2C5RA

The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna-binding protein/dna
molecule keywords EARLY PROTEIN P16.7
publication title Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 21
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2c5rA00
2C5RA 1ZAEA 2BNKA
chains in the Genus database with same CATH superfamily
3J81S 1XMOM 4IBDA 2C9OA 3M6AA 5ITUA 4DV2M 2KXEA 1OQYA 2GQFA 5ITXA 3T1HM 3W0LB 4NRWA 2QHOB 4HEOA 4YHHM 2XFSA 2Z4SA 3SAWA 4LJ6A 3FRIA 1KSFX 2VF8A 2P5TA 4IBFA 4CIZA 3MMPA 3K9PA 1PM5A 1WIVA 3VK8A 2XLJA 1I4WA 5ITTA 3KOYE 5DNYA 2Z3XA 4Z6YA 4QNMA 4FWDA 3GRYA 1PJTA 4X64M 4MM3B 1TGUA 4DV4M 1R2YA 2JZ1A 5JI3E 2MJ5B 3UZUA 1MN3A 1IN6A 1R4GA 2XFTA 4KO8A 1NHWC 4GHLA 1TF0B 2LVAA 1DGFA 4PCZA 4AG6A 2C5RA 3L26A 2VF7A 8CATA 4DV3M 2HL7A 3LW5F 2N35A 2UXCM 2CV2A 3K1JA 2XEPA 2UU9M 1YLAA 2YFQA 2LH0A 2DWMA 3CTWB 3ZC7B 2ERCA 3FUVA 4I4LA 2UUBM 4LF8M 4XBOA 4LY6A 3AKZA 4DV0M 3B7ZA 5FTLA 1BVSA 2C9CA 4JI5M 1OFIA 4LJAA 4KODA 1WGNA 3A45A 2HCBA 5C18A 3AOEA 1CUKA 3U60A 4B08A 2EJSA 1N36M 5JI2E 5EXSA 1ORYB 1WHCA 1ZMWA 3C3EA 3SATA 3W0FA 1JR3D 3CF6E 3GLGA 3LMMA 1G3IA 4DR3M 1D0KA 5LMUM 3U61B 3EIEA 3I4YA 2L6OA 4IJEA 2JNHA 2K47A 3I04M 3M7GA 1SXJA 1VDLA 1Z5BA 3LCUA 3Q8GA 3R8FA 1DGHA 2KNAA 4DR1M 3I51A 1I94M 5E26A 1Q02A 2KHHA 4GH9A 2YQZA 1QQWA 3UGJA 1PJQA 2C98A 3GLFB 2XZUA 4JI8M 2DZOB 3MJ5A 1PJIA 3VFDA 5DYIA 2O25A 3E21A 3C3DA 3FRHA 4GITA 4JXJA 1Q3CA 1RU3A 4NSRA 4NRVA 2DZNB 3E46A 5DYGA 5ITYA 2QNJA 3SARA 1L1ZA 1VDDA 3AL0C 4I8OA 1VEGA 1FNNA 3B7QA 4M9SA 2CFOA 5EXXA 3U6DA 4B7FA 3PFIA 4D82A 1ZMUA 4CGYB 5H37D 1D0LA 1XC8A 1XNRM 2CE7A 4FWHA 4DUYM 2DVWB 2ZAMA 1QVRA 2Q2EB 4L6V6 5IT9S 2R4EA 2CWBA 1N77A 4IBBA 5IZ7D 4FCTA 2X8AA 4AG5A 4L15A 3SHGB 3U6MA 1IN5A 2VQEM 2I7PA 1IBKM 2LHGA 4DV1M 4M0WA 2XSZA 2WSCF 4BB9A 2OQ4A 3VKGA 1JR3E 4GC9A 2JWSA 3B74A 5FSWA 1GLNA 2OPFA 1OAIA 2WZJA 1J5EM 2DWNA 2MGWA 3SYKA 4CHTB 2JUJA 3C58A 2KZUA 3DFZA 4GC5A 2E5LM 4AZFA 3C9PA 3TL4X 3GPUA 2CHGA 4IBGA 2K9DA 1IBLM 4JI7M 1QZMA 3LVWA 4IIWA 2GNOA 1AIPC 4R71A 3VDUA 1K82A 3GP1A 4HL4A 1V34A 2HHHM 2EA0A 1E32A 3U6QA 2UXBM 2UXDM 2LNHC 2R0IA 1XXHE 3BBZA 1GL7A 3KOXE 1DO0A 2FFJA 2BJVA 3GLHA 1EE8A 1QANA 3Q8XA 2UUCM 1FJGM 1N32M 3TE6A 3BXWA 4P17A 3W67A 1VG5A 1NV8A 1TH3A 2G8LA 2QENA 3KXEC 4B7GA 1IY0A 4QOZC 3MHVC 5BR8M 3PNYA 1G59A 3U5ZB 5EJCA 2DKLA 4OVZB 5EXPA 4II7A 4CJ6A 3THGA 5KPZA 1IXSB 4GIPA 3EIHA 2KEBA 3I01M 4JI6M 2QBYA 1QUTA 3PNVA 4LF4M 1Q39A 3SASA 1XHBA 3GPXA 3HZJA 2WSFF 1L1TA 3GLHE 3K2LA 1YUBA 4LRTA 2F4VM 2J7OA 1DGGA 1TR8A 2F5QA 2YR0A 2DHRA 2KRUA 5C1BA 3SBJA 1R2ZA 4IJFA 2Y0TA 2LVQD 1NO1A 4LF6M 3GLIE 2HAKA 3AFHA 1OKSA 3HX3A 4NSOB 3R9XB 3LQRA 2W82A 3IG5A 5ITXE 1Z6TA 2LVOC 3SFZA 4OU7A 2DAGA 2Z4RA 2Y20A 1SG9A 3TQSA 1NJGA 4GKJM 4PD2A 4MH0E 1W5TA 4M9ZA 1OFHA 3SC3A 1UFZA 4MGKE 4B7HA 4AKHA 1N75A 2HKJA 2JA2A 3K9OA 1YSYA 2DENA 2FH0A 4AW4A 3GPPA 1XB2B 1D0MA 2CHVA 3T15A 3UK6A 1NY6A 2R45A 2RKOA 4DUZM 1IN7A 2J7NA 2MH8A 3HHXA 3T38A 3KDSE 1Z5CA 4ITQA 2R44A 1MX0A 2C96A 1QAOA 2R6FA 1NV9A 1TDHA 2L4EA 3K8ZA 3KS4A 3SMPA 3T6PA 4LCBA 1T43A 3HHYA 2LHCA 4XK8F 3FUTA 2CHQA 2HWJA 5KQDA 2F5OA 4JI1M 2DXIA 3J80S 3CF0A 2B3TA 2DHYA 5L8RF 2XGNA 3I4VA 2DWLA 2QSFX 4W5WA 4NOOB 2F5SA 4QHSA 1HQCA 5ITRA 2R65A 5FLXS 4FCVA 2O01F 1TTEA 5A2QS 2LVNC 2Z7JA 2R46A 3TWLA 2JY7A 2XZFA 3VK7A 1IFYA 1ZMVA 2EKKA 3HJQA 4LJ8A 1IN8A 1IXRC 5KPRA 1IM2A 4KT0F 4F1IA 2L7HA 2QQ8A 2XSZD 4DR5M 4K0KM 4G6ZA 3AOEC 3L28A 2K0BX 4Z8XA 3KOWE 2DAIA 3TWMA 3U61A 3KW6A 4ANRA 2V1CA 5EP1A 1E9SA 2VQFM 3GLGE 2QCUA 2V6ZM 3ZCBB 1HNZM 4CISA 2KNVA 4B3RM 4M0DA 2JY8A 4AI6A 2R62A 3VDPA 2H1RA 2LTUA 3FD9A 4NXMM 4RNAA 1SXJE 2DZLA 3GLFA 4FD2A 3FTFA 2L09A 5KPTA 1SXJC 3U6EA 3T1YM 1GJTA 2OOBA 4JN6A 1L2DA 1G71A 1GO5A 1TH2A 1NNJA 3ILKA 5EQTA 2M60A 2RGOA 2LWXA 3GRUA 4GHAA 3UMMA 4MGZE 3FYCA 1HNWM 1MJGM 3SHFA 5IWAM 1E9RA 3HGIA 1HQYE 3IHPA 2G3QA 4AQYM 2X4AA 4KHPM 1JB0F 4HLQA 1QAQA 3B7NA 4Y28F 1PJJA 4JI0M 2Y21A 2KZSA 3RGSA 3NBXX 3FKEA 3GQ4A 2CV0A 3HKPA 4IBIA 1E94E 4OX9M 3HU3A 1R5LA 1UM8A 1LV7A 3QYEA 4FWGA 1IN4A 4LG2A 1XXHB 4D80A 2OOAA 4RKUF 4RF0A 1XMQM 1WR1B 2FNAA 2YNMD 3GRVA 2L7IA 2RRUA 4WP2A 1D2NA 2BWBA 3IECA 3DA1A 4L16A 5EXTA 1J7KA 1G8PA 1VQ1A 2VDBB 2BWEA 3KP1E 5FTNA 3LCVB 5E6JA 1VEKA 2DI0A 2KDLA 1DO2A 5FTMA 3U6SA 2V1UA 1QAMA 2JY5A 4LJ9A 3FTCA 4LGYA 4IBCA 2WSEF 3AOGA 1J09A 1L2CA 5GKNA 4P16A 4X66M 4WW0A 4MGYE 2QZ4A 2MR9A 3GLHB 1XWIA 1T6OA 1NSFA 1GJSA 1PRBA 2ZM6M 3HU1A 4EIWA 1YE9A 2JZ0A 4IBJA 3FTEA 3SAUA 3B89A 4FW9A 1DV0A 3GLIB 4QHTA 1K3XA 2CP8A 1R6BX 1Y8GA 3H4MA 4DV6M 2D7GA 2R4JA 3D8LA 1IQPA 3FUWA 3TPZA 2K6BA 4PDIA 3U6CA 4XGIA 4LFCM 3DZDA 4NL4H 3U5ZA 1F4IA 4OVZA 3KSJA 1IXSA 4LZZA 1HT2E 4MGIE 5FTJA 1K3WA 2UUAM 3QYBA 4LJ5A 1KYIA 4WURA 4G4OA 3FTDA 4DV7M 1HT1E 2CRUA 3J2PB 4X65M 3GQ5A 2NQ8C 2F5PA 3FYDA 4PDGA 1N34M 3IG8A 4LJ4A 4LF7M 2BNKA 3NWLA 3OTOM 4IBKA 4GKKM 1P3QQ 2FS1A 1HJPA 4I5SA 1SXJD 4JV5M 1GKIA 4DR7M 3QAUA 2ZTDA 2X49A 5IREB 1T3TA 1TH4A 2AHMA 3KSXA 2DAEA 4LRSA 1OIPA 5BPVA 4JI4M 3J7AS 3KS8A 1C1KA 1GL6A 1G4AE 4LFBM 1X37A 2Z8YM 1QDRA 1Z5AA 4GRIA 2F5NA 4JI2M 1ZAEA 4MGHA 3L27A 1C7YA 1Z59A 4FCWA 4R3DA 2O5RA 1OJLA 1NNUC 3HHWA 3HHZA 2OO9A 2L4FA 4L78A 3RGPA 4BLCA 3RE8A 4AKIA 4GMQA 4DR2M 2LBCA 3U60B 1WXQA 2DAKA 4L8RC 3GRRA 4NC6A 3M0EA 3D8BA 3JAMS 3F92A 1OIZA 1QZEA 3V76A 2DWZB 3GLGB 4A3VB 4DBGB 5KO3A 4AKGA 2FE8A 3KP0E 2G5GX 1IY2A 2DNAA 3E9SA 4M9XA 2H5XA 1QYRA 3KVWA 3GQ3A 2KRKA 2LXEA 2D7EA 1V33A 1SXJB 2ZTCA 3LQQA 3QWLA 3U6PA 1DGHB 3DOAA 4PT5A 3AV0A 3J7BA 4TUWA 1VEJA 3MK6A 1NY5A 4OW0A 3WHKA 3NBIA 3UJNA 1QUSA 1HR0M 4DR6M 2M5ZA 1L8QA 1IXZA 1GVNA 3SYLA 4Q7JA 1N33M 4D81A 2EKFA 3LVVA 1WJ7A 1GABA 1EIJA 4DR4M 2J5YA 4G3OA 2D7HA 4R7GA 3JR4A 1N78A 3TWKA 1ZQ9A 4FVMA 3JR5A 4X62M 1OTRA 3J27B 1OAOC 3L29A 3L2AA 4I81A 4LGMA 4ZPXA 1HNXM 4NXNM 3RFWA 2KNZA 4REZA 4JI3M 1QDTA 4L4UA 4LF9M 2QP9X 4QOSA 4LJ7A 1XNQM 3GLFE 2XH9A 4LF5M 3HU2A 3WHLA 4UN2B 3A42A 3A98B 2VIIA 2BJWA 1JR3A 1LTMA 2JY6B 1G41A 4LFAM 3SMSA 3GPYA 5EP4A 3FUXA 1S3SA 2JP7A 1ZV1A 5DFLA 2I7NA 4KLNA 3KOZE 1WGLA 2APLA 4YY3M 2JXNA 2A5YB 3KFUG 3ZQJA 2XF3A 1DGBA 3GO8A 4G4NA 1H6UA 2KW0A 3ZH9B 4B3MM 1IY1A 2R18A 4BBAA 2CEAA 1TDZA 3H4JA 3VLFB 2FOIC 3L25A 1EFUB 1AUAA 5EP3A 2DAMA 3HJ8A 3FE3A 1XXHA 3CF2A 1A5TA 1W5SA 4S12A 5FTKA 1Q3BA 2Y0QA 2MROB 3AJIB 3W68A 4IBEA 1JQJC 1NHGC 1R7RA 2RGHA 3K92A 4LZJA 3A46A 2ZANA 4JYAM 4DV5M 5KQ8A 5ITQA 2LVPC 1MU5A 2CUZA 4B3SM 2EO2A 3E4RA 4F2LA 4QNRA 5F3WA 3HJSA 3PVSA 2ZAOA 2L2DA 3PXGA 1L2BA 1NJFA 2C99A 1PGYA 3B9PA 3U6OA 1V92A 3CGWA 4B3TM 2ZBKB 3FUUA 5LMNM 3SAVA 5EP2A 4RF1A 2KA6B 1KFVA 2QBYB 3HY5A 3VKHA 1NVMA 2CV1A 4G4QA 3BOSA 1IBMM 2EUCA 1PJSA 3HWSA 4MB7A 3U6LA 4G4RA 7CATA 3GLIA 4GEWA 2QPAA
chains in the Genus database with same CATH topology
3J81S 1XMOM 4IBDA 2C9OA 3M6AA 5ITUA 4DV2M 2KXEA 5ITXA 3T1HM 3W0LB 4NRWA 4YHHM 2XFSA 2Z4SA 3SAWA 4LJ6A 1KSFX 2P5TA 4IBFA 1PM5A 3VK8A 2XLJA 1I4WA 5ITTA 3KOYE 5DNYA 2Z3XA 4Z6YA 4QNMA 4FWDA 3GRYA 4X64M 4MM3B 1TGUA 4DV4M 1R2YA 5JI3E 3UZUA 1IN6A 2XFTA 4KO8A 1NHWC 4GHLA 1DGFA 4PCZA 4AG6A 2C5RA 3L26A 8CATA 4DV3M 2HL7A 2UXCM 2CV2A 3K1JA 2XEPA 2UU9M 2YFQA 2LH0A 2DWMA 3CTWB 3ZC7B 2ERCA 3FUVA 4I4LA 2UUBM 4LF8M 4XBOA 4LY6A 3AKZA 4DV0M 5FTLA 2C9CA 4JI5M 1OFIA 4LJAA 4KODA 3A45A 2HCBA 5C18A 3AOEA 3U60A 4B08A 1N36M 5JI2E 5EXSA 1ORYB 3SATA 3W0FA 1JR3D 3CF6E 3GLGA 3LMMA 1G3IA 4DR3M 5LMUM 3U61B 3EIEA 3I4YA 2L6OA 4IJEA 2K47A 3M7GA 1SXJA 1Z5BA 3R8FA 1DGHA 4DR1M 3I51A 1I94M 5E26A 4GH9A 2YQZA 1QQWA 3UGJA 2C98A 3GLFB 2XZUA 4JI8M 2DZOB 3MJ5A 1PJIA 3VFDA 5DYIA 4GITA 4JXJA 1Q3CA 4NSRA 4NRVA 2DZNB 5DYGA 5ITYA 3SARA 1L1ZA 1VDDA 3AL0C 4I8OA 1FNNA 4M9SA 2CFOA 5EXXA 3U6DA 4B7FA 3PFIA 4D82A 4CGYB 5H37D 1XC8A 1XNRM 2CE7A 4FWHA 4DUYM 2DVWB 2ZAMA 1QVRA 2Q2EB 5IT9S 2R4EA 1N77A 4IBBA 5IZ7D 4FCTA 2X8AA 4AG5A 4L15A 3SHGB 3U6MA 1IN5A 2VQEM 2I7PA 4DV1M 4M0WA 2XSZA 4BB9A 2OQ4A 3VKGA 4GC9A 5FSWA 1GLNA 2OPFA 1J5EM 2DWNA 3C58A 3SYKA 4CHTB 2KZUA 3DFZA 4GC5A 2E5LM 4AZFA 3TL4X 3GPUA 2CHGA 4IBGA 4JI7M 1IBLM 1QZMA 3LVWA 4IIWA 3VDUA 1K82A 3GP1A 4HL4A 2HHHM 2EA0A 1E32A 3U6QA 2UXBM 2UXDM 2LNHC 1GL7A 3KOXE 1DO0A 2FFJA 2BJVA 3GLHA 1EE8A 1QANA 3Q8XA 2UUCM 1FJGM 1N32M 3TE6A 1TH3A 2QENA 2G8LA 3KXEC 4B7GA 1IY0A 4QOZC 3MHVC 5BR8M 3PNYA 1G59A 3U5ZB 5EJCA 4OVZB 5EXPA 4II7A 3THGA 5KPZA 1IXSB 4GIPA 3EIHA 2KEBA 4JI6M 2QBYA 3PNVA 4LF4M 1Q39A 3SASA 1XHBA 3GPXA 1L1TA 3K2LA 1YUBA 4LRTA 2F4VM 2J7OA 1DGGA 2F5QA 2YR0A 2DHRA 2KRUA 5C1BA 3SBJA 1R2ZA 4IJFA 2Y0TA 4LF6M 3AFHA 3R9XB 4NSOB 3LQRA 2W82A 3IG5A 5ITXE 1Z6TA 3SFZA 4OU7A 2Z4RA 2Y20A 3TQSA 1NJGA 4GKJM 4PD2A 4MH0E 1W5TA 4M9ZA 1OFHA 3SC3A 4AKHA 4MGKE 4B7HA 1N75A 2HKJA 2JA2A 1YSYA 4AW4A 3GPPA 2CHVA 3T15A 3UK6A 1NY6A 2R45A 2RKOA 4DUZM 1IN7A 2J7NA 3HHXA 3T38A 3KDSE 1Z5CA 4ITQA 3KS4A 1MX0A 2C96A 1QAOA 3K8ZA 1TDHA 1IBKM 3SMPA 4LCBA 3HHYA 3FUTA 2CHQA 5KQDA 2F5OA 4JI1M 2DXIA 3J80S 3CF0A 2XGNA 3I4VA 2DWLA 4W5WA 4NOOB 2F5SA 4QHSA 1HQCA 5ITRA 2R65A 5FLXS 4FCVA 5A2QS 2Z7JA 2R46A 3TWLA 2XZFA 3VK7A 3HJQA 4LJ8A 1IN8A 1IXRC 5KPRA 1IM2A 4K0KM 2L7HA 2XSZD 4DR5M 4G6ZA 3AOEC 3L28A 4Z8XA 3TWMA 3KOWE 3U61A 3KW6A 2V1CA 5EP1A 1E9SA 2VQFM 2QCUA 2V6ZM 3ZCBB 1HNZM 4CISA 4B3RM 4M0DA 4AI6A 2R62A 3VDPA 2H1RA 3FD9A 4NXMM 4RNAA 1SXJE 3GLFA 4FD2A 3FTFA 2L09A 5KPTA 1SXJC 3U6EA 3T1YM 4JN6A 1L2DA 1TH2A 1NNJA 3ILKA 5EQTA 2M60A 2RGOA 2LWXA 3GRUA 4GHAA 3UMMA 4MGZE 3FYCA 1HNWM 3SHFA 5IWAM 1E9RA 3HGIA 1HQYE 4AQYM 2X4AA 4KHPM 4HLQA 1QAQA 1PJJA 4JI0M 2Y21A 2KZSA 3RGSA 3FKEA 3GQ4A 2CV0A 3HKPA 4IBIA 1E94E 4OX9M 3HU3A 1UM8A 1LV7A 4FWGA 1IN4A 4LG2A 1XXHB 4D80A 4RF0A 1XMQM 2FNAA 2YNMD 3GRVA 2L7IA 1D2NA 5EXTA 3DA1A 4L16A 1J7KA 1G8PA 3KP1E 5FTNA 5E6JA 3U6SA 5FTMA 2V1UA 1DO2A 1QAMA 4LJ9A 3FTCA 4LGYA 4IBCA 3AOGA 1J09A 1L2CA 5GKNA 4P16A 4X66M 4WW0A 4MGYE 2QZ4A 3GLHB 1XWIA 1NSFA 2ZM6M 3HU1A 4EIWA 1YE9A 4IBJA 3FTEA 3SAUA 4FW9A 3GLIB 4QHTA 1K3XA 3H4MA 1R6BX 4DV6M 3FUWA 2D7GA 2R4JA 1IQPA 3D8LA 3TPZA 4PDIA 3U6CA 4LFCM 4XGIA 3DZDA 4NL4H 3U5ZA 4OVZA 3KSJA 4LZZA 1HT2E 4MGIE 5FTJA 1K3WA 2UUAM 4LJ5A 1KYIA 4WURA 4G4OA 3FTDA 4DV7M 1HT1E 3J2PB 4X65M 3GQ5A 2NQ8C 2F5PA 3FYDA 4PDGA 1N34M 3IG8A 4LJ4A 4LF7M 2BNKA 3NWLA 3OTOM 4IBKA 4GKKM 4I5SA 1SXJD 4JV5M 1GKIA 4DR7M 3QAUA 2X49A 5IREB 1T3TA 1TH4A 2AHMA 3KSXA 4LRSA 5BPVA 4JI4M 3J7AS 3KS8A 1C1KA 1GL6A 1G4AE 4LFBM 1X37A 1Z5AA 4GRIA 2F5NA 4JI2M 1ZAEA 4MGHA 3L27A 1Z59A 4FCWA 4R3DA 2O5RA 1OJLA 1NNUC 3HHWA 3HHZA 4L78A 3RGPA 4BLCA 4AKIA 3RE8A 4GMQA 4DR2M 3U60B 1WXQA 4L8RC 3GRRA 3M0EA 3D8BA 3JAMS 3GLGB 2DWZB 4A3VB 5KO3A 4AKGA 2FE8A 3KP0E 2G5GX 1IY2A 3E9SA 4M9XA 1QYRA 3KVWA 3GQ3A 2KRKA 2LXEA 2D7EA 1SXJB 3LQQA 3QWLA 3U6PA 1DGHB 3DOAA 4PT5A 3AV0A 3J7BA 4TUWA 3MK6A 1NY5A 4OW0A 3WHKA 3NBIA 3UJNA 1HR0M 4DR6M 2M5ZA 1L8QA 1IXZA 1GVNA 3SYLA 1N33M 4D81A 3LVVA 4DR4M 4R7GA 2D7HA 3JR4A 1N78A 3TWKA 1ZQ9A 4FVMA 3JR5A 4X62M 3J27B 3L29A 3L2AA 4I81A 4LGMA 4ZPXA 1HNXM 4NXNM 3RFWA 4REZA 4JI3M 4L4UA 4LF9M 2QP9X 4QOSA 4LJ7A 1XNQM 2XH9A 4LF5M 3HU2A 3WHLA 3A42A 3A98B 2VIIA 2BJWA 1JR3A 1G41A 4LFAM 3SMSA 3GPYA 5EP4A 3FUXA 1S3SA 2I7NA 4KLNA 3KOZE 4YY3M 2A5YB 3KFUG 3GO8A 2XF3A 1DGBA 4G4NA 1H6UA 2KW0A 3ZH9B 4B3MM 1IY1A 2R18A 4BBAA 2CEAA 1TDZA 3VLFB 2FOIC 3L25A 5EP3A 3HJ8A 1XXHA 3CF2A 1W5SA 4S12A 5FTKA 1Q3BA 2Y0QA 3AJIB 4IBEA 1JQJC 1NHGC 1R7RA 2RGHA 3K92A 4LZJA 3A46A 2ZANA 4JYAM 4DV5M 5KQ8A 5ITQA 1MU5A 2CUZA 4B3SM 2EO2A 3E4RA 4QNRA 5F3WA 3HJSA 3PVSA 2ZAOA 3PXGA 1L2BA 1NJFA 2C99A 3U6OA 3B9PA 4B3TM 2ZBKB 3FUUA 5LMNM 3SAVA 5EP2A 4RF1A 2KA6B 1KFVA 2QBYB 3VKHA 1NVMA 2CV1A 4G4QA 3BOSA 1IBMM 2EUCA 3HWSA 4MB7A 3U6LA 4G4RA 7CATA 3GLIA 2QPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5R A;  1ZAE A;  2BNK A; 
#chains in the Genus database with same CATH topology
 3J81 S;  1XMO M;  4IBD A;  2C9O A;  3M6A A;  5ITU A;  4DV2 M;  2KXE A;  1OQY A;  2GQF A;  5ITX A;  3T1H M;  3W0L B;  4NRW A;  2QHO B;  4HEO A;  4YHH M;  2XFS A;  2Z4S A;  3SAW A;  4LJ6 A;  3FRI A;  1KSF X;  2VF8 A;  2P5T A;  4IBF A;  4CIZ A;  3MMP A;  3K9P A;  1PM5 A;  1WIV A;  3VK8 A;  2XLJ A;  1I4W A;  5ITT A;  3KOY E;  5DNY A;  2Z3X A;  4Z6Y A;  4QNM A;  4FWD A;  3GRY A;  1PJT A;  4X64 M;  4MM3 B;  1TGU A;  4DV4 M;  1R2Y A;  2JZ1 A;  5JI3 E;  2MJ5 B;  3UZU A;  1MN3 A;  1IN6 A;  1R4G A;  2XFT A;  4KO8 A;  1NHW C;  4GHL A;  1TF0 B;  2LVA A;  1DGF A;  4PCZ A;  4AG6 A;  2C5R A;  3L26 A;  2VF7 A;  8CAT A;  4DV3 M;  2HL7 A;  3LW5 F;  2N35 A;  2UXC M;  2CV2 A;  3K1J A;  2XEP A;  2UU9 M;  1YLA A;  2YFQ A;  2LH0 A;  2DWM A;  3CTW B;  3ZC7 B;  2ERC A;  3FUV A;  4I4L A;  2UUB M;  4LF8 M;  4XBO A;  4LY6 A;  3AKZ A;  4DV0 M;  3B7Z A;  5FTL A;  1BVS A;  2C9C A;  4JI5 M;  1OFI A;  4LJA A;  4KOD A;  1WGN A;  3A45 A;  2HCB A;  5C18 A;  3AOE A;  1CUK A;  3U60 A;  4B08 A;  2EJS A;  1N36 M;  5JI2 E;  5EXS A;  1ORY B;  1WHC A;  1ZMW A;  3C3E A;  3SAT A;  3W0F A;  1JR3 D;  3CF6 E;  3GLG A;  3LMM A;  1G3I A;  4DR3 M;  1D0K A;  5LMU M;  3U61 B;  3EIE A;  3I4Y A;  2L6O A;  4IJE A;  2JNH A;  2K47 A;  3I04 M;  3M7G A;  1SXJ A;  1VDL A;  1Z5B A;  3LCU A;  3Q8G A;  3R8F A;  1DGH A;  2KNA A;  4DR1 M;  3I51 A;  1I94 M;  5E26 A;  1Q02 A;  2KHH A;  4GH9 A;  2YQZ A;  1QQW A;  3UGJ A;  1PJQ A;  2C98 A;  3GLF B;  2XZU A;  4JI8 M;  2DZO B;  3MJ5 A;  1PJI A;  3VFD A;  5DYI A;  2O25 A;  3E21 A;  3C3D A;  3FRH A;  4GIT A;  4JXJ A;  1Q3C A;  1RU3 A;  4NSR A;  4NRV A;  2DZN B;  3E46 A;  5DYG A;  5ITY A;  2QNJ A;  3SAR A;  1L1Z A;  1VDD A;  3AL0 C;  4I8O A;  1VEG A;  1FNN A;  3B7Q A;  4M9S A;  2CFO A;  5EXX A;  3U6D A;  4B7F A;  3PFI A;  4D82 A;  1ZMU A;  4CGY B;  5H37 D;  1D0L A;  1XC8 A;  1XNR M;  2CE7 A;  4FWH A;  4DUY M;  2DVW B;  2ZAM A;  1QVR A;  2Q2E B;  4L6V 6;  5IT9 S;  2R4E A;  2CWB A;  1N77 A;  4IBB A;  5IZ7 D;  4FCT A;  2X8A A;  4AG5 A;  4L15 A;  3SHG B;  3U6M A;  1IN5 A;  2VQE M;  2I7P A;  1IBK M;  2LHG A;  4DV1 M;  4M0W A;  2XSZ A;  2WSC F;  4BB9 A;  2OQ4 A;  3VKG A;  1JR3 E;  4GC9 A;  2JWS A;  3B74 A;  5FSW A;  1GLN A;  2OPF A;  1OAI A;  2WZJ A;  1J5E M;  2DWN A;  2MGW A;  3SYK A;  4CHT B;  2JUJ A;  3C58 A;  2KZU A;  3DFZ A;  4GC5 A;  2E5L M;  4AZF A;  3C9P A;  3TL4 X;  3GPU A;  2CHG A;  4IBG A;  2K9D A;  1IBL M;  4JI7 M;  1QZM A;  3LVW A;  4IIW A;  2GNO A;  1AIP C;  4R71 A;  3VDU A;  1K82 A;  3GP1 A;  4HL4 A;  1V34 A;  2HHH M;  2EA0 A;  1E32 A;  3U6Q A;  2UXB M;  2UXD M;  2LNH C;  2R0I A;  1XXH E;  3BBZ A;  1GL7 A;  3KOX E;  1DO0 A;  2FFJ A;  2BJV A;  3GLH A;  1EE8 A;  1QAN A;  3Q8X A;  2UUC M;  1FJG M;  1N32 M;  3TE6 A;  3BXW A;  4P17 A;  3W67 A;  1VG5 A;  1NV8 A;  1TH3 A;  2G8L A;  2QEN A;  3KXE C;  4B7G A;  1IY0 A;  4QOZ C;  3MHV C;  5BR8 M;  3PNY A;  1G59 A;  3U5Z B;  5EJC A;  2DKL A;  4OVZ B;  5EXP A;  4II7 A;  4CJ6 A;  3THG A;  5KPZ A;  1IXS B;  4GIP A;  3EIH A;  2KEB A;  3I01 M;  4JI6 M;  2QBY A;  1QUT A;  3PNV A;  4LF4 M;  1Q39 A;  3SAS A;  1XHB A;  3GPX A;  3HZJ A;  2WSF F;  1L1T A;  3GLH E;  3K2L A;  1YUB A;  4LRT A;  2F4V M;  2J7O A;  1DGG A;  1TR8 A;  2F5Q A;  2YR0 A;  2DHR A;  2KRU A;  5C1B A;  3SBJ A;  1R2Z A;  4IJF A;  2Y0T A;  2LVQ D;  1NO1 A;  4LF6 M;  3GLI E;  2HAK A;  3AFH A;  1OKS A;  3HX3 A;  4NSO B;  3R9X B;  3LQR A;  2W82 A;  3IG5 A;  5ITX E;  1Z6T A;  2LVO C;  3SFZ A;  4OU7 A;  2DAG A;  2Z4R A;  2Y20 A;  1SG9 A;  3TQS A;  1NJG A;  4GKJ M;  4PD2 A;  4MH0 E;  1W5T A;  4M9Z A;  1OFH A;  3SC3 A;  1UFZ A;  4MGK E;  4B7H A;  4AKH A;  1N75 A;  2HKJ A;  2JA2 A;  3K9O A;  1YSY A;  2DEN A;  2FH0 A;  4AW4 A;  3GPP A;  1XB2 B;  1D0M A;  2CHV A;  3T15 A;  3UK6 A;  1NY6 A;  2R45 A;  2RKO A;  4DUZ M;  1IN7 A;  2J7N A;  2MH8 A;  3HHX A;  3T38 A;  3KDS E;  1Z5C A;  4ITQ A;  2R44 A;  1MX0 A;  2C96 A;  1QAO A;  2R6F A;  1NV9 A;  1TDH A;  2L4E A;  3K8Z A;  3KS4 A;  3SMP A;  3T6P A;  4LCB A;  1T43 A;  3HHY A;  2LHC A;  4XK8 F;  3FUT A;  2CHQ A;  2HWJ A;  5KQD A;  2F5O A;  4JI1 M;  2DXI A;  3J80 S;  3CF0 A;  2B3T A;  2DHY A;  5L8R F;  2XGN A;  3I4V A;  2DWL A;  2QSF X;  4W5W A;  4NOO B;  2F5S A;  4QHS A;  1HQC A;  5ITR A;  2R65 A;  5FLX S;  4FCV A;  2O01 F;  1TTE A;  5A2Q S;  2LVN C;  2Z7J A;  2R46 A;  3TWL A;  2JY7 A;  2XZF A;  3VK7 A;  1IFY A;  1ZMV A;  2EKK A;  3HJQ A;  4LJ8 A;  1IN8 A;  1IXR C;  5KPR A;  1IM2 A;  4KT0 F;  4F1I A;  2L7H A;  2QQ8 A;  2XSZ D;  4DR5 M;  4K0K M;  4G6Z A;  3AOE C;  3L28 A;  2K0B X;  4Z8X A;  3KOW E;  2DAI A;  3TWM A;  3U61 A;  3KW6 A;  4ANR A;  2V1C A;  5EP1 A;  1E9S A;  2VQF M;  3GLG E;  2QCU A;  2V6Z M;  3ZCB B;  1HNZ M;  4CIS A;  2KNV A;  4B3R M;  4M0D A;  2JY8 A;  4AI6 A;  2R62 A;  3VDP A;  2H1R A;  2LTU A;  3FD9 A;  4NXM M;  4RNA A;  1SXJ E;  2DZL A;  3GLF A;  4FD2 A;  3FTF A;  2L09 A;  5KPT A;  1SXJ C;  3U6E A;  3T1Y M;  1GJT A;  2OOB A;  4JN6 A;  1L2D A;  1G71 A;  1GO5 A;  1TH2 A;  1NNJ A;  3ILK A;  5EQT A;  2M60 A;  2RGO A;  2LWX A;  3GRU A;  4GHA A;  3UMM A;  4MGZ E;  3FYC A;  1HNW M;  1MJG M;  3SHF A;  5IWA M;  1E9R A;  3HGI A;  1HQY E;  3IHP A;  2G3Q A;  4AQY M;  2X4A A;  4KHP M;  1JB0 F;  4HLQ A;  1QAQ A;  3B7N A;  4Y28 F;  1PJJ A;  4JI0 M;  2Y21 A;  2KZS A;  3RGS A;  3NBX X;  3FKE A;  3GQ4 A;  2CV0 A;  3HKP A;  4IBI A;  1E94 E;  4OX9 M;  3HU3 A;  1R5L A;  1UM8 A;  1LV7 A;  3QYE A;  4FWG A;  1IN4 A;  4LG2 A;  1XXH B;  4D80 A;  2OOA A;  4RKU F;  4RF0 A;  1XMQ M;  1WR1 B;  2FNA A;  2YNM D;  3GRV A;  2L7I A;  2RRU A;  4WP2 A;  1D2N A;  2BWB A;  3IEC A;  3DA1 A;  4L16 A;  5EXT A;  1J7K A;  1G8P A;  1VQ1 A;  2VDB B;  2BWE A;  3KP1 E;  5FTN A;  3LCV B;  5E6J A;  1VEK A;  2DI0 A;  2KDL A;  1DO2 A;  5FTM A;  3U6S A;  2V1U A;  1QAM A;  2JY5 A;  4LJ9 A;  3FTC A;  4LGY A;  4IBC A;  2WSE F;  3AOG A;  1J09 A;  1L2C A;  5GKN A;  4P16 A;  4X66 M;  4WW0 A;  4MGY E;  2QZ4 A;  2MR9 A;  3GLH B;  1XWI A;  1T6O A;  1NSF A;  1GJS A;  1PRB A;  2ZM6 M;  3HU1 A;  4EIW A;  1YE9 A;  2JZ0 A;  4IBJ A;  3FTE A;  3SAU A;  3B89 A;  4FW9 A;  1DV0 A;  3GLI B;  4QHT A;  1K3X A;  2CP8 A;  1R6B X;  1Y8G A;  3H4M A;  4DV6 M;  2D7G A;  2R4J A;  3D8L A;  1IQP A;  3FUW A;  3TPZ A;  2K6B A;  4PDI A;  3U6C A;  4XGI A;  4LFC M;  3DZD A;  4NL4 H;  3U5Z A;  1F4I A;  4OVZ A;  3KSJ A;  1IXS A;  4LZZ A;  1HT2 E;  4MGI E;  5FTJ A;  1K3W A;  2UUA M;  3QYB A;  4LJ5 A;  1KYI A;  4WUR A;  4G4O A;  3FTD A;  4DV7 M;  1HT1 E;  2CRU A;  3J2P B;  4X65 M;  3GQ5 A;  2NQ8 C;  2F5P A;  3FYD A;  4PDG A;  1N34 M;  3IG8 A;  4LJ4 A;  4LF7 M;  2BNK A;  3NWL A;  3OTO M;  4IBK A;  4GKK M;  1P3Q Q;  2FS1 A;  1HJP A;  4I5S A;  1SXJ D;  4JV5 M;  1GKI A;  4DR7 M;  3QAU A;  2ZTD A;  2X49 A;  5IRE B;  1T3T A;  1TH4 A;  2AHM A;  3KSX A;  2DAE A;  4LRS A;  1OIP A;  5BPV A;  4JI4 M;  3J7A S;  3KS8 A;  1C1K A;  1GL6 A;  1G4A E;  4LFB M;  1X37 A;  2Z8Y M;  1QDR A;  1Z5A A;  4GRI A;  2F5N A;  4JI2 M;  1ZAE A;  4MGH A;  3L27 A;  1C7Y A;  1Z59 A;  4FCW A;  4R3D A;  2O5R A;  1OJL A;  1NNU C;  3HHW A;  3HHZ A;  2OO9 A;  2L4F A;  4L78 A;  3RGP A;  4BLC A;  3RE8 A;  4AKI A;  4GMQ A;  4DR2 M;  2LBC A;  3U60 B;  1WXQ A;  2DAK A;  4L8R C;  3GRR A;  4NC6 A;  3M0E A;  3D8B A;  3JAM S;  3F92 A;  1OIZ A;  1QZE A;  3V76 A;  2DWZ B;  3GLG B;  4A3V B;  4DBG B;  5KO3 A;  4AKG A;  2FE8 A;  3KP0 E;  2G5G X;  1IY2 A;  2DNA A;  3E9S A;  4M9X A;  2H5X A;  1QYR A;  3KVW A;  3GQ3 A;  2KRK A;  2LXE A;  2D7E A;  1V33 A;  1SXJ B;  2ZTC A;  3LQQ A;  3QWL A;  3U6P A;  1DGH B;  3DOA A;  4PT5 A;  3AV0 A;  3J7B A;  4TUW A;  1VEJ A;  3MK6 A;  1NY5 A;  4OW0 A;  3WHK A;  3NBI A;  3UJN A;  1QUS A;  1HR0 M;  4DR6 M;  2M5Z A;  1L8Q A;  1IXZ A;  1GVN A;  3SYL A;  4Q7J A;  1N33 M;  4D81 A;  2EKF A;  3LVV A;  1WJ7 A;  1GAB A;  1EIJ A;  4DR4 M;  2J5Y A;  4G3O A;  2D7H A;  4R7G A;  3JR4 A;  1N78 A;  3TWK A;  1ZQ9 A;  4FVM A;  3JR5 A;  4X62 M;  1OTR A;  3J27 B;  1OAO C;  3L29 A;  3L2A A;  4I81 A;  4LGM A;  4ZPX A;  1HNX M;  4NXN M;  3RFW A;  2KNZ A;  4REZ A;  4JI3 M;  1QDT A;  4L4U A;  4LF9 M;  2QP9 X;  4QOS A;  4LJ7 A;  1XNQ M;  3GLF E;  2XH9 A;  4LF5 M;  3HU2 A;  3WHL A;  4UN2 B;  3A42 A;  3A98 B;  2VII A;  2BJW A;  1JR3 A;  1LTM A;  2JY6 B;  1G41 A;  4LFA M;  3SMS A;  3GPY A;  5EP4 A;  3FUX A;  1S3S A;  2JP7 A;  1ZV1 A;  5DFL A;  2I7N A;  4KLN A;  3KOZ E;  1WGL A;  2APL A;  4YY3 M;  2JXN A;  2A5Y B;  3KFU G;  3ZQJ A;  2XF3 A;  1DGB A;  3GO8 A;  4G4N A;  1H6U A;  2KW0 A;  3ZH9 B;  4B3M M;  1IY1 A;  2R18 A;  4BBA A;  2CEA A;  1TDZ A;  3H4J A;  3VLF B;  2FOI C;  3L25 A;  1EFU B;  1AUA A;  5EP3 A;  2DAM A;  3HJ8 A;  3FE3 A;  1XXH A;  3CF2 A;  1A5T A;  1W5S A;  4S12 A;  5FTK A;  1Q3B A;  2Y0Q A;  2MRO B;  3AJI B;  3W68 A;  4IBE A;  1JQJ C;  1NHG C;  1R7R A;  2RGH A;  3K92 A;  4LZJ A;  3A46 A;  2ZAN A;  4JYA M;  4DV5 M;  5KQ8 A;  5ITQ A;  2LVP C;  1MU5 A;  2CUZ A;  4B3S M;  2EO2 A;  3E4R A;  4F2L A;  4QNR A;  5F3W A;  3HJS A;  3PVS A;  2ZAO A;  2L2D A;  3PXG A;  1L2B A;  1NJF A;  2C99 A;  1PGY A;  3B9P A;  3U6O A;  1V92 A;  3CGW A;  4B3T M;  2ZBK B;  3FUU A;  5LMN M;  3SAV A;  5EP2 A;  4RF1 A;  2KA6 B;  1KFV A;  2QBY B;  3HY5 A;  3VKH A;  1NVM A;  2CV1 A;  4G4Q A;  3BOS A;  1IBM M;  2EUC A;  1PJS A;  3HWS A;  4MB7 A;  3U6L A;  4G4R A;  7CAT A;  3GLI A;  4GEW A;  2QPA A; 
#chains in the Genus database with same CATH homology
 3J81 S;  1XMO M;  4IBD A;  2C9O A;  3M6A A;  5ITU A;  4DV2 M;  2KXE A;  5ITX A;  3T1H M;  3W0L B;  4NRW A;  4YHH M;  2XFS A;  2Z4S A;  3SAW A;  4LJ6 A;  1KSF X;  2P5T A;  4IBF A;  1PM5 A;  3VK8 A;  2XLJ A;  1I4W A;  5ITT A;  3KOY E;  5DNY A;  2Z3X A;  4Z6Y A;  4QNM A;  4FWD A;  3GRY A;  4X64 M;  4MM3 B;  1TGU A;  4DV4 M;  1R2Y A;  5JI3 E;  3UZU A;  1IN6 A;  2XFT A;  4KO8 A;  1NHW C;  4GHL A;  1DGF A;  4PCZ A;  4AG6 A;  2C5R A;  3L26 A;  8CAT A;  4DV3 M;  2HL7 A;  2UXC M;  2CV2 A;  3K1J A;  2XEP A;  2UU9 M;  2YFQ A;  2LH0 A;  2DWM A;  3CTW B;  3ZC7 B;  2ERC A;  3FUV A;  4I4L A;  2UUB M;  4LF8 M;  4XBO A;  4LY6 A;  3AKZ A;  4DV0 M;  5FTL A;  2C9C A;  4JI5 M;  1OFI A;  4LJA A;  4KOD A;  3A45 A;  2HCB A;  5C18 A;  3AOE A;  3U60 A;  4B08 A;  1N36 M;  5JI2 E;  5EXS A;  1ORY B;  3SAT A;  3W0F A;  1JR3 D;  3CF6 E;  3GLG A;  3LMM A;  1G3I A;  4DR3 M;  5LMU M;  3U61 B;  3EIE A;  3I4Y A;  2L6O A;  4IJE A;  2K47 A;  3M7G A;  1SXJ A;  1Z5B A;  3R8F A;  1DGH A;  4DR1 M;  3I51 A;  1I94 M;  5E26 A;  4GH9 A;  2YQZ A;  1QQW A;  3UGJ A;  2C98 A;  3GLF B;  2XZU A;  4JI8 M;  2DZO B;  3MJ5 A;  1PJI A;  3VFD A;  5DYI A;  4GIT A;  4JXJ A;  1Q3C A;  4NSR A;  4NRV A;  2DZN B;  5DYG A;  5ITY A;  3SAR A;  1L1Z A;  1VDD A;  3AL0 C;  4I8O A;  1FNN A;  4M9S A;  2CFO A;  5EXX A;  3U6D A;  4B7F A;  3PFI A;  4D82 A;  4CGY B;  5H37 D;  1XC8 A;  1XNR M;  2CE7 A;  4FWH A;  4DUY M;  2DVW B;  2ZAM A;  1QVR A;  2Q2E B;  5IT9 S;  2R4E A;  1N77 A;  4IBB A;  5IZ7 D;  4FCT A;  2X8A A;  4AG5 A;  4L15 A;  3SHG B;  3U6M A;  1IN5 A;  2VQE M;  2I7P A;  4DV1 M;  4M0W A;  2XSZ A;  4BB9 A;  2OQ4 A;  3VKG A;  4GC9 A;  5FSW A;  1GLN A;  2OPF A;  1J5E M;  2DWN A;  3C58 A;  3SYK A;  4CHT B;  2KZU A;  3DFZ A;  4GC5 A;  2E5L M;  4AZF A;  3TL4 X;  3GPU A;  2CHG A;  4IBG A;  4JI7 M;  1IBL M;  1QZM A;  3LVW A;  4IIW A;  3VDU A;  1K82 A;  3GP1 A;  4HL4 A;  2HHH M;  2EA0 A;  1E32 A;  3U6Q A;  2UXB M;  2UXD M;  2LNH C;  1GL7 A;  3KOX E;  1DO0 A;  2FFJ A;  2BJV A;  3GLH A;  1EE8 A;  1QAN A;  3Q8X A;  2UUC M;  1FJG M;  1N32 M;  3TE6 A;  1TH3 A;  2QEN A;  2G8L A;  3KXE C;  4B7G A;  1IY0 A;  4QOZ C;  3MHV C;  5BR8 M;  3PNY A;  1G59 A;  3U5Z B;  5EJC A;  4OVZ B;  5EXP A;  4II7 A;  3THG A;  5KPZ A;  1IXS B;  4GIP A;  3EIH A;  2KEB A;  4JI6 M;  2QBY A;  3PNV A;  4LF4 M;  1Q39 A;  3SAS A;  1XHB A;  3GPX A;  1L1T A;  3K2L A;  1YUB A;  4LRT A;  2F4V M;  2J7O A;  1DGG A;  2F5Q A;  2YR0 A;  2DHR A;  2KRU A;  5C1B A;  3SBJ A;  1R2Z A;  4IJF A;  2Y0T A;  4LF6 M;  3AFH A;  3R9X B;  4NSO B;  3LQR A;  2W82 A;  3IG5 A;  5ITX E;  1Z6T A;  3SFZ A;  4OU7 A;  2Z4R A;  2Y20 A;  3TQS A;  1NJG A;  4GKJ M;  4PD2 A;  4MH0 E;  1W5T A;  4M9Z A;  1OFH A;  3SC3 A;  4AKH A;  4MGK E;  4B7H A;  1N75 A;  2HKJ A;  2JA2 A;  1YSY A;  4AW4 A;  3GPP A;  2CHV A;  3T15 A;  3UK6 A;  1NY6 A;  2R45 A;  2RKO A;  4DUZ M;  1IN7 A;  2J7N A;  3HHX A;  3T38 A;  3KDS E;  1Z5C A;  4ITQ A;  3KS4 A;  1MX0 A;  2C96 A;  1QAO A;  3K8Z A;  1TDH A;  1IBK M;  3SMP A;  4LCB A;  3HHY A;  3FUT A;  2CHQ A;  5KQD A;  2F5O A;  4JI1 M;  2DXI A;  3J80 S;  3CF0 A;  2XGN A;  3I4V A;  2DWL A;  4W5W A;  4NOO B;  2F5S A;  4QHS A;  1HQC A;  5ITR A;  2R65 A;  5FLX S;  4FCV A;  5A2Q S;  2Z7J A;  2R46 A;  3TWL A;  2XZF A;  3VK7 A;  3HJQ A;  4LJ8 A;  1IN8 A;  1IXR C;  5KPR A;  1IM2 A;  4K0K M;  2L7H A;  2XSZ D;  4DR5 M;  4G6Z A;  3AOE C;  3L28 A;  4Z8X A;  3TWM A;  3KOW E;  3U61 A;  3KW6 A;  2V1C A;  5EP1 A;  1E9S A;  2VQF M;  2QCU A;  2V6Z M;  3ZCB B;  1HNZ M;  4CIS A;  4B3R M;  4M0D A;  4AI6 A;  2R62 A;  3VDP A;  2H1R A;  3FD9 A;  4NXM M;  4RNA A;  1SXJ E;  3GLF A;  4FD2 A;  3FTF A;  2L09 A;  5KPT A;  1SXJ C;  3U6E A;  3T1Y M;  4JN6 A;  1L2D A;  1TH2 A;  1NNJ A;  3ILK A;  5EQT A;  2M60 A;  2RGO A;  2LWX A;  3GRU A;  4GHA A;  3UMM A;  4MGZ E;  3FYC A;  1HNW M;  3SHF A;  5IWA M;  1E9R A;  3HGI A;  1HQY E;  4AQY M;  2X4A A;  4KHP M;  4HLQ A;  1QAQ A;  1PJJ A;  4JI0 M;  2Y21 A;  2KZS A;  3RGS A;  3FKE A;  3GQ4 A;  2CV0 A;  3HKP A;  4IBI A;  1E94 E;  4OX9 M;  3HU3 A;  1UM8 A;  1LV7 A;  4FWG A;  1IN4 A;  4LG2 A;  1XXH B;  4D80 A;  4RF0 A;  1XMQ M;  2FNA A;  2YNM D;  3GRV A;  2L7I A;  1D2N A;  5EXT A;  3DA1 A;  4L16 A;  1J7K A;  1G8P A;  3KP1 E;  5FTN A;  5E6J A;  3U6S A;  5FTM A;  2V1U A;  1DO2 A;  1QAM A;  4LJ9 A;  3FTC A;  4LGY A;  4IBC A;  3AOG A;  1J09 A;  1L2C A;  5GKN A;  4P16 A;  4X66 M;  4WW0 A;  4MGY E;  2QZ4 A;  3GLH B;  1XWI A;  1NSF A;  2ZM6 M;  3HU1 A;  4EIW A;  1YE9 A;  4IBJ A;  3FTE A;  3SAU A;  4FW9 A;  3GLI B;  4QHT A;  1K3X A;  3H4M A;  1R6B X;  4DV6 M;  3FUW A;  2D7G A;  2R4J A;  1IQP A;  3D8L A;  3TPZ A;  4PDI A;  3U6C A;  4LFC M;  4XGI A;  3DZD A;  4NL4 H;  3U5Z A;  4OVZ A;  3KSJ A;  4LZZ A;  1HT2 E;  4MGI E;  5FTJ A;  1K3W A;  2UUA M;  4LJ5 A;  1KYI A;  4WUR A;  4G4O A;  3FTD A;  4DV7 M;  1HT1 E;  3J2P B;  4X65 M;  3GQ5 A;  2NQ8 C;  2F5P A;  3FYD A;  4PDG A;  1N34 M;  3IG8 A;  4LJ4 A;  4LF7 M;  2BNK A;  3NWL A;  3OTO M;  4IBK A;  4GKK M;  4I5S A;  1SXJ D;  4JV5 M;  1GKI A;  4DR7 M;  3QAU A;  2X49 A;  5IRE B;  1T3T A;  1TH4 A;  2AHM A;  3KSX A;  4LRS A;  5BPV A;  4JI4 M;  3J7A S;  3KS8 A;  1C1K A;  1GL6 A;  1G4A E;  4LFB M;  1X37 A;  1Z5A A;  4GRI A;  2F5N A;  4JI2 M;  1ZAE A;  4MGH A;  3L27 A;  1Z59 A;  4FCW A;  4R3D A;  2O5R A;  1OJL A;  1NNU C;  3HHW A;  3HHZ A;  4L78 A;  3RGP A;  4BLC A;  4AKI A;  3RE8 A;  4GMQ A;  4DR2 M;  3U60 B;  1WXQ A;  4L8R C;  3GRR A;  3M0E A;  3D8B A;  3JAM S;  3GLG B;  2DWZ B;  4A3V B;  5KO3 A;  4AKG A;  2FE8 A;  3KP0 E;  2G5G X;  1IY2 A;  3E9S A;  4M9X A;  1QYR A;  3KVW A;  3GQ3 A;  2KRK A;  2LXE A;  2D7E A;  1SXJ B;  3LQQ A;  3QWL A;  3U6P A;  1DGH B;  3DOA A;  4PT5 A;  3AV0 A;  3J7B A;  4TUW A;  3MK6 A;  1NY5 A;  4OW0 A;  3WHK A;  3NBI A;  3UJN A;  1HR0 M;  4DR6 M;  2M5Z A;  1L8Q A;  1IXZ A;  1GVN A;  3SYL A;  1N33 M;  4D81 A;  3LVV A;  4DR4 M;  4R7G A;  2D7H A;  3JR4 A;  1N78 A;  3TWK A;  1ZQ9 A;  4FVM A;  3JR5 A;  4X62 M;  3J27 B;  3L29 A;  3L2A A;  4I81 A;  4LGM A;  4ZPX A;  1HNX M;  4NXN M;  3RFW A;  4REZ A;  4JI3 M;  4L4U A;  4LF9 M;  2QP9 X;  4QOS A;  4LJ7 A;  1XNQ M;  2XH9 A;  4LF5 M;  3HU2 A;  3WHL A;  3A42 A;  3A98 B;  2VII A;  2BJW A;  1JR3 A;  1G41 A;  4LFA M;  3SMS A;  3GPY A;  5EP4 A;  3FUX A;  1S3S A;  2I7N A;  4KLN A;  3KOZ E;  4YY3 M;  2A5Y B;  3KFU G;  3GO8 A;  2XF3 A;  1DGB A;  4G4N A;  1H6U A;  2KW0 A;  3ZH9 B;  4B3M M;  1IY1 A;  2R18 A;  4BBA A;  2CEA A;  1TDZ A;  3VLF B;  2FOI C;  3L25 A;  5EP3 A;  3HJ8 A;  1XXH A;  3CF2 A;  1W5S A;  4S12 A;  5FTK A;  1Q3B A;  2Y0Q A;  3AJI B;  4IBE A;  1JQJ C;  1NHG C;  1R7R A;  2RGH A;  3K92 A;  4LZJ A;  3A46 A;  2ZAN A;  4JYA M;  4DV5 M;  5KQ8 A;  5ITQ A;  1MU5 A;  2CUZ A;  4B3S M;  2EO2 A;  3E4R A;  4QNR A;  5F3W A;  3HJS A;  3PVS A;  2ZAO A;  3PXG A;  1L2B A;  1NJF A;  2C99 A;  3U6O A;  3B9P A;  4B3T M;  2ZBK B;  3FUU A;  5LMN M;  3SAV A;  5EP2 A;  4RF1 A;  2KA6 B;  1KFV A;  2QBY B;  3VKH A;  1NVM A;  2CV1 A;  4G4Q A;  3BOS A;  1IBM M;  2EUC A;  3HWS A;  4MB7 A;  3U6L A;  4G4R A;  7CAT A;  3GLI A;  2QPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...