2EJSA

Solution structure of ruh-076, a human cue domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'GSSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autocrine motility factor receptor, isoform 2
molecule tags Ligase
source organism Homo sapiens
publication title Solution structure of RUH-076, a human CUE domain
rcsb
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ejsA00
4Q7JA 1NV9A 1TR8A 1TTEA 1WIVA 1AIPC 2R0IA 1NV8A 3H4JA 4DBGB 3B89A 2DAIA 1JR3E 2G3QA 1OAIA 3BBZA 1IFYA 2JZ1A 1WR1B 2QSFX 2HWJA 3E21A 1ZMVA 1ZV1A 2JUJA 2JY8A 2MGWA 1YLAA 2DHYA 2LVQD 1VDLA 1DV0A 1WHCA 2BWBA 3LCVB 3GLGE 2DI0A 1WGNA 2MR9A 2JNHA 1BVSA 2EKKA 2L4FA 5JI2E 1MN3A 1HJPA 2BWEA 2CWBA 2JY5A 1VEGA 1HQYE 1SG9A 1ZMWA 4R71A 2JY7A 2K9DA 1F4IA 2DNAA 2LVOC 3T6PA 1OKSA 3GLIE 1VEKA 2B3TA 2EKFA 1VG5A 2DAMA 2LVNC 1Y8GA 1IM2A 2OOAA 3FE3A 2KNVA 2KNZA 2O25A 4F2LA 4UN2B 1C7YA 2ZTDA 1E94E 2RRUA 1EFUB 1OQYA 1PGYA 2KNAA 2QNJA 3FRIA 1P3QQ 1XXHE 1OTRA 1Q02A 2JP7A 1CUKA 1G4AE 2L4EA 1DO0A 4G3OA 1VQ1A 2QHOB 3K9OA 1DO2A 4F1IA 2LVAA 1T6OA 2LVPC 2DENA 2JZ0A 3K9PA 1G41A 1HT1E 1WJ7A 3LCUA 2KHHA 4GEWA 1IXSA 2DAEA 2H5XA 1GO5A 5DFLA 2HAKA 1QZEA 1A5TA 4WP2A 1HT2E 2DKLA 2K0BX 2JY6B 2OO9A 3IHPA 1R4GA 1KYIA 1T43A 2MJ5B 2LTUA 2ZTCA 2OOBA 2MROB 2DAGA 2L2DA 2LBCA 1G3IA 1ZMUA 1V92A 4HEOA 3IECA 2CP8A 1XB2B 3MMPA 1VEJA 2DAKA 2WZJA 3F92A 3E46A 3FRHA 1WGLA 3GLFE 1UFZA 2EJSA 3GLHE 2DZLA
chains in the Genus database with same CATH superfamily
1ORYB 3C9PA 2UUBM 3JR5A 4B3SM 3HGIA 3K2LA 1NV8A 2H1RA 3UK6A 2QBYA 4LF8M 4IBBA 4RF1A 1D0MA 3LVVA 1T3TA 5FTNA 1IBKM 1EIJA 4DV1M 3E21A 1ZMVA 2LWXA 3B9PA 4GRIA 2JY8A 1IXZA 1YSYA 3AOEA 3HHXA 2MGWA 1SXJA 2I7NA 3KFUG 3ZCBB 4Z6YA 4JI2M 4IBJA 5KO3A 2XF3A 3ZQJA 4PDGA 8CATA 3AV0A 3HKPA 2C5RA 5EP1A 2V6ZM 3IG5A 2BWBA 3LCVB 3LMMA 4FWDA 1E9RA 4G6ZA 3WHLA 4LF4M 1GJTA 3Q8GA 1FJGM 4B08A 1NSFA 1QAMA 1S3SA 2F5NA 1QUTA 4LF6M 1TH2A 3GRYA 4CGYB 4AQYM 3TWMA 2CWBA 2BWEA 2CV1A 3KS8A 2EUCA 4R7GA 3HJSA 3K1JA 3J80S 2JY7A 2RGHA 2QBYB 1F4IA 1XMOM 4JV5M 2DNAA 1XMQM 2F4VM 1QAQA 3GLIE 1VEKA 2DAMA 1VG5A 1Y8GA 1IM2A 1SXJB 3HJQA 3KOXE 4HL4A 5KQDA 3HU2A 4QHSA 2M5ZA 4YY3M 2KNZA 3RE8A 3SARA 3KVWA 2DWMA 3L26A 1I94M 1OIZA 2R4JA 2XSZD 2O25A 1K3WA 5ITRA 4IBGA 1G59A 4UN2B 3SASA 2XZFA 1E94E 2Z8YM 4LF7M 3HU3A 2YQZA 1QVRA 5DNYA 1IN5A 3W0FA 4G4RA 1L2CA 3L28A 3M7GA 1W5SA 1OTRA 4JN6A 1CUKA 2UXCM 4KODA 4GKJM 2UUCM 1GABA 1VQ1A 2HL7A 4B7GA 2UUAM 3TQSA 3B7QA 1IN4A 2D7EA 3C3EA 4TUWA 4LGMA 1XWIA 4LRTA 1N34M 1DGHB 3J81S 4F1IA 2HHHM 4G4QA 1T6OA 4MH0E 3OTOM 4FW9A 1DGBA 5FTMA 1SXJE 3MHVC 4QNMA 1LV7A 2C99A 4G4OA 1XHBA 2J7NA 2KHHA 5IT9S 5EXXA 3I51A 4GC9A 2DAEA 4IJEA 4LY6A 3VDPA 2BJVA 3VKGA 2QQ8A 3HWSA 2Y21A 4NSRA 1HR0M 1GO5A 5DFLA 3AKZA 4MGYE 3KOWE 4NRVA 2P5TA 2K47A 3GQ5A 2VDBB 4WP2A 5FLXS 3PNYA 3U6PA 4NC6A 3U60B 1N78A 2APLA 1MX0A 4FWGA 3TWLA 1R4GA 2FH0A 2MJ5B 2D7HA 3EIEA 4GIPA 5ITQA 3ZC7B 2XEPA 2KA6B 3TWKA 1DGFA 2L2DA 4RKUF 1N36M 1ZMUA 3BXWA 4LJ9A 1V92A 4HEOA 2KZUA 2VF8A 5FTLA 5KPRA 3IECA 3MMPA 3MJ5A 2DXIA 2YNMD 2L7IA 2EO2A 3QAUA 3FRHA 1JR3D 3KXEC 2ZBKB 3FUTA 4BLCA 2E5LM 4YHHM 4PD2A 2EJSA 5E6JA 2DZLA 3W68A 3A46A 1NY6A 4Q7JA 1DGHA 1AIPC 2ERCA 2Q2EB 3H4JA 4LJAA 3L27A 2OPFA 4DBGB 2KZSA 2ZAOA 4MGHA 2X4AA 2C9OA 3QYBA 4AKGA 1IY1A 2DZOB 2N35A 2G3QA 1OAIA 4JI0M 4A3VB 4PCZA 1WR1B 4OVZA 1NY5A 2HWJA 3SMPA 1ZV1A 4M9ZA 1QUSA 3U6SA 4XGIA 2DHYA 4DR4M 1HNXM 5ITXA 2LXEA 3EIHA 4LZZA 1NO1A 1N75A 3DA1A 2X8AA 2CFOA 2X49A 3UZUA 1DV0A 1J7KA 5EXTA 1K82A 3B7NA 4QHTA 3GP1A 4L15A 1WHCA 4L16A 3GLHB 4P16A 1BVSA 1LTMA 5A2QS 2EKKA 4AKHA 1NHGC 1QDTA 2L4FA 4MGIE 3U61B 1Q39A 1HJPA 4M9SA 4R3DA 3VDUA 4R71A 4B3MM 2K9DA 1Z5BA 3VKHA 4LF5M 4DR7M 1PJQA 2RGOA 3T6PA 2EKFA 3FTCA 4FCVA 2L6OA 4M9XA 1R2YA 3I04M 3FE3A 5BR8M 4GHLA 3L2AA 5LMUM 2XFTA 3SYLA 3T15A 3UGJA 3KSXA 3LW5F 5EP4A 4Z8XA 2ZTDA 1IXRC 2RRUA 3SBJA 3CF0A 1P3QQ 1VDDA 3FUXA 5L8RF 1PJSA 1Q02A 2JP7A 2XGNA 2JWSA 4LJ7A 2K6BA 2FOIC 4LCBA 3WHKA 1DO0A 2XH9A 4ANRA 2DZNB 4AW4A 2JXNA 4JI6M 1R2ZA 2R65A 2QHOB 3FTFA 3K9OA 1L2DA 3SAWA 1WXQA 1AUAA 1PRBA 3SHGB 1QQWA 2R44A 2R62A 3A98B 2OQ4A 3HHWA 2DENA 2O5RA 2J5YA 3K9PA 4GITA 4IBFA 3TPZA 4DV5M 1J5EM 4DR6M 3GLGA 1HT1E 1D0LA 3UMMA 4GEWA 4OU7A 3K92A 4L78A 2Y20A 4IBKA 2BNKA 3U60A 2QPAA 2ZM6M 3ZH9B 2DWLA 5EP3A 4XK8F 4CHTB 2HAKA 1NJGA 2YR0A 1QAOA 1IN8A 3FD9A 5KPTA 1A5TA 4Y28F 1HT2E 2K0BX 3W67A 4DUZM 5H37D 4FWHA 4GH9A 3IHPA 5F3WA 4B7FA 2D7GA 1OJLA 2OOBA 1GVNA 2GQFA 3U6CA 2GNOA 2MROB 4B3TM 2UXDM 4CIZA 2F5QA 1NNUC 4LJ4A 1HNZM 2ZANA 2CP8A 4QNRA 1EE8A 4JI1M 4ZPXA 2CV2A 3GLFE 3GLGB 2G5GX 2Y0QA 4BBAA 4FD2A 3I4VA 3BOSA 4HLQA 4X65M 4X64M 1NV9A 1JB0F 1TTEA 2C98A 2DVWB 1G71A 3E4RA 4NSOB 4JI8M 3I4YA 1NHWC 4D81A 1GLNA 1PM5A 3B89A 1KFVA 3AJIB 2XFSA 4AI6A 2DAIA 2CHVA 3GPUA 3J2PB 1JR3E 4NRWA 1IFYA 1TF0B 2MH8A 5JI3E 4X66M 3GRRA 1TH4A 4L4UA 4DV7M 1YLAA 4DR3M 3LQRA 5EXPA 3U5ZB 2CRUA 1VDLA 3T1YM 2VF7A 3GPPA 4JI7M 2KW0A 3FUVA 5ITTA 4DV6M 2HCBA 4I5SA 5C1BA 3A45A 4KO8A 5KPZA 3GLFB 3GLGE 3HHZA 1WGNA 3HHYA 2MR9A 2HKJA 4OX9M 2VQFM 2JNHA 4L8RC 3KSJA 1YUBA 1Q3BA 4IBIA 1YE9A 3R8FA 2JY5A 1XC8A 2CHQA 2RKOA 1HQYE 1ZMWA 2L09A 3L29A 5KQ8A 4DV3M 2FNAA 4MGKE 2KRKA 2UU9M 3L25A 3NBIA 4LJ5A 4JI5M 1OKSA 4NOOB 2B3TA 2LVNC 4LFCM 2OOAA 4KHPM 2KEBA 3U6QA 1TDZA 1JR3A 1IN6A 1ZAEA 3FUWA 3GLHA 1Q3CA 5DYGA 3FYDA 3TL4X 1C7YA 4FVMA 3T38A 5BPVA 1EFUB 1OQYA 3FYCA 2F5SA 3J7AS 2KNAA 2QNJA 3DOAA 3J7BA 4NXMM 3C58A 3DFZA 4S12A 4FCTA 4B3RM 1ZQ9A 3AOEC 1TDHA 2L4EA 3AL0C 3VFDA 4G3OA 3I01M 4IJFA 5EJCA 2XLJA 5IZ7D 1GKIA 4OW0A 2WSCF 3KS4A 2QP9X 1Z5CA 1QYRA 1E32A 4IBDA 3QYEA 3C3DA 2LVAA 2LVPC 4JXJA 1H6UA 3JAMS 1GJSA 2JZ0A 1RU3A 3B7ZA 4DUYM 1G41A 1X37A 1MJGM 1WJ7A 2QZ4A 3LCUA 3E9SA 2C9CA 2XSZA 3V76A 2VIIA 2R45A 1IXSA 3CF2A 2H5XA 4JYAM 4LG2A 3GLIA 4DV4M 1IN7A 2CE7A 2Y0TA 3RGPA 1R7RA 3SAVA 3TE6A 3GPXA 2CEAA 1QZEA 4PDIA 4PT5A 5EQTA 1HQCA 2DKLA 3CGWA 3QWLA 3CTWB 1HNWM 1JQJC 1T43A 4GMQA 3GRUA 3W0LB 2ZTCA 4AG5A 1E9SA 1R5LA 1IBMM 4D80A 4EIWA 4GKKM 2DAGA 1L8QA 1L1ZA 1G3IA 5FSWA 4BB9A 3SATA 2W82A 3MK6A 3IG8A 1XB2B 2C96A 2CUZA 1KSFX 2VQEM 2DHRA 3HY5A 2DAKA 2WZJA 3F92A 3FUUA 1WGLA 4LFAM 2EA0A 1Z5AA 1I4WA 2YFQA 1UFZA 1V33A 3B74A 4G4NA 2QCUA 4OVZB 3GLHE 3T1HM 1N33M 1OFHA 3PXGA 3M0EA 3SC3A 1TR8A 2FFJA 1IQPA 1WIVA 4WURA 5FTKA 2R0IA 2Z4RA 3ILKA 3RGSA 2I7PA 2JA2A 1OIPA 3DZDA 5IWAM 2Z3XA 2R6FA 3KP1E 2LHCA 3SAUA 1PJIA 5FTJA 1PJTA 4REZA 4DR1M 5C18A 2LHGA 1DGGA 3BBZA 4FCWA 1IBLM 2JZ1A 1OFIA 2QSFX 3GLFA 3U61A 3HU1A 4LF9M 2JUJA 4XBOA 3LVWA 5LMNM 1L1TA 2F5OA 4GHAA 2V1UA 3FTEA 4DV0M 2CHGA 2LVQD 4IIWA 3PNVA 1GL7A 2F5PA 3NBXX 2KXEA 3NWLA 5E26A 2M60A 3AOGA 1OAOC 2BJWA 2DI0A 3HX3A 1QDRA 3Q8XA 1L2BA 2DWNA 2UXBM 5EXSA 4DR2M 1NJFA 1XXHB 2O01F 1W5TA 3D8BA 4B7HA 3PFIA 3VLFB 2Z4SA 4RF0A 1IXSB 4QOSA 1MN3A 5JI2E 2LH0A 3GQ3A 1VEGA 3A42A 1SG9A 3K8ZA 3SYKA 1UM8A 4NXNM 4X62M 1QANA 4MGZE 1Z59A 4KLNA 1FNNA 1MU5A 3D8LA 2LVOC 1V34A 5GKNA 1Z6TA 4MB7A 3SFZA 2NQ8C 1GL6A 3U6MA 2DWZB 3SMSA 2WSEF 3U6LA 2KNVA 4L6V6 3HJ8A 4WW0A 5ITYA 3KOYE 1D2NA 3VK7A 4AG6A 3U6EA 4LFBM 4F2LA 5ITUA 3U5ZA 5DYIA 2L7HA 4LJ6A 4DR5M 1N32M 4M0DA 2AHMA 1TGUA 2ZAMA 5ITXE 3KDSE 1PGYA 1QZMA 3FRIA 1XXHE 3U6OA 1SXJC 4CJ6A 7CATA 1G4AE 3KP0E 4JI4M 3KW6A 4AZFA 2CV0A 3J27B 1R6BX 4CISA 2KDLA 3FKEA 3JR4A 1SXJD 4I4LA 1DO2A 5EP2A 2R4EA 4LZJA 1C1KA 3GLIB 4I81A 4ITQA 1N77A 3SHFA 4LRSA 4QOZC 4GC5A 4D82A 3M6AA 3R9XB 2R46A 3GPYA 3GQ4A 3AFHA 4AKIA 4II7A 4I8OA 3GO8A 4LGYA 4K0KM 3THGA 4MM3B 1XNRM 4NL4H 1XNQM 3KOZE 1K3XA 2FS1A 1NVMA 3CF6E 2V1CA 2J7OA 4DV2M 3UJNA 1G8PA 2A5YB 1IY0A 4P17A 5IREB 2JY6B 2LNHC 2OO9A 3FTDA 1KYIA 3U6DA 4IBEA 2LTUA 2FE8A 2Z7JA 3HZJA 4JI3M 2LBCA 2WSFF 3H4MA 1XXHA 3LQQA 1IY2A 1TH3A 2XZUA 3RFWA 1D0KA 1PJJA 1VEJA 2QENA 3E46A 3PVSA 3VK8A 1NNJA 2KRUA 4LJ8A 4W5WA 4KT0F 3GRVA 1J09A 2G8LA 4M0WA 4IBCA 4RNAA 2R18A
chains in the Genus database with same CATH topology
4Q7JA 1NV9A 1TR8A 1TTEA 1WIVA 1AIPC 2R0IA 1NV8A 3H4JA 4DBGB 3B89A 2DAIA 1JR3E 2G3QA 1OAIA 3BBZA 1IFYA 2JZ1A 1WR1B 2QSFX 2HWJA 3E21A 1ZMVA 1ZV1A 2JUJA 2JY8A 2MGWA 1YLAA 2DHYA 2LVQD 1VDLA 1DV0A 1WHCA 2BWBA 3LCVB 3GLGE 2DI0A 1WGNA 2MR9A 2JNHA 1BVSA 2EKKA 2L4FA 5JI2E 1MN3A 1HJPA 2BWEA 2CWBA 2JY5A 1VEGA 1HQYE 1SG9A 1ZMWA 4R71A 2JY7A 2K9DA 1F4IA 2DNAA 2LVOC 3T6PA 1OKSA 3GLIE 1VEKA 2B3TA 2EKFA 1VG5A 2DAMA 2LVNC 1Y8GA 1IM2A 2OOAA 3FE3A 2KNVA 2KNZA 2O25A 4F2LA 4UN2B 1C7YA 2ZTDA 1E94E 2RRUA 1EFUB 1OQYA 1PGYA 2KNAA 2QNJA 3FRIA 1P3QQ 1XXHE 1OTRA 1Q02A 2JP7A 1CUKA 1G4AE 2L4EA 1DO0A 4G3OA 1VQ1A 2QHOB 3K9OA 1DO2A 4F1IA 2LVAA 1T6OA 2LVPC 2DENA 2JZ0A 3K9PA 1G41A 1HT1E 1WJ7A 3LCUA 2KHHA 4GEWA 1IXSA 2DAEA 2H5XA 1GO5A 5DFLA 2HAKA 1QZEA 1A5TA 4WP2A 1HT2E 2DKLA 2K0BX 2JY6B 2OO9A 3IHPA 1R4GA 1KYIA 1T43A 2MJ5B 2LTUA 2ZTCA 2OOBA 2MROB 2DAGA 2L2DA 2LBCA 1G3IA 1ZMUA 1V92A 4HEOA 3IECA 2CP8A 1XB2B 3MMPA 1VEJA 2DAKA 2WZJA 3F92A 3E46A 3FRHA 1WGLA 3GLFE 1UFZA 2EJSA 3GLHE 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q7J A;  1NV9 A;  1TR8 A;  1TTE A;  1WIV A;  1AIP C;  2R0I A;  1NV8 A;  3H4J A;  4DBG B;  3B89 A;  2DAI A;  1JR3 E;  2G3Q A;  1OAI A;  3BBZ A;  1IFY A;  2JZ1 A;  1WR1 B;  2QSF X;  2HWJ A;  3E21 A;  1ZMV A;  1ZV1 A;  2JUJ A;  2JY8 A;  2MGW A;  1YLA A;  2DHY A;  2LVQ D;  1VDL A;  1DV0 A;  1WHC A;  2BWB A;  3LCV B;  3GLG E;  2DI0 A;  1WGN A;  2MR9 A;  2JNH A;  1BVS A;  2EKK A;  2L4F A;  5JI2 E;  1MN3 A;  1HJP A;  2BWE A;  2CWB A;  2JY5 A;  1VEG A;  1HQY E;  1SG9 A;  1ZMW A;  4R71 A;  2JY7 A;  2K9D A;  1F4I A;  2DNA A;  2LVO C;  3T6P A;  1OKS A;  3GLI E;  1VEK A;  2B3T A;  2EKF A;  1VG5 A;  2DAM A;  2LVN C;  1Y8G A;  1IM2 A;  2OOA A;  3FE3 A;  2KNV A;  2KNZ A;  2O25 A;  4F2L A;  4UN2 B;  1C7Y A;  2ZTD A;  1E94 E;  2RRU A;  1EFU B;  1OQY A;  1PGY A;  2KNA A;  2QNJ A;  3FRI A;  1P3Q Q;  1XXH E;  1OTR A;  1Q02 A;  2JP7 A;  1CUK A;  1G4A E;  2L4E A;  1DO0 A;  4G3O A;  1VQ1 A;  2QHO B;  3K9O A;  1DO2 A;  4F1I A;  2LVA A;  1T6O A;  2LVP C;  2DEN A;  2JZ0 A;  3K9P A;  1G41 A;  1HT1 E;  1WJ7 A;  3LCU A;  2KHH A;  4GEW A;  1IXS A;  2DAE A;  2H5X A;  1GO5 A;  5DFL A;  2HAK A;  1QZE A;  1A5T A;  4WP2 A;  1HT2 E;  2DKL A;  2K0B X;  2JY6 B;  2OO9 A;  3IHP A;  1R4G A;  1KYI A;  1T43 A;  2MJ5 B;  2LTU A;  2ZTC A;  2OOB A;  2MRO B;  2DAG A;  2L2D A;  2LBC A;  1G3I A;  1ZMU A;  1V92 A;  4HEO A;  3IEC A;  2CP8 A;  1XB2 B;  3MMP A;  1VEJ A;  2DAK A;  2WZJ A;  3F92 A;  3E46 A;  3FRH A;  1WGL A;  3GLF E;  1UFZ A;  2EJS A;  3GLH E;  2DZL A; 
#chains in the Genus database with same CATH topology
 1ORY B;  3C9P A;  2UUB M;  3JR5 A;  4B3S M;  3HGI A;  3K2L A;  1NV8 A;  2H1R A;  3UK6 A;  2QBY A;  4LF8 M;  4IBB A;  4RF1 A;  1D0M A;  3LVV A;  1T3T A;  5FTN A;  1IBK M;  1EIJ A;  4DV1 M;  3E21 A;  1ZMV A;  2LWX A;  3B9P A;  4GRI A;  2JY8 A;  1IXZ A;  1YSY A;  3AOE A;  3HHX A;  2MGW A;  1SXJ A;  2I7N A;  3KFU G;  3ZCB B;  4Z6Y A;  4JI2 M;  4IBJ A;  5KO3 A;  2XF3 A;  3ZQJ A;  4PDG A;  8CAT A;  3AV0 A;  3HKP A;  2C5R A;  5EP1 A;  2V6Z M;  3IG5 A;  2BWB A;  3LCV B;  3LMM A;  4FWD A;  1E9R A;  4G6Z A;  3WHL A;  4LF4 M;  1GJT A;  3Q8G A;  1FJG M;  4B08 A;  1NSF A;  1QAM A;  1S3S A;  2F5N A;  1QUT A;  4LF6 M;  1TH2 A;  3GRY A;  4CGY B;  4AQY M;  3TWM A;  2CWB A;  2BWE A;  2CV1 A;  3KS8 A;  2EUC A;  4R7G A;  3HJS A;  3K1J A;  3J80 S;  2JY7 A;  2RGH A;  2QBY B;  1F4I A;  1XMO M;  4JV5 M;  2DNA A;  1XMQ M;  2F4V M;  1QAQ A;  3GLI E;  1VEK A;  2DAM A;  1VG5 A;  1Y8G A;  1IM2 A;  1SXJ B;  3HJQ A;  3KOX E;  4HL4 A;  5KQD A;  3HU2 A;  4QHS A;  2M5Z A;  4YY3 M;  2KNZ A;  3RE8 A;  3SAR A;  3KVW A;  2DWM A;  3L26 A;  1I94 M;  1OIZ A;  2R4J A;  2XSZ D;  2O25 A;  1K3W A;  5ITR A;  4IBG A;  1G59 A;  4UN2 B;  3SAS A;  2XZF A;  1E94 E;  2Z8Y M;  4LF7 M;  3HU3 A;  2YQZ A;  1QVR A;  5DNY A;  1IN5 A;  3W0F A;  4G4R A;  1L2C A;  3L28 A;  3M7G A;  1W5S A;  1OTR A;  4JN6 A;  1CUK A;  2UXC M;  4KOD A;  4GKJ M;  2UUC M;  1GAB A;  1VQ1 A;  2HL7 A;  4B7G A;  2UUA M;  3TQS A;  3B7Q A;  1IN4 A;  2D7E A;  3C3E A;  4TUW A;  4LGM A;  1XWI A;  4LRT A;  1N34 M;  1DGH B;  3J81 S;  4F1I A;  2HHH M;  4G4Q A;  1T6O A;  4MH0 E;  3OTO M;  4FW9 A;  1DGB A;  5FTM A;  1SXJ E;  3MHV C;  4QNM A;  1LV7 A;  2C99 A;  4G4O A;  1XHB A;  2J7N A;  2KHH A;  5IT9 S;  5EXX A;  3I51 A;  4GC9 A;  2DAE A;  4IJE A;  4LY6 A;  3VDP A;  2BJV A;  3VKG A;  2QQ8 A;  3HWS A;  2Y21 A;  4NSR A;  1HR0 M;  1GO5 A;  5DFL A;  3AKZ A;  4MGY E;  3KOW E;  4NRV A;  2P5T A;  2K47 A;  3GQ5 A;  2VDB B;  4WP2 A;  5FLX S;  3PNY A;  3U6P A;  4NC6 A;  3U60 B;  1N78 A;  2APL A;  1MX0 A;  4FWG A;  3TWL A;  1R4G A;  2FH0 A;  2MJ5 B;  2D7H A;  3EIE A;  4GIP A;  5ITQ A;  3ZC7 B;  2XEP A;  2KA6 B;  3TWK A;  1DGF A;  2L2D A;  4RKU F;  1N36 M;  1ZMU A;  3BXW A;  4LJ9 A;  1V92 A;  4HEO A;  2KZU A;  2VF8 A;  5FTL A;  5KPR A;  3IEC A;  3MMP A;  3MJ5 A;  2DXI A;  2YNM D;  2L7I A;  2EO2 A;  3QAU A;  3FRH A;  1JR3 D;  3KXE C;  2ZBK B;  3FUT A;  4BLC A;  2E5L M;  4YHH M;  4PD2 A;  2EJS A;  5E6J A;  2DZL A;  3W68 A;  3A46 A;  1NY6 A;  4Q7J A;  1DGH A;  1AIP C;  2ERC A;  2Q2E B;  3H4J A;  4LJA A;  3L27 A;  2OPF A;  4DBG B;  2KZS A;  2ZAO A;  4MGH A;  2X4A A;  2C9O A;  3QYB A;  4AKG A;  1IY1 A;  2DZO B;  2N35 A;  2G3Q A;  1OAI A;  4JI0 M;  4A3V B;  4PCZ A;  1WR1 B;  4OVZ A;  1NY5 A;  2HWJ A;  3SMP A;  1ZV1 A;  4M9Z A;  1QUS A;  3U6S A;  4XGI A;  2DHY A;  4DR4 M;  1HNX M;  5ITX A;  2LXE A;  3EIH A;  4LZZ A;  1NO1 A;  1N75 A;  3DA1 A;  2X8A A;  2CFO A;  2X49 A;  3UZU A;  1DV0 A;  1J7K A;  5EXT A;  1K82 A;  3B7N A;  4QHT A;  3GP1 A;  4L15 A;  1WHC A;  4L16 A;  3GLH B;  4P16 A;  1BVS A;  1LTM A;  5A2Q S;  2EKK A;  4AKH A;  1NHG C;  1QDT A;  2L4F A;  4MGI E;  3U61 B;  1Q39 A;  1HJP A;  4M9S A;  4R3D A;  3VDU A;  4R71 A;  4B3M M;  2K9D A;  1Z5B A;  3VKH A;  4LF5 M;  4DR7 M;  1PJQ A;  2RGO A;  3T6P A;  2EKF A;  3FTC A;  4FCV A;  2L6O A;  4M9X A;  1R2Y A;  3I04 M;  3FE3 A;  5BR8 M;  4GHL A;  3L2A A;  5LMU M;  2XFT A;  3SYL A;  3T15 A;  3UGJ A;  3KSX A;  3LW5 F;  5EP4 A;  4Z8X A;  2ZTD A;  1IXR C;  2RRU A;  3SBJ A;  3CF0 A;  1P3Q Q;  1VDD A;  3FUX A;  5L8R F;  1PJS A;  1Q02 A;  2JP7 A;  2XGN A;  2JWS A;  4LJ7 A;  2K6B A;  2FOI C;  4LCB A;  3WHK A;  1DO0 A;  2XH9 A;  4ANR A;  2DZN B;  4AW4 A;  2JXN A;  4JI6 M;  1R2Z A;  2R65 A;  2QHO B;  3FTF A;  3K9O A;  1L2D A;  3SAW A;  1WXQ A;  1AUA A;  1PRB A;  3SHG B;  1QQW A;  2R44 A;  2R62 A;  3A98 B;  2OQ4 A;  3HHW A;  2DEN A;  2O5R A;  2J5Y A;  3K9P A;  4GIT A;  4IBF A;  3TPZ A;  4DV5 M;  1J5E M;  4DR6 M;  3GLG A;  1HT1 E;  1D0L A;  3UMM A;  4GEW A;  4OU7 A;  3K92 A;  4L78 A;  2Y20 A;  4IBK A;  2BNK A;  3U60 A;  2QPA A;  2ZM6 M;  3ZH9 B;  2DWL A;  5EP3 A;  4XK8 F;  4CHT B;  2HAK A;  1NJG A;  2YR0 A;  1QAO A;  1IN8 A;  3FD9 A;  5KPT A;  1A5T A;  4Y28 F;  1HT2 E;  2K0B X;  3W67 A;  4DUZ M;  5H37 D;  4FWH A;  4GH9 A;  3IHP A;  5F3W A;  4B7F A;  2D7G A;  1OJL A;  2OOB A;  1GVN A;  2GQF A;  3U6C A;  2GNO A;  2MRO B;  4B3T M;  2UXD M;  4CIZ A;  2F5Q A;  1NNU C;  4LJ4 A;  1HNZ M;  2ZAN A;  2CP8 A;  4QNR A;  1EE8 A;  4JI1 M;  4ZPX A;  2CV2 A;  3GLF E;  3GLG B;  2G5G X;  2Y0Q A;  4BBA A;  4FD2 A;  3I4V A;  3BOS A;  4HLQ A;  4X65 M;  4X64 M;  1NV9 A;  1JB0 F;  1TTE A;  2C98 A;  2DVW B;  1G71 A;  3E4R A;  4NSO B;  4JI8 M;  3I4Y A;  1NHW C;  4D81 A;  1GLN A;  1PM5 A;  3B89 A;  1KFV A;  3AJI B;  2XFS A;  4AI6 A;  2DAI A;  2CHV A;  3GPU A;  3J2P B;  1JR3 E;  4NRW A;  1IFY A;  1TF0 B;  2MH8 A;  5JI3 E;  4X66 M;  3GRR A;  1TH4 A;  4L4U A;  4DV7 M;  1YLA A;  4DR3 M;  3LQR A;  5EXP A;  3U5Z B;  2CRU A;  1VDL A;  3T1Y M;  2VF7 A;  3GPP A;  4JI7 M;  2KW0 A;  3FUV A;  5ITT A;  4DV6 M;  2HCB A;  4I5S A;  5C1B A;  3A45 A;  4KO8 A;  5KPZ A;  3GLF B;  3GLG E;  3HHZ A;  1WGN A;  3HHY A;  2MR9 A;  2HKJ A;  4OX9 M;  2VQF M;  2JNH A;  4L8R C;  3KSJ A;  1YUB A;  1Q3B A;  4IBI A;  1YE9 A;  3R8F A;  2JY5 A;  1XC8 A;  2CHQ A;  2RKO A;  1HQY E;  1ZMW A;  2L09 A;  3L29 A;  5KQ8 A;  4DV3 M;  2FNA A;  4MGK E;  2KRK A;  2UU9 M;  3L25 A;  3NBI A;  4LJ5 A;  4JI5 M;  1OKS A;  4NOO B;  2B3T A;  2LVN C;  4LFC M;  2OOA A;  4KHP M;  2KEB A;  3U6Q A;  1TDZ A;  1JR3 A;  1IN6 A;  1ZAE A;  3FUW A;  3GLH A;  1Q3C A;  5DYG A;  3FYD A;  3TL4 X;  1C7Y A;  4FVM A;  3T38 A;  5BPV A;  1EFU B;  1OQY A;  3FYC A;  2F5S A;  3J7A S;  2KNA A;  2QNJ A;  3DOA A;  3J7B A;  4NXM M;  3C58 A;  3DFZ A;  4S12 A;  4FCT A;  4B3R M;  1ZQ9 A;  3AOE C;  1TDH A;  2L4E A;  3AL0 C;  3VFD A;  4G3O A;  3I01 M;  4IJF A;  5EJC A;  2XLJ A;  5IZ7 D;  1GKI A;  4OW0 A;  2WSC F;  3KS4 A;  2QP9 X;  1Z5C A;  1QYR A;  1E32 A;  4IBD A;  3QYE A;  3C3D A;  2LVA A;  2LVP C;  4JXJ A;  1H6U A;  3JAM S;  1GJS A;  2JZ0 A;  1RU3 A;  3B7Z A;  4DUY M;  1G41 A;  1X37 A;  1MJG M;  1WJ7 A;  2QZ4 A;  3LCU A;  3E9S A;  2C9C A;  2XSZ A;  3V76 A;  2VII A;  2R45 A;  1IXS A;  3CF2 A;  2H5X A;  4JYA M;  4LG2 A;  3GLI A;  4DV4 M;  1IN7 A;  2CE7 A;  2Y0T A;  3RGP A;  1R7R A;  3SAV A;  3TE6 A;  3GPX A;  2CEA A;  1QZE A;  4PDI A;  4PT5 A;  5EQT A;  1HQC A;  2DKL A;  3CGW A;  3QWL A;  3CTW B;  1HNW M;  1JQJ C;  1T43 A;  4GMQ A;  3GRU A;  3W0L B;  2ZTC A;  4AG5 A;  1E9S A;  1R5L A;  1IBM M;  4D80 A;  4EIW A;  4GKK M;  2DAG A;  1L8Q A;  1L1Z A;  1G3I A;  5FSW A;  4BB9 A;  3SAT A;  2W82 A;  3MK6 A;  3IG8 A;  1XB2 B;  2C96 A;  2CUZ A;  1KSF X;  2VQE M;  2DHR A;  3HY5 A;  2DAK A;  2WZJ A;  3F92 A;  3FUU A;  1WGL A;  4LFA M;  2EA0 A;  1Z5A A;  1I4W A;  2YFQ A;  1UFZ A;  1V33 A;  3B74 A;  4G4N A;  2QCU A;  4OVZ B;  3GLH E;  3T1H M;  1N33 M;  1OFH A;  3PXG A;  3M0E A;  3SC3 A;  1TR8 A;  2FFJ A;  1IQP A;  1WIV A;  4WUR A;  5FTK A;  2R0I A;  2Z4R A;  3ILK A;  3RGS A;  2I7P A;  2JA2 A;  1OIP A;  3DZD A;  5IWA M;  2Z3X A;  2R6F A;  3KP1 E;  2LHC A;  3SAU A;  1PJI A;  5FTJ A;  1PJT A;  4REZ A;  4DR1 M;  5C18 A;  2LHG A;  1DGG A;  3BBZ A;  4FCW A;  1IBL M;  2JZ1 A;  1OFI A;  2QSF X;  3GLF A;  3U61 A;  3HU1 A;  4LF9 M;  2JUJ A;  4XBO A;  3LVW A;  5LMN M;  1L1T A;  2F5O A;  4GHA A;  2V1U A;  3FTE A;  4DV0 M;  2CHG A;  2LVQ D;  4IIW A;  3PNV A;  1GL7 A;  2F5P A;  3NBX X;  2KXE A;  3NWL A;  5E26 A;  2M60 A;  3AOG A;  1OAO C;  2BJW A;  2DI0 A;  3HX3 A;  1QDR A;  3Q8X A;  1L2B A;  2DWN A;  2UXB M;  5EXS A;  4DR2 M;  1NJF A;  1XXH B;  2O01 F;  1W5T A;  3D8B A;  4B7H A;  3PFI A;  3VLF B;  2Z4S A;  4RF0 A;  1IXS B;  4QOS A;  1MN3 A;  5JI2 E;  2LH0 A;  3GQ3 A;  1VEG A;  3A42 A;  1SG9 A;  3K8Z A;  3SYK A;  1UM8 A;  4NXN M;  4X62 M;  1QAN A;  4MGZ E;  1Z59 A;  4KLN A;  1FNN A;  1MU5 A;  3D8L A;  2LVO C;  1V34 A;  5GKN A;  1Z6T A;  4MB7 A;  3SFZ A;  2NQ8 C;  1GL6 A;  3U6M A;  2DWZ B;  3SMS A;  2WSE F;  3U6L A;  2KNV A;  4L6V 6;  3HJ8 A;  4WW0 A;  5ITY A;  3KOY E;  1D2N A;  3VK7 A;  4AG6 A;  3U6E A;  4LFB M;  4F2L A;  5ITU A;  3U5Z A;  5DYI A;  2L7H A;  4LJ6 A;  4DR5 M;  1N32 M;  4M0D A;  2AHM A;  1TGU A;  2ZAM A;  5ITX E;  3KDS E;  1PGY A;  1QZM A;  3FRI A;  1XXH E;  3U6O A;  1SXJ C;  4CJ6 A;  7CAT A;  1G4A E;  3KP0 E;  4JI4 M;  3KW6 A;  4AZF A;  2CV0 A;  3J27 B;  1R6B X;  4CIS A;  2KDL A;  3FKE A;  3JR4 A;  1SXJ D;  4I4L A;  1DO2 A;  5EP2 A;  2R4E A;  4LZJ A;  1C1K A;  3GLI B;  4I81 A;  4ITQ A;  1N77 A;  3SHF A;  4LRS A;  4QOZ C;  4GC5 A;  4D82 A;  3M6A A;  3R9X B;  2R46 A;  3GPY A;  3GQ4 A;  3AFH A;  4AKI A;  4II7 A;  4I8O A;  3GO8 A;  4LGY A;  4K0K M;  3THG A;  4MM3 B;  1XNR M;  4NL4 H;  1XNQ M;  3KOZ E;  1K3X A;  2FS1 A;  1NVM A;  3CF6 E;  2V1C A;  2J7O A;  4DV2 M;  3UJN A;  1G8P A;  2A5Y B;  1IY0 A;  4P17 A;  5IRE B;  2JY6 B;  2LNH C;  2OO9 A;  3FTD A;  1KYI A;  3U6D A;  4IBE A;  2LTU A;  2FE8 A;  2Z7J A;  3HZJ A;  4JI3 M;  2LBC A;  2WSF F;  3H4M A;  1XXH A;  3LQQ A;  1IY2 A;  1TH3 A;  2XZU A;  3RFW A;  1D0K A;  1PJJ A;  1VEJ A;  2QEN A;  3E46 A;  3PVS A;  3VK8 A;  1NNJ A;  2KRU A;  4LJ8 A;  4W5W A;  4KT0 F;  3GRV A;  1J09 A;  2G8L A;  4M0W A;  4IBC A;  4RNA A;  2R18 A; 
#chains in the Genus database with same CATH homology
 4Q7J A;  1NV9 A;  1TR8 A;  1TTE A;  1WIV A;  1AIP C;  2R0I A;  1NV8 A;  3H4J A;  4DBG B;  3B89 A;  2DAI A;  1JR3 E;  2G3Q A;  1OAI A;  3BBZ A;  1IFY A;  2JZ1 A;  1WR1 B;  2QSF X;  2HWJ A;  3E21 A;  1ZMV A;  1ZV1 A;  2JUJ A;  2JY8 A;  2MGW A;  1YLA A;  2DHY A;  2LVQ D;  1VDL A;  1DV0 A;  1WHC A;  2BWB A;  3LCV B;  3GLG E;  2DI0 A;  1WGN A;  2MR9 A;  2JNH A;  1BVS A;  2EKK A;  2L4F A;  5JI2 E;  1MN3 A;  1HJP A;  2BWE A;  2CWB A;  2JY5 A;  1VEG A;  1HQY E;  1SG9 A;  1ZMW A;  4R71 A;  2JY7 A;  2K9D A;  1F4I A;  2DNA A;  2LVO C;  3T6P A;  1OKS A;  3GLI E;  1VEK A;  2B3T A;  2EKF A;  1VG5 A;  2DAM A;  2LVN C;  1Y8G A;  1IM2 A;  2OOA A;  3FE3 A;  2KNV A;  2KNZ A;  2O25 A;  4F2L A;  4UN2 B;  1C7Y A;  2ZTD A;  1E94 E;  2RRU A;  1EFU B;  1OQY A;  1PGY A;  2KNA A;  2QNJ A;  3FRI A;  1P3Q Q;  1XXH E;  1OTR A;  1Q02 A;  2JP7 A;  1CUK A;  1G4A E;  2L4E A;  1DO0 A;  4G3O A;  1VQ1 A;  2QHO B;  3K9O A;  1DO2 A;  4F1I A;  2LVA A;  1T6O A;  2LVP C;  2DEN A;  2JZ0 A;  3K9P A;  1G41 A;  1HT1 E;  1WJ7 A;  3LCU A;  2KHH A;  4GEW A;  1IXS A;  2DAE A;  2H5X A;  1GO5 A;  5DFL A;  2HAK A;  1QZE A;  1A5T A;  4WP2 A;  1HT2 E;  2DKL A;  2K0B X;  2JY6 B;  2OO9 A;  3IHP A;  1R4G A;  1KYI A;  1T43 A;  2MJ5 B;  2LTU A;  2ZTC A;  2OOB A;  2MRO B;  2DAG A;  2L2D A;  2LBC A;  1G3I A;  1ZMU A;  1V92 A;  4HEO A;  3IEC A;  2CP8 A;  1XB2 B;  3MMP A;  1VEJ A;  2DAK A;  2WZJ A;  3F92 A;  3E46 A;  3FRH A;  1WGL A;  3GLF E;  1UFZ A;  2EJS A;  3GLH E;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...