46A 1GVNA 3HJ8A 2L6OA 3K2LA 2BWBA 4GHLA 2XZFA 2P5TA 2XF3A 4LF9M 3A98B 4IJFA 2QQ8A 3HZJA 3W0FA 4JYAM 1DO0A 3GO8A 1JR3D 1NNUC 4DUZM 1TH4A 3EIEA 2OOBA 2R4JA 3KOZE 2KRUA 3GPXA 1XNRM 2JUJA 1IXSA 3KOYE 2R0IA 2DWLA 4NOOB 4FWHA 1TTEA 4IBFA 3GLIE 3W68A 1RU3A 1IN5A 2UUBM 2KXEA 4X64M 2Y21A 3HU2A 3KS4A 5IT9S 1IN6A 3L26A 3LQRA 3L2AA 1Q3CA 3GP1A 2X4AA 4CGYB 1JR3E 4WP2A 3IHPA 2DKLA 3QYBA 2QZ4A 3GRYA 2W82A 3JR4A 3U6QA 2RGOA 4LJ8A 2LVAA 1KSFX 1XWIA 2CWBA 2R65A 2HKJA 3FUTA 1L2CA 2JY5A 1Y8GA 4MGIE 4OVZB 3RFWA 5JI3E 1QVRA 3KSXA 4GKKM 1IN8A 5DNYA 2ZM6M 2LVPC 3U6MA 4B3MM 2ZBKB 1GL7A 2O25A 1IM2A 2EKFA 1WJ7A 1OQYA 1L1ZA 4AW4A 2AHMA 3CF0A 5FSWA 3DOAA 3AV0A 2J7NA 2DWMA 2V1CA 4DBGB 3K8ZA 3W67A 2LH0A 5EXPA 3HJQA 4LJ9A 4HL4A 1AUAA 4OVZA 1E32A 1TR8A 3T1HM 1H6UA 1IXZA 3M6AA 3GLFE 2EA0A 2JY8A 3FYDA 4F2LA 1E94E 4Z6YA 3HWSA 1ZQ9A 2L7IA 4G4QA 2GNOA 1PJQA 1QZEA 1HQCA 2K6BA 3THGA 4GEWA 3HY5A 1GJTA 2CFOA 4JI4M 1QUSA 1PJSA 3HHWA 1NY6A 3KOWE 1TDHA 4DV6M 2DVWB 5KQ8A 4D82A 1R6BX 1XXHE 4FVMA 3IG5A 1VDDA 5DYGA 1XMQM 2I7PA 3SFZA 3SAUA 4JI6M 1L8QA 5ITYA 4YY3M 4LRSA 1OKSA 1QQWA 3KP1E 2F5SA 5JI2E 3GLFB 4LJ5A 3HU3A 3KFUG 2JY7A 3IG8A 3U6EA 3T38A 3B9PA 1J7KA 2FNAA 2QP9X 2HHHM 2QBYB 4LF6M 5BPVA 2BJWA 2DNAA 4L4UA 4RF0A 5EXXA 3AOEC 1PRBA 4IBJA 1LTMA 3FE3A 2LXEA 5L8RF 3TQSA 5IWAM 1HNXM 1A5TA 1UFZA 4GC5A 4JN6A 4P17A 3GQ3A 1XXHB 3U5ZB 2CV0A 4LZJA 3HKPA 1JQJC 2LVQD 3DA1A 2R44A 3KSJA 4JXJA 3HHZA 3B74A 2BJVA 2H1RA 4WW0A 4AKGA 4FWGA 3HX3A 3D8LA 4QNMA 4LFBM 5KO3A 2QBYA 3HHYA 4EIWA 2JZ0A 1G4AE 4LJ7A 3WHLA 2VF7A 4NXNM 4RF1A 2VDBB 4LGYA 2Y0TA 1HR0M 2LTUA 3U5ZA 3ZC7B 1XC8A 2J5YA 1NVMA 2V6ZM 3MHVC 4F1IA 2CUZA 4LJAA 1GO5A 1IXRC 4LRTA 3J80S 5EP2A 4PDGA 2RKOA 1VQ1A 2ZTDA 3CF6E 2N35A 3T15A 1TDZA 4IBKA 5EJCA 1NY5A 2CP8A 4Q7JA 3R8FA 1WIVA 1GABA 4GITA 1EFUB 4PCZA 4IIWA 2LHCA 3ZQJA 2Z3XA 1MJGM 3L27A 2DI0A 1WGLA 2Z4RA 2OOAA 4MH0E 1N77A 3WHKA 2APLA 1S3SA 1W5TA 4KO8A 1ZMUA 2DHYA 4HLQA 1TH2A 4L16A 4MGHA 2UUAM 1DGGA 4BBAA 3ILKA 4HEOA 1D0MA 2QCUA 1L1TA 2FE8A 2JA2A 2KNAA 1E9RA 3D8BA 4LZZA 4P16A 2XFTA 4BB9A 1OAIA 3T6PA 5F3WA 1NHGC 3SYKA 4LFCM 1Z5BA 4DR7M 2QNJA 5KPRA 2CHVA 4I5SA 5KPTA 4CJ6A 2DAIA 3CTWB 5ITQA 2YNMD 4CIZA 3TPZA 2F5PA 5FLXS 4JI7M 3HHXA 1NJFA 4G4RA 4DR2M 2QHOB 4KHPM 1HJPA 1L2BA 3VK7A 1G3IA 3I04M 2DZLA 3AJIB 2D7HA 1PJJA 1MU5A 4NSRA 2QPAA 2MR9A 3KVWA 1MN3A 5KPZA 1DGFA 1VEJA 3VFDA 3PXGA 2JWSA 2LHGA 5GKNA 1VEKA 1GL6A 4L8RC 2LNHC 3VLFB 3W0LB 2UXCM 2XEPA 3KDSE 3SC3A 3GLIB 7CATA 5EXTA 1QDTA 3C3EA 3LVVA 4PDIA 3UZUA 2CRUA 2CV1A 1QAQA 3A45A 1NHWC 4X65M 2K47A 1HT1E 3K9OA 4FCWA 1DGBA 3J81S 2VQEM 5ITUA 3SYLA 3U61B 2KRKA 1X37A 2H5XA 3J7BA 5LMUM 1WHCA 1XNQM 2B3TA 2JXNA 4DV3M 2C5RA 2XGNA 4JI1M 4DR4M 1YE9A 4JV5M 1GKIA 1XMOM 4AG6A 3GLIA 3U6DA 2EO2A 4L6V6 3BOSA 4B08A 1L2DA 2WSCF 3TL4X 4CHTB 4S12A 3B89A 3MJ5A 1Q39A 2D7GA 1DGHB 1T43A 3E4RA 2XZUA 1XHBA 1JR3A 4B3RM 1KFVA 1SXJD 1G41A 2XH9A 3NBIA 2R62A 4B3SM 1FNNA 3KP0E 1IBKM 1DO2A 2DHRA 4I81A 4K0KM 1IY1A 1Z5AA 5FTKA 1G71A 2JY6B 3BXWA 3GQ5A 4LF4M 1N78A 1NJGA 1R2ZA 2XSZD 4JI8M 2YQZA 3GRVA 3A46A 3FTFA 4AI6A 4B7GA 3GPPA 4LFAM 1OTRA 4LJ4A 3JAMS 1DGHA 3GRUA 1PJTA 4OW0A 2K9DA 4MGZE 3J7AS 4M9SA 1SXJE 2WSFF 4YHHM 2L2DA 2KNVA 4R7GA 1TGUA 4PD2A 4DV1M 2O01F 3L28A 3KS8A 2ZANA 3AOGA 2KZSA 3KW6A 4LCBA 4MGKE 4NC6A 5ITRA 2ERCA 2DZOB 3GLFA 4FD2A 5KQDA 4B7HA 2BNKA 4Y28F 4DR3M 4AKIA 1LV7A 2JNHA 3LMMA 3LCUA 4QNRA 3ZH9B 3AL0C 4GRIA 1ZMWA 3GLGE 2A5YB 1NV8A 2FOIC 5IREB 2F5QA 1ZV1A 5FTJA 2I7NA 1J5EM 5EP4A 2HL7A 1GLNA 2ZAOA 3FKEA 2EJSA 2M5ZA 2R4EA 4LGMA 4M0WA 2OPFA 3AOEA 4DV4M 3AKZA 3KXEC 3PNYA 2C9CA 1N36M 2Z8YM 3U6PA 2MGWA 5FTLA 1PM5A 1WGNA 4PT5A 1SXJC 1IQPA 1R5LA 1XXHA 2DAEA 4RKUF 1EE8A 1TF0B 3PFIA 4M9XA 4QHTA 3GPUA 3I51A 4DV0M 3DFZA 3H4MA 2VF8A 3SATA 1IFYA 4NSOB 2X8AA 4NXMM 4L15A 4GHAA 1OFIA 2UXBM 4GH9A 1MX0A 2LBCA 5E26A 4OX9M 4I4LA 2KNZA 1IN7A 3M0EA 3GLGB 2Z4SA 3B7ZA 2RGHA 4LF5M 3J27B 1JB0F 1J09A 1E9SA 1QYRA 4NRWA 2C98A 4DV5M 2RRUA 3QYEA 3E9SA 1SG9A 4G6ZA 2DAGA 3J2PB 4NL4H 2XLJA 2XFSA 1N34M 1C7YA 2YFQA 2E5LM 4ANRA 1EIJA 4QHSA 2OQ4A 1N32M 1XB2B 1VDLA 1HNZM 4MGYE 3FRIA 4Z8XA 1NNJA 1I94M 3JR5A 4QOZC 4UN2B 3UMMA 1PJIA 4XK8F 1QUTA 1W5SA 2FFJA 1AIPC 2MROB 2F5NA 4MB7A 5ITXE 1QAOA 3TE6A 1Z5CA 2DWZB 3FUWA 3GQ4A 2Y0QA 3FUXA 2R6FA 2KEBA 3CGWA 4NRVA 4XGIA 5FTNA 2HWJA 2KA6B 2LVOC 1WXQA 4L78A 4GKJM 4AQYM 3FTDA 1VEGA 1K82A 3L29A 1V92A 2KW0A 1Z6TA 3KOXE 2UUCM 4JI3M 5C1BA 1YLAA 3R9XB 1QANA 3VDUA 2DAKA 4IBCA 4W5WA 1NO1A 3E21A 3RE8A 2CEAA 2MJ5B 5FTMA 2CHGA 3LW5F 4OU7A 4KT0F 3NWLA 3V76A 2DAMA 3B7QA 2G8LA 3BBZA 4GC9A 1N33M 1F4IA 1D0KA 3RGSA 4X62M 3TWLA 3UK6A 3A42A 3VKHA 3U6CA 3SHGB 1ZAEA 1N75A 1HQYE 2Y20A 3H4JA 4IBGA 5EQTA 4B7FA 4BLCA 1KYIA 4D81A 2C96A 3C9PA 1HNWM 3HU1A 1OIZA 4FCTA 3TWKA 1PGYA 2CHQA 4G3OA 4IJEA 3C58A 1FJGM 2FH0A 3FUVA 4GMQA 4X66M 3PVSA 2G3QA 5EXSA
chains in the Genus database with same CATH topology
3HJSA 2ZAMA 3CF2A 4MM3B 1YSYA 2C99A 1HT2E 4REZA 5ITXA 2NQ8C 5IZ7D 3SAWA 3I4VA 4DV2M 4DR1M 4RNAA 3ZCBB 1K3WA 2QENA 2CV2A 1I4WA 2X49A 3U61A 4I8OA 2F4VM 1G59A 4DR5M 2YR0A 1YUBA 2J7OA 3U6SA 1IBLM 1R2YA 3FYCA 1QAMA 2EUCA 2UXDM 2UU9M 4LY6A 5EP1A 4LJ6A 3FTCA 4B3TM 1IBMM 4JI2M 1D2NA 4ITQA 1NSFA 1IY0A 2V1UA 3FTEA 1OJLA 2VQFM 1R7RA 2M60A 4XBOA 3QAUA 4CISA 4FW9A 4IBBA 4II7A 2R18A 3TWMA 4DUYM 2HCBA 4TUWA 3GPYA 3UJNA 1OFHA 2D7EA 5ITTA 2Z7JA 2VIIA 1T3TA 2Q2EB 3LQQA 4LF7M 5C18A 2DXIA 1Z59A 4G4NA 4A3VB 4AKHA 1TH3A 4KODA 5H37D 4R3DA 3FD9A 3K1JA 2C9OA 3MK6A 3GLHB 4IBEA 1G8PA 3SAVA 5E6JA 2G5GX 8CATA 4M0DA 3U60B 3VK8A 4DV7M 2L7HA 3RGPA 3SBJA 1SXJB 3SASA 2R45A 5DYIA 2KZUA 1K3XA 4IBIA 4AG5A 3AFHA 3U6LA 5LMNM 2CE7A 4ZPXA 3SMSA 3SHFA 2L09A 3I4YA 1ORYB 4QOSA 3GLHA 4LF8M 3VKGA 5A2QS 3EIHA 4G4OA 4FWDA 1IN4A 3FUUA 3U60A 3T1YM 3HGIA 3OTOM 3SMPA 3K92A 3M7GA 1SXJA 1IY2A 4FCVA 3Q8XA 4JI0M 3PNVA 1QZMA 1C1KA 4IBDA 3GRRA 2DZNB 2XSZA 4M9ZA 4DR6M 5BR8M 4GIPA 1Q3BA 2O5RA 3DZDA 3GLGA 3SARA 4AZFA 3UGJA 3QWLA 3U6OA 1IXSB 3LVWA 4JI5M 4WURA 4KLNA 5EP3A 2DWNA 3L25A 1UM8A 3VDPA 2LWXA 4LG2A 2F5OA 4D80A 2R46A 1GVNA 3HJ8A 2L6OA 3K2LA 4GHLA 2XZFA 2P5TA 2XF3A 4LF9M 3A98B 4IJFA 3W0FA 4JYAM 1DO0A 3GO8A 1JR3D 1NNUC 4DUZM 1TH4A 3EIEA 2R4JA 3KOZE 2KRUA 3GPXA 1XNRM 3KOYE 2DWLA 4NOOB 4FWHA 4IBFA 1IN5A 2UUBM 2KXEA 4X64M 2Y21A 3HU2A 3KS4A 5IT9S 1IN6A 3L26A 3LQRA 3L2AA 1Q3CA 3GP1A 2X4AA 4CGYB 2QZ4A 3GRYA 2W82A 3JR4A 3U6QA 2RGOA 4LJ8A 1KSFX 1XWIA 2R65A 2HKJA 3FUTA 1L2CA 4MGIE 4OVZB 3RFWA 5JI3E 1QVRA 3KSXA 4GKKM 1IN8A 5DNYA 2ZM6M 3U6MA 4B3MM 2ZBKB 1GL7A 1IM2A 1L1ZA 4AW4A 2AHMA 3CF0A 5FSWA 3DOAA 3AV0A 2J7NA 2DWMA 2V1CA 3K8ZA 2LH0A 5EXPA 3HJQA 4LJ9A 4HL4A 4OVZA 1E32A 3T1HM 1H6UA 1IXZA 3M6AA 2EA0A 3FYDA 1E94E 4Z6YA 3HWSA 1ZQ9A 2L7IA 4G4QA 1HQCA 3THGA 2CFOA 4JI4M 3HHWA 3KOWE 1NY6A 1TDHA 4DV6M 2DVWB 5KQ8A 4D82A 1R6BX 4FVMA 3IG5A 1VDDA 5DYGA 1XMQM 2I7PA 3SFZA 3SAUA 4JI6M 1L8QA 5ITYA 4YY3M 4LRSA 1QQWA 3KP1E 2F5SA 5JI2E 3GLFB 4LJ5A 3HU3A 3KFUG 3IG8A 3U6EA 3T38A 3B9PA 1J7KA 2FNAA 2QP9X 2HHHM 2QBYB 4LF6M 5BPVA 2BJWA 4L4UA 4RF0A 5EXXA 3AOEC 4IBJA 2LXEA 3TQSA 5IWAM 1HNXM 4GC5A 4JN6A 3GQ3A 3U5ZB 1XXHB 2CV0A 4LZJA 3HKPA 1JQJC 3DA1A 3KSJA 4JXJA 3HHZA 4WW0A 2BJVA 2H1RA 4AKGA 4FWGA 3D8LA 4QNMA 4LFBM 5KO3A 2QBYA 3HHYA 4EIWA 1G4AE 4LJ7A 3WHLA 4NXNM 4RF1A 4LGYA 2Y0TA 1HR0M 3U5ZA 3ZC7B 1XC8A 1NVMA 2V6ZM 3MHVC 2CUZA 4LJAA 1IXRC 4LRTA 3J80S 5EP2A 4PDGA 2RKOA 3CF6E 3T15A 1TDZA 4IBKA 5EJCA 1NY5A 3R8FA 4GITA 4PCZA 4IIWA 2Z3XA 3L27A 4MH0E 2Z4RA 1N77A 3WHKA 1S3SA 1W5TA 4KO8A 4HLQA 1TH2A 4L16A 4MGHA 2UUAM 1DGGA 4BBAA 3ILKA 2QCUA 1L1TA 2FE8A 2JA2A 4P16A 1E9RA 3D8BA 4LZZA 4BB9A 2XFTA 5F3WA 4LFCM 1NHGC 3SYKA 1Z5BA 4DR7M 5KPRA 2CHVA 4I5SA 5KPTA 5ITQA 3CTWB 2YNMD 3TPZA 2F5PA 5FLXS 4JI7M 3HHXA 1NJFA 4G4RA 4DR2M 4KHPM 1L2BA 3VK7A 1G3IA 1PJJA 3AJIB 2D7HA 1MU5A 4NSRA 2QPAA 3KVWA 5KPZA 1DGFA 3VFDA 3PXGA 5GKNA 1GL6A 4L8RC 2LNHC 3VLFB 3W0LB 2UXCM 2XEPA 3KDSE 3SC3A 3GLIB 7CATA 5EXTA 4PDIA 3LVVA 3UZUA 2CV1A 1QAQA 3A45A 1NHWC 4X65M 2K47A 1HT1E 4FCWA 1DGBA 3J81S 2VQEM 5ITUA 3SYLA 3U61B 2KRKA 1X37A 3J7BA 5LMUM 1XNQM 4DV3M 2C5RA 2XGNA 4JI1M 4DR4M 1YE9A 4JV5M 1GKIA 1XMOM 4AG6A 3GLIA 3U6DA 2EO2A 3BOSA 4B08A 1L2DA 3TL4X 4CHTB 4S12A 3MJ5A 1Q39A 2D7GA 1DGHB 3E4RA 2XZUA 1XHBA 1JR3A 4B3RM 1KFVA 1SXJD 1G41A 2XH9A 3NBIA 2R62A 4B3SM 1FNNA 3KP0E 1IBKM 1DO2A 2DHRA 4I81A 4K0KM 1IY1A 1Z5AA 5FTKA 3GQ5A 4LF4M 1N78A 1NJGA 1R2ZA 2XSZD 4JI8M 2YQZA 3GRVA 3A46A 3FTFA 4AI6A 4B7GA 3GPPA 4LFAM 4LJ4A 3JAMS 1DGHA 3GRUA 4OW0A 4MGZE 3J7AS 4M9SA 1SXJE 4YHHM 4R7GA 1TGUA 4PD2A 4DV1M 3L28A 3KS8A 2ZANA 3AOGA 2KZSA 3KW6A 4LCBA 4MGKE 5ITRA 2ERCA 2DZOB 3GLFA 4FD2A 5KQDA 4B7HA 2BNKA 4DR3M 4AKIA 1LV7A 3LMMA 4QNRA 3ZH9B 3AL0C 4GRIA 2A5YB 2FOIC 5IREB 2F5QA 5FTJA 2I7NA 1J5EM 5EP4A 2HL7A 1GLNA 2ZAOA 3FKEA 2M5ZA 2R4EA 4LGMA 4M0WA 2OPFA 4DV4M 3AOEA 3AKZA 3KXEC 3PNYA 2C9CA 1N36M 3U6PA 5FTLA 1PM5A 4PT5A 1SXJC 1IQPA 1XXHA 1EE8A 3PFIA 4M9XA 4QHTA 3GPUA 3I51A 4DV0M 3DFZA 3H4MA 3SATA 4NSOB 2X8AA 4NXMM 4L15A 4GHAA 1OFIA 2UXBM 4GH9A 1MX0A 5E26A 4OX9M 4I4LA 1IN7A 3M0EA 3GLGB 2Z4SA 2RGHA 4LF5M 3J27B 1J09A 1E9SA 1QYRA 4NRWA 2C98A 4DV5M 3E9SA 4G6ZA 3J2PB 4NL4H 2XLJA 1N34M 2XFSA 2YFQA 2E5LM 4QHSA 2OQ4A 1N32M 1HNZM 4MGYE 4Z8XA 1NNJA 1I94M 3JR5A 4QOZC 3UMMA 1PJIA 1W5SA 2FFJA 2F5NA 4MB7A 5ITXE 1QAOA 3TE6A 3FUWA 1Z5CA 2DWZB 3GQ4A 2Y0QA 3FUXA 4XGIA 2KEBA 5FTNA 4NRVA 2KA6B 1WXQA 4L78A 4GKJM 4AQYM 3FTDA 1K82A 3L29A 2KW0A 1Z6TA 3KOXE 2UUCM 4JI3M 5C1BA 3R9XB 1QANA 3VDUA 4IBCA 4W5WA 3RE8A 2CEAA 5FTMA 2CHGA 4OU7A 3NWLA 1N33M 2G8LA 4GC9A 3RGSA 4X62M 3TWLA 3UK6A 3A42A 3VKHA 3U6CA 3SHGB 1ZAEA 1N75A 1HQYE 2Y20A 4IBGA 5EQTA 4B7FA 4BLCA 1KYIA 4D81A 2C96A 1HNWM 3HU1A 4FCTA 3TWKA 2CHQA 4IJEA 3C58A 1FJGM 3FUVA 4GMQA 4X66M 3PVSA 5EXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 M;  4NXN M;  3W0F A;  4JYA M;  3GO8 A;  1HR0 M;  4DUZ M;  1XC8 A;  5ITX A;  3SAW A;  3J7A S;  3GPX A;  4DV2 M;  1XNR M;  4YHH M;  4DR1 M;  4PD2 A;  4DV1 M;  1K3W A;  3J80 S;  4PDG A;  5ITR A;  2UUB M;  4X64 M;  1TDZ A;  2F4V M;  5IT9 S;  4DR3 M;  4DR5 M;  3U6S A;  1IBL M;  4PCZ A;  1Q3C A;  1R2Y A;  3GP1 A;  2F5Q A;  2UXD M;  2UU9 M;  1J5E M;  2OPF A;  3JR4 A;  4B3T M;  1IBM M;  4JI2 M;  4DR6 M;  4DV4 M;  3U6Q A;  1N36 M;  4ITQ A;  3U6P A;  1PM5 A;  2UUA M;  2HKJ A;  1L2C A;  1L1T A;  1EE8 A;  2VQF M;  4CIS A;  4GKK M;  4LFC M;  3GPU A;  3SAT A;  4DV0 M;  2ZM6 M;  1Z5B A;  3TWM A;  4DUY M;  3U6M A;  2ZBK B;  4B3M M;  4DR7 M;  3GPY A;  4NXM M;  5ITQ A;  5ITT A;  2UXB M;  1MX0 A;  1L1Z A;  4OX9 M;  2Q2E B;  5FLX S;  2F5P A;  3DOA A;  4JI7 M;  4LF7 M;  1Z59 A;  4G4N A;  4G4R A;  4DR2 M;  4KHP M;  4LF5 M;  1L2B A;  3VK7 A;  1PJJ A;  4NRW A;  3T1H M;  4DV5 M;  1MU5 A;  2EA0 A;  3SAV A;  1N34 M;  2E5L M;  4G4Q A;  3VK8 A;  2OQ4 A;  4DV7 M;  1N32 M;  3SBJ A;  3SAS A;  1HNZ M;  1K3X A;  1NNJ A;  1I94 M;  3JR5 A;  4JI4 M;  2UXC M;  1PJI A;  3U6L A;  5LMN M;  1TDH A;  4DV6 M;  4PDI A;  2F5N A;  4MB7 A;  5ITX E;  3A45 A;  4LF8 M;  4X65 M;  1Z5C A;  5A2Q S;  3GQ4 A;  4G4O A;  1XMQ M;  3SAU A;  4JI6 M;  3J81 S;  5ITY A;  4NRV A;  4YY3 M;  5ITU A;  2VQE M;  3T1Y M;  3OTO M;  5LMU M;  4GKJ M;  4AQY M;  1XNQ M;  1K82 A;  2F5S A;  4DV3 M;  2UUC M;  4JI0 M;  4JI1 M;  3U6E A;  4JI3 M;  4DR4 M;  1XMO M;  4JV5 M;  3U6D A;  2HHH M;  1L2D A;  4LF6 M;  1Q39 A;  1N33 M;  5BR8 M;  1Q3B A;  5IWA M;  2XZU A;  1HNX M;  3SAR A;  4X62 M;  3GQ3 A;  3TWL A;  4B3R M;  3A42 A;  1KFV A;  3U6C A;  3U6O A;  4B3S M;  1IBK M;  4JI5 M;  4K0K M;  1Z5A A;  1HNW M;  3GQ5 A;  4LF4 M;  3TWK A;  4LFB M;  2F5O A;  3C58 A;  1R2Z A;  4JI8 M;  3A46 A;  1FJG M;  4X66 M;  3GPP A;  4LFA M;  3JAM S;  2XZF A; 
#chains in the Genus database with same CATH topology
 3K9P A;  3HJS A;  2ZAM A;  3CF2 A;  2L4F A;  4MM3 B;  1ZMV A;  1YSY A;  2C99 A;  1HT2 E;  4REZ A;  5ITX A;  1T6O A;  2NQ8 C;  5IZ7 D;  3I4V A;  3SAW A;  4DV2 M;  4DR1 M;  4RNA A;  3ZCB B;  1K3W A;  2QEN A;  2CV2 A;  1I4W A;  2X49 A;  3U61 A;  4I8O A;  2F4V M;  3IEC A;  1G59 A;  2LVN C;  4DR5 M;  2YR0 A;  1YUB A;  2J7O A;  3U6S A;  1CUK A;  1IBL M;  1R2Y A;  1P3Q Q;  2JP7 A;  3FYC A;  1QAM A;  2EUC A;  2UXD M;  3LCV B;  2UU9 M;  1R4G A;  4LY6 A;  5EP1 A;  4LJ6 A;  3FTC A;  4B3T M;  1IBM M;  4JI2 M;  1D2N A;  2KDL A;  3GLH E;  4ITQ A;  1OAO C;  3FRH A;  1DV0 A;  1NSF A;  5DFL A;  2K0B X;  1IY0 A;  2FS1 A;  2V1U A;  3FTE A;  1D0L A;  1OJL A;  1R7R A;  2M60 A;  3Q8G A;  3QAU A;  4XBO A;  2VQF M;  4CIS A;  4FW9 A;  4IBB A;  4II7 A;  1Q02 A;  2R18 A;  3TWM A;  1OIP A;  2HCB A;  4DUY M;  4TUW A;  3GPY A;  2EKK A;  3UJN A;  1OFH A;  2D7E A;  5ITT A;  1BVS A;  2Z7J A;  1WR1 B;  2VII A;  1T3T A;  2Q2E B;  3LQQ A;  4LF7 M;  5C18 A;  2DXI A;  1Z59 A;  4G4N A;  4A3V B;  2JZ1 A;  4AKH A;  1TH3 A;  4KOD A;  5H37 D;  4R3D A;  3FD9 A;  3K1J A;  2C9O A;  3MK6 A;  3GLH B;  4IBE A;  1G8P A;  3SAV A;  5E6J A;  2G5G X;  8CAT A;  4M0D A;  2MH8 A;  3U60 B;  3VK8 A;  4DV7 M;  2L7H A;  2QSF X;  3RGP A;  3SBJ A;  1SXJ B;  3SAS A;  2L4E A;  2R45 A;  5DYI A;  2WZJ A;  2KZU A;  1K3X A;  4IBI A;  3E46 A;  4AG5 A;  3AFH A;  3U6L A;  2BWE A;  2CE7 A;  4ZPX A;  5LMN M;  3SMS A;  3C3D A;  3SHF A;  2L09 A;  3I4Y A;  1ORY B;  4QOS A;  3GLH A;  4LF8 M;  3VKG A;  3MMP A;  5A2Q S;  3EIH A;  4G4O A;  4FWD A;  1IN4 A;  3FUU A;  3U60 A;  3T1Y M;  3HGI A;  3OTO M;  3SMP A;  2HAK A;  3K92 A;  3M7G A;  1SXJ A;  1IY2 A;  2ZTC A;  4FCV A;  3Q8X A;  4JI0 M;  2DEN A;  3PNV A;  1QZM A;  4R71 A;  1C1K A;  4IBD A;  3GRR A;  1NV9 A;  2DZN B;  2XSZ A;  2GQF A;  2OO9 A;  4M9Z A;  4DR6 M;  5BR8 M;  4GIP A;  3I01 M;  1Q3B A;  1V33 A;  2O5R A;  3DZD A;  3GLG A;  1VG5 A;  4AZF A;  3SAR A;  3UGJ A;  3NBX X;  3QWL A;  3U6O A;  2WSE F;  1QDR A;  1IXS B;  3LVW A;  4JI5 M;  4WUR A;  4KLN A;  3F92 A;  5EP3 A;  2DWN A;  3L25 A;  1UM8 A;  3VDP A;  2LWX A;  1V34 A;  4LG2 A;  2F5O A;  1GJS A;  2KHH A;  4D80 A;  3B7N A;  2R46 A;  1GVN A;  3HJ8 A;  2L6O A;  3K2L A;  2BWB A;  4GHL A;  2XZF A;  2P5T A;  2XF3 A;  4LF9 M;  3A98 B;  4IJF A;  2QQ8 A;  3HZJ A;  3W0F A;  4JYA M;  1DO0 A;  3GO8 A;  1JR3 D;  1NNU C;  4DUZ M;  1TH4 A;  3EIE A;  2OOB A;  2R4J A;  3KOZ E;  2KRU A;  3GPX A;  1XNR M;  2JUJ A;  1IXS A;  3KOY E;  2R0I A;  2DWL A;  4NOO B;  4FWH A;  1TTE A;  4IBF A;  3GLI E;  3W68 A;  1RU3 A;  1IN5 A;  2UUB M;  2KXE A;  4X64 M;  2Y21 A;  3HU2 A;  3KS4 A;  5IT9 S;  1IN6 A;  3L26 A;  3LQR A;  3L2A A;  1Q3C A;  3GP1 A;  2X4A A;  4CGY B;  1JR3 E;  4WP2 A;  3IHP A;  2DKL A;  3QYB A;  2QZ4 A;  3GRY A;  2W82 A;  3JR4 A;  3U6Q A;  2RGO A;  4LJ8 A;  2LVA A;  1KSF X;  1XWI A;  2CWB A;  2R65 A;  2HKJ A;  3FUT A;  1L2C A;  2JY5 A;  1Y8G A;  4MGI E;  4OVZ B;  3RFW A;  5JI3 E;  1QVR A;  3KSX A;  4GKK M;  1IN8 A;  5DNY A;  2ZM6 M;  2LVP C;  3U6M A;  4B3M M;  2ZBK B;  1GL7 A;  2O25 A;  1IM2 A;  2EKF A;  1WJ7 A;  1OQY A;  1L1Z A;  4AW4 A;  2AHM A;  3CF0 A;  5FSW A;  3DOA A;  3AV0 A;  2J7N A;  2DWM A;  2V1C A;  4DBG B;  3K8Z A;  3W67 A;  2LH0 A;  5EXP A;  3HJQ A;  4LJ9 A;  4HL4 A;  1AUA A;  4OVZ A;  1E32 A;  1TR8 A;  3T1H M;  1H6U A;  1IXZ A;  3M6A A;  3GLF E;  2EA0 A;  2JY8 A;  3FYD A;  4F2L A;  1E94 E;  4Z6Y A;  3HWS A;  1ZQ9 A;  2L7I A;  4G4Q A;  2GNO A;  1PJQ A;  1QZE A;  1HQC A;  2K6B A;  3THG A;  4GEW A;  3HY5 A;  1GJT A;  2CFO A;  4JI4 M;  1QUS A;  1PJS A;  3HHW A;  1NY6 A;  3KOW E;  1TDH A;  4DV6 M;  2DVW B;  5KQ8 A;  4D82 A;  1R6B X;  1XXH E;  4FVM A;  3IG5 A;  1VDD A;  5DYG A;  1XMQ M;  2I7P A;  3SFZ A;  3SAU A;  4JI6 M;  1L8Q A;  5ITY A;  4YY3 M;  4LRS A;  1OKS A;  1QQW A;  3KP1 E;  2F5S A;  5JI2 E;  3GLF B;  4LJ5 A;  3HU3 A;  3KFU G;  2JY7 A;  3IG8 A;  3U6E A;  3T38 A;  3B9P A;  1J7K A;  2FNA A;  2QP9 X;  2HHH M;  2QBY B;  4LF6 M;  5BPV A;  2BJW A;  2DNA A;  4L4U A;  4RF0 A;  5EXX A;  3AOE C;  1PRB A;  4IBJ A;  1LTM A;  3FE3 A;  2LXE A;  5L8R F;  3TQS A;  5IWA M;  1HNX M;  1A5T A;  1UFZ A;  4GC5 A;  4JN6 A;  4P17 A;  3GQ3 A;  1XXH B;  3U5Z B;  2CV0 A;  4LZJ A;  3HKP A;  1JQJ C;  2LVQ D;  3DA1 A;  2R44 A;  3KSJ A;  4JXJ A;  3HHZ A;  3B74 A;  2BJV A;  2H1R A;  4WW0 A;  4AKG A;  4FWG A;  3HX3 A;  3D8L A;  4QNM A;  4LFB M;  5KO3 A;  2QBY A;  3HHY A;  4EIW A;  2JZ0 A;  1G4A E;  4LJ7 A;  3WHL A;  2VF7 A;  4NXN M;  4RF1 A;  2VDB B;  4LGY A;  2Y0T A;  1HR0 M;  2LTU A;  3U5Z A;  3ZC7 B;  1XC8 A;  2J5Y A;  1NVM A;  2V6Z M;  3MHV C;  4F1I A;  2CUZ A;  4LJA A;  1GO5 A;  1IXR C;  4LRT A;  3J80 S;  5EP2 A;  4PDG A;  2RKO A;  1VQ1 A;  2ZTD A;  3CF6 E;  2N35 A;  3T15 A;  1TDZ A;  4IBK A;  5EJC A;  1NY5 A;  2CP8 A;  4Q7J A;  3R8F A;  1WIV A;  1GAB A;  4GIT A;  1EFU B;  4PCZ A;  4IIW A;  2LHC A;  3ZQJ A;  2Z3X A;  1MJG M;  3L27 A;  2DI0 A;  1WGL A;  2Z4R A;  2OOA A;  4MH0 E;  1N77 A;  3WHK A;  2APL A;  1S3S A;  1W5T A;  4KO8 A;  1ZMU A;  2DHY A;  4HLQ A;  1TH2 A;  4L16 A;  4MGH A;  2UUA M;  1DGG A;  4BBA A;  3ILK A;  4HEO A;  1D0M A;  2QCU A;  1L1T A;  2FE8 A;  2JA2 A;  2KNA A;  1E9R A;  3D8B A;  4LZZ A;  4P16 A;  2XFT A;  4BB9 A;  1OAI A;  3T6P A;  5F3W A;  1NHG C;  3SYK A;  4LFC M;  1Z5B A;  4DR7 M;  2QNJ A;  5KPR A;  2CHV A;  4I5S A;  5KPT A;  4CJ6 A;  2DAI A;  3CTW B;  5ITQ A;  2YNM D;  4CIZ A;  3TPZ A;  2F5P A;  5FLX S;  4JI7 M;  3HHX A;  1NJF A;  4G4R A;  4DR2 M;  2QHO B;  4KHP M;  1HJP A;  1L2B A;  3VK7 A;  1G3I A;  3I04 M;  2DZL A;  3AJI B;  2D7H A;  1PJJ A;  1MU5 A;  4NSR A;  2QPA A;  2MR9 A;  3KVW A;  1MN3 A;  5KPZ A;  1DGF A;  1VEJ A;  3VFD A;  3PXG A;  2JWS A;  2LHG A;  5GKN A;  1VEK A;  1GL6 A;  4L8R C;  2LNH C;  3VLF B;  3W0L B;  2UXC M;  2XEP A;  3KDS E;  3SC3 A;  3GLI B;  7CAT A;  5EXT A;  1QDT A;  3C3E A;  3LVV A;  4PDI A;  3UZU A;  2CRU A;  2CV1 A;  1QAQ A;  3A45 A;  1NHW C;  4X65 M;  2K47 A;  1HT1 E;  3K9O A;  4FCW A;  1DGB A;  3J81 S;  2VQE M;  5ITU A;  3SYL A;  3U61 B;  2KRK A;  1X37 A;  2H5X A;  3J7B A;  5LMU M;  1WHC A;  1XNQ M;  2B3T A;  2JXN A;  4DV3 M;  2C5R A;  2XGN A;  4JI1 M;  4DR4 M;  1YE9 A;  4JV5 M;  1GKI A;  1XMO M;  4AG6 A;  3GLI A;  3U6D A;  2EO2 A;  4L6V 6;  3BOS A;  4B08 A;  1L2D A;  2WSC F;  3TL4 X;  4CHT B;  4S12 A;  3B89 A;  3MJ5 A;  1Q39 A;  2D7G A;  1DGH B;  1T43 A;  3E4R A;  2XZU A;  1XHB A;  1JR3 A;  4B3R M;  1KFV A;  1SXJ D;  1G41 A;  2XH9 A;  3NBI A;  2R62 A;  4B3S M;  1FNN A;  3KP0 E;  1IBK M;  1DO2 A;  2DHR A;  4I81 A;  4K0K M;  1IY1 A;  1Z5A A;  5FTK A;  1G71 A;  2JY6 B;  3BXW A;  3GQ5 A;  4LF4 M;  1N78 A;  1NJG A;  1R2Z A;  2XSZ D;  4JI8 M;  2YQZ A;  3GRV A;  3A46 A;  3FTF A;  4AI6 A;  4B7G A;  3GPP A;  4LFA M;  1OTR A;  4LJ4 A;  3JAM S;  1DGH A;  3GRU A;  1PJT A;  4OW0 A;  2K9D A;  4MGZ E;  3J7A S;  4M9S A;  1SXJ E;  2WSF F;  4YHH M;  2L2D A;  2KNV A;  4R7G A;  1TGU A;  4PD2 A;  4DV1 M;  2O01 F;  3L28 A;  3KS8 A;  2ZAN A;  3AOG A;  2KZS A;  3KW6 A;  4LCB A;  4MGK E;  4NC6 A;  5ITR A;  2ERC A;  2DZO B;  3GLF A;  4FD2 A;  5KQD A;  4B7H A;  2BNK A;  4Y28 F;  4DR3 M;  4AKI A;  1LV7 A;  2JNH A;  3LMM A;  3LCU A;  4QNR A;  3ZH9 B;  3AL0 C;  4GRI A;  1ZMW A;  3GLG E;  2A5Y B;  1NV8 A;  2FOI C;  5IRE B;  2F5Q A;  1ZV1 A;  5FTJ A;  2I7N A;  1J5E M;  5EP4 A;  2HL7 A;  1GLN A;  2ZAO A;  3FKE A;  2EJS A;  2M5Z A;  2R4E A;  4LGM A;  4M0W A;  2OPF A;  3AOE A;  4DV4 M;  3AKZ A;  3KXE C;  3PNY A;  2C9C A;  1N36 M;  2Z8Y M;  3U6P A;  2MGW A;  5FTL A;  1PM5 A;  1WGN A;  4PT5 A;  1SXJ C;  1IQP A;  1R5L A;  1XXH A;  2DAE A;  4RKU F;  1EE8 A;  1TF0 B;  3PFI A;  4M9X A;  4QHT A;  3GPU A;  3I51 A;  4DV0 M;  3DFZ A;  3H4M A;  2VF8 A;  3SAT A;  1IFY A;  4NSO B;  2X8A A;  4NXM M;  4L15 A;  4GHA A;  1OFI A;  2UXB M;  4GH9 A;  1MX0 A;  2LBC A;  5E26 A;  4OX9 M;  4I4L A;  2KNZ A;  1IN7 A;  3M0E A;  3GLG B;  2Z4S A;  3B7Z A;  2RGH A;  4LF5 M;  3J27 B;  1JB0 F;  1J09 A;  1E9S A;  1QYR A;  4NRW A;  2C98 A;  4DV5 M;  2RRU A;  3QYE A;  3E9S A;  1SG9 A;  4G6Z A;  2DAG A;  3J2P B;  4NL4 H;  2XLJ A;  2XFS A;  1N34 M;  1C7Y A;  2YFQ A;  2E5L M;  4ANR A;  1EIJ A;  4QHS A;  2OQ4 A;  1N32 M;  1XB2 B;  1VDL A;  1HNZ M;  4MGY E;  3FRI A;  4Z8X A;  1NNJ A;  1I94 M;  3JR5 A;  4QOZ C;  4UN2 B;  3UMM A;  1PJI A;  4XK8 F;  1QUT A;  1W5S A;  2FFJ A;  1AIP C;  2MRO B;  2F5N A;  4MB7 A;  5ITX E;  1QAO A;  3TE6 A;  1Z5C A;  2DWZ B;  3FUW A;  3GQ4 A;  2Y0Q A;  3FUX A;  2R6F A;  2KEB A;  3CGW A;  4NRV A;  4XGI A;  5FTN A;  2HWJ A;  2KA6 B;  2LVO C;  1WXQ A;  4L78 A;  4GKJ M;  4AQY M;  3FTD A;  1VEG A;  1K82 A;  3L29 A;  1V92 A;  2KW0 A;  1Z6T A;  3KOX E;  2UUC M;  4JI3 M;  5C1B A;  1YLA A;  3R9X B;  1QAN A;  3VDU A;  2DAK A;  4IBC A;  4W5W A;  1NO1 A;  3E21 A;  3RE8 A;  2CEA A;  2MJ5 B;  5FTM A;  2CHG A;  3LW5 F;  4OU7 A;  4KT0 F;  3NWL A;  3V76 A;  2DAM A;  3B7Q A;  2G8L A;  3BBZ A;  4GC9 A;  1N33 M;  1F4I A;  1D0K A;  3RGS A;  4X62 M;  3TWL A;  3UK6 A;  3A42 A;  3VKH A;  3U6C A;  3SHG B;  1ZAE A;  1N75 A;  1HQY E;  2Y20 A;  3H4J A;  4IBG A;  5EQT A;  4B7F A;  4BLC A;  1KYI A;  4D81 A;  2C96 A;  3C9P A;  1HNW M;  3HU1 A;  1OIZ A;  4FCT A;  3TWK A;  1PGY A;  2CHQ A;  4G3O A;  4IJE A;  3C58 A;  1FJG M;  2FH0 A;  3FUV A;  4GMQ A;  4X66 M;  3PVS A;  2G3Q A;  5EXS A; 
#chains in the Genus database with same CATH homology
 3HJS A;  2ZAM A;  3CF2 A;  4MM3 B;  1YSY A;  2C99 A;  1HT2 E;  4REZ A;  5ITX A;  2NQ8 C;  5IZ7 D;  3SAW A;  3I4V A;  4DV2 M;  4DR1 M;  4RNA A;  3ZCB B;  1K3W A;  2QEN A;  2CV2 A;  1I4W A;  2X49 A;  3U61 A;  4I8O A;  2F4V M;  1G59 A;  4DR5 M;  2YR0 A;  1YUB A;  2J7O A;  3U6S A;  1IBL M;  1R2Y A;  3FYC A;  1QAM A;  2EUC A;  2UXD M;  2UU9 M;  4LY6 A;  5EP1 A;  4LJ6 A;  3FTC A;  4B3T M;  1IBM M;  4JI2 M;  1D2N A;  4ITQ A;  1NSF A;  1IY0 A;  2V1U A;  3FTE A;  1OJL A;  2VQF M;  1R7R A;  2M60 A;  4XBO A;  3QAU A;  4CIS A;  4FW9 A;  4IBB A;  4II7 A;  2R18 A;  3TWM A;  4DUY M;  2HCB A;  4TUW A;  3GPY A;  3UJN A;  1OFH A;  2D7E A;  5ITT A;  2Z7J A;  2VII A;  1T3T A;  2Q2E B;  3LQQ A;  4LF7 M;  5C18 A;  2DXI A;  1Z59 A;  4G4N A;  4A3V B;  4AKH A;  1TH3 A;  4KOD A;  5H37 D;  4R3D A;  3FD9 A;  3K1J A;  2C9O A;  3MK6 A;  3GLH B;  4IBE A;  1G8P A;  3SAV A;  5E6J A;  2G5G X;  8CAT A;  4M0D A;  3U60 B;  3VK8 A;  4DV7 M;  2L7H A;  3RGP A;  3SBJ A;  1SXJ B;  3SAS A;  2R45 A;  5DYI A;  2KZU A;  1K3X A;  4IBI A;  4AG5 A;  3AFH A;  3U6L A;  5LMN M;  2CE7 A;  4ZPX A;  3SMS A;  3SHF A;  2L09 A;  3I4Y A;  1ORY B;  4QOS A;  3GLH A;  4LF8 M;  3VKG A;  5A2Q S;  3EIH A;  4G4O A;  4FWD A;  1IN4 A;  3FUU A;  3U60 A;  3T1Y M;  3HGI A;  3OTO M;  3SMP A;  3K92 A;  3M7G A;  1SXJ A;  1IY2 A;  4FCV A;  3Q8X A;  4JI0 M;  3PNV A;  1QZM A;  1C1K A;  4IBD A;  3GRR A;  2DZN B;  2XSZ A;  4M9Z A;  4DR6 M;  5BR8 M;  4GIP A;  1Q3B A;  2O5R A;  3DZD A;  3GLG A;  3SAR A;  4AZF A;  3UGJ A;  3QWL A;  3U6O A;  1IXS B;  3LVW A;  4JI5 M;  4WUR A;  4KLN A;  5EP3 A;  2DWN A;  3L25 A;  1UM8 A;  3VDP A;  2LWX A;  4LG2 A;  2F5O A;  4D80 A;  2R46 A;  1GVN A;  3HJ8 A;  2L6O A;  3K2L A;  4GHL A;  2XZF A;  2P5T A;  2XF3 A;  4LF9 M;  3A98 B;  4IJF A;  3W0F A;  4JYA M;  1DO0 A;  3GO8 A;  1JR3 D;  1NNU C;  4DUZ M;  1TH4 A;  3EIE A;  2R4J A;  3KOZ E;  2KRU A;  3GPX A;  1XNR M;  3KOY E;  2DWL A;  4NOO B;  4FWH A;  4IBF A;  1IN5 A;  2UUB M;  2KXE A;  4X64 M;  2Y21 A;  3HU2 A;  3KS4 A;  5IT9 S;  1IN6 A;  3L26 A;  3LQR A;  3L2A A;  1Q3C A;  3GP1 A;  2X4A A;  4CGY B;  2QZ4 A;  3GRY A;  2W82 A;  3JR4 A;  3U6Q A;  2RGO A;  4LJ8 A;  1KSF X;  1XWI A;  2R65 A;  2HKJ A;  3FUT A;  1L2C A;  4MGI E;  4OVZ B;  3RFW A;  5JI3 E;  1QVR A;  3KSX A;  4GKK M;  1IN8 A;  5DNY A;  2ZM6 M;  3U6M A;  4B3M M;  2ZBK B;  1GL7 A;  1IM2 A;  1L1Z A;  4AW4 A;  2AHM A;  3CF0 A;  5FSW A;  3DOA A;  3AV0 A;  2J7N A;  2DWM A;  2V1C A;  3K8Z A;  2LH0 A;  5EXP A;  3HJQ A;  4LJ9 A;  4HL4 A;  4OVZ A;  1E32 A;  3T1H M;  1H6U A;  1IXZ A;  3M6A A;  2EA0 A;  3FYD A;  1E94 E;  4Z6Y A;  3HWS A;  1ZQ9 A;  2L7I A;  4G4Q A;  1HQC A;  3THG A;  2CFO A;  4JI4 M;  3HHW A;  3KOW E;  1NY6 A;  1TDH A;  4DV6 M;  2DVW B;  5KQ8 A;  4D82 A;  1R6B X;  4FVM A;  3IG5 A;  1VDD A;  5DYG A;  1XMQ M;  2I7P A;  3SFZ A;  3SAU A;  4JI6 M;  1L8Q A;  5ITY A;  4YY3 M;  4LRS A;  1QQW A;  3KP1 E;  2F5S A;  5JI2 E;  3GLF B;  4LJ5 A;  3HU3 A;  3KFU G;  3IG8 A;  3U6E A;  3T38 A;  3B9P A;  1J7K A;  2FNA A;  2QP9 X;  2HHH M;  2QBY B;  4LF6 M;  5BPV A;  2BJW A;  4L4U A;  4RF0 A;  5EXX A;  3AOE C;  4IBJ A;  2LXE A;  3TQS A;  5IWA M;  1HNX M;  4GC5 A;  4JN6 A;  3GQ3 A;  3U5Z B;  1XXH B;  2CV0 A;  4LZJ A;  3HKP A;  1JQJ C;  3DA1 A;  3KSJ A;  4JXJ A;  3HHZ A;  4WW0 A;  2BJV A;  2H1R A;  4AKG A;  4FWG A;  3D8L A;  4QNM A;  4LFB M;  5KO3 A;  2QBY A;  3HHY A;  4EIW A;  1G4A E;  4LJ7 A;  3WHL A;  4NXN M;  4RF1 A;  4LGY A;  2Y0T A;  1HR0 M;  3U5Z A;  3ZC7 B;  1XC8 A;  1NVM A;  2V6Z M;  3MHV C;  2CUZ A;  4LJA A;  1IXR C;  4LRT A;  3J80 S;  5EP2 A;  4PDG A;  2RKO A;  3CF6 E;  3T15 A;  1TDZ A;  4IBK A;  5EJC A;  1NY5 A;  3R8F A;  4GIT A;  4PCZ A;  4IIW A;  2Z3X A;  3L27 A;  4MH0 E;  2Z4R A;  1N77 A;  3WHK A;  1S3S A;  1W5T A;  4KO8 A;  4HLQ A;  1TH2 A;  4L16 A;  4MGH A;  2UUA M;  1DGG A;  4BBA A;  3ILK A;  2QCU A;  1L1T A;  2FE8 A;  2JA2 A;  4P16 A;  1E9R A;  3D8B A;  4LZZ A;  4BB9 A;  2XFT A;  5F3W A;  4LFC M;  1NHG C;  3SYK A;  1Z5B A;  4DR7 M;  5KPR A;  2CHV A;  4I5S A;  5KPT A;  5ITQ A;  3CTW B;  2YNM D;  3TPZ A;  2F5P A;  5FLX S;  4JI7 M;  3HHX A;  1NJF A;  4G4R A;  4DR2 M;  4KHP M;  1L2B A;  3VK7 A;  1G3I A;  1PJJ A;  3AJI B;  2D7H A;  1MU5 A;  4NSR A;  2QPA A;  3KVW A;  5KPZ A;  1DGF A;  3VFD A;  3PXG A;  5GKN A;  1GL6 A;  4L8R C;  2LNH C;  3VLF B;  3W0L B;  2UXC M;  2XEP A;  3KDS E;  3SC3 A;  3GLI B;  7CAT A;  5EXT A;  4PDI A;  3LVV A;  3UZU A;  2CV1 A;  1QAQ A;  3A45 A;  1NHW C;  4X65 M;  2K47 A;  1HT1 E;  4FCW A;  1DGB A;  3J81 S;  2VQE M;  5ITU A;  3SYL A;  3U61 B;  2KRK A;  1X37 A;  3J7B A;  5LMU M;  1XNQ M;  4DV3 M;  2C5R A;  2XGN A;  4JI1 M;  4DR4 M;  1YE9 A;  4JV5 M;  1GKI A;  1XMO M;  4AG6 A;  3GLI A;  3U6D A;  2EO2 A;  3BOS A;  4B08 A;  1L2D A;  3TL4 X;  4CHT B;  4S12 A;  3MJ5 A;  1Q39 A;  2D7G A;  1DGH B;  3E4R A;  2XZU A;  1XHB A;  1JR3 A;  4B3R M;  1KFV A;  1SXJ D;  1G41 A;  2XH9 A;  3NBI A;  2R62 A;  4B3S M;  1FNN A;  3KP0 E;  1IBK M;  1DO2 A;  2DHR A;  4I81 A;  4K0K M;  1IY1 A;  1Z5A A;  5FTK A;  3GQ5 A;  4LF4 M;  1N78 A;  1NJG A;  1R2Z A;  2XSZ D;  4JI8 M;  2YQZ A;  3GRV A;  3A46 A;  3FTF A;  4AI6 A;  4B7G A;  3GPP A;  4LFA M;  4LJ4 A;  3JAM S;  1DGH A;  3GRU A;  4OW0 A;  4MGZ E;  3J7A S;  4M9S A;  1SXJ E;  4YHH M;  4R7G A;  1TGU A;  4PD2 A;  4DV1 M;  3L28 A;  3KS8 A;  2ZAN A;  3AOG A;  2KZS A;  3KW6 A;  4LCB A;  4MGK E;  5ITR A;  2ERC A;  2DZO B;  3GLF A;  4FD2 A;  5KQD A;  4B7H A;  2BNK A;  4DR3 M;  4AKI A;  1LV7 A;  3LMM A;  4QNR A;  3ZH9 B;  3AL0 C;  4GRI A;  2A5Y B;  2FOI C;  5IRE B;  2F5Q A;  5FTJ A;  2I7N A;  1J5E M;  5EP4 A;  2HL7 A;  1GLN A;  2ZAO A;  3FKE A;  2M5Z A;  2R4E A;  4LGM A;  4M0W A;  2OPF A;  4DV4 M;  3AOE A;  3AKZ A;  3KXE C;  3PNY A;  2C9C A;  1N36 M;  3U6P A;  5FTL A;  1PM5 A;  4PT5 A;  1SXJ C;  1IQP A;  1XXH A;  1EE8 A;  3PFI A;  4M9X A;  4QHT A;  3GPU A;  3I51 A;  4DV0 M;  3DFZ A;  3H4M A;  3SAT A;  4NSO B;  2X8A A;  4NXM M;  4L15 A;  4GHA A;  1OFI A;  2UXB M;  4GH9 A;  1MX0 A;  5E26 A;  4OX9 M;  4I4L A;  1IN7 A;  3M0E A;  3GLG B;  2Z4S A;  2RGH A;  4LF5 M;  3J27 B;  1J09 A;  1E9S A;  1QYR A;  4NRW A;  2C98 A;  4DV5 M;  3E9S A;  4G6Z A;  3J2P B;  4NL4 H;  2XLJ A;  1N34 M;  2XFS A;  2YFQ A;  2E5L M;  4QHS A;  2OQ4 A;  1N32 M;  1HNZ M;  4MGY E;  4Z8X A;  1NNJ A;  1I94 M;  3JR5 A;  4QOZ C;  3UMM A;  1PJI A;  1W5S A;  2FFJ A;  2F5N A;  4MB7 A;  5ITX E;  1QAO A;  3TE6 A;  3FUW A;  1Z5C A;  2DWZ B;  3GQ4 A;  2Y0Q A;  3FUX A;  4XGI A;  2KEB A;  5FTN A;  4NRV A;  2KA6 B;  1WXQ A;  4L78 A;  4GKJ M;  4AQY M;  3FTD A;  1K82 A;  3L29 A;  2KW0 A;  1Z6T A;  3KOX E;  2UUC M;  4JI3 M;  5C1B A;  3R9X B;  1QAN A;  3VDU A;  4IBC A;  4W5W A;  3RE8 A;  2CEA A;  5FTM A;  2CHG A;  4OU7 A;  3NWL A;  1N33 M;  2G8L A;  4GC9 A;  3RGS A;  4X62 M;  3TWL A;  3UK6 A;  3A42 A;  3VKH A;  3U6C A;  3SHG B;  1ZAE A;  1N75 A;  1HQY E;  2Y20 A;  4IBG A;  5EQT A;  4B7F A;  4BLC A;  1KYI A;  4D81 A;  2C96 A;  1HNW M;  3HU1 A;  4FCT A;  3TWK A;  2CHQ A;  4IJE A;  3C58 A;  1FJG M;  3FUV A;  4GMQ A;  4X66 M;  3PVS A;  5EXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...