2C5RA

The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EARLY PROTEIN P16.7
publication title Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Dna-binding protein/dna
total genus 21
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2c5rA00
1ZAEA 2BNKA 2C5RA
chains in the Genus database with same CATH superfamily
4RF0A 1PJTA 2JXNA 3LQRA 4WP2A 1GLNA 4HL4A 3RFWA 4GKJM 2X8AA 4DV6M 1G41A 4FCTA 2R65A 1L8QA 3HX3A 3EIHA 5EP2A 5IREB 2DHRA 5IZ7D 3U60B 2FOIC 4L78A 1G8PA 2WZJA 4B3RM 1NHGC 4OX9M 2R45A 5ITYA 4Z8XA 3U5ZB 5DYGA 4Z6YA 2LVNC 3T1HM 4JI8M 4X65M 4LF4M 1D0LA 2JP7A 3ZQJA 3HWSA 4MH0E 1MX0A 2Y21A 4D81A 4JI5M 5FTKA 3K8ZA 1HNWM 3IECA 3K9PA 1T43A 1ZQ9A 5EXSA 1KFVA 2CRUA 4ZPXA 2ZTDA 1KYIA 5ITTA 4NC6A 1TDZA 4PD2A 3DZDA 1F4IA 4XK8F 3KSJA 3K2LA 1JR3D 3TE6A 1AUAA 3SYLA 2F5SA 3NWLA 2FS1A 5IWAM 1ZAEA 4IBCA 5ITXE 3Q8XA 4PT5A 3VDPA 2LVPC 4NOOB 3GPXA 4RNAA 4JI0M 4A3VB 3F92A 4WW0A 1EFUB 2C9OA 4CGYB 3GLIA 3U6CA 4LF5M 1G4AE 3WHKA 5EJCA 3I04M 3GLFB 1TTEA 4D80A 2Z3XA 4XBOA 4I81A 1PGYA 4I4LA 4LRTA 1DGBA 1C1KA 1VDDA 2LVQD 2JZ0A 4KHPM 1IN6A 4ANRA 3SMPA 5FTLA 3FYDA 3VDUA 4P16A 3AOEA 4GC9A 2KHHA 4NXNM 1I4WA 4LJ9A 1W5SA 1HNXM 3SHFA 4B7GA 1MJGM 1SXJA 3BOSA 4IBGA 3J80S 3W0LB 3SASA 1TDHA 1IY0A 4L16A 1E32A 4RKUF 1TR8A 1DGGA 1HQCA 2L7HA 4Q7JA 3SMSA 4FWHA 3GLGA 2L7IA 2K6BA 1R2ZA 4NRWA 4GMQA 3HU3A 4L15A 3HJQA 4LY6A 1A5TA 4LZJA 1JR3E 3I51A 3K1JA 3EIEA 1V34A 3AOGA 2C98A 3GPUA 3U6DA 4GITA 2UUBM 1OTRA 3RGSA 2DWMA 2D7GA 2YNMD 3GQ4A 3LMMA 1NNUC 1NHWC 1OKSA 5JI2E 3GLGB 3KFUG 3M0EA 2F5OA 1GABA 4LFBM 1GL7A 1DV0A 2GNOA 5FSWA 1W5TA 5EP1A 4B3TM 2XSZA 4AG6A 1ORYB 2R44A 1MU5A 3CF6E 3HU2A 4JI6M 3ZC7B 2EA0A 3E4RA 4S12A 3GQ5A 2DAKA 4IBEA 4LZZA 4LGMA 3I4YA 4HEOA 3GRVA 2KNAA 3E21A 4CJ6A 3C9PA 1YE9A 4DR7M 1TH2A 2DENA 2NQ8C 3E46A 2QBYA 2WSFF 1IY1A 1SG9A 2V1UA 1JQJC 2CHVA 1IXZA 2MJ5B 2LHCA 2UUAM 2EJSA 4DV7M 4LJ4A 4NXMM 2ZAMA 1PJQA 2JY6B 2QPAA 3J27B 5JI3E 1IN8A 3GRRA 3FTFA 1VG5A 3J81S 3HHZA 2RGOA 2F5NA 5KQDA 1TF0B 1G71A 4GKKM 4M9XA 3V76A 2VDBB 3FYCA 5L8RF 1XMOM 3MK6A 4G4QA 1D2NA 4MGYE 2EKFA 1XC8A 2DXIA 2OOBA 2R62A 1WR1B 1XXHE 3SAVA 3TPZA 4DR1M 4NSOB 3B9PA 3IG5A 3B7ZA 1L2DA 2CV2A 5E6JA 3KSXA 4AW4A 4G4RA 4LF6M 4X62M 1OJLA 1IFYA 2QZ4A 4DV1M 1QQWA 2OQ4A 1GO5A 3KOXE 3CTWB 3GRYA 1WGNA 3GLHE 1GJSA 1NNJA 2DWLA 4F2LA 2C9CA 1WXQA 2QSFX 2WSCF 1XNQM 1JB0F 4DV2M 5LMUM 2UU9M 3VKHA 3FUTA 4LJ7A 3FUWA 2EKKA 4OVZA 4X64M 4JI2M 2DWZB 1XWIA 2KZUA 4YY3M 4YHHM 1YLAA 3BBZA 5E26A 4AG5A 2VIIA 3VK8A 1IQPA 4QHSA 1ZV1A 4TUWA 5FTNA 2XF3A 3AJIB 2V1CA 1DO0A 5FTJA 1PJIA 1OAOC 1R6BX 3WHLA 2FFJA 2Z4RA 1L1TA 2CFOA 4LF9M 4L6V6 3LVWA 2ZANA 3LCUA 4OVZB 1VQ1A 2J7OA 2L09A 1QYRA 4EIWA 1GJTA 1IN4A 1DGHA 3KP0E 3PNVA 4G6ZA 4FVMA 1CUKA 2UXDM 4QOSA 2F5PA 4QHTA 5FTMA 2QP9X 4DV5M 1AIPC 2N35A 2X49A 1XHBA 4IBBA 2FE8A 1QAOA 3RE8A 4JYAM 3L27A 1ZMVA 3MMPA 4FCWA 4LFCM 3KS4A 1K82A 3DA1A 4IBIA 2I7PA 1OIZA 1OFHA 1IM2A 1TH4A 2DZOB 4FWDA 2H5XA 2LNHC 1DGHB 2K9DA 3HJ8A 1IY2A 4G4OA 1E9SA 1QAQA 5KQ8A 1MN3A 2V6ZM 3HHYA 3HGIA 2RRUA 3M6AA 2R18A 3CGWA 3QYBA 3AOEC 1SXJD 2JA2A 4JI3M 3TWLA 3U6PA 2DNAA 3GLIB 3FTCA 5H37D 2JZ1A 1V92A 4MB7A 1OAIA 2ZM6M 2O01F 2UUCM 1TGUA 4RF1A 1EE8A 4AKGA 1T6OA 3T6PA 3A98B 3GQ3A 2KW0A 1UFZA 2L4EA 5ITQA 3H4MA 4DUZM 3GLFE 2XEPA 4REZA 4DR5M 4AZFA 2QCUA 3VKGA 2HHHM 2LTUA 2ERCA 4B08A 1J09A 2O25A 3JR5A 2VQEM 1SXJB 1Q39A 1QUTA 1WJ7A 3UZUA 5A2QS 1L1ZA 4B3SM 2BNKA 4GH9A 2LBCA 4R7GA 1Q02A 3FUUA 3HU1A 2F5QA 1YUBA 4LJ8A 2YR0A 1D0MA 2W82A 4B3MM 4ITQA 1QVRA 1NO1A 2H1RA 4LRSA 4GHAA 4LJ6A 3KW6A 2XSZD 2KRKA 4CHTB 2CHQA 2LXEA 3U6LA 3GRUA 1NY5A 2Z4SA 1NJGA 1T3TA 1D0KA 2RGHA 4QNRA 5EXTA 1V33A 2QQ8A 4KO8A 3OTOM 3J7BA 3U6QA 3HHXA 1I94M 2DVWB 1OFIA 4DBGB 3E9SA 4W5WA 2DAEA 2HAKA 3AL0C 1PJSA 4B7FA 4K0KM 3FUXA 3MHVC 5EP4A 3GPPA 2DHYA 3R9XB 1HT1E 2HCBA 3HKPA 2CWBA 4FD2A 1IBLM 4UN2B 4MGKE 5EXXA 3GLGE 3KOYE 2ZBKB 4DR2M 2XZUA 1E94E 3AV0A 1XXHA 4GEWA 3MJ5A 1GL6A 3QAUA 5C1BA 2R0IA 4HLQA 2Q2EB 1QZEA 3L28A 3KOZE 3UMMA 1QANA 4I5SA 3T15A 2QHOB 4PDIA 1OIPA 7CATA 4KT0F 1RU3A 1Z5BA 3A46A 4LF8M 2QBYB 2L6OA 3AFHA 4M0DA 1Z5AA 3THGA 3SC3A 3FD9A 4GC5A 4NL4H 2BJVA 3U61A 3U6SA 4IJEA 4G4NA 1Z59A 3K92A 4M9ZA 3I4VA 1L2BA 5EQTA 2JNHA 2HL7A 1K3WA 2KRUA 3CF0A 4LG2A 2YFQA 1FNNA 1ZMUA 2KDLA 4JXJA 1K3XA 3KOWE 3IG8A 2WSEF 4JN6A 1XB2B 4Y28F 4F1IA 3D8BA 3AKZA 3C3EA 4DUYM 3SAUA 3KS8A 2VQFM 2EUCA 4OU7A 2UXCM 1NJFA 4KODA 2OO9A 3QWLA 2G5GX 1IN5A 3U61B 2Y0TA 2LHGA 1LTMA 3H4JA 2KEBA 1TH3A 3PXGA 4BBAA 3L2AA 2KNVA 1Q3BA 3TL4X 4DV4M 4L8RC 2CV1A 4MGZE 1NVMA 3T38A 4DR3M 2DAIA 3NBXX 3D8LA 3J7AS 1WHCA 1R5LA 2K0BX 3FUVA 1QDRA 1VDLA 1DO2A 2CHGA 4IBKA 3L26A 4BB9A 2RKOA 1HT2E 2Y20A 1IN7A 3KDSE 2R4EA 2XH9A 2ZTCA 5ITXA 4XGIA 3SATA 5C18A 5FLXS 3TQSA 1IBMM 1WGLA 4WURA 3HZJA 4M9SA 4II7A 2J7NA 3ILKA 3FKEA 3LVVA 3SHGB 2QENA 2CUZA 2LVAA 4IIWA 4MGIE 4OW0A 2EO2A 1C7YA 4GHLA 3FTEA 1X37A 4LFAM 2HKJA 5BR8M 3B7NA 3PNYA 3TWKA 1NY6A 4IJFA 1N78A 1VEJA 2CV0A 3UK6A 3VLFB 5ITUA 3GO8A 3RGPA 4QOZC 1GKIA 2G3QA 4JI1M 4D82A 2YQZA 1QUSA 4DV0M 3FRIA 1N36M 3W68A 2KA6B 1HJPA 2XZFA 1L2CA 3GLFA 3SAWA 1PJJA 1Y8GA 4KLNA 2M60A 3CF2A 2LH0A 1JR3A 4MGHA 8CATA 3UJNA 1YSYA 1G3IA 1SXJC 2BWBA 3QYEA 3VFDA 4B7HA 1HQYE 5KPRA 1KSFX 2L4FA 4I8OA 1J7KA 1WIVA 1NSFA 2BJWA 3DOAA 2Z7JA 2XGNA 3FE3A 5KPTA 4FCVA 1P3QQ 2XLJA 1XNRM 3SFZA 2OPFA 1N77A 2B3TA 4AQYM 3HJSA 2R4JA 3J2PB 4LCBA 2HWJA 3A45A 1Q3CA 3DFZA 3Q8GA 3ZCBB 2JY7A 1UM8A 5LMNM 3KP1E 2R6FA 4JI7M 5DFLA 5GKNA 2C99A 1S3SA 3L25A 3GLIE 3W0FA 2MR9A 2CE7A 3U6MA 2F4VM 3M7GA 1NV9A 4R71A 1N34M 2MGWA 2DKLA 2I7NA 3UGJA 4DR4M 2DZNB 1VEGA 2OOAA 2D7HA 1OQYA 3FTDA 3I01M 4IBDA 3SBJA 1NV8A 1BVSA 4JI4M 2BWEA 3JR4A 2XFTA 1IXRC 2JUJA 2JWSA 2J5YA 1HR0M 1XMQM 4QNMA 1PM5A 1SXJE 2X4AA 4FW9A 1R2YA 4IBFA 3B7QA 2Y0QA 2P5TA 3C58A 3R8FA 2G8LA 1IXSA 5IT9S 3LQQA 4MM3B 1LV7A 3BXWA 3B74A 2A5YB 3PVSA 4R3DA 4NRVA 3SYKA 2KXEA 3C3DA 4AI6A 2FH0A 4PDGA 4PCZA 1HNZM 4G3OA 1Z5CA 2C96A 2VF8A 3HHWA 1DGFA 4DV3M 2QNJA 1R4GA 2AHMA 4LJAA 4BLCA 2R46A 3GLHA 3LCVB 2CP8A 5ITRA 1G59A 3VK7A 2O5RA 4X66M 1IXSB 3ZH9B 3TWMA 3K9OA 4L4UA 4CIZA 1XXHB 1QZMA 5KO3A 3JAMS 3FRHA 2K47A 1N75A 3KVWA 4M0WA 4GIPA 1GVNA 3GP1A 3PFIA 2JY8A 5F3WA 3U6EA 1N32M 3B89A 3L29A 4NSRA 2DI0A 4AKHA 1N33M 2D7EA 3IHPA 3NBIA 1Z6TA 3HY5A 4JV5M 3GPYA 2ZAOA 2LVOC 5EP3A 2KZSA 3GLHB 1IBKM 2DAGA 3KXEC 1J5EM 4GRIA 2M5ZA 3T1YM 1FJGM 2DZLA 2UXBM 2JY5A 4CISA 3A42A 4LGYA 4LF7M 2APLA 2FNAA 2CEAA 4IBJA 1H6UA 3SARA 1QAMA 2Z8YM 4LJ5A 4FWGA 5DYIA 2GQFA 2DWNA 1ZMWA 3LW5F 3W67A 2MH8A 1VEKA 2DAMA 3U60A 3U6OA 2KNZA 2VF7A 1EIJA 4AKIA 1E9RA 1R7RA 5BPVA 2L2DA 2MROB 5KPZA 2LWXA 2XFSA 5DNYA 3U5ZA 4DR6M 5EXPA 2E5LM 2C5RA 4P17A 1QDTA 1PRBA
chains in the Genus database with same CATH topology
4RF0A 3LQRA 1GLNA 4HL4A 3RFWA 4GKJM 2X8AA 4DV6M 1G41A 4FCTA 2R65A 1L8QA 3EIHA 5EP2A 5IREB 2DHRA 5IZ7D 3U60B 2FOIC 4L78A 1G8PA 4B3RM 1NHGC 4OX9M 2R45A 5ITYA 4Z8XA 3U5ZB 5DYGA 4Z6YA 3T1HM 4JI8M 4X65M 4LF4M 3HWSA 4MH0E 1MX0A 2Y21A 4D81A 4JI5M 5FTKA 3K8ZA 1HNWM 1ZQ9A 5EXSA 1KFVA 4ZPXA 1KYIA 5ITTA 1TDZA 4PD2A 3DZDA 3KSJA 3K2LA 1JR3D 3TE6A 3SYLA 2F5SA 3NWLA 5IWAM 1ZAEA 4IBCA 5ITXE 3Q8XA 4PT5A 3VDPA 4NOOB 3GPXA 4RNAA 4JI0M 4A3VB 4WW0A 4CGYB 3GLIA 2C9OA 3U6CA 4LF5M 1G4AE 3WHKA 5EJCA 3GLFB 4D80A 2Z3XA 4XBOA 4I81A 4I4LA 4LRTA 1DGBA 1C1KA 1VDDA 4KHPM 1IN6A 3SMPA 5FTLA 3FYDA 3VDUA 4P16A 3AOEA 4GC9A 4NXNM 1I4WA 4LJ9A 1W5SA 1HNXM 3SHFA 4B7GA 1SXJA 3W0LB 3BOSA 4IBGA 3J80S 3SASA 1TDHA 1IY0A 4L16A 1E32A 2L7HA 1DGGA 1HQCA 3SMSA 1R2ZA 3GLGA 4FWHA 2L7IA 4NRWA 4GMQA 3HU3A 4L15A 3HJQA 4LY6A 4LZJA 3I51A 3K1JA 3EIEA 3AOGA 2UUBM 2C98A 3GPUA 3U6DA 4GITA 2DWMA 3RGSA 2D7GA 2YNMD 3GQ4A 3LMMA 1NNUC 1NHWC 5JI2E 3GLGB 3KFUG 3M0EA 2F5OA 4LFBM 1GL7A 4B3TM 5FSWA 1W5TA 5EP1A 2XSZA 4AG6A 1ORYB 3CF6E 1MU5A 3HU2A 4JI6M 3ZC7B 2EA0A 3E4RA 4S12A 3GQ5A 4IBEA 4LZZA 4LGMA 3I4YA 3GRVA 1YE9A 4DR7M 1TH2A 2NQ8C 2QBYA 1IY1A 2V1UA 1JQJC 2CHVA 1IXZA 2UUAM 4DV7M 4LJ4A 4NXMM 2ZAMA 2QPAA 3J27B 5JI3E 1IN8A 3GRRA 3FTFA 3J81S 3HHZA 2RGOA 2F5NA 5KQDA 4GKKM 4M9XA 3FYCA 1XMOM 3MK6A 4G4QA 1D2NA 4MGYE 1XC8A 2DXIA 2R62A 3SAVA 3TPZA 4DR1M 4NSOB 3B9PA 3IG5A 1L2DA 2CV2A 5E6JA 3KSXA 4AW4A 4G4RA 4LF6M 4X62M 1OJLA 2QZ4A 4DV1M 1QQWA 2OQ4A 3KOXE 3CTWB 3GRYA 1NNJA 2DWLA 2C9CA 1WXQA 1XNQM 3VKHA 4DV2M 5LMUM 2UU9M 3FUTA 4LJ7A 3FUWA 4OVZA 4X64M 4JI2M 2DWZB 1XWIA 2KZUA 4YY3M 4YHHM 5E26A 4AG5A 2VIIA 3VK8A 1IQPA 4QHSA 4TUWA 5FTNA 2XF3A 3AJIB 2V1CA 1DO0A 5FTJA 1PJIA 1R6BX 3WHLA 2FFJA 2Z4RA 1L1TA 2CFOA 4LF9M 4EIWA 3LVWA 2ZANA 4OVZB 2J7OA 2L09A 1QYRA 1IN4A 1DGHA 3KP0E 3PNVA 4G6ZA 4FVMA 2UXDM 4QOSA 2F5PA 4QHTA 5FTMA 2QP9X 4DV5M 2X49A 1XHBA 4IBBA 2FE8A 1QAOA 3RE8A 3L27A 4FCWA 4LFCM 3KS4A 1K82A 3DA1A 4IBIA 2I7PA 1OFHA 1IM2A 1TH4A 2DZOB 4FWDA 2LNHC 1DGHB 3HJ8A 1IY2A 4G4OA 1E9SA 1QAQA 5KQ8A 2V6ZM 3HHYA 3HGIA 3M6AA 2R18A 3AOEC 1SXJD 2JA2A 4JI3M 3TWLA 3U6PA 3GLIB 3FTCA 5H37D 4MB7A 2ZM6M 2UUCM 1TGUA 4RF1A 4AKGA 3A98B 3GQ3A 2KW0A 5ITQA 4DUZM 4DR5M 3H4MA 2XEPA 4REZA 3VKGA 4AZFA 2QCUA 2HHHM 2ERCA 4B08A 1J09A 3JR5A 2VQEM 1SXJB 1Q39A 5A2QS 3UZUA 1L1ZA 4B3SM 2BNKA 4GH9A 4R7GA 3FUUA 3HU1A 2F5QA 1YUBA 4LJ8A 2YR0A 2W82A 4B3MM 4ITQA 1QVRA 2H1RA 4LRSA 4GHAA 4LJ6A 3KW6A 2XSZD 2KRKA 4CHTB 2CHQA 2LXEA 3U6LA 3GRUA 1NY5A 2Z4SA 1NJGA 1T3TA 4QNRA 2RGHA 4DR3M 5EXTA 4KO8A 3OTOM 3U6QA 1I94M 3J7BA 3HHXA 2DVWB 1OFIA 3E9SA 4W5WA 3AL0C 4B7FA 4K0KM 3FUXA 3MHVC 5EP4A 3GPPA 3R9XB 1HT1E 2HCBA 3HKPA 4FD2A 1IBLM 4MGKE 5EXXA 3KOYE 2ZBKB 4DR2M 2XZUA 1E94E 3AV0A 1XXHA 3MJ5A 1GL6A 3QAUA 5C1BA 4HLQA 2Q2EB 3L28A 3KOZE 3UMMA 1QANA 4I5SA 3T15A 4PDIA 7CATA 3A46A 1Z5BA 4LF8M 2QBYB 2L6OA 3AFHA 4M0DA 1Z5AA 3THGA 3SC3A 3FD9A 4GC5A 4NL4H 2BJVA 3U61A 3U6SA 4IJEA 4G4NA 1Z59A 3K92A 4M9ZA 3I4VA 1L2BA 5EQTA 2HL7A 1K3WA 2KRUA 3CF0A 4LG2A 2YFQA 1FNNA 4JXJA 1K3XA 3KOWE 3IG8A 4JN6A 3D8BA 3AKZA 4DUYM 3SAUA 3KS8A 2VQFM 2EUCA 4OU7A 2UXCM 1NJFA 4KODA 3QWLA 2G5GX 1IN5A 3U61B 2Y0TA 3PXGA 2KEBA 1TH3A 4BBAA 3L2AA 1Q3BA 3TL4X 4DV4M 4L8RC 2CV1A 4MGZE 1NVMA 3T38A 3D8LA 3J7AS 3FUVA 1DO2A 2CHGA 4IBKA 3L26A 4BB9A 2RKOA 1HT2E 2Y20A 1IN7A 3KDSE 2R4EA 2XH9A 5ITXA 4XGIA 3SATA 5C18A 5FLXS 3TQSA 1IBMM 4WURA 4M9SA 4II7A 2J7NA 3ILKA 3FKEA 3LVVA 3SHGB 2QENA 2CUZA 4IIWA 4MGIE 4OW0A 4GHLA 2EO2A 4JYAM 3FTEA 1X37A 4LFAM 2HKJA 5BR8M 3PNYA 3TWKA 1NY6A 4IJFA 1N78A 2CV0A 3UK6A 3VLFB 5ITUA 3GO8A 3RGPA 4QOZC 1GKIA 4JI1M 4D82A 2YQZA 4DV0M 1N36M 2KA6B 2XZFA 1L2CA 3GLFA 3SAWA 1PJJA 4KLNA 2M60A 3CF2A 2LH0A 1JR3A 4MGHA 8CATA 3UJNA 1YSYA 1G3IA 1SXJC 3VFDA 4B7HA 1HQYE 5KPRA 1KSFX 4I8OA 1J7KA 3DOAA 1NSFA 2BJWA 2Z7JA 2XGNA 5KPTA 4FCVA 2XLJA 1XNRM 3SFZA 2OPFA 1N77A 4AQYM 3HJSA 2R4JA 3J2PB 4LCBA 3A45A 1Q3CA 3DFZA 3ZCBB 1UM8A 5LMNM 3KP1E 4JI7M 5GKNA 2C99A 1S3SA 3L25A 3W0FA 3U6MA 2CE7A 2F4VM 3M7GA 1N34M 2I7NA 3UGJA 4DR4M 2DZNB 2D7HA 3FTDA 3SBJA 4IBDA 4JI4M 3JR4A 2XFTA 1IXRC 1HR0M 1XMQM 4QNMA 1PM5A 1SXJE 2X4AA 4FW9A 1R2YA 4IBFA 2Y0QA 2P5TA 3C58A 3R8FA 2G8LA 5IT9S 3LQQA 4MM3B 1LV7A 2A5YB 3PVSA 4R3DA 4NRVA 3SYKA 2KXEA 4AI6A 4PDGA 4PCZA 1HNZM 1Z5CA 2C96A 3HHWA 1DGFA 4DV3M 2AHMA 4LJAA 4BLCA 2R46A 3GLHA 5ITRA 1G59A 3VK7A 2O5RA 4X66M 1IXSB 3ZH9B 3TWMA 4L4UA 1XXHB 1QZMA 5KO3A 3JAMS 3KVWA 2K47A 1N75A 4M0WA 3GP1A 4GIPA 1GVNA 3PFIA 5F3WA 3U6EA 1N32M 3L29A 4NSRA 4AKHA 1N33M 2D7EA 3NBIA 1Z6TA 4JV5M 3GPYA 2ZAOA 5EP3A 2KZSA 3GLHB 1IBKM 3KXEC 1J5EM 4GRIA 2M5ZA 3T1YM 1FJGM 2UXBM 4CISA 3A42A 4LGYA 4LF7M 2FNAA 2CEAA 4IBJA 1H6UA 3SARA 1QAMA 4LJ5A 4FWGA 5DYIA 2DWNA 3U60A 3U6OA 4AKIA 1E9RA 1R7RA 5BPVA 5KPZA 5DNYA 3U5ZA 2LWXA 2XFSA 4DR6M 5EXPA 2E5LM 2C5RA 1EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAE A;  2BNK A;  2C5R A; 
#chains in the Genus database with same CATH topology
 4RF0 A;  1PJT A;  2JXN A;  3LQR A;  4WP2 A;  1GLN A;  4HL4 A;  3RFW A;  4GKJ M;  2X8A A;  4DV6 M;  1G41 A;  4FCT A;  2R65 A;  1L8Q A;  3HX3 A;  3EIH A;  5EP2 A;  5IRE B;  2DHR A;  5IZ7 D;  3U60 B;  2FOI C;  4L78 A;  1G8P A;  2WZJ A;  4B3R M;  1NHG C;  4OX9 M;  2R45 A;  5ITY A;  4Z8X A;  3U5Z B;  5DYG A;  4Z6Y A;  2LVN C;  3T1H M;  4JI8 M;  4X65 M;  4LF4 M;  1D0L A;  2JP7 A;  3ZQJ A;  3HWS A;  4MH0 E;  1MX0 A;  2Y21 A;  4D81 A;  4JI5 M;  5FTK A;  3K8Z A;  1HNW M;  3IEC A;  3K9P A;  1T43 A;  1ZQ9 A;  5EXS A;  1KFV A;  2CRU A;  4ZPX A;  2ZTD A;  1KYI A;  5ITT A;  4NC6 A;  1TDZ A;  4PD2 A;  3DZD A;  1F4I A;  4XK8 F;  3KSJ A;  3K2L A;  1JR3 D;  3TE6 A;  1AUA A;  3SYL A;  2F5S A;  3NWL A;  2FS1 A;  5IWA M;  1ZAE A;  4IBC A;  5ITX E;  3Q8X A;  4PT5 A;  3VDP A;  2LVP C;  4NOO B;  3GPX A;  4RNA A;  4JI0 M;  4A3V B;  3F92 A;  4WW0 A;  1EFU B;  2C9O A;  4CGY B;  3GLI A;  3U6C A;  4LF5 M;  1G4A E;  3WHK A;  5EJC A;  3I04 M;  3GLF B;  1TTE A;  4D80 A;  2Z3X A;  4XBO A;  4I81 A;  1PGY A;  4I4L A;  4LRT A;  1DGB A;  1C1K A;  1VDD A;  2LVQ D;  2JZ0 A;  4KHP M;  1IN6 A;  4ANR A;  3SMP A;  5FTL A;  3FYD A;  3VDU A;  4P16 A;  3AOE A;  4GC9 A;  2KHH A;  4NXN M;  1I4W A;  4LJ9 A;  1W5S A;  1HNX M;  3SHF A;  4B7G A;  1MJG M;  1SXJ A;  3BOS A;  4IBG A;  3J80 S;  3W0L B;  3SAS A;  1TDH A;  1IY0 A;  4L16 A;  1E32 A;  4RKU F;  1TR8 A;  1DGG A;  1HQC A;  2L7H A;  4Q7J A;  3SMS A;  4FWH A;  3GLG A;  2L7I A;  2K6B A;  1R2Z A;  4NRW A;  4GMQ A;  3HU3 A;  4L15 A;  3HJQ A;  4LY6 A;  1A5T A;  4LZJ A;  1JR3 E;  3I51 A;  3K1J A;  3EIE A;  1V34 A;  3AOG A;  2C98 A;  3GPU A;  3U6D A;  4GIT A;  2UUB M;  1OTR A;  3RGS A;  2DWM A;  2D7G A;  2YNM D;  3GQ4 A;  3LMM A;  1NNU C;  1NHW C;  1OKS A;  5JI2 E;  3GLG B;  3KFU G;  3M0E A;  2F5O A;  1GAB A;  4LFB M;  1GL7 A;  1DV0 A;  2GNO A;  5FSW A;  1W5T A;  5EP1 A;  4B3T M;  2XSZ A;  4AG6 A;  1ORY B;  2R44 A;  1MU5 A;  3CF6 E;  3HU2 A;  4JI6 M;  3ZC7 B;  2EA0 A;  3E4R A;  4S12 A;  3GQ5 A;  2DAK A;  4IBE A;  4LZZ A;  4LGM A;  3I4Y A;  4HEO A;  3GRV A;  2KNA A;  3E21 A;  4CJ6 A;  3C9P A;  1YE9 A;  4DR7 M;  1TH2 A;  2DEN A;  2NQ8 C;  3E46 A;  2QBY A;  2WSF F;  1IY1 A;  1SG9 A;  2V1U A;  1JQJ C;  2CHV A;  1IXZ A;  2MJ5 B;  2LHC A;  2UUA M;  2EJS A;  4DV7 M;  4LJ4 A;  4NXM M;  2ZAM A;  1PJQ A;  2JY6 B;  2QPA A;  3J27 B;  5JI3 E;  1IN8 A;  3GRR A;  3FTF A;  1VG5 A;  3J81 S;  3HHZ A;  2RGO A;  2F5N A;  5KQD A;  1TF0 B;  1G71 A;  4GKK M;  4M9X A;  3V76 A;  2VDB B;  3FYC A;  5L8R F;  1XMO M;  3MK6 A;  4G4Q A;  1D2N A;  4MGY E;  2EKF A;  1XC8 A;  2DXI A;  2OOB A;  2R62 A;  1WR1 B;  1XXH E;  3SAV A;  3TPZ A;  4DR1 M;  4NSO B;  3B9P A;  3IG5 A;  3B7Z A;  1L2D A;  2CV2 A;  5E6J A;  3KSX A;  4AW4 A;  4G4R A;  4LF6 M;  4X62 M;  1OJL A;  1IFY A;  2QZ4 A;  4DV1 M;  1QQW A;  2OQ4 A;  1GO5 A;  3KOX E;  3CTW B;  3GRY A;  1WGN A;  3GLH E;  1GJS A;  1NNJ A;  2DWL A;  4F2L A;  2C9C A;  1WXQ A;  2QSF X;  2WSC F;  1XNQ M;  1JB0 F;  4DV2 M;  5LMU M;  2UU9 M;  3VKH A;  3FUT A;  4LJ7 A;  3FUW A;  2EKK A;  4OVZ A;  4X64 M;  4JI2 M;  2DWZ B;  1XWI A;  2KZU A;  4YY3 M;  4YHH M;  1YLA A;  3BBZ A;  5E26 A;  4AG5 A;  2VII A;  3VK8 A;  1IQP A;  4QHS A;  1ZV1 A;  4TUW A;  5FTN A;  2XF3 A;  3AJI B;  2V1C A;  1DO0 A;  5FTJ A;  1PJI A;  1OAO C;  1R6B X;  3WHL A;  2FFJ A;  2Z4R A;  1L1T A;  2CFO A;  4LF9 M;  4L6V 6;  3LVW A;  2ZAN A;  3LCU A;  4OVZ B;  1VQ1 A;  2J7O A;  2L09 A;  1QYR A;  4EIW A;  1GJT A;  1IN4 A;  1DGH A;  3KP0 E;  3PNV A;  4G6Z A;  4FVM A;  1CUK A;  2UXD M;  4QOS A;  2F5P A;  4QHT A;  5FTM A;  2QP9 X;  4DV5 M;  1AIP C;  2N35 A;  2X49 A;  1XHB A;  4IBB A;  2FE8 A;  1QAO A;  3RE8 A;  4JYA M;  3L27 A;  1ZMV A;  3MMP A;  4FCW A;  4LFC M;  3KS4 A;  1K82 A;  3DA1 A;  4IBI A;  2I7P A;  1OIZ A;  1OFH A;  1IM2 A;  1TH4 A;  2DZO B;  4FWD A;  2H5X A;  2LNH C;  1DGH B;  2K9D A;  3HJ8 A;  1IY2 A;  4G4O A;  1E9S A;  1QAQ A;  5KQ8 A;  1MN3 A;  2V6Z M;  3HHY A;  3HGI A;  2RRU A;  3M6A A;  2R18 A;  3CGW A;  3QYB A;  3AOE C;  1SXJ D;  2JA2 A;  4JI3 M;  3TWL A;  3U6P A;  2DNA A;  3GLI B;  3FTC A;  5H37 D;  2JZ1 A;  1V92 A;  4MB7 A;  1OAI A;  2ZM6 M;  2O01 F;  2UUC M;  1TGU A;  4RF1 A;  1EE8 A;  4AKG A;  1T6O A;  3T6P A;  3A98 B;  3GQ3 A;  2KW0 A;  1UFZ A;  2L4E A;  5ITQ A;  3H4M A;  4DUZ M;  3GLF E;  2XEP A;  4REZ A;  4DR5 M;  4AZF A;  2QCU A;  3VKG A;  2HHH M;  2LTU A;  2ERC A;  4B08 A;  1J09 A;  2O25 A;  3JR5 A;  2VQE M;  1SXJ B;  1Q39 A;  1QUT A;  1WJ7 A;  3UZU A;  5A2Q S;  1L1Z A;  4B3S M;  2BNK A;  4GH9 A;  2LBC A;  4R7G A;  1Q02 A;  3FUU A;  3HU1 A;  2F5Q A;  1YUB A;  4LJ8 A;  2YR0 A;  1D0M A;  2W82 A;  4B3M M;  4ITQ A;  1QVR A;  1NO1 A;  2H1R A;  4LRS A;  4GHA A;  4LJ6 A;  3KW6 A;  2XSZ D;  2KRK A;  4CHT B;  2CHQ A;  2LXE A;  3U6L A;  3GRU A;  1NY5 A;  2Z4S A;  1NJG A;  1T3T A;  1D0K A;  2RGH A;  4QNR A;  5EXT A;  1V33 A;  2QQ8 A;  4KO8 A;  3OTO M;  3J7B A;  3U6Q A;  3HHX A;  1I94 M;  2DVW B;  1OFI A;  4DBG B;  3E9S A;  4W5W A;  2DAE A;  2HAK A;  3AL0 C;  1PJS A;  4B7F A;  4K0K M;  3FUX A;  3MHV C;  5EP4 A;  3GPP A;  2DHY A;  3R9X B;  1HT1 E;  2HCB A;  3HKP A;  2CWB A;  4FD2 A;  1IBL M;  4UN2 B;  4MGK E;  5EXX A;  3GLG E;  3KOY E;  2ZBK B;  4DR2 M;  2XZU A;  1E94 E;  3AV0 A;  1XXH A;  4GEW A;  3MJ5 A;  1GL6 A;  3QAU A;  5C1B A;  2R0I A;  4HLQ A;  2Q2E B;  1QZE A;  3L28 A;  3KOZ E;  3UMM A;  1QAN A;  4I5S A;  3T15 A;  2QHO B;  4PDI A;  1OIP A;  7CAT A;  4KT0 F;  1RU3 A;  1Z5B A;  3A46 A;  4LF8 M;  2QBY B;  2L6O A;  3AFH A;  4M0D A;  1Z5A A;  3THG A;  3SC3 A;  3FD9 A;  4GC5 A;  4NL4 H;  2BJV A;  3U61 A;  3U6S A;  4IJE A;  4G4N A;  1Z59 A;  3K92 A;  4M9Z A;  3I4V A;  1L2B A;  5EQT A;  2JNH A;  2HL7 A;  1K3W A;  2KRU A;  3CF0 A;  4LG2 A;  2YFQ A;  1FNN A;  1ZMU A;  2KDL A;  4JXJ A;  1K3X A;  3KOW E;  3IG8 A;  2WSE F;  4JN6 A;  1XB2 B;  4Y28 F;  4F1I A;  3D8B A;  3AKZ A;  3C3E A;  4DUY M;  3SAU A;  3KS8 A;  2VQF M;  2EUC A;  4OU7 A;  2UXC M;  1NJF A;  4KOD A;  2OO9 A;  3QWL A;  2G5G X;  1IN5 A;  3U61 B;  2Y0T A;  2LHG A;  1LTM A;  3H4J A;  2KEB A;  1TH3 A;  3PXG A;  4BBA A;  3L2A A;  2KNV A;  1Q3B A;  3TL4 X;  4DV4 M;  4L8R C;  2CV1 A;  4MGZ E;  1NVM A;  3T38 A;  4DR3 M;  2DAI A;  3NBX X;  3D8L A;  3J7A S;  1WHC A;  1R5L A;  2K0B X;  3FUV A;  1QDR A;  1VDL A;  1DO2 A;  2CHG A;  4IBK A;  3L26 A;  4BB9 A;  2RKO A;  1HT2 E;  2Y20 A;  1IN7 A;  3KDS E;  2R4E A;  2XH9 A;  2ZTC A;  5ITX A;  4XGI A;  3SAT A;  5C18 A;  5FLX S;  3TQS A;  1IBM M;  1WGL A;  4WUR A;  3HZJ A;  4M9S A;  4II7 A;  2J7N A;  3ILK A;  3FKE A;  3LVV A;  3SHG B;  2QEN A;  2CUZ A;  2LVA A;  4IIW A;  4MGI E;  4OW0 A;  2EO2 A;  1C7Y A;  4GHL A;  3FTE A;  1X37 A;  4LFA M;  2HKJ A;  5BR8 M;  3B7N A;  3PNY A;  3TWK A;  1NY6 A;  4IJF A;  1N78 A;  1VEJ A;  2CV0 A;  3UK6 A;  3VLF B;  5ITU A;  3GO8 A;  3RGP A;  4QOZ C;  1GKI A;  2G3Q A;  4JI1 M;  4D82 A;  2YQZ A;  1QUS A;  4DV0 M;  3FRI A;  1N36 M;  3W68 A;  2KA6 B;  1HJP A;  2XZF A;  1L2C A;  3GLF A;  3SAW A;  1PJJ A;  1Y8G A;  4KLN A;  2M60 A;  3CF2 A;  2LH0 A;  1JR3 A;  4MGH A;  8CAT A;  3UJN A;  1YSY A;  1G3I A;  1SXJ C;  2BWB A;  3QYE A;  3VFD A;  4B7H A;  1HQY E;  5KPR A;  1KSF X;  2L4F A;  4I8O A;  1J7K A;  1WIV A;  1NSF A;  2BJW A;  3DOA A;  2Z7J A;  2XGN A;  3FE3 A;  5KPT A;  4FCV A;  1P3Q Q;  2XLJ A;  1XNR M;  3SFZ A;  2OPF A;  1N77 A;  2B3T A;  4AQY M;  3HJS A;  2R4J A;  3J2P B;  4LCB A;  2HWJ A;  3A45 A;  1Q3C A;  3DFZ A;  3Q8G A;  3ZCB B;  2JY7 A;  1UM8 A;  5LMN M;  3KP1 E;  2R6F A;  4JI7 M;  5DFL A;  5GKN A;  2C99 A;  1S3S A;  3L25 A;  3GLI E;  3W0F A;  2MR9 A;  2CE7 A;  3U6M A;  2F4V M;  3M7G A;  1NV9 A;  4R71 A;  1N34 M;  2MGW A;  2DKL A;  2I7N A;  3UGJ A;  4DR4 M;  2DZN B;  1VEG A;  2OOA A;  2D7H A;  1OQY A;  3FTD A;  3I01 M;  4IBD A;  3SBJ A;  1NV8 A;  1BVS A;  4JI4 M;  2BWE A;  3JR4 A;  2XFT A;  1IXR C;  2JUJ A;  2JWS A;  2J5Y A;  1HR0 M;  1XMQ M;  4QNM A;  1PM5 A;  1SXJ E;  2X4A A;  4FW9 A;  1R2Y A;  4IBF A;  3B7Q A;  2Y0Q A;  2P5T A;  3C58 A;  3R8F A;  2G8L A;  1IXS A;  5IT9 S;  3LQQ A;  4MM3 B;  1LV7 A;  3BXW A;  3B74 A;  2A5Y B;  3PVS A;  4R3D A;  4NRV A;  3SYK A;  2KXE A;  3C3D A;  4AI6 A;  2FH0 A;  4PDG A;  4PCZ A;  1HNZ M;  4G3O A;  1Z5C A;  2C96 A;  2VF8 A;  3HHW A;  1DGF A;  4DV3 M;  2QNJ A;  1R4G A;  2AHM A;  4LJA A;  4BLC A;  2R46 A;  3GLH A;  3LCV B;  2CP8 A;  5ITR A;  1G59 A;  3VK7 A;  2O5R A;  4X66 M;  1IXS B;  3ZH9 B;  3TWM A;  3K9O A;  4L4U A;  4CIZ A;  1XXH B;  1QZM A;  5KO3 A;  3JAM S;  3FRH A;  2K47 A;  1N75 A;  3KVW A;  4M0W A;  4GIP A;  1GVN A;  3GP1 A;  3PFI A;  2JY8 A;  5F3W A;  3U6E A;  1N32 M;  3B89 A;  3L29 A;  4NSR A;  2DI0 A;  4AKH A;  1N33 M;  2D7E A;  3IHP A;  3NBI A;  1Z6T A;  3HY5 A;  4JV5 M;  3GPY A;  2ZAO A;  2LVO C;  5EP3 A;  2KZS A;  3GLH B;  1IBK M;  2DAG A;  3KXE C;  1J5E M;  4GRI A;  2M5Z A;  3T1Y M;  1FJG M;  2DZL A;  2UXB M;  2JY5 A;  4CIS A;  3A42 A;  4LGY A;  4LF7 M;  2APL A;  2FNA A;  2CEA A;  4IBJ A;  1H6U A;  3SAR A;  1QAM A;  2Z8Y M;  4LJ5 A;  4FWG A;  5DYI A;  2GQF A;  2DWN A;  1ZMW A;  3LW5 F;  3W67 A;  2MH8 A;  1VEK A;  2DAM A;  3U60 A;  3U6O A;  2KNZ A;  2VF7 A;  1EIJ A;  4AKI A;  1E9R A;  1R7R A;  5BPV A;  2L2D A;  2MRO B;  5KPZ A;  2LWX A;  2XFS A;  5DNY A;  3U5Z A;  4DR6 M;  5EXP A;  2E5L M;  2C5R A;  4P17 A;  1QDT A;  1PRB A; 
#chains in the Genus database with same CATH homology
 4RF0 A;  3LQR A;  1GLN A;  4HL4 A;  3RFW A;  4GKJ M;  2X8A A;  4DV6 M;  1G41 A;  4FCT A;  2R65 A;  1L8Q A;  3EIH A;  5EP2 A;  5IRE B;  2DHR A;  5IZ7 D;  3U60 B;  2FOI C;  4L78 A;  1G8P A;  4B3R M;  1NHG C;  4OX9 M;  2R45 A;  5ITY A;  4Z8X A;  3U5Z B;  5DYG A;  4Z6Y A;  3T1H M;  4JI8 M;  4X65 M;  4LF4 M;  3HWS A;  4MH0 E;  1MX0 A;  2Y21 A;  4D81 A;  4JI5 M;  5FTK A;  3K8Z A;  1HNW M;  1ZQ9 A;  5EXS A;  1KFV A;  4ZPX A;  1KYI A;  5ITT A;  1TDZ A;  4PD2 A;  3DZD A;  3KSJ A;  3K2L A;  1JR3 D;  3TE6 A;  3SYL A;  2F5S A;  3NWL A;  5IWA M;  1ZAE A;  4IBC A;  5ITX E;  3Q8X A;  4PT5 A;  3VDP A;  4NOO B;  3GPX A;  4RNA A;  4JI0 M;  4A3V B;  4WW0 A;  4CGY B;  3GLI A;  2C9O A;  3U6C A;  4LF5 M;  1G4A E;  3WHK A;  5EJC A;  3GLF B;  4D80 A;  2Z3X A;  4XBO A;  4I81 A;  4I4L A;  4LRT A;  1DGB A;  1C1K A;  1VDD A;  4KHP M;  1IN6 A;  3SMP A;  5FTL A;  3FYD A;  3VDU A;  4P16 A;  3AOE A;  4GC9 A;  4NXN M;  1I4W A;  4LJ9 A;  1W5S A;  1HNX M;  3SHF A;  4B7G A;  1SXJ A;  3W0L B;  3BOS A;  4IBG A;  3J80 S;  3SAS A;  1TDH A;  1IY0 A;  4L16 A;  1E32 A;  2L7H A;  1DGG A;  1HQC A;  3SMS A;  1R2Z A;  3GLG A;  4FWH A;  2L7I A;  4NRW A;  4GMQ A;  3HU3 A;  4L15 A;  3HJQ A;  4LY6 A;  4LZJ A;  3I51 A;  3K1J A;  3EIE A;  3AOG A;  2UUB M;  2C98 A;  3GPU A;  3U6D A;  4GIT A;  2DWM A;  3RGS A;  2D7G A;  2YNM D;  3GQ4 A;  3LMM A;  1NNU C;  1NHW C;  5JI2 E;  3GLG B;  3KFU G;  3M0E A;  2F5O A;  4LFB M;  1GL7 A;  4B3T M;  5FSW A;  1W5T A;  5EP1 A;  2XSZ A;  4AG6 A;  1ORY B;  3CF6 E;  1MU5 A;  3HU2 A;  4JI6 M;  3ZC7 B;  2EA0 A;  3E4R A;  4S12 A;  3GQ5 A;  4IBE A;  4LZZ A;  4LGM A;  3I4Y A;  3GRV A;  1YE9 A;  4DR7 M;  1TH2 A;  2NQ8 C;  2QBY A;  1IY1 A;  2V1U A;  1JQJ C;  2CHV A;  1IXZ A;  2UUA M;  4DV7 M;  4LJ4 A;  4NXM M;  2ZAM A;  2QPA A;  3J27 B;  5JI3 E;  1IN8 A;  3GRR A;  3FTF A;  3J81 S;  3HHZ A;  2RGO A;  2F5N A;  5KQD A;  4GKK M;  4M9X A;  3FYC A;  1XMO M;  3MK6 A;  4G4Q A;  1D2N A;  4MGY E;  1XC8 A;  2DXI A;  2R62 A;  3SAV A;  3TPZ A;  4DR1 M;  4NSO B;  3B9P A;  3IG5 A;  1L2D A;  2CV2 A;  5E6J A;  3KSX A;  4AW4 A;  4G4R A;  4LF6 M;  4X62 M;  1OJL A;  2QZ4 A;  4DV1 M;  1QQW A;  2OQ4 A;  3KOX E;  3CTW B;  3GRY A;  1NNJ A;  2DWL A;  2C9C A;  1WXQ A;  1XNQ M;  3VKH A;  4DV2 M;  5LMU M;  2UU9 M;  3FUT A;  4LJ7 A;  3FUW A;  4OVZ A;  4X64 M;  4JI2 M;  2DWZ B;  1XWI A;  2KZU A;  4YY3 M;  4YHH M;  5E26 A;  4AG5 A;  2VII A;  3VK8 A;  1IQP A;  4QHS A;  4TUW A;  5FTN A;  2XF3 A;  3AJI B;  2V1C A;  1DO0 A;  5FTJ A;  1PJI A;  1R6B X;  3WHL A;  2FFJ A;  2Z4R A;  1L1T A;  2CFO A;  4LF9 M;  4EIW A;  3LVW A;  2ZAN A;  4OVZ B;  2J7O A;  2L09 A;  1QYR A;  1IN4 A;  1DGH A;  3KP0 E;  3PNV A;  4G6Z A;  4FVM A;  2UXD M;  4QOS A;  2F5P A;  4QHT A;  5FTM A;  2QP9 X;  4DV5 M;  2X49 A;  1XHB A;  4IBB A;  2FE8 A;  1QAO A;  3RE8 A;  3L27 A;  4FCW A;  4LFC M;  3KS4 A;  1K82 A;  3DA1 A;  4IBI A;  2I7P A;  1OFH A;  1IM2 A;  1TH4 A;  2DZO B;  4FWD A;  2LNH C;  1DGH B;  3HJ8 A;  1IY2 A;  4G4O A;  1E9S A;  1QAQ A;  5KQ8 A;  2V6Z M;  3HHY A;  3HGI A;  3M6A A;  2R18 A;  3AOE C;  1SXJ D;  2JA2 A;  4JI3 M;  3TWL A;  3U6P A;  3GLI B;  3FTC A;  5H37 D;  4MB7 A;  2ZM6 M;  2UUC M;  1TGU A;  4RF1 A;  4AKG A;  3A98 B;  3GQ3 A;  2KW0 A;  5ITQ A;  4DUZ M;  4DR5 M;  3H4M A;  2XEP A;  4REZ A;  3VKG A;  4AZF A;  2QCU A;  2HHH M;  2ERC A;  4B08 A;  1J09 A;  3JR5 A;  2VQE M;  1SXJ B;  1Q39 A;  5A2Q S;  3UZU A;  1L1Z A;  4B3S M;  2BNK A;  4GH9 A;  4R7G A;  3FUU A;  3HU1 A;  2F5Q A;  1YUB A;  4LJ8 A;  2YR0 A;  2W82 A;  4B3M M;  4ITQ A;  1QVR A;  2H1R A;  4LRS A;  4GHA A;  4LJ6 A;  3KW6 A;  2XSZ D;  2KRK A;  4CHT B;  2CHQ A;  2LXE A;  3U6L A;  3GRU A;  1NY5 A;  2Z4S A;  1NJG A;  1T3T A;  4QNR A;  2RGH A;  4DR3 M;  5EXT A;  4KO8 A;  3OTO M;  3U6Q A;  1I94 M;  3J7B A;  3HHX A;  2DVW B;  1OFI A;  3E9S A;  4W5W A;  3AL0 C;  4B7F A;  4K0K M;  3FUX A;  3MHV C;  5EP4 A;  3GPP A;  3R9X B;  1HT1 E;  2HCB A;  3HKP A;  4FD2 A;  1IBL M;  4MGK E;  5EXX A;  3KOY E;  2ZBK B;  4DR2 M;  2XZU A;  1E94 E;  3AV0 A;  1XXH A;  3MJ5 A;  1GL6 A;  3QAU A;  5C1B A;  4HLQ A;  2Q2E B;  3L28 A;  3KOZ E;  3UMM A;  1QAN A;  4I5S A;  3T15 A;  4PDI A;  7CAT A;  3A46 A;  1Z5B A;  4LF8 M;  2QBY B;  2L6O A;  3AFH A;  4M0D A;  1Z5A A;  3THG A;  3SC3 A;  3FD9 A;  4GC5 A;  4NL4 H;  2BJV A;  3U61 A;  3U6S A;  4IJE A;  4G4N A;  1Z59 A;  3K92 A;  4M9Z A;  3I4V A;  1L2B A;  5EQT A;  2HL7 A;  1K3W A;  2KRU A;  3CF0 A;  4LG2 A;  2YFQ A;  1FNN A;  4JXJ A;  1K3X A;  3KOW E;  3IG8 A;  4JN6 A;  3D8B A;  3AKZ A;  4DUY M;  3SAU A;  3KS8 A;  2VQF M;  2EUC A;  4OU7 A;  2UXC M;  1NJF A;  4KOD A;  3QWL A;  2G5G X;  1IN5 A;  3U61 B;  2Y0T A;  3PXG A;  2KEB A;  1TH3 A;  4BBA A;  3L2A A;  1Q3B A;  3TL4 X;  4DV4 M;  4L8R C;  2CV1 A;  4MGZ E;  1NVM A;  3T38 A;  3D8L A;  3J7A S;  3FUV A;  1DO2 A;  2CHG A;  4IBK A;  3L26 A;  4BB9 A;  2RKO A;  1HT2 E;  2Y20 A;  1IN7 A;  3KDS E;  2R4E A;  2XH9 A;  5ITX A;  4XGI A;  3SAT A;  5C18 A;  5FLX S;  3TQS A;  1IBM M;  4WUR A;  4M9S A;  4II7 A;  2J7N A;  3ILK A;  3FKE A;  3LVV A;  3SHG B;  2QEN A;  2CUZ A;  4IIW A;  4MGI E;  4OW0 A;  4GHL A;  2EO2 A;  4JYA M;  3FTE A;  1X37 A;  4LFA M;  2HKJ A;  5BR8 M;  3PNY A;  3TWK A;  1NY6 A;  4IJF A;  1N78 A;  2CV0 A;  3UK6 A;  3VLF B;  5ITU A;  3GO8 A;  3RGP A;  4QOZ C;  1GKI A;  4JI1 M;  4D82 A;  2YQZ A;  4DV0 M;  1N36 M;  2KA6 B;  2XZF A;  1L2C A;  3GLF A;  3SAW A;  1PJJ A;  4KLN A;  2M60 A;  3CF2 A;  2LH0 A;  1JR3 A;  4MGH A;  8CAT A;  3UJN A;  1YSY A;  1G3I A;  1SXJ C;  3VFD A;  4B7H A;  1HQY E;  5KPR A;  1KSF X;  4I8O A;  1J7K A;  3DOA A;  1NSF A;  2BJW A;  2Z7J A;  2XGN A;  5KPT A;  4FCV A;  2XLJ A;  1XNR M;  3SFZ A;  2OPF A;  1N77 A;  4AQY M;  3HJS A;  2R4J A;  3J2P B;  4LCB A;  3A45 A;  1Q3C A;  3DFZ A;  3ZCB B;  1UM8 A;  5LMN M;  3KP1 E;  4JI7 M;  5GKN A;  2C99 A;  1S3S A;  3L25 A;  3W0F A;  3U6M A;  2CE7 A;  2F4V M;  3M7G A;  1N34 M;  2I7N A;  3UGJ A;  4DR4 M;  2DZN B;  2D7H A;  3FTD A;  3SBJ A;  4IBD A;  4JI4 M;  3JR4 A;  2XFT A;  1IXR C;  1HR0 M;  1XMQ M;  4QNM A;  1PM5 A;  1SXJ E;  2X4A A;  4FW9 A;  1R2Y A;  4IBF A;  2Y0Q A;  2P5T A;  3C58 A;  3R8F A;  2G8L A;  5IT9 S;  3LQQ A;  4MM3 B;  1LV7 A;  2A5Y B;  3PVS A;  4R3D A;  4NRV A;  3SYK A;  2KXE A;  4AI6 A;  4PDG A;  4PCZ A;  1HNZ M;  1Z5C A;  2C96 A;  3HHW A;  1DGF A;  4DV3 M;  2AHM A;  4LJA A;  4BLC A;  2R46 A;  3GLH A;  5ITR A;  1G59 A;  3VK7 A;  2O5R A;  4X66 M;  1IXS B;  3ZH9 B;  3TWM A;  4L4U A;  1XXH B;  1QZM A;  5KO3 A;  3JAM S;  3KVW A;  2K47 A;  1N75 A;  4M0W A;  3GP1 A;  4GIP A;  1GVN A;  3PFI A;  5F3W A;  3U6E A;  1N32 M;  3L29 A;  4NSR A;  4AKH A;  1N33 M;  2D7E A;  3NBI A;  1Z6T A;  4JV5 M;  3GPY A;  2ZAO A;  5EP3 A;  2KZS A;  3GLH B;  1IBK M;  3KXE C;  1J5E M;  4GRI A;  2M5Z A;  3T1Y M;  1FJG M;  2UXB M;  4CIS A;  3A42 A;  4LGY A;  4LF7 M;  2FNA A;  2CEA A;  4IBJ A;  1H6U A;  3SAR A;  1QAM A;  4LJ5 A;  4FWG A;  5DYI A;  2DWN A;  3U60 A;  3U6O A;  4AKI A;  1E9R A;  1R7R A;  5BPV A;  5KPZ A;  5DNY A;  3U5Z A;  2LWX A;  2XFS A;  4DR6 M;  5EXP A;  2E5L M;  2C5R A;  1EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...