2C5RA

The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EARLY PROTEIN P16.7
publication title Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Dna-binding protein/dna
total genus 21
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2c5rA00
2C5RA 2BNKA 1ZAEA
chains in the Genus database with same CATH superfamily
2F5OA 3D8LA 4LF6M 2QBYA 4AKGA 1QAQA 1IY2A 3AKZA 4GHAA 3TE6A 3V76A 4LJ6A 1TR8A 4NC6A 1QYRA 1VEKA 1VQ1A 4WURA 4IBEA 5L8RF 1XMQM 3PVSA 2O25A 1Z5BA 2MR9A 3ZH9B 3BOSA 4P16A 4G3OA 4GRIA 4KO8A 2F5SA 3VFDA 2H5XA 2LH0A 4G4QA 5A2QS 1DO0A 4GITA 2DHRA 3W0FA 5H37D 2C5RA 1SXJE 3I51A 3HU1A 1L2BA 1XNQM 4LRSA 5DFLA 1NY6A 1N77A 3NBXX 4JI2M 3B74A 5ITYA 4JI5M 4GHLA 1TH3A 2MH8A 4LJ7A 3FUXA 3MK6A 2W82A 4FW9A 5EQTA 5IREB 2KDLA 4HLQA 1XMOM 1GL6A 5ITUA 3KOYE 1OAIA 1VG5A 1XHBA 2P5TA 3R8FA 1SXJC 1QVRA 2O01F 3K8ZA 3JR5A 2HL7A 3HJ8A 4MGKE 3SYKA 3W68A 4WP2A 2VF7A 1WGNA 3T6PA 4JV5M 3HU3A 4FWGA 4X64M 1NV8A 4KLNA 1PGYA 1V34A 3SMPA 2J7OA 2B3TA 1NNUC 2DZLA 2R62A 3GPUA 3GPXA 3C9PA 3LVVA 2F5NA 1YE9A 1E9SA 2ZM6M 4GMQA 4MB7A 4X66M 2FE8A 4LGMA 2MGWA 4KODA 4D81A 3H4JA 1Q3BA 1YSYA 3HJSA 5ITXE 2R65A 3FRIA 3KP1E 2LVOC 1TH4A 2C9OA 5FTMA 3GLGE 2DWZB 2L09A 3C3DA 1E32A 1IBMM 2KZSA 2M5ZA 1ZMWA 1DGFA 1G71A 1DV0A 3CF0A 1GJTA 3HY5A 1ZAEA 3Q8XA 3VLFB 4MGZE 1Q02A 5EXSA 4OU7A 2KRKA 4L8RC 4ITQA 1KSFX 4JXJA 3F92A 4DR5M 2Z4SA 2X4AA 2DXIA 3KFUG 3HHWA 1IY0A 2Y0QA 3HU2A 1SXJD 4DR1M 4L16A 2YR0A 3DFZA 1C7YA 1T6OA 5EP2A 1YLAA 2RRUA 3B9PA 4MM3B 3U6OA 3U6QA 3U61B 1N34M 1G41A 3J27B 3TPZA 3K1JA 3AV0A 4BBAA 2L7IA 3TWLA 4K0KM 1L1ZA 1IXSB 1QANA 2KRUA 1DGBA 1HT2E 4Q7JA 2Y0TA 2K47A 4LGYA 5ITQA 3C3EA 1SXJB 2A5YB 3QYEA 4PDGA 1DO2A 2QP9X 4XK8F 5C18A 3K92A 2R4EA 2Z8YM 3L26A 3WHKA 1Q39A 5LMUM 2L7HA 3E9SA 3UZUA 2JNHA 2KZUA 4JI7M 4G4NA 1N75A 1QDRA 3GLHE 2LTUA 2MJ5B 2DWLA 4B3TM 1ZMUA 4F1IA 3SATA 2DHYA 2DAKA 1G59A 4ZPXA 1IXZA 2LXEA 4OVZA 1MX0A 4FD2A 5DYGA 1OTRA 4XBOA 4F2LA 4LFBM 3U6EA 3A42A 4AI6A 4AG5A 5FTJA 1L8QA 2Y21A 2BNKA 2OQ4A 4X65M 1IN4A 1JR3D 2V1CA 4LZJA 3VK8A 2OOBA 2Q2EB 1DGHA 3UK6A 3GRYA 1HR0M 2KHHA 1GABA 3GLGB 1E9RA 2QNJA 2YFQA 4RF0A 3L29A 2KA6B 3E4RA 5IWAM 2EA0A 2X8AA 3LW5F 3VDUA 4LF7M 2C96A 3RFWA 3J7AS 2GQFA 2BWEA 3GQ3A 2XH9A 3KDSE 1PJTA 1E94E 4PT5A 4M9ZA 3PXGA 4QHSA 4MGHA 2R18A 1IXSA 3SAUA 2KXEA 3TL4X 5FTLA 5ITTA 3BBZA 4IBIA 4PD2A 1QUTA 2EKKA 2LVNC 4IBGA 1SXJA 2DVWB 1OIZA 1VEJA 3GPPA 4DV0M 2G5GX 4DV4M 3KS8A 1UFZA 3JR4A 1R6BX 1TTEA 5EP3A 1OFIA 5IZ7D 5LMNM 4QOZC 3D8BA 3CF2A 3LVWA 3RGPA 2XEPA 2BJWA 1PJJA 3MMPA 2QHOB 3BXWA 3KSXA 4LCBA 4I81A 4REZA 2JY6B 4D80A 2K0BX 1MN3A 2R6FA 4QOSA 4QNRA 3GLFE 2C99A 3VK7A 5KPTA 3AOEC 4PCZA 2R4JA 4CHTB 2CV1A 3GLIB 4FWDA 2N35A 4B3MM 4HL4A 2I7NA 5ITRA 2FOIC 1WGLA 1EFUB 1I94M 3B89A 4LG2A 1VDDA 3GLHB 4FWHA 3HKPA 4IBJA 2WZJA 1L1TA 1NVMA 3GO8A 1WR1B 2CV0A 4B7GA 1NV9A 5C1BA 5KO3A 2DNAA 1XXHB 3M0EA 4IBFA 3GLGA 2YNMD 4UN2B 1OAOC 1XC8A 4B08A 3CTWB 1NSFA 5EP1A 1KFVA 5KQ8A 4MH0E 5BPVA 4KHPM 3AJIB 4MGIE 1PJSA 2V1UA 3U60B 2RKOA 2C98A 1XWIA 2CHGA 3C58A 3HHXA 1JR3A 1VEGA 2XFTA 1NNJA 1HNZM 3AL0C 5IT9S 1KYIA 4EIWA 3FTDA 2UXBM 4I5SA 3L28A 1R4GA 2L4EA 3M7GA 5DNYA 4IJEA 4JI6M 3EIHA 2FFJA 2XLJA 2HAKA 4AKHA 4R7GA 1TF0B 2L4FA 2AHMA 4CISA 1N78A 3PFIA 7CATA 1I4WA 1W5TA 4DR6M 2WSEF 3RGSA 1QZEA 1NO1A 1Y8GA 1QDTA 1S3SA 1R2ZA 1QAMA 1Z5AA 4OX9M 2ZBKB 4G4OA 2OOAA 4DR2M 2GNOA 4P17A 1TH2A 3SAVA 4JI1M 4GKKM 3K9OA 1HQCA 2APLA 4NRWA 1YUBA 2LVAA 1BVSA 2VF8A 1H6UA 4JI3M 1IBLM 3LQRA 4LFCM 2QPAA 3B7ZA 4JN6A 3GLIA 1JQJC 3J81S 4LF4M 3ZCBB 4G6ZA 1UM8A 3IECA 3GLHA 2FNAA 3SAWA 1NHWC 1PM5A 1G4AE 2H1RA 1L2DA 4NXNM 3FUVA 3KOZE 2DWMA 4R71A 3M6AA 1D0MA 1W5SA 2I7PA 3GLFB 1XXHA 2CRUA 3W0LB 1G8PA 1TDHA 2JY7A 3E46A 4YHHM 1GVNA 2C9CA 4IJFA 1EIJA 1IN5A 2JWSA 2OO9A 1SG9A 4M0DA 2HKJA 5EXTA 4GEWA 1L2CA 2HHHM 2JZ1A 4YY3M 3B7QA 3SYLA 2CFOA 4IBBA 4Y28F 3LMMA 3KOXE 2WSCF 1HNXM 2QENA 1TGUA 4QHTA 1P3QQ 4LJ8A 4DV1M 2QBYB 1D0LA 3HZJA 5EJCA 1R7RA 1HJPA 2E5LM 2VQFM 2YQZA 3MJ5A 2FS1A 2KNAA 3J7BA 3FTEA 2X49A 2R44A 3AFHA 3HHYA 3THGA 2KNVA 2XGNA 1HT1E 4DV3M 2HCBA 4DV5M 1XB2B 2BWBA 4G4RA 4GC9A 3HWSA 2UXCM 4PDIA 3R9XB 2JUJA 3IG8A 5BR8M 2DZNB 3GQ5A 4Z8XA 4WW0A 4RF1A 1GKIA 3GRUA 1J7KA 4A3VB 4JI4M 4II7A 1K3XA 3U61A 3SARA 2DKLA 1GL7A 3GRVA 4RNAA 1IXRC 1WJ7A 3DOAA 4CJ6A 2CEAA 1OIPA 5GKNA 3FYCA 4IBCA 3TQSA 3U6CA 1G3IA 3K2LA 4I4LA 1IN6A 1IM2A 4CIZA 4NOOB 4B7HA 2Y20A 5E26A 3SMSA 3CF6E 1WHCA 4ANRA 3U6MA 2CP8A 4HEOA 1MU5A 1LV7A 2R46A 4I8OA 3GLFA 1OQYA 1PJIA 2UXDM 3SASA 2QCUA 3K9PA 4LJ5A 4NSOB 1Q3CA 2J5YA 2RGHA 5EP4A 2CV2A 1T3TA 3SFZA 2G3QA 1Z6TA 3QYBA 5FTNA 3RE8A 4LFAM 2UU9M 1PRBA 4AKIA 3FD9A 3IG5A 2Z3XA 3IHPA 1V33A 2DAEA 1ZQ9A 5JI3E 2JXNA 2LVQD 2WSFF 2DAIA 2UUCM 2F5PA 5EXXA 3FYDA 1IFYA 4DR7M 4M0WA 1VDLA 1NHGC 5KQDA 3U6PA 4LF9M 4LJ9A 4NXMM 5F3WA 2XF3A 4L4UA 2ZAOA 3U6LA 3VDPA 1X37A 3T38A 5ITXA 1NJFA 3T15A 2DAMA 3I04M 3KW6A 2FH0A 2D7HA 1AIPC 4FVMA 1ZV1A 1IN8A 4DR3M 1OKSA 2HWJA 1V92A 3KS4A 3I4YA 3UGJA 3DA1A 2ERCA 1TDZA 3HGIA 2CUZA 3KP0E 4NSRA 2BJVA 4IBKA 3FRHA 3FKEA 2ZTCA 4GH9A 3OTOM 3W67A 2QZ4A 1D2NA 1PJQA 3FUTA 3LCUA 1LTMA 1QQWA 2XFSA 3SHFA 3VKGA 1QAOA 4LY6A 1JB0F 3U5ZB 2NQ8C 3UMMA 2DAGA 3AOGA 4D82A 2DZOB 4FCVA 2JA2A 2ZAMA 2XSZD 4L15A 2VIIA 3SBJA 2KNZA 4FCWA 3CGWA 4QNMA 4B3SM 4LRTA 4BB9A 4DUYM 3HX3A 2DWNA 2DENA 2K6BA 2K9DA 4Z6YA 3NBIA 1K3WA 5KPRA 4BLCA 4JI8M 1R2YA 4LZZA 1IBKM 1WXQA 4LF8M 2MROB 4OW0A 1OJLA 2LHCA 2L2DA 4M9XA 1J5EM 1HNWM 2L6OA 3E21A 3A46A 3I01M 1OFHA 5FLXS 2KEBA 2CHQA 3SC3A 3T1YM 2DI0A 2CWBA 4JYAM 4L78A 5DYIA 3L2AA 2CE7A 4OVZB 4DUZM 4XGIA 3U6DA 3J80S 2VQEM 3B7NA 2CHVA 1ORYB 4GC5A 4L6V6 2EKFA 1Z59A 3L27A 2XZFA 4DR4M 2M60A 4LJ4A 1JR3E 1DGHB 1HQYE 4CGYB 3UJNA 4FCTA 2QSFX 3U6SA 4LJAA 3J2PB 3KVWA 3MHVC 4RKUF 3HHZA 1EE8A 4DBGB 5EXPA 3SHGB 1NY5A 4AQYM 1QZMA 3KXEC 3PNYA 3PNVA 4B7FA 2LBCA 1GJSA 5FTKA 4DV6M 5E6JA 4R3DA 1WIVA 3U60A 1K82A 3FTCA 2EUCA 2EO2A 2V6ZM 2JZ0A 3I4VA 1J09A 1DGGA 1GLNA 5JI2E 2QQ8A 4TUWA 1GO5A 2EJSA 2J7NA 4IBDA 4M9SA 4AG6A 3GPYA 3FE3A 3U5ZA 2UUAM 1N32M 2JY8A 5FSWA 1FJGM 1FNNA 4KT0F 2ZANA 4LF5M 2XZUA 3LCVB 2F4VM 2G8LA 2Z4RA 3NWLA 2R45A 3Q8GA 3GLIE 4DV7M 3QAUA 1IY1A 4AZFA 1R5LA 3FUUA 3JAMS 1NJGA 3T1HM 1F4IA 3A98B 3KSJA 2ZTDA 1IN7A 1IQPA 2LHGA 4X62M 2XSZA 1A5TA 3ZQJA 4IIWA 3FUWA 4NRVA 3ZC7B 2JP7A 1XXHE 8CATA 5KPZA 1Z5CA 1T43A 3KOWE 4AW4A 3TWMA 1N33M 3DZDA 1D0KA 2VDBB 3GQ4A 2R0IA 3A45A 3AOEA 4MGYE 4S12A 1ZMVA 2OPFA 2Z7JA 1MJGM 3VKHA 1N36M 4DV2M 3GRRA 2RGOA 4NL4H 2JY5A 3WHLA 2KW0A 1XNRM 4B3RM 4GIPA 1QUSA 2D7GA 3QWLA 4W5WA 1RU3A 3FTFA 3ILKA 2UUBM 2LWXA 3GP1A 3EIEA 4JI0M 3TWKA 1CUKA 3L25A 2LNHC 2LVPC 2O5RA 2D7EA 3H4MA 4GKJM 1AUAA 3LQQA 1C1KA 2F5QA 3HJQA
chains in the Genus database with same CATH topology
2F5OA 3D8LA 4LF6M 2QBYA 4AKGA 1QAQA 1IY2A 3AKZA 4GHAA 3TE6A 4LJ6A 4WURA 1QYRA 1XMQM 4IBEA 3PVSA 1Z5BA 3ZH9B 3BOSA 4P16A 4GRIA 4KO8A 2F5SA 3VFDA 2LH0A 4G4QA 5A2QS 1DO0A 4GITA 2DHRA 3W0FA 5H37D 2C5RA 1SXJE 3I51A 3HU1A 1L2BA 1XNQM 4LRSA 1NY6A 1N77A 4JI2M 5ITYA 4JI5M 4GHLA 1TH3A 5EQTA 4LJ7A 3FUXA 3MK6A 2W82A 4FW9A 5IREB 1XMOM 4HLQA 1GL6A 5ITUA 3KOYE 1XHBA 3R8FA 2P5TA 1SXJC 1QVRA 3K8ZA 3JR5A 2HL7A 3HJ8A 4MGKE 3SYKA 4JV5M 3HU3A 4FWGA 4X64M 4KLNA 3SMPA 2J7OA 1NNUC 2R62A 3GPUA 3GPXA 2F5NA 3LVVA 1YE9A 1E9SA 2ZM6M 4GMQA 4MB7A 4X66M 2FE8A 4LGMA 4D81A 4KODA 5ITXE 4LFCM 1Q3BA 1YSYA 3HJSA 4DR7M 2R65A 3KP1E 1TH4A 2C9OA 5FTMA 2DWZB 2L09A 1E32A 1IBMM 2KZSA 2M5ZA 1DGFA 3CF0A 1ZAEA 3Q8XA 3VLFB 4MGZE 5EXSA 4OU7A 2KRKA 4L8RC 4ITQA 1KSFX 4JXJA 4DR5M 2Z4SA 2X4AA 2DXIA 3KFUG 3HHWA 1IY0A 2Y0QA 3HU2A 1SXJD 4DR1M 4L16A 2YR0A 3DFZA 5EP2A 3U6QA 3U61B 3B9PA 4MM3B 3U6OA 1N34M 1G41A 3J27B 3TPZA 3K1JA 3AV0A 4BBAA 2L7IA 3TWLA 4K0KM 1L1ZA 1IXSB 1QANA 2KRUA 1DGBA 1HT2E 2Y0TA 2K47A 4LGYA 5ITQA 1SXJB 2A5YB 4PDGA 1DO2A 2QP9X 5C18A 3K92A 2R4EA 3L26A 3WHKA 1Q39A 5LMUM 2L7HA 3E9SA 3UZUA 2KZUA 4JI7M 4G4NA 1N75A 2DWLA 4B3TM 3SATA 1G59A 4ZPXA 1IXZA 2LXEA 4OVZA 1MX0A 4FD2A 5DYGA 4XBOA 4LFBM 4AI6A 3U6EA 3A42A 4AG5A 5FTJA 1L8QA 2Y21A 2BNKA 4X65M 1IN4A 1JR3D 2V1CA 4LZJA 3VK8A 2Q2EB 1DGHA 3UK6A 3GRYA 1HR0M 3GLGB 1E9RA 2YFQA 4RF0A 3L29A 2KA6B 3E4RA 5IWAM 2EA0A 2X8AA 3VDUA 4LF7M 2C96A 3RFWA 3J7AS 3GQ3A 2XH9A 3KDSE 1E94E 4PT5A 4M9ZA 3PXGA 4QHSA 4MGHA 2R18A 3SAUA 2KXEA 3TL4X 5FTLA 5ITTA 4IBIA 4PD2A 4IBGA 1SXJA 2DVWB 3GPPA 4DV0M 2G5GX 4DV4M 3KS8A 3JR4A 1R6BX 5EP3A 5IZ7D 1OFIA 5LMNM 4QOZC 3D8BA 3CF2A 3LVWA 3RGPA 2XEPA 2BJWA 1PJJA 3KSXA 4LCBA 4I81A 4REZA 4D80A 4QOSA 4QNRA 2C99A 3VK7A 5KPTA 3AOEC 4PCZA 2R4JA 4CHTB 2CV1A 3GLIB 4FWDA 4B3MM 4HL4A 2I7NA 5ITRA 2FOIC 1I94M 4LG2A 1VDDA 3GLHB 4FWHA 3HKPA 4IBJA 1L1TA 1NVMA 3GO8A 2CV0A 4B7GA 5C1BA 5KO3A 1XXHB 3M0EA 4IBFA 3GLGA 2YNMD 1XC8A 4B08A 3CTWB 1NSFA 5EP1A 1KFVA 5KQ8A 4MH0E 5BPVA 4KHPM 3AJIB 4MGIE 2V1UA 3U60B 2RKOA 2C98A 1XWIA 2CHGA 3C58A 3HHXA 1JR3A 2XFTA 1HNZM 1NNJA 3AL0C 5IT9S 1KYIA 4EIWA 3FTDA 2UXBM 4I5SA 3L28A 3M7GA 5DNYA 4IJEA 4JI6M 3EIHA 2FFJA 2XLJA 4AKHA 4R7GA 4CISA 2AHMA 1N78A 3PFIA 7CATA 1I4WA 1W5TA 4DR6M 3RGSA 1S3SA 1R2ZA 1QAMA 1Z5AA 4OX9M 2ZBKB 4G4OA 4DR2M 3SAVA 4JI1M 1TH2A 4GKKM 1HQCA 4NRWA 1YUBA 1H6UA 4JI3M 1IBLM 3LQRA 2QPAA 4JN6A 3GLIA 1JQJC 3J81S 4LF4M 3ZCBB 4G6ZA 1UM8A 3GLHA 2FNAA 3SAWA 1NHWC 1PM5A 1G4AE 2H1RA 1L2DA 4NXNM 3FUVA 3KOZE 2DWMA 3M6AA 1W5SA 2I7PA 3GLFB 1XXHA 3W0LB 4YHHM 1G8PA 1TDHA 1GVNA 2C9CA 4IJFA 1IN5A 4M0DA 2HKJA 5EXTA 1L2CA 2HHHM 4YY3M 3SYLA 2CFOA 4IBBA 3LMMA 3KOXE 1HNXM 2QENA 1TGUA 4QHTA 4LJ8A 4DV1M 2QBYB 5EJCA 1R7RA 2E5LM 2VQFM 2YQZA 3MJ5A 3J7BA 3FTEA 2X49A 3HHYA 3AFHA 3THGA 2XGNA 1HT1E 4DV3M 2HCBA 4DV5M 4G4RA 4GC9A 3HWSA 2UXCM 4PDIA 3R9XB 3IG8A 5BR8M 2DZNB 3GQ5A 4Z8XA 4WW0A 4RF1A 1GKIA 3GRUA 1J7KA 4A3VB 4JI4M 4II7A 1K3XA 3U61A 3SARA 1GL7A 3GRVA 4RNAA 1IXRC 3DOAA 2CEAA 5GKNA 3FYCA 4IBCA 3TQSA 3U6CA 1G3IA 3K2LA 4I4LA 1IN6A 1IM2A 4NOOB 4B7HA 2Y20A 5E26A 3SMSA 3CF6E 3U6MA 1MU5A 1LV7A 2R46A 4I8OA 3GLFA 1PJIA 2UXDM 3SASA 2QCUA 4LJ5A 4NSOB 1Q3CA 2RGHA 5EP4A 2CV2A 1T3TA 3SFZA 1Z6TA 5FTNA 3RE8A 4LFAM 2UU9M 4AKIA 3FD9A 3IG5A 2Z3XA 1ZQ9A 5JI3E 2UUCM 2F5PA 5EXXA 3FYDA 4M0WA 5KQDA 1NHGC 3U6PA 4LF9M 4LJ9A 4NXMM 5F3WA 2XF3A 4L4UA 2ZAOA 3U6LA 3VDPA 1X37A 3T38A 5ITXA 1NJFA 3T15A 4FVMA 3KW6A 2D7HA 1IN8A 4DR3M 1TDZA 3KS4A 3I4YA 3UGJA 3DA1A 2ERCA 3HGIA 2CUZA 3KP0E 4NSRA 2BJVA 4IBKA 3FKEA 4GH9A 3OTOM 2QZ4A 1D2NA 3FUTA 1QQWA 2XFSA 3SHFA 3VKGA 1QAOA 4LY6A 3U5ZB 2NQ8C 3UMMA 3AOGA 4D82A 2DZOB 4FCVA 2JA2A 2ZAMA 2XSZD 4L15A 2VIIA 3SBJA 4FCWA 4QNMA 4B3SM 4LRTA 4BB9A 4DUYM 2DWNA 1K3WA 4Z6YA 3NBIA 5KPRA 4BLCA 4JI8M 1R2YA 4LZZA 1IBKM 1WXQA 4LF8M 4OW0A 1OJLA 1J5EM 4M9XA 1HNWM 2L6OA 3A46A 1OFHA 5FLXS 2KEBA 2CHQA 3SC3A 3T1YM 4JYAM 4L78A 5DYIA 3L2AA 2CE7A 4OVZB 4DUZM 4XGIA 3U6DA 3J80S 2VQEM 2CHVA 1ORYB 4GC5A 1Z59A 3L27A 2XZFA 4DR4M 2M60A 4LJ4A 3UJNA 1DGHB 1HQYE 4CGYB 4FCTA 3U6SA 4LJAA 3J2PB 3KVWA 3MHVC 3HHZA 1EE8A 5EXPA 3SHGB 1NY5A 4AQYM 1QZMA 3KXEC 3PNYA 3PNVA 4B7FA 5FTKA 4DV6M 5E6JA 4R3DA 3U60A 1K82A 3FTCA 2EUCA 2EO2A 2V6ZM 3I4VA 1J09A 1DGGA 1GLNA 5JI2E 4TUWA 3U5ZA 2J7NA 4IBDA 4M9SA 4AG6A 3GPYA 1N32M 2UUAM 1FJGM 5FSWA 1FNNA 2ZANA 4LF5M 2XZUA 2F4VM 2G8LA 2Z4RA 3NWLA 2R45A 4DV7M 3QAUA 1IY1A 4AZFA 3JAMS 3FUUA 1NJGA 3T1HM 3A98B 3KSJA 1IN7A 1IQPA 4X62M 2XSZA 2OQ4A 4IIWA 3FUWA 4NRVA 3ZC7B 8CATA 5KPZA 1XNRM 1N33M 1Z5CA 3KOWE 4AW4A 3TWMA 3DZDA 3GQ4A 3A45A 3AOEA 4MGYE 4S12A 2OPFA 2Z7JA 3VKHA 1N36M 4DV2M 3GRRA 2RGOA 4NL4H 3WHLA 2KW0A 4B3RM 4GIPA 2D7GA 3QWLA 4W5WA 3FTFA 3ILKA 2UUBM 2LWXA 3GP1A 3EIEA 4JI0M 3TWKA 3L25A 2LNHC 2O5RA 2D7EA 3H4MA 4GKJM 3LQQA 1C1KA 2F5QA 3HJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5R A;  2BNK A;  1ZAE A; 
#chains in the Genus database with same CATH topology
 2F5O A;  3D8L A;  4LF6 M;  2QBY A;  4AKG A;  1QAQ A;  1IY2 A;  3AKZ A;  4GHA A;  3TE6 A;  3V76 A;  4LJ6 A;  1TR8 A;  4NC6 A;  1QYR A;  1VEK A;  1VQ1 A;  4WUR A;  4IBE A;  5L8R F;  1XMQ M;  3PVS A;  2O25 A;  1Z5B A;  2MR9 A;  3ZH9 B;  3BOS A;  4P16 A;  4G3O A;  4GRI A;  4KO8 A;  2F5S A;  3VFD A;  2H5X A;  2LH0 A;  4G4Q A;  5A2Q S;  1DO0 A;  4GIT A;  2DHR A;  3W0F A;  5H37 D;  2C5R A;  1SXJ E;  3I51 A;  3HU1 A;  1L2B A;  1XNQ M;  4LRS A;  5DFL A;  1NY6 A;  1N77 A;  3NBX X;  4JI2 M;  3B74 A;  5ITY A;  4JI5 M;  4GHL A;  1TH3 A;  2MH8 A;  4LJ7 A;  3FUX A;  3MK6 A;  2W82 A;  4FW9 A;  5EQT A;  5IRE B;  2KDL A;  4HLQ A;  1XMO M;  1GL6 A;  5ITU A;  3KOY E;  1OAI A;  1VG5 A;  1XHB A;  2P5T A;  3R8F A;  1SXJ C;  1QVR A;  2O01 F;  3K8Z A;  3JR5 A;  2HL7 A;  3HJ8 A;  4MGK E;  3SYK A;  3W68 A;  4WP2 A;  2VF7 A;  1WGN A;  3T6P A;  4JV5 M;  3HU3 A;  4FWG A;  4X64 M;  1NV8 A;  4KLN A;  1PGY A;  1V34 A;  3SMP A;  2J7O A;  2B3T A;  1NNU C;  2DZL A;  2R62 A;  3GPU A;  3GPX A;  3C9P A;  3LVV A;  2F5N A;  1YE9 A;  1E9S A;  2ZM6 M;  4GMQ A;  4MB7 A;  4X66 M;  2FE8 A;  4LGM A;  2MGW A;  4KOD A;  4D81 A;  3H4J A;  1Q3B A;  1YSY A;  3HJS A;  5ITX E;  2R65 A;  3FRI A;  3KP1 E;  2LVO C;  1TH4 A;  2C9O A;  5FTM A;  3GLG E;  2DWZ B;  2L09 A;  3C3D A;  1E32 A;  1IBM M;  2KZS A;  2M5Z A;  1ZMW A;  1DGF A;  1G71 A;  1DV0 A;  3CF0 A;  1GJT A;  3HY5 A;  1ZAE A;  3Q8X A;  3VLF B;  4MGZ E;  1Q02 A;  5EXS A;  4OU7 A;  2KRK A;  4L8R C;  4ITQ A;  1KSF X;  4JXJ A;  3F92 A;  4DR5 M;  2Z4S A;  2X4A A;  2DXI A;  3KFU G;  3HHW A;  1IY0 A;  2Y0Q A;  3HU2 A;  1SXJ D;  4DR1 M;  4L16 A;  2YR0 A;  3DFZ A;  1C7Y A;  1T6O A;  5EP2 A;  1YLA A;  2RRU A;  3B9P A;  4MM3 B;  3U6O A;  3U6Q A;  3U61 B;  1N34 M;  1G41 A;  3J27 B;  3TPZ A;  3K1J A;  3AV0 A;  4BBA A;  2L7I A;  3TWL A;  4K0K M;  1L1Z A;  1IXS B;  1QAN A;  2KRU A;  1DGB A;  1HT2 E;  4Q7J A;  2Y0T A;  2K47 A;  4LGY A;  5ITQ A;  3C3E A;  1SXJ B;  2A5Y B;  3QYE A;  4PDG A;  1DO2 A;  2QP9 X;  4XK8 F;  5C18 A;  3K92 A;  2R4E A;  2Z8Y M;  3L26 A;  3WHK A;  1Q39 A;  5LMU M;  2L7H A;  3E9S A;  3UZU A;  2JNH A;  2KZU A;  4JI7 M;  4G4N A;  1N75 A;  1QDR A;  3GLH E;  2LTU A;  2MJ5 B;  2DWL A;  4B3T M;  1ZMU A;  4F1I A;  3SAT A;  2DHY A;  2DAK A;  1G59 A;  4ZPX A;  1IXZ A;  2LXE A;  4OVZ A;  1MX0 A;  4FD2 A;  5DYG A;  1OTR A;  4XBO A;  4F2L A;  4LFB M;  3U6E A;  3A42 A;  4AI6 A;  4AG5 A;  5FTJ A;  1L8Q A;  2Y21 A;  2BNK A;  2OQ4 A;  4X65 M;  1IN4 A;  1JR3 D;  2V1C A;  4LZJ A;  3VK8 A;  2OOB A;  2Q2E B;  1DGH A;  3UK6 A;  3GRY A;  1HR0 M;  2KHH A;  1GAB A;  3GLG B;  1E9R A;  2QNJ A;  2YFQ A;  4RF0 A;  3L29 A;  2KA6 B;  3E4R A;  5IWA M;  2EA0 A;  2X8A A;  3LW5 F;  3VDU A;  4LF7 M;  2C96 A;  3RFW A;  3J7A S;  2GQF A;  2BWE A;  3GQ3 A;  2XH9 A;  3KDS E;  1PJT A;  1E94 E;  4PT5 A;  4M9Z A;  3PXG A;  4QHS A;  4MGH A;  2R18 A;  1IXS A;  3SAU A;  2KXE A;  3TL4 X;  5FTL A;  5ITT A;  3BBZ A;  4IBI A;  4PD2 A;  1QUT A;  2EKK A;  2LVN C;  4IBG A;  1SXJ A;  2DVW B;  1OIZ A;  1VEJ A;  3GPP A;  4DV0 M;  2G5G X;  4DV4 M;  3KS8 A;  1UFZ A;  3JR4 A;  1R6B X;  1TTE A;  5EP3 A;  1OFI A;  5IZ7 D;  5LMN M;  4QOZ C;  3D8B A;  3CF2 A;  3LVW A;  3RGP A;  2XEP A;  2BJW A;  1PJJ A;  3MMP A;  2QHO B;  3BXW A;  3KSX A;  4LCB A;  4I81 A;  4REZ A;  2JY6 B;  4D80 A;  2K0B X;  1MN3 A;  2R6F A;  4QOS A;  4QNR A;  3GLF E;  2C99 A;  3VK7 A;  5KPT A;  3AOE C;  4PCZ A;  2R4J A;  4CHT B;  2CV1 A;  3GLI B;  4FWD A;  2N35 A;  4B3M M;  4HL4 A;  2I7N A;  5ITR A;  2FOI C;  1WGL A;  1EFU B;  1I94 M;  3B89 A;  4LG2 A;  1VDD A;  3GLH B;  4FWH A;  3HKP A;  4IBJ A;  2WZJ A;  1L1T A;  1NVM A;  3GO8 A;  1WR1 B;  2CV0 A;  4B7G A;  1NV9 A;  5C1B A;  5KO3 A;  2DNA A;  1XXH B;  3M0E A;  4IBF A;  3GLG A;  2YNM D;  4UN2 B;  1OAO C;  1XC8 A;  4B08 A;  3CTW B;  1NSF A;  5EP1 A;  1KFV A;  5KQ8 A;  4MH0 E;  5BPV A;  4KHP M;  3AJI B;  4MGI E;  1PJS A;  2V1U A;  3U60 B;  2RKO A;  2C98 A;  1XWI A;  2CHG A;  3C58 A;  3HHX A;  1JR3 A;  1VEG A;  2XFT A;  1NNJ A;  1HNZ M;  3AL0 C;  5IT9 S;  1KYI A;  4EIW A;  3FTD A;  2UXB M;  4I5S A;  3L28 A;  1R4G A;  2L4E A;  3M7G A;  5DNY A;  4IJE A;  4JI6 M;  3EIH A;  2FFJ A;  2XLJ A;  2HAK A;  4AKH A;  4R7G A;  1TF0 B;  2L4F A;  2AHM A;  4CIS A;  1N78 A;  3PFI A;  7CAT A;  1I4W A;  1W5T A;  4DR6 M;  2WSE F;  3RGS A;  1QZE A;  1NO1 A;  1Y8G A;  1QDT A;  1S3S A;  1R2Z A;  1QAM A;  1Z5A A;  4OX9 M;  2ZBK B;  4G4O A;  2OOA A;  4DR2 M;  2GNO A;  4P17 A;  1TH2 A;  3SAV A;  4JI1 M;  4GKK M;  3K9O A;  1HQC A;  2APL A;  4NRW A;  1YUB A;  2LVA A;  1BVS A;  2VF8 A;  1H6U A;  4JI3 M;  1IBL M;  3LQR A;  4LFC M;  2QPA A;  3B7Z A;  4JN6 A;  3GLI A;  1JQJ C;  3J81 S;  4LF4 M;  3ZCB B;  4G6Z A;  1UM8 A;  3IEC A;  3GLH A;  2FNA A;  3SAW A;  1NHW C;  1PM5 A;  1G4A E;  2H1R A;  1L2D A;  4NXN M;  3FUV A;  3KOZ E;  2DWM A;  4R71 A;  3M6A A;  1D0M A;  1W5S A;  2I7P A;  3GLF B;  1XXH A;  2CRU A;  3W0L B;  1G8P A;  1TDH A;  2JY7 A;  3E46 A;  4YHH M;  1GVN A;  2C9C A;  4IJF A;  1EIJ A;  1IN5 A;  2JWS A;  2OO9 A;  1SG9 A;  4M0D A;  2HKJ A;  5EXT A;  4GEW A;  1L2C A;  2HHH M;  2JZ1 A;  4YY3 M;  3B7Q A;  3SYL A;  2CFO A;  4IBB A;  4Y28 F;  3LMM A;  3KOX E;  2WSC F;  1HNX M;  2QEN A;  1TGU A;  4QHT A;  1P3Q Q;  4LJ8 A;  4DV1 M;  2QBY B;  1D0L A;  3HZJ A;  5EJC A;  1R7R A;  1HJP A;  2E5L M;  2VQF M;  2YQZ A;  3MJ5 A;  2FS1 A;  2KNA A;  3J7B A;  3FTE A;  2X49 A;  2R44 A;  3AFH A;  3HHY A;  3THG A;  2KNV A;  2XGN A;  1HT1 E;  4DV3 M;  2HCB A;  4DV5 M;  1XB2 B;  2BWB A;  4G4R A;  4GC9 A;  3HWS A;  2UXC M;  4PDI A;  3R9X B;  2JUJ A;  3IG8 A;  5BR8 M;  2DZN B;  3GQ5 A;  4Z8X A;  4WW0 A;  4RF1 A;  1GKI A;  3GRU A;  1J7K A;  4A3V B;  4JI4 M;  4II7 A;  1K3X A;  3U61 A;  3SAR A;  2DKL A;  1GL7 A;  3GRV A;  4RNA A;  1IXR C;  1WJ7 A;  3DOA A;  4CJ6 A;  2CEA A;  1OIP A;  5GKN A;  3FYC A;  4IBC A;  3TQS A;  3U6C A;  1G3I A;  3K2L A;  4I4L A;  1IN6 A;  1IM2 A;  4CIZ A;  4NOO B;  4B7H A;  2Y20 A;  5E26 A;  3SMS A;  3CF6 E;  1WHC A;  4ANR A;  3U6M A;  2CP8 A;  4HEO A;  1MU5 A;  1LV7 A;  2R46 A;  4I8O A;  3GLF A;  1OQY A;  1PJI A;  2UXD M;  3SAS A;  2QCU A;  3K9P A;  4LJ5 A;  4NSO B;  1Q3C A;  2J5Y A;  2RGH A;  5EP4 A;  2CV2 A;  1T3T A;  3SFZ A;  2G3Q A;  1Z6T A;  3QYB A;  5FTN A;  3RE8 A;  4LFA M;  2UU9 M;  1PRB A;  4AKI A;  3FD9 A;  3IG5 A;  2Z3X A;  3IHP A;  1V33 A;  2DAE A;  1ZQ9 A;  5JI3 E;  2JXN A;  2LVQ D;  2WSF F;  2DAI A;  2UUC M;  2F5P A;  5EXX A;  3FYD A;  1IFY A;  4DR7 M;  4M0W A;  1VDL A;  1NHG C;  5KQD A;  3U6P A;  4LF9 M;  4LJ9 A;  4NXM M;  5F3W A;  2XF3 A;  4L4U A;  2ZAO A;  3U6L A;  3VDP A;  1X37 A;  3T38 A;  5ITX A;  1NJF A;  3T15 A;  2DAM A;  3I04 M;  3KW6 A;  2FH0 A;  2D7H A;  1AIP C;  4FVM A;  1ZV1 A;  1IN8 A;  4DR3 M;  1OKS A;  2HWJ A;  1V92 A;  3KS4 A;  3I4Y A;  3UGJ A;  3DA1 A;  2ERC A;  1TDZ A;  3HGI A;  2CUZ A;  3KP0 E;  4NSR A;  2BJV A;  4IBK A;  3FRH A;  3FKE A;  2ZTC A;  4GH9 A;  3OTO M;  3W67 A;  2QZ4 A;  1D2N A;  1PJQ A;  3FUT A;  3LCU A;  1LTM A;  1QQW A;  2XFS A;  3SHF A;  3VKG A;  1QAO A;  4LY6 A;  1JB0 F;  3U5Z B;  2NQ8 C;  3UMM A;  2DAG A;  3AOG A;  4D82 A;  2DZO B;  4FCV A;  2JA2 A;  2ZAM A;  2XSZ D;  4L15 A;  2VII A;  3SBJ A;  2KNZ A;  4FCW A;  3CGW A;  4QNM A;  4B3S M;  4LRT A;  4BB9 A;  4DUY M;  3HX3 A;  2DWN A;  2DEN A;  2K6B A;  2K9D A;  4Z6Y A;  3NBI A;  1K3W A;  5KPR A;  4BLC A;  4JI8 M;  1R2Y A;  4LZZ A;  1IBK M;  1WXQ A;  4LF8 M;  2MRO B;  4OW0 A;  1OJL A;  2LHC A;  2L2D A;  4M9X A;  1J5E M;  1HNW M;  2L6O A;  3E21 A;  3A46 A;  3I01 M;  1OFH A;  5FLX S;  2KEB A;  2CHQ A;  3SC3 A;  3T1Y M;  2DI0 A;  2CWB A;  4JYA M;  4L78 A;  5DYI A;  3L2A A;  2CE7 A;  4OVZ B;  4DUZ M;  4XGI A;  3U6D A;  3J80 S;  2VQE M;  3B7N A;  2CHV A;  1ORY B;  4GC5 A;  4L6V 6;  2EKF A;  1Z59 A;  3L27 A;  2XZF A;  4DR4 M;  2M60 A;  4LJ4 A;  1JR3 E;  1DGH B;  1HQY E;  4CGY B;  3UJN A;  4FCT A;  2QSF X;  3U6S A;  4LJA A;  3J2P B;  3KVW A;  3MHV C;  4RKU F;  3HHZ A;  1EE8 A;  4DBG B;  5EXP A;  3SHG B;  1NY5 A;  4AQY M;  1QZM A;  3KXE C;  3PNY A;  3PNV A;  4B7F A;  2LBC A;  1GJS A;  5FTK A;  4DV6 M;  5E6J A;  4R3D A;  1WIV A;  3U60 A;  1K82 A;  3FTC A;  2EUC A;  2EO2 A;  2V6Z M;  2JZ0 A;  3I4V A;  1J09 A;  1DGG A;  1GLN A;  5JI2 E;  2QQ8 A;  4TUW A;  1GO5 A;  2EJS A;  2J7N A;  4IBD A;  4M9S A;  4AG6 A;  3GPY A;  3FE3 A;  3U5Z A;  2UUA M;  1N32 M;  2JY8 A;  5FSW A;  1FJG M;  1FNN A;  4KT0 F;  2ZAN A;  4LF5 M;  2XZU A;  3LCV B;  2F4V M;  2G8L A;  2Z4R A;  3NWL A;  2R45 A;  3Q8G A;  3GLI E;  4DV7 M;  3QAU A;  1IY1 A;  4AZF A;  1R5L A;  3FUU A;  3JAM S;  1NJG A;  3T1H M;  1F4I A;  3A98 B;  3KSJ A;  2ZTD A;  1IN7 A;  1IQP A;  2LHG A;  4X62 M;  2XSZ A;  1A5T A;  3ZQJ A;  4IIW A;  3FUW A;  4NRV A;  3ZC7 B;  2JP7 A;  1XXH E;  8CAT A;  5KPZ A;  1Z5C A;  1T43 A;  3KOW E;  4AW4 A;  3TWM A;  1N33 M;  3DZD A;  1D0K A;  2VDB B;  3GQ4 A;  2R0I A;  3A45 A;  3AOE A;  4MGY E;  4S12 A;  1ZMV A;  2OPF A;  2Z7J A;  1MJG M;  3VKH A;  1N36 M;  4DV2 M;  3GRR A;  2RGO A;  4NL4 H;  2JY5 A;  3WHL A;  2KW0 A;  1XNR M;  4B3R M;  4GIP A;  1QUS A;  2D7G A;  3QWL A;  4W5W A;  1RU3 A;  3FTF A;  3ILK A;  2UUB M;  2LWX A;  3GP1 A;  3EIE A;  4JI0 M;  3TWK A;  1CUK A;  3L25 A;  2LNH C;  2LVP C;  2O5R A;  2D7E A;  3H4M A;  4GKJ M;  1AUA A;  3LQQ A;  1C1K A;  2F5Q A;  3HJQ A; 
#chains in the Genus database with same CATH homology
 2F5O A;  3D8L A;  4LF6 M;  2QBY A;  4AKG A;  1QAQ A;  1IY2 A;  3AKZ A;  4GHA A;  3TE6 A;  4LJ6 A;  4WUR A;  1QYR A;  1XMQ M;  4IBE A;  3PVS A;  1Z5B A;  3ZH9 B;  3BOS A;  4P16 A;  4GRI A;  4KO8 A;  2F5S A;  3VFD A;  2LH0 A;  4G4Q A;  5A2Q S;  1DO0 A;  4GIT A;  2DHR A;  3W0F A;  5H37 D;  2C5R A;  1SXJ E;  3I51 A;  3HU1 A;  1L2B A;  1XNQ M;  4LRS A;  1NY6 A;  1N77 A;  4JI2 M;  5ITY A;  4JI5 M;  4GHL A;  1TH3 A;  5EQT A;  4LJ7 A;  3FUX A;  3MK6 A;  2W82 A;  4FW9 A;  5IRE B;  1XMO M;  4HLQ A;  1GL6 A;  5ITU A;  3KOY E;  1XHB A;  3R8F A;  2P5T A;  1SXJ C;  1QVR A;  3K8Z A;  3JR5 A;  2HL7 A;  3HJ8 A;  4MGK E;  3SYK A;  4JV5 M;  3HU3 A;  4FWG A;  4X64 M;  4KLN A;  3SMP A;  2J7O A;  1NNU C;  2R62 A;  3GPU A;  3GPX A;  2F5N A;  3LVV A;  1YE9 A;  1E9S A;  2ZM6 M;  4GMQ A;  4MB7 A;  4X66 M;  2FE8 A;  4LGM A;  4D81 A;  4KOD A;  5ITX E;  4LFC M;  1Q3B A;  1YSY A;  3HJS A;  4DR7 M;  2R65 A;  3KP1 E;  1TH4 A;  2C9O A;  5FTM A;  2DWZ B;  2L09 A;  1E32 A;  1IBM M;  2KZS A;  2M5Z A;  1DGF A;  3CF0 A;  1ZAE A;  3Q8X A;  3VLF B;  4MGZ E;  5EXS A;  4OU7 A;  2KRK A;  4L8R C;  4ITQ A;  1KSF X;  4JXJ A;  4DR5 M;  2Z4S A;  2X4A A;  2DXI A;  3KFU G;  3HHW A;  1IY0 A;  2Y0Q A;  3HU2 A;  1SXJ D;  4DR1 M;  4L16 A;  2YR0 A;  3DFZ A;  5EP2 A;  3U6Q A;  3U61 B;  3B9P A;  4MM3 B;  3U6O A;  1N34 M;  1G41 A;  3J27 B;  3TPZ A;  3K1J A;  3AV0 A;  4BBA A;  2L7I A;  3TWL A;  4K0K M;  1L1Z A;  1IXS B;  1QAN A;  2KRU A;  1DGB A;  1HT2 E;  2Y0T A;  2K47 A;  4LGY A;  5ITQ A;  1SXJ B;  2A5Y B;  4PDG A;  1DO2 A;  2QP9 X;  5C18 A;  3K92 A;  2R4E A;  3L26 A;  3WHK A;  1Q39 A;  5LMU M;  2L7H A;  3E9S A;  3UZU A;  2KZU A;  4JI7 M;  4G4N A;  1N75 A;  2DWL A;  4B3T M;  3SAT A;  1G59 A;  4ZPX A;  1IXZ A;  2LXE A;  4OVZ A;  1MX0 A;  4FD2 A;  5DYG A;  4XBO A;  4LFB M;  4AI6 A;  3U6E A;  3A42 A;  4AG5 A;  5FTJ A;  1L8Q A;  2Y21 A;  2BNK A;  4X65 M;  1IN4 A;  1JR3 D;  2V1C A;  4LZJ A;  3VK8 A;  2Q2E B;  1DGH A;  3UK6 A;  3GRY A;  1HR0 M;  3GLG B;  1E9R A;  2YFQ A;  4RF0 A;  3L29 A;  2KA6 B;  3E4R A;  5IWA M;  2EA0 A;  2X8A A;  3VDU A;  4LF7 M;  2C96 A;  3RFW A;  3J7A S;  3GQ3 A;  2XH9 A;  3KDS E;  1E94 E;  4PT5 A;  4M9Z A;  3PXG A;  4QHS A;  4MGH A;  2R18 A;  3SAU A;  2KXE A;  3TL4 X;  5FTL A;  5ITT A;  4IBI A;  4PD2 A;  4IBG A;  1SXJ A;  2DVW B;  3GPP A;  4DV0 M;  2G5G X;  4DV4 M;  3KS8 A;  3JR4 A;  1R6B X;  5EP3 A;  5IZ7 D;  1OFI A;  5LMN M;  4QOZ C;  3D8B A;  3CF2 A;  3LVW A;  3RGP A;  2XEP A;  2BJW A;  1PJJ A;  3KSX A;  4LCB A;  4I81 A;  4REZ A;  4D80 A;  4QOS A;  4QNR A;  2C99 A;  3VK7 A;  5KPT A;  3AOE C;  4PCZ A;  2R4J A;  4CHT B;  2CV1 A;  3GLI B;  4FWD A;  4B3M M;  4HL4 A;  2I7N A;  5ITR A;  2FOI C;  1I94 M;  4LG2 A;  1VDD A;  3GLH B;  4FWH A;  3HKP A;  4IBJ A;  1L1T A;  1NVM A;  3GO8 A;  2CV0 A;  4B7G A;  5C1B A;  5KO3 A;  1XXH B;  3M0E A;  4IBF A;  3GLG A;  2YNM D;  1XC8 A;  4B08 A;  3CTW B;  1NSF A;  5EP1 A;  1KFV A;  5KQ8 A;  4MH0 E;  5BPV A;  4KHP M;  3AJI B;  4MGI E;  2V1U A;  3U60 B;  2RKO A;  2C98 A;  1XWI A;  2CHG A;  3C58 A;  3HHX A;  1JR3 A;  2XFT A;  1HNZ M;  1NNJ A;  3AL0 C;  5IT9 S;  1KYI A;  4EIW A;  3FTD A;  2UXB M;  4I5S A;  3L28 A;  3M7G A;  5DNY A;  4IJE A;  4JI6 M;  3EIH A;  2FFJ A;  2XLJ A;  4AKH A;  4R7G A;  4CIS A;  2AHM A;  1N78 A;  3PFI A;  7CAT A;  1I4W A;  1W5T A;  4DR6 M;  3RGS A;  1S3S A;  1R2Z A;  1QAM A;  1Z5A A;  4OX9 M;  2ZBK B;  4G4O A;  4DR2 M;  3SAV A;  4JI1 M;  1TH2 A;  4GKK M;  1HQC A;  4NRW A;  1YUB A;  1H6U A;  4JI3 M;  1IBL M;  3LQR A;  2QPA A;  4JN6 A;  3GLI A;  1JQJ C;  3J81 S;  4LF4 M;  3ZCB B;  4G6Z A;  1UM8 A;  3GLH A;  2FNA A;  3SAW A;  1NHW C;  1PM5 A;  1G4A E;  2H1R A;  1L2D A;  4NXN M;  3FUV A;  3KOZ E;  2DWM A;  3M6A A;  1W5S A;  2I7P A;  3GLF B;  1XXH A;  3W0L B;  4YHH M;  1G8P A;  1TDH A;  1GVN A;  2C9C A;  4IJF A;  1IN5 A;  4M0D A;  2HKJ A;  5EXT A;  1L2C A;  2HHH M;  4YY3 M;  3SYL A;  2CFO A;  4IBB A;  3LMM A;  3KOX E;  1HNX M;  2QEN A;  1TGU A;  4QHT A;  4LJ8 A;  4DV1 M;  2QBY B;  5EJC A;  1R7R A;  2E5L M;  2VQF M;  2YQZ A;  3MJ5 A;  3J7B A;  3FTE A;  2X49 A;  3HHY A;  3AFH A;  3THG A;  2XGN A;  1HT1 E;  4DV3 M;  2HCB A;  4DV5 M;  4G4R A;  4GC9 A;  3HWS A;  2UXC M;  4PDI A;  3R9X B;  3IG8 A;  5BR8 M;  2DZN B;  3GQ5 A;  4Z8X A;  4WW0 A;  4RF1 A;  1GKI A;  3GRU A;  1J7K A;  4A3V B;  4JI4 M;  4II7 A;  1K3X A;  3U61 A;  3SAR A;  1GL7 A;  3GRV A;  4RNA A;  1IXR C;  3DOA A;  2CEA A;  5GKN A;  3FYC A;  4IBC A;  3TQS A;  3U6C A;  1G3I A;  3K2L A;  4I4L A;  1IN6 A;  1IM2 A;  4NOO B;  4B7H A;  2Y20 A;  5E26 A;  3SMS A;  3CF6 E;  3U6M A;  1MU5 A;  1LV7 A;  2R46 A;  4I8O A;  3GLF A;  1PJI A;  2UXD M;  3SAS A;  2QCU A;  4LJ5 A;  4NSO B;  1Q3C A;  2RGH A;  5EP4 A;  2CV2 A;  1T3T A;  3SFZ A;  1Z6T A;  5FTN A;  3RE8 A;  4LFA M;  2UU9 M;  4AKI A;  3FD9 A;  3IG5 A;  2Z3X A;  1ZQ9 A;  5JI3 E;  2UUC M;  2F5P A;  5EXX A;  3FYD A;  4M0W A;  5KQD A;  1NHG C;  3U6P A;  4LF9 M;  4LJ9 A;  4NXM M;  5F3W A;  2XF3 A;  4L4U A;  2ZAO A;  3U6L A;  3VDP A;  1X37 A;  3T38 A;  5ITX A;  1NJF A;  3T15 A;  4FVM A;  3KW6 A;  2D7H A;  1IN8 A;  4DR3 M;  1TDZ A;  3KS4 A;  3I4Y A;  3UGJ A;  3DA1 A;  2ERC A;  3HGI A;  2CUZ A;  3KP0 E;  4NSR A;  2BJV A;  4IBK A;  3FKE A;  4GH9 A;  3OTO M;  2QZ4 A;  1D2N A;  3FUT A;  1QQW A;  2XFS A;  3SHF A;  3VKG A;  1QAO A;  4LY6 A;  3U5Z B;  2NQ8 C;  3UMM A;  3AOG A;  4D82 A;  2DZO B;  4FCV A;  2JA2 A;  2ZAM A;  2XSZ D;  4L15 A;  2VII A;  3SBJ A;  4FCW A;  4QNM A;  4B3S M;  4LRT A;  4BB9 A;  4DUY M;  2DWN A;  1K3W A;  4Z6Y A;  3NBI A;  5KPR A;  4BLC A;  4JI8 M;  1R2Y A;  4LZZ A;  1IBK M;  1WXQ A;  4LF8 M;  4OW0 A;  1OJL A;  1J5E M;  4M9X A;  1HNW M;  2L6O A;  3A46 A;  1OFH A;  5FLX S;  2KEB A;  2CHQ A;  3SC3 A;  3T1Y M;  4JYA M;  4L78 A;  5DYI A;  3L2A A;  2CE7 A;  4OVZ B;  4DUZ M;  4XGI A;  3U6D A;  3J80 S;  2VQE M;  2CHV A;  1ORY B;  4GC5 A;  1Z59 A;  3L27 A;  2XZF A;  4DR4 M;  2M60 A;  4LJ4 A;  3UJN A;  1DGH B;  1HQY E;  4CGY B;  4FCT A;  3U6S A;  4LJA A;  3J2P B;  3KVW A;  3MHV C;  3HHZ A;  1EE8 A;  5EXP A;  3SHG B;  1NY5 A;  4AQY M;  1QZM A;  3KXE C;  3PNY A;  3PNV A;  4B7F A;  5FTK A;  4DV6 M;  5E6J A;  4R3D A;  3U60 A;  1K82 A;  3FTC A;  2EUC A;  2EO2 A;  2V6Z M;  3I4V A;  1J09 A;  1DGG A;  1GLN A;  5JI2 E;  4TUW A;  3U5Z A;  2J7N A;  4IBD A;  4M9S A;  4AG6 A;  3GPY A;  1N32 M;  2UUA M;  1FJG M;  5FSW A;  1FNN A;  2ZAN A;  4LF5 M;  2XZU A;  2F4V M;  2G8L A;  2Z4R A;  3NWL A;  2R45 A;  4DV7 M;  3QAU A;  1IY1 A;  4AZF A;  3JAM S;  3FUU A;  1NJG A;  3T1H M;  3A98 B;  3KSJ A;  1IN7 A;  1IQP A;  4X62 M;  2XSZ A;  2OQ4 A;  4IIW A;  3FUW A;  4NRV A;  3ZC7 B;  8CAT A;  5KPZ A;  1XNR M;  1N33 M;  1Z5C A;  3KOW E;  4AW4 A;  3TWM A;  3DZD A;  3GQ4 A;  3A45 A;  3AOE A;  4MGY E;  4S12 A;  2OPF A;  2Z7J A;  3VKH A;  1N36 M;  4DV2 M;  3GRR A;  2RGO A;  4NL4 H;  3WHL A;  2KW0 A;  4B3R M;  4GIP A;  2D7G A;  3QWL A;  4W5W A;  3FTF A;  3ILK A;  2UUB M;  2LWX A;  3GP1 A;  3EIE A;  4JI0 M;  3TWK A;  3L25 A;  2LNH C;  2O5R A;  2D7E A;  3H4M A;  4GKJ M;  3LQQ A;  1C1K A;  2F5Q A;  3HJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...