2ZM6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 24
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2zm6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2zm6M02
3GPYA 4JI8M 4DR2M 3U6CA 4K0KM 4DV7M 3GO8A 5ITQA 3GQ3A 1N36M 4DV2M 4JI3M 1Q39A 1PJIA 1XNQM 3J7AS 2ZM6M 1Z59A 3J80S 1XMOM 4DR4M 4JI0M 4DV0M 4KHPM 1K3XA 3J81S 4JI5M 2Q2EB 1N34M 3U6LA 1Z5CA 4B3RM 5IWAM 4PDIA 3VK7A 1K82A 1KFVA 2F5NA 1PM5A 1J5EM 2EA0A 4DV4M 2UXCM 4LF5M 3U6EA 5ITTA 3SASA 4JI1M 1TDZA 2F5SA 4JI2M 3TWLA 4DR7M 5ITRA 2HKJA 4JV5M 3DOAA 2F4VM 3GQ4A 5IT9S 4LF4M 5BR8M 3SARA 1XMQM 1NNJA 4B3MM 3JR4A 1HNWM 5ITXA 1Q3CA 2E5LM 3C58A 1MX0A 4X64M 3SAUA 1HNXM 3SAVA 4B3TM 3SBJA 4YY3M 2XZFA 1I94M 4G4OA 2ZBKB 4JI4M 2F5PA 3U6MA 5ITYA 2UUCM 4ITQA 1K3WA 5A2QS 3U6QA 4DUZM 3T1YM 4GKKM 3A42A 3GPUA 3SATA 1XNRM 4GKJM 4JI6M 3U6PA 1MU5A 1PJJA 2OQ4A 3SAWA 1L1TA 4DV6M 4LF7M 4DV3M 5LMUM 1L2BA 4B3SM 2VQEM 2XZUA 4OX9M 1HNZM 1N33M 4DR6M 4MB7A 1L2CA 4DUYM 3A46A 2UU9M 4AQYM 4PD2A 3JR5A 1Z5AA 4PDGA 3GQ5A 1R2YA 4NRWA 4DV5M 3TWKA 4LF9M 2UXDM 3TWMA 4DR1M 4YHHM 1FJGM 3A45A 4X65M 3W0FA 4G4QA 2VQFM 1Q3BA 3GPXA 3JAMS 4PCZA 4X66M 4NRVA 2OPFA 5ITUA 3VK8A 4LF6M 4LFBM 1IBMM 4LFCM 4G4NA 5FLXS 3U6SA 1HR0M 4NXNM 4NXMM 3OTOM 1EE8A 2F5QA 3U6DA 3GPPA 5ITXE 4LFAM 4CISA 1TDHA 5LMNM 1XC8A 3GP1A 1R2ZA 4LF8M 4DR5M 3U6OA 1L2DA 2UUAM 4JI7M 2UXBM 4DR3M 4JYAM 4X62M 4G4RA 2UUBM 1Z5BA 1N32M 3T1HM 1IBKM 1IBLM 1L1ZA 2F5OA 4DV1M 2HHHM
chains in the Genus database with same CATH superfamily
4JI8M 5KO3A 4DR2M 2MGWA 3U6CA 3B7QA 2X8AA 2EUCA 3ZQJA 1N36M 4DV2M 4JI3M 1XNQM 4ZPXA 3J7AS 2ZM6M 2KHHA 5JI2E 1TF0B 4KODA 1G8PA 4L4UA 1L8QA 5FTLA 2LVPC 3J81S 3B7ZA 4I5SA 4MGKE 2KRUA 3VKGA 1X37A 4Y28F 1QZMA 3LW5F 4FVMA 3UGJA 4HL4A 2B3TA 4G6ZA 8CATA 3B74A 5IWAM 2OOBA 5IREB 2BJVA 1OAOC 1ZAEA 3GRRA 1J5EM 1C7YA 2EA0A 4DV4M 1T43A 2CUZA 1XXHE 1DV0A 4Q7JA 2M60A 3GRVA 1V33A 1DGHB 4L16A 3UMMA 2OO9A 3TWLA 1GJSA 4DR7M 2H1RA 1IN4A 1E9RA 2DNAA 2JWSA 4AKIA 3DOAA 3FTFA 4R7GA 2JZ0A 5BR8M 1XMQM 1NNJA 3FRHA 3GLGA 5ITXA 3IG5A 5EP1A 4X64M 1CUKA 2CFOA 3UJNA 1A5TA 2WSFF 4YY3M 2YNMD 1I94M 1R7RA 3D8LA 5C1BA 3K92A 4FCWA 1V92A 1EFUB 5EP4A 1G41A 2DZNB 2DWMA 1IN7A 4IBFA 3L25A 2R4JA 2QNJA 3HJSA 3QYBA 2J5YA 5EJCA 2JY5A 3T38A 1JR3A 1XWIA 4NC6A 2QBYA 1D2NA 3KFUG 1KYIA 4DV3M 3FE3A 1GABA 1NSFA 2VQEM 1TH2A 2J7OA 4NOOB 3TL4X 1GLNA 4MGIE 2L2DA 4LJ9A 1HNZM 3T15A 1HT1E 3LQRA 2CV0A 3PVSA 1NNUC 3AJIB 1LV7A 3E4RA 1IY2A 1IY0A 3C3DA 1NV8A 3SMSA 1FNNA 2L7IA 1Z5AA 4FWGA 3ZH9B 3V76A 1NO1A 5DYGA 4DV5M 4GEWA 1QDRA 1E94E 3GLGB 1WR1B 2R62A 5JI3E 4GHLA 4G4QA 2DAMA 3K9OA 3CF0A 5EXTA 1DO2A 4FWHA 2DWLA 4OU7A 4Z6YA 4X66M 4NRVA 1ZV1A 1IXSA 3KP0E 1R4GA 1GJTA 3HY5A 2R45A 4AZFA 1OQYA 4WP2A 1IN8A 1HR0M 4NXNM 1ZQ9A 4NXMM 2K47A 1IN6A 1GL7A 2YQZA 4IJFA 5EXSA 3R9XB 1W5SA 3LVVA 2FFJA 1QAMA 4LFAM 1N77A 2O01F 3CF6E 1XC8A 5KPTA 3F92A 3GP1A 1GO5A 4DR5M 2ZAOA 4DR3M 2L7HA 2KRKA 3U60B 2UUBM 3HHXA 5FSWA 1G4AE 1SXJA 3MHVC 3LQQA 5C18A 5KQDA 2YR0A 5GKNA 4GHAA 3GO8A 3GQ3A 2FS1A 1TTEA 1Q39A 2LHGA 3W0LB 2Y0TA 1TR8A 2A5YB 1IN5A 4KHPM 2KNZA 2CHVA 4F2LA 2CV1A 4RF1A 2JP7A 2QCUA 3U6LA 2I7NA 4NL4H 4QHTA 1QVRA 2FOIC 4A3VB 4BLCA 1H6UA 3SYKA 2VF7A 3KSXA 2G8LA 4LJ5A 3L2AA 4KT0F 1QANA 4CJ6A 1PM5A 3UZUA 3FUWA 2LH0A 4NSOB 3SC3A 4L78A 3I4YA 3RGSA 3SMPA 1Y8GA 4LF5M 1NJFA 4DBGB 5ITTA 4IIWA 3FTCA 3AOEA 1QDTA 2LVQD 5EQTA 1SXJE 3PNYA 1PJTA 2HKJA 2JY7A 4JV5M 3HHWA 2QSFX 1J7KA 2QENA 2JXNA 3DZDA 1EIJA 4I8OA 4LF4M 3HU2A 4B3MM 3A98B 2VDBB 3KSJA 5EP3A 4AKGA 3HZJA 2LVAA 4LCBA 5F3WA 4B3TM 1DGGA 1NY6A 2Y0QA 4GH9A 4RNAA 4L6V6 4G4OA 3KXEC 4JI4M 2EO2A 1C1KA 3AL0C 2L09A 4ITQA 3R8FA 4D80A 2C5RA 3GPUA 4GKJM 3J27B 4JI6M 1MU5A 2LVNC 1PJJA 1DGHA 2CHGA 3SYLA 2OQ4A 4HLQA 5FTJA 2GNOA 4DV6M 1L1TA 3HU1A 1HQCA 2H5XA 4B08A 3K2LA 3U5ZA 4IBIA 2X49A 4OX9M 1AUAA 4LGMA 4PT5A 2BNKA 3BXWA 4P17A 3RFWA 3IHPA 3GLFA 3FKEA 1OKSA 2M5ZA 3KOYE 1L2CA 1JQJC 1VEKA 2AHMA 5IZ7D 3BOSA 2UU9M 4PD2A 2Y21A 4PDGA 2JY8A 2RKOA 1XXHB 3Q8XA 2R46A 2R0IA 3AFHA 1OTRA 3TWKA 5FTNA 4OVZB 2KXEA 3FRIA 3TWMA 1PJSA 2JZ1A 3W0FA 1QYRA 2XF3A 4MGZE 1Q3BA 3BBZA 3THGA 2DI0A 1G3IA 4QOSA 4WURA 3GPXA 3JAMS 3RE8A 4Z8XA 1VG5A 3L27A 2CHQA 1MN3A 3GLIE 1NV9A 2L6OA 2VF8A 2ZAMA 3VK8A 2R65A 2Z3XA 4LF6M 4IJEA 4XGIA 5DFLA 4LFBM 3E9SA 2KDLA 3TQSA 1IBMM 4G4NA 1SG9A 4LFCM 2ZTCA 1JR3D 1RU3A 3L29A 5FLXS 3AOGA 3KOZE 3KVWA 2XGNA 1EE8A 2LHCA 1NJGA 1OIZA 3E21A 1QUSA 3SFZA 1XHBA 4CISA 3NBXX 5LMNM 3Q8GA 4QOZC 3AOEC 3B7NA 1DGFA 5KPRA 1QAQA 3U6OA 1GVNA 2EJSA 2HCBA 3GLFB 4LZZA 4G4RA 2V1UA 2KEBA 4CGYB 1IBLM 1L1ZA 2K6BA 1DGBA 3GLIA 3L28A 2HHHM 3GPYA 1XXHA 3VFDA 2FNAA 3FUUA 5KPZA 1IXSB 1Z59A 4ANRA 2D7HA 1T3TA 2L4EA 1WHCA 2JA2A 4DR4M 5E26A 3TE6A 4DV0M 3E46A 1ZMWA 5EP2A 4JI5M 3H4MA 5FTKA 2Q2EB 1ORYB 4FW9A 4XBOA 1Z5CA 4HEOA 4B3RM 4M9XA 2XFSA 2QBYB 4L8RC 4PDIA 4LJ8A 3VK7A 2V6ZM 2WSEF 4AG5A 3L26A 2F5NA 1SXJC 1OJLA 4D82A 2MJ5B 2C9CA 2UXCM 3FUTA 3VKHA 2MROB 2JY6B 1TGUA 2EKKA 5KQ8A 1T6OA 1WGLA 3AKZA 2KZSA 1W5TA 4GC9A 5ITRA 2HL7A 2ZTDA 3NBIA 4LY6A 3J2PB 2ZANA 4QHSA 3LMMA 2F4VM 2BJWA 2LTUA 3KS8A 5IT9S 5EXXA 2DXIA 3H4JA 2Z8YM 3SHFA 3SARA 3JR4A 4KLNA 1HNWM 4IBCA 4MM3B 4AG6A 4AI6A 3LCVB 3I04M 3C58A 2P5TA 2E5LM 2XEPA 3GLIB 3SAUA 5DYIA 2XZFA 2CE7A 1TH4A 2QPAA 2LWXA 4GMQA 4II7A 4LJAA 2Z4RA 2F5PA 3U6MA 5ITYA 1OFHA 4D81A 1R6BX 4IBJA 5A2QS 3I4VA 3HKPA 4DUZM 4JN6A 4RF0A 1V34A 1LTMA 3DA1A 2N35A 3T1YM 4AW4A 1IFYA 3J7BA 1QUTA 3QYEA 2XLJA 1NY5A 2DKLA 1VEJA 3FYDA 1R5LA 3SAWA 1IXRC 1P3QQ 4JXJA 4LJ7A 2DWZB 3LVWA 4GC5A 5LMUM 1VDLA 1UFZA 3EIEA 2GQFA 3EIHA 2NQ8C 3TPZA 1Z6TA 2QHOB 1N33M 4DR6M 3HU3A 2XH9A 2DHRA 4DUYM 1G71A 1YSYA 3FUVA 1YUBA 3LCUA 4AQYM 3QAUA 2FH0A 3C9PA 3WHKA 4NRWA 1KSFX 4LF9M 3W68A 2Z7JA 4JI1M 2UXDM 3FUXA 4DR1M 1FJGM 4X65M 3KS4A 1I4WA 4IBGA 4I4LA 2G5GX 3GLHB 1E32A 2OPFA 2C99A 2LNHC 3FTDA 3K1JA 5DNYA 1ZMVA 1E9SA 1Q02A 1QQWA 5BPVA 2D7EA 3GLGE 4LG2A 3PNVA 1HQYE 1SXJD 1IM2A 3OTOM 1IBKM 2MH8A 2L4FA 3D8BA 4OW0A 3W67A 2DAIA 4IBKA 3U6DA 5ITXE 1F4IA 3IG8A 2DENA 1TDHA 2K0BX 4LF8M 4RKUF 3HWSA 2DAGA 2CP8A 2I7PA 3C3EA 2RGOA 1QAOA 1HT2E 3HJQA 4S12A 4B7FA 4MGHA 3U61B 1L2DA 2Z4SA 3MK6A 4OVZA 1D0KA 4F1IA 4JYAM 4M0DA 3ILKA 2X4AA 3T1HM 2APLA 3B89A 2O25A 2F5OA 3GRUA 3MMPA 4W5WA 3HHZA 4TUWA 3KOXE 2LVOC 2KW0A 2VIIA 3FYCA 1PGYA 3M7GA 4IBBA 2R4EA 5ITQA 4DV7M 4K0KM 1PJIA 4REZA 4FCTA 2C9OA 2KA6B 2CWBA 3J80S 4BBAA 1XMOM 2OOAA 3RGPA 1D0LA 4JI0M 1K3XA 3CGWA 1N34M 5E6JA 1J09A 1BVSA 1WIVA 3M0EA 4GRIA 2DWNA 4GIPA 1ZMUA 2QP9X 4M9SA 3VDPA 1K82A 3K8ZA 1JB0F 2D7GA 1KFVA 1YE9A 2C98A 2Y20A 2UXBM 1N78A 3U5ZB 3GRYA 3ZC7B 1HJPA 1DO0A 1OFIA 4MGYE 2XFTA 4WW0A 2DVWB 3U6EA 1VDDA 1TDZA 2F5SA 3SASA 2DAEA 3CF2A 1TH3A 4JI2M 3K9PA 1OIPA 3IECA 2V1CA 1WGNA 1G59A 3SHGB 3GQ4A 3U61A 4QNRA 1IQPA 4XK8F 1PRBA 2C96A 4R3DA 1PJQA 4B7GA 1Q3CA 3PFIA 1MX0A 1HNXM 3SAVA 2G3QA 2XSZD 3SBJA 4UN2B 2RGHA 3GLFE 2ZBKB 1WJ7A 4CHTB 4LZJA 2ERCA 4LJ4A 4LRTA 3WHLA 2UUCM 3UK6A 1K3WA 1MJGM 3U6QA 1VQ1A 4GKKM 3KDSE 3A42A 5H37D 4R71A 3SATA 3VDUA 3KP1E 1XNRM 7CATA 3U6PA 4FCVA 5L8RF 2R44A 2YFQA 2CEAA 2LBCA 2DZOB 4P16A 4LF7M 1N75A 2J7NA 1L2BA 4B3SM 1QZEA 2XZUA 2O5RA 1UM8A 2FE8A 3DFZA 4BB9A 1NHWC 4AKHA 2JNHA 1NVMA 3PXGA 2BWBA 2RRUA 5EXPA 2QQ8A 4MH0E 3FTEA 2MR9A 4I81A 4G3OA 3I01M 4MB7A 1XB2B 2DZLA 3HX3A 3ZCBB 1GKIA 3A46A 3JR5A 3AV0A 4FD2A 4IBEA 4QNMA 2DHYA 4CIZA 3GQ5A 1R2YA 1GL6A 4L15A 3QWLA 4DV1M 2XSZA 1YLAA 3U60A 4YHHM 3A45A 2HWJA 2WSCF 4IBDA 3KOWE 1SXJB 4LGYA 2VQFM 4LJ6A 2CV2A 4B7HA 3HHYA 1IY1A 4PCZA 3M6AA 5ITUA 1AIPC 3GLHE 2QZ4A 3HGIA 3NWLA 3T6PA 2KZUA 3KW6A 3FD9A 4GITA 1WXQA 1S3SA 2R18A 3U6SA 5FTMA 2LXEA 3I51A 2F5QA 2BWEA 1VEGA 4M9ZA 1NHGC 3GPPA 2K9DA 3B9PA 4NSRA 1JR3E 2WZJA 1R2ZA 2R6FA 4LRSA 4JI7M 3VLFB 2UUAM 2EKFA 3MJ5A 4FWDA 4X62M 2JUJA 1Z5BA 1D0MA 3HJ8A 1N32M 2CRUA 2HAKA 3CTWB 1OAIA 2W82A 2KNAA 4KO8A 2KNVA 4M0WA 4EIWA 2DAKA 3GLHA 1IXZA
chains in the Genus database with same CATH topology
4JI8M 5KO3A 4DR2M 3U6CA 2X8AA 2EUCA 1N36M 4DV2M 4JI3M 1XNQM 4ZPXA 3J7AS 2ZM6M 5JI2E 4KODA 1G8PA 4L4UA 1L8QA 5FTLA 3J81S 4I5SA 4MGKE 2KRUA 3VKGA 1X37A 1QZMA 4FVMA 3UGJA 4HL4A 4G6ZA 8CATA 5IWAM 5IREB 2BJVA 1ZAEA 3GRRA 1J5EM 2EA0A 4DV4M 2CUZA 2M60A 1DGHB 4L16A 3UMMA 3TWLA 4DR7M 2H1RA 1IN4A 1E9RA 4AKIA 3DOAA 3FTFA 4R7GA 5BR8M 1XMQM 1NNJA 3GLGA 5ITXA 3IG5A 5EP1A 4X64M 2CFOA 3UJNA 4YY3M 2YNMD 1I94M 1R7RA 3D8LA 5C1BA 3K92A 4FCWA 5EP4A 1G41A 2DZNB 2DWMA 1IN7A 4IBFA 3L25A 2R4JA 3HJSA 5EJCA 3T38A 1JR3A 1XWIA 2QBYA 1D2NA 3KFUG 1KYIA 4DV3M 1NSFA 2VQEM 1TH2A 2J7OA 4NOOB 3TL4X 1GLNA 4MGIE 4LJ9A 1HNZM 3T15A 1HT1E 3LQRA 2CV0A 3PVSA 1NNUC 3AJIB 1LV7A 3E4RA 1IY2A 1IY0A 3SMSA 3ZH9B 1FNNA 2L7IA 1Z5AA 4FWGA 5DYGA 4DV5M 1E94E 3GLGB 2R62A 5JI3E 4GHLA 4G4QA 3CF0A 5EXTA 1DO2A 4FWHA 2DWLA 4OU7A 4Z6YA 4X66M 4NRVA 3KP0E 2R45A 4AZFA 1IN8A 1HR0M 4NXNM 1ZQ9A 4NXMM 2K47A 1IN6A 1GL7A 2YQZA 4IJFA 5EXSA 3R9XB 1W5SA 3LVVA 2FFJA 1QAMA 4LFAM 1N77A 3CF6E 1XC8A 5KPTA 3GP1A 4DR5M 2ZAOA 4DR3M 2L7HA 2KRKA 3U60B 2UUBM 3HHXA 5FSWA 1G4AE 1SXJA 3MHVC 3LQQA 5C18A 5KQDA 2YR0A 5GKNA 4GHAA 3GO8A 3GQ3A 1Q39A 3W0LB 2Y0TA 2A5YB 1IN5A 4KHPM 2CHVA 2CV1A 4RF1A 2QCUA 3U6LA 2I7NA 4NL4H 4QHTA 1QVRA 2FOIC 4A3VB 4BLCA 1H6UA 3SYKA 3KSXA 2G8LA 4LJ5A 3L2AA 1QANA 1PM5A 3UZUA 3FUWA 2LH0A 4NSOB 3SC3A 4L78A 3I4YA 3RGSA 3SMPA 4LF5M 1NJFA 5ITTA 4IIWA 3FTCA 3AOEA 5EQTA 1SXJE 3PNYA 2HKJA 4JV5M 3HHWA 1J7KA 2QENA 3DZDA 4I8OA 4LF4M 3HU2A 4B3MM 3A98B 3KSJA 5EP3A 4AKGA 4LCBA 5F3WA 4B3TM 1DGGA 1NY6A 2Y0QA 4GH9A 4RNAA 4G4OA 3KXEC 4JI4M 2EO2A 1C1KA 3AL0C 2L09A 4ITQA 3R8FA 4D80A 2C5RA 3GPUA 4GKJM 3J27B 4JI6M 1MU5A 1PJJA 1DGHA 2CHGA 3SYLA 2OQ4A 4HLQA 5FTJA 1L1TA 4DV6M 3HU1A 1HQCA 4B08A 3K2LA 3U5ZA 4IBIA 2X49A 4OX9M 4LGMA 4PT5A 2BNKA 3RFWA 3GLFA 3FKEA 2M5ZA 3KOYE 1L2CA 1JQJC 2AHMA 5IZ7D 3BOSA 2UU9M 4PD2A 2Y21A 4PDGA 2RKOA 1XXHB 3Q8XA 2R46A 3AFHA 3TWKA 5FTNA 4OVZB 2KXEA 3TWMA 3W0FA 1QYRA 2XF3A 4MGZE 1Q3BA 3THGA 1G3IA 4QOSA 4WURA 3GPXA 3JAMS 3RE8A 4Z8XA 3L27A 2CHQA 3VK8A 2L6OA 2ZAMA 2R65A 2Z3XA 4LF6M 4IJEA 4XGIA 4LFBM 3E9SA 1IBMM 3TQSA 4LFCM 4G4NA 3L29A 1JR3D 5FLXS 3AOGA 3KOZE 3KVWA 2XGNA 1EE8A 1NJGA 3SFZA 1XHBA 4CISA 5LMNM 4QOZC 3AOEC 5KPRA 1DGFA 3U6OA 1QAQA 1GVNA 2HCBA 3GLFB 4LZZA 4G4RA 2V1UA 2KEBA 4CGYB 1IBLM 1L1ZA 1DGBA 3GLIA 3L28A 2HHHM 3GPYA 1XXHA 3VFDA 2FNAA 3FUUA 5KPZA 1IXSB 1Z59A 2D7HA 1T3TA 2JA2A 4DR4M 5E26A 3TE6A 4DV0M 5EP2A 4JI5M 3H4MA 5FTKA 2Q2EB 1ORYB 4FW9A 4XBOA 1Z5CA 4B3RM 4M9XA 2XFSA 2QBYB 4L8RC 4PDIA 4LJ8A 3VK7A 2V6ZM 4AG5A 3L26A 2F5NA 1SXJC 1OJLA 4D82A 2UXCM 2C9CA 3FUTA 3VKHA 1TGUA 5KQ8A 3AKZA 2KZSA 1W5TA 4GC9A 5ITRA 2HL7A 3NBIA 4LY6A 3J2PB 2ZANA 4QHSA 3LMMA 2F4VM 2BJWA 3KS8A 5IT9S 5EXXA 2DXIA 3SARA 3SHFA 3JR4A 4KLNA 1HNWM 4IBCA 4MM3B 4AG6A 4AI6A 2E5LM 3C58A 2P5TA 2XEPA 3GLIB 3SAUA 5DYIA 2XZFA 2CE7A 1TH4A 2QPAA 2LWXA 4GMQA 4II7A 4LJAA 2Z4RA 2F5PA 3U6MA 5ITYA 1OFHA 4D81A 1R6BX 4IBJA 5A2QS 3I4VA 3HKPA 4DUZM 4JN6A 4RF0A 3T1YM 3DA1A 4AW4A 3J7BA 2XLJA 1NY5A 3FYDA 3SAWA 1IXRC 4JXJA 4LJ7A 2DWZB 4GC5A 3LVWA 5LMUM 3EIEA 3EIHA 2NQ8C 3TPZA 1Z6TA 1N33M 4DR6M 3HU3A 2XH9A 2DHRA 4DUYM 1YSYA 3FUVA 1YUBA 4AQYM 3QAUA 3WHKA 4NRWA 1KSFX 4LF9M 2Z7JA 4JI1M 2UXDM 3FUXA 4DR1M 1FJGM 4X65M 3KS4A 1I4WA 4IBGA 4I4LA 2G5GX 3GLHB 1E32A 2OPFA 2C99A 2LNHC 3FTDA 3K1JA 5DNYA 1E9SA 1QQWA 5BPVA 2D7EA 4LG2A 3PNVA 1SXJD 1HQYE 1IM2A 3OTOM 3D8BA 4OW0A 4IBKA 3U6DA 5ITXE 3IG8A 1TDHA 4LF8M 3HWSA 2I7PA 2RGOA 1QAOA 1HT2E 3HJQA 4S12A 4B7FA 4MGHA 3U61B 1L2DA 2Z4SA 3MK6A 4OVZA 4JYAM 4M0DA 3ILKA 2X4AA 3T1HM 2F5OA 3GRUA 4W5WA 3HHZA 4TUWA 3KOXE 2VIIA 2KW0A 3FYCA 3M7GA 4K0KM 4DV7M 4IBBA 2R4EA 5ITQA 1PJIA 4REZA 4FCTA 2C9OA 2KA6B 3J80S 4BBAA 1XMOM 3RGPA 4JI0M 1K3XA 1N34M 5E6JA 1J09A 3M0EA 4GRIA 2DWNA 4GIPA 2QP9X 4M9SA 3VDPA 1K82A 3K8ZA 2D7GA 1KFVA 1YE9A 2C98A 2Y20A 2UXBM 1N78A 3U5ZB 3GRYA 3ZC7B 1DO0A 1OFIA 4MGYE 2XFTA 4WW0A 2DVWB 3U6EA 1VDDA 1TDZA 2F5SA 3SASA 3CF2A 4JI2M 1TH3A 2V1CA 1G59A 3SHGB 3GQ4A 3U61A 4QNRA 1IQPA 2C96A 4R3DA 4B7GA 1Q3CA 3PFIA 1MX0A 1HNXM 3SAVA 3SBJA 2XSZD 2RGHA 2ZBKB 4CHTB 4LZJA 2ERCA 4LJ4A 4LRTA 3WHLA 2UUCM 3UK6A 1K3WA 3U6QA 4GKKM 3KDSE 3A42A 5H37D 3SATA 3VDUA 3KP1E 1XNRM 7CATA 3U6PA 4FCVA 2YFQA 2CEAA 4LF7M 2DZOB 4P16A 1N75A 2J7NA 1L2BA 4B3SM 2XZUA 2O5RA 1UM8A 2FE8A 3DFZA 4BB9A 1NHWC 4AKHA 1NVMA 3PXGA 3FTEA 5EXPA 4MH0E 4I81A 4MB7A 3ZCBB 1GKIA 3A46A 3JR5A 3AV0A 4FD2A 4IBEA 4QNMA 3GQ5A 1R2YA 1GL6A 4L15A 3QWLA 4DV1M 2XSZA 3U60A 4YHHM 3A45A 4IBDA 3KOWE 1SXJB 4LGYA 2VQFM 4LJ6A 2CV2A 4B7HA 3HHYA 1IY1A 4PCZA 3M6AA 5ITUA 2QZ4A 3HGIA 3NWLA 2KZUA 3KW6A 3FD9A 4GITA 1WXQA 1S3SA 2R18A 3U6SA 5FTMA 3I51A 2LXEA 2F5QA 4M9ZA 1NHGC 3GPPA 3B9PA 4NSRA 1R2ZA 4LRSA 4JI7M 3VLFB 2UUAM 3MJ5A 4FWDA 4X62M 3HJ8A 1Z5BA 1N32M 1IBKM 3CTWB 2W82A 4KO8A 4EIWA 4M0WA 3GRVA 3GLHA 1IXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPY A;  4JI8 M;  4DR2 M;  3U6C A;  4K0K M;  4DV7 M;  3GO8 A;  5ITQ A;  3GQ3 A;  1N36 M;  4DV2 M;  4JI3 M;  1Q39 A;  1PJI A;  1XNQ M;  3J7A S;  2ZM6 M;  1Z59 A;  3J80 S;  1XMO M;  4DR4 M;  4JI0 M;  4DV0 M;  4KHP M;  1K3X A;  3J81 S;  4JI5 M;  2Q2E B;  1N34 M;  3U6L A;  1Z5C A;  4B3R M;  5IWA M;  4PDI A;  3VK7 A;  1K82 A;  1KFV A;  2F5N A;  1PM5 A;  1J5E M;  2EA0 A;  4DV4 M;  2UXC M;  4LF5 M;  3U6E A;  5ITT A;  3SAS A;  4JI1 M;  1TDZ A;  2F5S A;  4JI2 M;  3TWL A;  4DR7 M;  5ITR A;  2HKJ A;  4JV5 M;  3DOA A;  2F4V M;  3GQ4 A;  5IT9 S;  4LF4 M;  5BR8 M;  3SAR A;  1XMQ M;  1NNJ A;  4B3M M;  3JR4 A;  1HNW M;  5ITX A;  1Q3C A;  2E5L M;  3C58 A;  1MX0 A;  4X64 M;  3SAU A;  1HNX M;  3SAV A;  4B3T M;  3SBJ A;  4YY3 M;  2XZF A;  1I94 M;  4G4O A;  2ZBK B;  4JI4 M;  2F5P A;  3U6M A;  5ITY A;  2UUC M;  4ITQ A;  1K3W A;  5A2Q S;  3U6Q A;  4DUZ M;  3T1Y M;  4GKK M;  3A42 A;  3GPU A;  3SAT A;  1XNR M;  4GKJ M;  4JI6 M;  3U6P A;  1MU5 A;  1PJJ A;  2OQ4 A;  3SAW A;  1L1T A;  4DV6 M;  4LF7 M;  4DV3 M;  5LMU M;  1L2B A;  4B3S M;  2VQE M;  2XZU A;  4OX9 M;  1HNZ M;  1N33 M;  4DR6 M;  4MB7 A;  1L2C A;  4DUY M;  3A46 A;  2UU9 M;  4AQY M;  4PD2 A;  3JR5 A;  1Z5A A;  4PDG A;  3GQ5 A;  1R2Y A;  4NRW A;  4DV5 M;  3TWK A;  4LF9 M;  2UXD M;  3TWM A;  4DR1 M;  4YHH M;  1FJG M;  3A45 A;  4X65 M;  3W0F A;  4G4Q A;  2VQF M;  1Q3B A;  3GPX A;  3JAM S;  4PCZ A;  4X66 M;  4NRV A;  2OPF A;  5ITU A;  3VK8 A;  4LF6 M;  4LFB M;  1IBM M;  4LFC M;  4G4N A;  5FLX S;  3U6S A;  1HR0 M;  4NXN M;  4NXM M;  3OTO M;  1EE8 A;  2F5Q A;  3U6D A;  3GPP A;  5ITX E;  4LFA M;  4CIS A;  1TDH A;  5LMN M;  1XC8 A;  3GP1 A;  1R2Z A;  4LF8 M;  4DR5 M;  3U6O A;  1L2D A;  2UUA M;  4JI7 M;  2UXB M;  4DR3 M;  4JYA M;  4X62 M;  4G4R A;  2UUB M;  1Z5B A;  1N32 M;  3T1H M;  1IBK M;  1IBL M;  1L1Z A;  2F5O A;  4DV1 M;  2HHH M; 
#chains in the Genus database with same CATH topology
 4JI8 M;  5KO3 A;  4DR2 M;  2MGW A;  3U6C A;  3B7Q A;  2X8A A;  2EUC A;  3ZQJ A;  1N36 M;  4DV2 M;  4JI3 M;  1XNQ M;  4ZPX A;  3J7A S;  2ZM6 M;  2KHH A;  5JI2 E;  1TF0 B;  4KOD A;  1G8P A;  4L4U A;  1L8Q A;  5FTL A;  2LVP C;  3J81 S;  3B7Z A;  4I5S A;  4MGK E;  2KRU A;  3VKG A;  1X37 A;  4Y28 F;  1QZM A;  3LW5 F;  4FVM A;  3UGJ A;  4HL4 A;  2B3T A;  4G6Z A;  8CAT A;  3B74 A;  5IWA M;  2OOB A;  5IRE B;  2BJV A;  1OAO C;  1ZAE A;  3GRR A;  1J5E M;  1C7Y A;  2EA0 A;  4DV4 M;  1T43 A;  2CUZ A;  1XXH E;  1DV0 A;  4Q7J A;  2M60 A;  3GRV A;  1V33 A;  1DGH B;  4L16 A;  3UMM A;  2OO9 A;  3TWL A;  1GJS A;  4DR7 M;  2H1R A;  1IN4 A;  1E9R A;  2DNA A;  2JWS A;  4AKI A;  3DOA A;  3FTF A;  4R7G A;  2JZ0 A;  5BR8 M;  1XMQ M;  1NNJ A;  3FRH A;  3GLG A;  5ITX A;  3IG5 A;  5EP1 A;  4X64 M;  1CUK A;  2CFO A;  3UJN A;  1A5T A;  2WSF F;  4YY3 M;  2YNM D;  1I94 M;  1R7R A;  3D8L A;  5C1B A;  3K92 A;  4FCW A;  1V92 A;  1EFU B;  5EP4 A;  1G41 A;  2DZN B;  2DWM A;  1IN7 A;  4IBF A;  3L25 A;  2R4J A;  2QNJ A;  3HJS A;  3QYB A;  2J5Y A;  5EJC A;  2JY5 A;  3T38 A;  1JR3 A;  1XWI A;  4NC6 A;  2QBY A;  1D2N A;  3KFU G;  1KYI A;  4DV3 M;  3FE3 A;  1GAB A;  1NSF A;  2VQE M;  1TH2 A;  2J7O A;  4NOO B;  3TL4 X;  1GLN A;  4MGI E;  2L2D A;  4LJ9 A;  1HNZ M;  3T15 A;  1HT1 E;  3LQR A;  2CV0 A;  3PVS A;  1NNU C;  3AJI B;  1LV7 A;  3E4R A;  1IY2 A;  1IY0 A;  3C3D A;  1NV8 A;  3SMS A;  1FNN A;  2L7I A;  1Z5A A;  4FWG A;  3ZH9 B;  3V76 A;  1NO1 A;  5DYG A;  4DV5 M;  4GEW A;  1QDR A;  1E94 E;  3GLG B;  1WR1 B;  2R62 A;  5JI3 E;  4GHL A;  4G4Q A;  2DAM A;  3K9O A;  3CF0 A;  5EXT A;  1DO2 A;  4FWH A;  2DWL A;  4OU7 A;  4Z6Y A;  4X66 M;  4NRV A;  1ZV1 A;  1IXS A;  3KP0 E;  1R4G A;  1GJT A;  3HY5 A;  2R45 A;  4AZF A;  1OQY A;  4WP2 A;  1IN8 A;  1HR0 M;  4NXN M;  1ZQ9 A;  4NXM M;  2K47 A;  1IN6 A;  1GL7 A;  2YQZ A;  4IJF A;  5EXS A;  3R9X B;  1W5S A;  3LVV A;  2FFJ A;  1QAM A;  4LFA M;  1N77 A;  2O01 F;  3CF6 E;  1XC8 A;  5KPT A;  3F92 A;  3GP1 A;  1GO5 A;  4DR5 M;  2ZAO A;  4DR3 M;  2L7H A;  2KRK A;  3U60 B;  2UUB M;  3HHX A;  5FSW A;  1G4A E;  1SXJ A;  3MHV C;  3LQQ A;  5C18 A;  5KQD A;  2YR0 A;  5GKN A;  4GHA A;  3GO8 A;  3GQ3 A;  2FS1 A;  1TTE A;  1Q39 A;  2LHG A;  3W0L B;  2Y0T A;  1TR8 A;  2A5Y B;  1IN5 A;  4KHP M;  2KNZ A;  2CHV A;  4F2L A;  2CV1 A;  4RF1 A;  2JP7 A;  2QCU A;  3U6L A;  2I7N A;  4NL4 H;  4QHT A;  1QVR A;  2FOI C;  4A3V B;  4BLC A;  1H6U A;  3SYK A;  2VF7 A;  3KSX A;  2G8L A;  4LJ5 A;  3L2A A;  4KT0 F;  1QAN A;  4CJ6 A;  1PM5 A;  3UZU A;  3FUW A;  2LH0 A;  4NSO B;  3SC3 A;  4L78 A;  3I4Y A;  3RGS A;  3SMP A;  1Y8G A;  4LF5 M;  1NJF A;  4DBG B;  5ITT A;  4IIW A;  3FTC A;  3AOE A;  1QDT A;  2LVQ D;  5EQT A;  1SXJ E;  3PNY A;  1PJT A;  2HKJ A;  2JY7 A;  4JV5 M;  3HHW A;  2QSF X;  1J7K A;  2QEN A;  2JXN A;  3DZD A;  1EIJ A;  4I8O A;  4LF4 M;  3HU2 A;  4B3M M;  3A98 B;  2VDB B;  3KSJ A;  5EP3 A;  4AKG A;  3HZJ A;  2LVA A;  4LCB A;  5F3W A;  4B3T M;  1DGG A;  1NY6 A;  2Y0Q A;  4GH9 A;  4RNA A;  4L6V 6;  4G4O A;  3KXE C;  4JI4 M;  2EO2 A;  1C1K A;  3AL0 C;  2L09 A;  4ITQ A;  3R8F A;  4D80 A;  2C5R A;  3GPU A;  4GKJ M;  3J27 B;  4JI6 M;  1MU5 A;  2LVN C;  1PJJ A;  1DGH A;  2CHG A;  3SYL A;  2OQ4 A;  4HLQ A;  5FTJ A;  2GNO A;  4DV6 M;  1L1T A;  3HU1 A;  1HQC A;  2H5X A;  4B08 A;  3K2L A;  3U5Z A;  4IBI A;  2X49 A;  4OX9 M;  1AUA A;  4LGM A;  4PT5 A;  2BNK A;  3BXW A;  4P17 A;  3RFW A;  3IHP A;  3GLF A;  3FKE A;  1OKS A;  2M5Z A;  3KOY E;  1L2C A;  1JQJ C;  1VEK A;  2AHM A;  5IZ7 D;  3BOS A;  2UU9 M;  4PD2 A;  2Y21 A;  4PDG A;  2JY8 A;  2RKO A;  1XXH B;  3Q8X A;  2R46 A;  2R0I A;  3AFH A;  1OTR A;  3TWK A;  5FTN A;  4OVZ B;  2KXE A;  3FRI A;  3TWM A;  1PJS A;  2JZ1 A;  3W0F A;  1QYR A;  2XF3 A;  4MGZ E;  1Q3B A;  3BBZ A;  3THG A;  2DI0 A;  1G3I A;  4QOS A;  4WUR A;  3GPX A;  3JAM S;  3RE8 A;  4Z8X A;  1VG5 A;  3L27 A;  2CHQ A;  1MN3 A;  3GLI E;  1NV9 A;  2L6O A;  2VF8 A;  2ZAM A;  3VK8 A;  2R65 A;  2Z3X A;  4LF6 M;  4IJE A;  4XGI A;  5DFL A;  4LFB M;  3E9S A;  2KDL A;  3TQS A;  1IBM M;  4G4N A;  1SG9 A;  4LFC M;  2ZTC A;  1JR3 D;  1RU3 A;  3L29 A;  5FLX S;  3AOG A;  3KOZ E;  3KVW A;  2XGN A;  1EE8 A;  2LHC A;  1NJG A;  1OIZ A;  3E21 A;  1QUS A;  3SFZ A;  1XHB A;  4CIS A;  3NBX X;  5LMN M;  3Q8G A;  4QOZ C;  3AOE C;  3B7N A;  1DGF A;  5KPR A;  1QAQ A;  3U6O A;  1GVN A;  2EJS A;  2HCB A;  3GLF B;  4LZZ A;  4G4R A;  2V1U A;  2KEB A;  4CGY B;  1IBL M;  1L1Z A;  2K6B A;  1DGB A;  3GLI A;  3L28 A;  2HHH M;  3GPY A;  1XXH A;  3VFD A;  2FNA A;  3FUU A;  5KPZ A;  1IXS B;  1Z59 A;  4ANR A;  2D7H A;  1T3T A;  2L4E A;  1WHC A;  2JA2 A;  4DR4 M;  5E26 A;  3TE6 A;  4DV0 M;  3E46 A;  1ZMW A;  5EP2 A;  4JI5 M;  3H4M A;  5FTK A;  2Q2E B;  1ORY B;  4FW9 A;  4XBO A;  1Z5C A;  4HEO A;  4B3R M;  4M9X A;  2XFS A;  2QBY B;  4L8R C;  4PDI A;  4LJ8 A;  3VK7 A;  2V6Z M;  2WSE F;  4AG5 A;  3L26 A;  2F5N A;  1SXJ C;  1OJL A;  4D82 A;  2MJ5 B;  2C9C A;  2UXC M;  3FUT A;  3VKH A;  2MRO B;  2JY6 B;  1TGU A;  2EKK A;  5KQ8 A;  1T6O A;  1WGL A;  3AKZ A;  2KZS A;  1W5T A;  4GC9 A;  5ITR A;  2HL7 A;  2ZTD A;  3NBI A;  4LY6 A;  3J2P B;  2ZAN A;  4QHS A;  3LMM A;  2F4V M;  2BJW A;  2LTU A;  3KS8 A;  5IT9 S;  5EXX A;  2DXI A;  3H4J A;  2Z8Y M;  3SHF A;  3SAR A;  3JR4 A;  4KLN A;  1HNW M;  4IBC A;  4MM3 B;  4AG6 A;  4AI6 A;  3LCV B;  3I04 M;  3C58 A;  2P5T A;  2E5L M;  2XEP A;  3GLI B;  3SAU A;  5DYI A;  2XZF A;  2CE7 A;  1TH4 A;  2QPA A;  2LWX A;  4GMQ A;  4II7 A;  4LJA A;  2Z4R A;  2F5P A;  3U6M A;  5ITY A;  1OFH A;  4D81 A;  1R6B X;  4IBJ A;  5A2Q S;  3I4V A;  3HKP A;  4DUZ M;  4JN6 A;  4RF0 A;  1V34 A;  1LTM A;  3DA1 A;  2N35 A;  3T1Y M;  4AW4 A;  1IFY A;  3J7B A;  1QUT A;  3QYE A;  2XLJ A;  1NY5 A;  2DKL A;  1VEJ A;  3FYD A;  1R5L A;  3SAW A;  1IXR C;  1P3Q Q;  4JXJ A;  4LJ7 A;  2DWZ B;  3LVW A;  4GC5 A;  5LMU M;  1VDL A;  1UFZ A;  3EIE A;  2GQF A;  3EIH A;  2NQ8 C;  3TPZ A;  1Z6T A;  2QHO B;  1N33 M;  4DR6 M;  3HU3 A;  2XH9 A;  2DHR A;  4DUY M;  1G71 A;  1YSY A;  3FUV A;  1YUB A;  3LCU A;  4AQY M;  3QAU A;  2FH0 A;  3C9P A;  3WHK A;  4NRW A;  1KSF X;  4LF9 M;  3W68 A;  2Z7J A;  4JI1 M;  2UXD M;  3FUX A;  4DR1 M;  1FJG M;  4X65 M;  3KS4 A;  1I4W A;  4IBG A;  4I4L A;  2G5G X;  3GLH B;  1E32 A;  2OPF A;  2C99 A;  2LNH C;  3FTD A;  3K1J A;  5DNY A;  1ZMV A;  1E9S A;  1Q02 A;  1QQW A;  5BPV A;  2D7E A;  3GLG E;  4LG2 A;  3PNV A;  1HQY E;  1SXJ D;  1IM2 A;  3OTO M;  1IBK M;  2MH8 A;  2L4F A;  3D8B A;  4OW0 A;  3W67 A;  2DAI A;  4IBK A;  3U6D A;  5ITX E;  1F4I A;  3IG8 A;  2DEN A;  1TDH A;  2K0B X;  4LF8 M;  4RKU F;  3HWS A;  2DAG A;  2CP8 A;  2I7P A;  3C3E A;  2RGO A;  1QAO A;  1HT2 E;  3HJQ A;  4S12 A;  4B7F A;  4MGH A;  3U61 B;  1L2D A;  2Z4S A;  3MK6 A;  4OVZ A;  1D0K A;  4F1I A;  4JYA M;  4M0D A;  3ILK A;  2X4A A;  3T1H M;  2APL A;  3B89 A;  2O25 A;  2F5O A;  3GRU A;  3MMP A;  4W5W A;  3HHZ A;  4TUW A;  3KOX E;  2LVO C;  2KW0 A;  2VII A;  3FYC A;  1PGY A;  3M7G A;  4IBB A;  2R4E A;  5ITQ A;  4DV7 M;  4K0K M;  1PJI A;  4REZ A;  4FCT A;  2C9O A;  2KA6 B;  2CWB A;  3J80 S;  4BBA A;  1XMO M;  2OOA A;  3RGP A;  1D0L A;  4JI0 M;  1K3X A;  3CGW A;  1N34 M;  5E6J A;  1J09 A;  1BVS A;  1WIV A;  3M0E A;  4GRI A;  2DWN A;  4GIP A;  1ZMU A;  2QP9 X;  4M9S A;  3VDP A;  1K82 A;  3K8Z A;  1JB0 F;  2D7G A;  1KFV A;  1YE9 A;  2C98 A;  2Y20 A;  2UXB M;  1N78 A;  3U5Z B;  3GRY A;  3ZC7 B;  1HJP A;  1DO0 A;  1OFI A;  4MGY E;  2XFT A;  4WW0 A;  2DVW B;  3U6E A;  1VDD A;  1TDZ A;  2F5S A;  3SAS A;  2DAE A;  3CF2 A;  1TH3 A;  4JI2 M;  3K9P A;  1OIP A;  3IEC A;  2V1C A;  1WGN A;  1G59 A;  3SHG B;  3GQ4 A;  3U61 A;  4QNR A;  1IQP A;  4XK8 F;  1PRB A;  2C96 A;  4R3D A;  1PJQ A;  4B7G A;  1Q3C A;  3PFI A;  1MX0 A;  1HNX M;  3SAV A;  2G3Q A;  2XSZ D;  3SBJ A;  4UN2 B;  2RGH A;  3GLF E;  2ZBK B;  1WJ7 A;  4CHT B;  4LZJ A;  2ERC A;  4LJ4 A;  4LRT A;  3WHL A;  2UUC M;  3UK6 A;  1K3W A;  1MJG M;  3U6Q A;  1VQ1 A;  4GKK M;  3KDS E;  3A42 A;  5H37 D;  4R71 A;  3SAT A;  3VDU A;  3KP1 E;  1XNR M;  7CAT A;  3U6P A;  4FCV A;  5L8R F;  2R44 A;  2YFQ A;  2CEA A;  2LBC A;  2DZO B;  4P16 A;  4LF7 M;  1N75 A;  2J7N A;  1L2B A;  4B3S M;  1QZE A;  2XZU A;  2O5R A;  1UM8 A;  2FE8 A;  3DFZ A;  4BB9 A;  1NHW C;  4AKH A;  2JNH A;  1NVM A;  3PXG A;  2BWB A;  2RRU A;  5EXP A;  2QQ8 A;  4MH0 E;  3FTE A;  2MR9 A;  4I81 A;  4G3O A;  3I01 M;  4MB7 A;  1XB2 B;  2DZL A;  3HX3 A;  3ZCB B;  1GKI A;  3A46 A;  3JR5 A;  3AV0 A;  4FD2 A;  4IBE A;  4QNM A;  2DHY A;  4CIZ A;  3GQ5 A;  1R2Y A;  1GL6 A;  4L15 A;  3QWL A;  4DV1 M;  2XSZ A;  1YLA A;  3U60 A;  4YHH M;  3A45 A;  2HWJ A;  2WSC F;  4IBD A;  3KOW E;  1SXJ B;  4LGY A;  2VQF M;  4LJ6 A;  2CV2 A;  4B7H A;  3HHY A;  1IY1 A;  4PCZ A;  3M6A A;  5ITU A;  1AIP C;  3GLH E;  2QZ4 A;  3HGI A;  3NWL A;  3T6P A;  2KZU A;  3KW6 A;  3FD9 A;  4GIT A;  1WXQ A;  1S3S A;  2R18 A;  3U6S A;  5FTM A;  2LXE A;  3I51 A;  2F5Q A;  2BWE A;  1VEG A;  4M9Z A;  1NHG C;  3GPP A;  2K9D A;  3B9P A;  4NSR A;  1JR3 E;  2WZJ A;  1R2Z A;  2R6F A;  4LRS A;  4JI7 M;  3VLF B;  2UUA M;  2EKF A;  3MJ5 A;  4FWD A;  4X62 M;  2JUJ A;  1Z5B A;  1D0M A;  3HJ8 A;  1N32 M;  2CRU A;  2HAK A;  3CTW B;  1OAI A;  2W82 A;  2KNA A;  4KO8 A;  2KNV A;  4M0W A;  4EIW A;  2DAK A;  3GLH A;  1IXZ A; 
#chains in the Genus database with same CATH homology
 4JI8 M;  5KO3 A;  4DR2 M;  3U6C A;  2X8A A;  2EUC A;  1N36 M;  4DV2 M;  4JI3 M;  1XNQ M;  4ZPX A;  3J7A S;  2ZM6 M;  5JI2 E;  4KOD A;  1G8P A;  4L4U A;  1L8Q A;  5FTL A;  3J81 S;  4I5S A;  4MGK E;  2KRU A;  3VKG A;  1X37 A;  1QZM A;  4FVM A;  3UGJ A;  4HL4 A;  4G6Z A;  8CAT A;  5IWA M;  5IRE B;  2BJV A;  1ZAE A;  3GRR A;  1J5E M;  2EA0 A;  4DV4 M;  2CUZ A;  2M60 A;  1DGH B;  4L16 A;  3UMM A;  3TWL A;  4DR7 M;  2H1R A;  1IN4 A;  1E9R A;  4AKI A;  3DOA A;  3FTF A;  4R7G A;  5BR8 M;  1XMQ M;  1NNJ A;  3GLG A;  5ITX A;  3IG5 A;  5EP1 A;  4X64 M;  2CFO A;  3UJN A;  4YY3 M;  2YNM D;  1I94 M;  1R7R A;  3D8L A;  5C1B A;  3K92 A;  4FCW A;  5EP4 A;  1G41 A;  2DZN B;  2DWM A;  1IN7 A;  4IBF A;  3L25 A;  2R4J A;  3HJS A;  5EJC A;  3T38 A;  1JR3 A;  1XWI A;  2QBY A;  1D2N A;  3KFU G;  1KYI A;  4DV3 M;  1NSF A;  2VQE M;  1TH2 A;  2J7O A;  4NOO B;  3TL4 X;  1GLN A;  4MGI E;  4LJ9 A;  1HNZ M;  3T15 A;  1HT1 E;  3LQR A;  2CV0 A;  3PVS A;  1NNU C;  3AJI B;  1LV7 A;  3E4R A;  1IY2 A;  1IY0 A;  3SMS A;  3ZH9 B;  1FNN A;  2L7I A;  1Z5A A;  4FWG A;  5DYG A;  4DV5 M;  1E94 E;  3GLG B;  2R62 A;  5JI3 E;  4GHL A;  4G4Q A;  3CF0 A;  5EXT A;  1DO2 A;  4FWH A;  2DWL A;  4OU7 A;  4Z6Y A;  4X66 M;  4NRV A;  3KP0 E;  2R45 A;  4AZF A;  1IN8 A;  1HR0 M;  4NXN M;  1ZQ9 A;  4NXM M;  2K47 A;  1IN6 A;  1GL7 A;  2YQZ A;  4IJF A;  5EXS A;  3R9X B;  1W5S A;  3LVV A;  2FFJ A;  1QAM A;  4LFA M;  1N77 A;  3CF6 E;  1XC8 A;  5KPT A;  3GP1 A;  4DR5 M;  2ZAO A;  4DR3 M;  2L7H A;  2KRK A;  3U60 B;  2UUB M;  3HHX A;  5FSW A;  1G4A E;  1SXJ A;  3MHV C;  3LQQ A;  5C18 A;  5KQD A;  2YR0 A;  5GKN A;  4GHA A;  3GO8 A;  3GQ3 A;  1Q39 A;  3W0L B;  2Y0T A;  2A5Y B;  1IN5 A;  4KHP M;  2CHV A;  2CV1 A;  4RF1 A;  2QCU A;  3U6L A;  2I7N A;  4NL4 H;  4QHT A;  1QVR A;  2FOI C;  4A3V B;  4BLC A;  1H6U A;  3SYK A;  3KSX A;  2G8L A;  4LJ5 A;  3L2A A;  1QAN A;  1PM5 A;  3UZU A;  3FUW A;  2LH0 A;  4NSO B;  3SC3 A;  4L78 A;  3I4Y A;  3RGS A;  3SMP A;  4LF5 M;  1NJF A;  5ITT A;  4IIW A;  3FTC A;  3AOE A;  5EQT A;  1SXJ E;  3PNY A;  2HKJ A;  4JV5 M;  3HHW A;  1J7K A;  2QEN A;  3DZD A;  4I8O A;  4LF4 M;  3HU2 A;  4B3M M;  3A98 B;  3KSJ A;  5EP3 A;  4AKG A;  4LCB A;  5F3W A;  4B3T M;  1DGG A;  1NY6 A;  2Y0Q A;  4GH9 A;  4RNA A;  4G4O A;  3KXE C;  4JI4 M;  2EO2 A;  1C1K A;  3AL0 C;  2L09 A;  4ITQ A;  3R8F A;  4D80 A;  2C5R A;  3GPU A;  4GKJ M;  3J27 B;  4JI6 M;  1MU5 A;  1PJJ A;  1DGH A;  2CHG A;  3SYL A;  2OQ4 A;  4HLQ A;  5FTJ A;  1L1T A;  4DV6 M;  3HU1 A;  1HQC A;  4B08 A;  3K2L A;  3U5Z A;  4IBI A;  2X49 A;  4OX9 M;  4LGM A;  4PT5 A;  2BNK A;  3RFW A;  3GLF A;  3FKE A;  2M5Z A;  3KOY E;  1L2C A;  1JQJ C;  2AHM A;  5IZ7 D;  3BOS A;  2UU9 M;  4PD2 A;  2Y21 A;  4PDG A;  2RKO A;  1XXH B;  3Q8X A;  2R46 A;  3AFH A;  3TWK A;  5FTN A;  4OVZ B;  2KXE A;  3TWM A;  3W0F A;  1QYR A;  2XF3 A;  4MGZ E;  1Q3B A;  3THG A;  1G3I A;  4QOS A;  4WUR A;  3GPX A;  3JAM S;  3RE8 A;  4Z8X A;  3L27 A;  2CHQ A;  3VK8 A;  2L6O A;  2ZAM A;  2R65 A;  2Z3X A;  4LF6 M;  4IJE A;  4XGI A;  4LFB M;  3E9S A;  1IBM M;  3TQS A;  4LFC M;  4G4N A;  3L29 A;  1JR3 D;  5FLX S;  3AOG A;  3KOZ E;  3KVW A;  2XGN A;  1EE8 A;  1NJG A;  3SFZ A;  1XHB A;  4CIS A;  5LMN M;  4QOZ C;  3AOE C;  5KPR A;  1DGF A;  3U6O A;  1QAQ A;  1GVN A;  2HCB A;  3GLF B;  4LZZ A;  4G4R A;  2V1U A;  2KEB A;  4CGY B;  1IBL M;  1L1Z A;  1DGB A;  3GLI A;  3L28 A;  2HHH M;  3GPY A;  1XXH A;  3VFD A;  2FNA A;  3FUU A;  5KPZ A;  1IXS B;  1Z59 A;  2D7H A;  1T3T A;  2JA2 A;  4DR4 M;  5E26 A;  3TE6 A;  4DV0 M;  5EP2 A;  4JI5 M;  3H4M A;  5FTK A;  2Q2E B;  1ORY B;  4FW9 A;  4XBO A;  1Z5C A;  4B3R M;  4M9X A;  2XFS A;  2QBY B;  4L8R C;  4PDI A;  4LJ8 A;  3VK7 A;  2V6Z M;  4AG5 A;  3L26 A;  2F5N A;  1SXJ C;  1OJL A;  4D82 A;  2UXC M;  2C9C A;  3FUT A;  3VKH A;  1TGU A;  5KQ8 A;  3AKZ A;  2KZS A;  1W5T A;  4GC9 A;  5ITR A;  2HL7 A;  3NBI A;  4LY6 A;  3J2P B;  2ZAN A;  4QHS A;  3LMM A;  2F4V M;  2BJW A;  3KS8 A;  5IT9 S;  5EXX A;  2DXI A;  3SAR A;  3SHF A;  3JR4 A;  4KLN A;  1HNW M;  4IBC A;  4MM3 B;  4AG6 A;  4AI6 A;  2E5L M;  3C58 A;  2P5T A;  2XEP A;  3GLI B;  3SAU A;  5DYI A;  2XZF A;  2CE7 A;  1TH4 A;  2QPA A;  2LWX A;  4GMQ A;  4II7 A;  4LJA A;  2Z4R A;  2F5P A;  3U6M A;  5ITY A;  1OFH A;  4D81 A;  1R6B X;  4IBJ A;  5A2Q S;  3I4V A;  3HKP A;  4DUZ M;  4JN6 A;  4RF0 A;  3T1Y M;  3DA1 A;  4AW4 A;  3J7B A;  2XLJ A;  1NY5 A;  3FYD A;  3SAW A;  1IXR C;  4JXJ A;  4LJ7 A;  2DWZ B;  4GC5 A;  3LVW A;  5LMU M;  3EIE A;  3EIH A;  2NQ8 C;  3TPZ A;  1Z6T A;  1N33 M;  4DR6 M;  3HU3 A;  2XH9 A;  2DHR A;  4DUY M;  1YSY A;  3FUV A;  1YUB A;  4AQY M;  3QAU A;  3WHK A;  4NRW A;  1KSF X;  4LF9 M;  2Z7J A;  4JI1 M;  2UXD M;  3FUX A;  4DR1 M;  1FJG M;  4X65 M;  3KS4 A;  1I4W A;  4IBG A;  4I4L A;  2G5G X;  3GLH B;  1E32 A;  2OPF A;  2C99 A;  2LNH C;  3FTD A;  3K1J A;  5DNY A;  1E9S A;  1QQW A;  5BPV A;  2D7E A;  4LG2 A;  3PNV A;  1SXJ D;  1HQY E;  1IM2 A;  3OTO M;  3D8B A;  4OW0 A;  4IBK A;  3U6D A;  5ITX E;  3IG8 A;  1TDH A;  4LF8 M;  3HWS A;  2I7P A;  2RGO A;  1QAO A;  1HT2 E;  3HJQ A;  4S12 A;  4B7F A;  4MGH A;  3U61 B;  1L2D A;  2Z4S A;  3MK6 A;  4OVZ A;  4JYA M;  4M0D A;  3ILK A;  2X4A A;  3T1H M;  2F5O A;  3GRU A;  4W5W A;  3HHZ A;  4TUW A;  3KOX E;  2VII A;  2KW0 A;  3FYC A;  3M7G A;  4K0K M;  4DV7 M;  4IBB A;  2R4E A;  5ITQ A;  1PJI A;  4REZ A;  4FCT A;  2C9O A;  2KA6 B;  3J80 S;  4BBA A;  1XMO M;  3RGP A;  4JI0 M;  1K3X A;  1N34 M;  5E6J A;  1J09 A;  3M0E A;  4GRI A;  2DWN A;  4GIP A;  2QP9 X;  4M9S A;  3VDP A;  1K82 A;  3K8Z A;  2D7G A;  1KFV A;  1YE9 A;  2C98 A;  2Y20 A;  2UXB M;  1N78 A;  3U5Z B;  3GRY A;  3ZC7 B;  1DO0 A;  1OFI A;  4MGY E;  2XFT A;  4WW0 A;  2DVW B;  3U6E A;  1VDD A;  1TDZ A;  2F5S A;  3SAS A;  3CF2 A;  4JI2 M;  1TH3 A;  2V1C A;  1G59 A;  3SHG B;  3GQ4 A;  3U61 A;  4QNR A;  1IQP A;  2C96 A;  4R3D A;  4B7G A;  1Q3C A;  3PFI A;  1MX0 A;  1HNX M;  3SAV A;  3SBJ A;  2XSZ D;  2RGH A;  2ZBK B;  4CHT B;  4LZJ A;  2ERC A;  4LJ4 A;  4LRT A;  3WHL A;  2UUC M;  3UK6 A;  1K3W A;  3U6Q A;  4GKK M;  3KDS E;  3A42 A;  5H37 D;  3SAT A;  3VDU A;  3KP1 E;  1XNR M;  7CAT A;  3U6P A;  4FCV A;  2YFQ A;  2CEA A;  4LF7 M;  2DZO B;  4P16 A;  1N75 A;  2J7N A;  1L2B A;  4B3S M;  2XZU A;  2O5R A;  1UM8 A;  2FE8 A;  3DFZ A;  4BB9 A;  1NHW C;  4AKH A;  1NVM A;  3PXG A;  3FTE A;  5EXP A;  4MH0 E;  4I81 A;  4MB7 A;  3ZCB B;  1GKI A;  3A46 A;  3JR5 A;  3AV0 A;  4FD2 A;  4IBE A;  4QNM A;  3GQ5 A;  1R2Y A;  1GL6 A;  4L15 A;  3QWL A;  4DV1 M;  2XSZ A;  3U60 A;  4YHH M;  3A45 A;  4IBD A;  3KOW E;  1SXJ B;  4LGY A;  2VQF M;  4LJ6 A;  2CV2 A;  4B7H A;  3HHY A;  1IY1 A;  4PCZ A;  3M6A A;  5ITU A;  2QZ4 A;  3HGI A;  3NWL A;  2KZU A;  3KW6 A;  3FD9 A;  4GIT A;  1WXQ A;  1S3S A;  2R18 A;  3U6S A;  5FTM A;  3I51 A;  2LXE A;  2F5Q A;  4M9Z A;  1NHG C;  3GPP A;  3B9P A;  4NSR A;  1R2Z A;  4LRS A;  4JI7 M;  3VLF B;  2UUA M;  3MJ5 A;  4FWD A;  4X62 M;  3HJ8 A;  1Z5B A;  1N32 M;  1IBK M;  3CTW B;  2W82 A;  4KO8 A;  4EIW A;  4M0W A;  3GRV A;  3GLH A;  1IXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...