2C5RA

The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Dna-binding protein/dna
molecule keywords EARLY PROTEIN P16.7
total genus 21
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2c5rA00
1ZAEA 2C5RA 2BNKA
chains in the Genus database with same CATH superfamily
4QNMA 2LVOC 3HWSA 3U6EA 3SATA 2K47A 1IY1A 1DO2A 1E94E 4LJ4A 3ZH9B 2DAIA 3KOYE 5EQTA 4P17A 1JR3D 2RKOA 2CV1A 3W0FA 1XXHE 4JI1M 4LF8M 1XC8A 2Z4RA 2QQ8A 1DGFA 5GKNA 2P5TA 1R6BX 3PFIA 4M9SA 4LJ8A 3HU2A 2QHOB 1SXJB 2V6ZM 2X49A 3GPPA 2RRUA 2L7IA 3K9OA 1SXJC 1WIVA 2JXNA 3J81S 2DNAA 3U6CA 4JI5M 5FTKA 1G8PA 1GL6A 5ITTA 3TL4X 3CF0A 3GRYA 4XBOA 1K3WA 4KO8A 1IN7A 5L8RF 4B3MM 4LF6M 3KVWA 4IJFA 3CF6E 2LVAA 1R2YA 4XK8F 3VK7A 3CGWA 2CWBA 1Z59A 2VF8A 2EKKA 4AZFA 1E9SA 3UZUA 1ORYB 4M0WA 4L8RC 2XH9A 1IXZA 3EIEA 4JI0M 2FNAA 1IN5A 2LVNC 3VDUA 4GC5A 3SYLA 4CGYB 5KQ8A 3M0EA 4DV0M 2F4VM 2F5SA 3HGIA 5EP1A 2LVQD 1OFHA 1V34A 2R45A 2XSZD 5EXPA 3ZQJA 3RGPA 8CATA 4AG5A 4IBEA 1ZMVA 1N32M 2JNHA 2JY8A 3GLGA 1TDZA 2UXCM 2K6BA 3E9SA 3W0LB 4DR5M 3Q8XA 2R65A 1HT2E 4QHSA 3GLHA 3WHLA 2HL7A 1D0LA 2YFQA 3ZC7B 5ITXE 1OIPA 2F5NA 4LJ6A 1F4IA 4BLCA 1HQCA 2A5YB 4QHTA 4IBBA 3U6DA 2M5ZA 1KYIA 2L6OA 3FTCA 2LBCA 4CISA 1GLNA 5C18A 4OW0A 2VF7A 1NV8A 2XFTA 3MMPA 4WP2A 1G41A 2YNMD 1ZQ9A 3KOZE 4LZJA 3GLGE 2E5LM 4OX9M 1G3IA 4G4OA 3GQ4A 1VEGA 3GRRA 2HHHM 4JI8M 4A3VB 1QZEA 4DV5M 4X62M 1R7RA 2EKFA 3FTDA 4M9XA 2DAEA 3PNYA 2QENA 4FVMA 2F5QA 1ZV1A 2GQFA 1BVSA 4G4RA 3FRHA 3RFWA 3GLHB 2OQ4A 2KHHA 3U60B 1RU3A 4QOSA 1OJLA 1YLAA 3T15A 4G4QA 1K82A 4MGKE 4BBAA 4LGMA 1E9RA 2FE8A 2NQ8C 1ZAEA 3FYCA 1QDRA 4KT0F 1R2ZA 2J7OA 1PM5A 2LH0A 3VKGA 3HZJA 3JR5A 5KPRA 4DV7M 3L25A 3B9PA 1NHGC 4D82A 1HR0M 2UUBM 4PT5A 3TWKA 2LXEA 3I51A 3QAUA 2C96A 4AKIA 1OAIA 1XHBA 1HNXM 3FUWA 2R4EA 3BXWA 4WW0A 3I4VA 1V92A 2UUCM 2I7PA 4W5WA 2L4EA 3TWLA 3J2PB 2XGNA 1H6UA 5EXXA 2QP9X 5DNYA 1J5EM 2UU9M 4Z6YA 1L2BA 4D80A 1DGHA 4DR2M 5E6JA 5FTMA 2MH8A 1EIJA 1W5TA 3KP1E 2Y0QA 4OU7A 4KHPM 3UMMA 4F1IA 4WURA 1Z5BA 2Q2EB 3HY5A 3SMPA 4DUYM 2DWNA 4FCVA 4AG6A 1HT1E 4GHAA 1XWIA 2JZ0A 4NSOB 4LRSA 3AOEC 3B89A 1YSYA 5EP3A 3GQ3A 2YQZA 4II7A 3HHXA 3MJ5A 4FW9A 1IM2A 1Z5CA 4F2LA 4HLQA 4DV4M 1IN6A 1P3QQ 1QAOA 2CEAA 2L2DA 1L1TA 1D2NA 1MX0A 5ITYA 4OVZA 3NBXX 3PVSA 2C9CA 4FCTA 1HQYE 3HX3A 4ZPXA 5FTJA 4JI3M 3C58A 1JB0F 2EA0A 1IBLM 4IBFA 1HNWM 5KPZA 3GRVA 2CV0A 4MH0E 2H1RA 4LJ9A 2HCBA 4L4UA 2QBYA 3AOGA 2XEPA 3DOAA 2FOIC 3I04M 3KW6A 3SFZA 1NJGA 5IZ7D 3SBJA 1N75A 4LGYA 1VDDA 4L6V6 3SC3A 5H37D 3UGJA 3GO8A 1IBMM 3Q8GA 2DXIA 4GKJM 5C1BA 4HL4A 3KS4A 3L29A 1T43A 3LCVB 5BPVA 1MJGM 1QDTA 1QUTA 2DAKA 3FUTA 2L09A 3SYKA 1KFVA 4EIWA 4ANRA 2O5RA 1CUKA 4IJEA 4B3TM 5FTLA 4AKHA 4GITA 4I8OA 1QQWA 1C7YA 1Q3BA 3J7BA 1SXJA 3U61B 2CFOA 5LMNM 1JR3A 4AW4A 4R71A 3A98B 1L1ZA 1GABA 2XFSA 4GHLA 1VDLA 2QNJA 3GLHE 5FLXS 1SXJD 1I4WA 3V76A 3U60A 3K92A 4GH9A 2R46A 2JY6B 4DV6M 2FS1A 1LV7A 2I7NA 2C98A 2V1UA 3EIHA 2ZAOA 5F3WA 2KW0A 2D7EA 1KSFX 2QZ4A 1ZMUA 3GLGB 2FH0A 3I4YA 4P16A 1NNJA 2BJWA 2YR0A 4RF0A 1W5SA 4S12A 2DWLA 3FTFA 1WJ7A 1L2DA 2JWSA 1DGBA 4LJ5A 2F5OA 2RGHA 4LZZA 4CIZA 1D0MA 2K0BX 5DYIA 4L16A 2XZFA 4G6ZA 4JXJA 2ZM6M 3L27A 4IBCA 3SASA 5BR8M 2OO9A 2EJSA 4MGZE 2UXDM 1OTRA 2QCUA 2QPAA 1VQ1A 2XSZA 3U6QA 1N34M 4LFBM 4FD2A 5JI2E 5IWAM 4IBIA 2MGWA 3FTEA 1IXRC 2EO2A 3TWMA 3B74A 3GQ5A 3U6SA 4YY3M 5IREB 3HU3A 3FYDA 4L78A 3A42A 1XNQM 4NSRA 4NC6A 1Q02A 4BB9A 3SAUA 2DWZB 3KDSE 2KXEA 2DZOB 3E4RA 3HJ8A 3THGA 4Y28F 2DVWB 3JR4A 5EP4A 1IXSA 3M6AA 3F92A 1QAQA 1Q3CA 4I5SA 3T1YM 1HNZM 1GKIA 1XB2B 2W82A 2DKLA 1VG5A 1YE9A 2X4AA 4PDGA 1J7KA 1E32A 3BBZA 3LQRA 2KNVA 3U5ZA 1XMQM 1OKSA 1TF0B 4R7GA 4JI4M 3IECA 1N33M 3C3DA 3U61A 4M0DA 3D8LA 2F5PA 2CP8A 2R6FA 2O25A 1GJSA 3KOWE 1T3TA 2CHQA 3E21A 4HEOA 1IBKM 3NBIA 2OPFA 1XMOM 4YHHM 1AIPC 1PJSA 2CRUA 3FD9A 2EUCA 1XXHB 5IT9S 4LJAA 4GC9A 2KZSA 4GEWA 3AKZA 4GRIA 1QYRA 3ZCBB 2CV2A 2ZBKB 2DZLA 2R44A 2ZANA 2B3TA 2JZ1A 3U6PA 4NXNM 4LF4M 5FTNA 1TR8A 3RE8A 4TUWA 2G8LA 3H4MA 3C3EA 5E26A 3PXGA 2BWBA 1R4GA 2LVPC 4GKKM 4I81A 4LF9M 1WXQA 4R3DA 1DO0A 1PRBA 2LHCA 3IG5A 5DYGA 2JUJA 3L2AA 2CE7A 1AUAA 2BNKA 3QWLA 2V1CA 3QYBA 5ITQA 5EP2A 2LWXA 5FSWA 1DGHB 2MR9A 3GLIE 3VK8A 4B3RM 4RNAA 1VEJA 1HJPA 4OVZB 1XNRM 1QVRA 3KOXE 2DHRA 4IBJA 2OOAA 3LVWA 3WHKA 4QOZC 1PJQA 4AQYM 2QSFX 2AHMA 4IBGA 2G3QA 3R9XB 2MROB 4B7HA 3GPYA 3U6MA 3K8ZA 2VQFM 1DV0A 3IG8A 4K0KM 3D8BA 4DV2M 4GIPA 4JI2M 3TQSA 1NV9A 2KRKA 1QZMA 2Z8YM 3B7NA 3KSXA 3I01M 2APLA 3LCUA 2G5GX 1S3SA 3AOEA 3NWLA 2H5XA 2Y0TA 3RGSA 2J5YA 3SMSA 1GL7A 4LG2A 2C99A 5JI3E 2HKJA 3U5ZB 1L2CA 4B3SM 4NRWA 4JYAM 3BOSA 4Q7JA 3HKPA 3K2LA 4LF5M 2LNHC 4NRVA 1J09A 4B08A 3VDPA 1VEKA 3FUVA 4NL4H 4REZA 1WGLA 3GLFB 2JA2A 4QNRA 1OQYA 1XXHA 3HJQA 4UN2B 3LVVA 2M60A 2N35A 4NOOB 1WHCA 3JAMS 3T1HM 4RF1A 2K9DA 3KSJA 3FE3A 3A46A 1G4AE 1WGNA 7CATA 4B7GA 3KXEC 2JY5A 2LHGA 2Y20A 3MHVC 3W67A 2UUAM 1NJFA 2GNOA 4DV3M 4M9ZA 1WR1B 3VFDA 3PNVA 2R62A 4I4LA 2FFJA 2WSEF 1IFYA 1G59A 5EJCA 3GP1A 1TTEA 1IXSB 3M7GA 4DR7M 1FNNA 5ITRA 2DHYA 1R5LA 4CJ6A 4X66M 3B7QA 3AFHA 3SHGB 3QYEA 2XZUA 1JQJC 1G71A 2DZNB 1PJTA 1OAOC 4GMQA 1NVMA 3GLIB 3HHYA 5LMUM 3GPUA 4ITQA 2KDLA 3FUXA 4B7FA 1SG9A 1TH3A 4JI6M 1NY6A 2UXBM 4Z8XA 1V33A 1GJTA 3L28A 1YUBA 2X8AA 1GVNA 1N36M 1QAMA 2RGOA 1ZMWA 3SAWA 2C5RA 2WSFF 2C9OA 3TPZA 1Y8GA 3CTWB 2KA6B 1K3XA 3H4JA 2D7HA 3FUUA 2VDBB 4FCWA 4DV1M 3FRIA 2Y21A 2ZTCA 4JN6A 3GPXA 4XGIA 5DFLA 1MU5A 1Z6TA 3K1JA 3T38A 3LQQA 1UM8A 1T6OA 4PDIA 1Q39A 3C9PA 3SARA 4MGYE 2WSCF 4KLNA 3R8FA 3KS8A 2LTUA 4L15A 4MGIE 1NY5A 3UK6A 4X65M 3UJNA 3DZDA 2VQEM 3IHPA 4JV5M 4MM3B 2JY7A 2KZUA 2CHGA 2KRUA 2HWJA 1NHWC 3DA1A 3MK6A 4LF7M 3W68A 3KFUG 2Z7JA 3HHZA 4PCZA 4LFAM 1TH4A 2XLJA 3VLFB 2Z4SA 2DAMA 1DGGA 5KO3A 4LJ7A 2HAKA 1IQPA 1C1KA 1QUSA 5KQDA 3FKEA 3AL0C 4DR3M 2OOBA 4LY6A 3CF2A 5EXSA 1NSFA 2JP7A 1QANA 2ERCA 2J7NA 4IIWA 4D81A 3AV0A 3GLFE 1N78A 3HU1A 4DBGB 3GLFA 3J80S 2CHVA 1JR3E 2BWEA 1FJGM 2DWMA 1IN4A 1EFUB 1L8QA 2MJ5B 2CUZA 1IN8A 2DI0A 5ITXA 2Z3XA 1TDHA 1UFZA 5A2QS 1Z5AA 4DR6M 2KNAA 3B7ZA 1PGYA 3HJSA 1GO5A 2DAGA 3HHWA 3U6OA 4AKGA 5KPTA 3AJIB 4DR4M 1SXJE 1NNUC 1N77A 4DR1M 2R18A 2QBYB 3GRUA 3GLIA 3SHFA 2D7GA 1X37A 1IY0A 1PJIA 1D0KA 4LCBA 1A5TA 2KNZA 3KP0E 3LW5F 4LRTA 4JI7M 4NXMM 1TGUA 5ITUA 4AI6A 2L7HA 3U6LA 1IY2A 3VKHA 2L4FA 3L26A 1OIZA 3TE6A 2DENA 3T6PA 2ZAMA 1EE8A 3SAVA 3DFZA 3E46A 2BJVA 3K9PA 2R4JA 2KEBA 4LFCM 4G4NA 1TH2A 5EXTA 1I94M 3A45A 3J27B 3LMMA 3J7AS 2O01F 4CHTB 4KODA 4X64M 4FWGA 1PJJA 2VIIA 4G3OA 1NO1A 2ZTDA 2WZJA 4IBKA 1LTMA 1MN3A 3ILKA 4FWHA 2XF3A 4FWDA 4MB7A 4RKUF 4MGHA 4DUZM 2R0IA 3OTOM 4IBDA 1OFIA 4PD2A
chains in the Genus database with same CATH topology
4QNMA 3HWSA 3U6EA 3SATA 2K47A 1IY1A 1DO2A 1E94E 4LJ4A 3ZH9B 3KOYE 5EQTA 2CV1A 1JR3D 2RKOA 4LF8M 3W0FA 4JI1M 1XC8A 2Z4RA 1DGFA 5GKNA 2P5TA 1R6BX 3PFIA 4M9SA 4LJ8A 3HU2A 1SXJB 2V6ZM 2X49A 3GPPA 2L7IA 1SXJC 3J81S 3U6CA 4JI5M 5FTKA 1G8PA 1GL6A 5ITTA 3TL4X 3CF0A 3GRYA 4XBOA 1K3WA 4KO8A 1IN7A 4B3MM 4LF6M 3KVWA 4IJFA 3CF6E 1R2YA 3VK7A 1Z59A 4AZFA 1E9SA 3UZUA 1ORYB 4M0WA 4L8RC 2XH9A 1IXZA 3EIEA 4JI0M 2FNAA 1IN5A 3VDUA 5KQ8A 4GC5A 3SYLA 4CGYB 4DV0M 3M0EA 2F4VM 2F5SA 3HGIA 5EP1A 1OFHA 2R45A 2XSZD 5EXPA 3RGPA 8CATA 4AG5A 4IBEA 1N32M 3GLGA 1TDZA 2UXCM 3E9SA 3W0LB 4DR5M 3Q8XA 2R65A 1HT2E 4QHSA 3GLHA 3WHLA 2HL7A 2YFQA 3ZC7B 5ITXE 2F5NA 4LJ6A 4BLCA 1HQCA 2A5YB 4QHTA 4IBBA 3U6DA 1KYIA 2L6OA 2M5ZA 3FTCA 4CISA 1GLNA 5C18A 4OW0A 2XFTA 1G41A 2YNMD 1ZQ9A 3KOZE 4LZJA 2E5LM 4OX9M 1G3IA 4G4OA 3GQ4A 3GRRA 2HHHM 4JI8M 4A3VB 4DV5M 4X62M 1R7RA 3FTDA 4M9XA 3PNYA 2QENA 4FVMA 2F5QA 4G4RA 3RFWA 3GLHB 2OQ4A 3U60B 4QOSA 1OJLA 3T15A 4G4QA 1K82A 4MGKE 4BBAA 4LGMA 1E9RA 2FE8A 2NQ8C 1ZAEA 3FYCA 1R2ZA 2J7OA 1PM5A 2LH0A 3VKGA 3JR5A 5KPRA 4DV7M 3L25A 3B9PA 1NHGC 4D82A 1HR0M 2UUBM 4PT5A 3TWKA 2LXEA 3I51A 3QAUA 2C96A 4AKIA 1XHBA 1HNXM 3FUWA 2R4EA 4WW0A 3I4VA 2I7PA 4W5WA 3TWLA 3J2PB 2XGNA 1H6UA 5EXXA 2QP9X 5DNYA 1J5EM 2UU9M 4Z6YA 1L2BA 4D80A 1DGHA 4DR2M 5E6JA 5FTMA 1W5TA 3KP1E 2Y0QA 4OU7A 4KHPM 3UMMA 4WURA 1Z5BA 2Q2EB 3SMPA 4DUYM 2DWNA 4FCVA 4AG6A 1HT1E 4GHAA 1XWIA 4NSOB 4LRSA 3AOEC 1YSYA 5EP3A 3GQ3A 2YQZA 4II7A 3HHXA 3MJ5A 4FW9A 1IM2A 1Z5CA 4HLQA 4DV4M 1IN6A 1QAOA 2CEAA 1L1TA 1D2NA 1MX0A 5ITYA 4OVZA 3PVSA 2C9CA 4FCTA 1HQYE 4ZPXA 5FTJA 4JI3M 3C58A 2UUCM 2EA0A 1IBLM 4IBFA 1HNWM 5KPZA 3GRVA 2CV0A 4MH0E 2H1RA 4LJ9A 2HCBA 4L4UA 2QBYA 3AOGA 2XEPA 3DOAA 2FOIC 3KW6A 3SFZA 1NJGA 5IZ7D 3SBJA 1N75A 4LGYA 1VDDA 3SC3A 3UGJA 5H37D 1IBMM 3GO8A 2DXIA 4GKJM 5C1BA 4HL4A 3KS4A 3L29A 5BPVA 3FUTA 3SYKA 2L09A 1KFVA 4EIWA 4B3TM 2O5RA 4IJEA 5FTLA 4AKHA 4GITA 4I8OA 1QQWA 1Q3BA 3J7BA 1SXJA 3U61B 2CFOA 5LMNM 1JR3A 4AW4A 3A98B 1L1ZA 2XFSA 4GHLA 5FLXS 1SXJD 1I4WA 3U60A 3K92A 4GH9A 2R46A 2V1UA 4DV6M 1LV7A 2I7NA 2C98A 3EIHA 2ZAOA 5F3WA 2KW0A 2D7EA 1KSFX 2QZ4A 3GLGB 3I4YA 4P16A 1NNJA 2BJWA 2YR0A 4RF0A 1W5SA 4S12A 2DWLA 3FTFA 1L2DA 2F5OA 1DGBA 4LJ5A 2RGHA 4LZZA 5DYIA 4L16A 2XZFA 4G6ZA 4JXJA 2ZM6M 3L27A 4IBCA 3SASA 5BR8M 4MGZE 2UXDM 2QCUA 2QPAA 2XSZA 3U6QA 1N34M 4LFBM 4FD2A 5JI2E 5IWAM 4IBIA 3FTEA 1IXRC 2EO2A 3TWMA 3GQ5A 3U6SA 4YY3M 5IREB 3HU3A 3FYDA 4L78A 3A42A 1XNQM 4NSRA 4BB9A 3SAUA 2DWZB 3KDSE 2KXEA 3HJ8A 2DZOB 3E4RA 3THGA 3JR4A 2DVWB 5EP4A 3M6AA 1QAQA 1Q3CA 4I5SA 3T1YM 1HNZM 1GKIA 2W82A 2X4AA 1YE9A 4PDGA 1J7KA 1E32A 3LQRA 1XMQM 3U5ZA 4R7GA 4JI4M 1N33M 3U61A 4M0DA 3D8LA 2F5PA 3KOWE 1T3TA 2CHQA 1IBKM 3NBIA 2OPFA 1XMOM 4YHHM 3FD9A 2EUCA 1XXHB 5IT9S 4LJAA 4GC9A 2KZSA 3AKZA 4GRIA 1QYRA 3ZCBB 2CV2A 2ZBKB 2ZANA 3U6PA 4NXNM 4LF4M 5FTNA 3RE8A 4TUWA 2G8LA 3H4MA 5E26A 3PXGA 4GKKM 4I81A 4LF9M 1WXQA 4R3DA 1DO0A 3IG5A 5DYGA 3L2AA 2CE7A 2BNKA 3QWLA 2V1CA 5ITQA 5EP2A 2LWXA 5FSWA 1DGHB 3VK8A 4B3RM 4RNAA 4OVZB 1XNRM 1QVRA 3KOXE 2DHRA 4IBJA 3LVWA 3WHKA 4QOZC 4AQYM 2AHMA 4IBGA 3R9XB 4B7HA 3GPYA 3U6MA 3K8ZA 2VQFM 3IG8A 4K0KM 3D8BA 4DV2M 4GIPA 4JI2M 3TQSA 2KRKA 1QZMA 3KSXA 2G5GX 1S3SA 3AOEA 3NWLA 2Y0TA 3RGSA 3SMSA 1GL7A 4LG2A 2C99A 5JI3E 2HKJA 3U5ZB 1L2CA 4B3SM 4NRWA 4JYAM 3BOSA 3HKPA 3K2LA 4LF5M 2LNHC 4NRVA 1J09A 4B08A 3VDPA 3FUVA 4NL4H 4REZA 3GLFB 2JA2A 4QNRA 1XXHA 3HJQA 3LVVA 2M60A 4NOOB 3JAMS 3T1HM 4RF1A 3KSJA 3A46A 1G4AE 7CATA 4B7GA 3KXEC 2Y20A 3MHVC 2UUAM 1NJFA 4DV3M 4M9ZA 3VFDA 3PNVA 2R62A 4I4LA 2FFJA 1G59A 5EJCA 3GP1A 1IXSB 3M7GA 4DR7M 1FNNA 5ITRA 4X66M 3AFHA 3SHGB 2XZUA 1JQJC 2DZNB 4GMQA 1NVMA 3GLIB 3HHYA 5LMUM 3GPUA 4ITQA 3FUXA 4B7FA 4JI6M 1TH3A 2UXBM 1NY6A 4Z8XA 3L28A 1YUBA 2X8AA 1GVNA 1N36M 1QAMA 2RGOA 3SAWA 2C5RA 2C9OA 3TPZA 3CTWB 2KA6B 1K3XA 2D7HA 3FUUA 4FCWA 4DV1M 2Y21A 4JN6A 3GPXA 4XGIA 1MU5A 1Z6TA 3K1JA 3T38A 3LQQA 1UM8A 4PDIA 1Q39A 3SARA 4MGYE 4KLNA 3R8FA 3KS8A 3UK6A 4L15A 4MGIE 1NY5A 4X65M 3UJNA 3DZDA 2VQEM 4JV5M 4MM3B 2KZUA 2CHGA 2KRUA 1NHWC 3DA1A 3MK6A 4LF7M 3KFUG 2Z7JA 3HHZA 4PCZA 4LFAM 1TH4A 2XLJA 3VLFB 2Z4SA 1DGGA 5KO3A 4LJ7A 1IQPA 1C1KA 5KQDA 3FKEA 3AL0C 4DR3M 4LY6A 5EXSA 3CF2A 1NSFA 1QANA 2ERCA 2J7NA 4IIWA 4D81A 3AV0A 1N78A 3HU1A 3GLFA 3J80S 2CHVA 1FJGM 2DWMA 1IN4A 1L8QA 2CUZA 1IN8A 5ITXA 2Z3XA 1TDHA 5A2QS 1Z5AA 4DR6M 3HJSA 3HHWA 3U6OA 4AKGA 5KPTA 3AJIB 4DR4M 1SXJE 1NNUC 1N77A 4DR1M 2R18A 2QBYB 3GRUA 3GLIA 3SHFA 2D7GA 1X37A 1IY0A 1PJIA 4LCBA 3KP0E 4LRTA 4JI7M 4NXMM 1TGUA 5ITUA 4AI6A 2L7HA 3U6LA 1IY2A 3VKHA 3L26A 3TE6A 2ZAMA 1EE8A 3SAVA 3DFZA 2BJVA 2R4JA 2KEBA 4LFCM 4G4NA 1TH2A 5EXTA 1I94M 3A45A 3J27B 3LMMA 3J7AS 4CHTB 4KODA 4X64M 4FWGA 1PJJA 2VIIA 4IBKA 3ILKA 4FWHA 4FWDA 2XF3A 4MB7A 4DUZM 4MGHA 3OTOM 4IBDA 1OFIA 4PD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAE A;  2C5R A;  2BNK A; 
#chains in the Genus database with same CATH topology
 4QNM A;  2LVO C;  3HWS A;  3U6E A;  3SAT A;  2K47 A;  1IY1 A;  1DO2 A;  1E94 E;  4LJ4 A;  3ZH9 B;  2DAI A;  3KOY E;  5EQT A;  4P17 A;  1JR3 D;  2RKO A;  2CV1 A;  3W0F A;  1XXH E;  4JI1 M;  4LF8 M;  1XC8 A;  2Z4R A;  2QQ8 A;  1DGF A;  5GKN A;  2P5T A;  1R6B X;  3PFI A;  4M9S A;  4LJ8 A;  3HU2 A;  2QHO B;  1SXJ B;  2V6Z M;  2X49 A;  3GPP A;  2RRU A;  2L7I A;  3K9O A;  1SXJ C;  1WIV A;  2JXN A;  3J81 S;  2DNA A;  3U6C A;  4JI5 M;  5FTK A;  1G8P A;  1GL6 A;  5ITT A;  3TL4 X;  3CF0 A;  3GRY A;  4XBO A;  1K3W A;  4KO8 A;  1IN7 A;  5L8R F;  4B3M M;  4LF6 M;  3KVW A;  4IJF A;  3CF6 E;  2LVA A;  1R2Y A;  4XK8 F;  3VK7 A;  3CGW A;  2CWB A;  1Z59 A;  2VF8 A;  2EKK A;  4AZF A;  1E9S A;  3UZU A;  1ORY B;  4M0W A;  4L8R C;  2XH9 A;  1IXZ A;  3EIE A;  4JI0 M;  2FNA A;  1IN5 A;  2LVN C;  3VDU A;  4GC5 A;  3SYL A;  4CGY B;  5KQ8 A;  3M0E A;  4DV0 M;  2F4V M;  2F5S A;  3HGI A;  5EP1 A;  2LVQ D;  1OFH A;  1V34 A;  2R45 A;  2XSZ D;  5EXP A;  3ZQJ A;  3RGP A;  8CAT A;  4AG5 A;  4IBE A;  1ZMV A;  1N32 M;  2JNH A;  2JY8 A;  3GLG A;  1TDZ A;  2UXC M;  2K6B A;  3E9S A;  3W0L B;  4DR5 M;  3Q8X A;  2R65 A;  1HT2 E;  4QHS A;  3GLH A;  3WHL A;  2HL7 A;  1D0L A;  2YFQ A;  3ZC7 B;  5ITX E;  1OIP A;  2F5N A;  4LJ6 A;  1F4I A;  4BLC A;  1HQC A;  2A5Y B;  4QHT A;  4IBB A;  3U6D A;  2M5Z A;  1KYI A;  2L6O A;  3FTC A;  2LBC A;  4CIS A;  1GLN A;  5C18 A;  4OW0 A;  2VF7 A;  1NV8 A;  2XFT A;  3MMP A;  4WP2 A;  1G41 A;  2YNM D;  1ZQ9 A;  3KOZ E;  4LZJ A;  3GLG E;  2E5L M;  4OX9 M;  1G3I A;  4G4O A;  3GQ4 A;  1VEG A;  3GRR A;  2HHH M;  4JI8 M;  4A3V B;  1QZE A;  4DV5 M;  4X62 M;  1R7R A;  2EKF A;  3FTD A;  4M9X A;  2DAE A;  3PNY A;  2QEN A;  4FVM A;  2F5Q A;  1ZV1 A;  2GQF A;  1BVS A;  4G4R A;  3FRH A;  3RFW A;  3GLH B;  2OQ4 A;  2KHH A;  3U60 B;  1RU3 A;  4QOS A;  1OJL A;  1YLA A;  3T15 A;  4G4Q A;  1K82 A;  4MGK E;  4BBA A;  4LGM A;  1E9R A;  2FE8 A;  2NQ8 C;  1ZAE A;  3FYC A;  1QDR A;  4KT0 F;  1R2Z A;  2J7O A;  1PM5 A;  2LH0 A;  3VKG A;  3HZJ A;  3JR5 A;  5KPR A;  4DV7 M;  3L25 A;  3B9P A;  1NHG C;  4D82 A;  1HR0 M;  2UUB M;  4PT5 A;  3TWK A;  2LXE A;  3I51 A;  3QAU A;  2C96 A;  4AKI A;  1OAI A;  1XHB A;  1HNX M;  3FUW A;  2R4E A;  3BXW A;  4WW0 A;  3I4V A;  1V92 A;  2UUC M;  2I7P A;  4W5W A;  2L4E A;  3TWL A;  3J2P B;  2XGN A;  1H6U A;  5EXX A;  2QP9 X;  5DNY A;  1J5E M;  2UU9 M;  4Z6Y A;  1L2B A;  4D80 A;  1DGH A;  4DR2 M;  5E6J A;  5FTM A;  2MH8 A;  1EIJ A;  1W5T A;  3KP1 E;  2Y0Q A;  4OU7 A;  4KHP M;  3UMM A;  4F1I A;  4WUR A;  1Z5B A;  2Q2E B;  3HY5 A;  3SMP A;  4DUY M;  2DWN A;  4FCV A;  4AG6 A;  1HT1 E;  4GHA A;  1XWI A;  2JZ0 A;  4NSO B;  4LRS A;  3AOE C;  3B89 A;  1YSY A;  5EP3 A;  3GQ3 A;  2YQZ A;  4II7 A;  3HHX A;  3MJ5 A;  4FW9 A;  1IM2 A;  1Z5C A;  4F2L A;  4HLQ A;  4DV4 M;  1IN6 A;  1P3Q Q;  1QAO A;  2CEA A;  2L2D A;  1L1T A;  1D2N A;  1MX0 A;  5ITY A;  4OVZ A;  3NBX X;  3PVS A;  2C9C A;  4FCT A;  1HQY E;  3HX3 A;  4ZPX A;  5FTJ A;  4JI3 M;  3C58 A;  1JB0 F;  2EA0 A;  1IBL M;  4IBF A;  1HNW M;  5KPZ A;  3GRV A;  2CV0 A;  4MH0 E;  2H1R A;  4LJ9 A;  2HCB A;  4L4U A;  2QBY A;  3AOG A;  2XEP A;  3DOA A;  2FOI C;  3I04 M;  3KW6 A;  3SFZ A;  1NJG A;  5IZ7 D;  3SBJ A;  1N75 A;  4LGY A;  1VDD A;  4L6V 6;  3SC3 A;  5H37 D;  3UGJ A;  3GO8 A;  1IBM M;  3Q8G A;  2DXI A;  4GKJ M;  5C1B A;  4HL4 A;  3KS4 A;  3L29 A;  1T43 A;  3LCV B;  5BPV A;  1MJG M;  1QDT A;  1QUT A;  2DAK A;  3FUT A;  2L09 A;  3SYK A;  1KFV A;  4EIW A;  4ANR A;  2O5R A;  1CUK A;  4IJE A;  4B3T M;  5FTL A;  4AKH A;  4GIT A;  4I8O A;  1QQW A;  1C7Y A;  1Q3B A;  3J7B A;  1SXJ A;  3U61 B;  2CFO A;  5LMN M;  1JR3 A;  4AW4 A;  4R71 A;  3A98 B;  1L1Z A;  1GAB A;  2XFS A;  4GHL A;  1VDL A;  2QNJ A;  3GLH E;  5FLX S;  1SXJ D;  1I4W A;  3V76 A;  3U60 A;  3K92 A;  4GH9 A;  2R46 A;  2JY6 B;  4DV6 M;  2FS1 A;  1LV7 A;  2I7N A;  2C98 A;  2V1U A;  3EIH A;  2ZAO A;  5F3W A;  2KW0 A;  2D7E A;  1KSF X;  2QZ4 A;  1ZMU A;  3GLG B;  2FH0 A;  3I4Y A;  4P16 A;  1NNJ A;  2BJW A;  2YR0 A;  4RF0 A;  1W5S A;  4S12 A;  2DWL A;  3FTF A;  1WJ7 A;  1L2D A;  2JWS A;  1DGB A;  4LJ5 A;  2F5O A;  2RGH A;  4LZZ A;  4CIZ A;  1D0M A;  2K0B X;  5DYI A;  4L16 A;  2XZF A;  4G6Z A;  4JXJ A;  2ZM6 M;  3L27 A;  4IBC A;  3SAS A;  5BR8 M;  2OO9 A;  2EJS A;  4MGZ E;  2UXD M;  1OTR A;  2QCU A;  2QPA A;  1VQ1 A;  2XSZ A;  3U6Q A;  1N34 M;  4LFB M;  4FD2 A;  5JI2 E;  5IWA M;  4IBI A;  2MGW A;  3FTE A;  1IXR C;  2EO2 A;  3TWM A;  3B74 A;  3GQ5 A;  3U6S A;  4YY3 M;  5IRE B;  3HU3 A;  3FYD A;  4L78 A;  3A42 A;  1XNQ M;  4NSR A;  4NC6 A;  1Q02 A;  4BB9 A;  3SAU A;  2DWZ B;  3KDS E;  2KXE A;  2DZO B;  3E4R A;  3HJ8 A;  3THG A;  4Y28 F;  2DVW B;  3JR4 A;  5EP4 A;  1IXS A;  3M6A A;  3F92 A;  1QAQ A;  1Q3C A;  4I5S A;  3T1Y M;  1HNZ M;  1GKI A;  1XB2 B;  2W82 A;  2DKL A;  1VG5 A;  1YE9 A;  2X4A A;  4PDG A;  1J7K A;  1E32 A;  3BBZ A;  3LQR A;  2KNV A;  3U5Z A;  1XMQ M;  1OKS A;  1TF0 B;  4R7G A;  4JI4 M;  3IEC A;  1N33 M;  3C3D A;  3U61 A;  4M0D A;  3D8L A;  2F5P A;  2CP8 A;  2R6F A;  2O25 A;  1GJS A;  3KOW E;  1T3T A;  2CHQ A;  3E21 A;  4HEO A;  1IBK M;  3NBI A;  2OPF A;  1XMO M;  4YHH M;  1AIP C;  1PJS A;  2CRU A;  3FD9 A;  2EUC A;  1XXH B;  5IT9 S;  4LJA A;  4GC9 A;  2KZS A;  4GEW A;  3AKZ A;  4GRI A;  1QYR A;  3ZCB B;  2CV2 A;  2ZBK B;  2DZL A;  2R44 A;  2ZAN A;  2B3T A;  2JZ1 A;  3U6P A;  4NXN M;  4LF4 M;  5FTN A;  1TR8 A;  3RE8 A;  4TUW A;  2G8L A;  3H4M A;  3C3E A;  5E26 A;  3PXG A;  2BWB A;  1R4G A;  2LVP C;  4GKK M;  4I81 A;  4LF9 M;  1WXQ A;  4R3D A;  1DO0 A;  1PRB A;  2LHC A;  3IG5 A;  5DYG A;  2JUJ A;  3L2A A;  2CE7 A;  1AUA A;  2BNK A;  3QWL A;  2V1C A;  3QYB A;  5ITQ A;  5EP2 A;  2LWX A;  5FSW A;  1DGH B;  2MR9 A;  3GLI E;  3VK8 A;  4B3R M;  4RNA A;  1VEJ A;  1HJP A;  4OVZ B;  1XNR M;  1QVR A;  3KOX E;  2DHR A;  4IBJ A;  2OOA A;  3LVW A;  3WHK A;  4QOZ C;  1PJQ A;  4AQY M;  2QSF X;  2AHM A;  4IBG A;  2G3Q A;  3R9X B;  2MRO B;  4B7H A;  3GPY A;  3U6M A;  3K8Z A;  2VQF M;  1DV0 A;  3IG8 A;  4K0K M;  3D8B A;  4DV2 M;  4GIP A;  4JI2 M;  3TQS A;  1NV9 A;  2KRK A;  1QZM A;  2Z8Y M;  3B7N A;  3KSX A;  3I01 M;  2APL A;  3LCU A;  2G5G X;  1S3S A;  3AOE A;  3NWL A;  2H5X A;  2Y0T A;  3RGS A;  2J5Y A;  3SMS A;  1GL7 A;  4LG2 A;  2C99 A;  5JI3 E;  2HKJ A;  3U5Z B;  1L2C A;  4B3S M;  4NRW A;  4JYA M;  3BOS A;  4Q7J A;  3HKP A;  3K2L A;  4LF5 M;  2LNH C;  4NRV A;  1J09 A;  4B08 A;  3VDP A;  1VEK A;  3FUV A;  4NL4 H;  4REZ A;  1WGL A;  3GLF B;  2JA2 A;  4QNR A;  1OQY A;  1XXH A;  3HJQ A;  4UN2 B;  3LVV A;  2M60 A;  2N35 A;  4NOO B;  1WHC A;  3JAM S;  3T1H M;  4RF1 A;  2K9D A;  3KSJ A;  3FE3 A;  3A46 A;  1G4A E;  1WGN A;  7CAT A;  4B7G A;  3KXE C;  2JY5 A;  2LHG A;  2Y20 A;  3MHV C;  3W67 A;  2UUA M;  1NJF A;  2GNO A;  4DV3 M;  4M9Z A;  1WR1 B;  3VFD A;  3PNV A;  2R62 A;  4I4L A;  2FFJ A;  2WSE F;  1IFY A;  1G59 A;  5EJC A;  3GP1 A;  1TTE A;  1IXS B;  3M7G A;  4DR7 M;  1FNN A;  5ITR A;  2DHY A;  1R5L A;  4CJ6 A;  4X66 M;  3B7Q A;  3AFH A;  3SHG B;  3QYE A;  2XZU A;  1JQJ C;  1G71 A;  2DZN B;  1PJT A;  1OAO C;  4GMQ A;  1NVM A;  3GLI B;  3HHY A;  5LMU M;  3GPU A;  4ITQ A;  2KDL A;  3FUX A;  4B7F A;  1SG9 A;  1TH3 A;  4JI6 M;  1NY6 A;  2UXB M;  4Z8X A;  1V33 A;  1GJT A;  3L28 A;  1YUB A;  2X8A A;  1GVN A;  1N36 M;  1QAM A;  2RGO A;  1ZMW A;  3SAW A;  2C5R A;  2WSF F;  2C9O A;  3TPZ A;  1Y8G A;  3CTW B;  2KA6 B;  1K3X A;  3H4J A;  2D7H A;  3FUU A;  2VDB B;  4FCW A;  4DV1 M;  3FRI A;  2Y21 A;  2ZTC A;  4JN6 A;  3GPX A;  4XGI A;  5DFL A;  1MU5 A;  1Z6T A;  3K1J A;  3T38 A;  3LQQ A;  1UM8 A;  1T6O A;  4PDI A;  1Q39 A;  3C9P A;  3SAR A;  4MGY E;  2WSC F;  4KLN A;  3R8F A;  3KS8 A;  2LTU A;  4L15 A;  4MGI E;  1NY5 A;  3UK6 A;  4X65 M;  3UJN A;  3DZD A;  2VQE M;  3IHP A;  4JV5 M;  4MM3 B;  2JY7 A;  2KZU A;  2CHG A;  2KRU A;  2HWJ A;  1NHW C;  3DA1 A;  3MK6 A;  4LF7 M;  3W68 A;  3KFU G;  2Z7J A;  3HHZ A;  4PCZ A;  4LFA M;  1TH4 A;  2XLJ A;  3VLF B;  2Z4S A;  2DAM A;  1DGG A;  5KO3 A;  4LJ7 A;  2HAK A;  1IQP A;  1C1K A;  1QUS A;  5KQD A;  3FKE A;  3AL0 C;  4DR3 M;  2OOB A;  4LY6 A;  3CF2 A;  5EXS A;  1NSF A;  2JP7 A;  1QAN A;  2ERC A;  2J7N A;  4IIW A;  4D81 A;  3AV0 A;  3GLF E;  1N78 A;  3HU1 A;  4DBG B;  3GLF A;  3J80 S;  2CHV A;  1JR3 E;  2BWE A;  1FJG M;  2DWM A;  1IN4 A;  1EFU B;  1L8Q A;  2MJ5 B;  2CUZ A;  1IN8 A;  2DI0 A;  5ITX A;  2Z3X A;  1TDH A;  1UFZ A;  5A2Q S;  1Z5A A;  4DR6 M;  2KNA A;  3B7Z A;  1PGY A;  3HJS A;  1GO5 A;  2DAG A;  3HHW A;  3U6O A;  4AKG A;  5KPT A;  3AJI B;  4DR4 M;  1SXJ E;  1NNU C;  1N77 A;  4DR1 M;  2R18 A;  2QBY B;  3GRU A;  3GLI A;  3SHF A;  2D7G A;  1X37 A;  1IY0 A;  1PJI A;  1D0K A;  4LCB A;  1A5T A;  2KNZ A;  3KP0 E;  3LW5 F;  4LRT A;  4JI7 M;  4NXM M;  1TGU A;  5ITU A;  4AI6 A;  2L7H A;  3U6L A;  1IY2 A;  3VKH A;  2L4F A;  3L26 A;  1OIZ A;  3TE6 A;  2DEN A;  3T6P A;  2ZAM A;  1EE8 A;  3SAV A;  3DFZ A;  3E46 A;  2BJV A;  3K9P A;  2R4J A;  2KEB A;  4LFC M;  4G4N A;  1TH2 A;  5EXT A;  1I94 M;  3A45 A;  3J27 B;  3LMM A;  3J7A S;  2O01 F;  4CHT B;  4KOD A;  4X64 M;  4FWG A;  1PJJ A;  2VII A;  4G3O A;  1NO1 A;  2ZTD A;  2WZJ A;  4IBK A;  1LTM A;  1MN3 A;  3ILK A;  4FWH A;  2XF3 A;  4FWD A;  4MB7 A;  4RKU F;  4MGH A;  4DUZ M;  2R0I A;  3OTO M;  4IBD A;  1OFI A;  4PD2 A; 
#chains in the Genus database with same CATH homology
 4QNM A;  3HWS A;  3U6E A;  3SAT A;  2K47 A;  1IY1 A;  1DO2 A;  1E94 E;  4LJ4 A;  3ZH9 B;  3KOY E;  5EQT A;  2CV1 A;  1JR3 D;  2RKO A;  4LF8 M;  3W0F A;  4JI1 M;  1XC8 A;  2Z4R A;  1DGF A;  5GKN A;  2P5T A;  1R6B X;  3PFI A;  4M9S A;  4LJ8 A;  3HU2 A;  1SXJ B;  2V6Z M;  2X49 A;  3GPP A;  2L7I A;  1SXJ C;  3J81 S;  3U6C A;  4JI5 M;  5FTK A;  1G8P A;  1GL6 A;  5ITT A;  3TL4 X;  3CF0 A;  3GRY A;  4XBO A;  1K3W A;  4KO8 A;  1IN7 A;  4B3M M;  4LF6 M;  3KVW A;  4IJF A;  3CF6 E;  1R2Y A;  3VK7 A;  1Z59 A;  4AZF A;  1E9S A;  3UZU A;  1ORY B;  4M0W A;  4L8R C;  2XH9 A;  1IXZ A;  3EIE A;  4JI0 M;  2FNA A;  1IN5 A;  3VDU A;  5KQ8 A;  4GC5 A;  3SYL A;  4CGY B;  4DV0 M;  3M0E A;  2F4V M;  2F5S A;  3HGI A;  5EP1 A;  1OFH A;  2R45 A;  2XSZ D;  5EXP A;  3RGP A;  8CAT A;  4AG5 A;  4IBE A;  1N32 M;  3GLG A;  1TDZ A;  2UXC M;  3E9S A;  3W0L B;  4DR5 M;  3Q8X A;  2R65 A;  1HT2 E;  4QHS A;  3GLH A;  3WHL A;  2HL7 A;  2YFQ A;  3ZC7 B;  5ITX E;  2F5N A;  4LJ6 A;  4BLC A;  1HQC A;  2A5Y B;  4QHT A;  4IBB A;  3U6D A;  1KYI A;  2L6O A;  2M5Z A;  3FTC A;  4CIS A;  1GLN A;  5C18 A;  4OW0 A;  2XFT A;  1G41 A;  2YNM D;  1ZQ9 A;  3KOZ E;  4LZJ A;  2E5L M;  4OX9 M;  1G3I A;  4G4O A;  3GQ4 A;  3GRR A;  2HHH M;  4JI8 M;  4A3V B;  4DV5 M;  4X62 M;  1R7R A;  3FTD A;  4M9X A;  3PNY A;  2QEN A;  4FVM A;  2F5Q A;  4G4R A;  3RFW A;  3GLH B;  2OQ4 A;  3U60 B;  4QOS A;  1OJL A;  3T15 A;  4G4Q A;  1K82 A;  4MGK E;  4BBA A;  4LGM A;  1E9R A;  2FE8 A;  2NQ8 C;  1ZAE A;  3FYC A;  1R2Z A;  2J7O A;  1PM5 A;  2LH0 A;  3VKG A;  3JR5 A;  5KPR A;  4DV7 M;  3L25 A;  3B9P A;  1NHG C;  4D82 A;  1HR0 M;  2UUB M;  4PT5 A;  3TWK A;  2LXE A;  3I51 A;  3QAU A;  2C96 A;  4AKI A;  1XHB A;  1HNX M;  3FUW A;  2R4E A;  4WW0 A;  3I4V A;  2I7P A;  4W5W A;  3TWL A;  3J2P B;  2XGN A;  1H6U A;  5EXX A;  2QP9 X;  5DNY A;  1J5E M;  2UU9 M;  4Z6Y A;  1L2B A;  4D80 A;  1DGH A;  4DR2 M;  5E6J A;  5FTM A;  1W5T A;  3KP1 E;  2Y0Q A;  4OU7 A;  4KHP M;  3UMM A;  4WUR A;  1Z5B A;  2Q2E B;  3SMP A;  4DUY M;  2DWN A;  4FCV A;  4AG6 A;  1HT1 E;  4GHA A;  1XWI A;  4NSO B;  4LRS A;  3AOE C;  1YSY A;  5EP3 A;  3GQ3 A;  2YQZ A;  4II7 A;  3HHX A;  3MJ5 A;  4FW9 A;  1IM2 A;  1Z5C A;  4HLQ A;  4DV4 M;  1IN6 A;  1QAO A;  2CEA A;  1L1T A;  1D2N A;  1MX0 A;  5ITY A;  4OVZ A;  3PVS A;  2C9C A;  4FCT A;  1HQY E;  4ZPX A;  5FTJ A;  4JI3 M;  3C58 A;  2UUC M;  2EA0 A;  1IBL M;  4IBF A;  1HNW M;  5KPZ A;  3GRV A;  2CV0 A;  4MH0 E;  2H1R A;  4LJ9 A;  2HCB A;  4L4U A;  2QBY A;  3AOG A;  2XEP A;  3DOA A;  2FOI C;  3KW6 A;  3SFZ A;  1NJG A;  5IZ7 D;  3SBJ A;  1N75 A;  4LGY A;  1VDD A;  3SC3 A;  3UGJ A;  5H37 D;  1IBM M;  3GO8 A;  2DXI A;  4GKJ M;  5C1B A;  4HL4 A;  3KS4 A;  3L29 A;  5BPV A;  3FUT A;  3SYK A;  2L09 A;  1KFV A;  4EIW A;  4B3T M;  2O5R A;  4IJE A;  5FTL A;  4AKH A;  4GIT A;  4I8O A;  1QQW A;  1Q3B A;  3J7B A;  1SXJ A;  3U61 B;  2CFO A;  5LMN M;  1JR3 A;  4AW4 A;  3A98 B;  1L1Z A;  2XFS A;  4GHL A;  5FLX S;  1SXJ D;  1I4W A;  3U60 A;  3K92 A;  4GH9 A;  2R46 A;  2V1U A;  4DV6 M;  1LV7 A;  2I7N A;  2C98 A;  3EIH A;  2ZAO A;  5F3W A;  2KW0 A;  2D7E A;  1KSF X;  2QZ4 A;  3GLG B;  3I4Y A;  4P16 A;  1NNJ A;  2BJW A;  2YR0 A;  4RF0 A;  1W5S A;  4S12 A;  2DWL A;  3FTF A;  1L2D A;  2F5O A;  1DGB A;  4LJ5 A;  2RGH A;  4LZZ A;  5DYI A;  4L16 A;  2XZF A;  4G6Z A;  4JXJ A;  2ZM6 M;  3L27 A;  4IBC A;  3SAS A;  5BR8 M;  4MGZ E;  2UXD M;  2QCU A;  2QPA A;  2XSZ A;  3U6Q A;  1N34 M;  4LFB M;  4FD2 A;  5JI2 E;  5IWA M;  4IBI A;  3FTE A;  1IXR C;  2EO2 A;  3TWM A;  3GQ5 A;  3U6S A;  4YY3 M;  5IRE B;  3HU3 A;  3FYD A;  4L78 A;  3A42 A;  1XNQ M;  4NSR A;  4BB9 A;  3SAU A;  2DWZ B;  3KDS E;  2KXE A;  3HJ8 A;  2DZO B;  3E4R A;  3THG A;  3JR4 A;  2DVW B;  5EP4 A;  3M6A A;  1QAQ A;  1Q3C A;  4I5S A;  3T1Y M;  1HNZ M;  1GKI A;  2W82 A;  2X4A A;  1YE9 A;  4PDG A;  1J7K A;  1E32 A;  3LQR A;  1XMQ M;  3U5Z A;  4R7G A;  4JI4 M;  1N33 M;  3U61 A;  4M0D A;  3D8L A;  2F5P A;  3KOW E;  1T3T A;  2CHQ A;  1IBK M;  3NBI A;  2OPF A;  1XMO M;  4YHH M;  3FD9 A;  2EUC A;  1XXH B;  5IT9 S;  4LJA A;  4GC9 A;  2KZS A;  3AKZ A;  4GRI A;  1QYR A;  3ZCB B;  2CV2 A;  2ZBK B;  2ZAN A;  3U6P A;  4NXN M;  4LF4 M;  5FTN A;  3RE8 A;  4TUW A;  2G8L A;  3H4M A;  5E26 A;  3PXG A;  4GKK M;  4I81 A;  4LF9 M;  1WXQ A;  4R3D A;  1DO0 A;  3IG5 A;  5DYG A;  3L2A A;  2CE7 A;  2BNK A;  3QWL A;  2V1C A;  5ITQ A;  5EP2 A;  2LWX A;  5FSW A;  1DGH B;  3VK8 A;  4B3R M;  4RNA A;  4OVZ B;  1XNR M;  1QVR A;  3KOX E;  2DHR A;  4IBJ A;  3LVW A;  3WHK A;  4QOZ C;  4AQY M;  2AHM A;  4IBG A;  3R9X B;  4B7H A;  3GPY A;  3U6M A;  3K8Z A;  2VQF M;  3IG8 A;  4K0K M;  3D8B A;  4DV2 M;  4GIP A;  4JI2 M;  3TQS A;  2KRK A;  1QZM A;  3KSX A;  2G5G X;  1S3S A;  3AOE A;  3NWL A;  2Y0T A;  3RGS A;  3SMS A;  1GL7 A;  4LG2 A;  2C99 A;  5JI3 E;  2HKJ A;  3U5Z B;  1L2C A;  4B3S M;  4NRW A;  4JYA M;  3BOS A;  3HKP A;  3K2L A;  4LF5 M;  2LNH C;  4NRV A;  1J09 A;  4B08 A;  3VDP A;  3FUV A;  4NL4 H;  4REZ A;  3GLF B;  2JA2 A;  4QNR A;  1XXH A;  3HJQ A;  3LVV A;  2M60 A;  4NOO B;  3JAM S;  3T1H M;  4RF1 A;  3KSJ A;  3A46 A;  1G4A E;  7CAT A;  4B7G A;  3KXE C;  2Y20 A;  3MHV C;  2UUA M;  1NJF A;  4DV3 M;  4M9Z A;  3VFD A;  3PNV A;  2R62 A;  4I4L A;  2FFJ A;  1G59 A;  5EJC A;  3GP1 A;  1IXS B;  3M7G A;  4DR7 M;  1FNN A;  5ITR A;  4X66 M;  3AFH A;  3SHG B;  2XZU A;  1JQJ C;  2DZN B;  4GMQ A;  1NVM A;  3GLI B;  3HHY A;  5LMU M;  3GPU A;  4ITQ A;  3FUX A;  4B7F A;  4JI6 M;  1TH3 A;  2UXB M;  1NY6 A;  4Z8X A;  3L28 A;  1YUB A;  2X8A A;  1GVN A;  1N36 M;  1QAM A;  2RGO A;  3SAW A;  2C5R A;  2C9O A;  3TPZ A;  3CTW B;  2KA6 B;  1K3X A;  2D7H A;  3FUU A;  4FCW A;  4DV1 M;  2Y21 A;  4JN6 A;  3GPX A;  4XGI A;  1MU5 A;  1Z6T A;  3K1J A;  3T38 A;  3LQQ A;  1UM8 A;  4PDI A;  1Q39 A;  3SAR A;  4MGY E;  4KLN A;  3R8F A;  3KS8 A;  3UK6 A;  4L15 A;  4MGI E;  1NY5 A;  4X65 M;  3UJN A;  3DZD A;  2VQE M;  4JV5 M;  4MM3 B;  2KZU A;  2CHG A;  2KRU A;  1NHW C;  3DA1 A;  3MK6 A;  4LF7 M;  3KFU G;  2Z7J A;  3HHZ A;  4PCZ A;  4LFA M;  1TH4 A;  2XLJ A;  3VLF B;  2Z4S A;  1DGG A;  5KO3 A;  4LJ7 A;  1IQP A;  1C1K A;  5KQD A;  3FKE A;  3AL0 C;  4DR3 M;  4LY6 A;  5EXS A;  3CF2 A;  1NSF A;  1QAN A;  2ERC A;  2J7N A;  4IIW A;  4D81 A;  3AV0 A;  1N78 A;  3HU1 A;  3GLF A;  3J80 S;  2CHV A;  1FJG M;  2DWM A;  1IN4 A;  1L8Q A;  2CUZ A;  1IN8 A;  5ITX A;  2Z3X A;  1TDH A;  5A2Q S;  1Z5A A;  4DR6 M;  3HJS A;  3HHW A;  3U6O A;  4AKG A;  5KPT A;  3AJI B;  4DR4 M;  1SXJ E;  1NNU C;  1N77 A;  4DR1 M;  2R18 A;  2QBY B;  3GRU A;  3GLI A;  3SHF A;  2D7G A;  1X37 A;  1IY0 A;  1PJI A;  4LCB A;  3KP0 E;  4LRT A;  4JI7 M;  4NXM M;  1TGU A;  5ITU A;  4AI6 A;  2L7H A;  3U6L A;  1IY2 A;  3VKH A;  3L26 A;  3TE6 A;  2ZAM A;  1EE8 A;  3SAV A;  3DFZ A;  2BJV A;  2R4J A;  2KEB A;  4LFC M;  4G4N A;  1TH2 A;  5EXT A;  1I94 M;  3A45 A;  3J27 B;  3LMM A;  3J7A S;  4CHT B;  4KOD A;  4X64 M;  4FWG A;  1PJJ A;  2VII A;  4IBK A;  3ILK A;  4FWH A;  4FWD A;  2XF3 A;  4MB7 A;  4DUZ M;  4MGH A;  3OTO M;  4IBD A;  1OFI A;  4PD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...