2C5RA

The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Membrane Anchorage of Viral Phi 29 DNA During Replication.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Dna-binding protein/dna
molecule keywords EARLY PROTEIN P16.7
total genus 21
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2c5rA00
2C5RA 1ZAEA 2BNKA
chains in the Genus database with same CATH superfamily
1N75A 1CUKA 2CE7A 2JUJA 2EKKA 3R8FA 4Y28F 2Y0TA 3U6EA 1JB0F 3FRIA 4GIPA 2DZNB 2LVQD 3A42A 4RF0A 4W5WA 3PXGA 1NNUC 1IY0A 2MROB 3V76A 5ITXA 2EO2A 1JR3A 2FS1A 1W5TA 1IM2A 4QHTA 2UXBM 4AKHA 2Y20A 2JY7A 4QNRA 3GLGE 2VQEM 5EXSA 5FTKA 1Z6TA 4MGYE 3HHWA 5ITXE 2HHHM 4DR2M 1G8PA 2B3TA 3U6SA 2HL7A 4EIWA 1X37A 2JZ1A 3I51A 2CV2A 4QOSA 4IBIA 1IBKM 3OTOM 4JI1M 1DV0A 4MB7A 4AI6A 3I4VA 2X49A 4LFAM 2RGOA 1HQYE 3CGWA 3KP0E 1KYIA 1LTMA 4LJ6A 4L78A 4RNAA 3GLGB 5C1BA 2ZM6M 2L4FA 5DFLA 1XHBA 4GMQA 3IHPA 2R0IA 2DHYA 3U60A 2XFSA 4LF5M 3TWMA 3J2PB 3HWSA 3AJIB 3B89A 3BBZA 4MGIE 2O01F 3HHZA 1DO2A 3U6PA 1PRBA 4IBFA 2F5PA 4F2LA 2Y21A 4ZPXA 4LCBA 3QAUA 1QYRA 4YY3M 4MGHA 5FTLA 1R4GA 4GEWA 1G41A 4ITQA 2OQ4A 3M0EA 2WSEF 4L4UA 2F5SA 4PDGA 2L7HA 5KQDA 1Q3CA 4DR3M 3FUWA 4LJ7A 1G59A 3T38A 2C9CA 3SHGB 1IN4A 4NSRA 3HGIA 4LFBM 4OU7A 3LCVB 3GLFE 3ZQJA 3B74A 1WJ7A 5JI2E 4DV5M 4DV7M 3A46A 1HNXM 3CF2A 1TH4A 3KDSE 5IREB 1T6OA 3IG8A 3GLFA 2V6ZM 1DGGA 3HZJA 2RGHA 2YFQA 4LRTA 4BLCA 2EA0A 1Y8GA 4FCTA 3HKPA 2QCUA 3HU1A 3B9PA 2DAMA 4FW9A 3KOWE 3E4RA 2CEAA 1JR3E 2KNAA 2C99A 3QYBA 3U61A 1IQPA 1XMQM 4IJFA 3L27A 1OIZA 2GQFA 2OPFA 1Z59A 3AOGA 3AKZA 3AOEA 2DAEA 2EKFA 1K3XA 1SG9A 2LNHC 3U6LA 2ZTDA 1QDRA 1IN7A 1JQJC 1W5SA 1ZMVA 3B7QA 4L6V6 1UFZA 2AHMA 4JI4M 1IY1A 2LVOC 3HU2A 2LTUA 5IZ7D 2D7EA 2NQ8C 1N77A 2LH0A 4LF7M 3GQ5A 2CWBA 2X8AA 1J7KA 4LZZA 4S12A 4PCZA 5EXXA 3U6MA 3GPXA 3EIHA 2EUCA 1OJLA 1VEGA 4XK8F 2VDBB 3W68A 5FLXS 4IBJA 4BBAA 1R7RA 4R71A 1YSYA 2G3QA 3GLHB 3HX3A 3U61B 1HJPA 4QHSA 1QZEA 4AKIA 1L2DA 1C7YA 1NV8A 1VDDA 4NRVA 3VK7A 1L8QA 1OIPA 1GLNA 1VEKA 1IY2A 4XGIA 4CGYB 3GLFB 3SBJA 2UXDM 1OFIA 4JXJA 1IN8A 5DYIA 1AUAA 2CHGA 7CATA 3AL0C 3HHYA 2WZJA 4LJ5A 3TWLA 4B7HA 2K6BA 2JY8A 1NSFA 3LW5F 2DAKA 2I7PA 4FCVA 4FVMA 4AZFA 1GKIA 4AW4A 4JI3M 4G4NA 1OAOC 4AG5A 5EXTA 1OTRA 3VKGA 2Y0QA 1PJSA 2XZUA 3R9XB 4GHLA 4CIZA 2CHQA 4JI2M 2LHCA 5KQ8A 2MJ5B 4JN6A 4Z8XA 3RE8A 1DGBA 1WHCA 3UZUA 2J7NA 1WIVA 2GNOA 3KXEC 1D0MA 1TDHA 2DKLA 3A45A 3GLHE 3KOXE 3ZCBB 4I81A 2F5OA 2KEBA 2KXEA 2QNJA 2RRUA 3J7BA 2K9DA 1DGHB 1L2BA 5A2QS 3SAVA 2W82A 2WSFF 4CJ6A 3PNVA 3MJ5A 3M6AA 5EP4A 2KZUA 3SYKA 1HT2E 1HNWM 3RGSA 3T1YM 2R4EA 5DNYA 4B3TM 3LCUA 1QUTA 1K3WA 3UGJA 4DR7M 3L25A 3SAWA 1VEJA 1XNRM 1TDZA 4AKGA 2LWXA 1TH3A 2G8LA 3U6CA 2R65A 1QVRA 3DOAA 3U6OA 3NWLA 2LBCA 1SXJD 1QANA 2DAIA 3L2AA 1KFVA 1GJTA 1JR3D 4GC5A 2M60A 4HEOA 1VQ1A 4JYAM 4GHAA 2HWJA 1XB2B 2KNZA 1V33A 2DWZB 2JXNA 2ZAMA 3QYEA 4B7GA 4NOOB 1IN6A 4NC6A 1GABA 2UUCM 4B3MM 3WHKA 1Q39A 2DHRA 4X66M 4I5SA 4JI7M 4PDIA 4FWHA 4B3RM 3GRYA 5FSWA 4IIWA 3FYCA 4M9SA 3ILKA 2C9OA 1L1TA 5L8RF 4JI5M 5BR8M 4DR1M 3FTFA 1QAMA 3MHVC 3FUUA 2R46A 2OOBA 3FYDA 4M0WA 3KFUG 2QP9X 4DR6M 2MH8A 1QQWA 4MM3B 1XXHE 5C18A 2DWNA 4L8RC 2L7IA 2L09A 2VF7A 1Q3BA 3KS8A 3J81S 5LMNM 4AQYM 1R5LA 4IBDA 3GPYA 2DZOB 1IXSA 1TF0B 3VLFB 3KP1E 2UU9M 3K9OA 2CV0A 2QHOB 3K8ZA 3Q8XA 3C3DA 2F5QA 2O5RA 5ITYA 4GRIA 2H5XA 3GLIB 2XSZD 1DO0A 2J5YA 3EIEA 2VF8A 3K1JA 4DV2M 4NL4H 1IXSB 1QUSA 2CP8A 2FOIC 3J27B 5E26A 5F3WA 1R2ZA 2QBYB 1EFUB 1N78A 2DAGA 3PFIA 1KSFX 1QZMA 2QBYA 1TH2A 2QZ4A 3SMSA 4B08A 4DV6M 2BNKA 2KZSA 2KDLA 4RF1A 1ZQ9A 2LHGA 2J7OA 4GH9A 1NJGA 2CFOA 3K9PA 4DUZM 3MMPA 4D81A 1HNZM 2K0BX 2QQ8A 1WXQA 2QSFX 3DA1A 2JNHA 2KRUA 5KO3A 1PJJA 3KS4A 3M7GA 3E9SA 3D8BA 3VDPA 1Z5AA 1IXZA 5EP3A 3BXWA 1PM5A 4WW0A 4FCWA 4ANRA 1VDLA 1D2NA 5DYGA 3J7AS 1D0LA 2BJWA 3SHFA 1FNNA 4LJ4A 4LGMA 3C9PA 1SXJE 1XXHB 5KPZA 2JY5A 2KHHA 4L16A 3DZDA 4Q7JA 3GPPA 4QNMA 1GO5A 1J5EM 3QWLA 1F4IA 1IBLM 4G4OA 3GRVA 3I04M 4M9XA 1N36M 2DXIA 3RGPA 1OFHA 4DV0M 1NV9A 2LVAA 4CISA 1NO1A 2XF3A 2JY6B 2Z3XA 2LXEA 5E6JA 2APLA 1YLAA 2YNMD 3HJSA 2K47A 3SYLA 1S3SA 2P5TA 2KA6B 2V1UA 1GJSA 1J09A 1E9RA 3GQ4A 1HQCA 3FKEA 4LF4M 1E94E 4MH0E 2MGWA 1DGHA 1MU5A 4OW0A 4JI0M 1XNQM 1FJGM 1PJIA 2RKOA 4NRWA 2XGNA 3FUVA 2CV1A 3T15A 3NBIA 4OVZB 4UN2B 4A3VB 3KVWA 3VFDA 4LJ8A 2XEPA 1GL6A 2XLJA 3GLIE 1V92A 1LV7A 3FRHA 3THGA 1NHWC 3TQSA 1VG5A 2HAKA 4NXNM 4REZA 4DUYM 4G3OA 4DBGB 1NHGC 2ERCA 5EP1A 1Z5BA 4G6ZA 2EJSA 2Z4RA 2XZFA 2Z7JA 3U5ZA 2C98A 1NY6A 1EE8A 3KSXA 3DFZA 4LRSA 3JAMS 5IWAM 3GO8A 5FTMA 1MJGM 3JR5A 4DV1M 2Z8YM 2ZTCA 3L28A 4XBOA 1SXJB 1PJTA 2H1RA 4I8OA 3SFZA 2XFTA 3IECA 3K2LA 1A5TA 1Q02A 4LZJA 3CTWB 2ZAOA 4M9ZA 3SARA 4LF9M 1NNJA 2XH9A 4LG2A 4OX9M 2WSCF 3VKHA 2A5YB 3HHXA 4PD2A 3C58A 2G5GX 2V1CA 2LVNC 1GVNA 3ZH9B 5ITRA 1HT1E 1OKSA 3K92A 3SATA 4NXMM 3J80S 1IFYA 1PGYA 2KRKA 1GL7A 1E32A 2I7NA 1IXRC 4LGYA 3AFHA 2HCBA 3GLHA 4P16A 2VQFM 4LF8M 1RU3A 1H6UA 2JP7A 1SXJA 2O25A 4D80A 1N34M 1QDTA 2FNAA 3LVWA 4L15A 4AG6A 1R2YA 1Z5CA 2BJVA 1PJQA 1NJFA 3H4MA 3U5ZB 1G3IA 2FFJA 3W67A 3L26A 3GRUA 3GPUA 2R45A 4GKKM 2DWMA 1TGUA 4JV5M 1N32M 4M0DA 3Q8GA 3FTEA 2VIIA 4IBEA 2DI0A 2R4JA 1C1KA 5EQTA 1TR8A 2N35A 1I4WA 2DVWB 3FD9A 3MK6A 4OVZA 3FUXA 2JZ0A 3B7NA 4QOZC 3FE3A 1SXJC 2CUZA 4HL4A 4MGZE 3HJ8A 5EXPA 1BVSA 3TWKA 2ZANA 2R18A 1R6BX 2UXCM 2E5LM 3IG5A 1MN3A 1AIPC 2MR9A 1WR1B 1EIJA 1L1ZA 4KO8A 4KHPM 2FH0A 1ZMWA 2QPAA 1ORYB 3TPZA 5ITTA 4B7FA 4K0KM 2CRUA 4Z6YA 4X64M 3RFWA 2R6FA 2JWSA 4B3SM 4DV3M 1ZMUA 2D7HA 1HR0M 2R62A 3I01M 2F4VM 4II7A 4IBGA 3FTCA 3CF0A 3T6PA 4DV4M 4KODA 1DGFA 5ITUA 4DR5M 2BWBA 4IBBA 1IBMM 4LF6M 2LVPC 1XC8A 3E46A 4GC9A 1P3QQ 1XXHA 2C5RA 4PT5A 2BWEA 2DENA 3NBXX 3U6DA 1TTEA 2R44A 1OAIA 1E9SA 2L6OA 4D82A 4LJ9A 4CHTB 3UMMA 2DZLA 1ZAEA 3E21A 2QENA 4IBCA 3AOEC 4WP2A 1K82A 5JI3E 3U60B 1NY5A 3HJQA 5EJCA 3D8LA 4RKUF 3GLGA 5FTNA 5KPTA 1NVMA 3GP1A 1V34A 4IBKA 3HY5A 2L2DA 3WHLA 3ZC7B 4GITA 2YQZA 4KLNA 4LJAA 3CF6E 2HKJA 4P17A 3UJNA 4JI6M 4LFCM 4GKJM 2UUAM 2F5NA 3LMMA 2L4EA 1L2CA 4WURA 3GRRA 4R3DA 3B7ZA 5BPVA 5LMUM 4HLQA 3W0FA 3KSJA 4FWGA 3T1HM 1OQYA 1ZV1A 3KOZE 3LQQA 5FTJA 5KPRA 1G4AE 1QAOA 3A98B 3LQRA 4NSOB 2DWLA 2YR0A 4KT0F 3SMPA 1WGLA 3VK8A 3FUTA 4F1IA 3FTDA 8CATA 4G4RA 3GLIA 4I4LA 2JA2A 4MGKE 4LY6A 5GKNA 3KOYE 4JI8M 2DNAA 3I4YA 1YE9A 4FD2A 4R7GA 1UM8A 3LVVA 1T3TA 3HU3A 4IJEA 5IT9S 1XMOM 1MX0A 2Q2EB 2CHVA 3F92A 1WGNA 3H4JA 2OOAA 3TE6A 4TUWA 2XSZA 2KW0A 4X65M 3C3EA 4G4QA 3VDUA 3SAUA 1I94M 3U6QA 5ITQA 2FE8A 3W0LB 2UUBM 5H37D 4YHHM 2D7GA 2X4AA 1XWIA 3PVSA 1G71A 4X62M 3AV0A 2M5ZA 3PNYA 1N33M 1IN5A 3GQ3A 2C96A 2OO9A 2Z4SA 2ZBKB 3UK6A 3L29A 1D0KA 3JR4A 4FWDA 4DR4M 3SASA 3SC3A 1YUBA 3TL4X 1QAQA 3BOSA 3KW6A 5EP2A 1T43A 4BB9A 2KNVA
chains in the Genus database with same CATH topology
1N75A 2CE7A 3R8FA 2Y0TA 3U6EA 4GIPA 2DZNB 4W5WA 3A42A 4RF0A 3PXGA 1NNUC 1IY0A 5ITXA 2EO2A 1JR3A 1W5TA 1IM2A 4QHTA 2UXBM 4AKHA 2Y20A 4QNRA 2VQEM 5EXSA 5FTKA 1Z6TA 4MGYE 3HHWA 5ITXE 2HHHM 4DR2M 1G8PA 3U6SA 2HL7A 4EIWA 1X37A 3I51A 2CV2A 4QOSA 4IBIA 1IBKM 3OTOM 4JI1M 4MB7A 4AI6A 3I4VA 2X49A 4LFAM 2RGOA 1HQYE 3KP0E 1KYIA 4LJ6A 4L78A 4RNAA 3GLGB 5C1BA 2ZM6M 1XHBA 4GMQA 3U60A 4LF5M 2XFSA 3TWMA 3J2PB 3HWSA 3AJIB 4MGIE 3HHZA 1DO2A 3U6PA 4IBFA 2F5PA 2Y21A 4ZPXA 4LCBA 3QAUA 1QYRA 4YY3M 4MGHA 5FTLA 1G41A 4ITQA 2OQ4A 3M0EA 4L4UA 2F5SA 4PDGA 2L7HA 5KQDA 1Q3CA 4DR3M 3FUWA 4LJ7A 1G59A 3T38A 2C9CA 3SHGB 1IN4A 4NSRA 3HGIA 4LFBM 4OU7A 5JI2E 4DV5M 4DV7M 3A46A 1HNXM 3CF2A 1TH4A 3KDSE 5IREB 3GLFA 3IG8A 2V6ZM 1DGGA 2RGHA 2YFQA 4LRTA 4BLCA 2EA0A 4FCTA 3HKPA 2QCUA 3HU1A 3B9PA 4FW9A 3KOWE 3E4RA 2CEAA 2C99A 3U61A 1IQPA 1XMQM 4IJFA 3L27A 2OPFA 1Z59A 3AOGA 3AKZA 3AOEA 1K3XA 2LNHC 3U6LA 1IN7A 1JQJC 1W5SA 4JI4M 2AHMA 1IY1A 3HU2A 5IZ7D 2D7EA 2NQ8C 1N77A 2LH0A 4LF7M 3GQ5A 2X8AA 1J7KA 4LZZA 4S12A 4PCZA 5EXXA 3U6MA 3GPXA 3EIHA 2EUCA 1OJLA 5FLXS 4IBJA 4BBAA 1R7RA 1YSYA 3GLHB 3U61B 4QHSA 4AKIA 1L2DA 1VDDA 4NRVA 3VK7A 1L8QA 1GLNA 4XGIA 1IY2A 4CGYB 3SBJA 3GLFB 2UXDM 1OFIA 4JXJA 1IN8A 5DYIA 7CATA 2CHGA 3AL0C 3HHYA 4LJ5A 3TWLA 4B7HA 1NSFA 2I7PA 4FCVA 4FVMA 4AZFA 1GKIA 4AW4A 4JI3M 4G4NA 4AG5A 5EXTA 3VKGA 2Y0QA 2XZUA 3R9XB 4GHLA 2CHQA 4JI2M 5KQ8A 3RE8A 4JN6A 4Z8XA 1DGBA 3UZUA 2J7NA 3KXEC 3KOXE 1TDHA 3A45A 3ZCBB 4I81A 2F5OA 2KEBA 2KXEA 3J7BA 1DGHB 1L2BA 5A2QS 3SAVA 2W82A 3PNVA 3MJ5A 3M6AA 5EP4A 2KZUA 3SYKA 1HT2E 1HNWM 3RGSA 3T1YM 2R4EA 5DNYA 4B3TM 1K3WA 3UGJA 4DR7M 3L25A 3SAWA 1XNRM 1TDZA 4AKGA 2LWXA 1TH3A 2G8LA 3U6CA 2R65A 1QVRA 3DOAA 3U6OA 3NWLA 1SXJD 1QANA 3L2AA 1KFVA 1JR3D 4GC5A 2M60A 4JYAM 4GHAA 2DWZB 2ZAMA 4B7GA 4NOOB 1IN6A 2UUCM 4B3MM 3WHKA 1Q39A 2DHRA 4X66M 4I5SA 4JI7M 4PDIA 4FWHA 4B3RM 3GRYA 5FSWA 4IIWA 3FYCA 4M9SA 3ILKA 2C9OA 1L1TA 4JI5M 5BR8M 4DR1M 3FTFA 1QAMA 3MHVC 3FUUA 2R46A 3FYDA 4M0WA 3KFUG 2QP9X 4DR6M 1QQWA 4MM3B 5C18A 2DWNA 4L8RC 2L7IA 2L09A 1Q3BA 3KS8A 3J81S 5LMNM 4AQYM 4IBDA 3GPYA 2DZOB 3VLFB 2UU9M 3KP1E 2CV0A 3K8ZA 3Q8XA 2F5QA 2O5RA 5ITYA 4GRIA 3GLIB 2XSZD 1DO0A 3K1JA 3EIEA 4DV2M 4NL4H 1IXSB 5F3WA 2FOIC 3J27B 5E26A 1R2ZA 2QBYB 1N78A 3PFIA 1KSFX 1QZMA 1TH2A 2QZ4A 3SMSA 4B08A 4DV6M 2BNKA 2KZSA 4RF1A 1ZQ9A 2J7OA 4GH9A 1NJGA 2CFOA 4DUZM 4D81A 1HNZM 1WXQA 3DA1A 2KRUA 5KO3A 1PJJA 3KS4A 3M7GA 3E9SA 3D8BA 3VDPA 1Z5AA 1IXZA 5EP3A 1PM5A 4WW0A 4FCWA 1D2NA 5DYGA 3J7AS 2BJWA 3SHFA 1FNNA 4LJ4A 4LGMA 1SXJE 1XXHB 5KPZA 4L16A 3DZDA 3GPPA 4QNMA 1J5EM 3QWLA 1IBLM 4G4OA 3GRVA 4M9XA 1N36M 2DXIA 3RGPA 1OFHA 4DV0M 4CISA 2XF3A 2Z3XA 2LXEA 5E6JA 2YNMD 3HJSA 2K47A 3SYLA 1S3SA 2P5TA 2KA6B 2V1UA 1J09A 1E9RA 3GQ4A 1HQCA 3FKEA 4LF4M 1E94E 4MH0E 4JI0M 1DGHA 1MU5A 4OW0A 1XNQM 1FJGM 1PJIA 2RKOA 4NRWA 2XGNA 3FUVA 2CV1A 3T15A 3NBIA 4OVZB 4A3VB 3KVWA 3VFDA 4LJ8A 2XEPA 1GL6A 2XLJA 1LV7A 3THGA 3TQSA 1NHWC 4NXNM 4REZA 4DUYM 1NHGC 2ERCA 5EP1A 1Z5BA 4G6ZA 2Z4RA 2XZFA 2Z7JA 3U5ZA 2C98A 1NY6A 3KSXA 1EE8A 3DFZA 4LRSA 3JAMS 5IWAM 3GO8A 5FTMA 3JR5A 4DV1M 3L28A 4XBOA 1SXJB 4I8OA 2H1RA 3SFZA 2XFTA 3K2LA 4LZJA 3CTWB 2ZAOA 4M9ZA 3SARA 4LF9M 1NNJA 2XH9A 4LG2A 4OX9M 3VKHA 2A5YB 3HHXA 4PD2A 3C58A 2G5GX 2V1CA 3ZH9B 1GVNA 5ITRA 3SATA 1HT1E 3K92A 4NXMM 3J80S 1GL7A 1E32A 2I7NA 2KRKA 1IXRC 4LGYA 3AFHA 2HCBA 3GLHA 4P16A 2VQFM 4LF8M 1H6UA 1SXJA 4D80A 1N34M 2FNAA 3LVWA 4L15A 4AG6A 1R2YA 1Z5CA 2BJVA 1NJFA 3H4MA 3U5ZB 1G3IA 2FFJA 3L26A 3GRUA 3GPUA 2R45A 4GKKM 2DWMA 1TGUA 4JV5M 1N32M 4M0DA 3FTEA 2VIIA 4IBEA 2R4JA 1C1KA 5EQTA 1I4WA 2DVWB 3FD9A 3MK6A 4OVZA 3FUXA 4QOZC 1SXJC 2CUZA 4HL4A 4MGZE 3HJ8A 5EXPA 3TWKA 2ZANA 2R18A 1R6BX 2UXCM 2E5LM 3IG5A 1L1ZA 4KO8A 4KHPM 2QPAA 1ORYB 3TPZA 5ITTA 4B7FA 4K0KM 4Z6YA 4X64M 3RFWA 4B3SM 4DV3M 2D7HA 1HR0M 2R62A 2F4VM 4II7A 4IBGA 3FTCA 3CF0A 4DV4M 4KODA 1DGFA 5ITUA 4DR5M 4IBBA 1IBMM 4LF6M 1XC8A 4GC9A 1XXHA 2C5RA 4PT5A 3U6DA 1E9SA 2L6OA 4D82A 4LJ9A 4CHTB 3UMMA 1ZAEA 2QENA 4IBCA 3AOEC 1K82A 5JI3E 3U60B 1NY5A 3HJQA 5EJCA 3D8LA 3GLGA 5FTNA 5KPTA 1NVMA 3GP1A 4IBKA 3WHLA 3ZC7B 4GITA 2YQZA 4KLNA 4LJAA 3CF6E 2HKJA 3UJNA 4JI6M 4LFCM 4GKJM 2UUAM 2F5NA 3LMMA 1L2CA 4WURA 3GRRA 4R3DA 5BPVA 5LMUM 4HLQA 3W0FA 3KSJA 4FWGA 3T1HM 3KOZE 3LQQA 5FTJA 5KPRA 1G4AE 1QAOA 3LQRA 3A98B 4NSOB 2DWLA 2YR0A 3SMPA 3VK8A 2QBYA 3FUTA 8CATA 3FTDA 4G4RA 3GLIA 4I4LA 2JA2A 4MGKE 4LY6A 5GKNA 3KOYE 4JI8M 3I4YA 1YE9A 4FD2A 4R7GA 1UM8A 3LVVA 1T3TA 3HU3A 4IJEA 5IT9S 1XMOM 1MX0A 2Q2EB 2CHVA 3TE6A 4TUWA 2XSZA 2KW0A 4X65M 4G4QA 3VDUA 3SAUA 1I94M 3U6QA 5ITQA 2FE8A 3W0LB 2UUBM 5H37D 4YHHM 2D7GA 2X4AA 1XWIA 3PVSA 4X62M 3AV0A 2M5ZA 3PNYA 1N33M 1IN5A 3GQ3A 2C96A 2Z4SA 2ZBKB 3UK6A 3L29A 3JR4A 4FWDA 4DR4M 3SASA 3SC3A 1YUBA 3TL4X 1QAQA 3BOSA 3KW6A 5EP2A 4BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5R A;  1ZAE A;  2BNK A; 
#chains in the Genus database with same CATH topology
 1N75 A;  1CUK A;  2CE7 A;  2JUJ A;  2EKK A;  3R8F A;  4Y28 F;  2Y0T A;  3U6E A;  1JB0 F;  3FRI A;  4GIP A;  2DZN B;  2LVQ D;  3A42 A;  4RF0 A;  4W5W A;  3PXG A;  1NNU C;  1IY0 A;  2MRO B;  3V76 A;  5ITX A;  2EO2 A;  1JR3 A;  2FS1 A;  1W5T A;  1IM2 A;  4QHT A;  2UXB M;  4AKH A;  2Y20 A;  2JY7 A;  4QNR A;  3GLG E;  2VQE M;  5EXS A;  5FTK A;  1Z6T A;  4MGY E;  3HHW A;  5ITX E;  2HHH M;  4DR2 M;  1G8P A;  2B3T A;  3U6S A;  2HL7 A;  4EIW A;  1X37 A;  2JZ1 A;  3I51 A;  2CV2 A;  4QOS A;  4IBI A;  1IBK M;  3OTO M;  4JI1 M;  1DV0 A;  4MB7 A;  4AI6 A;  3I4V A;  2X49 A;  4LFA M;  2RGO A;  1HQY E;  3CGW A;  3KP0 E;  1KYI A;  1LTM A;  4LJ6 A;  4L78 A;  4RNA A;  3GLG B;  5C1B A;  2ZM6 M;  2L4F A;  5DFL A;  1XHB A;  4GMQ A;  3IHP A;  2R0I A;  2DHY A;  3U60 A;  2XFS A;  4LF5 M;  3TWM A;  3J2P B;  3HWS A;  3AJI B;  3B89 A;  3BBZ A;  4MGI E;  2O01 F;  3HHZ A;  1DO2 A;  3U6P A;  1PRB A;  4IBF A;  2F5P A;  4F2L A;  2Y21 A;  4ZPX A;  4LCB A;  3QAU A;  1QYR A;  4YY3 M;  4MGH A;  5FTL A;  1R4G A;  4GEW A;  1G41 A;  4ITQ A;  2OQ4 A;  3M0E A;  2WSE F;  4L4U A;  2F5S A;  4PDG A;  2L7H A;  5KQD A;  1Q3C A;  4DR3 M;  3FUW A;  4LJ7 A;  1G59 A;  3T38 A;  2C9C A;  3SHG B;  1IN4 A;  4NSR A;  3HGI A;  4LFB M;  4OU7 A;  3LCV B;  3GLF E;  3ZQJ A;  3B74 A;  1WJ7 A;  5JI2 E;  4DV5 M;  4DV7 M;  3A46 A;  1HNX M;  3CF2 A;  1TH4 A;  3KDS E;  5IRE B;  1T6O A;  3IG8 A;  3GLF A;  2V6Z M;  1DGG A;  3HZJ A;  2RGH A;  2YFQ A;  4LRT A;  4BLC A;  2EA0 A;  1Y8G A;  4FCT A;  3HKP A;  2QCU A;  3HU1 A;  3B9P A;  2DAM A;  4FW9 A;  3KOW E;  3E4R A;  2CEA A;  1JR3 E;  2KNA A;  2C99 A;  3QYB A;  3U61 A;  1IQP A;  1XMQ M;  4IJF A;  3L27 A;  1OIZ A;  2GQF A;  2OPF A;  1Z59 A;  3AOG A;  3AKZ A;  3AOE A;  2DAE A;  2EKF A;  1K3X A;  1SG9 A;  2LNH C;  3U6L A;  2ZTD A;  1QDR A;  1IN7 A;  1JQJ C;  1W5S A;  1ZMV A;  3B7Q A;  4L6V 6;  1UFZ A;  2AHM A;  4JI4 M;  1IY1 A;  2LVO C;  3HU2 A;  2LTU A;  5IZ7 D;  2D7E A;  2NQ8 C;  1N77 A;  2LH0 A;  4LF7 M;  3GQ5 A;  2CWB A;  2X8A A;  1J7K A;  4LZZ A;  4S12 A;  4PCZ A;  5EXX A;  3U6M A;  3GPX A;  3EIH A;  2EUC A;  1OJL A;  1VEG A;  4XK8 F;  2VDB B;  3W68 A;  5FLX S;  4IBJ A;  4BBA A;  1R7R A;  4R71 A;  1YSY A;  2G3Q A;  3GLH B;  3HX3 A;  3U61 B;  1HJP A;  4QHS A;  1QZE A;  4AKI A;  1L2D A;  1C7Y A;  1NV8 A;  1VDD A;  4NRV A;  3VK7 A;  1L8Q A;  1OIP A;  1GLN A;  1VEK A;  1IY2 A;  4XGI A;  4CGY B;  3GLF B;  3SBJ A;  2UXD M;  1OFI A;  4JXJ A;  1IN8 A;  5DYI A;  1AUA A;  2CHG A;  7CAT A;  3AL0 C;  3HHY A;  2WZJ A;  4LJ5 A;  3TWL A;  4B7H A;  2K6B A;  2JY8 A;  1NSF A;  3LW5 F;  2DAK A;  2I7P A;  4FCV A;  4FVM A;  4AZF A;  1GKI A;  4AW4 A;  4JI3 M;  4G4N A;  1OAO C;  4AG5 A;  5EXT A;  1OTR A;  3VKG A;  2Y0Q A;  1PJS A;  2XZU A;  3R9X B;  4GHL A;  4CIZ A;  2CHQ A;  4JI2 M;  2LHC A;  5KQ8 A;  2MJ5 B;  4JN6 A;  4Z8X A;  3RE8 A;  1DGB A;  1WHC A;  3UZU A;  2J7N A;  1WIV A;  2GNO A;  3KXE C;  1D0M A;  1TDH A;  2DKL A;  3A45 A;  3GLH E;  3KOX E;  3ZCB B;  4I81 A;  2F5O A;  2KEB A;  2KXE A;  2QNJ A;  2RRU A;  3J7B A;  2K9D A;  1DGH B;  1L2B A;  5A2Q S;  3SAV A;  2W82 A;  2WSF F;  4CJ6 A;  3PNV A;  3MJ5 A;  3M6A A;  5EP4 A;  2KZU A;  3SYK A;  1HT2 E;  1HNW M;  3RGS A;  3T1Y M;  2R4E A;  5DNY A;  4B3T M;  3LCU A;  1QUT A;  1K3W A;  3UGJ A;  4DR7 M;  3L25 A;  3SAW A;  1VEJ A;  1XNR M;  1TDZ A;  4AKG A;  2LWX A;  1TH3 A;  2G8L A;  3U6C A;  2R65 A;  1QVR A;  3DOA A;  3U6O A;  3NWL A;  2LBC A;  1SXJ D;  1QAN A;  2DAI A;  3L2A A;  1KFV A;  1GJT A;  1JR3 D;  4GC5 A;  2M60 A;  4HEO A;  1VQ1 A;  4JYA M;  4GHA A;  2HWJ A;  1XB2 B;  2KNZ A;  1V33 A;  2DWZ B;  2JXN A;  2ZAM A;  3QYE A;  4B7G A;  4NOO B;  1IN6 A;  4NC6 A;  1GAB A;  2UUC M;  4B3M M;  3WHK A;  1Q39 A;  2DHR A;  4X66 M;  4I5S A;  4JI7 M;  4PDI A;  4FWH A;  4B3R M;  3GRY A;  5FSW A;  4IIW A;  3FYC A;  4M9S A;  3ILK A;  2C9O A;  1L1T A;  5L8R F;  4JI5 M;  5BR8 M;  4DR1 M;  3FTF A;  1QAM A;  3MHV C;  3FUU A;  2R46 A;  2OOB A;  3FYD A;  4M0W A;  3KFU G;  2QP9 X;  4DR6 M;  2MH8 A;  1QQW A;  4MM3 B;  1XXH E;  5C18 A;  2DWN A;  4L8R C;  2L7I A;  2L09 A;  2VF7 A;  1Q3B A;  3KS8 A;  3J81 S;  5LMN M;  4AQY M;  1R5L A;  4IBD A;  3GPY A;  2DZO B;  1IXS A;  1TF0 B;  3VLF B;  3KP1 E;  2UU9 M;  3K9O A;  2CV0 A;  2QHO B;  3K8Z A;  3Q8X A;  3C3D A;  2F5Q A;  2O5R A;  5ITY A;  4GRI A;  2H5X A;  3GLI B;  2XSZ D;  1DO0 A;  2J5Y A;  3EIE A;  2VF8 A;  3K1J A;  4DV2 M;  4NL4 H;  1IXS B;  1QUS A;  2CP8 A;  2FOI C;  3J27 B;  5E26 A;  5F3W A;  1R2Z A;  2QBY B;  1EFU B;  1N78 A;  2DAG A;  3PFI A;  1KSF X;  1QZM A;  2QBY A;  1TH2 A;  2QZ4 A;  3SMS A;  4B08 A;  4DV6 M;  2BNK A;  2KZS A;  2KDL A;  4RF1 A;  1ZQ9 A;  2LHG A;  2J7O A;  4GH9 A;  1NJG A;  2CFO A;  3K9P A;  4DUZ M;  3MMP A;  4D81 A;  1HNZ M;  2K0B X;  2QQ8 A;  1WXQ A;  2QSF X;  3DA1 A;  2JNH A;  2KRU A;  5KO3 A;  1PJJ A;  3KS4 A;  3M7G A;  3E9S A;  3D8B A;  3VDP A;  1Z5A A;  1IXZ A;  5EP3 A;  3BXW A;  1PM5 A;  4WW0 A;  4FCW A;  4ANR A;  1VDL A;  1D2N A;  5DYG A;  3J7A S;  1D0L A;  2BJW A;  3SHF A;  1FNN A;  4LJ4 A;  4LGM A;  3C9P A;  1SXJ E;  1XXH B;  5KPZ A;  2JY5 A;  2KHH A;  4L16 A;  3DZD A;  4Q7J A;  3GPP A;  4QNM A;  1GO5 A;  1J5E M;  3QWL A;  1F4I A;  1IBL M;  4G4O A;  3GRV A;  3I04 M;  4M9X A;  1N36 M;  2DXI A;  3RGP A;  1OFH A;  4DV0 M;  1NV9 A;  2LVA A;  4CIS A;  1NO1 A;  2XF3 A;  2JY6 B;  2Z3X A;  2LXE A;  5E6J A;  2APL A;  1YLA A;  2YNM D;  3HJS A;  2K47 A;  3SYL A;  1S3S A;  2P5T A;  2KA6 B;  2V1U A;  1GJS A;  1J09 A;  1E9R A;  3GQ4 A;  1HQC A;  3FKE A;  4LF4 M;  1E94 E;  4MH0 E;  2MGW A;  1DGH A;  1MU5 A;  4OW0 A;  4JI0 M;  1XNQ M;  1FJG M;  1PJI A;  2RKO A;  4NRW A;  2XGN A;  3FUV A;  2CV1 A;  3T15 A;  3NBI A;  4OVZ B;  4UN2 B;  4A3V B;  3KVW A;  3VFD A;  4LJ8 A;  2XEP A;  1GL6 A;  2XLJ A;  3GLI E;  1V92 A;  1LV7 A;  3FRH A;  3THG A;  1NHW C;  3TQS A;  1VG5 A;  2HAK A;  4NXN M;  4REZ A;  4DUY M;  4G3O A;  4DBG B;  1NHG C;  2ERC A;  5EP1 A;  1Z5B A;  4G6Z A;  2EJS A;  2Z4R A;  2XZF A;  2Z7J A;  3U5Z A;  2C98 A;  1NY6 A;  1EE8 A;  3KSX A;  3DFZ A;  4LRS A;  3JAM S;  5IWA M;  3GO8 A;  5FTM A;  1MJG M;  3JR5 A;  4DV1 M;  2Z8Y M;  2ZTC A;  3L28 A;  4XBO A;  1SXJ B;  1PJT A;  2H1R A;  4I8O A;  3SFZ A;  2XFT A;  3IEC A;  3K2L A;  1A5T A;  1Q02 A;  4LZJ A;  3CTW B;  2ZAO A;  4M9Z A;  3SAR A;  4LF9 M;  1NNJ A;  2XH9 A;  4LG2 A;  4OX9 M;  2WSC F;  3VKH A;  2A5Y B;  3HHX A;  4PD2 A;  3C58 A;  2G5G X;  2V1C A;  2LVN C;  1GVN A;  3ZH9 B;  5ITR A;  1HT1 E;  1OKS A;  3K92 A;  3SAT A;  4NXM M;  3J80 S;  1IFY A;  1PGY A;  2KRK A;  1GL7 A;  1E32 A;  2I7N A;  1IXR C;  4LGY A;  3AFH A;  2HCB A;  3GLH A;  4P16 A;  2VQF M;  4LF8 M;  1RU3 A;  1H6U A;  2JP7 A;  1SXJ A;  2O25 A;  4D80 A;  1N34 M;  1QDT A;  2FNA A;  3LVW A;  4L15 A;  4AG6 A;  1R2Y A;  1Z5C A;  2BJV A;  1PJQ A;  1NJF A;  3H4M A;  3U5Z B;  1G3I A;  2FFJ A;  3W67 A;  3L26 A;  3GRU A;  3GPU A;  2R45 A;  4GKK M;  2DWM A;  1TGU A;  4JV5 M;  1N32 M;  4M0D A;  3Q8G A;  3FTE A;  2VII A;  4IBE A;  2DI0 A;  2R4J A;  1C1K A;  5EQT A;  1TR8 A;  2N35 A;  1I4W A;  2DVW B;  3FD9 A;  3MK6 A;  4OVZ A;  3FUX A;  2JZ0 A;  3B7N A;  4QOZ C;  3FE3 A;  1SXJ C;  2CUZ A;  4HL4 A;  4MGZ E;  3HJ8 A;  5EXP A;  1BVS A;  3TWK A;  2ZAN A;  2R18 A;  1R6B X;  2UXC M;  2E5L M;  3IG5 A;  1MN3 A;  1AIP C;  2MR9 A;  1WR1 B;  1EIJ A;  1L1Z A;  4KO8 A;  4KHP M;  2FH0 A;  1ZMW A;  2QPA A;  1ORY B;  3TPZ A;  5ITT A;  4B7F A;  4K0K M;  2CRU A;  4Z6Y A;  4X64 M;  3RFW A;  2R6F A;  2JWS A;  4B3S M;  4DV3 M;  1ZMU A;  2D7H A;  1HR0 M;  2R62 A;  3I01 M;  2F4V M;  4II7 A;  4IBG A;  3FTC A;  3CF0 A;  3T6P A;  4DV4 M;  4KOD A;  1DGF A;  5ITU A;  4DR5 M;  2BWB A;  4IBB A;  1IBM M;  4LF6 M;  2LVP C;  1XC8 A;  3E46 A;  4GC9 A;  1P3Q Q;  1XXH A;  2C5R A;  4PT5 A;  2BWE A;  2DEN A;  3NBX X;  3U6D A;  1TTE A;  2R44 A;  1OAI A;  1E9S A;  2L6O A;  4D82 A;  4LJ9 A;  4CHT B;  3UMM A;  2DZL A;  1ZAE A;  3E21 A;  2QEN A;  4IBC A;  3AOE C;  4WP2 A;  1K82 A;  5JI3 E;  3U60 B;  1NY5 A;  3HJQ A;  5EJC A;  3D8L A;  4RKU F;  3GLG A;  5FTN A;  5KPT A;  1NVM A;  3GP1 A;  1V34 A;  4IBK A;  3HY5 A;  2L2D A;  3WHL A;  3ZC7 B;  4GIT A;  2YQZ A;  4KLN A;  4LJA A;  3CF6 E;  2HKJ A;  4P17 A;  3UJN A;  4JI6 M;  4LFC M;  4GKJ M;  2UUA M;  2F5N A;  3LMM A;  2L4E A;  1L2C A;  4WUR A;  3GRR A;  4R3D A;  3B7Z A;  5BPV A;  5LMU M;  4HLQ A;  3W0F A;  3KSJ A;  4FWG A;  3T1H M;  1OQY A;  1ZV1 A;  3KOZ E;  3LQQ A;  5FTJ A;  5KPR A;  1G4A E;  1QAO A;  3A98 B;  3LQR A;  4NSO B;  2DWL A;  2YR0 A;  4KT0 F;  3SMP A;  1WGL A;  3VK8 A;  3FUT A;  4F1I A;  3FTD A;  8CAT A;  4G4R A;  3GLI A;  4I4L A;  2JA2 A;  4MGK E;  4LY6 A;  5GKN A;  3KOY E;  4JI8 M;  2DNA A;  3I4Y A;  1YE9 A;  4FD2 A;  4R7G A;  1UM8 A;  3LVV A;  1T3T A;  3HU3 A;  4IJE A;  5IT9 S;  1XMO M;  1MX0 A;  2Q2E B;  2CHV A;  3F92 A;  1WGN A;  3H4J A;  2OOA A;  3TE6 A;  4TUW A;  2XSZ A;  2KW0 A;  4X65 M;  3C3E A;  4G4Q A;  3VDU A;  3SAU A;  1I94 M;  3U6Q A;  5ITQ A;  2FE8 A;  3W0L B;  2UUB M;  5H37 D;  4YHH M;  2D7G A;  2X4A A;  1XWI A;  3PVS A;  1G71 A;  4X62 M;  3AV0 A;  2M5Z A;  3PNY A;  1N33 M;  1IN5 A;  3GQ3 A;  2C96 A;  2OO9 A;  2Z4S A;  2ZBK B;  3UK6 A;  3L29 A;  1D0K A;  3JR4 A;  4FWD A;  4DR4 M;  3SAS A;  3SC3 A;  1YUB A;  3TL4 X;  1QAQ A;  3BOS A;  3KW6 A;  5EP2 A;  1T43 A;  4BB9 A;  2KNV A; 
#chains in the Genus database with same CATH homology
 1N75 A;  2CE7 A;  3R8F A;  2Y0T A;  3U6E A;  4GIP A;  2DZN B;  4W5W A;  3A42 A;  4RF0 A;  3PXG A;  1NNU C;  1IY0 A;  5ITX A;  2EO2 A;  1JR3 A;  1W5T A;  1IM2 A;  4QHT A;  2UXB M;  4AKH A;  2Y20 A;  4QNR A;  2VQE M;  5EXS A;  5FTK A;  1Z6T A;  4MGY E;  3HHW A;  5ITX E;  2HHH M;  4DR2 M;  1G8P A;  3U6S A;  2HL7 A;  4EIW A;  1X37 A;  3I51 A;  2CV2 A;  4QOS A;  4IBI A;  1IBK M;  3OTO M;  4JI1 M;  4MB7 A;  4AI6 A;  3I4V A;  2X49 A;  4LFA M;  2RGO A;  1HQY E;  3KP0 E;  1KYI A;  4LJ6 A;  4L78 A;  4RNA A;  3GLG B;  5C1B A;  2ZM6 M;  1XHB A;  4GMQ A;  3U60 A;  4LF5 M;  2XFS A;  3TWM A;  3J2P B;  3HWS A;  3AJI B;  4MGI E;  3HHZ A;  1DO2 A;  3U6P A;  4IBF A;  2F5P A;  2Y21 A;  4ZPX A;  4LCB A;  3QAU A;  1QYR A;  4YY3 M;  4MGH A;  5FTL A;  1G41 A;  4ITQ A;  2OQ4 A;  3M0E A;  4L4U A;  2F5S A;  4PDG A;  2L7H A;  5KQD A;  1Q3C A;  4DR3 M;  3FUW A;  4LJ7 A;  1G59 A;  3T38 A;  2C9C A;  3SHG B;  1IN4 A;  4NSR A;  3HGI A;  4LFB M;  4OU7 A;  5JI2 E;  4DV5 M;  4DV7 M;  3A46 A;  1HNX M;  3CF2 A;  1TH4 A;  3KDS E;  5IRE B;  3GLF A;  3IG8 A;  2V6Z M;  1DGG A;  2RGH A;  2YFQ A;  4LRT A;  4BLC A;  2EA0 A;  4FCT A;  3HKP A;  2QCU A;  3HU1 A;  3B9P A;  4FW9 A;  3KOW E;  3E4R A;  2CEA A;  2C99 A;  3U61 A;  1IQP A;  1XMQ M;  4IJF A;  3L27 A;  2OPF A;  1Z59 A;  3AOG A;  3AKZ A;  3AOE A;  1K3X A;  2LNH C;  3U6L A;  1IN7 A;  1JQJ C;  1W5S A;  4JI4 M;  2AHM A;  1IY1 A;  3HU2 A;  5IZ7 D;  2D7E A;  2NQ8 C;  1N77 A;  2LH0 A;  4LF7 M;  3GQ5 A;  2X8A A;  1J7K A;  4LZZ A;  4S12 A;  4PCZ A;  5EXX A;  3U6M A;  3GPX A;  3EIH A;  2EUC A;  1OJL A;  5FLX S;  4IBJ A;  4BBA A;  1R7R A;  1YSY A;  3GLH B;  3U61 B;  4QHS A;  4AKI A;  1L2D A;  1VDD A;  4NRV A;  3VK7 A;  1L8Q A;  1GLN A;  4XGI A;  1IY2 A;  4CGY B;  3SBJ A;  3GLF B;  2UXD M;  1OFI A;  4JXJ A;  1IN8 A;  5DYI A;  7CAT A;  2CHG A;  3AL0 C;  3HHY A;  4LJ5 A;  3TWL A;  4B7H A;  1NSF A;  2I7P A;  4FCV A;  4FVM A;  4AZF A;  1GKI A;  4AW4 A;  4JI3 M;  4G4N A;  4AG5 A;  5EXT A;  3VKG A;  2Y0Q A;  2XZU A;  3R9X B;  4GHL A;  2CHQ A;  4JI2 M;  5KQ8 A;  3RE8 A;  4JN6 A;  4Z8X A;  1DGB A;  3UZU A;  2J7N A;  3KXE C;  3KOX E;  1TDH A;  3A45 A;  3ZCB B;  4I81 A;  2F5O A;  2KEB A;  2KXE A;  3J7B A;  1DGH B;  1L2B A;  5A2Q S;  3SAV A;  2W82 A;  3PNV A;  3MJ5 A;  3M6A A;  5EP4 A;  2KZU A;  3SYK A;  1HT2 E;  1HNW M;  3RGS A;  3T1Y M;  2R4E A;  5DNY A;  4B3T M;  1K3W A;  3UGJ A;  4DR7 M;  3L25 A;  3SAW A;  1XNR M;  1TDZ A;  4AKG A;  2LWX A;  1TH3 A;  2G8L A;  3U6C A;  2R65 A;  1QVR A;  3DOA A;  3U6O A;  3NWL A;  1SXJ D;  1QAN A;  3L2A A;  1KFV A;  1JR3 D;  4GC5 A;  2M60 A;  4JYA M;  4GHA A;  2DWZ B;  2ZAM A;  4B7G A;  4NOO B;  1IN6 A;  2UUC M;  4B3M M;  3WHK A;  1Q39 A;  2DHR A;  4X66 M;  4I5S A;  4JI7 M;  4PDI A;  4FWH A;  4B3R M;  3GRY A;  5FSW A;  4IIW A;  3FYC A;  4M9S A;  3ILK A;  2C9O A;  1L1T A;  4JI5 M;  5BR8 M;  4DR1 M;  3FTF A;  1QAM A;  3MHV C;  3FUU A;  2R46 A;  3FYD A;  4M0W A;  3KFU G;  2QP9 X;  4DR6 M;  1QQW A;  4MM3 B;  5C18 A;  2DWN A;  4L8R C;  2L7I A;  2L09 A;  1Q3B A;  3KS8 A;  3J81 S;  5LMN M;  4AQY M;  4IBD A;  3GPY A;  2DZO B;  3VLF B;  2UU9 M;  3KP1 E;  2CV0 A;  3K8Z A;  3Q8X A;  2F5Q A;  2O5R A;  5ITY A;  4GRI A;  3GLI B;  2XSZ D;  1DO0 A;  3K1J A;  3EIE A;  4DV2 M;  4NL4 H;  1IXS B;  5F3W A;  2FOI C;  3J27 B;  5E26 A;  1R2Z A;  2QBY B;  1N78 A;  3PFI A;  1KSF X;  1QZM A;  1TH2 A;  2QZ4 A;  3SMS A;  4B08 A;  4DV6 M;  2BNK A;  2KZS A;  4RF1 A;  1ZQ9 A;  2J7O A;  4GH9 A;  1NJG A;  2CFO A;  4DUZ M;  4D81 A;  1HNZ M;  1WXQ A;  3DA1 A;  2KRU A;  5KO3 A;  1PJJ A;  3KS4 A;  3M7G A;  3E9S A;  3D8B A;  3VDP A;  1Z5A A;  1IXZ A;  5EP3 A;  1PM5 A;  4WW0 A;  4FCW A;  1D2N A;  5DYG A;  3J7A S;  2BJW A;  3SHF A;  1FNN A;  4LJ4 A;  4LGM A;  1SXJ E;  1XXH B;  5KPZ A;  4L16 A;  3DZD A;  3GPP A;  4QNM A;  1J5E M;  3QWL A;  1IBL M;  4G4O A;  3GRV A;  4M9X A;  1N36 M;  2DXI A;  3RGP A;  1OFH A;  4DV0 M;  4CIS A;  2XF3 A;  2Z3X A;  2LXE A;  5E6J A;  2YNM D;  3HJS A;  2K47 A;  3SYL A;  1S3S A;  2P5T A;  2KA6 B;  2V1U A;  1J09 A;  1E9R A;  3GQ4 A;  1HQC A;  3FKE A;  4LF4 M;  1E94 E;  4MH0 E;  4JI0 M;  1DGH A;  1MU5 A;  4OW0 A;  1XNQ M;  1FJG M;  1PJI A;  2RKO A;  4NRW A;  2XGN A;  3FUV A;  2CV1 A;  3T15 A;  3NBI A;  4OVZ B;  4A3V B;  3KVW A;  3VFD A;  4LJ8 A;  2XEP A;  1GL6 A;  2XLJ A;  1LV7 A;  3THG A;  3TQS A;  1NHW C;  4NXN M;  4REZ A;  4DUY M;  1NHG C;  2ERC A;  5EP1 A;  1Z5B A;  4G6Z A;  2Z4R A;  2XZF A;  2Z7J A;  3U5Z A;  2C98 A;  1NY6 A;  3KSX A;  1EE8 A;  3DFZ A;  4LRS A;  3JAM S;  5IWA M;  3GO8 A;  5FTM A;  3JR5 A;  4DV1 M;  3L28 A;  4XBO A;  1SXJ B;  4I8O A;  2H1R A;  3SFZ A;  2XFT A;  3K2L A;  4LZJ A;  3CTW B;  2ZAO A;  4M9Z A;  3SAR A;  4LF9 M;  1NNJ A;  2XH9 A;  4LG2 A;  4OX9 M;  3VKH A;  2A5Y B;  3HHX A;  4PD2 A;  3C58 A;  2G5G X;  2V1C A;  3ZH9 B;  1GVN A;  5ITR A;  3SAT A;  1HT1 E;  3K92 A;  4NXM M;  3J80 S;  1GL7 A;  1E32 A;  2I7N A;  2KRK A;  1IXR C;  4LGY A;  3AFH A;  2HCB A;  3GLH A;  4P16 A;  2VQF M;  4LF8 M;  1H6U A;  1SXJ A;  4D80 A;  1N34 M;  2FNA A;  3LVW A;  4L15 A;  4AG6 A;  1R2Y A;  1Z5C A;  2BJV A;  1NJF A;  3H4M A;  3U5Z B;  1G3I A;  2FFJ A;  3L26 A;  3GRU A;  3GPU A;  2R45 A;  4GKK M;  2DWM A;  1TGU A;  4JV5 M;  1N32 M;  4M0D A;  3FTE A;  2VII A;  4IBE A;  2R4J A;  1C1K A;  5EQT A;  1I4W A;  2DVW B;  3FD9 A;  3MK6 A;  4OVZ A;  3FUX A;  4QOZ C;  1SXJ C;  2CUZ A;  4HL4 A;  4MGZ E;  3HJ8 A;  5EXP A;  3TWK A;  2ZAN A;  2R18 A;  1R6B X;  2UXC M;  2E5L M;  3IG5 A;  1L1Z A;  4KO8 A;  4KHP M;  2QPA A;  1ORY B;  3TPZ A;  5ITT A;  4B7F A;  4K0K M;  4Z6Y A;  4X64 M;  3RFW A;  4B3S M;  4DV3 M;  2D7H A;  1HR0 M;  2R62 A;  2F4V M;  4II7 A;  4IBG A;  3FTC A;  3CF0 A;  4DV4 M;  4KOD A;  1DGF A;  5ITU A;  4DR5 M;  4IBB A;  1IBM M;  4LF6 M;  1XC8 A;  4GC9 A;  1XXH A;  2C5R A;  4PT5 A;  3U6D A;  1E9S A;  2L6O A;  4D82 A;  4LJ9 A;  4CHT B;  3UMM A;  1ZAE A;  2QEN A;  4IBC A;  3AOE C;  1K82 A;  5JI3 E;  3U60 B;  1NY5 A;  3HJQ A;  5EJC A;  3D8L A;  3GLG A;  5FTN A;  5KPT A;  1NVM A;  3GP1 A;  4IBK A;  3WHL A;  3ZC7 B;  4GIT A;  2YQZ A;  4KLN A;  4LJA A;  3CF6 E;  2HKJ A;  3UJN A;  4JI6 M;  4LFC M;  4GKJ M;  2UUA M;  2F5N A;  3LMM A;  1L2C A;  4WUR A;  3GRR A;  4R3D A;  5BPV A;  5LMU M;  4HLQ A;  3W0F A;  3KSJ A;  4FWG A;  3T1H M;  3KOZ E;  3LQQ A;  5FTJ A;  5KPR A;  1G4A E;  1QAO A;  3LQR A;  3A98 B;  4NSO B;  2DWL A;  2YR0 A;  3SMP A;  3VK8 A;  2QBY A;  3FUT A;  8CAT A;  3FTD A;  4G4R A;  3GLI A;  4I4L A;  2JA2 A;  4MGK E;  4LY6 A;  5GKN A;  3KOY E;  4JI8 M;  3I4Y A;  1YE9 A;  4FD2 A;  4R7G A;  1UM8 A;  3LVV A;  1T3T A;  3HU3 A;  4IJE A;  5IT9 S;  1XMO M;  1MX0 A;  2Q2E B;  2CHV A;  3TE6 A;  4TUW A;  2XSZ A;  2KW0 A;  4X65 M;  4G4Q A;  3VDU A;  3SAU A;  1I94 M;  3U6Q A;  5ITQ A;  2FE8 A;  3W0L B;  2UUB M;  5H37 D;  4YHH M;  2D7G A;  2X4A A;  1XWI A;  3PVS A;  4X62 M;  3AV0 A;  2M5Z A;  3PNY A;  1N33 M;  1IN5 A;  3GQ3 A;  2C96 A;  2Z4S A;  2ZBK B;  3UK6 A;  3L29 A;  3JR4 A;  4FWD A;  4DR4 M;  3SAS A;  3SC3 A;  1YUB A;  3TL4 X;  1QAQ A;  3BOS A;  3KW6 A;  5EP2 A;  4BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...