2EJSA

Solution structure of ruh-076, a human cue domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
GSSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Autocrine motility factor receptor, isoform 2
publication title Solution structure of RUH-076, a human CUE domain
rcsb
source organism Homo sapiens
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ejsA00
2RRUA 1CUKA 1G4AE 2DI0A 2DZLA 2H5XA 3H4JA 1C7YA 2DAKA 1UFZA 1T43A 1OQYA 1HQYE 1JR3E 1KYIA 1HT1E 2L4EA 2O25A 1VEKA 1E94E 3GLGE 1HT2E 2KNAA 2OOAA 3GLHE 3GLFE 1WHCA 2JNHA 2JY7A 2L2DA 1G3IA 2B3TA 2DHYA 2LVOC 1IFYA 2WZJA 1DO0A 2LVNC 3E21A 3FRHA 1ZV1A 4R71A 3BBZA 4F1IA 3FRIA 1QZEA 1XB2B 4WP2A 2QSFX 2QHOB 2DAIA 2KNZA 3LCUA 3K9PA 1T6OA 2DAEA 2MGWA 3T6PA 1F4IA 2LVPC 2JZ1A 2EKFA 2CWBA 1TTEA 3MMPA 2L4FA 1VEJA 1P3QQ 1DV0A 3E46A 1MN3A 1VEGA 4UN2B 2BWEA 2DAGA 2BWBA 2JY5A 2ZTCA 3FE3A 2JY6B 2OO9A 2HAKA 2LBCA 4HEOA 1WR1B 1OAIA 2LVAA 1ZMWA 2QNJA 1GO5A 2HWJA 2K0BX 2K9DA 1TR8A 2OOBA 2CP8A 1HJPA 2MJ5B 1SG9A 2JP7A 1NV8A 1BVSA 3IECA 3IHPA 1Y8GA 1YLAA 4GEWA 1AIPC 2DKLA 1OTRA 2G3QA 5DFLA 4Q7JA 3F92A 1ZMUA 2MROB 1Q02A 4DBGB 5JI2E 1WJ7A 3LCVB 4G3OA 1IM2A 2JUJA 2DNAA 1VG5A 1XXHE 2MR9A 3K9OA 1OKSA 1R4GA 2JZ0A 1NV9A 1V92A 1VQ1A 4F2LA 2EKKA 2LVQD 2KHHA 1VDLA 1IXSA 1WGLA 1WIVA 2DENA 3B89A 1WGNA 2LTUA 1DO2A 2EJSA 1ZMVA 1PGYA 2DAMA 2JY8A 1G41A 1A5TA 1EFUB 2R0IA 2ZTDA 2KNVA 3GLIE
chains in the Genus database with same CATH superfamily
3VDPA 4IBCA 2F5NA 4D81A 4GHLA 3L27A 2DI0A 2DZLA 1JR3A 2XFTA 2CV0A 3R8FA 1C7YA 1UFZA 2EO2A 1MU5A 3HX3A 4G6ZA 3SYKA 4L16A 1HQYE 3M0EA 3Q8XA 2XLJA 4JI1M 4D82A 1IY0A 4MGYE 1Z6TA 2EA0A 2C96A 1IBKM 4DR7M 1JQJC 2LNHC 2R45A 3R9XB 1Z5AA 3CF2A 1E94E 3J80S 3GLFE 4P16A 2XZFA 3ZQJA 1QUSA 2ZAMA 2JNHA 3SARA 2XEPA 1G3IA 4DV7M 2LVOC 3J2PB 1D2NA 5EP2A 5C18A 1IFYA 3GO8A 5E26A 3KP0E 2ZANA 3FRHA 1ZV1A 4IBJA 2CEAA 2R46A 4L78A 2VF7A 4I5SA 3HHYA 4JI6M 4B3MM 1E9RA 4JI7M 1QDTA 4RF1A 2F5QA 3JAMS 3SAVA 2J7NA 3QYBA 5KPTA 3HHWA 5C1BA 1XB2B 4NC6A 4LF9M 4L6V6 2QENA 5EXTA 4X64M 2CHVA 3TWKA 2DZOB 3C58A 1WXQA 1QUTA 3C3DA 1R5LA 1R6BX 4QOZC 5DYGA 4NL4H 3U60B 3KVWA 2R62A 3T6PA 1N36M 1DGGA 4Z6YA 2EKFA 3AJIB 3VK7A 4XBOA 5JI3E 1HR0M 2L4FA 1Z5CA 3VK8A 4K0KM 1HNZM 1P3QQ 1DV0A 4DV5M 4NRWA 1VEGA 2BNKA 5EXSA 1HQCA 1X37A 2BWBA 1V33A 4KO8A 2UXCM 2JY6B 2OO9A 5KQ8A 4AKGA 1YSYA 2RGOA 2QBYA 5LMNM 1WR1B 4IBGA 4PDGA 2O5RA 2X8AA 4OW0A 3W68A 3QYEA 2FOIC 1W5TA 4OU7A 2CUZA 2HWJA 4I8OA 2L6OA 1TH2A 5EP1A 3HJSA 1XNRM 5GKNA 1DGFA 1HJPA 4MGKE 2GNOA 4BB9A 4JN6A 3GLIA 3IHPA 3KSXA 1JR3D 1YLAA 4LGMA 4G4OA 4AW4A 1SXJB 2C9OA 1XMQM 1OTRA 5KPRA 4M0DA 3Q8GA 4DUZM 3SMPA 3A98B 4LZZA 3T38A 3I01M 4DBGB 2BJWA 3AOEA 3LCVB 4G3OA 3WHLA 1IM2A 1OAOC 3CF6E 3TWLA 2DNAA 3OTOM 2P5TA 3FYCA 5FTJA 1R4GA 1QQWA 1XC8A 2KA6B 4M0WA 4JI5M 2QPAA 1N33M 3GLFA 3U61A 4B3SM 1GL7A 3D8BA 2EKKA 2KRKA 3DOAA 2RKOA 3FTCA 1MJGM 1SXJC 4B3TM 3FD9A 2G5GX 1GVNA 4OVZB 5KPZA 1IY1A 2QZ4A 2LTUA 3HWSA 3PNYA 2VDBB 4I81A 4FD2A 4NXNM 4G4NA 3K8ZA 4MH0E 4A3VB 2HHHM 3K2LA 2KNVA 1Q3BA 1K3XA 2C98A 3DZDA 3U6EA 2WSFF 4IBFA 4JI0M 1IN5A 4ANRA 1NHWC 5IT9S 1CUKA 4ZPXA 1G4AE 2YR0A 2YFQA 4RNAA 3VDUA 3H4JA 4Z8XA 1OJLA 1IXRC 1EE8A 3GQ4A 4LFBM 2APLA 4LF6M 3GLHA 1F4IA 2BJVA 1NHGC 3LMMA 3ZC7B 1QANA 2L4EA 4YY3M 3WHKA 2C5RA 1SXJE 3U6LA 3U6CA 3HHZA 2DWLA 4LF7M 4MB7A 2B3TA 2CHGA 1NJGA 3FTDA 3HJ8A 2ZBKB 4X66M 2LVNC 2Z7JA 1G59A 1XXHB 4GIPA 3MJ5A 5EJCA 1T3TA 4P17A 3RE8A 4BLCA 4DR5M 1R2ZA 2WSEF 3I04M 4F1IA 3SFZA 1QZEA 2JWSA 3SC3A 2XSZA 4LJ4A 1DGBA 1NNJA 1PJJA 2QSFX 1L2CA 5LMUM 1N34M 3U5ZB 2J7OA 3ZH9B 2DAIA 3HU2A 2OQ4A 4PT5A 5ITTA 3GPPA 2MGWA 5A2QS 2LVPC 3E4RA 4QOSA 4AG5A 4DV1M 2V1CA 4FCVA 3SHFA 2JZ1A 4DV3M 3J7AS 2F4VM 1QZMA 2CFOA 1VEJA 3U6MA 1MN3A 2UU9M 5ITRA 5H37D 2JY5A 4RKUF 4L15A 3SAUA 4IIWA 2ERCA 3QAUA 2LVAA 1YUBA 5EP3A 3B7QA 3U60A 2F5PA 1TH4A 1Z5BA 4HL4A 2KEBA 1TR8A 2OOBA 1KFVA 4DR2M 2GQFA 2JP7A 2ZAOA 1NV8A 2X4AA 4Y28F 3AOGA 3IECA 3W0LB 3IG5A 2R6FA 3PVSA 1PJQA 1PJSA 1QDRA 5IZ7D 1XNQM 3HU1A 2UXBM 1FJGM 3GRUA 5BPVA 4B7GA 3EIHA 1AUAA 1E32A 3K92A 3VKGA 1IXSB 3KSJA 5JI2E 1WJ7A 4GKKM 4GH9A 3V76A 4NSRA 3NBIA 1XXHE 2LXEA 3KP1E 3U6DA 1N78A 5L8RF 4AI6A 5EXPA 4LG2A 4II7A 3J7BA 4PDIA 2K6BA 1SXJA 1YE9A 1NV9A 1GKIA 2C99A 2N35A 1IQPA 4JI3M 2ZM6M 4R3DA 4CJ6A 4GRIA 1WIVA 2QQ8A 3BXWA 1NO1A 3BOSA 4KLNA 1GABA 1IN8A 1GJSA 1D0KA 2KDLA 1GJTA 2XFSA 2W82A 4FWGA 2FNAA 5ITXE 2LH0A 1A5TA 1EFUB 2R0IA 2A5YB 4L4UA 5BR8M 1MX0A 3EIEA 4LJ8A 4X62M 4DV2M 1VDDA 2CE7A 2HL7A 2X49A 3T15A 3TPZA 1V34A 5EP4A 4AG6A 2RGHA 3L28A 3FUUA 4B7HA 2DHRA 2H5XA 2KW0A 3CF0A 1IBMM 2Z3XA 3GP1A 3VKHA 3DFZA 1G71A 1TDHA 2QP9X 1PJTA 1J5EM 1T43A 2Y0QA 1OQYA 3PNVA 1L2DA 3KOXE 4WW0A 4FCTA 2VQEM 3D8LA 3LQRA 3UJNA 2I7NA 2R65A 4NRVA 3LVWA 1JR3E 1KYIA 3GQ5A 4I4LA 2O25A 3FUVA 2XZUA 4LJ7A 1QAOA 1VEKA 2XGNA 3CTWB 3QWLA 2KNAA 4GHAA 2EUCA 1WHCA 2R18A 4NOOB 2L09A 4AQYM 2JY7A 3FKEA 4MGHA 2L2DA 1Q39A 4LFCM 1K82A 3SHGB 2M60A 4G4QA 4LRSA 1S3SA 2VQFM 4NSOB 3MHVC 3L2AA 3U6PA 3PXGA 2FE8A 2J5YA 5KQDA 1C1KA 2UXDM 3HZJA 3LW5F 4WP2A 2DVWB 1IBLM 1EIJA 1DGHB 5FTNA 2QHOB 3JR5A 4IJFA 2UUBM 4W5WA 1HNXM 3T1YM 2G8LA 3K9PA 1R7RA 1XWIA 2C9CA 1T6OA 2Q2EB 3GRYA 1QYRA 4DV0M 3KW6A 4JV5M 1XXHA 4G4RA 3KOYE 3A46A 3RFWA 3MMPA 3FUXA 4M9SA 4OX9M 3AL0C 4DUYM 3E46A 1PM5A 4NXMM 3I51A 3HGIA 4AZFA 4UN2B 2L7HA 4XK8F 2KZUA 1NY6A 1IXZA 3FE3A 3KS4A 2HAKA 4FW9A 3U5ZA 4LFAM 2LBCA 1RU3A 4HEOA 3GRVA 3HKPA 1XMOM 5KO3A 4QHSA 5DNYA 4X65M 2DXIA 1OAIA 1ZMWA 1GO5A 5ITXA 3LVVA 1IN4A 3KOWE 1LV7A 2M5ZA 2CP8A 7CATA 3FUWA 4IBKA 2MJ5B 3U6OA 4KT0F 1BVSA 4B08A 4FWDA 2VIIA 4QNRA 2HKJA 1Y8GA 4GEWA 3GLGB 3W0FA 3GLHB 2DKLA 2WSCF 4JI2M 2G3QA 3THGA 5DFLA 5FTLA 4Q7JA 3F92A 2F5OA 1ZMUA 2DWMA 3ILKA 4GC5A 1NY5A 1PRBA 1Q02A 4HLQA 4MM3B 3L26A 4DR4M 3RGPA 4S12A 4IJEA 4YHHM 4GKJM 2Z8YM 4LF4M 2MR9A 2R4JA 2LHGA 3I4VA 1FNNA 1L1ZA 2JZ0A 1L8QA 2R44A 4WURA 5ITYA 4LZJA 2L7IA 1VQ1A 2CRUA 3AV0A 3CGWA 3SBJA 2Y20A 3UK6A 3FTFA 1OFHA 1IXSA 3B89A 2DENA 4LJAA 3U6SA 4AKIA 2E5LM 4LJ5A 1I94M 3KFUG 5FTKA 2EJSA 1PGYA 3UZUA 3B74A 1L2BA 3VFDA 3PFIA 1IY2A 1UM8A 3C3EA 2KZSA 2CV2A 3NWLA 2Y0TA 1ZQ9A 2RRUA 5IWAM 4LRTA 4AKHA 1QVRA 2CHQA 2DAKA 3IG8A 3HU3A 4ITQA 4LGYA 3TWMA 4JI8M 4FWHA 1ZAEA 8CATA 3W67A 5F3WA 4M9ZA 1J09A 1QAMA 2I7PA 1E9SA 1OFIA 3HJQA 3K1JA 3GPXA 1HT1E 3M7GA 1Z59A 1IN6A 3TL4X 2JXNA 3FUTA 4JYAM 4LJ6A 4DR6M 2V6ZM 3E9SA 3GLGE 2Y21A 1HT2E 2OOAA 2F5SA 3B7ZA 2Z4RA 3GLHE 2UUAM 3AFHA 2V1UA 1D0MA 1D0LA 3RGSA 4PCZA 2XF3A 4DV4M 4LJ9A 3SAWA 2D7GA 2XSZD 3UMMA 1HNWM 5FSWA 1TDZA 2DHYA 3SATA 3GRRA 2WZJA 3U6QA 4TUWA 1JB0F 4FCWA 1DO0A 4CHTB 3E21A 4CISA 3GPYA 4R71A 4LCBA 3BBZA 1NJFA 3FRIA 1QAQA 1NVMA 4DV6M 3C9PA 4OVZA 2DWZB 2FFJA 1I4WA 2DZNB 1W5SA 4IBEA 3KOZE 1PJIA 2XH9A 4QNMA 2QBYB 4JXJA 4QHTA 3AKZA 2KNZA 2AHMA 2D7HA 3LCUA 1IN7A 5EXXA 4CIZA 5ITUA 5FLXS 2DAEA 2H1RA 3ZCBB 2OPFA 4KHPM 3LQQA 4LY6A 4JI4M 2JA2A 2CWBA 1TTEA 2K47A 5ITQA 2UUCM 2KXEA 3T1HM 5E6JA 1N75A 2BWEA 3GLIB 2DAGA 4B3RM 3TE6A 2ZTCA 3A42A 1GLNA 1DGHA 2D7EA 4GMQA 2KRUA 4IBBA 1GL6A 2QNJA 3UGJA 3J81S 1G8PA 3HY5A 1OIPA 4IBIA 3B9PA 2K0BX 2K9DA 3NBXX 2Z4SA 3SASA 3KS8A 1SG9A 4PD2A 1Q3CA 1N32M 2MH8A 3J27B 2LHCA 4EIWA 1H6UA 4BBAA 3L29A 4FVMA 4IBDA 1TH3A 4MGIE 3GPUA 3GLFB 1AIPC 4D80A 3I4YA 3U61B 4GC9A 4LF8M 2VF8A 1TF0B 2YNMD 1SXJD 2MROB 3MK6A 3TQSA 4DR1M 1NSFA 1NNUC 4M9XA 4XGIA 3SMSA 5EQTA 3GQ3A 4B7FA 4GITA 2QCUA 1N77A 2JUJA 1KSFX 3SYLA 1VG5A 3K9OA 1J7KA 5DYIA 1OIZA 1OKSA 5FTMA 2NQ8C 1K3WA 3AOEC 2YQZA 3GLGA 3FYDA 4RF0A 4L8RC 4KODA 1V92A 3HHXA 4MGZE 1LTMA 3FTEA 3L25A 2O01F 3B7NA 4LF5M 4F2LA 2LVQD 1ORYB 3KXEC 2KHHA 3H4MA 1VDLA 2DWNA 3A45A 2FS1A 1WGLA 2HCBA 1R2YA 1XHBA 2R4EA 4CGYB 3KDSE 1WGNA 1DO2A 1ZMVA 2DAMA 2JY8A 4REZA 1G41A 1TGUA 3M6AA 2CV1A 3VLFB 1L1TA 2FH0A 2ZTDA 2LWXA 3DA1A 4R7GA 3JR4A 5IREB 4DR3M 3GLIE
chains in the Genus database with same CATH topology
2RRUA 1CUKA 1G4AE 2DI0A 2DZLA 2H5XA 3H4JA 1C7YA 2DAKA 1UFZA 1T43A 1OQYA 1HQYE 1JR3E 1KYIA 1HT1E 2L4EA 2O25A 1VEKA 1E94E 3GLGE 1HT2E 2KNAA 2OOAA 3GLHE 3GLFE 1WHCA 2JNHA 2JY7A 2L2DA 1G3IA 2B3TA 2DHYA 2LVOC 1IFYA 2WZJA 1DO0A 2LVNC 3E21A 3FRHA 1ZV1A 4R71A 3BBZA 4F1IA 3FRIA 1QZEA 1XB2B 4WP2A 2QSFX 2QHOB 2DAIA 2KNZA 3LCUA 3K9PA 1T6OA 2DAEA 2MGWA 3T6PA 1F4IA 2LVPC 2JZ1A 2EKFA 2CWBA 1TTEA 3MMPA 2L4FA 1VEJA 1P3QQ 1DV0A 3E46A 1MN3A 1VEGA 4UN2B 2BWEA 2DAGA 2BWBA 2JY5A 2ZTCA 3FE3A 2JY6B 2OO9A 2HAKA 2LBCA 4HEOA 1WR1B 1OAIA 2LVAA 1ZMWA 2QNJA 1GO5A 2HWJA 2K0BX 2K9DA 1TR8A 2OOBA 2CP8A 1HJPA 2MJ5B 1SG9A 2JP7A 1NV8A 1BVSA 3IECA 3IHPA 1Y8GA 1YLAA 4GEWA 1AIPC 2DKLA 1OTRA 2G3QA 5DFLA 4Q7JA 3F92A 1ZMUA 2MROB 1Q02A 4DBGB 5JI2E 1WJ7A 3LCVB 4G3OA 1IM2A 2JUJA 2DNAA 1VG5A 1XXHE 2MR9A 3K9OA 1OKSA 1R4GA 2JZ0A 1NV9A 1V92A 1VQ1A 4F2LA 2EKKA 2LVQD 2KHHA 1VDLA 1IXSA 1WGLA 1WIVA 2DENA 3B89A 1WGNA 2LTUA 1DO2A 2EJSA 1ZMVA 1PGYA 2DAMA 2JY8A 1G41A 1A5TA 1EFUB 2R0IA 2ZTDA 2KNVA 3GLIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRU A;  1CUK A;  1G4A E;  2DI0 A;  2DZL A;  2H5X A;  3H4J A;  1C7Y A;  2DAK A;  1UFZ A;  1T43 A;  1OQY A;  1HQY E;  1JR3 E;  1KYI A;  1HT1 E;  2L4E A;  2O25 A;  1VEK A;  1E94 E;  3GLG E;  1HT2 E;  2KNA A;  2OOA A;  3GLH E;  3GLF E;  1WHC A;  2JNH A;  2JY7 A;  2L2D A;  1G3I A;  2B3T A;  2DHY A;  2LVO C;  1IFY A;  2WZJ A;  1DO0 A;  2LVN C;  3E21 A;  3FRH A;  1ZV1 A;  4R71 A;  3BBZ A;  4F1I A;  3FRI A;  1QZE A;  1XB2 B;  4WP2 A;  2QSF X;  2QHO B;  2DAI A;  2KNZ A;  3LCU A;  3K9P A;  1T6O A;  2DAE A;  2MGW A;  3T6P A;  1F4I A;  2LVP C;  2JZ1 A;  2EKF A;  2CWB A;  1TTE A;  3MMP A;  2L4F A;  1VEJ A;  1P3Q Q;  1DV0 A;  3E46 A;  1MN3 A;  1VEG A;  4UN2 B;  2BWE A;  2DAG A;  2BWB A;  2JY5 A;  2ZTC A;  3FE3 A;  2JY6 B;  2OO9 A;  2HAK A;  2LBC A;  4HEO A;  1WR1 B;  1OAI A;  2LVA A;  1ZMW A;  2QNJ A;  1GO5 A;  2HWJ A;  2K0B X;  2K9D A;  1TR8 A;  2OOB A;  2CP8 A;  1HJP A;  2MJ5 B;  1SG9 A;  2JP7 A;  1NV8 A;  1BVS A;  3IEC A;  3IHP A;  1Y8G A;  1YLA A;  4GEW A;  1AIP C;  2DKL A;  1OTR A;  2G3Q A;  5DFL A;  4Q7J A;  3F92 A;  1ZMU A;  2MRO B;  1Q02 A;  4DBG B;  5JI2 E;  1WJ7 A;  3LCV B;  4G3O A;  1IM2 A;  2JUJ A;  2DNA A;  1VG5 A;  1XXH E;  2MR9 A;  3K9O A;  1OKS A;  1R4G A;  2JZ0 A;  1NV9 A;  1V92 A;  1VQ1 A;  4F2L A;  2EKK A;  2LVQ D;  2KHH A;  1VDL A;  1IXS A;  1WGL A;  1WIV A;  2DEN A;  3B89 A;  1WGN A;  2LTU A;  1DO2 A;  2EJS A;  1ZMV A;  1PGY A;  2DAM A;  2JY8 A;  1G41 A;  1A5T A;  1EFU B;  2R0I A;  2ZTD A;  2KNV A;  3GLI E; 
#chains in the Genus database with same CATH topology
 3VDP A;  4IBC A;  2F5N A;  4D81 A;  4GHL A;  3L27 A;  2DI0 A;  2DZL A;  1JR3 A;  2XFT A;  2CV0 A;  3R8F A;  1C7Y A;  1UFZ A;  2EO2 A;  1MU5 A;  3HX3 A;  4G6Z A;  3SYK A;  4L16 A;  1HQY E;  3M0E A;  3Q8X A;  2XLJ A;  4JI1 M;  4D82 A;  1IY0 A;  4MGY E;  1Z6T A;  2EA0 A;  2C96 A;  1IBK M;  4DR7 M;  1JQJ C;  2LNH C;  2R45 A;  3R9X B;  1Z5A A;  3CF2 A;  1E94 E;  3J80 S;  3GLF E;  4P16 A;  2XZF A;  3ZQJ A;  1QUS A;  2ZAM A;  2JNH A;  3SAR A;  2XEP A;  1G3I A;  4DV7 M;  2LVO C;  3J2P B;  1D2N A;  5EP2 A;  5C18 A;  1IFY A;  3GO8 A;  5E26 A;  3KP0 E;  2ZAN A;  3FRH A;  1ZV1 A;  4IBJ A;  2CEA A;  2R46 A;  4L78 A;  2VF7 A;  4I5S A;  3HHY A;  4JI6 M;  4B3M M;  1E9R A;  4JI7 M;  1QDT A;  4RF1 A;  2F5Q A;  3JAM S;  3SAV A;  2J7N A;  3QYB A;  5KPT A;  3HHW A;  5C1B A;  1XB2 B;  4NC6 A;  4LF9 M;  4L6V 6;  2QEN A;  5EXT A;  4X64 M;  2CHV A;  3TWK A;  2DZO B;  3C58 A;  1WXQ A;  1QUT A;  3C3D A;  1R5L A;  1R6B X;  4QOZ C;  5DYG A;  4NL4 H;  3U60 B;  3KVW A;  2R62 A;  3T6P A;  1N36 M;  1DGG A;  4Z6Y A;  2EKF A;  3AJI B;  3VK7 A;  4XBO A;  5JI3 E;  1HR0 M;  2L4F A;  1Z5C A;  3VK8 A;  4K0K M;  1HNZ M;  1P3Q Q;  1DV0 A;  4DV5 M;  4NRW A;  1VEG A;  2BNK A;  5EXS A;  1HQC A;  1X37 A;  2BWB A;  1V33 A;  4KO8 A;  2UXC M;  2JY6 B;  2OO9 A;  5KQ8 A;  4AKG A;  1YSY A;  2RGO A;  2QBY A;  5LMN M;  1WR1 B;  4IBG A;  4PDG A;  2O5R A;  2X8A A;  4OW0 A;  3W68 A;  3QYE A;  2FOI C;  1W5T A;  4OU7 A;  2CUZ A;  2HWJ A;  4I8O A;  2L6O A;  1TH2 A;  5EP1 A;  3HJS A;  1XNR M;  5GKN A;  1DGF A;  1HJP A;  4MGK E;  2GNO A;  4BB9 A;  4JN6 A;  3GLI A;  3IHP A;  3KSX A;  1JR3 D;  1YLA A;  4LGM A;  4G4O A;  4AW4 A;  1SXJ B;  2C9O A;  1XMQ M;  1OTR A;  5KPR A;  4M0D A;  3Q8G A;  4DUZ M;  3SMP A;  3A98 B;  4LZZ A;  3T38 A;  3I01 M;  4DBG B;  2BJW A;  3AOE A;  3LCV B;  4G3O A;  3WHL A;  1IM2 A;  1OAO C;  3CF6 E;  3TWL A;  2DNA A;  3OTO M;  2P5T A;  3FYC A;  5FTJ A;  1R4G A;  1QQW A;  1XC8 A;  2KA6 B;  4M0W A;  4JI5 M;  2QPA A;  1N33 M;  3GLF A;  3U61 A;  4B3S M;  1GL7 A;  3D8B A;  2EKK A;  2KRK A;  3DOA A;  2RKO A;  3FTC A;  1MJG M;  1SXJ C;  4B3T M;  3FD9 A;  2G5G X;  1GVN A;  4OVZ B;  5KPZ A;  1IY1 A;  2QZ4 A;  2LTU A;  3HWS A;  3PNY A;  2VDB B;  4I81 A;  4FD2 A;  4NXN M;  4G4N A;  3K8Z A;  4MH0 E;  4A3V B;  2HHH M;  3K2L A;  2KNV A;  1Q3B A;  1K3X A;  2C98 A;  3DZD A;  3U6E A;  2WSF F;  4IBF A;  4JI0 M;  1IN5 A;  4ANR A;  1NHW C;  5IT9 S;  1CUK A;  4ZPX A;  1G4A E;  2YR0 A;  2YFQ A;  4RNA A;  3VDU A;  3H4J A;  4Z8X A;  1OJL A;  1IXR C;  1EE8 A;  3GQ4 A;  4LFB M;  2APL A;  4LF6 M;  3GLH A;  1F4I A;  2BJV A;  1NHG C;  3LMM A;  3ZC7 B;  1QAN A;  2L4E A;  4YY3 M;  3WHK A;  2C5R A;  1SXJ E;  3U6L A;  3U6C A;  3HHZ A;  2DWL A;  4LF7 M;  4MB7 A;  2B3T A;  2CHG A;  1NJG A;  3FTD A;  3HJ8 A;  2ZBK B;  4X66 M;  2LVN C;  2Z7J A;  1G59 A;  1XXH B;  4GIP A;  3MJ5 A;  5EJC A;  1T3T A;  4P17 A;  3RE8 A;  4BLC A;  4DR5 M;  1R2Z A;  2WSE F;  3I04 M;  4F1I A;  3SFZ A;  1QZE A;  2JWS A;  3SC3 A;  2XSZ A;  4LJ4 A;  1DGB A;  1NNJ A;  1PJJ A;  2QSF X;  1L2C A;  5LMU M;  1N34 M;  3U5Z B;  2J7O A;  3ZH9 B;  2DAI A;  3HU2 A;  2OQ4 A;  4PT5 A;  5ITT A;  3GPP A;  2MGW A;  5A2Q S;  2LVP C;  3E4R A;  4QOS A;  4AG5 A;  4DV1 M;  2V1C A;  4FCV A;  3SHF A;  2JZ1 A;  4DV3 M;  3J7A S;  2F4V M;  1QZM A;  2CFO A;  1VEJ A;  3U6M A;  1MN3 A;  2UU9 M;  5ITR A;  5H37 D;  2JY5 A;  4RKU F;  4L15 A;  3SAU A;  4IIW A;  2ERC A;  3QAU A;  2LVA A;  1YUB A;  5EP3 A;  3B7Q A;  3U60 A;  2F5P A;  1TH4 A;  1Z5B A;  4HL4 A;  2KEB A;  1TR8 A;  2OOB A;  1KFV A;  4DR2 M;  2GQF A;  2JP7 A;  2ZAO A;  1NV8 A;  2X4A A;  4Y28 F;  3AOG A;  3IEC A;  3W0L B;  3IG5 A;  2R6F A;  3PVS A;  1PJQ A;  1PJS A;  1QDR A;  5IZ7 D;  1XNQ M;  3HU1 A;  2UXB M;  1FJG M;  3GRU A;  5BPV A;  4B7G A;  3EIH A;  1AUA A;  1E32 A;  3K92 A;  3VKG A;  1IXS B;  3KSJ A;  5JI2 E;  1WJ7 A;  4GKK M;  4GH9 A;  3V76 A;  4NSR A;  3NBI A;  1XXH E;  2LXE A;  3KP1 E;  3U6D A;  1N78 A;  5L8R F;  4AI6 A;  5EXP A;  4LG2 A;  4II7 A;  3J7B A;  4PDI A;  2K6B A;  1SXJ A;  1YE9 A;  1NV9 A;  1GKI A;  2C99 A;  2N35 A;  1IQP A;  4JI3 M;  2ZM6 M;  4R3D A;  4CJ6 A;  4GRI A;  1WIV A;  2QQ8 A;  3BXW A;  1NO1 A;  3BOS A;  4KLN A;  1GAB A;  1IN8 A;  1GJS A;  1D0K A;  2KDL A;  1GJT A;  2XFS A;  2W82 A;  4FWG A;  2FNA A;  5ITX E;  2LH0 A;  1A5T A;  1EFU B;  2R0I A;  2A5Y B;  4L4U A;  5BR8 M;  1MX0 A;  3EIE A;  4LJ8 A;  4X62 M;  4DV2 M;  1VDD A;  2CE7 A;  2HL7 A;  2X49 A;  3T15 A;  3TPZ A;  1V34 A;  5EP4 A;  4AG6 A;  2RGH A;  3L28 A;  3FUU A;  4B7H A;  2DHR A;  2H5X A;  2KW0 A;  3CF0 A;  1IBM M;  2Z3X A;  3GP1 A;  3VKH A;  3DFZ A;  1G71 A;  1TDH A;  2QP9 X;  1PJT A;  1J5E M;  1T43 A;  2Y0Q A;  1OQY A;  3PNV A;  1L2D A;  3KOX E;  4WW0 A;  4FCT A;  2VQE M;  3D8L A;  3LQR A;  3UJN A;  2I7N A;  2R65 A;  4NRV A;  3LVW A;  1JR3 E;  1KYI A;  3GQ5 A;  4I4L A;  2O25 A;  3FUV A;  2XZU A;  4LJ7 A;  1QAO A;  1VEK A;  2XGN A;  3CTW B;  3QWL A;  2KNA A;  4GHA A;  2EUC A;  1WHC A;  2R18 A;  4NOO B;  2L09 A;  4AQY M;  2JY7 A;  3FKE A;  4MGH A;  2L2D A;  1Q39 A;  4LFC M;  1K82 A;  3SHG B;  2M60 A;  4G4Q A;  4LRS A;  1S3S A;  2VQF M;  4NSO B;  3MHV C;  3L2A A;  3U6P A;  3PXG A;  2FE8 A;  2J5Y A;  5KQD A;  1C1K A;  2UXD M;  3HZJ A;  3LW5 F;  4WP2 A;  2DVW B;  1IBL M;  1EIJ A;  1DGH B;  5FTN A;  2QHO B;  3JR5 A;  4IJF A;  2UUB M;  4W5W A;  1HNX M;  3T1Y M;  2G8L A;  3K9P A;  1R7R A;  1XWI A;  2C9C A;  1T6O A;  2Q2E B;  3GRY A;  1QYR A;  4DV0 M;  3KW6 A;  4JV5 M;  1XXH A;  4G4R A;  3KOY E;  3A46 A;  3RFW A;  3MMP A;  3FUX A;  4M9S A;  4OX9 M;  3AL0 C;  4DUY M;  3E46 A;  1PM5 A;  4NXM M;  3I51 A;  3HGI A;  4AZF A;  4UN2 B;  2L7H A;  4XK8 F;  2KZU A;  1NY6 A;  1IXZ A;  3FE3 A;  3KS4 A;  2HAK A;  4FW9 A;  3U5Z A;  4LFA M;  2LBC A;  1RU3 A;  4HEO A;  3GRV A;  3HKP A;  1XMO M;  5KO3 A;  4QHS A;  5DNY A;  4X65 M;  2DXI A;  1OAI A;  1ZMW A;  1GO5 A;  5ITX A;  3LVV A;  1IN4 A;  3KOW E;  1LV7 A;  2M5Z A;  2CP8 A;  7CAT A;  3FUW A;  4IBK A;  2MJ5 B;  3U6O A;  4KT0 F;  1BVS A;  4B08 A;  4FWD A;  2VII A;  4QNR A;  2HKJ A;  1Y8G A;  4GEW A;  3GLG B;  3W0F A;  3GLH B;  2DKL A;  2WSC F;  4JI2 M;  2G3Q A;  3THG A;  5DFL A;  5FTL A;  4Q7J A;  3F92 A;  2F5O A;  1ZMU A;  2DWM A;  3ILK A;  4GC5 A;  1NY5 A;  1PRB A;  1Q02 A;  4HLQ A;  4MM3 B;  3L26 A;  4DR4 M;  3RGP A;  4S12 A;  4IJE A;  4YHH M;  4GKJ M;  2Z8Y M;  4LF4 M;  2MR9 A;  2R4J A;  2LHG A;  3I4V A;  1FNN A;  1L1Z A;  2JZ0 A;  1L8Q A;  2R44 A;  4WUR A;  5ITY A;  4LZJ A;  2L7I A;  1VQ1 A;  2CRU A;  3AV0 A;  3CGW A;  3SBJ A;  2Y20 A;  3UK6 A;  3FTF A;  1OFH A;  1IXS A;  3B89 A;  2DEN A;  4LJA A;  3U6S A;  4AKI A;  2E5L M;  4LJ5 A;  1I94 M;  3KFU G;  5FTK A;  2EJS A;  1PGY A;  3UZU A;  3B74 A;  1L2B A;  3VFD A;  3PFI A;  1IY2 A;  1UM8 A;  3C3E A;  2KZS A;  2CV2 A;  3NWL A;  2Y0T A;  1ZQ9 A;  2RRU A;  5IWA M;  4LRT A;  4AKH A;  1QVR A;  2CHQ A;  2DAK A;  3IG8 A;  3HU3 A;  4ITQ A;  4LGY A;  3TWM A;  4JI8 M;  4FWH A;  1ZAE A;  8CAT A;  3W67 A;  5F3W A;  4M9Z A;  1J09 A;  1QAM A;  2I7P A;  1E9S A;  1OFI A;  3HJQ A;  3K1J A;  3GPX A;  1HT1 E;  3M7G A;  1Z59 A;  1IN6 A;  3TL4 X;  2JXN A;  3FUT A;  4JYA M;  4LJ6 A;  4DR6 M;  2V6Z M;  3E9S A;  3GLG E;  2Y21 A;  1HT2 E;  2OOA A;  2F5S A;  3B7Z A;  2Z4R A;  3GLH E;  2UUA M;  3AFH A;  2V1U A;  1D0M A;  1D0L A;  3RGS A;  4PCZ A;  2XF3 A;  4DV4 M;  4LJ9 A;  3SAW A;  2D7G A;  2XSZ D;  3UMM A;  1HNW M;  5FSW A;  1TDZ A;  2DHY A;  3SAT A;  3GRR A;  2WZJ A;  3U6Q A;  4TUW A;  1JB0 F;  4FCW A;  1DO0 A;  4CHT B;  3E21 A;  4CIS A;  3GPY A;  4R71 A;  4LCB A;  3BBZ A;  1NJF A;  3FRI A;  1QAQ A;  1NVM A;  4DV6 M;  3C9P A;  4OVZ A;  2DWZ B;  2FFJ A;  1I4W A;  2DZN B;  1W5S A;  4IBE A;  3KOZ E;  1PJI A;  2XH9 A;  4QNM A;  2QBY B;  4JXJ A;  4QHT A;  3AKZ A;  2KNZ A;  2AHM A;  2D7H A;  3LCU A;  1IN7 A;  5EXX A;  4CIZ A;  5ITU A;  5FLX S;  2DAE A;  2H1R A;  3ZCB B;  2OPF A;  4KHP M;  3LQQ A;  4LY6 A;  4JI4 M;  2JA2 A;  2CWB A;  1TTE A;  2K47 A;  5ITQ A;  2UUC M;  2KXE A;  3T1H M;  5E6J A;  1N75 A;  2BWE A;  3GLI B;  2DAG A;  4B3R M;  3TE6 A;  2ZTC A;  3A42 A;  1GLN A;  1DGH A;  2D7E A;  4GMQ A;  2KRU A;  4IBB A;  1GL6 A;  2QNJ A;  3UGJ A;  3J81 S;  1G8P A;  3HY5 A;  1OIP A;  4IBI A;  3B9P A;  2K0B X;  2K9D A;  3NBX X;  2Z4S A;  3SAS A;  3KS8 A;  1SG9 A;  4PD2 A;  1Q3C A;  1N32 M;  2MH8 A;  3J27 B;  2LHC A;  4EIW A;  1H6U A;  4BBA A;  3L29 A;  4FVM A;  4IBD A;  1TH3 A;  4MGI E;  3GPU A;  3GLF B;  1AIP C;  4D80 A;  3I4Y A;  3U61 B;  4GC9 A;  4LF8 M;  2VF8 A;  1TF0 B;  2YNM D;  1SXJ D;  2MRO B;  3MK6 A;  3TQS A;  4DR1 M;  1NSF A;  1NNU C;  4M9X A;  4XGI A;  3SMS A;  5EQT A;  3GQ3 A;  4B7F A;  4GIT A;  2QCU A;  1N77 A;  2JUJ A;  1KSF X;  3SYL A;  1VG5 A;  3K9O A;  1J7K A;  5DYI A;  1OIZ A;  1OKS A;  5FTM A;  2NQ8 C;  1K3W A;  3AOE C;  2YQZ A;  3GLG A;  3FYD A;  4RF0 A;  4L8R C;  4KOD A;  1V92 A;  3HHX A;  4MGZ E;  1LTM A;  3FTE A;  3L25 A;  2O01 F;  3B7N A;  4LF5 M;  4F2L A;  2LVQ D;  1ORY B;  3KXE C;  2KHH A;  3H4M A;  1VDL A;  2DWN A;  3A45 A;  2FS1 A;  1WGL A;  2HCB A;  1R2Y A;  1XHB A;  2R4E A;  4CGY B;  3KDS E;  1WGN A;  1DO2 A;  1ZMV A;  2DAM A;  2JY8 A;  4REZ A;  1G41 A;  1TGU A;  3M6A A;  2CV1 A;  3VLF B;  1L1T A;  2FH0 A;  2ZTD A;  2LWX A;  3DA1 A;  4R7G A;  3JR4 A;  5IRE B;  4DR3 M;  3GLI E; 
#chains in the Genus database with same CATH homology
 2RRU A;  1CUK A;  1G4A E;  2DI0 A;  2DZL A;  2H5X A;  3H4J A;  1C7Y A;  2DAK A;  1UFZ A;  1T43 A;  1OQY A;  1HQY E;  1JR3 E;  1KYI A;  1HT1 E;  2L4E A;  2O25 A;  1VEK A;  1E94 E;  3GLG E;  1HT2 E;  2KNA A;  2OOA A;  3GLH E;  3GLF E;  1WHC A;  2JNH A;  2JY7 A;  2L2D A;  1G3I A;  2B3T A;  2DHY A;  2LVO C;  1IFY A;  2WZJ A;  1DO0 A;  2LVN C;  3E21 A;  3FRH A;  1ZV1 A;  4R71 A;  3BBZ A;  4F1I A;  3FRI A;  1QZE A;  1XB2 B;  4WP2 A;  2QSF X;  2QHO B;  2DAI A;  2KNZ A;  3LCU A;  3K9P A;  1T6O A;  2DAE A;  2MGW A;  3T6P A;  1F4I A;  2LVP C;  2JZ1 A;  2EKF A;  2CWB A;  1TTE A;  3MMP A;  2L4F A;  1VEJ A;  1P3Q Q;  1DV0 A;  3E46 A;  1MN3 A;  1VEG A;  4UN2 B;  2BWE A;  2DAG A;  2BWB A;  2JY5 A;  2ZTC A;  3FE3 A;  2JY6 B;  2OO9 A;  2HAK A;  2LBC A;  4HEO A;  1WR1 B;  1OAI A;  2LVA A;  1ZMW A;  2QNJ A;  1GO5 A;  2HWJ A;  2K0B X;  2K9D A;  1TR8 A;  2OOB A;  2CP8 A;  1HJP A;  2MJ5 B;  1SG9 A;  2JP7 A;  1NV8 A;  1BVS A;  3IEC A;  3IHP A;  1Y8G A;  1YLA A;  4GEW A;  1AIP C;  2DKL A;  1OTR A;  2G3Q A;  5DFL A;  4Q7J A;  3F92 A;  1ZMU A;  2MRO B;  1Q02 A;  4DBG B;  5JI2 E;  1WJ7 A;  3LCV B;  4G3O A;  1IM2 A;  2JUJ A;  2DNA A;  1VG5 A;  1XXH E;  2MR9 A;  3K9O A;  1OKS A;  1R4G A;  2JZ0 A;  1NV9 A;  1V92 A;  1VQ1 A;  4F2L A;  2EKK A;  2LVQ D;  2KHH A;  1VDL A;  1IXS A;  1WGL A;  1WIV A;  2DEN A;  3B89 A;  1WGN A;  2LTU A;  1DO2 A;  2EJS A;  1ZMV A;  1PGY A;  2DAM A;  2JY8 A;  1G41 A;  1A5T A;  1EFU B;  2R0I A;  2ZTD A;  2KNV A;  3GLI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...