2EJSA

Solution structure of ruh-076, a human cue domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
GSSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RUH-076, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Autocrine motility factor receptor, isoform 2
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ejsA00
1HT1E 2CP8A 2JY5A 1G41A 1HT2E 3T6PA 2ZTCA 1T6OA 2R0IA 3E21A 3FRIA 2EKFA 1CUKA 1ZMUA 2DAKA 2LVPC 1MN3A 3LCVB 2BWBA 2B3TA 1IM2A 1ZMWA 2EKKA 1T43A 1F4IA 1ZMVA 1R4GA 1TTEA 2LVOC 1DO2A 4UN2B 3B89A 2L4FA 2JY7A 2OO9A 1E94E 1OQYA 4G3OA 1KYIA 2KNZA 1Q02A 2HWJA 1C7YA 1NV9A 2KHHA 4F1IA 3LCUA 2LVNC 4HEOA 4R71A 1OTRA 2DKLA 1HJPA 2JY6B 3K9OA 1WJ7A 1UFZA 3H4JA 2DAEA 2MR9A 1P3QQ 1EFUB 2L2DA 2JY8A 1VDLA 2H5XA 3MMPA 1IFYA 3BBZA 2QNJA 2KNAA 2WZJA 4DBGB 1G3IA 1VEKA 2QHOB 2DZLA 4WP2A 2DHYA 3FRHA 1AIPC 3GLFE 1OKSA 3GLGE 1SG9A 2LVAA 1XB2B 1PGYA 2JNHA 3FE3A 5JI2E 2QSFX 3IHPA 1DO0A 1VEGA 1DV0A 1HQYE 2DNAA 1WGLA 1V92A 2KNVA 2BWEA 2JZ1A 4F2LA 1A5TA 2MROB 3GLHE 1OAIA 2K0BX 2K9DA 2JUJA 1QZEA 2HAKA 2O25A 2EJSA 2L4EA 2DENA 3GLIE 3K9PA 2JP7A 1WHCA 2MGWA 3E46A 2OOAA 2DAMA 1XXHE 2ZTDA 1WR1B 5DFLA 2OOBA 2CWBA 2LVQD 1TR8A 1NV8A 2G3QA 4Q7JA 2MJ5B 2RRUA 1BVSA 2DI0A 1VG5A 1IXSA 1WIVA 2DAIA 1JR3E 1VEJA 2LBCA 1YLAA 1VQ1A 1G4AE 2JZ0A 3IECA 1ZV1A 3F92A 2DAGA 1WGNA 1Y8GA 2LTUA 1GO5A 4GEWA
chains in the Genus database with same CATH superfamily
3KSJA 5IREB 3U6LA 2I7NA 2R4EA 4II7A 4M9ZA 1HR0M 1XNQM 3HJQA 4DR5M 2EUCA 2F5PA 2DWLA 4IBKA 2K6BA 4G4OA 3FRIA 1XMOM 4B3TM 2EKFA 5IWAM 3TQSA 4AKHA 4B7HA 4LF6M 3U60A 3LCVB 3MHVC 1Z5AA 2MH8A 4KODA 2EKKA 3CF6E 2XSZA 4OW0A 4JI6M 3SASA 4PDIA 2CV2A 1QUTA 1R4GA 3A46A 1EIJA 1OIPA 1TTEA 1LV7A 3HU3A 1LTMA 4GIPA 4DV6M 2UU9M 3RGPA 4PT5A 4NRWA 3L28A 3SYKA 4A3VB 1L1ZA 3T15A 3GO8A 3GLFA 1C7YA 4DV0M 3GRRA 4NOOB 2BNKA 1VDDA 4I4LA 2LWXA 3CF0A 3T1YM 3DFZA 1NJGA 4LFAM 3W67A 1IBLM 3DZDA 1HQCA 3Q8GA 4LZZA 4W5WA 3FTFA 3KOWE 2FE8A 1IN5A 1UFZA 3WHKA 4AI6A 4LZJA 1EFUB 1JB0F 3SHGB 4FW9A 5IZ7D 2QNJA 2Z4RA 2V6ZM 1G71A 3GLGB 3LQQA 2KNAA 2VIIA 4DBGB 3CTWB 3PVSA 3JR4A 3KS8A 3KFUG 3SARA 2ZAMA 4IBJA 1OAOC 2FS1A 3UGJA 3FYDA 1PGYA 4JV5M 3QYEA 2RGOA 1K82A 3IG5A 1VEGA 2DNAA 1WGLA 1K3WA 2KNVA 2BWEA 1E9SA 2MROB 1OAIA 3SC3A 1TDHA 3M6AA 2HAKA 1E32A 1G59A 2DZOB 4MGYE 3NBIA 2QQ8A 1ZAEA 4CJ6A 3AJIB 3BOSA 4AKIA 2JP7A 1YUBA 2QPAA 4RNAA 2MGWA 1MX0A 4M9XA 3TPZA 1H6UA 4IBGA 3SBJA 1N77A 4AW4A 5ITRA 1OFHA 2VF7A 1PJQA 2NQ8C 3R9XB 1R7RA 3E9SA 1GL7A 4CIZA 1IBKM 2KXEA 4YHHM 1QDRA 2LVQD 3GQ5A 4PDGA 2RKOA 2UXBM 2D7EA 2G3QA 3TWKA 2XLJA 2MJ5B 2J7NA 1YE9A 3LW5F 1BVSA 4OU7A 1IXSA 1WIVA 4OVZA 2ZM6M 3C3EA 5DNYA 5ITYA 4TUWA 5E6JA 3J80S 1R5LA 2ERCA 3ZCBB 3VDUA 1IXZA 4WW0A 3W68A 1G4AE 4LRSA 2X49A 1IY1A 3GPYA 4Z8XA 3HKPA 5FSWA 5EQTA 5DYIA 3F92A 2DAGA 1XXHA 2V1UA 5FTNA 1XNRM 4LJ8A 2FFJA 2LNHC 4JI1M 1QAOA 1L2BA 1E9RA 3IG8A 5BR8M 3GLGA 4XBOA 1HT1E 3L2AA 2R62A 4Y28F 1PM5A 1HT2E 2ZAOA 3SMPA 4QHTA 2ZTCA 3QYBA 3DOAA 1XMQM 2R0IA 3SMSA 4LF5M 3B7QA 1CUKA 4HL4A 2ZBKB 4D81A 7CATA 2I7PA 4QOSA 4JI2M 1MN3A 2BWBA 4G4RA 5FLXS 3GLHA 4ITQA 4FD2A 3QWLA 4LFBM 1IM2A 1ZMWA 1T43A 1F4IA 3UZUA 4GITA 3C9PA 1MJGM 2HKJA 2UUCM 2Q2EB 2LVOC 5LMNM 1SXJD 4UN2B 2C5RA 1NNUC 3SATA 3B89A 4AG6A 4QOZC 2JY7A 4G3OA 4X65M 1PRBA 3JR5A 4BB9A 2Y0TA 2HWJA 2E5LM 1NV9A 2KHHA 5KPTA 2FNAA 3KW6A 1PJSA 3J2PB 1SXJA 3LCUA 4DV4M 4QNMA 4HEOA 1ORYB 2C96A 3K1JA 4MB7A 4B7FA 4I81A 4R71A 3AOEC 1N36M 2QBYA 1OTRA 2M5ZA 3PNVA 4PD2A 4KLNA 3H4JA 3GPXA 3Q8XA 3U6CA 2XZFA 2RGHA 3MMPA 4JI0M 2UUAM 2BJVA 3I01M 4DV3M 4G6ZA 2F5NA 3KS4A 3K8ZA 3U60B 1IXRC 1G3IA 5JI3E 2HHHM 3U5ZB 2Z8YM 5L8RF 3FRHA 4LF4M 4D82A 3GLFE 4RKUF 3LVWA 1OKSA 2G8LA 1SG9A 4JI3M 2LVAA 3U6QA 1N32M 1JR3D 3L27A 3SAUA 3I04M 1UM8A 3VK8A 2YR0A 3FE3A 1KSFX 1NHWC 2QSFX 3HHYA 5JI2E 4JI8M 1DV0A 3U6OA 3TWLA 4B08A 1NVMA 4LJ4A 4EIWA 5C1BA 1V92A 3FYCA 3GPPA 2R6FA 2JXNA 3GLFB 3UJNA 2JZ1A 1JR3A 2R44A 4NSOB 2K9DA 1HNWM 5EP3A 1L2DA 3KP1E 1QZEA 5EXTA 2O25A 2DZNB 4G4QA 1IN8A 3GPUA 4M0WA 4X66M 1N34M 4L16A 3V76A 3K9PA 5FTKA 3CF2A 2G5GX 1WHCA 4ZPXA 1QAQA 4R7GA 3ZQJA 1HNZM 3U6DA 2H1RA 2XFSA 1QUSA 1R6BX 1Z5BA 3FKEA 2OOAA 5F3WA 1WR1B 4LFCM 1NNJA 2OOBA 1QYRA 1XHBA 2CWBA 4D80A 2F4VM 4QNRA 2YFQA 1DGHA 2HL7A 2D7HA 1IN4A 4NXMM 1R2ZA 1PJTA 3U6SA 1QANA 2O01F 3VKHA 4DV2M 2DI0A 1L8QA 2A5YB 2DAIA 3W0LB 3I51A 1JR3E 2XF3A 3FUTA 4GC5A 2Y0QA 2CV1A 1YLAA 2KZSA 1VQ1A 2VF8A 2JZ0A 2GQFA 4S12A 4OX9M 2XFTA 3J7AS 1K3XA 1WGNA 2JWSA 1EE8A 4L6V6 3K2LA 4LCBA 3C3DA 5E26A 3U6EA 3M7GA 5H37D 1GJTA 3HU1A 1Z6TA 1OIZA 5IT9S 3EIEA 2JY5A 5C18A 1IY2A 4M0DA 4P17A 4MGHA 3RE8A 3RGSA 2C99A 4JN6A 1T6OA 1GKIA 3E21A 2L6OA 4REZA 1PJIA 2Z4SA 1W5SA 1ZMUA 2DWMA 2DAKA 2LVPC 1NY6A 3KSXA 2BJWA 2ZANA 3SHFA 1D0MA 4DR2M 1SXJC 3FUWA 2B3TA 4NSRA 1C1KA 4B3SM 2EO2A 2VDBB 4MGKE 1ZMVA 2C98A 2CHVA 3AOEA 4R3DA 3GLIA 3B9PA 5EP4A 2CV0A 5ITQA 1OJLA 3M0EA 3KXEC 4GHAA 5KPZA 1IN7A 4JXJA 2DWZB 3I4VA 2OO9A 4LGMA 1KYIA 2KNZA 3HHZA 1SXJB 1R2YA 4FCVA 4DR7M 4K0KM 2VQFM 4F1IA 4MGZE 1Q3BA 3GLHB 4NC6A 2CHQA 3HWSA 2LVNC 4RF1A 1TF0B 3TL4X 2GNOA 1N78A 1GJSA 2DKLA 2JY6B 4PCZA 1WJ7A 5DYGA 3DA1A 1JQJC 2DAEA 3PXGA 3EIHA 4IJEA 2XZUA 1GABA 3J7BA 1DGGA 2L2DA 2JY8A 1VDLA 4LY6A 1IFYA 1Q39A 2L7IA 3BBZA 2WSFF 3D8LA 4RF0A 4GMQA 4JYAM 4LJAA 4BBAA 3KOXE 2KRKA 1D2NA 1L1TA 4B3RM 2LXEA 1Z59A 3AV0A 4WP2A 2DHYA 4IJFA 5EXPA 2UXDM 2N35A 3GRVA 3BXWA 4GKKM 3GLGE 3FTDA 1FNNA 2R4JA 3SFZA 1D0KA 4LJ5A 4DR3M 1XC8A 1XB2B 3FUUA 3U61B 2JNHA 2CHGA 2OPFA 1IXSB 4OVZB 1N75A 1Z5CA 3D8BA 3ZH9B 4DR6M 2LH0A 2KA6B 2L7HA 4XK8F 2F5SA 1HNXM 1WXQA 4LJ9A 4FVMA 3THGA 4F2LA 3FUVA 1A5TA 3VKGA 2F5QA 2R46A 1W5TA 2O5RA 3B7NA 2K0BX 1NJFA 4L4UA 3UMMA 1PJJA 4LG2A 3VDPA 4LJ6A 4NL4H 1J09A 1TH3A 4NRVA 1IY0A 4XGIA 2UUBM 2L4EA 4FWGA 2DENA 3GQ4A 3A98B 3I4YA 1GVNA 2HCBA 4L8RC 3E46A 1TDZA 1GL6A 2OQ4A 1ZQ9A 3GLIB 3J81S 1FJGM 2DVWB 5FTJA 2DAMA 2ZTDA 1AUAA 1TH4A 3HHXA 4FCTA 4MM3B 5ITXA 4B7GA 3GP1A 3FTCA 4LF7M 2J7OA 2KRUA 3LMMA 3NWLA 2JA2A 4M9SA 4DR4M 3W0FA 4QHSA 4AQYM 4HLQA 3FUXA 4IBIA 3HJSA 3FTEA 1VG5A 2QCUA 2DHRA 1VEJA 2CE7A 1QQWA 3AOGA 2LBCA 2XH9A 4ANRA 2QZ4A 2R65A 4YY3M 3R8FA 3KP0E 4AG5A 2LHCA 4NXNM 4WURA 2X8AA 2QENA 1Y8GA 1GO5A 2XSZD 2DXIA 4I5SA 2QBYB 3U5ZA 4GEWA 4L15A 4GC9A 3VFDA 1V34A 3B7ZA 3LQRA 2CP8A 2V1CA 1G41A 4X62M 3T6PA 4P16A 4IBBA 3FD9A 4FWHA 3HU2A 3GQ3A 3H4MA 5ITXE 3L25A 2WSCF 1SXJE 4KO8A 2FOIC 4CHTB 4DUYM 5LMUM 4CGYB 3L26A 2YNMD 4LRTA 1S3SA 1MU5A 5EXXA 1NO1A 2UXCM 4FCWA 1IQPA 3HY5A 1DO2A 3SYLA 1T3TA 3CGWA 3ZC7B 4Z6YA 4JI4M 1QAMA 2L4FA 1E94E 1OQYA 2CEAA 5ITUA 4MGIE 2CRUA 2W82A 5KQDA 1Q02A 2P5TA 3OTOM 3RFWA 3MK6A 4GH9A 5A2QS 1DGBA 4IBFA 4JI7M 4LGYA 1X37A 4KT0F 5EJCA 1YSYA 4GKJM 3KOYE 1HJPA 3K9OA 3NBXX 4FWDA 2KZUA 5FTMA 2MR9A 4X64M 2Z3XA 5BPVA 1P3QQ 2FH0A 3QAUA 5KQ8A 3MJ5A 2YQZA 3GRYA 5ITTA 2H5XA 2Y21A 5KO3A 1NY5A 5FTLA 2WZJA 3AL0C 3U61A 3E4RA 1VEKA 2LHGA 2QHOB 4MH0E 2DZLA 3HX3A 1AIPC 4G4NA 1TH2A 3U6MA 4JI5M 1TGUA 3HJ8A 1IN6A 1Q3CA 5EP1A 3A42A 2C9OA 3KDSE 1DGHB 2CUZA 3TWMA 3SAWA 4DV5M 2KW0A 3UK6A 1NHGC 1DO0A 3IHPA 2L09A 4BLCA 1HQYE 2XEPA 1QDTA 1OFIA 1V33A 4IBCA 3T1HM 2APLA 4I8OA 5EXSA 3HZJA 2C9CA 2KEBA 3GLHE 3PFIA 5GKNA 3C58A 5EP2A 2JUJA 2Z7JA 1IBMM 4GHLA 3PNYA 3B74A 1XXHB 2DWNA 2QP9X 4AZFA 1J7KA 2EJSA 2X4AA 3SAVA 4GRIA 4DUZM 8CATA 3GLIE 2R45A 4L78A 4LF8M 3HGIA 3T38A 4B3MM 2M60A 5KPRA 1I4WA 1QZMA 2K47A 3KVWA 4IIWA 1J5EM 2VQEM 1NSFA 3J27B 3WHLA 1XXHE 5DFLA 3K92A 1XWIA 1GLNA 1KFVA 3JAMS 1G8PA 2EA0A 4CISA 4LJ7A 3A45A 3KOZE 1TR8A 1NV8A 2AHMA 3AFHA 4Q7JA 3VK7A 4IBEA 3L29A 1D0LA 2RRUA 2WSEF 4KHPM 3U6PA 1I94M 2CFOA 2J5YA 4DR1M 3LVVA 4DV7M 1DGFA 3IECA 4IBDA 2D7GA 2XGNA 1RU3A 3HHWA 1ZV1A 3VLFB 1L2CA 1N33M 3TE6A 1QVRA 3ILKA 3GRUA 2LTUA 3AKZA 2R18A 2Y20A 4DV1M 2F5OA 4LF9M 2KDLA 4AKGA
chains in the Genus database with same CATH topology
1HT1E 2CP8A 2JY5A 1G41A 1HT2E 3T6PA 2ZTCA 1T6OA 2R0IA 3E21A 3FRIA 2EKFA 1CUKA 1ZMUA 2DAKA 2LVPC 1MN3A 3LCVB 2BWBA 2B3TA 1IM2A 1ZMWA 2EKKA 1T43A 1F4IA 1ZMVA 1R4GA 1TTEA 2LVOC 1DO2A 4UN2B 3B89A 2L4FA 2JY7A 2OO9A 1E94E 1OQYA 4G3OA 1KYIA 2KNZA 1Q02A 2HWJA 1C7YA 1NV9A 2KHHA 4F1IA 3LCUA 2LVNC 4HEOA 4R71A 1OTRA 2DKLA 1HJPA 2JY6B 3K9OA 1WJ7A 1UFZA 3H4JA 2DAEA 2MR9A 1P3QQ 1EFUB 2L2DA 2JY8A 1VDLA 2H5XA 3MMPA 1IFYA 3BBZA 2QNJA 2KNAA 2WZJA 4DBGB 1G3IA 1VEKA 2QHOB 2DZLA 4WP2A 2DHYA 3FRHA 1AIPC 3GLFE 1OKSA 3GLGE 1SG9A 2LVAA 1XB2B 1PGYA 2JNHA 3FE3A 5JI2E 2QSFX 3IHPA 1DO0A 1VEGA 1DV0A 1HQYE 2DNAA 1WGLA 1V92A 2KNVA 2BWEA 2JZ1A 4F2LA 1A5TA 2MROB 3GLHE 1OAIA 2K0BX 2K9DA 2JUJA 1QZEA 2HAKA 2O25A 2EJSA 2L4EA 2DENA 3GLIE 3K9PA 2JP7A 1WHCA 2MGWA 3E46A 2OOAA 2DAMA 1XXHE 2ZTDA 1WR1B 5DFLA 2OOBA 2CWBA 2LVQD 1TR8A 1NV8A 2G3QA 4Q7JA 2MJ5B 2RRUA 1BVSA 2DI0A 1VG5A 1IXSA 1WIVA 2DAIA 1JR3E 1VEJA 2LBCA 1YLAA 1VQ1A 1G4AE 2JZ0A 3IECA 1ZV1A 3F92A 2DAGA 1WGNA 1Y8GA 2LTUA 1GO5A 4GEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HT1 E;  2CP8 A;  2JY5 A;  1G41 A;  1HT2 E;  3T6P A;  2ZTC A;  1T6O A;  2R0I A;  3E21 A;  3FRI A;  2EKF A;  1CUK A;  1ZMU A;  2DAK A;  2LVP C;  1MN3 A;  3LCV B;  2BWB A;  2B3T A;  1IM2 A;  1ZMW A;  2EKK A;  1T43 A;  1F4I A;  1ZMV A;  1R4G A;  1TTE A;  2LVO C;  1DO2 A;  4UN2 B;  3B89 A;  2L4F A;  2JY7 A;  2OO9 A;  1E94 E;  1OQY A;  4G3O A;  1KYI A;  2KNZ A;  1Q02 A;  2HWJ A;  1C7Y A;  1NV9 A;  2KHH A;  4F1I A;  3LCU A;  2LVN C;  4HEO A;  4R71 A;  1OTR A;  2DKL A;  1HJP A;  2JY6 B;  3K9O A;  1WJ7 A;  1UFZ A;  3H4J A;  2DAE A;  2MR9 A;  1P3Q Q;  1EFU B;  2L2D A;  2JY8 A;  1VDL A;  2H5X A;  3MMP A;  1IFY A;  3BBZ A;  2QNJ A;  2KNA A;  2WZJ A;  4DBG B;  1G3I A;  1VEK A;  2QHO B;  2DZL A;  4WP2 A;  2DHY A;  3FRH A;  1AIP C;  3GLF E;  1OKS A;  3GLG E;  1SG9 A;  2LVA A;  1XB2 B;  1PGY A;  2JNH A;  3FE3 A;  5JI2 E;  2QSF X;  3IHP A;  1DO0 A;  1VEG A;  1DV0 A;  1HQY E;  2DNA A;  1WGL A;  1V92 A;  2KNV A;  2BWE A;  2JZ1 A;  4F2L A;  1A5T A;  2MRO B;  3GLH E;  1OAI A;  2K0B X;  2K9D A;  2JUJ A;  1QZE A;  2HAK A;  2O25 A;  2EJS A;  2L4E A;  2DEN A;  3GLI E;  3K9P A;  2JP7 A;  1WHC A;  2MGW A;  3E46 A;  2OOA A;  2DAM A;  1XXH E;  2ZTD A;  1WR1 B;  5DFL A;  2OOB A;  2CWB A;  2LVQ D;  1TR8 A;  1NV8 A;  2G3Q A;  4Q7J A;  2MJ5 B;  2RRU A;  1BVS A;  2DI0 A;  1VG5 A;  1IXS A;  1WIV A;  2DAI A;  1JR3 E;  1VEJ A;  2LBC A;  1YLA A;  1VQ1 A;  1G4A E;  2JZ0 A;  3IEC A;  1ZV1 A;  3F92 A;  2DAG A;  1WGN A;  1Y8G A;  2LTU A;  1GO5 A;  4GEW A; 
#chains in the Genus database with same CATH topology
 3KSJ A;  5IRE B;  3U6L A;  2I7N A;  2R4E A;  4II7 A;  4M9Z A;  1HR0 M;  1XNQ M;  3HJQ A;  4DR5 M;  2EUC A;  2F5P A;  2DWL A;  4IBK A;  2K6B A;  4G4O A;  3FRI A;  1XMO M;  4B3T M;  2EKF A;  5IWA M;  3TQS A;  4AKH A;  4B7H A;  4LF6 M;  3U60 A;  3LCV B;  3MHV C;  1Z5A A;  2MH8 A;  4KOD A;  2EKK A;  3CF6 E;  2XSZ A;  4OW0 A;  4JI6 M;  3SAS A;  4PDI A;  2CV2 A;  1QUT A;  1R4G A;  3A46 A;  1EIJ A;  1OIP A;  1TTE A;  1LV7 A;  3HU3 A;  1LTM A;  4GIP A;  4DV6 M;  2UU9 M;  3RGP A;  4PT5 A;  4NRW A;  3L28 A;  3SYK A;  4A3V B;  1L1Z A;  3T15 A;  3GO8 A;  3GLF A;  1C7Y A;  4DV0 M;  3GRR A;  4NOO B;  2BNK A;  1VDD A;  4I4L A;  2LWX A;  3CF0 A;  3T1Y M;  3DFZ A;  1NJG A;  4LFA M;  3W67 A;  1IBL M;  3DZD A;  1HQC A;  3Q8G A;  4LZZ A;  4W5W A;  3FTF A;  3KOW E;  2FE8 A;  1IN5 A;  1UFZ A;  3WHK A;  4AI6 A;  4LZJ A;  1EFU B;  1JB0 F;  3SHG B;  4FW9 A;  5IZ7 D;  2QNJ A;  2Z4R A;  2V6Z M;  1G71 A;  3GLG B;  3LQQ A;  2KNA A;  2VII A;  4DBG B;  3CTW B;  3PVS A;  3JR4 A;  3KS8 A;  3KFU G;  3SAR A;  2ZAM A;  4IBJ A;  1OAO C;  2FS1 A;  3UGJ A;  3FYD A;  1PGY A;  4JV5 M;  3QYE A;  2RGO A;  1K82 A;  3IG5 A;  1VEG A;  2DNA A;  1WGL A;  1K3W A;  2KNV A;  2BWE A;  1E9S A;  2MRO B;  1OAI A;  3SC3 A;  1TDH A;  3M6A A;  2HAK A;  1E32 A;  1G59 A;  2DZO B;  4MGY E;  3NBI A;  2QQ8 A;  1ZAE A;  4CJ6 A;  3AJI B;  3BOS A;  4AKI A;  2JP7 A;  1YUB A;  2QPA A;  4RNA A;  2MGW A;  1MX0 A;  4M9X A;  3TPZ A;  1H6U A;  4IBG A;  3SBJ A;  1N77 A;  4AW4 A;  5ITR A;  1OFH A;  2VF7 A;  1PJQ A;  2NQ8 C;  3R9X B;  1R7R A;  3E9S A;  1GL7 A;  4CIZ A;  1IBK M;  2KXE A;  4YHH M;  1QDR A;  2LVQ D;  3GQ5 A;  4PDG A;  2RKO A;  2UXB M;  2D7E A;  2G3Q A;  3TWK A;  2XLJ A;  2MJ5 B;  2J7N A;  1YE9 A;  3LW5 F;  1BVS A;  4OU7 A;  1IXS A;  1WIV A;  4OVZ A;  2ZM6 M;  3C3E A;  5DNY A;  5ITY A;  4TUW A;  5E6J A;  3J80 S;  1R5L A;  2ERC A;  3ZCB B;  3VDU A;  1IXZ A;  4WW0 A;  3W68 A;  1G4A E;  4LRS A;  2X49 A;  1IY1 A;  3GPY A;  4Z8X A;  3HKP A;  5FSW A;  5EQT A;  5DYI A;  3F92 A;  2DAG A;  1XXH A;  2V1U A;  5FTN A;  1XNR M;  4LJ8 A;  2FFJ A;  2LNH C;  4JI1 M;  1QAO A;  1L2B A;  1E9R A;  3IG8 A;  5BR8 M;  3GLG A;  4XBO A;  1HT1 E;  3L2A A;  2R62 A;  4Y28 F;  1PM5 A;  1HT2 E;  2ZAO A;  3SMP A;  4QHT A;  2ZTC A;  3QYB A;  3DOA A;  1XMQ M;  2R0I A;  3SMS A;  4LF5 M;  3B7Q A;  1CUK A;  4HL4 A;  2ZBK B;  4D81 A;  7CAT A;  2I7P A;  4QOS A;  4JI2 M;  1MN3 A;  2BWB A;  4G4R A;  5FLX S;  3GLH A;  4ITQ A;  4FD2 A;  3QWL A;  4LFB M;  1IM2 A;  1ZMW A;  1T43 A;  1F4I A;  3UZU A;  4GIT A;  3C9P A;  1MJG M;  2HKJ A;  2UUC M;  2Q2E B;  2LVO C;  5LMN M;  1SXJ D;  4UN2 B;  2C5R A;  1NNU C;  3SAT A;  3B89 A;  4AG6 A;  4QOZ C;  2JY7 A;  4G3O A;  4X65 M;  1PRB A;  3JR5 A;  4BB9 A;  2Y0T A;  2HWJ A;  2E5L M;  1NV9 A;  2KHH A;  5KPT A;  2FNA A;  3KW6 A;  1PJS A;  3J2P B;  1SXJ A;  3LCU A;  4DV4 M;  4QNM A;  4HEO A;  1ORY B;  2C96 A;  3K1J A;  4MB7 A;  4B7F A;  4I81 A;  4R71 A;  3AOE C;  1N36 M;  2QBY A;  1OTR A;  2M5Z A;  3PNV A;  4PD2 A;  4KLN A;  3H4J A;  3GPX A;  3Q8X A;  3U6C A;  2XZF A;  2RGH A;  3MMP A;  4JI0 M;  2UUA M;  2BJV A;  3I01 M;  4DV3 M;  4G6Z A;  2F5N A;  3KS4 A;  3K8Z A;  3U60 B;  1IXR C;  1G3I A;  5JI3 E;  2HHH M;  3U5Z B;  2Z8Y M;  5L8R F;  3FRH A;  4LF4 M;  4D82 A;  3GLF E;  4RKU F;  3LVW A;  1OKS A;  2G8L A;  1SG9 A;  4JI3 M;  2LVA A;  3U6Q A;  1N32 M;  1JR3 D;  3L27 A;  3SAU A;  3I04 M;  1UM8 A;  3VK8 A;  2YR0 A;  3FE3 A;  1KSF X;  1NHW C;  2QSF X;  3HHY A;  5JI2 E;  4JI8 M;  1DV0 A;  3U6O A;  3TWL A;  4B08 A;  1NVM A;  4LJ4 A;  4EIW A;  5C1B A;  1V92 A;  3FYC A;  3GPP A;  2R6F A;  2JXN A;  3GLF B;  3UJN A;  2JZ1 A;  1JR3 A;  2R44 A;  4NSO B;  2K9D A;  1HNW M;  5EP3 A;  1L2D A;  3KP1 E;  1QZE A;  5EXT A;  2O25 A;  2DZN B;  4G4Q A;  1IN8 A;  3GPU A;  4M0W A;  4X66 M;  1N34 M;  4L16 A;  3V76 A;  3K9P A;  5FTK A;  3CF2 A;  2G5G X;  1WHC A;  4ZPX A;  1QAQ A;  4R7G A;  3ZQJ A;  1HNZ M;  3U6D A;  2H1R A;  2XFS A;  1QUS A;  1R6B X;  1Z5B A;  3FKE A;  2OOA A;  5F3W A;  1WR1 B;  4LFC M;  1NNJ A;  2OOB A;  1QYR A;  1XHB A;  2CWB A;  4D80 A;  2F4V M;  4QNR A;  2YFQ A;  1DGH A;  2HL7 A;  2D7H A;  1IN4 A;  4NXM M;  1R2Z A;  1PJT A;  3U6S A;  1QAN A;  2O01 F;  3VKH A;  4DV2 M;  2DI0 A;  1L8Q A;  2A5Y B;  2DAI A;  3W0L B;  3I51 A;  1JR3 E;  2XF3 A;  3FUT A;  4GC5 A;  2Y0Q A;  2CV1 A;  1YLA A;  2KZS A;  1VQ1 A;  2VF8 A;  2JZ0 A;  2GQF A;  4S12 A;  4OX9 M;  2XFT A;  3J7A S;  1K3X A;  1WGN A;  2JWS A;  1EE8 A;  4L6V 6;  3K2L A;  4LCB A;  3C3D A;  5E26 A;  3U6E A;  3M7G A;  5H37 D;  1GJT A;  3HU1 A;  1Z6T A;  1OIZ A;  5IT9 S;  3EIE A;  2JY5 A;  5C18 A;  1IY2 A;  4M0D A;  4P17 A;  4MGH A;  3RE8 A;  3RGS A;  2C99 A;  4JN6 A;  1T6O A;  1GKI A;  3E21 A;  2L6O A;  4REZ A;  1PJI A;  2Z4S A;  1W5S A;  1ZMU A;  2DWM A;  2DAK A;  2LVP C;  1NY6 A;  3KSX A;  2BJW A;  2ZAN A;  3SHF A;  1D0M A;  4DR2 M;  1SXJ C;  3FUW A;  2B3T A;  4NSR A;  1C1K A;  4B3S M;  2EO2 A;  2VDB B;  4MGK E;  1ZMV A;  2C98 A;  2CHV A;  3AOE A;  4R3D A;  3GLI A;  3B9P A;  5EP4 A;  2CV0 A;  5ITQ A;  1OJL A;  3M0E A;  3KXE C;  4GHA A;  5KPZ A;  1IN7 A;  4JXJ A;  2DWZ B;  3I4V A;  2OO9 A;  4LGM A;  1KYI A;  2KNZ A;  3HHZ A;  1SXJ B;  1R2Y A;  4FCV A;  4DR7 M;  4K0K M;  2VQF M;  4F1I A;  4MGZ E;  1Q3B A;  3GLH B;  4NC6 A;  2CHQ A;  3HWS A;  2LVN C;  4RF1 A;  1TF0 B;  3TL4 X;  2GNO A;  1N78 A;  1GJS A;  2DKL A;  2JY6 B;  4PCZ A;  1WJ7 A;  5DYG A;  3DA1 A;  1JQJ C;  2DAE A;  3PXG A;  3EIH A;  4IJE A;  2XZU A;  1GAB A;  3J7B A;  1DGG A;  2L2D A;  2JY8 A;  1VDL A;  4LY6 A;  1IFY A;  1Q39 A;  2L7I A;  3BBZ A;  2WSF F;  3D8L A;  4RF0 A;  4GMQ A;  4JYA M;  4LJA A;  4BBA A;  3KOX E;  2KRK A;  1D2N A;  1L1T A;  4B3R M;  2LXE A;  1Z59 A;  3AV0 A;  4WP2 A;  2DHY A;  4IJF A;  5EXP A;  2UXD M;  2N35 A;  3GRV A;  3BXW A;  4GKK M;  3GLG E;  3FTD A;  1FNN A;  2R4J A;  3SFZ A;  1D0K A;  4LJ5 A;  4DR3 M;  1XC8 A;  1XB2 B;  3FUU A;  3U61 B;  2JNH A;  2CHG A;  2OPF A;  1IXS B;  4OVZ B;  1N75 A;  1Z5C A;  3D8B A;  3ZH9 B;  4DR6 M;  2LH0 A;  2KA6 B;  2L7H A;  4XK8 F;  2F5S A;  1HNX M;  1WXQ A;  4LJ9 A;  4FVM A;  3THG A;  4F2L A;  3FUV A;  1A5T A;  3VKG A;  2F5Q A;  2R46 A;  1W5T A;  2O5R A;  3B7N A;  2K0B X;  1NJF A;  4L4U A;  3UMM A;  1PJJ A;  4LG2 A;  3VDP A;  4LJ6 A;  4NL4 H;  1J09 A;  1TH3 A;  4NRV A;  1IY0 A;  4XGI A;  2UUB M;  2L4E A;  4FWG A;  2DEN A;  3GQ4 A;  3A98 B;  3I4Y A;  1GVN A;  2HCB A;  4L8R C;  3E46 A;  1TDZ A;  1GL6 A;  2OQ4 A;  1ZQ9 A;  3GLI B;  3J81 S;  1FJG M;  2DVW B;  5FTJ A;  2DAM A;  2ZTD A;  1AUA A;  1TH4 A;  3HHX A;  4FCT A;  4MM3 B;  5ITX A;  4B7G A;  3GP1 A;  3FTC A;  4LF7 M;  2J7O A;  2KRU A;  3LMM A;  3NWL A;  2JA2 A;  4M9S A;  4DR4 M;  3W0F A;  4QHS A;  4AQY M;  4HLQ A;  3FUX A;  4IBI A;  3HJS A;  3FTE A;  1VG5 A;  2QCU A;  2DHR A;  1VEJ A;  2CE7 A;  1QQW A;  3AOG A;  2LBC A;  2XH9 A;  4ANR A;  2QZ4 A;  2R65 A;  4YY3 M;  3R8F A;  3KP0 E;  4AG5 A;  2LHC A;  4NXN M;  4WUR A;  2X8A A;  2QEN A;  1Y8G A;  1GO5 A;  2XSZ D;  2DXI A;  4I5S A;  2QBY B;  3U5Z A;  4GEW A;  4L15 A;  4GC9 A;  3VFD A;  1V34 A;  3B7Z A;  3LQR A;  2CP8 A;  2V1C A;  1G41 A;  4X62 M;  3T6P A;  4P16 A;  4IBB A;  3FD9 A;  4FWH A;  3HU2 A;  3GQ3 A;  3H4M A;  5ITX E;  3L25 A;  2WSC F;  1SXJ E;  4KO8 A;  2FOI C;  4CHT B;  4DUY M;  5LMU M;  4CGY B;  3L26 A;  2YNM D;  4LRT A;  1S3S A;  1MU5 A;  5EXX A;  1NO1 A;  2UXC M;  4FCW A;  1IQP A;  3HY5 A;  1DO2 A;  3SYL A;  1T3T A;  3CGW A;  3ZC7 B;  4Z6Y A;  4JI4 M;  1QAM A;  2L4F A;  1E94 E;  1OQY A;  2CEA A;  5ITU A;  4MGI E;  2CRU A;  2W82 A;  5KQD A;  1Q02 A;  2P5T A;  3OTO M;  3RFW A;  3MK6 A;  4GH9 A;  5A2Q S;  1DGB A;  4IBF A;  4JI7 M;  4LGY A;  1X37 A;  4KT0 F;  5EJC A;  1YSY A;  4GKJ M;  3KOY E;  1HJP A;  3K9O A;  3NBX X;  4FWD A;  2KZU A;  5FTM A;  2MR9 A;  4X64 M;  2Z3X A;  5BPV A;  1P3Q Q;  2FH0 A;  3QAU A;  5KQ8 A;  3MJ5 A;  2YQZ A;  3GRY A;  5ITT A;  2H5X A;  2Y21 A;  5KO3 A;  1NY5 A;  5FTL A;  2WZJ A;  3AL0 C;  3U61 A;  3E4R A;  1VEK A;  2LHG A;  2QHO B;  4MH0 E;  2DZL A;  3HX3 A;  1AIP C;  4G4N A;  1TH2 A;  3U6M A;  4JI5 M;  1TGU A;  3HJ8 A;  1IN6 A;  1Q3C A;  5EP1 A;  3A42 A;  2C9O A;  3KDS E;  1DGH B;  2CUZ A;  3TWM A;  3SAW A;  4DV5 M;  2KW0 A;  3UK6 A;  1NHG C;  1DO0 A;  3IHP A;  2L09 A;  4BLC A;  1HQY E;  2XEP A;  1QDT A;  1OFI A;  1V33 A;  4IBC A;  3T1H M;  2APL A;  4I8O A;  5EXS A;  3HZJ A;  2C9C A;  2KEB A;  3GLH E;  3PFI A;  5GKN A;  3C58 A;  5EP2 A;  2JUJ A;  2Z7J A;  1IBM M;  4GHL A;  3PNY A;  3B74 A;  1XXH B;  2DWN A;  2QP9 X;  4AZF A;  1J7K A;  2EJS A;  2X4A A;  3SAV A;  4GRI A;  4DUZ M;  8CAT A;  3GLI E;  2R45 A;  4L78 A;  4LF8 M;  3HGI A;  3T38 A;  4B3M M;  2M60 A;  5KPR A;  1I4W A;  1QZM A;  2K47 A;  3KVW A;  4IIW A;  1J5E M;  2VQE M;  1NSF A;  3J27 B;  3WHL A;  1XXH E;  5DFL A;  3K92 A;  1XWI A;  1GLN A;  1KFV A;  3JAM S;  1G8P A;  2EA0 A;  4CIS A;  4LJ7 A;  3A45 A;  3KOZ E;  1TR8 A;  1NV8 A;  2AHM A;  3AFH A;  4Q7J A;  3VK7 A;  4IBE A;  3L29 A;  1D0L A;  2RRU A;  2WSE F;  4KHP M;  3U6P A;  1I94 M;  2CFO A;  2J5Y A;  4DR1 M;  3LVV A;  4DV7 M;  1DGF A;  3IEC A;  4IBD A;  2D7G A;  2XGN A;  1RU3 A;  3HHW A;  1ZV1 A;  3VLF B;  1L2C A;  1N33 M;  3TE6 A;  1QVR A;  3ILK A;  3GRU A;  2LTU A;  3AKZ A;  2R18 A;  2Y20 A;  4DV1 M;  2F5O A;  4LF9 M;  2KDL A;  4AKG A; 
#chains in the Genus database with same CATH homology
 1HT1 E;  2CP8 A;  2JY5 A;  1G41 A;  1HT2 E;  3T6P A;  2ZTC A;  1T6O A;  2R0I A;  3E21 A;  3FRI A;  2EKF A;  1CUK A;  1ZMU A;  2DAK A;  2LVP C;  1MN3 A;  3LCV B;  2BWB A;  2B3T A;  1IM2 A;  1ZMW A;  2EKK A;  1T43 A;  1F4I A;  1ZMV A;  1R4G A;  1TTE A;  2LVO C;  1DO2 A;  4UN2 B;  3B89 A;  2L4F A;  2JY7 A;  2OO9 A;  1E94 E;  1OQY A;  4G3O A;  1KYI A;  2KNZ A;  1Q02 A;  2HWJ A;  1C7Y A;  1NV9 A;  2KHH A;  4F1I A;  3LCU A;  2LVN C;  4HEO A;  4R71 A;  1OTR A;  2DKL A;  1HJP A;  2JY6 B;  3K9O A;  1WJ7 A;  1UFZ A;  3H4J A;  2DAE A;  2MR9 A;  1P3Q Q;  1EFU B;  2L2D A;  2JY8 A;  1VDL A;  2H5X A;  3MMP A;  1IFY A;  3BBZ A;  2QNJ A;  2KNA A;  2WZJ A;  4DBG B;  1G3I A;  1VEK A;  2QHO B;  2DZL A;  4WP2 A;  2DHY A;  3FRH A;  1AIP C;  3GLF E;  1OKS A;  3GLG E;  1SG9 A;  2LVA A;  1XB2 B;  1PGY A;  2JNH A;  3FE3 A;  5JI2 E;  2QSF X;  3IHP A;  1DO0 A;  1VEG A;  1DV0 A;  1HQY E;  2DNA A;  1WGL A;  1V92 A;  2KNV A;  2BWE A;  2JZ1 A;  4F2L A;  1A5T A;  2MRO B;  3GLH E;  1OAI A;  2K0B X;  2K9D A;  2JUJ A;  1QZE A;  2HAK A;  2O25 A;  2EJS A;  2L4E A;  2DEN A;  3GLI E;  3K9P A;  2JP7 A;  1WHC A;  2MGW A;  3E46 A;  2OOA A;  2DAM A;  1XXH E;  2ZTD A;  1WR1 B;  5DFL A;  2OOB A;  2CWB A;  2LVQ D;  1TR8 A;  1NV8 A;  2G3Q A;  4Q7J A;  2MJ5 B;  2RRU A;  1BVS A;  2DI0 A;  1VG5 A;  1IXS A;  1WIV A;  2DAI A;  1JR3 E;  1VEJ A;  2LBC A;  1YLA A;  1VQ1 A;  1G4A E;  2JZ0 A;  3IEC A;  1ZV1 A;  3F92 A;  2DAG A;  1WGN A;  1Y8G A;  2LTU A;  1GO5 A;  4GEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...