2ZM6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 24
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2zm6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2zm6M02
3GPUA 1XC8A 1I94M 2UU9M 3U6QA 4JI6M 3GPPA 5ITRA 4DV3M 2UUBM 1Z5CA 1N33M 3J81S 3U6CA 1L2CA 2ZM6M 2VQFM 2EA0A 4DR1M 4B3MM 4JI4M 4GKJM 4DV4M 3SBJA 2Q2EB 5ITXE 3SAWA 1R2ZA 2UUCM 4PD2A 4X65M 2F5PA 4KHPM 1Z59A 4DR6M 3JR4A 3U6PA 2F5SA 3SASA 1L2BA 4NRVA 1L1ZA 1PM5A 4LF6M 4LF7M 4PDGA 4CISA 3TWMA 4OX9M 1MX0A 2UXBM 4AQYM 2UXDM 4DV2M 4JYAM 4B3TM 1K3XA 4NXMM 4DR7M 3TWKA 3T1HM 3J7AS 4LFCM 3A46A 3A45A 3SATA 4JI0M 5ITXA 1KFVA 4B3RM 1NNJA 1N36M 1Q3BA 4JI2M 3GO8A 1R2YA 1PJIA 2OQ4A 4JI8M 4G4QA 2XZFA 1Z5BA 3GQ3A 4K0KM 1N34M 5ITTA 4DR5M 4DV1M 3U6EA 4JV5M 3SARA 5A2QS 1K82A 3W0FA 3JAMS 1HNXM 4DR2M 2F5OA 4MB7A 2F5QA 5IWAM 4DUYM 1FJGM 1IBKM 4LF9M 4GKKM 5ITQA 1MU5A 3OTOM 2XZUA 2HHHM 4ITQA 1K3WA 1XNRM 4X62M 2HKJA 4DV5M 1J5EM 4B3SM 2OPFA 4DV7M 4NXNM 3U6DA 3C58A 3U6MA 1HNZM 4PDIA 3GQ4A 4X66M 3J80S 4LFAM 2F5NA 1HNWM 4JI5M 4PCZA 4DR3M 3U6SA 1IBLM 1IBMM 1PJJA 5ITYA 1XMOM 4X64M 1TDZA 1L2DA 4LF4M 4LFBM 1Z5AA 3DOAA 4G4RA 1Q39A 2UUAM 4JI1M 4LF8M 1XNQM 2UXCM 2F4VM 4JI7M 3JR5A 4DR4M 1HR0M 3GP1A 4JI3M 4DV0M 3VK7A 3U6OA 4G4NA 4G4OA 3SAUA 2E5LM 5LMUM 1EE8A 4DUZM 1XMQM 5LMNM 3SAVA 2ZBKB 2VQEM 5ITUA 4YHHM 1TDHA 3T1YM 1N32M 4YY3M 1L1TA 3VK8A 5IT9S 3GPXA 4NRWA 1Q3CA 3TWLA 3GQ5A 3GPYA 5FLXS 4DV6M 4LF5M 5BR8M 3A42A 3U6LA
chains in the Genus database with same CATH superfamily
1XC8A 3ZQJA 4JI6M 3GPPA 1XXHB 4KO8A 3B7QA 4DV3M 3F92A 3J81S 1L2CA 2VQFM 1IN4A 2DAEA 1W5TA 1TH4A 3GRRA 4L8RC 5EXSA 3CF6E 1PJSA 2Q2EB 2DZOB 2KA6B 1IN8A 3ZCBB 4LGYA 4KHPM 1J7KA 4DR6M 2CEAA 2XEPA 3JR4A 4LRTA 5JI3E 3W0LB 4OW0A 1IN6A 2F5SA 3D8BA 2FNAA 3R9XB 5KQDA 4CISA 3LQQA 1KYIA 4L16A 2UXBM 3HHWA 3SFZA 2K0BX 2UXDM 4JYAM 1XXHE 1XHBA 2K6BA 3TWKA 3AOGA 3FTFA 3KOYE 5EP2A 2DNAA 2MGWA 1NO1A 3FRHA 4LFCM 2CHQA 2DAGA 1L8QA 3HWSA 1SXJB 1VQ1A 4JI0M 1H6UA 3VFDA 1E9RA 2R18A 3TE6A 3K9PA 3UK6A 3L27A 3MJ5A 4D81A 3E46A 3PNYA 1NNJA 1YE9A 3UMMA 2FS1A 1NY6A 3AV0A 2O5RA 1S3SA 2O01F 3U5ZA 2W82A 1JR3E 2XFTA 2OO9A 3L28A 4BLCA 2CP8A 3T38A 2R4EA 2YFQA 3ILKA 4REZA 3SARA 1Q02A 4AKHA 2YNMD 4L15A 2QBYB 5A2QS 1K82A 1QZMA 2D7GA 2OOAA 5FTLA 4W5WA 2CFOA 3HHXA 1SXJE 4HL4A 3NWLA 4LJ4A 1NJGA 3ZC7B 4D80A 4FWGA 5IWAM 4DUYM 1IBKM 2HHHM 1VDLA 4DV5M 2HKJA 4LGMA 3MK6A 3Q8XA 2CHGA 3MHVC 2GNOA 3CTWB 4AKGA 2OPFA 1HQCA 4Z8XA 3Q8GA 3QAUA 5BPVA 2L7IA 1JR3A 2XGNA 2ZTCA 3HZJA 3M0EA 3WHKA 2APLA 2QP9X 4MGIE 4PDIA 4X66M 4LFAM 2DXIA 1EFUB 4L78A 1QUTA 2QCUA 2QHOB 4RNAA 3VDPA 4R7GA 2H5XA 2QQ8A 1IBMM 4KT0F 1TGUA 1OQYA 2H1RA 3KS8A 4NC6A 3D8LA 4LF4M 1VEJA 4LFBM 4L4UA 4WW0A 1SXJC 4QNRA 2OOBA 4LF8M 2UXCM 1G8PA 2F4VM 1HR0M 3CF0A 3GP1A 2K47A 2C9OA 3B7ZA 1TR8A 4G4OA 3AKZA 4GHAA 2Y21A 1NV9A 4LY6A 2RRUA 3QYBA 3SYLA 5DNYA 1QVRA 4IBCA 5EP1A 1AUAA 2Y20A 3LCVB 7CATA 1WXQA 3E9SA 1D0KA 2DAIA 3KP0E 2YR0A 3T1YM 4QHTA 2QSFX 1N32M 1L1TA 2V1CA 4NRWA 3KVWA 2DWLA 4GITA 4AZFA 3GQ5A 1EIJA 5FLXS 3SC3A 1NV8A 2WZJA 2DHYA 1DO0A 3IHPA 3U61B 3W68A 1G59A 3GPUA 4B7GA 2G8LA 1Z5CA 3C9PA 5EP4A 3U6CA 2O25A 4KLNA 2DAKA 2Z7JA 4JI4M 3I04M 4D82A 4IBDA 4DV4M 1ZV1A 3KXEC 2DENA 3FUTA 5JI2E 2LNHC 3AOEC 4LZZA 2D7EA 5ITXE 1R2ZA 2KEBA 2UUCM 4B7FA 1TF0B 2HCBA 2JY5A 1OAIA 2JY6B 3J2PB 4BB9A 3GLFA 1R5LA 3SASA 2BJWA 3R8FA 1L1ZA 1GLNA 1NHGC 1OAOC 5IREB 4MGZE 4P17A 3RE8A 3U5ZB 4LF7M 3TWMA 4OX9M 1MX0A 1J09A 2LWXA 2CV0A 2MH8A 1HT1E 4FCTA 4TUWA 1K3XA 1OIZA 4IIWA 4I81A 2VF8A 3T1HM 1NY5A 5EP3A 1C1KA 4FW9A 4GC9A 4OVZA 3DA1A 3RFWA 3A46A 3M7GA 3I51A 3KOXE 3VLFB 3LQRA 4PT5A 5ITXA 1N78A 3IG5A 2L4EA 4WP2A 4M9XA 4NOOB 2XFSA 1QZEA 1Q3BA 1WJ7A 5E26A 1DGHA 1N36M 1D2NA 1R2YA 1PJIA 2OQ4A 1WIVA 4G4QA 3QYEA 3J27B 4IBEA 2XZFA 3GQ3A 4K0KM 3K2LA 4LJ9A 5ITTA 1OTRA 1E94E 2I7NA 2KZSA 3HGIA 3HJ8A 4NL4H 3U6EA 1P3QQ 4JV5M 1VEGA 2CV1A 2ZAOA 4IBGA 5FTJA 3W0FA 2R6FA 4NSRA 2CV2A 3DZDA 1HNXM 2DWNA 1E9SA 2JZ1A 2K9DA 3RGSA 3VDUA 3M6AA 5E6JA 2QENA 2KRUA 3GLHB 3K1JA 1QDRA 1QQWA 1OFHA 4FVMA 5ITQA 1CUKA 3KOWE 3TQSA 3KS4A 1C7YA 4ITQA 1J5EM 2MR9A 1T6OA 2C96A 1MJGM 2N35A 1WHCA 3CGWA 1DGGA 1WGLA 3C58A 1DV0A 3U6MA 2WSCF 2HAKA 1GJTA 3GQ4A 1GABA 1JQJC 1QANA 4PCZA 4XK8F 3U6SA 3L26A 3SYKA 1IBLM 2LH0A 3E4RA 1XMOM 2C5RA 4X64M 1TDZA 1V33A 4GRIA 1Z5AA 1X37A 4G4RA 4LJ7A 2UUAM 1T3TA 2L6OA 2X4AA 3K9OA 3GLHE 3LCUA 3KW6A 4BBAA 5KPRA 2Z4SA 3EIHA 4FCWA 4DR4M 1E32A 3HKPA 1PRBA 2EO2A 4M9ZA 3I01M 2KDLA 2XLJA 2Y0TA 2R46A 4G4NA 4GHLA 3FE3A 3J7BA 2E5LM 5LMUM 3W67A 2DKLA 4DUZM 2GQFA 2L4FA 5LMNM 3SAVA 1W5SA 3GRVA 1GKIA 2VQEM 2MROB 4YHHM 3B89A 3FTDA 1WR1B 1VEKA 2AHMA 3FUUA 4GC5A 5IT9S 4CGYB 3GPYA 3FKEA 5FTNA 1IY0A 4LF5M 1NNUC 1QAQA 2R4JA 1SXJD 2RKOA 3E21A 3GLHA 3IECA 2HWJA 1DGBA 3AJIB 4LJ6A 3GLFB 4M9SA 4IBKA 1IM2A 4LZJA 5ITRA 2LVNC 3HHZA 2UUBM 1HT2E 2LXEA 2LHCA 1GL7A 4B3MM 1D0MA 4R3DA 3PNVA 4FCVA 2QZ4A 2EJSA 3SHFA 1Z6TA 4B08A 1IXRC 4DBGB 2WSFF 4MGYE 4OVZB 3NBIA 3SAWA 4IJFA 5KQ8A 4PD2A 1UFZA 5DFLA 1LV7A 1MN3A 3IG8A 3FTEA 2DI0A 4Z6YA 3U6PA 2JUJA 5F3WA 2L7HA 4XBOA 1DGHB 1OJLA 4JXJA 3AL0C 1L2BA 1GJSA 2CRUA 3B9PA 4NRVA 1PM5A 1A5TA 5IZ7D 1YUBA 3GLFE 2DVWB 4AQYM 3C3EA 4HEOA 4DV2M 4JI2M 4B3TM 4DR7M 3GRUA 4Q7JA 3HJSA 4LJ5A 2QNJA 1QUSA 2NQ8C 1AIPC 3BBZA 3DFZA 1ZMUA 3KFUG 1N75A 2JWSA 3B7NA 1IN7A 2Z4RA 4OU7A 4MH0E 3BXWA 4IBIA 1TH2A 5DYIA 3CF2A 2XSZA 3I4VA 4ZPXA 1N34M 1WGNA 2JY8A 2VIIA 2XF3A 4DR5M 3K8ZA 2CUZA 3GLGB 1VDDA 3THGA 3U61A 4DV1M 1PJQA 2Y0QA 3HU2A 5FTKA 3U60A 2R45A 1IQPA 2EUCA 4F2LA 1UM8A 4MB7A 2KXEA 1V92A 2FFJA 1FJGM 4GKKM 4II7A 3OTOM 2XZUA 1XNRM 2KNAA 1G4AE 5FSWA 1QAOA 2KRKA 3HHYA 4NXNM 2J7NA 2R62A 3U6DA 1QAMA 1VG5A 2EKFA 4MGKE 1XB2B 1HNZM 2B3TA 1GVNA 3A42A 3KDSE 3NBXX 3J80S 1IN5A 3K92A 2G3QA 4CHTB 3GLGE 4JI5M 1TH3A 3KSXA 4DR3M 1HNWM 3VKHA 1PJJA 4AG5A 2Z8YM 1T43A 2CWBA 5EXPA 4G6ZA 5ITYA 1IY2A 2KHHA 5EJCA 3HX3A 3L29A 3TPZA 4L6V6 2LVOC 1XNQM 3V76A 4Y28F 2JNHA 3WHLA 2JZ0A 4M0DA 3JR5A 2BJVA 3KP1E 4DV0M 4JI3M 3VK7A 3U6OA 2DWZB 1NJFA 3SMSA 4I5SA 4GIPA 4RF1A 1NHWC 3LW5F 5EQTA 3GRYA 3FD9A 2C99A 3LMMA 2DHRA 2EKKA 4CIZA 4NSOB 5KPZA 5H37D 2ZBKB 3HY5A 2V1UA 1XWIA 3GLGA 1TDHA 2DWMA 4B7HA 1D0LA 1G41A 3PFIA 3VK8A 4FWHA 4HLQA 3GPXA 1Q3CA 1PGYA 5C1BA 3FYCA 1N77A 5FTMA 1ZQ9A 4DV6M 4AG6A 4EIWA 2UU9M 1I94M 3U6QA 4AKIA 2VF7A 1KSFX 1V34A 1QYRA 1N33M 3QWLA 1IXSA 1OFIA 2LVQD 3HU1A 3I4YA 4FD2A 3TL4X 2ZM6M 2JA2A 2BNKA 2EA0A 4DR1M 2R44A 4GKJM 1ZMWA 3VKGA 3FUXA 3UGJA 3SBJA 1GO5A 1JR3D 2L09A 4X65M 2F5PA 1Z59A 2XH9A 3GLIB 1I4WA 4QOSA 3B74A 1OKSA 1ZAEA 4QHSA 2FOIC 1QDTA 1R7RA 2VDBB 3LVWA 4LF6M 4PDGA 1XXHA 4RF0A 1YLAA 1BVSA 3RGPA 2J5YA 1FNNA 3PVSA 3UJNA 2RGHA 2R0IA 4IJEA 3PXGA 8CATA 4NXMM 2J7OA 4I8OA 3U60B 3J7AS 3L25A 1OIPA 2X49A 4R71A 2JP7A 3A45A 3SATA 2C9CA 4GEWA 3KOZE 2LTUA 2C98A 1PJTA 3SHGB 2P5TA 1KFVA 4GMQA 1GL6A 3T15A 4B3RM 5C18A 2D7HA 2FE8A 3GO8A 4JI8M 2BWBA 3GLIE 2BWEA 2M5ZA 2DZNB 2KNVA 2LVAA 2ERCA 1YSYA 1R4GA 1Z5BA 3H4MA 5DYGA 1SG9A 1F4IA 1G71A 4S12A 1JB0F 1IY1A 4MM3B 2JXNA 3BOSA 1NVMA 2MJ5B 2ZTDA 4I4LA 3LVVA 2M60A 4FWDA 3JAMS 1R6BX 1SXJA 1ZMVA 3MMPA 4A3VB 3FUVA 4M0WA 4DR2M 2JY7A 2LVPC 3A98B 2Z3XA 1Y8GA 4KODA 2F5OA 2F5QA 4WURA 4LF9M 2G5GX 1MU5A 4IBJA 1K3WA 4QNMA 4CJ6A 4X62M 4QOZC 1LTMA 4AW4A 3KSJA 1DGFA 2YQZA 4B3SM 4AI6A 3FTCA 5KPTA 3GLIA 4DV7M 2XSZD 2QPAA 1HQYE 2HL7A 2KZUA 2KW0A 3FRIA 2LBCA 2RGOA 2L2DA 2I7PA 3L2AA 2F5NA 2QBYA 4LCBA 2KNZA 2ZAMA 3FUWA 1IXZA 5EXXA 1TTEA 4LRSA 2LHGA 1L2DA 4G3OA 3C3DA 3UZUA 3DOAA 2V6ZM 1Q39A 3HU3A 4JI1M 4IBFA 3FYDA 2CE7A 4JN6A 4RKUF 4JI7M 3EIEA 4XGIA 1HJPA 5GKNA 5L8RF 3SMPA 1NSFA 3SAUA 3T6PA 1IXSB 1EE8A 2FH0A 3AOEA 1RU3A 1XMQM 4IBBA 3AFHA 4ANRA 4LG2A 4LJAA 5ITUA 1DO2A 1G3IA 4MGHA 2ZANA 2DZLA 5EXTA 2WSEF 2CHVA 3HJQA 3H4JA 2DAMA 4YY3M 3ZH9B 1IFYA 4LJ8A 4P16A 4UN2B 4GH9A 3TWLA 2A5YB 2X8AA 5BR8M 1ORYB 5KO3A 4F1IA 2R65A 3U6LA
chains in the Genus database with same CATH topology
1XC8A 4JI6M 3GPPA 1XXHB 4KO8A 4DV3M 3J81S 1L2CA 2VQFM 1IN4A 1W5TA 1TH4A 3GRRA 4L8RC 5EXSA 3CF6E 2Q2EB 2DZOB 2KA6B 1IN8A 3ZCBB 4LGYA 4KHPM 1J7KA 4DR6M 2CEAA 2XEPA 3JR4A 4LRTA 5JI3E 3W0LB 4OW0A 1IN6A 2F5SA 3D8BA 2FNAA 3R9XB 5KQDA 4CISA 3LQQA 1KYIA 4L16A 2UXBM 3HHWA 3SFZA 2UXDM 4JYAM 1XHBA 3TWKA 3AOGA 3FTFA 3KOYE 5EP2A 4LFCM 2CHQA 1L8QA 3HWSA 1SXJB 4JI0M 1H6UA 3VFDA 1E9RA 2R18A 3TE6A 3UK6A 3L27A 3MJ5A 4D81A 3PNYA 1NNJA 1YE9A 3UMMA 3AV0A 1NY6A 2O5RA 1S3SA 3U5ZA 2W82A 2XFTA 3L28A 4BLCA 3T38A 2R4EA 2YFQA 3ILKA 4REZA 3SARA 4AKHA 2YNMD 4L15A 2QBYB 5A2QS 1K82A 1QZMA 2D7GA 5FTLA 4W5WA 2CFOA 3HHXA 1SXJE 4HL4A 3NWLA 4LJ4A 1NJGA 3ZC7B 4D80A 4FWGA 5IWAM 4DUYM 1IBKM 2HHHM 4DV5M 2HKJA 4LGMA 3MK6A 3Q8XA 2CHGA 3MHVC 3CTWB 4AKGA 2OPFA 1HQCA 4Z8XA 3QAUA 5BPVA 2L7IA 1JR3A 2XGNA 3M0EA 3WHKA 2QP9X 4MGIE 4PDIA 4X66M 4LFAM 2DXIA 4L78A 2QCUA 1IBMM 4RNAA 3VDPA 4R7GA 1TGUA 2H1RA 3KS8A 3D8LA 4LF4M 4LFBM 4L4UA 4WW0A 1SXJC 4QNRA 4LF8M 2UXCM 1G8PA 2F4VM 1HR0M 3CF0A 3GP1A 2K47A 2C9OA 4G4OA 3AKZA 4GHAA 2Y21A 4LY6A 3SYLA 5DNYA 1QVRA 4IBCA 5EP1A 2Y20A 7CATA 1WXQA 3E9SA 3KP0E 2YR0A 3T1YM 4QHTA 1N32M 1L1TA 2V1CA 4NRWA 3KVWA 2DWLA 4GITA 4AZFA 3GQ5A 5FLXS 3SC3A 3U61B 1DO0A 1G59A 3GPUA 4B7GA 2G8LA 1Z5CA 5EP4A 3U6CA 4KLNA 2Z7JA 4JI4M 4D82A 4IBDA 4DV4M 3KXEC 3FUTA 5JI2E 2LNHC 3AOEC 4LZZA 2D7EA 5ITXE 1R2ZA 2KEBA 2UUCM 4B7FA 2HCBA 3J2PB 4BB9A 3GLFA 3SASA 2BJWA 3R8FA 1L1ZA 1GLNA 1NHGC 5IREB 3RE8A 4MGZE 3U5ZB 4LF7M 3TWMA 4OX9M 1MX0A 1J09A 2LWXA 2CV0A 1HT1E 4FCTA 4TUWA 1K3XA 4IIWA 4I81A 3T1HM 1NY5A 5EP3A 1C1KA 4FW9A 4GC9A 4OVZA 3DA1A 3RFWA 3A46A 3M7GA 3I51A 3KOXE 3VLFB 3LQRA 4PT5A 5ITXA 1N78A 3IG5A 4M9XA 4NOOB 2XFSA 5E26A 1Q3BA 1N36M 4JI2M 1DGHA 1D2NA 1R2YA 1PJIA 2OQ4A 4G4QA 4IBEA 3J27B 2XZFA 3GQ3A 4K0KM 3K2LA 4LJ9A 5ITTA 2I7NA 1E94E 3HJ8A 2KZSA 3HGIA 4NL4H 4JV5M 3U6EA 2CV1A 2ZAOA 4IBGA 5FTJA 3W0FA 4NSRA 2CV2A 3DZDA 1HNXM 2DWNA 1E9SA 3VDUA 3RGSA 3M6AA 5E6JA 2QENA 2KRUA 3GLHB 3K1JA 1QQWA 1OFHA 4FVMA 5ITQA 3KOWE 4ITQA 3TQSA 3KS4A 1J5EM 2C96A 1DGGA 3C58A 3U6MA 3GQ4A 1JQJC 1QANA 4PCZA 3U6SA 3L26A 3SYKA 1IBLM 2LH0A 3E4RA 1XMOM 2C5RA 4X64M 1TDZA 4GRIA 1Z5AA 1X37A 4G4RA 4LJ7A 2UUAM 1T3TA 2L6OA 2X4AA 3KW6A 4BBAA 5KPRA 2Z4SA 3EIHA 4FCWA 4DR4M 1E32A 3HKPA 2EO2A 4M9ZA 2XLJA 2Y0TA 2R46A 4G4NA 4GHLA 3J7BA 2E5LM 5LMUM 4DUZM 5LMNM 3SAVA 1W5SA 3GRVA 1GKIA 2VQEM 4YHHM 3FTDA 2AHMA 3FUUA 4GC5A 5IT9S 4CGYB 3GPYA 3FKEA 5FTNA 1IY0A 4LF5M 1NNUC 2RKOA 1QAQA 1SXJD 2R4JA 4LJ6A 3GLHA 4MM3B 1DGBA 3AJIB 3GLFB 3HHZA 4M9SA 4IBKA 1IM2A 4LZJA 5ITRA 2UUBM 1HT2E 2LXEA 1GL7A 4B3MM 4R3DA 3PNVA 4FCVA 2QZ4A 3SHFA 1Z6TA 4B08A 1IXRC 4MGYE 4OVZB 3NBIA 3SAWA 4IJFA 5KQ8A 4PD2A 1LV7A 3IG8A 3FTEA 4Z6YA 3U6PA 5F3WA 2L7HA 4XBOA 1DGHB 1OJLA 4JXJA 3AL0C 1L2BA 3B9PA 4NRVA 1PM5A 5IZ7D 1YUBA 2DVWB 4AQYM 4DV2M 4B3TM 4DR7M 3GRUA 3HJSA 4LJ5A 2NQ8C 3DFZA 3KFUG 1N75A 1IN7A 2Z4RA 4OU7A 4MH0E 4IBIA 1TH2A 5DYIA 3CF2A 2XSZA 3I4VA 4ZPXA 1N34M 2VIIA 2XF3A 4DR5M 3K8ZA 2CUZA 3GLGB 1VDDA 3THGA 3U61A 4DV1M 2Y0QA 3HU2A 5FTKA 3U60A 2R45A 1IQPA 2EUCA 1UM8A 4MB7A 2KXEA 2FFJA 1FJGM 4GKKM 4II7A 3OTOM 2XZUA 1XNRM 1G4AE 5FSWA 1QAOA 2KRKA 3HHYA 4NXNM 2J7NA 2R62A 3U6DA 1QAMA 4MGKE 1HNZM 1GVNA 3KDSE 1ORYB 3J80S 1IN5A 3K92A 4CHTB 4JI5M 1HNWM 1TH3A 3KSXA 4DR3M 3VKHA 1PJJA 4AG5A 5ITYA 5EXPA 4G6ZA 1IY2A 5EJCA 3L29A 3TPZA 1XNQM 3WHLA 4M0DA 3JR5A 2BJVA 3KP1E 4DV0M 4JI3M 3VK7A 3U6OA 2DWZB 1NJFA 3SMSA 4I5SA 4GIPA 4RF1A 1NHWC 5EQTA 3GRYA 3FD9A 2C99A 3LMMA 2DHRA 5KPZA 4NSOB 5H37D 2ZBKB 2V1UA 1XWIA 3GLGA 1TDHA 2DWMA 4B7HA 1G41A 3PFIA 3VK8A 4FWHA 4HLQA 3GPXA 1Q3CA 5C1BA 3FYCA 1N77A 5FTMA 1ZQ9A 4DV6M 4AG6A 4EIWA 2UU9M 1I94M 3U6QA 4AKIA 1KSFX 1QYRA 1N33M 3QWLA 1OFIA 3HU1A 3I4YA 4FD2A 3TL4X 2ZM6M 2EA0A 2JA2A 2BNKA 4DR1M 4GKJM 3VKGA 3FUXA 3UGJA 3SBJA 1JR3D 2L09A 4X65M 2F5PA 1Z59A 2XH9A 3GLIB 1I4WA 4QOSA 1ZAEA 4QHSA 2FOIC 1R7RA 3LVWA 4LF6M 4PDGA 1XXHA 4RF0A 3RGPA 1FNNA 3PVSA 3UJNA 2RGHA 4IJEA 3PXGA 8CATA 4NXMM 2J7OA 4I8OA 3U60B 3J7AS 3L25A 2X49A 3A45A 3SATA 2C9CA 3KOZE 2C98A 3SHGB 2P5TA 1KFVA 4GMQA 1GL6A 3T15A 4B3RM 5C18A 2D7HA 2FE8A 3GO8A 4JI8M 2M5ZA 2DZNB 2ERCA 1YSYA 1Z5BA 3H4MA 5DYGA 4S12A 1IY1A 3BOSA 1NVMA 4I4LA 3LVVA 2M60A 4FWDA 3JAMS 1R6BX 1SXJA 4A3VB 3FUVA 4M0WA 4DR2M 3A98B 2Z3XA 4KODA 2F5OA 2F5QA 4WURA 4LF9M 2G5GX 1MU5A 4IBJA 1K3WA 4QNMA 4X62M 4QOZC 4AW4A 3KSJA 1DGFA 2YQZA 4B3SM 4AI6A 3FTCA 5KPTA 3GLIA 4DV7M 2XSZD 2QPAA 1HQYE 2HL7A 2KZUA 2KW0A 2RGOA 3L2AA 2I7PA 2F5NA 2QBYA 4LCBA 2ZAMA 3FUWA 1IXZA 5EXXA 4LRSA 1L2DA 3UZUA 3DOAA 2V6ZM 1Q39A 3HU3A 4JI1M 4IBFA 3FYDA 2CE7A 4JN6A 4JI7M 3EIEA 4XGIA 5GKNA 3SMPA 1NSFA 3SAUA 1IXSB 1EE8A 3AOEA 1XMQM 4IBBA 3AFHA 4LG2A 4LJAA 5ITUA 1DO2A 1G3IA 4MGHA 2ZANA 5EXTA 2CHVA 3HJQA 4YY3M 3ZH9B 4LJ8A 4P16A 4GH9A 3TWLA 2A5YB 2X8AA 5BR8M 3A42A 5KO3A 2R65A 3U6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPU A;  1XC8 A;  1I94 M;  2UU9 M;  3U6Q A;  4JI6 M;  3GPP A;  5ITR A;  4DV3 M;  2UUB M;  1Z5C A;  1N33 M;  3J81 S;  3U6C A;  1L2C A;  2ZM6 M;  2VQF M;  2EA0 A;  4DR1 M;  4B3M M;  4JI4 M;  4GKJ M;  4DV4 M;  3SBJ A;  2Q2E B;  5ITX E;  3SAW A;  1R2Z A;  2UUC M;  4PD2 A;  4X65 M;  2F5P A;  4KHP M;  1Z59 A;  4DR6 M;  3JR4 A;  3U6P A;  2F5S A;  3SAS A;  1L2B A;  4NRV A;  1L1Z A;  1PM5 A;  4LF6 M;  4LF7 M;  4PDG A;  4CIS A;  3TWM A;  4OX9 M;  1MX0 A;  2UXB M;  4AQY M;  2UXD M;  4DV2 M;  4JYA M;  4B3T M;  1K3X A;  4NXM M;  4DR7 M;  3TWK A;  3T1H M;  3J7A S;  4LFC M;  3A46 A;  3A45 A;  3SAT A;  4JI0 M;  5ITX A;  1KFV A;  4B3R M;  1NNJ A;  1N36 M;  1Q3B A;  4JI2 M;  3GO8 A;  1R2Y A;  1PJI A;  2OQ4 A;  4JI8 M;  4G4Q A;  2XZF A;  1Z5B A;  3GQ3 A;  4K0K M;  1N34 M;  5ITT A;  4DR5 M;  4DV1 M;  3U6E A;  4JV5 M;  3SAR A;  5A2Q S;  1K82 A;  3W0F A;  3JAM S;  1HNX M;  4DR2 M;  2F5O A;  4MB7 A;  2F5Q A;  5IWA M;  4DUY M;  1FJG M;  1IBK M;  4LF9 M;  4GKK M;  5ITQ A;  1MU5 A;  3OTO M;  2XZU A;  2HHH M;  4ITQ A;  1K3W A;  1XNR M;  4X62 M;  2HKJ A;  4DV5 M;  1J5E M;  4B3S M;  2OPF A;  4DV7 M;  4NXN M;  3U6D A;  3C58 A;  3U6M A;  1HNZ M;  4PDI A;  3GQ4 A;  4X66 M;  3J80 S;  4LFA M;  2F5N A;  1HNW M;  4JI5 M;  4PCZ A;  4DR3 M;  3U6S A;  1IBL M;  1IBM M;  1PJJ A;  5ITY A;  1XMO M;  4X64 M;  1TDZ A;  1L2D A;  4LF4 M;  4LFB M;  1Z5A A;  3DOA A;  4G4R A;  1Q39 A;  2UUA M;  4JI1 M;  4LF8 M;  1XNQ M;  2UXC M;  2F4V M;  4JI7 M;  3JR5 A;  4DR4 M;  1HR0 M;  3GP1 A;  4JI3 M;  4DV0 M;  3VK7 A;  3U6O A;  4G4N A;  4G4O A;  3SAU A;  2E5L M;  5LMU M;  1EE8 A;  4DUZ M;  1XMQ M;  5LMN M;  3SAV A;  2ZBK B;  2VQE M;  5ITU A;  4YHH M;  1TDH A;  3T1Y M;  1N32 M;  4YY3 M;  1L1T A;  3VK8 A;  5IT9 S;  3GPX A;  4NRW A;  1Q3C A;  3TWL A;  3GQ5 A;  3GPY A;  5FLX S;  4DV6 M;  4LF5 M;  5BR8 M;  3A42 A;  3U6L A; 
#chains in the Genus database with same CATH topology
 1XC8 A;  3ZQJ A;  4JI6 M;  3GPP A;  1XXH B;  4KO8 A;  3B7Q A;  4DV3 M;  3F92 A;  3J81 S;  1L2C A;  2VQF M;  1IN4 A;  2DAE A;  1W5T A;  1TH4 A;  3GRR A;  4L8R C;  5EXS A;  3CF6 E;  1PJS A;  2Q2E B;  2DZO B;  2KA6 B;  1IN8 A;  3ZCB B;  4LGY A;  4KHP M;  1J7K A;  4DR6 M;  2CEA A;  2XEP A;  3JR4 A;  4LRT A;  5JI3 E;  3W0L B;  4OW0 A;  1IN6 A;  2F5S A;  3D8B A;  2FNA A;  3R9X B;  5KQD A;  4CIS A;  3LQQ A;  1KYI A;  4L16 A;  2UXB M;  3HHW A;  3SFZ A;  2K0B X;  2UXD M;  4JYA M;  1XXH E;  1XHB A;  2K6B A;  3TWK A;  3AOG A;  3FTF A;  3KOY E;  5EP2 A;  2DNA A;  2MGW A;  1NO1 A;  3FRH A;  4LFC M;  2CHQ A;  2DAG A;  1L8Q A;  3HWS A;  1SXJ B;  1VQ1 A;  4JI0 M;  1H6U A;  3VFD A;  1E9R A;  2R18 A;  3TE6 A;  3K9P A;  3UK6 A;  3L27 A;  3MJ5 A;  4D81 A;  3E46 A;  3PNY A;  1NNJ A;  1YE9 A;  3UMM A;  2FS1 A;  1NY6 A;  3AV0 A;  2O5R A;  1S3S A;  2O01 F;  3U5Z A;  2W82 A;  1JR3 E;  2XFT A;  2OO9 A;  3L28 A;  4BLC A;  2CP8 A;  3T38 A;  2R4E A;  2YFQ A;  3ILK A;  4REZ A;  3SAR A;  1Q02 A;  4AKH A;  2YNM D;  4L15 A;  2QBY B;  5A2Q S;  1K82 A;  1QZM A;  2D7G A;  2OOA A;  5FTL A;  4W5W A;  2CFO A;  3HHX A;  1SXJ E;  4HL4 A;  3NWL A;  4LJ4 A;  1NJG A;  3ZC7 B;  4D80 A;  4FWG A;  5IWA M;  4DUY M;  1IBK M;  2HHH M;  1VDL A;  4DV5 M;  2HKJ A;  4LGM A;  3MK6 A;  3Q8X A;  2CHG A;  3MHV C;  2GNO A;  3CTW B;  4AKG A;  2OPF A;  1HQC A;  4Z8X A;  3Q8G A;  3QAU A;  5BPV A;  2L7I A;  1JR3 A;  2XGN A;  2ZTC A;  3HZJ A;  3M0E A;  3WHK A;  2APL A;  2QP9 X;  4MGI E;  4PDI A;  4X66 M;  4LFA M;  2DXI A;  1EFU B;  4L78 A;  1QUT A;  2QCU A;  2QHO B;  4RNA A;  3VDP A;  4R7G A;  2H5X A;  2QQ8 A;  1IBM M;  4KT0 F;  1TGU A;  1OQY A;  2H1R A;  3KS8 A;  4NC6 A;  3D8L A;  4LF4 M;  1VEJ A;  4LFB M;  4L4U A;  4WW0 A;  1SXJ C;  4QNR A;  2OOB A;  4LF8 M;  2UXC M;  1G8P A;  2F4V M;  1HR0 M;  3CF0 A;  3GP1 A;  2K47 A;  2C9O A;  3B7Z A;  1TR8 A;  4G4O A;  3AKZ A;  4GHA A;  2Y21 A;  1NV9 A;  4LY6 A;  2RRU A;  3QYB A;  3SYL A;  5DNY A;  1QVR A;  4IBC A;  5EP1 A;  1AUA A;  2Y20 A;  3LCV B;  7CAT A;  1WXQ A;  3E9S A;  1D0K A;  2DAI A;  3KP0 E;  2YR0 A;  3T1Y M;  4QHT A;  2QSF X;  1N32 M;  1L1T A;  2V1C A;  4NRW A;  3KVW A;  2DWL A;  4GIT A;  4AZF A;  3GQ5 A;  1EIJ A;  5FLX S;  3SC3 A;  1NV8 A;  2WZJ A;  2DHY A;  1DO0 A;  3IHP A;  3U61 B;  3W68 A;  1G59 A;  3GPU A;  4B7G A;  2G8L A;  1Z5C A;  3C9P A;  5EP4 A;  3U6C A;  2O25 A;  4KLN A;  2DAK A;  2Z7J A;  4JI4 M;  3I04 M;  4D82 A;  4IBD A;  4DV4 M;  1ZV1 A;  3KXE C;  2DEN A;  3FUT A;  5JI2 E;  2LNH C;  3AOE C;  4LZZ A;  2D7E A;  5ITX E;  1R2Z A;  2KEB A;  2UUC M;  4B7F A;  1TF0 B;  2HCB A;  2JY5 A;  1OAI A;  2JY6 B;  3J2P B;  4BB9 A;  3GLF A;  1R5L A;  3SAS A;  2BJW A;  3R8F A;  1L1Z A;  1GLN A;  1NHG C;  1OAO C;  5IRE B;  4MGZ E;  4P17 A;  3RE8 A;  3U5Z B;  4LF7 M;  3TWM A;  4OX9 M;  1MX0 A;  1J09 A;  2LWX A;  2CV0 A;  2MH8 A;  1HT1 E;  4FCT A;  4TUW A;  1K3X A;  1OIZ A;  4IIW A;  4I81 A;  2VF8 A;  3T1H M;  1NY5 A;  5EP3 A;  1C1K A;  4FW9 A;  4GC9 A;  4OVZ A;  3DA1 A;  3RFW A;  3A46 A;  3M7G A;  3I51 A;  3KOX E;  3VLF B;  3LQR A;  4PT5 A;  5ITX A;  1N78 A;  3IG5 A;  2L4E A;  4WP2 A;  4M9X A;  4NOO B;  2XFS A;  1QZE A;  1Q3B A;  1WJ7 A;  5E26 A;  1DGH A;  1N36 M;  1D2N A;  1R2Y A;  1PJI A;  2OQ4 A;  1WIV A;  4G4Q A;  3QYE A;  3J27 B;  4IBE A;  2XZF A;  3GQ3 A;  4K0K M;  3K2L A;  4LJ9 A;  5ITT A;  1OTR A;  1E94 E;  2I7N A;  2KZS A;  3HGI A;  3HJ8 A;  4NL4 H;  3U6E A;  1P3Q Q;  4JV5 M;  1VEG A;  2CV1 A;  2ZAO A;  4IBG A;  5FTJ A;  3W0F A;  2R6F A;  4NSR A;  2CV2 A;  3DZD A;  1HNX M;  2DWN A;  1E9S A;  2JZ1 A;  2K9D A;  3RGS A;  3VDU A;  3M6A A;  5E6J A;  2QEN A;  2KRU A;  3GLH B;  3K1J A;  1QDR A;  1QQW A;  1OFH A;  4FVM A;  5ITQ A;  1CUK A;  3KOW E;  3TQS A;  3KS4 A;  1C7Y A;  4ITQ A;  1J5E M;  2MR9 A;  1T6O A;  2C96 A;  1MJG M;  2N35 A;  1WHC A;  3CGW A;  1DGG A;  1WGL A;  3C58 A;  1DV0 A;  3U6M A;  2WSC F;  2HAK A;  1GJT A;  3GQ4 A;  1GAB A;  1JQJ C;  1QAN A;  4PCZ A;  4XK8 F;  3U6S A;  3L26 A;  3SYK A;  1IBL M;  2LH0 A;  3E4R A;  1XMO M;  2C5R A;  4X64 M;  1TDZ A;  1V33 A;  4GRI A;  1Z5A A;  1X37 A;  4G4R A;  4LJ7 A;  2UUA M;  1T3T A;  2L6O A;  2X4A A;  3K9O A;  3GLH E;  3LCU A;  3KW6 A;  4BBA A;  5KPR A;  2Z4S A;  3EIH A;  4FCW A;  4DR4 M;  1E32 A;  3HKP A;  1PRB A;  2EO2 A;  4M9Z A;  3I01 M;  2KDL A;  2XLJ A;  2Y0T A;  2R46 A;  4G4N A;  4GHL A;  3FE3 A;  3J7B A;  2E5L M;  5LMU M;  3W67 A;  2DKL A;  4DUZ M;  2GQF A;  2L4F A;  5LMN M;  3SAV A;  1W5S A;  3GRV A;  1GKI A;  2VQE M;  2MRO B;  4YHH M;  3B89 A;  3FTD A;  1WR1 B;  1VEK A;  2AHM A;  3FUU A;  4GC5 A;  5IT9 S;  4CGY B;  3GPY A;  3FKE A;  5FTN A;  1IY0 A;  4LF5 M;  1NNU C;  1QAQ A;  2R4J A;  1SXJ D;  2RKO A;  3E21 A;  3GLH A;  3IEC A;  2HWJ A;  1DGB A;  3AJI B;  4LJ6 A;  3GLF B;  4M9S A;  4IBK A;  1IM2 A;  4LZJ A;  5ITR A;  2LVN C;  3HHZ A;  2UUB M;  1HT2 E;  2LXE A;  2LHC A;  1GL7 A;  4B3M M;  1D0M A;  4R3D A;  3PNV A;  4FCV A;  2QZ4 A;  2EJS A;  3SHF A;  1Z6T A;  4B08 A;  1IXR C;  4DBG B;  2WSF F;  4MGY E;  4OVZ B;  3NBI A;  3SAW A;  4IJF A;  5KQ8 A;  4PD2 A;  1UFZ A;  5DFL A;  1LV7 A;  1MN3 A;  3IG8 A;  3FTE A;  2DI0 A;  4Z6Y A;  3U6P A;  2JUJ A;  5F3W A;  2L7H A;  4XBO A;  1DGH B;  1OJL A;  4JXJ A;  3AL0 C;  1L2B A;  1GJS A;  2CRU A;  3B9P A;  4NRV A;  1PM5 A;  1A5T A;  5IZ7 D;  1YUB A;  3GLF E;  2DVW B;  4AQY M;  3C3E A;  4HEO A;  4DV2 M;  4JI2 M;  4B3T M;  4DR7 M;  3GRU A;  4Q7J A;  3HJS A;  4LJ5 A;  2QNJ A;  1QUS A;  2NQ8 C;  1AIP C;  3BBZ A;  3DFZ A;  1ZMU A;  3KFU G;  1N75 A;  2JWS A;  3B7N A;  1IN7 A;  2Z4R A;  4OU7 A;  4MH0 E;  3BXW A;  4IBI A;  1TH2 A;  5DYI A;  3CF2 A;  2XSZ A;  3I4V A;  4ZPX A;  1N34 M;  1WGN A;  2JY8 A;  2VII A;  2XF3 A;  4DR5 M;  3K8Z A;  2CUZ A;  3GLG B;  1VDD A;  3THG A;  3U61 A;  4DV1 M;  1PJQ A;  2Y0Q A;  3HU2 A;  5FTK A;  3U60 A;  2R45 A;  1IQP A;  2EUC A;  4F2L A;  1UM8 A;  4MB7 A;  2KXE A;  1V92 A;  2FFJ A;  1FJG M;  4GKK M;  4II7 A;  3OTO M;  2XZU A;  1XNR M;  2KNA A;  1G4A E;  5FSW A;  1QAO A;  2KRK A;  3HHY A;  4NXN M;  2J7N A;  2R62 A;  3U6D A;  1QAM A;  1VG5 A;  2EKF A;  4MGK E;  1XB2 B;  1HNZ M;  2B3T A;  1GVN A;  3A42 A;  3KDS E;  3NBX X;  3J80 S;  1IN5 A;  3K92 A;  2G3Q A;  4CHT B;  3GLG E;  4JI5 M;  1TH3 A;  3KSX A;  4DR3 M;  1HNW M;  3VKH A;  1PJJ A;  4AG5 A;  2Z8Y M;  1T43 A;  2CWB A;  5EXP A;  4G6Z A;  5ITY A;  1IY2 A;  2KHH A;  5EJC A;  3HX3 A;  3L29 A;  3TPZ A;  4L6V 6;  2LVO C;  1XNQ M;  3V76 A;  4Y28 F;  2JNH A;  3WHL A;  2JZ0 A;  4M0D A;  3JR5 A;  2BJV A;  3KP1 E;  4DV0 M;  4JI3 M;  3VK7 A;  3U6O A;  2DWZ B;  1NJF A;  3SMS A;  4I5S A;  4GIP A;  4RF1 A;  1NHW C;  3LW5 F;  5EQT A;  3GRY A;  3FD9 A;  2C99 A;  3LMM A;  2DHR A;  2EKK A;  4CIZ A;  4NSO B;  5KPZ A;  5H37 D;  2ZBK B;  3HY5 A;  2V1U A;  1XWI A;  3GLG A;  1TDH A;  2DWM A;  4B7H A;  1D0L A;  1G41 A;  3PFI A;  3VK8 A;  4FWH A;  4HLQ A;  3GPX A;  1Q3C A;  1PGY A;  5C1B A;  3FYC A;  1N77 A;  5FTM A;  1ZQ9 A;  4DV6 M;  4AG6 A;  4EIW A;  2UU9 M;  1I94 M;  3U6Q A;  4AKI A;  2VF7 A;  1KSF X;  1V34 A;  1QYR A;  1N33 M;  3QWL A;  1IXS A;  1OFI A;  2LVQ D;  3HU1 A;  3I4Y A;  4FD2 A;  3TL4 X;  2ZM6 M;  2JA2 A;  2BNK A;  2EA0 A;  4DR1 M;  2R44 A;  4GKJ M;  1ZMW A;  3VKG A;  3FUX A;  3UGJ A;  3SBJ A;  1GO5 A;  1JR3 D;  2L09 A;  4X65 M;  2F5P A;  1Z59 A;  2XH9 A;  3GLI B;  1I4W A;  4QOS A;  3B74 A;  1OKS A;  1ZAE A;  4QHS A;  2FOI C;  1QDT A;  1R7R A;  2VDB B;  3LVW A;  4LF6 M;  4PDG A;  1XXH A;  4RF0 A;  1YLA A;  1BVS A;  3RGP A;  2J5Y A;  1FNN A;  3PVS A;  3UJN A;  2RGH A;  2R0I A;  4IJE A;  3PXG A;  8CAT A;  4NXM M;  2J7O A;  4I8O A;  3U60 B;  3J7A S;  3L25 A;  1OIP A;  2X49 A;  4R71 A;  2JP7 A;  3A45 A;  3SAT A;  2C9C A;  4GEW A;  3KOZ E;  2LTU A;  2C98 A;  1PJT A;  3SHG B;  2P5T A;  1KFV A;  4GMQ A;  1GL6 A;  3T15 A;  4B3R M;  5C18 A;  2D7H A;  2FE8 A;  3GO8 A;  4JI8 M;  2BWB A;  3GLI E;  2BWE A;  2M5Z A;  2DZN B;  2KNV A;  2LVA A;  2ERC A;  1YSY A;  1R4G A;  1Z5B A;  3H4M A;  5DYG A;  1SG9 A;  1F4I A;  1G71 A;  4S12 A;  1JB0 F;  1IY1 A;  4MM3 B;  2JXN A;  3BOS A;  1NVM A;  2MJ5 B;  2ZTD A;  4I4L A;  3LVV A;  2M60 A;  4FWD A;  3JAM S;  1R6B X;  1SXJ A;  1ZMV A;  3MMP A;  4A3V B;  3FUV A;  4M0W A;  4DR2 M;  2JY7 A;  2LVP C;  3A98 B;  2Z3X A;  1Y8G A;  4KOD A;  2F5O A;  2F5Q A;  4WUR A;  4LF9 M;  2G5G X;  1MU5 A;  4IBJ A;  1K3W A;  4QNM A;  4CJ6 A;  4X62 M;  4QOZ C;  1LTM A;  4AW4 A;  3KSJ A;  1DGF A;  2YQZ A;  4B3S M;  4AI6 A;  3FTC A;  5KPT A;  3GLI A;  4DV7 M;  2XSZ D;  2QPA A;  1HQY E;  2HL7 A;  2KZU A;  2KW0 A;  3FRI A;  2LBC A;  2RGO A;  2L2D A;  2I7P A;  3L2A A;  2F5N A;  2QBY A;  4LCB A;  2KNZ A;  2ZAM A;  3FUW A;  1IXZ A;  5EXX A;  1TTE A;  4LRS A;  2LHG A;  1L2D A;  4G3O A;  3C3D A;  3UZU A;  3DOA A;  2V6Z M;  1Q39 A;  3HU3 A;  4JI1 M;  4IBF A;  3FYD A;  2CE7 A;  4JN6 A;  4RKU F;  4JI7 M;  3EIE A;  4XGI A;  1HJP A;  5GKN A;  5L8R F;  3SMP A;  1NSF A;  3SAU A;  3T6P A;  1IXS B;  1EE8 A;  2FH0 A;  3AOE A;  1RU3 A;  1XMQ M;  4IBB A;  3AFH A;  4ANR A;  4LG2 A;  4LJA A;  5ITU A;  1DO2 A;  1G3I A;  4MGH A;  2ZAN A;  2DZL A;  5EXT A;  2WSE F;  2CHV A;  3HJQ A;  3H4J A;  2DAM A;  4YY3 M;  3ZH9 B;  1IFY A;  4LJ8 A;  4P16 A;  4UN2 B;  4GH9 A;  3TWL A;  2A5Y B;  2X8A A;  5BR8 M;  1ORY B;  5KO3 A;  4F1I A;  2R65 A;  3U6L A; 
#chains in the Genus database with same CATH homology
 1XC8 A;  4JI6 M;  3GPP A;  1XXH B;  4KO8 A;  4DV3 M;  3J81 S;  1L2C A;  2VQF M;  1IN4 A;  1W5T A;  1TH4 A;  3GRR A;  4L8R C;  5EXS A;  3CF6 E;  2Q2E B;  2DZO B;  2KA6 B;  1IN8 A;  3ZCB B;  4LGY A;  4KHP M;  1J7K A;  4DR6 M;  2CEA A;  2XEP A;  3JR4 A;  4LRT A;  5JI3 E;  3W0L B;  4OW0 A;  1IN6 A;  2F5S A;  3D8B A;  2FNA A;  3R9X B;  5KQD A;  4CIS A;  3LQQ A;  1KYI A;  4L16 A;  2UXB M;  3HHW A;  3SFZ A;  2UXD M;  4JYA M;  1XHB A;  3TWK A;  3AOG A;  3FTF A;  3KOY E;  5EP2 A;  4LFC M;  2CHQ A;  1L8Q A;  3HWS A;  1SXJ B;  4JI0 M;  1H6U A;  3VFD A;  1E9R A;  2R18 A;  3TE6 A;  3UK6 A;  3L27 A;  3MJ5 A;  4D81 A;  3PNY A;  1NNJ A;  1YE9 A;  3UMM A;  3AV0 A;  1NY6 A;  2O5R A;  1S3S A;  3U5Z A;  2W82 A;  2XFT A;  3L28 A;  4BLC A;  3T38 A;  2R4E A;  2YFQ A;  3ILK A;  4REZ A;  3SAR A;  4AKH A;  2YNM D;  4L15 A;  2QBY B;  5A2Q S;  1K82 A;  1QZM A;  2D7G A;  5FTL A;  4W5W A;  2CFO A;  3HHX A;  1SXJ E;  4HL4 A;  3NWL A;  4LJ4 A;  1NJG A;  3ZC7 B;  4D80 A;  4FWG A;  5IWA M;  4DUY M;  1IBK M;  2HHH M;  4DV5 M;  2HKJ A;  4LGM A;  3MK6 A;  3Q8X A;  2CHG A;  3MHV C;  3CTW B;  4AKG A;  2OPF A;  1HQC A;  4Z8X A;  3QAU A;  5BPV A;  2L7I A;  1JR3 A;  2XGN A;  3M0E A;  3WHK A;  2QP9 X;  4MGI E;  4PDI A;  4X66 M;  4LFA M;  2DXI A;  4L78 A;  2QCU A;  1IBM M;  4RNA A;  3VDP A;  4R7G A;  1TGU A;  2H1R A;  3KS8 A;  3D8L A;  4LF4 M;  4LFB M;  4L4U A;  4WW0 A;  1SXJ C;  4QNR A;  4LF8 M;  2UXC M;  1G8P A;  2F4V M;  1HR0 M;  3CF0 A;  3GP1 A;  2K47 A;  2C9O A;  4G4O A;  3AKZ A;  4GHA A;  2Y21 A;  4LY6 A;  3SYL A;  5DNY A;  1QVR A;  4IBC A;  5EP1 A;  2Y20 A;  7CAT A;  1WXQ A;  3E9S A;  3KP0 E;  2YR0 A;  3T1Y M;  4QHT A;  1N32 M;  1L1T A;  2V1C A;  4NRW A;  3KVW A;  2DWL A;  4GIT A;  4AZF A;  3GQ5 A;  5FLX S;  3SC3 A;  3U61 B;  1DO0 A;  1G59 A;  3GPU A;  4B7G A;  2G8L A;  1Z5C A;  5EP4 A;  3U6C A;  4KLN A;  2Z7J A;  4JI4 M;  4D82 A;  4IBD A;  4DV4 M;  3KXE C;  3FUT A;  5JI2 E;  2LNH C;  3AOE C;  4LZZ A;  2D7E A;  5ITX E;  1R2Z A;  2KEB A;  2UUC M;  4B7F A;  2HCB A;  3J2P B;  4BB9 A;  3GLF A;  3SAS A;  2BJW A;  3R8F A;  1L1Z A;  1GLN A;  1NHG C;  5IRE B;  3RE8 A;  4MGZ E;  3U5Z B;  4LF7 M;  3TWM A;  4OX9 M;  1MX0 A;  1J09 A;  2LWX A;  2CV0 A;  1HT1 E;  4FCT A;  4TUW A;  1K3X A;  4IIW A;  4I81 A;  3T1H M;  1NY5 A;  5EP3 A;  1C1K A;  4FW9 A;  4GC9 A;  4OVZ A;  3DA1 A;  3RFW A;  3A46 A;  3M7G A;  3I51 A;  3KOX E;  3VLF B;  3LQR A;  4PT5 A;  5ITX A;  1N78 A;  3IG5 A;  4M9X A;  4NOO B;  2XFS A;  5E26 A;  1Q3B A;  1N36 M;  4JI2 M;  1DGH A;  1D2N A;  1R2Y A;  1PJI A;  2OQ4 A;  4G4Q A;  4IBE A;  3J27 B;  2XZF A;  3GQ3 A;  4K0K M;  3K2L A;  4LJ9 A;  5ITT A;  2I7N A;  1E94 E;  3HJ8 A;  2KZS A;  3HGI A;  4NL4 H;  4JV5 M;  3U6E A;  2CV1 A;  2ZAO A;  4IBG A;  5FTJ A;  3W0F A;  4NSR A;  2CV2 A;  3DZD A;  1HNX M;  2DWN A;  1E9S A;  3VDU A;  3RGS A;  3M6A A;  5E6J A;  2QEN A;  2KRU A;  3GLH B;  3K1J A;  1QQW A;  1OFH A;  4FVM A;  5ITQ A;  3KOW E;  4ITQ A;  3TQS A;  3KS4 A;  1J5E M;  2C96 A;  1DGG A;  3C58 A;  3U6M A;  3GQ4 A;  1JQJ C;  1QAN A;  4PCZ A;  3U6S A;  3L26 A;  3SYK A;  1IBL M;  2LH0 A;  3E4R A;  1XMO M;  2C5R A;  4X64 M;  1TDZ A;  4GRI A;  1Z5A A;  1X37 A;  4G4R A;  4LJ7 A;  2UUA M;  1T3T A;  2L6O A;  2X4A A;  3KW6 A;  4BBA A;  5KPR A;  2Z4S A;  3EIH A;  4FCW A;  4DR4 M;  1E32 A;  3HKP A;  2EO2 A;  4M9Z A;  2XLJ A;  2Y0T A;  2R46 A;  4G4N A;  4GHL A;  3J7B A;  2E5L M;  5LMU M;  4DUZ M;  5LMN M;  3SAV A;  1W5S A;  3GRV A;  1GKI A;  2VQE M;  4YHH M;  3FTD A;  2AHM A;  3FUU A;  4GC5 A;  5IT9 S;  4CGY B;  3GPY A;  3FKE A;  5FTN A;  1IY0 A;  4LF5 M;  1NNU C;  2RKO A;  1QAQ A;  1SXJ D;  2R4J A;  4LJ6 A;  3GLH A;  4MM3 B;  1DGB A;  3AJI B;  3GLF B;  3HHZ A;  4M9S A;  4IBK A;  1IM2 A;  4LZJ A;  5ITR A;  2UUB M;  1HT2 E;  2LXE A;  1GL7 A;  4B3M M;  4R3D A;  3PNV A;  4FCV A;  2QZ4 A;  3SHF A;  1Z6T A;  4B08 A;  1IXR C;  4MGY E;  4OVZ B;  3NBI A;  3SAW A;  4IJF A;  5KQ8 A;  4PD2 A;  1LV7 A;  3IG8 A;  3FTE A;  4Z6Y A;  3U6P A;  5F3W A;  2L7H A;  4XBO A;  1DGH B;  1OJL A;  4JXJ A;  3AL0 C;  1L2B A;  3B9P A;  4NRV A;  1PM5 A;  5IZ7 D;  1YUB A;  2DVW B;  4AQY M;  4DV2 M;  4B3T M;  4DR7 M;  3GRU A;  3HJS A;  4LJ5 A;  2NQ8 C;  3DFZ A;  3KFU G;  1N75 A;  1IN7 A;  2Z4R A;  4OU7 A;  4MH0 E;  4IBI A;  1TH2 A;  5DYI A;  3CF2 A;  2XSZ A;  3I4V A;  4ZPX A;  1N34 M;  2VII A;  2XF3 A;  4DR5 M;  3K8Z A;  2CUZ A;  3GLG B;  1VDD A;  3THG A;  3U61 A;  4DV1 M;  2Y0Q A;  3HU2 A;  5FTK A;  3U60 A;  2R45 A;  1IQP A;  2EUC A;  1UM8 A;  4MB7 A;  2KXE A;  2FFJ A;  1FJG M;  4GKK M;  4II7 A;  3OTO M;  2XZU A;  1XNR M;  1G4A E;  5FSW A;  1QAO A;  2KRK A;  3HHY A;  4NXN M;  2J7N A;  2R62 A;  3U6D A;  1QAM A;  4MGK E;  1HNZ M;  1GVN A;  3KDS E;  1ORY B;  3J80 S;  1IN5 A;  3K92 A;  4CHT B;  4JI5 M;  1HNW M;  1TH3 A;  3KSX A;  4DR3 M;  3VKH A;  1PJJ A;  4AG5 A;  5ITY A;  5EXP A;  4G6Z A;  1IY2 A;  5EJC A;  3L29 A;  3TPZ A;  1XNQ M;  3WHL A;  4M0D A;  3JR5 A;  2BJV A;  3KP1 E;  4DV0 M;  4JI3 M;  3VK7 A;  3U6O A;  2DWZ B;  1NJF A;  3SMS A;  4I5S A;  4GIP A;  4RF1 A;  1NHW C;  5EQT A;  3GRY A;  3FD9 A;  2C99 A;  3LMM A;  2DHR A;  5KPZ A;  4NSO B;  5H37 D;  2ZBK B;  2V1U A;  1XWI A;  3GLG A;  1TDH A;  2DWM A;  4B7H A;  1G41 A;  3PFI A;  3VK8 A;  4FWH A;  4HLQ A;  3GPX A;  1Q3C A;  5C1B A;  3FYC A;  1N77 A;  5FTM A;  1ZQ9 A;  4DV6 M;  4AG6 A;  4EIW A;  2UU9 M;  1I94 M;  3U6Q A;  4AKI A;  1KSF X;  1QYR A;  1N33 M;  3QWL A;  1OFI A;  3HU1 A;  3I4Y A;  4FD2 A;  3TL4 X;  2ZM6 M;  2EA0 A;  2JA2 A;  2BNK A;  4DR1 M;  4GKJ M;  3VKG A;  3FUX A;  3UGJ A;  3SBJ A;  1JR3 D;  2L09 A;  4X65 M;  2F5P A;  1Z59 A;  2XH9 A;  3GLI B;  1I4W A;  4QOS A;  1ZAE A;  4QHS A;  2FOI C;  1R7R A;  3LVW A;  4LF6 M;  4PDG A;  1XXH A;  4RF0 A;  3RGP A;  1FNN A;  3PVS A;  3UJN A;  2RGH A;  4IJE A;  3PXG A;  8CAT A;  4NXM M;  2J7O A;  4I8O A;  3U60 B;  3J7A S;  3L25 A;  2X49 A;  3A45 A;  3SAT A;  2C9C A;  3KOZ E;  2C98 A;  3SHG B;  2P5T A;  1KFV A;  4GMQ A;  1GL6 A;  3T15 A;  4B3R M;  5C18 A;  2D7H A;  2FE8 A;  3GO8 A;  4JI8 M;  2M5Z A;  2DZN B;  2ERC A;  1YSY A;  1Z5B A;  3H4M A;  5DYG A;  4S12 A;  1IY1 A;  3BOS A;  1NVM A;  4I4L A;  3LVV A;  2M60 A;  4FWD A;  3JAM S;  1R6B X;  1SXJ A;  4A3V B;  3FUV A;  4M0W A;  4DR2 M;  3A98 B;  2Z3X A;  4KOD A;  2F5O A;  2F5Q A;  4WUR A;  4LF9 M;  2G5G X;  1MU5 A;  4IBJ A;  1K3W A;  4QNM A;  4X62 M;  4QOZ C;  4AW4 A;  3KSJ A;  1DGF A;  2YQZ A;  4B3S M;  4AI6 A;  3FTC A;  5KPT A;  3GLI A;  4DV7 M;  2XSZ D;  2QPA A;  1HQY E;  2HL7 A;  2KZU A;  2KW0 A;  2RGO A;  3L2A A;  2I7P A;  2F5N A;  2QBY A;  4LCB A;  2ZAM A;  3FUW A;  1IXZ A;  5EXX A;  4LRS A;  1L2D A;  3UZU A;  3DOA A;  2V6Z M;  1Q39 A;  3HU3 A;  4JI1 M;  4IBF A;  3FYD A;  2CE7 A;  4JN6 A;  4JI7 M;  3EIE A;  4XGI A;  5GKN A;  3SMP A;  1NSF A;  3SAU A;  1IXS B;  1EE8 A;  3AOE A;  1XMQ M;  4IBB A;  3AFH A;  4LG2 A;  4LJA A;  5ITU A;  1DO2 A;  1G3I A;  4MGH A;  2ZAN A;  5EXT A;  2CHV A;  3HJQ A;  4YY3 M;  3ZH9 B;  4LJ8 A;  4P16 A;  4GH9 A;  3TWL A;  2A5Y B;  2X8A A;  5BR8 M;  3A42 A;  5KO3 A;  2R65 A;  3U6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...