2EJSA

Solution structure of ruh-076, a human cue domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
GSSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autocrine motility factor receptor, isoform 2
publication title Solution structure of RUH-076, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ejsA00
1Y8GA 3MMPA 1OQYA 2QSFX 2ZTDA 1WHCA 4R71A 2LTUA 3T6PA 2B3TA 3FRIA 2CWBA 1VDLA 1G41A 1OTRA 2KNAA 4G3OA 2QHOB 1DO0A 2DAMA 2OOBA 1V92A 1WGLA 3GLGE 2DI0A 3IECA 1WIVA 4Q7JA 1WJ7A 2JY8A 1OAIA 1G4AE 2LVPC 3GLFE 1HT2E 2BWEA 1YLAA 2LBCA 5JI2E 1QZEA 2K9DA 2G3QA 2DHYA 1ZMWA 2EKFA 1HJPA 2DENA 1WR1B 4DBGB 2JY6B 1VQ1A 1CUKA 2JY7A 1VEJA 1MN3A 2HWJA 3LCUA 1E94E 3LCVB 2LVNC 2MJ5B 1KYIA 1HT1E 1TTEA 2DAGA 2EJSA 2JZ0A 1HQYE 1DO2A 1T43A 2EKKA 1VEGA 2KHHA 4F1IA 1G3IA 1ZMVA 3GLIE 1C7YA 2KNVA 2DAKA 2L4FA 5DFLA 3H4JA 2R0IA 2LVAA 2H5XA 2BWBA 2WZJA 1XXHE 1F4IA 1P3QQ 3K9OA 3E21A 1VG5A 2K0BX 1Q02A 1XB2B 1TR8A 4UN2B 1BVSA 3BBZA 2CP8A 2JZ1A 2MGWA 1VEKA 2OO9A 2O25A 2ZTCA 1T6OA 2HAKA 2L2DA 1PGYA 2JNHA 1IXSA 2MR9A 1DV0A 1WGNA 1UFZA 1AIPC 2LVQD 4WP2A 3FRHA 2JUJA 1IM2A 2DAIA 2L4EA 1IFYA 3FE3A 2DKLA 1OKSA 2DZLA 1NV8A 2QNJA 1EFUB 1ZV1A 1R4GA 2MROB 1ZMUA 3GLHE 1NV9A 3IHPA 1JR3E 3K9PA 3E46A 2DNAA 1SG9A 3F92A 4GEWA 1GO5A 2JY5A 2KNZA 3B89A 4HEOA 2LVOC 4F2LA 2JP7A 1A5TA 2DAEA 2RRUA 2OOAA
chains in the Genus database with same CATH superfamily
2KRUA 3D8BA 1SXJD 1NY5A 2OPFA 2C96A 1N36M 2J5YA 2UXDM 2LHGA 1SXJA 3FRIA 2KNAA 1OTRA 3B9PA 2QHOB 2Y20A 2GQFA 3DOAA 4DUZM 2DAMA 2Y0TA 2YFQA 1WGLA 2RGHA 3U6PA 1FJGM 4LFBM 2CE7A 5EXSA 5EJCA 3GLIA 3FTCA 4B3SM 3HJSA 5ITYA 4LJ8A 2L6OA 3L25A 3VKGA 4MM3B 2JY8A 1JQJC 4DR5M 1G4AE 3TE6A 1IBKM 1SXJB 3GLFE 4JYAM 1XNRM 1YLAA 1Q39A 1XNQM 1Z5BA 1QQWA 4MGYE 3C58A 4L6V6 2X4AA 3BOSA 1GL7A 1D0KA 4AG5A 3B7ZA 2Y0QA 2QCUA 1HJPA 1K3WA 1D0MA 2JY6B 1CUKA 1SXJC 1VEJA 1MN3A 3LCUA 4I8OA 1E94E 8CATA 1NHWC 3PNYA 2DWMA 5BPVA 2UU9M 2LNHC 2MJ5B 4R7GA 5EXXA 1NSFA 4NSRA 5DYIA 3THGA 1IXRC 4IBGA 2X49A 3MJ5A 2FS1A 4FVMA 1IY2A 1HQYE 4X66M 1DO2A 1T43A 1KFVA 1E9RA 3SASA 1Q3BA 1G3IA 4IBBA 4DR7M 1Q3CA 4LJ5A 4CIZA 2KNVA 2DAKA 4AKIA 2FE8A 3LW5F 4WURA 4QHSA 2WZJA 2DZNB 2GNOA 1N32M 3J2PB 3HJQA 3FUTA 1OFIA 3E21A 3KW6A 4HLQA 5H37D 5FSWA 2I7NA 1TR8A 4CJ6A 1N78A 2EO2A 3A98B 3KDSE 3VFDA 4ITQA 3GRRA 1JR3D 4M0WA 4P17A 1GKIA 4LCBA 3KOZE 2MGWA 3GPPA 5C1BA 4OVZB 1VEKA 1JR3A 1AUAA 3T38A 2V1UA 2XGNA 2BJVA 2ZAMA 2HAKA 2L2DA 1NVMA 2XEPA 2CV1A 2BNKA 4XGIA 3CTWB 2HCBA 5LMUM 1IBLM 1WGNA 4W5WA 2WSFF 3V76A 1TDZA 4XK8F 1XMOM 2HHHM 5LMNM 1KSFX 2XFSA 3PVSA 2I7PA 2F5PA 2V1CA 4EIWA 2DKLA 4MH0E 3DFZA 1QDRA 3QAUA 3J27B 5JI3E 4LF8M 1NV8A 4AG6A 2C99A 4NOOB 1IBMM 1GJSA 4AW4A 2K47A 3WHKA 1R4GA 2MROB 3GLHE 4LFAM 2KZUA 4YHHM 4G4OA 2EA0A 3I04M 3K9PA 2D7HA 4JI5M 2D7EA 4GC5A 4B7HA 3ZH9B 3F92A 4GEWA 1TH2A 4LGYA 3VDPA 4FWDA 1W5SA 3HHWA 4BBAA 2XZUA 4GRIA 3KS8A 1DGFA 4HEOA 4LZZA 3U6SA 3UJNA 4AKHA 1NNJA 3DZDA 3HU1A 3MMPA 4ZPXA 3U6OA 1J7KA 3UGJA 1OQYA 2ZTDA 4M9XA 3GQ4A 3HHZA 3B74A 1QDTA 2B3TA 2BJWA 3IG5A 3KVWA 1G41A 2R4EA 3LQRA 1E32A 1IXSB 1DO0A 1IN4A 3CF0A 2V6ZM 2WSEF 2FNAA 1DGGA 1G71A 1LTMA 2KXEA 2Y21A 1T3TA 3GLGA 3QYEA 1WIVA 4OX9M 4Q7JA 5ITQA 4JI4M 2M5ZA 4DV1M 1I94M 2YNMD 3U6DA 3OTOM 4L78A 2KA6B 3SAVA 3CF2A 3AOGA 1QZEA 4PDGA 3NWLA 2DZOB 1X37A 1Z5CA 2DHYA 2HKJA 4I81A 4IBEA 5KPTA 4YY3M 5EXPA 3GLGB 2VF8A 1ZMWA 2QPAA 2VDBB 1V33A 3RGSA 4CGYB 4RKUF 2F5NA 3PNVA 3EIEA 2JY7A 4CHTB 4G4NA 4GKJM 2HWJA 5ITXE 4LY6A 1GJTA 1PJSA 4FWGA 3U61A 3U6QA 3VK7A 3ZQJA 2Q2EB 4MGZE 2JZ0A 2RKOA 2EKKA 1QAQA 3HGIA 1HR0M 4B3RM 1TF0B 1ZMVA 1C7YA 2XF3A 2Z3XA 3H4JA 4L16A 4LJ4A 2YR0A 4P16A 1XWIA 1FNNA 1PJJA 1NHGC 1XXHE 2L7HA 3NBIA 3QYBA 4I5SA 4NSOB 3L26A 3U61B 4PDIA 1K3XA 2KRKA 3SC3A 3B7QA 3HJ8A 5BR8M 1VG5A 1L2CA 2O5RA 2QBYA 2E5LM 2K0BX 3PFIA 4QOSA 3I01M 3VK8A 3SMPA 4JI6M 4IJEA 5ITUA 4LG2A 4LJ7A 3GLIB 3VDUA 1BVSA 3J7AS 3KS4A 3BBZA 2JZ1A 2QP9X 3GLHA 3U60A 4IJFA 3HX3A 3FTFA 3L29A 1I4WA 3KSXA 4DR4M 2ZTCA 1IQPA 1T6OA 3I4YA 4PT5A 1TH4A 1OJLA 4X65M 4GITA 2DXIA 4DV4M 3IG8A 1R2YA 1R5LA 1UFZA 1OIZA 1TDHA 5ITRA 3SARA 2XH9A 3FUXA 3TQSA 3TWLA 1L8QA 5E6JA 5KPZA 4DV3M 2O01F 2DAIA 2L4EA 3KXEC 4REZA 3L2AA 2F5OA 2Z8YM 4IBDA 4LF6M 1H6UA 2J7OA 4NXNM 1K82A 2KW0A 1PJIA 2W82A 3LVVA 1EFUB 3MHVC 1NY6A 1VDDA 1QVRA 4G6ZA 4L15A 4MGKE 4X64M 2XFTA 3VKHA 4Z6YA 3U6LA 3KP1E 2Z4RA 4NC6A 2JWSA 2CHQA 1WXQA 4DV2M 5IZ7D 2WSCF 1PJQA 2DNAA 3LMMA 4FWHA 3AOEA 2R45A 3T15A 4KHPM 3U6EA 3KFUG 5IREB 2KNZA 2L09A 5EP3A 4KT0F 4DR1M 2G5GX 4F2LA 1JB0F 2RRUA 5GKNA 1Y8GA 4RF0A 2C9CA 3FYDA 4AKGA 5FLXS 1QYRA 5C18A 2QSFX 1ZQ9A 1ORYB 5IT9S 1Z5AA 4KO8A 1N33M 1IN6A 3T6PA 1SXJE 1J5EM 5FTJA 1E9SA 4JI8M 2CWBA 2KZSA 4D80A 3R8FA 2CV2A 3T1YM 5KQDA 4LF5M 5EP2A 4DR3M 3KOYE 3HZJA 3AJIB 2DI0A 3CF6E 4MB7A 2CFOA 3JAMS 5KO3A 1L2BA 3K92A 1WJ7A 2ZM6M 2R4JA 3AOEC 4B7FA 1YSYA 2UUCM 3LQQA 2DWZB 4K0KM 2JXNA 3GPXA 1DGHA 3J81S 3QWLA 4MGHA 1HT2E 4D81A 4NL4H 2FH0A 3GLFA 3W67A 3SFZA 4DV6M 3U5ZA 3HWSA 5EP4A 4CISA 2QQ8A 5JI2E 1NJGA 3SHFA 1G59A 2K9DA 2G3QA 4QHTA 2QENA 4XBOA 1RU3A 3RGPA 2K6BA 4JI3M 4LF4M 2R46A 3CGWA 3UZUA 1IN7A 5KQ8A 2DHRA 5FTKA 3K2LA 1IY0A 2FOIC 2X8AA 4LF9M 3LCVB 4D82A 3UK6A 4LF7M 1KYIA 1HT1E 3GLFB 2DAGA 4JV5M 3K1JA 4JI1M 2RGOA 5FTNA 2EJSA 3GPYA 3U5ZB 2UXCM 1HNWM 2KHHA 4NRVA 4F1IA 3DA1A 3FD9A 1HNZM 1ZAEA 4I4LA 3W68A 4IBCA 3TL4X 3I4VA 5ITTA 4X62M 3GQ5A 2R0IA 4Z8XA 1R2ZA 3SATA 4OW0A 1HQCA 2BWBA 1NO1A 4GH9A 2LXEA 4LJ6A 4G4QA 1P3QQ 4FW9A 3K9OA 1YUBA 5L8RF 4GIPA 1Z6TA 2ZBKB 4B3MM 2VQEM 3HKPA 2UXBM 2LH0A 2AHMA 4UN2B 1DGBA 2UUBM 4JXJA 4RNAA 1GVNA 5A2QS 2F4VM 3VLFB 2CP8A 2XSZD 3Q8GA 4M0DA 3W0LB 2ERCA 4KODA 4S12A 3FUVA 3SMSA 2XSZA 2C5RA 3SAWA 1N77A 3HY5A 2CHVA 1PGYA 2JNHA 3MK6A 1OAOC 3RFWA 2F5QA 1DV0A 1NJFA 3HU3A 4G4RA 2J7NA 2JA2A 4WP2A 1IY1A 4LJAA 4Y28F 3RE8A 2JUJA 1IM2A 1QZMA 4QOZC 3T1HM 1G8PA 3SYKA 4L8RC 3AL0C 3AV0A 1HNXM 2CV0A 2MH8A 3C3DA 2DZLA 2LWXA 3KSJA 1QUSA 2QNJA 4PCZA 3U6MA 3M7GA 3FTEA 3SYLA 4BB9A 2OQ4A 4FCVA 3FUWA 3IHPA 2VQFM 1C1KA 3LVWA 4DV5M 2DWLA 1YE9A 2XLJA 2FFJA 4GHAA 2KDLA 4NXMM 2G8LA 3E46A 3Q8XA 2C98A 4MGIE 2QBYB 4WW0A 1SG9A 4DUYM 1QANA 1L1TA 2LHCA 3B89A 1LV7A 5IWAM 2LVOC 1IXZA 1A5TA 2OOAA 4GC9A 3GLHB 4R3DA 4DV7M 3U60B 2CEAA 2CHGA 5E26A 3L27A 4FCTA 1WHCA 1GL6A 2R18A 4R71A 3L28A 2LTUA 3HU2A 4NRWA 2M60A 2VF7A 1VDLA 2EUCA 1MJGM 1R7RA 1L1ZA 4G3OA 1V92A 4QNMA 3U6CA 4B7GA 2R44A 4LRTA 3GLGE 5DNYA 3IECA 1D0LA 2APLA 2VIIA 2CRUA 4PD2A 2DWNA 3SBJA 3HHXA 4IBFA 3J7BA 1MX0A 3C9PA 3GO8A 3GP1A 1OAIA 4DR2M 4JI2M 3NBXX 4AI6A 2LVPC 4OVZA 1EE8A 2BWEA 3UMMA 3FUUA 3KP0E 3E4RA 3GRYA 2UUAM 2LBCA 3K8ZA 4GHLA 2ZANA 1V34A 4ANRA 1TGUA 3M6AA 2EKFA 1N75A 2DENA 1WR1B 4DBGB 4IIWA 1VQ1A 5DYGA 3PXGA 4AQYM 2C9OA 4JI7M 3KOWE 1TH3A 5ITXA 2LVNC 5EXTA 1UM8A 4B3TM 1GLNA 1TTEA 3ILKA 3GPUA 4DR6M 3A45A 3M0EA 4DV0M 4LZJA 1S3SA 1VEGA 2Z4SA 3J80S 4OU7A 1IN5A 4HL4A 1J09A 3GLIE 1W5TA 2F5SA 2HL7A 2L4FA 5DFLA 5KPRA 3BXWA 2LVAA 2H5XA 3GRUA 3EIHA 4JN6A 4KLNA 3WHLA 2CUZA 1XXHA 3JR5A 2D7GA 2XZFA 3JR4A 1PJTA 4GMQA 3SHGB 1Q02A 4FCWA 1XB2B 3A42A 2A5YB 3TPZA 2L7IA 1PRBA 3HHYA 3TWMA 4M9ZA 3TWKA 1QUTA 2YQZA 3AKZA 4LRSA 4RF1A 2QZ4A 2R6FA 4M9SA 1DGHB 1OFHA 4A3VB 2R62A 1XXHB 2N35A 1EIJA 3I51A 1F4IA 1D2NA 3FTDA 4L4UA 3SAUA 2OO9A 1Z59A 2O25A 2H1RA 4LGMA 5FTLA 5F3WA 4IBKA 1IN8A 3C3EA 4LFCM 2R65A 5EQTA 4AZFA 4GKKM 1IXSA 2MR9A 2P5TA 3H4MA 1AIPC 1QAOA 3ZCBB 2LVQD 3AFHA 1MU5A 3FRHA 1QAMA 1XMQM 4QNRA 4FD2A 1XC8A 1IFYA 3FE3A 4IBJA 1OKSA 5FTMA 2Z7JA 3GRVA 4TUWA 3R9XB 3B7NA 5EP1A 2ZAOA 1ZV1A 1ZMUA 1PM5A 1GABA 1NV9A 4BLCA 7CATA 4IBIA 1JR3E 3GQ3A 3FKEA 1NNUC 2KEBA 4JI0M 4II7A 1L2DA 3FYCA 1R6BX 2DVWB 3W0FA 1GO5A 2JY5A 3KOXE 4B08A 1N34M 3A46A 1OIPA 4LJ9A 3E9SA 1XHBA 3D8LA 2JP7A 2DAEA 2NQ8C 3ZC7B 2OOBA
chains in the Genus database with same CATH topology
1Y8GA 3MMPA 1OQYA 2QSFX 2ZTDA 1WHCA 4R71A 2LTUA 3T6PA 2B3TA 3FRIA 2CWBA 1VDLA 1G41A 1OTRA 2KNAA 4G3OA 2QHOB 1DO0A 2DAMA 2OOBA 1V92A 1WGLA 3GLGE 2DI0A 3IECA 1WIVA 4Q7JA 1WJ7A 2JY8A 1OAIA 1G4AE 2LVPC 3GLFE 1HT2E 2BWEA 1YLAA 2LBCA 5JI2E 1QZEA 2K9DA 2G3QA 2DHYA 1ZMWA 2EKFA 1HJPA 2DENA 1WR1B 4DBGB 2JY6B 1VQ1A 1CUKA 2JY7A 1VEJA 1MN3A 2HWJA 3LCUA 1E94E 3LCVB 2LVNC 2MJ5B 1KYIA 1HT1E 1TTEA 2DAGA 2EJSA 2JZ0A 1HQYE 1DO2A 1T43A 2EKKA 1VEGA 2KHHA 4F1IA 1G3IA 1ZMVA 3GLIE 1C7YA 2KNVA 2DAKA 2L4FA 5DFLA 3H4JA 2R0IA 2LVAA 2H5XA 2BWBA 2WZJA 1XXHE 1F4IA 1P3QQ 3K9OA 3E21A 1VG5A 2K0BX 1Q02A 1XB2B 1TR8A 4UN2B 1BVSA 3BBZA 2CP8A 2JZ1A 2MGWA 1VEKA 2OO9A 2O25A 2ZTCA 1T6OA 2HAKA 2L2DA 1PGYA 2JNHA 1IXSA 2MR9A 1DV0A 1WGNA 1UFZA 1AIPC 2LVQD 4WP2A 3FRHA 2JUJA 1IM2A 2DAIA 2L4EA 1IFYA 3FE3A 2DKLA 1OKSA 2DZLA 1NV8A 2QNJA 1EFUB 1ZV1A 1R4GA 2MROB 1ZMUA 3GLHE 1NV9A 3IHPA 1JR3E 3K9PA 3E46A 2DNAA 1SG9A 3F92A 4GEWA 1GO5A 2JY5A 2KNZA 3B89A 4HEOA 2LVOC 4F2LA 2JP7A 1A5TA 2DAEA 2RRUA 2OOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8G A;  3MMP A;  1OQY A;  2QSF X;  2ZTD A;  1WHC A;  4R71 A;  2LTU A;  3T6P A;  2B3T A;  3FRI A;  2CWB A;  1VDL A;  1G41 A;  1OTR A;  2KNA A;  4G3O A;  2QHO B;  1DO0 A;  2DAM A;  2OOB A;  1V92 A;  1WGL A;  3GLG E;  2DI0 A;  3IEC A;  1WIV A;  4Q7J A;  1WJ7 A;  2JY8 A;  1OAI A;  1G4A E;  2LVP C;  3GLF E;  1HT2 E;  2BWE A;  1YLA A;  2LBC A;  5JI2 E;  1QZE A;  2K9D A;  2G3Q A;  2DHY A;  1ZMW A;  2EKF A;  1HJP A;  2DEN A;  1WR1 B;  4DBG B;  2JY6 B;  1VQ1 A;  1CUK A;  2JY7 A;  1VEJ A;  1MN3 A;  2HWJ A;  3LCU A;  1E94 E;  3LCV B;  2LVN C;  2MJ5 B;  1KYI A;  1HT1 E;  1TTE A;  2DAG A;  2EJS A;  2JZ0 A;  1HQY E;  1DO2 A;  1T43 A;  2EKK A;  1VEG A;  2KHH A;  4F1I A;  1G3I A;  1ZMV A;  3GLI E;  1C7Y A;  2KNV A;  2DAK A;  2L4F A;  5DFL A;  3H4J A;  2R0I A;  2LVA A;  2H5X A;  2BWB A;  2WZJ A;  1XXH E;  1F4I A;  1P3Q Q;  3K9O A;  3E21 A;  1VG5 A;  2K0B X;  1Q02 A;  1XB2 B;  1TR8 A;  4UN2 B;  1BVS A;  3BBZ A;  2CP8 A;  2JZ1 A;  2MGW A;  1VEK A;  2OO9 A;  2O25 A;  2ZTC A;  1T6O A;  2HAK A;  2L2D A;  1PGY A;  2JNH A;  1IXS A;  2MR9 A;  1DV0 A;  1WGN A;  1UFZ A;  1AIP C;  2LVQ D;  4WP2 A;  3FRH A;  2JUJ A;  1IM2 A;  2DAI A;  2L4E A;  1IFY A;  3FE3 A;  2DKL A;  1OKS A;  2DZL A;  1NV8 A;  2QNJ A;  1EFU B;  1ZV1 A;  1R4G A;  2MRO B;  1ZMU A;  3GLH E;  1NV9 A;  3IHP A;  1JR3 E;  3K9P A;  3E46 A;  2DNA A;  1SG9 A;  3F92 A;  4GEW A;  1GO5 A;  2JY5 A;  2KNZ A;  3B89 A;  4HEO A;  2LVO C;  4F2L A;  2JP7 A;  1A5T A;  2DAE A;  2RRU A;  2OOA A; 
#chains in the Genus database with same CATH topology
 2KRU A;  3D8B A;  1SXJ D;  1NY5 A;  2OPF A;  2C96 A;  1N36 M;  2J5Y A;  2UXD M;  2LHG A;  1SXJ A;  3FRI A;  2KNA A;  1OTR A;  3B9P A;  2QHO B;  2Y20 A;  2GQF A;  3DOA A;  4DUZ M;  2DAM A;  2Y0T A;  2YFQ A;  1WGL A;  2RGH A;  3U6P A;  1FJG M;  4LFB M;  2CE7 A;  5EXS A;  5EJC A;  3GLI A;  3FTC A;  4B3S M;  3HJS A;  5ITY A;  4LJ8 A;  2L6O A;  3L25 A;  3VKG A;  4MM3 B;  2JY8 A;  1JQJ C;  4DR5 M;  1G4A E;  3TE6 A;  1IBK M;  1SXJ B;  3GLF E;  4JYA M;  1XNR M;  1YLA A;  1Q39 A;  1XNQ M;  1Z5B A;  1QQW A;  4MGY E;  3C58 A;  4L6V 6;  2X4A A;  3BOS A;  1GL7 A;  1D0K A;  4AG5 A;  3B7Z A;  2Y0Q A;  2QCU A;  1HJP A;  1K3W A;  1D0M A;  2JY6 B;  1CUK A;  1SXJ C;  1VEJ A;  1MN3 A;  3LCU A;  4I8O A;  1E94 E;  8CAT A;  1NHW C;  3PNY A;  2DWM A;  5BPV A;  2UU9 M;  2LNH C;  2MJ5 B;  4R7G A;  5EXX A;  1NSF A;  4NSR A;  5DYI A;  3THG A;  1IXR C;  4IBG A;  2X49 A;  3MJ5 A;  2FS1 A;  4FVM A;  1IY2 A;  1HQY E;  4X66 M;  1DO2 A;  1T43 A;  1KFV A;  1E9R A;  3SAS A;  1Q3B A;  1G3I A;  4IBB A;  4DR7 M;  1Q3C A;  4LJ5 A;  4CIZ A;  2KNV A;  2DAK A;  4AKI A;  2FE8 A;  3LW5 F;  4WUR A;  4QHS A;  2WZJ A;  2DZN B;  2GNO A;  1N32 M;  3J2P B;  3HJQ A;  3FUT A;  1OFI A;  3E21 A;  3KW6 A;  4HLQ A;  5H37 D;  5FSW A;  2I7N A;  1TR8 A;  4CJ6 A;  1N78 A;  2EO2 A;  3A98 B;  3KDS E;  3VFD A;  4ITQ A;  3GRR A;  1JR3 D;  4M0W A;  4P17 A;  1GKI A;  4LCB A;  3KOZ E;  2MGW A;  3GPP A;  5C1B A;  4OVZ B;  1VEK A;  1JR3 A;  1AUA A;  3T38 A;  2V1U A;  2XGN A;  2BJV A;  2ZAM A;  2HAK A;  2L2D A;  1NVM A;  2XEP A;  2CV1 A;  2BNK A;  4XGI A;  3CTW B;  2HCB A;  5LMU M;  1IBL M;  1WGN A;  4W5W A;  2WSF F;  3V76 A;  1TDZ A;  4XK8 F;  1XMO M;  2HHH M;  5LMN M;  1KSF X;  2XFS A;  3PVS A;  2I7P A;  2F5P A;  2V1C A;  4EIW A;  2DKL A;  4MH0 E;  3DFZ A;  1QDR A;  3QAU A;  3J27 B;  5JI3 E;  4LF8 M;  1NV8 A;  4AG6 A;  2C99 A;  4NOO B;  1IBM M;  1GJS A;  4AW4 A;  2K47 A;  3WHK A;  1R4G A;  2MRO B;  3GLH E;  4LFA M;  2KZU A;  4YHH M;  4G4O A;  2EA0 A;  3I04 M;  3K9P A;  2D7H A;  4JI5 M;  2D7E A;  4GC5 A;  4B7H A;  3ZH9 B;  3F92 A;  4GEW A;  1TH2 A;  4LGY A;  3VDP A;  4FWD A;  1W5S A;  3HHW A;  4BBA A;  2XZU A;  4GRI A;  3KS8 A;  1DGF A;  4HEO A;  4LZZ A;  3U6S A;  3UJN A;  4AKH A;  1NNJ A;  3DZD A;  3HU1 A;  3MMP A;  4ZPX A;  3U6O A;  1J7K A;  3UGJ A;  1OQY A;  2ZTD A;  4M9X A;  3GQ4 A;  3HHZ A;  3B74 A;  1QDT A;  2B3T A;  2BJW A;  3IG5 A;  3KVW A;  1G41 A;  2R4E A;  3LQR A;  1E32 A;  1IXS B;  1DO0 A;  1IN4 A;  3CF0 A;  2V6Z M;  2WSE F;  2FNA A;  1DGG A;  1G71 A;  1LTM A;  2KXE A;  2Y21 A;  1T3T A;  3GLG A;  3QYE A;  1WIV A;  4OX9 M;  4Q7J A;  5ITQ A;  4JI4 M;  2M5Z A;  4DV1 M;  1I94 M;  2YNM D;  3U6D A;  3OTO M;  4L78 A;  2KA6 B;  3SAV A;  3CF2 A;  3AOG A;  1QZE A;  4PDG A;  3NWL A;  2DZO B;  1X37 A;  1Z5C A;  2DHY A;  2HKJ A;  4I81 A;  4IBE A;  5KPT A;  4YY3 M;  5EXP A;  3GLG B;  2VF8 A;  1ZMW A;  2QPA A;  2VDB B;  1V33 A;  3RGS A;  4CGY B;  4RKU F;  2F5N A;  3PNV A;  3EIE A;  2JY7 A;  4CHT B;  4G4N A;  4GKJ M;  2HWJ A;  5ITX E;  4LY6 A;  1GJT A;  1PJS A;  4FWG A;  3U61 A;  3U6Q A;  3VK7 A;  3ZQJ A;  2Q2E B;  4MGZ E;  2JZ0 A;  2RKO A;  2EKK A;  1QAQ A;  3HGI A;  1HR0 M;  4B3R M;  1TF0 B;  1ZMV A;  1C7Y A;  2XF3 A;  2Z3X A;  3H4J A;  4L16 A;  4LJ4 A;  2YR0 A;  4P16 A;  1XWI A;  1FNN A;  1PJJ A;  1NHG C;  1XXH E;  2L7H A;  3NBI A;  3QYB A;  4I5S A;  4NSO B;  3L26 A;  3U61 B;  4PDI A;  1K3X A;  2KRK A;  3SC3 A;  3B7Q A;  3HJ8 A;  5BR8 M;  1VG5 A;  1L2C A;  2O5R A;  2QBY A;  2E5L M;  2K0B X;  3PFI A;  4QOS A;  3I01 M;  3VK8 A;  3SMP A;  4JI6 M;  4IJE A;  5ITU A;  4LG2 A;  4LJ7 A;  3GLI B;  3VDU A;  1BVS A;  3J7A S;  3KS4 A;  3BBZ A;  2JZ1 A;  2QP9 X;  3GLH A;  3U60 A;  4IJF A;  3HX3 A;  3FTF A;  3L29 A;  1I4W A;  3KSX A;  4DR4 M;  2ZTC A;  1IQP A;  1T6O A;  3I4Y A;  4PT5 A;  1TH4 A;  1OJL A;  4X65 M;  4GIT A;  2DXI A;  4DV4 M;  3IG8 A;  1R2Y A;  1R5L A;  1UFZ A;  1OIZ A;  1TDH A;  5ITR A;  3SAR A;  2XH9 A;  3FUX A;  3TQS A;  3TWL A;  1L8Q A;  5E6J A;  5KPZ A;  4DV3 M;  2O01 F;  2DAI A;  2L4E A;  3KXE C;  4REZ A;  3L2A A;  2F5O A;  2Z8Y M;  4IBD A;  4LF6 M;  1H6U A;  2J7O A;  4NXN M;  1K82 A;  2KW0 A;  1PJI A;  2W82 A;  3LVV A;  1EFU B;  3MHV C;  1NY6 A;  1VDD A;  1QVR A;  4G6Z A;  4L15 A;  4MGK E;  4X64 M;  2XFT A;  3VKH A;  4Z6Y A;  3U6L A;  3KP1 E;  2Z4R A;  4NC6 A;  2JWS A;  2CHQ A;  1WXQ A;  4DV2 M;  5IZ7 D;  2WSC F;  1PJQ A;  2DNA A;  3LMM A;  4FWH A;  3AOE A;  2R45 A;  3T15 A;  4KHP M;  3U6E A;  3KFU G;  5IRE B;  2KNZ A;  2L09 A;  5EP3 A;  4KT0 F;  4DR1 M;  2G5G X;  4F2L A;  1JB0 F;  2RRU A;  5GKN A;  1Y8G A;  4RF0 A;  2C9C A;  3FYD A;  4AKG A;  5FLX S;  1QYR A;  5C18 A;  2QSF X;  1ZQ9 A;  1ORY B;  5IT9 S;  1Z5A A;  4KO8 A;  1N33 M;  1IN6 A;  3T6P A;  1SXJ E;  1J5E M;  5FTJ A;  1E9S A;  4JI8 M;  2CWB A;  2KZS A;  4D80 A;  3R8F A;  2CV2 A;  3T1Y M;  5KQD A;  4LF5 M;  5EP2 A;  4DR3 M;  3KOY E;  3HZJ A;  3AJI B;  2DI0 A;  3CF6 E;  4MB7 A;  2CFO A;  3JAM S;  5KO3 A;  1L2B A;  3K92 A;  1WJ7 A;  2ZM6 M;  2R4J A;  3AOE C;  4B7F A;  1YSY A;  2UUC M;  3LQQ A;  2DWZ B;  4K0K M;  2JXN A;  3GPX A;  1DGH A;  3J81 S;  3QWL A;  4MGH A;  1HT2 E;  4D81 A;  4NL4 H;  2FH0 A;  3GLF A;  3W67 A;  3SFZ A;  4DV6 M;  3U5Z A;  3HWS A;  5EP4 A;  4CIS A;  2QQ8 A;  5JI2 E;  1NJG A;  3SHF A;  1G59 A;  2K9D A;  2G3Q A;  4QHT A;  2QEN A;  4XBO A;  1RU3 A;  3RGP A;  2K6B A;  4JI3 M;  4LF4 M;  2R46 A;  3CGW A;  3UZU A;  1IN7 A;  5KQ8 A;  2DHR A;  5FTK A;  3K2L A;  1IY0 A;  2FOI C;  2X8A A;  4LF9 M;  3LCV B;  4D82 A;  3UK6 A;  4LF7 M;  1KYI A;  1HT1 E;  3GLF B;  2DAG A;  4JV5 M;  3K1J A;  4JI1 M;  2RGO A;  5FTN A;  2EJS A;  3GPY A;  3U5Z B;  2UXC M;  1HNW M;  2KHH A;  4NRV A;  4F1I A;  3DA1 A;  3FD9 A;  1HNZ M;  1ZAE A;  4I4L A;  3W68 A;  4IBC A;  3TL4 X;  3I4V A;  5ITT A;  4X62 M;  3GQ5 A;  2R0I A;  4Z8X A;  1R2Z A;  3SAT A;  4OW0 A;  1HQC A;  2BWB A;  1NO1 A;  4GH9 A;  2LXE A;  4LJ6 A;  4G4Q A;  1P3Q Q;  4FW9 A;  3K9O A;  1YUB A;  5L8R F;  4GIP A;  1Z6T A;  2ZBK B;  4B3M M;  2VQE M;  3HKP A;  2UXB M;  2LH0 A;  2AHM A;  4UN2 B;  1DGB A;  2UUB M;  4JXJ A;  4RNA A;  1GVN A;  5A2Q S;  2F4V M;  3VLF B;  2CP8 A;  2XSZ D;  3Q8G A;  4M0D A;  3W0L B;  2ERC A;  4KOD A;  4S12 A;  3FUV A;  3SMS A;  2XSZ A;  2C5R A;  3SAW A;  1N77 A;  3HY5 A;  2CHV A;  1PGY A;  2JNH A;  3MK6 A;  1OAO C;  3RFW A;  2F5Q A;  1DV0 A;  1NJF A;  3HU3 A;  4G4R A;  2J7N A;  2JA2 A;  4WP2 A;  1IY1 A;  4LJA A;  4Y28 F;  3RE8 A;  2JUJ A;  1IM2 A;  1QZM A;  4QOZ C;  3T1H M;  1G8P A;  3SYK A;  4L8R C;  3AL0 C;  3AV0 A;  1HNX M;  2CV0 A;  2MH8 A;  3C3D A;  2DZL A;  2LWX A;  3KSJ A;  1QUS A;  2QNJ A;  4PCZ A;  3U6M A;  3M7G A;  3FTE A;  3SYL A;  4BB9 A;  2OQ4 A;  4FCV A;  3FUW A;  3IHP A;  2VQF M;  1C1K A;  3LVW A;  4DV5 M;  2DWL A;  1YE9 A;  2XLJ A;  2FFJ A;  4GHA A;  2KDL A;  4NXM M;  2G8L A;  3E46 A;  3Q8X A;  2C98 A;  4MGI E;  2QBY B;  4WW0 A;  1SG9 A;  4DUY M;  1QAN A;  1L1T A;  2LHC A;  3B89 A;  1LV7 A;  5IWA M;  2LVO C;  1IXZ A;  1A5T A;  2OOA A;  4GC9 A;  3GLH B;  4R3D A;  4DV7 M;  3U60 B;  2CEA A;  2CHG A;  5E26 A;  3L27 A;  4FCT A;  1WHC A;  1GL6 A;  2R18 A;  4R71 A;  3L28 A;  2LTU A;  3HU2 A;  4NRW A;  2M60 A;  2VF7 A;  1VDL A;  2EUC A;  1MJG M;  1R7R A;  1L1Z A;  4G3O A;  1V92 A;  4QNM A;  3U6C A;  4B7G A;  2R44 A;  4LRT A;  3GLG E;  5DNY A;  3IEC A;  1D0L A;  2APL A;  2VII A;  2CRU A;  4PD2 A;  2DWN A;  3SBJ A;  3HHX A;  4IBF A;  3J7B A;  1MX0 A;  3C9P A;  3GO8 A;  3GP1 A;  1OAI A;  4DR2 M;  4JI2 M;  3NBX X;  4AI6 A;  2LVP C;  4OVZ A;  1EE8 A;  2BWE A;  3UMM A;  3FUU A;  3KP0 E;  3E4R A;  3GRY A;  2UUA M;  2LBC A;  3K8Z A;  4GHL A;  2ZAN A;  1V34 A;  4ANR A;  1TGU A;  3M6A A;  2EKF A;  1N75 A;  2DEN A;  1WR1 B;  4DBG B;  4IIW A;  1VQ1 A;  5DYG A;  3PXG A;  4AQY M;  2C9O A;  4JI7 M;  3KOW E;  1TH3 A;  5ITX A;  2LVN C;  5EXT A;  1UM8 A;  4B3T M;  1GLN A;  1TTE A;  3ILK A;  3GPU A;  4DR6 M;  3A45 A;  3M0E A;  4DV0 M;  4LZJ A;  1S3S A;  1VEG A;  2Z4S A;  3J80 S;  4OU7 A;  1IN5 A;  4HL4 A;  1J09 A;  3GLI E;  1W5T A;  2F5S A;  2HL7 A;  2L4F A;  5DFL A;  5KPR A;  3BXW A;  2LVA A;  2H5X A;  3GRU A;  3EIH A;  4JN6 A;  4KLN A;  3WHL A;  2CUZ A;  1XXH A;  3JR5 A;  2D7G A;  2XZF A;  3JR4 A;  1PJT A;  4GMQ A;  3SHG B;  1Q02 A;  4FCW A;  1XB2 B;  3A42 A;  2A5Y B;  3TPZ A;  2L7I A;  1PRB A;  3HHY A;  3TWM A;  4M9Z A;  3TWK A;  1QUT A;  2YQZ A;  3AKZ A;  4LRS A;  4RF1 A;  2QZ4 A;  2R6F A;  4M9S A;  1DGH B;  1OFH A;  4A3V B;  2R62 A;  1XXH B;  2N35 A;  1EIJ A;  3I51 A;  1F4I A;  1D2N A;  3FTD A;  4L4U A;  3SAU A;  2OO9 A;  1Z59 A;  2O25 A;  2H1R A;  4LGM A;  5FTL A;  5F3W A;  4IBK A;  1IN8 A;  3C3E A;  4LFC M;  2R65 A;  5EQT A;  4AZF A;  4GKK M;  1IXS A;  2MR9 A;  2P5T A;  3H4M A;  1AIP C;  1QAO A;  3ZCB B;  2LVQ D;  3AFH A;  1MU5 A;  3FRH A;  1QAM A;  1XMQ M;  4QNR A;  4FD2 A;  1XC8 A;  1IFY A;  3FE3 A;  4IBJ A;  1OKS A;  5FTM A;  2Z7J A;  3GRV A;  4TUW A;  3R9X B;  3B7N A;  5EP1 A;  2ZAO A;  1ZV1 A;  1ZMU A;  1PM5 A;  1GAB A;  1NV9 A;  4BLC A;  7CAT A;  4IBI A;  1JR3 E;  3GQ3 A;  3FKE A;  1NNU C;  2KEB A;  4JI0 M;  4II7 A;  1L2D A;  3FYC A;  1R6B X;  2DVW B;  3W0F A;  1GO5 A;  2JY5 A;  3KOX E;  4B08 A;  1N34 M;  3A46 A;  1OIP A;  4LJ9 A;  3E9S A;  1XHB A;  3D8L A;  2JP7 A;  2DAE A;  2NQ8 C;  3ZC7 B;  2OOB A; 
#chains in the Genus database with same CATH homology
 1Y8G A;  3MMP A;  1OQY A;  2QSF X;  2ZTD A;  1WHC A;  4R71 A;  2LTU A;  3T6P A;  2B3T A;  3FRI A;  2CWB A;  1VDL A;  1G41 A;  1OTR A;  2KNA A;  4G3O A;  2QHO B;  1DO0 A;  2DAM A;  2OOB A;  1V92 A;  1WGL A;  3GLG E;  2DI0 A;  3IEC A;  1WIV A;  4Q7J A;  1WJ7 A;  2JY8 A;  1OAI A;  1G4A E;  2LVP C;  3GLF E;  1HT2 E;  2BWE A;  1YLA A;  2LBC A;  5JI2 E;  1QZE A;  2K9D A;  2G3Q A;  2DHY A;  1ZMW A;  2EKF A;  1HJP A;  2DEN A;  1WR1 B;  4DBG B;  2JY6 B;  1VQ1 A;  1CUK A;  2JY7 A;  1VEJ A;  1MN3 A;  2HWJ A;  3LCU A;  1E94 E;  3LCV B;  2LVN C;  2MJ5 B;  1KYI A;  1HT1 E;  1TTE A;  2DAG A;  2EJS A;  2JZ0 A;  1HQY E;  1DO2 A;  1T43 A;  2EKK A;  1VEG A;  2KHH A;  4F1I A;  1G3I A;  1ZMV A;  3GLI E;  1C7Y A;  2KNV A;  2DAK A;  2L4F A;  5DFL A;  3H4J A;  2R0I A;  2LVA A;  2H5X A;  2BWB A;  2WZJ A;  1XXH E;  1F4I A;  1P3Q Q;  3K9O A;  3E21 A;  1VG5 A;  2K0B X;  1Q02 A;  1XB2 B;  1TR8 A;  4UN2 B;  1BVS A;  3BBZ A;  2CP8 A;  2JZ1 A;  2MGW A;  1VEK A;  2OO9 A;  2O25 A;  2ZTC A;  1T6O A;  2HAK A;  2L2D A;  1PGY A;  2JNH A;  1IXS A;  2MR9 A;  1DV0 A;  1WGN A;  1UFZ A;  1AIP C;  2LVQ D;  4WP2 A;  3FRH A;  2JUJ A;  1IM2 A;  2DAI A;  2L4E A;  1IFY A;  3FE3 A;  2DKL A;  1OKS A;  2DZL A;  1NV8 A;  2QNJ A;  1EFU B;  1ZV1 A;  1R4G A;  2MRO B;  1ZMU A;  3GLH E;  1NV9 A;  3IHP A;  1JR3 E;  3K9P A;  3E46 A;  2DNA A;  1SG9 A;  3F92 A;  4GEW A;  1GO5 A;  2JY5 A;  2KNZ A;  3B89 A;  4HEO A;  2LVO C;  4F2L A;  2JP7 A;  1A5T A;  2DAE A;  2RRU A;  2OOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...