2C5RA

The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
b'NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EARLY PROTEIN P16.7
molecule tags Dna-binding protein/dna
source organism Bacillus phage phi29
publication title Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
pubmed doi rcsb
total genus 21
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2c5rA00
1ZAEA 2C5RA 2BNKA
chains in the Genus database with same CATH superfamily
3UMMA 1GVNA 2DAKA 2CEAA 4I5SA 4ZPXA 1PJIA 2R4EA 3KS8A 1T6OA 1YSYA 4DV1M 4GKKM 1SG9A 1Q39A 5ITXA 2LVQD 3W0FA 1TH3A 2MR9A 3KW6A 3UK6A 4G4QA 1N78A 3B9PA 3U5ZA 3GLIB 3KOYE 3GRUA 3U6PA 1QAOA 2LHCA 4XGIA 1Q02A 3V76A 1R6BX 1OJLA 2LVOC 2G3QA 3HGIA 2C9OA 1SXJD 4DUYM 2O5RA 3VDPA 4DV3M 3W67A 4LF7M 3ZQJA 5FTNA 2DAGA 2XSZA 1OAIA 2KZSA 1IN4A 3SMSA 3CF6E 5EXPA 2NQ8C 3Q8XA 2ZTCA 3DFZA 3I4YA 4NRVA 4X65M 3CTWB 4M0WA 3GLFA 1H6UA 1QAMA 3HHXA 3LQQA 1KYIA 3H4MA 4B7FA 2EA0A 1WGLA 2DAEA 2LNHC 4Y28F 4DV4M 5KQ8A 4LF6M 2HL7A 2XZFA 1GABA 3L27A 2JXNA 3GO8A 4DV5M 1WR1B 2O01F 3SARA 4NC6A 4S12A 2BJVA 4FCWA 1L8QA 4LCBA 4PCZA 1NY6A 3GLGE 4NRWA 3GQ3A 1XMQM 4K0KM 1I94M 1Z59A 1HQYE 2YQZA 2F5QA 2UUAM 4LZZA 4Z6YA 4A3VB 1L2CA 3K9PA 1WGNA 3GLIA 8CATA 4MGIE 1R2YA 4LFCM 1HNWM 4R71A 5KPTA 1XMOM 4LJ4A 5FTLA 1TDHA 1E94E 4XBOA 4FWHA 1IN5A 2ZTDA 2DWMA 2I7PA 3M6AA 2R44A 5FSWA 3SAVA 1W5TA 2LTUA 1WHCA 2VQEM 3L26A 1GJTA 2O25A 4HL4A 2V1CA 4LJ8A 2JNHA 5FTMA 4I4LA 3RGPA 2DENA 2LH0A 1T43A 2EUCA 2R45A 3TL4X 4MH0E 5BPVA 1MU5A 2ZBKB 1W5SA 2L7IA 2VDBB 2JY6B 3DA1A 1A5TA 2BJWA 3J7BA 3TE6A 2XFSA 3FUUA 1MX0A 1KSFX 1G4AE 1Z5BA 1DGGA 2LHGA 3U6OA 1FJGM 1IFYA 1XC8A 4Z8XA 3JAMS 1Z6TA 1X37A 1NVMA 3FTCA 4CJ6A 3AL0C 1JB0F 1JR3E 1ZMWA 2YR0A 5EP1A 4IBFA 4UN2B 1IXSB 2KNZA 3A42A 3SYKA 3GLGB 3B7NA 3IECA 1LV7A 2C99A 3F92A 3AV0A 1VEKA 2QP9X 2Y0QA 3L25A 2UUCM 2OOAA 3DZDA 5ITTA 2A5YB 2LVAA 2MGWA 3KSXA 5KQDA 2QCUA 2W82A 4DV0M 2OPFA 5LMNM 3HU2A 2K6BA 2K9DA 3U6DA 4QHSA 4MGKE 1PRBA 4KT0F 2JUJA 4BB9A 3FD9A 3J27B 1FNNA 2DWZB 2Z4SA 3FUWA 2R6FA 4JXJA 2B3TA 4G3OA 4NOOB 2L4FA 2H5XA 4CHTB 3K1JA 1IY1A 1IXZA 2LBCA 2DZLA 2HKJA 2DHRA 3GPPA 2JP7A 1GJSA 1XWIA 4IBDA 4LJ7A 4IBBA 3HZJA 2L6OA 2CWBA 4FVMA 2KNAA 4LRSA 1N36M 2MH8A 4LJ6A 2EKFA 1VG5A 1XB2B 3C3EA 1ORYB 2CP8A 3CF2A 4REZA 2G5GX 1QDTA 4D80A 3BXWA 3WHKA 1D0KA 4AW4A 1QVRA 3VLFB 1ZMVA 1N75A 3FUTA 5ITYA 1Y8GA 4QNMA 3HHZA 2ZAMA 1L1ZA 2QENA 1Q3BA 4AKGA 1VDLA 5DNYA 1DGHB 2EJSA 2V6ZM 1AUAA 1GLNA 1RU3A 3NWLA 1VEJA 4WP2A 5ITQA 3U5ZB 1HT1E 1YUBA 1QQWA 5IT9S 3PVSA 4IBIA 4IBGA 4F2LA 4JI5M 1Q3CA 4IBKA 1PJJA 3FTEA 1QAQA 2Z4RA 3L2AA 4DR3M 1IXRC 4DR4M 2F5PA 3KFUG 3E21A 4DV7M 3SYLA 2P5TA 2C5RA 2G8LA 4KODA 3RGSA 2KA6B 2Z7JA 3KDSE 2JWSA 3GLHA 3GRVA 3LVWA 1QYRA 4MGZE 2V1UA 1IBKM 3VKHA 4L8RC 4KLNA 3KVWA 1OKSA 3HHYA 4AI6A 3K92A 4LRTA 3L28A 2CUZA 4KHPM 2RGOA 3UZUA 2Y0TA 4G4RA 1OIZA 2VIIA 2DAIA 4FW9A 4NSRA 4EIWA 3I01M 3FUXA 2DHYA 1G71A 2EKKA 1EIJA 2QPAA 1KFVA 1WJ7A 2KZUA 4HLQA 4IIWA 3VK8A 1IBLM 2XH9A 2BNKA 3J80S 1ZQ9A 3SAWA 2QBYA 2VQFM 4JYAM 3K9OA 4NXNM 3TWMA 3T6PA 4QOZC 2F5OA 1XXHA 1NNJA 2YFQA 2R65A 4LY6A 4M9SA 4AG5A 3VK7A 1IN6A 2MROB 3VDUA 1GL6A 3U61B 3TQSA 3AOEA 1C1KA 5IWAM 1L1TA 3GLIE 4TUWA 2GQFA 2XF3A 3GPXA 4OVZB 4LGYA 1BVSA 2DKLA 3T1HM 5FTJA 2OQ4A 3BOSA 3KP1E 2WSCF 1L2DA 1HNZM 5EXXA 2LWXA 4BBAA 2R0IA 4X66M 3MHVC 4LJ5A 2KDLA 3HY5A 3GLFB 3R8FA 2JY5A 1SXJA 4GRIA 4NL4H 1MN3A 5EJCA 5BR8M 4JI2M 4GKJM 4DR2M 1V34A 2FH0A 1NV9A 2DWLA 2DAMA 1R7RA 3D8LA 4FCTA 4CGYB 1V92A 4GIPA 4RNAA 3GLFE 1UM8A 1PGYA 3PFIA 3SMPA 1IY2A 4DV2M 4B3MM 2F4VM 2KW0A 1G59A 4PDGA 4LF8M 2M60A 1Z5CA 1OFIA 2CV0A 1PJQA 4R3DA 3LVVA 4X64M 4JI8M 1IBMM 2VF8A 5EQTA 4JI1M 1EFUB 3AKZA 4LGMA 1PJTA 4BLCA 1K3XA 3A45A 5DYGA 3I04M 2ZM6M 1DO0A 1TR8A 4JI3M 2K47A 4LF9M 5EXSA 3HWSA 1HT2E 2WSEF 4OW0A 2JY8A 1N77A 1TGUA 3C58A 3U6LA 1R2ZA 3E46A 1TTEA 1XXHB 3HJ8A 1OFHA 2XGNA 3U6CA 1DGFA 2CE7A 2XSZD 4L78A 1GKIA 4W5WA 4GC5A 4LF4M 3RFWA 2MJ5B 1T3TA 2KRUA 2F5NA 3U61A 2CFOA 1TH4A 1DGBA 1L2BA 5F3WA 2JZ0A 3GRRA 4DV6M 3T38A 1NV8A 4NSOB 2HAKA 4ITQA 2R4JA 4L6V6 1QUTA 3FKEA 3KOXE 5E26A 1D2NA 2I7NA 2F5SA 3MK6A 4F1IA 5C18A 2E5LM 4GEWA 4ANRA 4I81A 3ZC7B 3SC3A 2FOIC 1F4IA 2KHHA 3I51A 3GQ4A 3GLGA 2N35A 2J5YA 4M9ZA 3VKGA 4FWGA 3SATA 2XLJA 4CISA 1IN8A 4LF5M 3MJ5A 4GHLA 4QOSA 2DWNA 3ZH9B 2OO9A 2FNAA 4B7HA 2UUBM 3KXEC 3J81S 2FFJA 4NXMM 3FE3A 5KPZA 1NSFA 4DR1M 1LTMA 1R5LA 1HQCA 2R46A 3SBJA 1NJGA 3FTFA 3W0LB 2CHVA 3LCVB 2DNAA 1VEGA 3GLHB 1GL7A 2D7HA 3QWLA 3GPUA 2R62A 2LXEA 2C96A 3E4RA 1UFZA 2RGHA 4XK8F 3B74A 1R4GA 3GQ5A 3GPYA 4LJAA 1I4WA 4L15A 3TWLA 4GH9A 2QNJA 4DR6M 1NNUC 5IZ7D 3CGWA 3GLHE 2DI0A 3LW5F 4AKIA 4AZFA 4GMQA 3U60A 2ZAOA 5EXTA 4G4NA 3U6QA 4DR5M 2XFTA 4OX9M 4R7GA 5EP4A 2C9CA 3AOEC 3K2LA 1E32A 1J5EM 1EE8A 4IJFA 2KRKA 4JN6A 2X4AA 4GHAA 2XEPA 4WW0A 4B7GA 2K0BX 3IG5A 5LMUM 3LCUA 3LMMA 2XZUA 1IQPA 4PD2A 2L4EA 5KO3A 1SXJC 2JY7A 1HR0M 1NHWC 2OOBA 3Q8GA 3T15A 1G41A 4OVZA 1QUSA 2KXEA 4JI4M 3QYEA 3JR4A 3HU3A 1ZV1A 3M0EA 4L4UA 4B3RM 2DVWB 3B7QA 4RKUF 3SHGB 3TWKA 4M0DA 2DXIA 2L2DA 3B7ZA 1JQJC 1OQYA 4IJEA 2JA2A 3M7GA 1D0LA 1D0MA 5JI2E 4LJ9A 3FRIA 5E6JA 3W68A 1NJFA 1NY5A 2QBYB 3B89A 4LZJA 3IHPA 1OTRA 5IREB 3RE8A 3HU1A 4AQYM 1XXHE 2D7EA 3ILKA 2QQ8A 3J7AS 4JI0M 1OAOC 4B08A 4YY3M 1CUKA 7CATA 5DYIA 5ITXE 3MMPA 4X62M 1XNQM 2JZ1A 4GC9A 4OU7A 1IM2A 2ERCA 3OTOM 2L7HA 4WURA 1VDDA 1YLAA 3EIEA 3AFHA 3U6MA 2LVNC 5DFLA 2Y20A 1DV0A 4JV5M 3U6EA 4FWDA 2ZANA 5GKNA 4AKHA 2LVPC 1E9RA 4PT5A 4PDIA 2CV1A 2UXDM 1IXSA 1J09A 5L8RF 3UJNA 2CRUA 2C98A 1K82A 4DR7M 4LFBM 2KEBA 3FUVA 2J7NA 2X49A 1HNXM 1XHBA 5KPRA 4L16A 3FYCA 1GO5A 4QNRA 4P17A 4QHTA 4IBCA 1JR3A 1YE9A 4MGHA 3D8BA 1TF0B 1HJPA 1VQ1A 1N33M 1NO1A 1G8PA 3K8ZA 2Y21A 1TH2A 3KSJA 3JR5A 3AJIB 2UXCM 1XNRM 1QANA 3VFDA 2R18A 5ITRA 1E9SA 1QDRA 2CHGA 4YHHM 2Q2EB 2WSFF 3KS4A 4D82A 5ITUA 2BWBA 4RF1A 3U60B 3EIHA 1N34M 2X8AA 5FTKA 3GP1A 1MJGM 2CV2A 3HHWA 2L09A 1G3IA 1AIPC 2VF7A 2QSFX 1SXJE 3FTDA 2APLA 3J2PB 2AHMA 4LG2A 1DGHA 2EO2A 3AOGA 4HEOA 4I8OA 4GITA 1N32M 1WIVA 4AG6A 2DZNB 2KNVA 4B3TM 2RKOA 2UXBM 1OIPA 4B3SM 4JI6M 3FYDA 3GRYA 2QZ4A 4M9XA 2HCBA 2H1RA 3NBXX 1WXQA 3KOWE 1PM5A 4CIZA 1ZMUA 4IBEA 3QAUA 2UU9M 1QZMA 1JR3D 3HJQA 2Z3XA 3C3DA 4JI7M 3R9XB 4FD2A 2BWEA 3FRHA 2DZOB 4MB7A 5EP3A 1K3WA 2FS1A 3TPZA 1SXJB 3C9PA 4P16A 5JI3E 3SASA 4KO8A 3BBZA 3PNYA 4LFAM 3LQRA 4D81A 3SAUA 1IN7A 3HX3A 2J7OA 3IG8A 1C7YA 1DO2A 2QHOB 4MGYE 5H37D 5C1BA 1IY0A 3UGJA 2RRUA 3L29A 2HWJA 3E9SA 4II7A 4DBGB 3HKPA 3SFZA 1S3SA 1J7KA 1V33A 2M5ZA 5A2QS 4G4OA 3NBIA 3ZCBB 3WHLA 4RF0A 3KOZE 3A46A 3T1YM 1P3QQ 4G6ZA 1PJSA 5EP2A 4DUZM 3KP0E 3PNVA 4IBJA 3A98B 3CF0A 3PXGA 1ZAEA 3U6SA 3SHFA 2WZJA 1QZEA 4MM3B 3THGA 1Z5AA 1TDZA 2Z8YM 2CHQA 4FCVA 2YNMD 2D7GA 3QYBA 2GNOA 4Q7JA 3HJSA 3H4JA 2FE8A 2HHHM 1NHGC 3DOAA 3I4VA 5FLXS
chains in the Genus database with same CATH topology
3UMMA 1GVNA 4I5SA 2CEAA 1PJIA 4ZPXA 2R4EA 3KS8A 1YSYA 4DV1M 4GKKM 1Q39A 5ITXA 3W0FA 1TH3A 3UK6A 3KW6A 4G4QA 1N78A 3B9PA 3U5ZA 3GLIB 3KOYE 3GRUA 3U6PA 1QAOA 4XGIA 1R6BX 1OJLA 3HGIA 2C9OA 1SXJD 4DUYM 2O5RA 3VDPA 4DV3M 4LF7M 5FTNA 2XSZA 2KZSA 1IN4A 3SMSA 3CF6E 5EXPA 2NQ8C 3Q8XA 3I4YA 3DFZA 4NRVA 4X65M 3CTWB 4M0WA 3GLFA 1H6UA 1QAMA 3HHXA 3LQQA 1KYIA 3H4MA 4B7FA 2EA0A 2LNHC 4DV4M 5KQ8A 4LF6M 2HL7A 2XZFA 3L27A 3GO8A 4DV5M 3SARA 4S12A 2BJVA 4FCWA 1L8QA 4LCBA 4PCZA 1NY6A 4NRWA 3GQ3A 1XMQM 4K0KM 1I94M 1Z59A 1HQYE 2YQZA 2F5QA 2UUAM 4LZZA 4Z6YA 4A3VB 1L2CA 3GLIA 8CATA 4MGIE 1R2YA 4LFCM 1HNWM 5KPTA 1XMOM 4LJ4A 5FTLA 1TDHA 1E94E 4XBOA 4FWHA 1IN5A 2DWMA 3M6AA 2I7PA 5FSWA 3SAVA 1W5TA 2VQEM 3L26A 4HL4A 2V1CA 4LJ8A 5FTMA 4I4LA 3RGPA 2R45A 2LH0A 2EUCA 3TL4X 4MH0E 5BPVA 1MU5A 2ZBKB 1W5SA 2L7IA 3DA1A 3J7BA 2BJWA 3TE6A 2XFSA 3FUUA 1MX0A 1KSFX 1G4AE 1Z5BA 1DGGA 3U6OA 1FJGM 1XC8A 4Z8XA 3JAMS 1Z6TA 1X37A 1NVMA 3FTCA 3AL0C 2YR0A 5EP1A 4IBFA 1IXSB 3A42A 3SYKA 3GLGB 1LV7A 2C99A 3AV0A 2QP9X 2Y0QA 3L25A 2UUCM 3DZDA 5ITTA 2A5YB 3KSXA 5KQDA 2QCUA 2W82A 4DV0M 2OPFA 5LMNM 3HU2A 3U6DA 4QHSA 4MGKE 4BB9A 3FD9A 3J27B 1FNNA 2DWZB 2Z4SA 3FUWA 4JXJA 4NOOB 4CHTB 3K1JA 1IY1A 1IXZA 2HKJA 2DHRA 3GPPA 1XWIA 4IBDA 4LJ7A 4IBBA 2L6OA 4FVMA 4LRSA 1N36M 4LJ6A 1ORYB 3CF2A 4REZA 2G5GX 4D80A 3WHKA 4AW4A 1QVRA 3VLFB 1N75A 3FUTA 5ITYA 3HHZA 4QNMA 2ZAMA 1L1ZA 2QENA 1Q3BA 4AKGA 5DNYA 1DGHB 2V6ZM 1GLNA 5ITQA 3NWLA 3U5ZB 1HT1E 1YUBA 1QQWA 5IT9S 3PVSA 4IBIA 4IBGA 4JI5M 1Q3CA 4IBKA 1PJJA 3FTEA 1QAQA 2Z4RA 3L2AA 4DR3M 1IXRC 4DR4M 2F5PA 3KFUG 4DV7M 3SYLA 2P5TA 2C5RA 2G8LA 4KODA 3RGSA 2KA6B 2Z7JA 3KDSE 3GLHA 3GRVA 3LVWA 1QYRA 4MGZE 2V1UA 1IBKM 3VKHA 4L8RC 4KLNA 3KVWA 3HHYA 4AI6A 3K92A 4LRTA 3L28A 2CUZA 4KHPM 2RGOA 3UZUA 2Y0TA 4G4RA 2VIIA 4FW9A 4NSRA 4EIWA 3FUXA 2QPAA 1KFVA 2KZUA 4HLQA 4IIWA 3VK8A 1IBLM 2XH9A 2BNKA 3J80S 1ZQ9A 3SAWA 2QBYA 2VQFM 4JYAM 4NXNM 3TWMA 4QOZC 2F5OA 1XXHA 1NNJA 2YFQA 2R65A 4LY6A 4M9SA 4AG5A 3VK7A 1IN6A 3VDUA 1GL6A 3U61B 3TQSA 3AOEA 1C1KA 5IWAM 1L1TA 4TUWA 2XF3A 3GPXA 4OVZB 4LGYA 3T1HM 5FTJA 2OQ4A 3BOSA 3KP1E 1HNZM 1L2DA 5EXXA 2LWXA 4BBAA 4X66M 3MHVC 4LJ5A 3GLFB 3R8FA 1SXJA 4GRIA 4NL4H 5EJCA 5BR8M 4JI2M 4GKJM 4DR2M 2DWLA 1R7RA 3D8LA 4FCTA 4CGYB 4GIPA 4RNAA 1UM8A 3PFIA 3SMPA 1IY2A 4DV2M 4B3MM 2F4VM 2KW0A 1G59A 4PDGA 4LF8M 1Z5CA 2M60A 1OFIA 2CV0A 4R3DA 3LVVA 4X64M 4JI8M 1IBMM 5EQTA 4JI1M 3AKZA 4LGMA 4BLCA 1K3XA 3A45A 5DYGA 2ZM6M 1DO0A 4JI3M 2K47A 4LF9M 5EXSA 3HWSA 1HT2E 4OW0A 1N77A 1TGUA 3C58A 3U6LA 1R2ZA 1XXHB 3HJ8A 1OFHA 2XGNA 3U6CA 1DGFA 2CE7A 2XSZD 4L78A 1GKIA 4W5WA 4GC5A 4LF4M 3RFWA 1T3TA 2KRUA 2F5NA 3U61A 2CFOA 1TH4A 1DGBA 1L2BA 5F3WA 4DV6M 3GRRA 3T38A 4NSOB 4ITQA 2R4JA 3FKEA 3KOXE 5E26A 1D2NA 2I7NA 2F5SA 3MK6A 5C18A 2E5LM 4I81A 3ZC7B 3SC3A 2FOIC 3I51A 3GQ4A 3GLGA 3VKGA 4M9ZA 4FWGA 3SATA 2XLJA 4CISA 1IN8A 4LF5M 3MJ5A 4GHLA 4QOSA 2DWNA 3ZH9B 4B7HA 2FNAA 2UUBM 3KXEC 3J81S 2FFJA 4NXMM 5KPZA 1NSFA 4DR1M 2R46A 3FTFA 1HQCA 3SBJA 1NJGA 3W0LB 2CHVA 3GLHB 1GL7A 2D7HA 3QWLA 3GPUA 2R62A 2LXEA 2C96A 3E4RA 2RGHA 3GQ5A 3GPYA 4LJAA 1I4WA 4L15A 3TWLA 4GH9A 4DR6M 1NNUC 5IZ7D 4AKIA 4AZFA 4GMQA 3U60A 2ZAOA 5EXTA 4G4NA 3U6QA 4DR5M 2XFTA 4OX9M 4R7GA 5EP4A 2C9CA 3AOEC 3K2LA 1E32A 1J5EM 1EE8A 4IJFA 2KRKA 4JN6A 2X4AA 4GHAA 2XEPA 4WW0A 4B7GA 3IG5A 5LMUM 3LMMA 2XZUA 1IQPA 4PD2A 5KO3A 1SXJC 1HR0M 1NHWC 3T15A 1G41A 4OVZA 2KXEA 4JI4M 3JR4A 3HU3A 3M0EA 4L4UA 4B3RM 2DVWB 3SHGB 3TWKA 4M0DA 2DXIA 1JQJC 4IJEA 2JA2A 3M7GA 5JI2E 4LJ9A 5E6JA 1NJFA 1NY5A 2QBYB 4LZJA 5IREB 3RE8A 3HU1A 4AQYM 2D7EA 3ILKA 3J7AS 4JI0M 4B08A 4YY3M 7CATA 5DYIA 5ITXE 4X62M 1XNQM 4OU7A 4GC9A 1IM2A 2ERCA 3OTOM 2L7HA 4WURA 1VDDA 3EIEA 3U6MA 3AFHA 2Y20A 4JV5M 3U6EA 4FWDA 2ZANA 5GKNA 4AKHA 1E9RA 4PT5A 4PDIA 2CV1A 2UXDM 1J09A 4DR7M 3UJNA 4LFBM 2C98A 1K82A 2KEBA 3FUVA 2J7NA 2X49A 1HNXM 1XHBA 5KPRA 4L16A 3FYCA 4QNRA 4QHTA 4IBCA 1JR3A 1YE9A 4MGHA 3D8BA 1N33M 1G8PA 3K8ZA 2Y21A 1TH2A 3KSJA 3JR5A 3AJIB 2UXCM 1XNRM 1QANA 3VFDA 2R18A 5ITRA 1E9SA 2CHGA 4YHHM 3KS4A 2Q2EB 4D82A 5ITUA 1N34M 4RF1A 3U60B 3EIHA 2X8AA 5FTKA 3GP1A 2CV2A 3HHWA 2L09A 1G3IA 3FTDA 1SXJE 3J2PB 4LG2A 2AHMA 1DGHA 2EO2A 3AOGA 4I8OA 4GITA 1N32M 4AG6A 2DZNB 4B3TM 2RKOA 2UXBM 4B3SM 4JI6M 3FYDA 3GRYA 2QZ4A 4M9XA 2HCBA 2H1RA 1WXQA 3KOWE 1PM5A 4IBEA 2UU9M 3QAUA 1QZMA 1JR3D 3HJQA 2Z3XA 4JI7M 3R9XB 4FD2A 2DZOB 4MB7A 5EP3A 1K3WA 3TPZA 1SXJB 4P16A 5JI3E 3SASA 4KO8A 3PNYA 4LFAM 4D81A 3LQRA 3SAUA 1IN7A 2J7OA 3IG8A 1DO2A 4MGYE 5H37D 5C1BA 1IY0A 3UGJA 3L29A 3E9SA 4II7A 3HKPA 3SFZA 1S3SA 1J7KA 5A2QS 2M5ZA 4G4OA 3NBIA 3ZCBB 3WHLA 4RF0A 3KOZE 3A46A 3T1YM 4G6ZA 5EP2A 4DUZM 3KP0E 3PNVA 4IBJA 3A98B 3CF0A 3PXGA 1ZAEA 3U6SA 3SHFA 4MM3B 3THGA 1Z5AA 1TDZA 2CHQA 4FCVA 2YNMD 2D7GA 3HJSA 2FE8A 2HHHM 1NHGC 3DOAA 3I4VA 5FLXS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAE A;  2C5R A;  2BNK A; 
#chains in the Genus database with same CATH topology
 3UMM A;  1GVN A;  2DAK A;  2CEA A;  4I5S A;  4ZPX A;  1PJI A;  2R4E A;  3KS8 A;  1T6O A;  1YSY A;  4DV1 M;  4GKK M;  1SG9 A;  1Q39 A;  5ITX A;  2LVQ D;  3W0F A;  1TH3 A;  2MR9 A;  3KW6 A;  3UK6 A;  4G4Q A;  1N78 A;  3B9P A;  3U5Z A;  3GLI B;  3KOY E;  3GRU A;  3U6P A;  1QAO A;  2LHC A;  4XGI A;  1Q02 A;  3V76 A;  1R6B X;  1OJL A;  2LVO C;  2G3Q A;  3HGI A;  2C9O A;  1SXJ D;  4DUY M;  2O5R A;  3VDP A;  4DV3 M;  3W67 A;  4LF7 M;  3ZQJ A;  5FTN A;  2DAG A;  2XSZ A;  1OAI A;  2KZS A;  1IN4 A;  3SMS A;  3CF6 E;  5EXP A;  2NQ8 C;  3Q8X A;  2ZTC A;  3DFZ A;  3I4Y A;  4NRV A;  4X65 M;  3CTW B;  4M0W A;  3GLF A;  1H6U A;  1QAM A;  3HHX A;  3LQQ A;  1KYI A;  3H4M A;  4B7F A;  2EA0 A;  1WGL A;  2DAE A;  2LNH C;  4Y28 F;  4DV4 M;  5KQ8 A;  4LF6 M;  2HL7 A;  2XZF A;  1GAB A;  3L27 A;  2JXN A;  3GO8 A;  4DV5 M;  1WR1 B;  2O01 F;  3SAR A;  4NC6 A;  4S12 A;  2BJV A;  4FCW A;  1L8Q A;  4LCB A;  4PCZ A;  1NY6 A;  3GLG E;  4NRW A;  3GQ3 A;  1XMQ M;  4K0K M;  1I94 M;  1Z59 A;  1HQY E;  2YQZ A;  2F5Q A;  2UUA M;  4LZZ A;  4Z6Y A;  4A3V B;  1L2C A;  3K9P A;  1WGN A;  3GLI A;  8CAT A;  4MGI E;  1R2Y A;  4LFC M;  1HNW M;  4R71 A;  5KPT A;  1XMO M;  4LJ4 A;  5FTL A;  1TDH A;  1E94 E;  4XBO A;  4FWH A;  1IN5 A;  2ZTD A;  2DWM A;  2I7P A;  3M6A A;  2R44 A;  5FSW A;  3SAV A;  1W5T A;  2LTU A;  1WHC A;  2VQE M;  3L26 A;  1GJT A;  2O25 A;  4HL4 A;  2V1C A;  4LJ8 A;  2JNH A;  5FTM A;  4I4L A;  3RGP A;  2DEN A;  2LH0 A;  1T43 A;  2EUC A;  2R45 A;  3TL4 X;  4MH0 E;  5BPV A;  1MU5 A;  2ZBK B;  1W5S A;  2L7I A;  2VDB B;  2JY6 B;  3DA1 A;  1A5T A;  2BJW A;  3J7B A;  3TE6 A;  2XFS A;  3FUU A;  1MX0 A;  1KSF X;  1G4A E;  1Z5B A;  1DGG A;  2LHG A;  3U6O A;  1FJG M;  1IFY A;  1XC8 A;  4Z8X A;  3JAM S;  1Z6T A;  1X37 A;  1NVM A;  3FTC A;  4CJ6 A;  3AL0 C;  1JB0 F;  1JR3 E;  1ZMW A;  2YR0 A;  5EP1 A;  4IBF A;  4UN2 B;  1IXS B;  2KNZ A;  3A42 A;  3SYK A;  3GLG B;  3B7N A;  3IEC A;  1LV7 A;  2C99 A;  3F92 A;  3AV0 A;  1VEK A;  2QP9 X;  2Y0Q A;  3L25 A;  2UUC M;  2OOA A;  3DZD A;  5ITT A;  2A5Y B;  2LVA A;  2MGW A;  3KSX A;  5KQD A;  2QCU A;  2W82 A;  4DV0 M;  2OPF A;  5LMN M;  3HU2 A;  2K6B A;  2K9D A;  3U6D A;  4QHS A;  4MGK E;  1PRB A;  4KT0 F;  2JUJ A;  4BB9 A;  3FD9 A;  3J27 B;  1FNN A;  2DWZ B;  2Z4S A;  3FUW A;  2R6F A;  4JXJ A;  2B3T A;  4G3O A;  4NOO B;  2L4F A;  2H5X A;  4CHT B;  3K1J A;  1IY1 A;  1IXZ A;  2LBC A;  2DZL A;  2HKJ A;  2DHR A;  3GPP A;  2JP7 A;  1GJS A;  1XWI A;  4IBD A;  4LJ7 A;  4IBB A;  3HZJ A;  2L6O A;  2CWB A;  4FVM A;  2KNA A;  4LRS A;  1N36 M;  2MH8 A;  4LJ6 A;  2EKF A;  1VG5 A;  1XB2 B;  3C3E A;  1ORY B;  2CP8 A;  3CF2 A;  4REZ A;  2G5G X;  1QDT A;  4D80 A;  3BXW A;  3WHK A;  1D0K A;  4AW4 A;  1QVR A;  3VLF B;  1ZMV A;  1N75 A;  3FUT A;  5ITY A;  1Y8G A;  4QNM A;  3HHZ A;  2ZAM A;  1L1Z A;  2QEN A;  1Q3B A;  4AKG A;  1VDL A;  5DNY A;  1DGH B;  2EJS A;  2V6Z M;  1AUA A;  1GLN A;  1RU3 A;  3NWL A;  1VEJ A;  4WP2 A;  5ITQ A;  3U5Z B;  1HT1 E;  1YUB A;  1QQW A;  5IT9 S;  3PVS A;  4IBI A;  4IBG A;  4F2L A;  4JI5 M;  1Q3C A;  4IBK A;  1PJJ A;  3FTE A;  1QAQ A;  2Z4R A;  3L2A A;  4DR3 M;  1IXR C;  4DR4 M;  2F5P A;  3KFU G;  3E21 A;  4DV7 M;  3SYL A;  2P5T A;  2C5R A;  2G8L A;  4KOD A;  3RGS A;  2KA6 B;  2Z7J A;  3KDS E;  2JWS A;  3GLH A;  3GRV A;  3LVW A;  1QYR A;  4MGZ E;  2V1U A;  1IBK M;  3VKH A;  4L8R C;  4KLN A;  3KVW A;  1OKS A;  3HHY A;  4AI6 A;  3K92 A;  4LRT A;  3L28 A;  2CUZ A;  4KHP M;  2RGO A;  3UZU A;  2Y0T A;  4G4R A;  1OIZ A;  2VII A;  2DAI A;  4FW9 A;  4NSR A;  4EIW A;  3I01 M;  3FUX A;  2DHY A;  1G71 A;  2EKK A;  1EIJ A;  2QPA A;  1KFV A;  1WJ7 A;  2KZU A;  4HLQ A;  4IIW A;  3VK8 A;  1IBL M;  2XH9 A;  2BNK A;  3J80 S;  1ZQ9 A;  3SAW A;  2QBY A;  2VQF M;  4JYA M;  3K9O A;  4NXN M;  3TWM A;  3T6P A;  4QOZ C;  2F5O A;  1XXH A;  1NNJ A;  2YFQ A;  2R65 A;  4LY6 A;  4M9S A;  4AG5 A;  3VK7 A;  1IN6 A;  2MRO B;  3VDU A;  1GL6 A;  3U61 B;  3TQS A;  3AOE A;  1C1K A;  5IWA M;  1L1T A;  3GLI E;  4TUW A;  2GQF A;  2XF3 A;  3GPX A;  4OVZ B;  4LGY A;  1BVS A;  2DKL A;  3T1H M;  5FTJ A;  2OQ4 A;  3BOS A;  3KP1 E;  2WSC F;  1L2D A;  1HNZ M;  5EXX A;  2LWX A;  4BBA A;  2R0I A;  4X66 M;  3MHV C;  4LJ5 A;  2KDL A;  3HY5 A;  3GLF B;  3R8F A;  2JY5 A;  1SXJ A;  4GRI A;  4NL4 H;  1MN3 A;  5EJC A;  5BR8 M;  4JI2 M;  4GKJ M;  4DR2 M;  1V34 A;  2FH0 A;  1NV9 A;  2DWL A;  2DAM A;  1R7R A;  3D8L A;  4FCT A;  4CGY B;  1V92 A;  4GIP A;  4RNA A;  3GLF E;  1UM8 A;  1PGY A;  3PFI A;  3SMP A;  1IY2 A;  4DV2 M;  4B3M M;  2F4V M;  2KW0 A;  1G59 A;  4PDG A;  4LF8 M;  2M60 A;  1Z5C A;  1OFI A;  2CV0 A;  1PJQ A;  4R3D A;  3LVV A;  4X64 M;  4JI8 M;  1IBM M;  2VF8 A;  5EQT A;  4JI1 M;  1EFU B;  3AKZ A;  4LGM A;  1PJT A;  4BLC A;  1K3X A;  3A45 A;  5DYG A;  3I04 M;  2ZM6 M;  1DO0 A;  1TR8 A;  4JI3 M;  2K47 A;  4LF9 M;  5EXS A;  3HWS A;  1HT2 E;  2WSE F;  4OW0 A;  2JY8 A;  1N77 A;  1TGU A;  3C58 A;  3U6L A;  1R2Z A;  3E46 A;  1TTE A;  1XXH B;  3HJ8 A;  1OFH A;  2XGN A;  3U6C A;  1DGF A;  2CE7 A;  2XSZ D;  4L78 A;  1GKI A;  4W5W A;  4GC5 A;  4LF4 M;  3RFW A;  2MJ5 B;  1T3T A;  2KRU A;  2F5N A;  3U61 A;  2CFO A;  1TH4 A;  1DGB A;  1L2B A;  5F3W A;  2JZ0 A;  3GRR A;  4DV6 M;  3T38 A;  1NV8 A;  4NSO B;  2HAK A;  4ITQ A;  2R4J A;  4L6V 6;  1QUT A;  3FKE A;  3KOX E;  5E26 A;  1D2N A;  2I7N A;  2F5S A;  3MK6 A;  4F1I A;  5C18 A;  2E5L M;  4GEW A;  4ANR A;  4I81 A;  3ZC7 B;  3SC3 A;  2FOI C;  1F4I A;  2KHH A;  3I51 A;  3GQ4 A;  3GLG A;  2N35 A;  2J5Y A;  4M9Z A;  3VKG A;  4FWG A;  3SAT A;  2XLJ A;  4CIS A;  1IN8 A;  4LF5 M;  3MJ5 A;  4GHL A;  4QOS A;  2DWN A;  3ZH9 B;  2OO9 A;  2FNA A;  4B7H A;  2UUB M;  3KXE C;  3J81 S;  2FFJ A;  4NXM M;  3FE3 A;  5KPZ A;  1NSF A;  4DR1 M;  1LTM A;  1R5L A;  1HQC A;  2R46 A;  3SBJ A;  1NJG A;  3FTF A;  3W0L B;  2CHV A;  3LCV B;  2DNA A;  1VEG A;  3GLH B;  1GL7 A;  2D7H A;  3QWL A;  3GPU A;  2R62 A;  2LXE A;  2C96 A;  3E4R A;  1UFZ A;  2RGH A;  4XK8 F;  3B74 A;  1R4G A;  3GQ5 A;  3GPY A;  4LJA A;  1I4W A;  4L15 A;  3TWL A;  4GH9 A;  2QNJ A;  4DR6 M;  1NNU C;  5IZ7 D;  3CGW A;  3GLH E;  2DI0 A;  3LW5 F;  4AKI A;  4AZF A;  4GMQ A;  3U60 A;  2ZAO A;  5EXT A;  4G4N A;  3U6Q A;  4DR5 M;  2XFT A;  4OX9 M;  4R7G A;  5EP4 A;  2C9C A;  3AOE C;  3K2L A;  1E32 A;  1J5E M;  1EE8 A;  4IJF A;  2KRK A;  4JN6 A;  2X4A A;  4GHA A;  2XEP A;  4WW0 A;  4B7G A;  2K0B X;  3IG5 A;  5LMU M;  3LCU A;  3LMM A;  2XZU A;  1IQP A;  4PD2 A;  2L4E A;  5KO3 A;  1SXJ C;  2JY7 A;  1HR0 M;  1NHW C;  2OOB A;  3Q8G A;  3T15 A;  1G41 A;  4OVZ A;  1QUS A;  2KXE A;  4JI4 M;  3QYE A;  3JR4 A;  3HU3 A;  1ZV1 A;  3M0E A;  4L4U A;  4B3R M;  2DVW B;  3B7Q A;  4RKU F;  3SHG B;  3TWK A;  4M0D A;  2DXI A;  2L2D A;  3B7Z A;  1JQJ C;  1OQY A;  4IJE A;  2JA2 A;  3M7G A;  1D0L A;  1D0M A;  5JI2 E;  4LJ9 A;  3FRI A;  5E6J A;  3W68 A;  1NJF A;  1NY5 A;  2QBY B;  3B89 A;  4LZJ A;  3IHP A;  1OTR A;  5IRE B;  3RE8 A;  3HU1 A;  4AQY M;  1XXH E;  2D7E A;  3ILK A;  2QQ8 A;  3J7A S;  4JI0 M;  1OAO C;  4B08 A;  4YY3 M;  1CUK A;  7CAT A;  5DYI A;  5ITX E;  3MMP A;  4X62 M;  1XNQ M;  2JZ1 A;  4GC9 A;  4OU7 A;  1IM2 A;  2ERC A;  3OTO M;  2L7H A;  4WUR A;  1VDD A;  1YLA A;  3EIE A;  3AFH A;  3U6M A;  2LVN C;  5DFL A;  2Y20 A;  1DV0 A;  4JV5 M;  3U6E A;  4FWD A;  2ZAN A;  5GKN A;  4AKH A;  2LVP C;  1E9R A;  4PT5 A;  4PDI A;  2CV1 A;  2UXD M;  1IXS A;  1J09 A;  5L8R F;  3UJN A;  2CRU A;  2C98 A;  1K82 A;  4DR7 M;  4LFB M;  2KEB A;  3FUV A;  2J7N A;  2X49 A;  1HNX M;  1XHB A;  5KPR A;  4L16 A;  3FYC A;  1GO5 A;  4QNR A;  4P17 A;  4QHT A;  4IBC A;  1JR3 A;  1YE9 A;  4MGH A;  3D8B A;  1TF0 B;  1HJP A;  1VQ1 A;  1N33 M;  1NO1 A;  1G8P A;  3K8Z A;  2Y21 A;  1TH2 A;  3KSJ A;  3JR5 A;  3AJI B;  2UXC M;  1XNR M;  1QAN A;  3VFD A;  2R18 A;  5ITR A;  1E9S A;  1QDR A;  2CHG A;  4YHH M;  2Q2E B;  2WSF F;  3KS4 A;  4D82 A;  5ITU A;  2BWB A;  4RF1 A;  3U60 B;  3EIH A;  1N34 M;  2X8A A;  5FTK A;  3GP1 A;  1MJG M;  2CV2 A;  3HHW A;  2L09 A;  1G3I A;  1AIP C;  2VF7 A;  2QSF X;  1SXJ E;  3FTD A;  2APL A;  3J2P B;  2AHM A;  4LG2 A;  1DGH A;  2EO2 A;  3AOG A;  4HEO A;  4I8O A;  4GIT A;  1N32 M;  1WIV A;  4AG6 A;  2DZN B;  2KNV A;  4B3T M;  2RKO A;  2UXB M;  1OIP A;  4B3S M;  4JI6 M;  3FYD A;  3GRY A;  2QZ4 A;  4M9X A;  2HCB A;  2H1R A;  3NBX X;  1WXQ A;  3KOW E;  1PM5 A;  4CIZ A;  1ZMU A;  4IBE A;  3QAU A;  2UU9 M;  1QZM A;  1JR3 D;  3HJQ A;  2Z3X A;  3C3D A;  4JI7 M;  3R9X B;  4FD2 A;  2BWE A;  3FRH A;  2DZO B;  4MB7 A;  5EP3 A;  1K3W A;  2FS1 A;  3TPZ A;  1SXJ B;  3C9P A;  4P16 A;  5JI3 E;  3SAS A;  4KO8 A;  3BBZ A;  3PNY A;  4LFA M;  3LQR A;  4D81 A;  3SAU A;  1IN7 A;  3HX3 A;  2J7O A;  3IG8 A;  1C7Y A;  1DO2 A;  2QHO B;  4MGY E;  5H37 D;  5C1B A;  1IY0 A;  3UGJ A;  2RRU A;  3L29 A;  2HWJ A;  3E9S A;  4II7 A;  4DBG B;  3HKP A;  3SFZ A;  1S3S A;  1J7K A;  1V33 A;  2M5Z A;  5A2Q S;  4G4O A;  3NBI A;  3ZCB B;  3WHL A;  4RF0 A;  3KOZ E;  3A46 A;  3T1Y M;  1P3Q Q;  4G6Z A;  1PJS A;  5EP2 A;  4DUZ M;  3KP0 E;  3PNV A;  4IBJ A;  3A98 B;  3CF0 A;  3PXG A;  1ZAE A;  3U6S A;  3SHF A;  2WZJ A;  1QZE A;  4MM3 B;  3THG A;  1Z5A A;  1TDZ A;  2Z8Y M;  2CHQ A;  4FCV A;  2YNM D;  2D7G A;  3QYB A;  2GNO A;  4Q7J A;  3HJS A;  3H4J A;  2FE8 A;  2HHH M;  1NHG C;  3DOA A;  3I4V A;  5FLX S; 
#chains in the Genus database with same CATH homology
 3UMM A;  1GVN A;  4I5S A;  2CEA A;  1PJI A;  4ZPX A;  2R4E A;  3KS8 A;  1YSY A;  4DV1 M;  4GKK M;  1Q39 A;  5ITX A;  3W0F A;  1TH3 A;  3UK6 A;  3KW6 A;  4G4Q A;  1N78 A;  3B9P A;  3U5Z A;  3GLI B;  3KOY E;  3GRU A;  3U6P A;  1QAO A;  4XGI A;  1R6B X;  1OJL A;  3HGI A;  2C9O A;  1SXJ D;  4DUY M;  2O5R A;  3VDP A;  4DV3 M;  4LF7 M;  5FTN A;  2XSZ A;  2KZS A;  1IN4 A;  3SMS A;  3CF6 E;  5EXP A;  2NQ8 C;  3Q8X A;  3I4Y A;  3DFZ A;  4NRV A;  4X65 M;  3CTW B;  4M0W A;  3GLF A;  1H6U A;  1QAM A;  3HHX A;  3LQQ A;  1KYI A;  3H4M A;  4B7F A;  2EA0 A;  2LNH C;  4DV4 M;  5KQ8 A;  4LF6 M;  2HL7 A;  2XZF A;  3L27 A;  3GO8 A;  4DV5 M;  3SAR A;  4S12 A;  2BJV A;  4FCW A;  1L8Q A;  4LCB A;  4PCZ A;  1NY6 A;  4NRW A;  3GQ3 A;  1XMQ M;  4K0K M;  1I94 M;  1Z59 A;  1HQY E;  2YQZ A;  2F5Q A;  2UUA M;  4LZZ A;  4Z6Y A;  4A3V B;  1L2C A;  3GLI A;  8CAT A;  4MGI E;  1R2Y A;  4LFC M;  1HNW M;  5KPT A;  1XMO M;  4LJ4 A;  5FTL A;  1TDH A;  1E94 E;  4XBO A;  4FWH A;  1IN5 A;  2DWM A;  3M6A A;  2I7P A;  5FSW A;  3SAV A;  1W5T A;  2VQE M;  3L26 A;  4HL4 A;  2V1C A;  4LJ8 A;  5FTM A;  4I4L A;  3RGP A;  2R45 A;  2LH0 A;  2EUC A;  3TL4 X;  4MH0 E;  5BPV A;  1MU5 A;  2ZBK B;  1W5S A;  2L7I A;  3DA1 A;  3J7B A;  2BJW A;  3TE6 A;  2XFS A;  3FUU A;  1MX0 A;  1KSF X;  1G4A E;  1Z5B A;  1DGG A;  3U6O A;  1FJG M;  1XC8 A;  4Z8X A;  3JAM S;  1Z6T A;  1X37 A;  1NVM A;  3FTC A;  3AL0 C;  2YR0 A;  5EP1 A;  4IBF A;  1IXS B;  3A42 A;  3SYK A;  3GLG B;  1LV7 A;  2C99 A;  3AV0 A;  2QP9 X;  2Y0Q A;  3L25 A;  2UUC M;  3DZD A;  5ITT A;  2A5Y B;  3KSX A;  5KQD A;  2QCU A;  2W82 A;  4DV0 M;  2OPF A;  5LMN M;  3HU2 A;  3U6D A;  4QHS A;  4MGK E;  4BB9 A;  3FD9 A;  3J27 B;  1FNN A;  2DWZ B;  2Z4S A;  3FUW A;  4JXJ A;  4NOO B;  4CHT B;  3K1J A;  1IY1 A;  1IXZ A;  2HKJ A;  2DHR A;  3GPP A;  1XWI A;  4IBD A;  4LJ7 A;  4IBB A;  2L6O A;  4FVM A;  4LRS A;  1N36 M;  4LJ6 A;  1ORY B;  3CF2 A;  4REZ A;  2G5G X;  4D80 A;  3WHK A;  4AW4 A;  1QVR A;  3VLF B;  1N75 A;  3FUT A;  5ITY A;  3HHZ A;  4QNM A;  2ZAM A;  1L1Z A;  2QEN A;  1Q3B A;  4AKG A;  5DNY A;  1DGH B;  2V6Z M;  1GLN A;  5ITQ A;  3NWL A;  3U5Z B;  1HT1 E;  1YUB A;  1QQW A;  5IT9 S;  3PVS A;  4IBI A;  4IBG A;  4JI5 M;  1Q3C A;  4IBK A;  1PJJ A;  3FTE A;  1QAQ A;  2Z4R A;  3L2A A;  4DR3 M;  1IXR C;  4DR4 M;  2F5P A;  3KFU G;  4DV7 M;  3SYL A;  2P5T A;  2C5R A;  2G8L A;  4KOD A;  3RGS A;  2KA6 B;  2Z7J A;  3KDS E;  3GLH A;  3GRV A;  3LVW A;  1QYR A;  4MGZ E;  2V1U A;  1IBK M;  3VKH A;  4L8R C;  4KLN A;  3KVW A;  3HHY A;  4AI6 A;  3K92 A;  4LRT A;  3L28 A;  2CUZ A;  4KHP M;  2RGO A;  3UZU A;  2Y0T A;  4G4R A;  2VII A;  4FW9 A;  4NSR A;  4EIW A;  3FUX A;  2QPA A;  1KFV A;  2KZU A;  4HLQ A;  4IIW A;  3VK8 A;  1IBL M;  2XH9 A;  2BNK A;  3J80 S;  1ZQ9 A;  3SAW A;  2QBY A;  2VQF M;  4JYA M;  4NXN M;  3TWM A;  4QOZ C;  2F5O A;  1XXH A;  1NNJ A;  2YFQ A;  2R65 A;  4LY6 A;  4M9S A;  4AG5 A;  3VK7 A;  1IN6 A;  3VDU A;  1GL6 A;  3U61 B;  3TQS A;  3AOE A;  1C1K A;  5IWA M;  1L1T A;  4TUW A;  2XF3 A;  3GPX A;  4OVZ B;  4LGY A;  3T1H M;  5FTJ A;  2OQ4 A;  3BOS A;  3KP1 E;  1HNZ M;  1L2D A;  5EXX A;  2LWX A;  4BBA A;  4X66 M;  3MHV C;  4LJ5 A;  3GLF B;  3R8F A;  1SXJ A;  4GRI A;  4NL4 H;  5EJC A;  5BR8 M;  4JI2 M;  4GKJ M;  4DR2 M;  2DWL A;  1R7R A;  3D8L A;  4FCT A;  4CGY B;  4GIP A;  4RNA A;  1UM8 A;  3PFI A;  3SMP A;  1IY2 A;  4DV2 M;  4B3M M;  2F4V M;  2KW0 A;  1G59 A;  4PDG A;  4LF8 M;  1Z5C A;  2M60 A;  1OFI A;  2CV0 A;  4R3D A;  3LVV A;  4X64 M;  4JI8 M;  1IBM M;  5EQT A;  4JI1 M;  3AKZ A;  4LGM A;  4BLC A;  1K3X A;  3A45 A;  5DYG A;  2ZM6 M;  1DO0 A;  4JI3 M;  2K47 A;  4LF9 M;  5EXS A;  3HWS A;  1HT2 E;  4OW0 A;  1N77 A;  1TGU A;  3C58 A;  3U6L A;  1R2Z A;  1XXH B;  3HJ8 A;  1OFH A;  2XGN A;  3U6C A;  1DGF A;  2CE7 A;  2XSZ D;  4L78 A;  1GKI A;  4W5W A;  4GC5 A;  4LF4 M;  3RFW A;  1T3T A;  2KRU A;  2F5N A;  3U61 A;  2CFO A;  1TH4 A;  1DGB A;  1L2B A;  5F3W A;  4DV6 M;  3GRR A;  3T38 A;  4NSO B;  4ITQ A;  2R4J A;  3FKE A;  3KOX E;  5E26 A;  1D2N A;  2I7N A;  2F5S A;  3MK6 A;  5C18 A;  2E5L M;  4I81 A;  3ZC7 B;  3SC3 A;  2FOI C;  3I51 A;  3GQ4 A;  3GLG A;  3VKG A;  4M9Z A;  4FWG A;  3SAT A;  2XLJ A;  4CIS A;  1IN8 A;  4LF5 M;  3MJ5 A;  4GHL A;  4QOS A;  2DWN A;  3ZH9 B;  4B7H A;  2FNA A;  2UUB M;  3KXE C;  3J81 S;  2FFJ A;  4NXM M;  5KPZ A;  1NSF A;  4DR1 M;  2R46 A;  3FTF A;  1HQC A;  3SBJ A;  1NJG A;  3W0L B;  2CHV A;  3GLH B;  1GL7 A;  2D7H A;  3QWL A;  3GPU A;  2R62 A;  2LXE A;  2C96 A;  3E4R A;  2RGH A;  3GQ5 A;  3GPY A;  4LJA A;  1I4W A;  4L15 A;  3TWL A;  4GH9 A;  4DR6 M;  1NNU C;  5IZ7 D;  4AKI A;  4AZF A;  4GMQ A;  3U60 A;  2ZAO A;  5EXT A;  4G4N A;  3U6Q A;  4DR5 M;  2XFT A;  4OX9 M;  4R7G A;  5EP4 A;  2C9C A;  3AOE C;  3K2L A;  1E32 A;  1J5E M;  1EE8 A;  4IJF A;  2KRK A;  4JN6 A;  2X4A A;  4GHA A;  2XEP A;  4WW0 A;  4B7G A;  3IG5 A;  5LMU M;  3LMM A;  2XZU A;  1IQP A;  4PD2 A;  5KO3 A;  1SXJ C;  1HR0 M;  1NHW C;  3T15 A;  1G41 A;  4OVZ A;  2KXE A;  4JI4 M;  3JR4 A;  3HU3 A;  3M0E A;  4L4U A;  4B3R M;  2DVW B;  3SHG B;  3TWK A;  4M0D A;  2DXI A;  1JQJ C;  4IJE A;  2JA2 A;  3M7G A;  5JI2 E;  4LJ9 A;  5E6J A;  1NJF A;  1NY5 A;  2QBY B;  4LZJ A;  5IRE B;  3RE8 A;  3HU1 A;  4AQY M;  2D7E A;  3ILK A;  3J7A S;  4JI0 M;  4B08 A;  4YY3 M;  7CAT A;  5DYI A;  5ITX E;  4X62 M;  1XNQ M;  4OU7 A;  4GC9 A;  1IM2 A;  2ERC A;  3OTO M;  2L7H A;  4WUR A;  1VDD A;  3EIE A;  3U6M A;  3AFH A;  2Y20 A;  4JV5 M;  3U6E A;  4FWD A;  2ZAN A;  5GKN A;  4AKH A;  1E9R A;  4PT5 A;  4PDI A;  2CV1 A;  2UXD M;  1J09 A;  4DR7 M;  3UJN A;  4LFB M;  2C98 A;  1K82 A;  2KEB A;  3FUV A;  2J7N A;  2X49 A;  1HNX M;  1XHB A;  5KPR A;  4L16 A;  3FYC A;  4QNR A;  4QHT A;  4IBC A;  1JR3 A;  1YE9 A;  4MGH A;  3D8B A;  1N33 M;  1G8P A;  3K8Z A;  2Y21 A;  1TH2 A;  3KSJ A;  3JR5 A;  3AJI B;  2UXC M;  1XNR M;  1QAN A;  3VFD A;  2R18 A;  5ITR A;  1E9S A;  2CHG A;  4YHH M;  3KS4 A;  2Q2E B;  4D82 A;  5ITU A;  1N34 M;  4RF1 A;  3U60 B;  3EIH A;  2X8A A;  5FTK A;  3GP1 A;  2CV2 A;  3HHW A;  2L09 A;  1G3I A;  3FTD A;  1SXJ E;  3J2P B;  4LG2 A;  2AHM A;  1DGH A;  2EO2 A;  3AOG A;  4I8O A;  4GIT A;  1N32 M;  4AG6 A;  2DZN B;  4B3T M;  2RKO A;  2UXB M;  4B3S M;  4JI6 M;  3FYD A;  3GRY A;  2QZ4 A;  4M9X A;  2HCB A;  2H1R A;  1WXQ A;  3KOW E;  1PM5 A;  4IBE A;  2UU9 M;  3QAU A;  1QZM A;  1JR3 D;  3HJQ A;  2Z3X A;  4JI7 M;  3R9X B;  4FD2 A;  2DZO B;  4MB7 A;  5EP3 A;  1K3W A;  3TPZ A;  1SXJ B;  4P16 A;  5JI3 E;  3SAS A;  4KO8 A;  3PNY A;  4LFA M;  4D81 A;  3LQR A;  3SAU A;  1IN7 A;  2J7O A;  3IG8 A;  1DO2 A;  4MGY E;  5H37 D;  5C1B A;  1IY0 A;  3UGJ A;  3L29 A;  3E9S A;  4II7 A;  3HKP A;  3SFZ A;  1S3S A;  1J7K A;  5A2Q S;  2M5Z A;  4G4O A;  3NBI A;  3ZCB B;  3WHL A;  4RF0 A;  3KOZ E;  3A46 A;  3T1Y M;  4G6Z A;  5EP2 A;  4DUZ M;  3KP0 E;  3PNV A;  4IBJ A;  3A98 B;  3CF0 A;  3PXG A;  1ZAE A;  3U6S A;  3SHF A;  4MM3 B;  3THG A;  1Z5A A;  1TDZ A;  2CHQ A;  4FCV A;  2YNM D;  2D7G A;  3HJS A;  2FE8 A;  2HHH M;  1NHG C;  3DOA A;  3I4V A;  5FLX S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...