4DV1M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv1M02
5BR8M 4DUZM 3VK8A 1HNZM 4G4NA 1PM5A 1EE8A 2E5LM 3A46A 1N34M 5ITXE 4LFBM 1R2YA 2UXDM 4LF4M 4OX9M 3TWKA 3T1YM 1XMOM 1L2CA 5A2QS 4CISA 1IBKM 1Z5AA 4X62M 3GQ3A 3GPXA 4PDIA 4JI0M 2UUCM 3OTOM 4DUYM 2VQEM 4G4QA 1L1ZA 3SBJA 4DV1M 1XMQM 4YHHM 5LMUM 4PD2A 4DV2M 3A45A 5ITUA 4DR5M 2VQFM 4GKJM 2F5QA 3C58A 5ITQA 1FJGM 4DR7M 4DV3M 5ITTA 1TDZA 4LF9M 2UU9M 4DV0M 4G4OA 3W0FA 5ITRA 1Z5BA 1PJJA 3U6MA 3TWMA 1HNXM 1XC8A 4LF7M 2UXCM 4YY3M 4DR3M 3JR4A 4X65M 2F5NA 5ITXA 3U6OA 4LFAM 3GPUA 1Z59A 3T1HM 4DV7M 3U6EA 2HHHM 4JI8M 4PCZA 1HNWM 1XNQM 4DR6M 1XNRM 4JYAM 2HKJA 3J81S 3GQ4A 1J5EM 2ZBKB 3U6LA 3VK7A 2F4VM 4ITQA 4NRWA 4B3RM 4AQYM 3U6CA 1Q39A 4DV4M 2UUAM 4JV5M 3GQ5A 3GPPA 1I94M 1N33M 5LMNM 1K82A 4JI7M 5IT9S 1R2ZA 2OQ4A 4B3TM 4NXMM 3SASA 2XZFA 3SARA 4X64M 1L1TA 1N36M 5IWAM 4JI2M 2OPFA 4DR1M 3U6DA 4DV5M 4DV6M 4JI6M 3J7AS 3A42A 2ZM6M 1PJIA 1HR0M 4GKKM 2EA0A 1TDHA 3U6QA 4PDGA 4LF5M 4B3MM 5FLXS 3SAWA 1K3WA 1KFVA 1Q3BA 3SAVA 2XZUA 4G4RA 1L2DA 2UXBM 2Q2EB 3GP1A 3JR5A 2F5PA 3JAMS 4B3SM 2UUBM 4DR2M 2F5SA 4JI4M 4LFCM 4K0KM 4LF8M 1L2BA 1Z5CA 2F5OA 4NRVA 4X66M 3SAUA 3U6PA 4MB7A 3J80S 4NXNM 1IBMM 3GPYA 4JI1M 1N32M 5ITYA 3U6SA 4DR4M 1IBLM 1K3XA 3TWLA 1Q3CA 3SATA 4KHPM 3DOAA 1MX0A 4LF6M 4JI5M 1NNJA 3GO8A 1MU5A 4JI3M
chains in the Genus database with same CATH superfamily
1QAMA 3AFHA 3LCVB 3VK8A 2EKKA 1HNZM 4L8RC 3KXEC 1PM5A 2LVPC 1IY1A 1E94E 4R3DA 1DO0A 2DAMA 1F4IA 3FKEA 2XGNA 4LF4M 4GC5A 4AG5A 1QANA 3SYKA 1QVRA 3T1YM 4L16A 4GH9A 1ZAEA 2JY6B 4G3OA 4LZJA 1QUTA 4X62M 1DGHB 2MH8A 2MROB 5KPZA 4LGMA 3GLHE 5FTKA 2VQEM 3KS8A 1DV0A 2HWJA 3M6AA 1IN7A 3KOXE 4DR5M 2VF7A 4GKJM 2L2DA 5KPRA 1E9SA 4QHTA 4DBGB 3UGJA 1KYIA 2KZSA 3TPZA 4DV3M 4FCVA 5C1BA 2KNAA 2UU9M 2DAIA 3E4RA 4GIPA 5EXPA 5H37D 1YSYA 2FE8A 3HU1A 1Z5BA 2CRUA 2JP7A 3PNVA 3FRHA 2UXCM 1V92A 4YY3M 4DR3M 1NY6A 2X8AA 1AIPC 5ITXA 2DAGA 5IZ7D 2L4FA 4LFAM 1NHWC 3B74A 1NNUC 4NC6A 5FTNA 2BJVA 3B9PA 4JYAM 1SG9A 2Y0QA 3SYLA 2JWSA 2R18A 2P5TA 2YQZA 1J5EM 2ZBKB 2QBYB 2F4VM 4B3RM 1G4AE 1GJTA 5L8RF 1MN3A 3V76A 4F1IA 2KA6B 4DV4M 2D7EA 1LV7A 1WJ7A 3I4VA 2DWMA 4LJ5A 3VKGA 4LJ9A 5LMNM 3CF6E 3RFWA 2L09A 1D2NA 3BOSA 4FVMA 2CHGA 2DZOB 2JA2A 2JZ0A 1V34A 3HWSA 1QZMA 4AKHA 2Z4SA 4FW9A 5KPTA 1NV8A 1E32A 2AHMA 1N36M 5IWAM 3I51A 2MR9A 2J5YA 2HL7A 4B7GA 3MK6A 1SXJE 4MGIE 2ZM6M 2LVNC 2EA0A 2A5YB 4IIWA 1TDHA 3L27A 3GLFA 1PJTA 5EP1A 3ZC7B 1G71A 2X4AA 2EUCA 4WP2A 2V1UA 3GLGE 4IBKA 2V6ZM 4MGZE 1ZQ9A 4G4RA 1L2DA 2UXBM 1JR3A 2R65A 1J7KA 1IY0A 3M7GA 2DXIA 3H4JA 2F5PA 3LMMA 3T15A 3JAMS 4B3SM 3HY5A 2UUBM 1TH4A 4CGYB 2KRKA 3M0EA 4IBDA 2QZ4A 3PFIA 4LF8M 3L25A 5EP4A 1L2BA 3LVVA 2F5OA 2CV0A 1IXRC 3UK6A 3D8LA 4NRVA 1ZMUA 3ZH9B 5EXTA 3PXGA 4AI6A 4JI1M 1N32M 4FWHA 4MGHA 5E26A 1VDLA 2BJWA 2G3QA 3L29A 3TWLA 2DAKA 4CIZA 3WHLA 3UZUA 2Y20A 3HZJA 3KOYE 3DOAA 1R7RA 2RGOA 3FD9A 2X49A 4AW4A 4LJAA 5BR8M 1YLAA 2BWBA 2W82A 5FTLA 3LW5F 1OIPA 4G4NA 2KNZA 3U60A 2DHYA 4LFBM 3K1JA 1OAOC 3CTWB 3VKHA 2LVAA 3LCUA 2LHGA 2YNMD 3TWKA 4AZFA 1WHCA 4CISA 3HHXA 2Y21A 4FCTA 1TH3A 1Z5AA 2Z4RA 3J27B 3FUXA 1OKSA 3RGSA 4GMQA 2Z3XA 1ZMVA 4LG2A 1QAOA 2NQ8C 4IJEA 1UFZA 1YE9A 4IBGA 1KSFX 2KXEA 2YFQA 3FRIA 3QWLA 4XGIA 1XMQM 1NHGC 2VQFM 4R7GA 1DO2A 3AV0A 3GLHA 3KSXA 4EIWA 1ZMWA 3C58A 3U5ZB 1TDZA 4XBOA 4LF9M 3AOEC 1NVMA 3J2PB 3Q8XA 2XSZA 2EJSA 4IBFA 1PJJA 1TF0B 4M9SA 2ZAOA 3NBIA 4JN6A 1XC8A 1SXJC 2H1RA 4KLNA 3JR4A 3DA1A 1PRBA 3U6OA 1IY2A 1Z59A 2HHHM 4JI8M 4PCZA 1XNRM 1NO1A 2C9CA 3SFZA 3R8FA 3IHPA 2O25A 3MMPA 4PT5A 3U6LA 3VFDA 1OFIA 3PVSA 5JI3E 1OQYA 3L2AA 4Q7JA 2FOIC 3B7NA 1BVSA 2CP8A 2KNVA 3HHYA 1HT1E 3K2LA 3GLFB 1WR1B 1PGYA 2CV2A 2HAKA 2EO2A 1D0MA 2R46A 3HHZA 1K82A 4JI7M 4MM3B 2N35A 2CHVA 2ERCA 3TL4X 1IFYA 5EP2A 4B3TM 3UJNA 3AOGA 3R9XB 2DI0A 4RKUF 2XZFA 1R5LA 3CF0A 1OJLA 5FTJA 1L1TA 1IN6A 1WIVA 4GC9A 2WSEF 3B7ZA 2OPFA 2LHCA 1OTRA 3IG5A 4DV5M 3U6DA 5BPVA 4P17A 1DGGA 1HR0M 2BWEA 4L4UA 2R45A 5EP3A 2LTUA 3HU3A 1N77A 1R4GA 1GABA 4LF5M 4LRTA 2ZAMA 3K9PA 5DYIA 1SXJA 1K3WA 3U5ZA 1Q3BA 2K47A 1GLNA 3W0LB 2DZLA 2EKFA 4L6V6 1XB2B 2L7HA 3W68A 2JZ1A 4I8OA 2KDLA 3LQQA 3LVWA 2XEPA 2FNAA 3GLGA 1ZV1A 4DR2M 4K0KM 2XFSA 3QYBA 1PJSA 1R6BX 2OOBA 3ILKA 2JXNA 2R4EA 4NSOB 4WW0A 4GHLA 3SAUA 1OIZA 3U60B 4MB7A 3J80S 2C99A 2CHQA 4P16A 3GPYA 1LTMA 3ZCBB 1I4WA 1IBLM 4GITA 4M0DA 3GLIE 3I01M 4ZPXA 4LY6A 1W5SA 2HCBA 4B7HA 3KS4A 5DNYA 1T43A 2QHOB 4M0WA 1HJPA 4LF6M 4D80A 2C5RA 4RNAA 3K92A 5DFLA 2CUZA 4LRSA 4QNMA 4I4LA 4JI3M 3FTEA 4NL4H 4DUZM 4CJ6A 1NY5A 3FYDA 5KQDA 2E5LM 4HL4A 1GKIA 1V33A 2B3TA 1XXHA 2WZJA 3IECA 1S3SA 4HLQA 5ITXE 3A46A 3GLHB 1QQWA 3KW6A 4NSRA 3CGWA 1R2YA 2QP9X 2UXDM 5KO3A 5IREB 2YR0A 4Y28F 2XH9A 3HU2A 1IXSA 3GRUA 1D0KA 2LWXA 2O5RA 2J7NA 2ZANA 4L15A 1P3QQ 1XMOM 5A2QS 1L2CA 3L26A 1IBKM 3GQ3A 1VG5A 3KP0E 1C7YA 2DENA 2LXEA 3J7BA 4JI0M 4PDIA 4M9XA 3FUWA 1JQJC 3KP1E 2VIIA 4G4QA 3EIHA 5EQTA 2DHRA 3WHKA 4YHHM 4PD2A 4DV2M 2JY8A 3A45A 5ITUA 2K0BX 1VEKA 1TR8A 1N78A 3E21A 1FJGM 4DR7M 1QDRA 2LNHC 4XK8F 3B7QA 4LJ4A 2FFJA 4DV0M 4G4OA 3W0FA 4BB9A 3H4MA 4G6ZA 4FCWA 1UM8A 1GVNA 4IBJA 2XLJA 3TWMA 3U6MA 3GLFE 4LGYA 4MGKE 4IJFA 4LF7M 3FUTA 1OAIA 2OOAA 1QAQA 4FD2A 1IN4A 2WSCF 3GPUA 3K8ZA 3T1HM 2J7OA 3KDSE 4DV7M 3U6EA 1XNQM 2R4JA 4RF1A 2HKJA 3FYCA 4WURA 3D8BA 1C1KA 2I7PA 1H6UA 3BXWA 3VK7A 4ITQA 1TTEA 2ZTCA 1YUBA 4NRWA 2RKOA 4AQYM 3TE6A 5EXXA 4LJ6A 2UUAM 4JV5M 2JNHA 4MH0E 1I94M 3AL0C 1SXJB 3FTCA 2QQ8A 3C3DA 4LJ7A 5EJCA 4CHTB 8CATA 5IT9S 1R2ZA 2DZNB 3CF2A 4GEWA 2CV1A 3HKPA 4QHSA 2JY7A 1QZEA 3SARA 1QDTA 7CATA 3GLGB 1NJFA 2XFTA 4Z8XA 1VEGA 3FTDA 3AKZA 4DR1M 4A3VB 3J7AS 4JI6M 2DKLA 3A42A 4AKIA 1G41A 4OW0A 3C3EA 3FTFA 3VDUA 3U6QA 3T6PA 1GO5A 5EXSA 4B3MM 3HGIA 2R44A 4Z6YA 2R62A 3SMSA 3HJ8A 4KO8A 2D7HA 2Q2EB 1Z6TA 1DGFA 3JR5A 3SMPA 2XF3A 4R71A 3EIEA 2F5SA 4OVZB 4JI4M 4LFCM 4GHAA 3AJIB 3HJSA 2KRUA 1A5TA 1XXHB 2DVWB 3I04M 3KVWA 4X66M 4ANRA 2V1CA 4NXNM 1IBMM 2GNOA 2VDBB 2JUJA 1X37A 5ITYA 3T38A 4F2LA 5FSWA 3U6SA 4LJ8A 4GRIA 1VQ1A 3AOEA 3L28A 4DR4M 1IXSB 3F92A 2MGWA 3ZQJA 2CEAA 4BLCA 1W5TA 3SATA 3QYEA 2CE7A 2O01F 3RE8A 3SHGB 4JI5M 3GLIA 1QUSA 1IXZA 4W5WA 1MU5A 1TH2A 3E46A 2R6FA 1GL6A 2RRUA 1NSFA 2BNKA 2ZTDA 1L8QA 3HX3A 3QAUA 4NOOB 1EE8A 4IBBA 4LCBA 1N34M 3B89A 1G8PA 1WGLA 1DGBA 4QNRA 4L78A 2C96A 3KOWE 1WGNA 2M60A 2QENA 2D7GA 1HQCA 2WSFF 3BBZA 3THGA 3U61B 4OX9M 1WXQA 2L7IA 3RGPA 1G3IA 3NWLA 1JB0F 4UN2B 5F3WA 3LQRA 2K9DA 2KHHA 5DYGA 3GPXA 4KT0F 2DWLA 2UUCM 3TQSA 3OTOM 4DUYM 4I81A 4OVZA 4REZA 1IM2A 1L1ZA 3SBJA 4DV1M 5LMUM 2R0IA 3IG8A 2XSZD 4FWDA 4IBEA 2F5QA 4D81A 2H5XA 5ITQA 5KQ8A 3FE3A 4TUWA 1RU3A 5ITTA 1IN5A 3MHVC 4IBIA 4IBCA 4BBAA 1Y8GA 1QYRA 5ITRA 1GL7A 3NBXX 1HNXM 1DGHA 1TGUA 3E9SA 2L6OA 3I4YA 1G59A 1E9RA 1OFHA 4X65M 4MGYE 2F5NA 1GJSA 3SHFA 2KW0A 4OU7A 3K9OA 3PNYA 1HNWM 2Y0TA 1AUAA 4DR6M 2FH0A 3J81S 3KSJA 4II7A 3GQ4A 2RGHA 1NJGA 2DAEA 1N75A 3U6CA 1Q39A 3GRRA 1EIJA 1ORYB 2QSFX 1FNNA 2Z8YM 2M5ZA 3Q8GA 3DZDA 4RF0A 4AG6A 5C18A 3GQ5A 3GPPA 2I7NA 1N33M 4B08A 3DFZA 1CUKA 2C98A 2QCUA 4LZZA 3VDPA 2FS1A 4B7FA 2OQ4A 3U61A 4NXMM 4KODA 3SASA 1EFUB 2QPAA 4X64M 2DWZB 4JI2M 1HT2E 4JXJA 1SXJD 2QBYA 4S12A 4DV6M 1PJIA 1IQPA 4GKKM 1VDDA 4QOZC 4PDGA 1JR3E 2GQFA 2G5GX 2CFOA 3UMMA 5FTMA 2MJ5B 5FLXS 1XXHE 2L4EA 2G8LA 3SAWA 3SAVA 2XZUA 3MJ5A 1KFVA 2QNJA 3GP1A 4HEOA 4QOSA 2K6BA 1J09A 3VLFB 3GLIB 2LH0A 1XWIA 2VF8A 4D82A 5GKNA 3KFUG 3KOZE 5E6JA 1XHBA 3GRYA 3W67A 1T6OA 1Z5CA 2KEBA 3GRVA 1D0LA 3A98B 2CWBA 1Q02A 4AKGA 3U6PA 3HHWA 3C9PA 3FUVA 2KZUA 1IN8A 5JI2E 3FUUA 3SC3A 1K3XA 4M9ZA 2JY5A 1Q3CA 1T3TA 2LVQD 1JR3D 2OO9A 2DNAA 1VEJA 4I5SA 4KHPM 2C9OA 1MX0A 1NV9A 2APLA 4FWGA 2DWNA 2Z7JA 1NNJA 2LVOC 3GO8A 2LBCA 3HJQA 1PJQA 1HQYE 1MJGM
chains in the Genus database with same CATH topology
1QAMA 3AFHA 1HNZM 3VK8A 4L8RC 3KXEC 1PM5A 1IY1A 1E94E 4R3DA 1DO0A 3FKEA 2XGNA 4LF4M 4GC5A 4AG5A 1QANA 3SYKA 1QVRA 3T1YM 4L16A 4GH9A 1ZAEA 4LZJA 4X62M 1DGHB 5KPZA 4LGMA 5FTKA 2VQEM 3KS8A 3M6AA 1IN7A 3KOXE 4DR5M 4GKJM 5KPRA 1E9SA 4QHTA 3UGJA 4DV3M 1KYIA 2KZSA 3TPZA 4FCVA 5C1BA 2UU9M 3E4RA 4GIPA 5EXPA 5H37D 1YSYA 2FE8A 3HU1A 1Z5BA 3PNVA 2UXCM 4YY3M 4DR3M 1NY6A 2X8AA 5ITXA 5IZ7D 4LFAM 1NHWC 5FTNA 1NNUC 4JYAM 2BJVA 3B9PA 2Y0QA 3SYLA 2R18A 2P5TA 2YQZA 1J5EM 2ZBKB 2QBYB 2F4VM 4B3RM 1G4AE 2KA6B 4DV4M 2D7EA 1LV7A 3I4VA 2DWMA 4LJ5A 3VKGA 4LJ9A 5LMNM 3CF6E 3RFWA 2L09A 1D2NA 3BOSA 4FVMA 2CHGA 2DZOB 2JA2A 3HWSA 4AKHA 1QZMA 2Z4SA 4FW9A 5KPTA 1E32A 2AHMA 1N36M 5IWAM 3I51A 2HL7A 4B7GA 3MK6A 1SXJE 4MGIE 2ZM6M 2EA0A 2A5YB 4IIWA 1TDHA 3L27A 3GLFA 5EP1A 3ZC7B 2X4AA 2EUCA 2V1UA 4IBKA 2V6ZM 4MGZE 1ZQ9A 4G4RA 1L2DA 2UXBM 1JR3A 2R65A 1IY0A 1J7KA 3M7GA 2DXIA 2F5PA 3LMMA 3T15A 3JAMS 4B3SM 2UUBM 1TH4A 4CGYB 2KRKA 3M0EA 4IBDA 2QZ4A 3PFIA 4LF8M 3L25A 5EP4A 1L2BA 3LVVA 2F5OA 2CV0A 1IXRC 3UK6A 3D8LA 4NRVA 3ZH9B 5EXTA 3PXGA 4AI6A 4JI1M 1N32M 4FWHA 4MGHA 5E26A 3TWLA 2BJWA 3L29A 3WHLA 3UZUA 2Y20A 3KOYE 3DOAA 1R7RA 2RGOA 3FD9A 2X49A 4AW4A 4LJAA 5BR8M 2W82A 5FTLA 4G4NA 3U60A 4LFBM 3K1JA 3CTWB 3VKHA 2YNMD 3TWKA 4AZFA 4CISA 3HHXA 2Y21A 4FCTA 1TH3A 1Z5AA 2Z4RA 3J27B 3FUXA 3RGSA 2Z3XA 4GMQA 4LG2A 1QAOA 2NQ8C 4IJEA 4IBGA 1YE9A 1KSFX 2KXEA 2YFQA 3QWLA 4XGIA 1XMQM 1NHGC 2VQFM 4R7GA 1DO2A 3AV0A 3GLHA 3KSXA 4EIWA 3C58A 3U5ZB 1TDZA 4XBOA 4LF9M 3AOEC 1NVMA 3J2PB 3Q8XA 2XSZA 1PJJA 4IBFA 4M9SA 2ZAOA 3NBIA 4JN6A 1XC8A 1SXJC 2H1RA 4KLNA 3JR4A 3DA1A 3U6OA 1IY2A 1Z59A 2HHHM 4JI8M 4PCZA 1XNRM 2C9CA 3SFZA 3R8FA 4PT5A 3U6LA 3VFDA 1OFIA 3PVSA 5JI3E 3L2AA 2FOIC 3HHYA 1HT1E 3K2LA 3GLFB 2CV2A 2EO2A 2R46A 3HHZA 1K82A 4JI7M 4MM3B 2CHVA 2ERCA 3TL4X 5EP2A 4B3TM 3UJNA 3AOGA 3R9XB 2XZFA 3CF0A 1OJLA 5FTJA 1L1TA 1IN6A 4GC9A 2OPFA 3U6DA 3IG5A 4DV5M 5BPVA 1HR0M 1DGGA 4L4UA 2R45A 5EP3A 3HU3A 1N77A 4LF5M 4LRTA 2ZAMA 5DYIA 1SXJA 1K3WA 3U5ZA 1Q3BA 2K47A 1GLNA 3W0LB 2L7HA 4I8OA 3LQQA 3LVWA 2XEPA 2FNAA 3GLGA 4DR2M 4K0KM 2XFSA 1R6BX 3ILKA 2R4EA 4NSOB 4WW0A 4GHLA 3SAUA 3U60B 4MB7A 3J80S 2C99A 2CHQA 4P16A 3GPYA 3ZCBB 1I4WA 1IBLM 4GITA 4M0DA 4ZPXA 4LY6A 1W5SA 2HCBA 4B7HA 3KS4A 5DNYA 4M0WA 4LF6M 4D80A 2C5RA 4RNAA 3K92A 2CUZA 4LRSA 4QNMA 4I4LA 4JI3M 3FTEA 4NL4H 4DUZM 1NY5A 3FYDA 5KQDA 2E5LM 4HL4A 1GKIA 3A46A 1XXHA 4HLQA 5ITXE 1S3SA 1R2YA 3GLHB 1QQWA 3KW6A 4NSRA 2UXDM 2QP9X 5KO3A 5IREB 2YR0A 2XH9A 3HU2A 3GRUA 2O5RA 2LWXA 2ZANA 2J7NA 1XMOM 4L15A 1L2CA 5A2QS 3L26A 1IBKM 3GQ3A 3KP0E 3J7BA 2LXEA 4PDIA 4JI0M 4M9XA 3FUWA 1JQJC 3KP1E 2VIIA 4G4QA 3EIHA 5EQTA 2DHRA 3WHKA 4YHHM 4PD2A 4DV2M 3A45A 5ITUA 1N78A 1FJGM 4DR7M 2LNHC 4LJ4A 2FFJA 4DV0M 4G4OA 3W0FA 4BB9A 3H4MA 4G6ZA 4FCWA 1UM8A 1GVNA 4IBJA 2XLJA 3TWMA 3U6MA 4LGYA 4MGKE 4IJFA 4LF7M 3FUTA 1QAQA 4FD2A 1IN4A 3GPUA 3K8ZA 3T1HM 2J7OA 3KDSE 4DV7M 3U6EA 1XNQM 2R4JA 4RF1A 2HKJA 3FYCA 4WURA 3D8BA 1C1KA 2I7PA 1H6UA 3VK7A 4ITQA 4NRWA 1YUBA 2RKOA 4AQYM 3TE6A 5EXXA 4LJ6A 2UUAM 4JV5M 4MH0E 1I94M 3AL0C 1SXJB 3FTCA 4LJ7A 4CHTB 5EJCA 8CATA 5IT9S 1R2ZA 2DZNB 3CF2A 2CV1A 3HKPA 4QHSA 3SARA 7CATA 3GLGB 1NJFA 2XFTA 4Z8XA 3FTDA 3AKZA 4DR1M 4A3VB 3J7AS 4JI6M 3A42A 4AKIA 1G41A 4OW0A 3FTFA 3VDUA 3U6QA 5EXSA 4B3MM 3HGIA 4Z6YA 2R62A 3SMSA 4KO8A 2D7HA 2Q2EB 1Z6TA 1DGFA 3JR5A 3SMPA 2XF3A 3EIEA 2F5SA 4JI4M 4LFCM 4GHAA 3AJIB 3HJSA 2KRUA 2DVWB 1XXHB 3KVWA 4X66M 2V1CA 4NXNM 1IBMM 1X37A 5ITYA 3T38A 5FSWA 3U6SA 4LJ8A 4GRIA 3AOEA 4DR4M 3L28A 1IXSB 2CEAA 4BLCA 1W5TA 3SATA 2CE7A 3RE8A 3SHGB 4JI5M 3GLIA 1IXZA 4W5WA 1MU5A 1TH2A 1GL6A 1NSFA 2BNKA 3QAUA 1L8QA 4NOOB 1EE8A 4IBBA 4LCBA 1N34M 1G8PA 1DGBA 4QNRA 4L78A 2C96A 3KOWE 2M60A 2QENA 2D7GA 1HQCA 3THGA 3U61B 4OX9M 1WXQA 2L7IA 3RGPA 1G3IA 3NWLA 5F3WA 3LQRA 5DYGA 3GPXA 2DWLA 2UUCM 3TQSA 3OTOM 4DUYM 4I81A 4OVZA 4REZA 1IM2A 1L1ZA 3SBJA 4DV1M 5LMUM 3IG8A 2XSZD 4FWDA 4IBEA 2F5QA 4D81A 5ITQA 5KQ8A 4TUWA 5ITTA 1IN5A 3MHVC 4IBIA 4IBCA 4BBAA 1QYRA 5ITRA 1GL7A 1HNXM 1DGHA 1TGUA 3E9SA 2L6OA 3I4YA 1HQYE 1G59A 1E9RA 1OFHA 4X65M 4MGYE 2F5NA 3SHFA 2KW0A 4OU7A 3PNYA 1HNWM 2Y0TA 4DR6M 3J81S 3KSJA 4II7A 3GQ4A 2RGHA 1NJGA 1N75A 3U6CA 1Q39A 3GRRA 1ORYB 1FNNA 2M5ZA 4RF0A 3DZDA 4AG6A 5C18A 3GQ5A 3GPPA 2I7NA 1N33M 4B08A 3DFZA 2C98A 3VDPA 2QCUA 4LZZA 4B7FA 2OQ4A 3U61A 4NXMM 4KODA 3SASA 2QPAA 4X64M 2DWZB 4JI2M 1HT2E 4JXJA 1SXJD 2QBYA 4S12A 4DV6M 1PJIA 1IQPA 4GKKM 1VDDA 4QOZC 4PDGA 2G5GX 2CFOA 3UMMA 5FTMA 5FLXS 3SAWA 1KFVA 2G8LA 3SAVA 2XZUA 3MJ5A 3GP1A 4QOSA 1J09A 3VLFB 3GLIB 2LH0A 1XWIA 4D82A 5GKNA 3KFUG 3KOZE 5E6JA 1XHBA 3GRYA 1Z5CA 2KEBA 3GRVA 3A98B 4AKGA 3U6PA 3HHWA 3FUVA 2KZUA 1IN8A 5JI2E 3FUUA 3SC3A 1K3XA 4M9ZA 1Q3CA 1T3TA 1JR3D 4I5SA 4KHPM 2C9OA 1MX0A 4FWGA 2DWNA 2Z7JA 1NNJA 3GO8A 4OVZB 3HJQA 3HJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 M;  4DUZ M;  3VK8 A;  1HNZ M;  4G4N A;  1PM5 A;  1EE8 A;  2E5L M;  3A46 A;  1N34 M;  5ITX E;  4LFB M;  1R2Y A;  2UXD M;  4LF4 M;  4OX9 M;  3TWK A;  3T1Y M;  1XMO M;  1L2C A;  5A2Q S;  4CIS A;  1IBK M;  1Z5A A;  4X62 M;  3GQ3 A;  3GPX A;  4PDI A;  4JI0 M;  2UUC M;  3OTO M;  4DUY M;  2VQE M;  4G4Q A;  1L1Z A;  3SBJ A;  4DV1 M;  1XMQ M;  4YHH M;  5LMU M;  4PD2 A;  4DV2 M;  3A45 A;  5ITU A;  4DR5 M;  2VQF M;  4GKJ M;  2F5Q A;  3C58 A;  5ITQ A;  1FJG M;  4DR7 M;  4DV3 M;  5ITT A;  1TDZ A;  4LF9 M;  2UU9 M;  4DV0 M;  4G4O A;  3W0F A;  5ITR A;  1Z5B A;  1PJJ A;  3U6M A;  3TWM A;  1HNX M;  1XC8 A;  4LF7 M;  2UXC M;  4YY3 M;  4DR3 M;  3JR4 A;  4X65 M;  2F5N A;  5ITX A;  3U6O A;  4LFA M;  3GPU A;  1Z59 A;  3T1H M;  4DV7 M;  3U6E A;  2HHH M;  4JI8 M;  4PCZ A;  1HNW M;  1XNQ M;  4DR6 M;  1XNR M;  4JYA M;  2HKJ A;  3J81 S;  3GQ4 A;  1J5E M;  2ZBK B;  3U6L A;  3VK7 A;  2F4V M;  4ITQ A;  4NRW A;  4B3R M;  4AQY M;  3U6C A;  1Q39 A;  4DV4 M;  2UUA M;  4JV5 M;  3GQ5 A;  3GPP A;  1I94 M;  1N33 M;  5LMN M;  1K82 A;  4JI7 M;  5IT9 S;  1R2Z A;  2OQ4 A;  4B3T M;  4NXM M;  3SAS A;  2XZF A;  3SAR A;  4X64 M;  1L1T A;  1N36 M;  5IWA M;  4JI2 M;  2OPF A;  4DR1 M;  3U6D A;  4DV5 M;  4DV6 M;  4JI6 M;  3J7A S;  3A42 A;  2ZM6 M;  1PJI A;  1HR0 M;  4GKK M;  2EA0 A;  1TDH A;  3U6Q A;  4PDG A;  4LF5 M;  4B3M M;  5FLX S;  3SAW A;  1K3W A;  1KFV A;  1Q3B A;  3SAV A;  2XZU A;  4G4R A;  1L2D A;  2UXB M;  2Q2E B;  3GP1 A;  3JR5 A;  2F5P A;  3JAM S;  4B3S M;  2UUB M;  4DR2 M;  2F5S A;  4JI4 M;  4LFC M;  4K0K M;  4LF8 M;  1L2B A;  1Z5C A;  2F5O A;  4NRV A;  4X66 M;  3SAU A;  3U6P A;  4MB7 A;  3J80 S;  4NXN M;  1IBM M;  3GPY A;  4JI1 M;  1N32 M;  5ITY A;  3U6S A;  4DR4 M;  1IBL M;  1K3X A;  3TWL A;  1Q3C A;  3SAT A;  4KHP M;  3DOA A;  1MX0 A;  4LF6 M;  4JI5 M;  1NNJ A;  3GO8 A;  1MU5 A;  4JI3 M; 
#chains in the Genus database with same CATH topology
 1QAM A;  3AFH A;  3LCV B;  3VK8 A;  2EKK A;  1HNZ M;  4L8R C;  3KXE C;  1PM5 A;  2LVP C;  1IY1 A;  1E94 E;  4R3D A;  1DO0 A;  2DAM A;  1F4I A;  3FKE A;  2XGN A;  4LF4 M;  4GC5 A;  4AG5 A;  1QAN A;  3SYK A;  1QVR A;  3T1Y M;  4L16 A;  4GH9 A;  1ZAE A;  2JY6 B;  4G3O A;  4LZJ A;  1QUT A;  4X62 M;  1DGH B;  2MH8 A;  2MRO B;  5KPZ A;  4LGM A;  3GLH E;  5FTK A;  2VQE M;  3KS8 A;  1DV0 A;  2HWJ A;  3M6A A;  1IN7 A;  3KOX E;  4DR5 M;  2VF7 A;  4GKJ M;  2L2D A;  5KPR A;  1E9S A;  4QHT A;  4DBG B;  3UGJ A;  1KYI A;  2KZS A;  3TPZ A;  4DV3 M;  4FCV A;  5C1B A;  2KNA A;  2UU9 M;  2DAI A;  3E4R A;  4GIP A;  5EXP A;  5H37 D;  1YSY A;  2FE8 A;  3HU1 A;  1Z5B A;  2CRU A;  2JP7 A;  3PNV A;  3FRH A;  2UXC M;  1V92 A;  4YY3 M;  4DR3 M;  1NY6 A;  2X8A A;  1AIP C;  5ITX A;  2DAG A;  5IZ7 D;  2L4F A;  4LFA M;  1NHW C;  3B74 A;  1NNU C;  4NC6 A;  5FTN A;  2BJV A;  3B9P A;  4JYA M;  1SG9 A;  2Y0Q A;  3SYL A;  2JWS A;  2R18 A;  2P5T A;  2YQZ A;  1J5E M;  2ZBK B;  2QBY B;  2F4V M;  4B3R M;  1G4A E;  1GJT A;  5L8R F;  1MN3 A;  3V76 A;  4F1I A;  2KA6 B;  4DV4 M;  2D7E A;  1LV7 A;  1WJ7 A;  3I4V A;  2DWM A;  4LJ5 A;  3VKG A;  4LJ9 A;  5LMN M;  3CF6 E;  3RFW A;  2L09 A;  1D2N A;  3BOS A;  4FVM A;  2CHG A;  2DZO B;  2JA2 A;  2JZ0 A;  1V34 A;  3HWS A;  1QZM A;  4AKH A;  2Z4S A;  4FW9 A;  5KPT A;  1NV8 A;  1E32 A;  2AHM A;  1N36 M;  5IWA M;  3I51 A;  2MR9 A;  2J5Y A;  2HL7 A;  4B7G A;  3MK6 A;  1SXJ E;  4MGI E;  2ZM6 M;  2LVN C;  2EA0 A;  2A5Y B;  4IIW A;  1TDH A;  3L27 A;  3GLF A;  1PJT A;  5EP1 A;  3ZC7 B;  1G71 A;  2X4A A;  2EUC A;  4WP2 A;  2V1U A;  3GLG E;  4IBK A;  2V6Z M;  4MGZ E;  1ZQ9 A;  4G4R A;  1L2D A;  2UXB M;  1JR3 A;  2R65 A;  1J7K A;  1IY0 A;  3M7G A;  2DXI A;  3H4J A;  2F5P A;  3LMM A;  3T15 A;  3JAM S;  4B3S M;  3HY5 A;  2UUB M;  1TH4 A;  4CGY B;  2KRK A;  3M0E A;  4IBD A;  2QZ4 A;  3PFI A;  4LF8 M;  3L25 A;  5EP4 A;  1L2B A;  3LVV A;  2F5O A;  2CV0 A;  1IXR C;  3UK6 A;  3D8L A;  4NRV A;  1ZMU A;  3ZH9 B;  5EXT A;  3PXG A;  4AI6 A;  4JI1 M;  1N32 M;  4FWH A;  4MGH A;  5E26 A;  1VDL A;  2BJW A;  2G3Q A;  3L29 A;  3TWL A;  2DAK A;  4CIZ A;  3WHL A;  3UZU A;  2Y20 A;  3HZJ A;  3KOY E;  3DOA A;  1R7R A;  2RGO A;  3FD9 A;  2X49 A;  4AW4 A;  4LJA A;  5BR8 M;  1YLA A;  2BWB A;  2W82 A;  5FTL A;  3LW5 F;  1OIP A;  4G4N A;  2KNZ A;  3U60 A;  2DHY A;  4LFB M;  3K1J A;  1OAO C;  3CTW B;  3VKH A;  2LVA A;  3LCU A;  2LHG A;  2YNM D;  3TWK A;  4AZF A;  1WHC A;  4CIS A;  3HHX A;  2Y21 A;  4FCT A;  1TH3 A;  1Z5A A;  2Z4R A;  3J27 B;  3FUX A;  1OKS A;  3RGS A;  4GMQ A;  2Z3X A;  1ZMV A;  4LG2 A;  1QAO A;  2NQ8 C;  4IJE A;  1UFZ A;  1YE9 A;  4IBG A;  1KSF X;  2KXE A;  2YFQ A;  3FRI A;  3QWL A;  4XGI A;  1XMQ M;  1NHG C;  2VQF M;  4R7G A;  1DO2 A;  3AV0 A;  3GLH A;  3KSX A;  4EIW A;  1ZMW A;  3C58 A;  3U5Z B;  1TDZ A;  4XBO A;  4LF9 M;  3AOE C;  1NVM A;  3J2P B;  3Q8X A;  2XSZ A;  2EJS A;  4IBF A;  1PJJ A;  1TF0 B;  4M9S A;  2ZAO A;  3NBI A;  4JN6 A;  1XC8 A;  1SXJ C;  2H1R A;  4KLN A;  3JR4 A;  3DA1 A;  1PRB A;  3U6O A;  1IY2 A;  1Z59 A;  2HHH M;  4JI8 M;  4PCZ A;  1XNR M;  1NO1 A;  2C9C A;  3SFZ A;  3R8F A;  3IHP A;  2O25 A;  3MMP A;  4PT5 A;  3U6L A;  3VFD A;  1OFI A;  3PVS A;  5JI3 E;  1OQY A;  3L2A A;  4Q7J A;  2FOI C;  3B7N A;  1BVS A;  2CP8 A;  2KNV A;  3HHY A;  1HT1 E;  3K2L A;  3GLF B;  1WR1 B;  1PGY A;  2CV2 A;  2HAK A;  2EO2 A;  1D0M A;  2R46 A;  3HHZ A;  1K82 A;  4JI7 M;  4MM3 B;  2N35 A;  2CHV A;  2ERC A;  3TL4 X;  1IFY A;  5EP2 A;  4B3T M;  3UJN A;  3AOG A;  3R9X B;  2DI0 A;  4RKU F;  2XZF A;  1R5L A;  3CF0 A;  1OJL A;  5FTJ A;  1L1T A;  1IN6 A;  1WIV A;  4GC9 A;  2WSE F;  3B7Z A;  2OPF A;  2LHC A;  1OTR A;  3IG5 A;  4DV5 M;  3U6D A;  5BPV A;  4P17 A;  1DGG A;  1HR0 M;  2BWE A;  4L4U A;  2R45 A;  5EP3 A;  2LTU A;  3HU3 A;  1N77 A;  1R4G A;  1GAB A;  4LF5 M;  4LRT A;  2ZAM A;  3K9P A;  5DYI A;  1SXJ A;  1K3W A;  3U5Z A;  1Q3B A;  2K47 A;  1GLN A;  3W0L B;  2DZL A;  2EKF A;  4L6V 6;  1XB2 B;  2L7H A;  3W68 A;  2JZ1 A;  4I8O A;  2KDL A;  3LQQ A;  3LVW A;  2XEP A;  2FNA A;  3GLG A;  1ZV1 A;  4DR2 M;  4K0K M;  2XFS A;  3QYB A;  1PJS A;  1R6B X;  2OOB A;  3ILK A;  2JXN A;  2R4E A;  4NSO B;  4WW0 A;  4GHL A;  3SAU A;  1OIZ A;  3U60 B;  4MB7 A;  3J80 S;  2C99 A;  2CHQ A;  4P16 A;  3GPY A;  1LTM A;  3ZCB B;  1I4W A;  1IBL M;  4GIT A;  4M0D A;  3GLI E;  3I01 M;  4ZPX A;  4LY6 A;  1W5S A;  2HCB A;  4B7H A;  3KS4 A;  5DNY A;  1T43 A;  2QHO B;  4M0W A;  1HJP A;  4LF6 M;  4D80 A;  2C5R A;  4RNA A;  3K92 A;  5DFL A;  2CUZ A;  4LRS A;  4QNM A;  4I4L A;  4JI3 M;  3FTE A;  4NL4 H;  4DUZ M;  4CJ6 A;  1NY5 A;  3FYD A;  5KQD A;  2E5L M;  4HL4 A;  1GKI A;  1V33 A;  2B3T A;  1XXH A;  2WZJ A;  3IEC A;  1S3S A;  4HLQ A;  5ITX E;  3A46 A;  3GLH B;  1QQW A;  3KW6 A;  4NSR A;  3CGW A;  1R2Y A;  2QP9 X;  2UXD M;  5KO3 A;  5IRE B;  2YR0 A;  4Y28 F;  2XH9 A;  3HU2 A;  1IXS A;  3GRU A;  1D0K A;  2LWX A;  2O5R A;  2J7N A;  2ZAN A;  4L15 A;  1P3Q Q;  1XMO M;  5A2Q S;  1L2C A;  3L26 A;  1IBK M;  3GQ3 A;  1VG5 A;  3KP0 E;  1C7Y A;  2DEN A;  2LXE A;  3J7B A;  4JI0 M;  4PDI A;  4M9X A;  3FUW A;  1JQJ C;  3KP1 E;  2VII A;  4G4Q A;  3EIH A;  5EQT A;  2DHR A;  3WHK A;  4YHH M;  4PD2 A;  4DV2 M;  2JY8 A;  3A45 A;  5ITU A;  2K0B X;  1VEK A;  1TR8 A;  1N78 A;  3E21 A;  1FJG M;  4DR7 M;  1QDR A;  2LNH C;  4XK8 F;  3B7Q A;  4LJ4 A;  2FFJ A;  4DV0 M;  4G4O A;  3W0F A;  4BB9 A;  3H4M A;  4G6Z A;  4FCW A;  1UM8 A;  1GVN A;  4IBJ A;  2XLJ A;  3TWM A;  3U6M A;  3GLF E;  4LGY A;  4MGK E;  4IJF A;  4LF7 M;  3FUT A;  1OAI A;  2OOA A;  1QAQ A;  4FD2 A;  1IN4 A;  2WSC F;  3GPU A;  3K8Z A;  3T1H M;  2J7O A;  3KDS E;  4DV7 M;  3U6E A;  1XNQ M;  2R4J A;  4RF1 A;  2HKJ A;  3FYC A;  4WUR A;  3D8B A;  1C1K A;  2I7P A;  1H6U A;  3BXW A;  3VK7 A;  4ITQ A;  1TTE A;  2ZTC A;  1YUB A;  4NRW A;  2RKO A;  4AQY M;  3TE6 A;  5EXX A;  4LJ6 A;  2UUA M;  4JV5 M;  2JNH A;  4MH0 E;  1I94 M;  3AL0 C;  1SXJ B;  3FTC A;  2QQ8 A;  3C3D A;  4LJ7 A;  5EJC A;  4CHT B;  8CAT A;  5IT9 S;  1R2Z A;  2DZN B;  3CF2 A;  4GEW A;  2CV1 A;  3HKP A;  4QHS A;  2JY7 A;  1QZE A;  3SAR A;  1QDT A;  7CAT A;  3GLG B;  1NJF A;  2XFT A;  4Z8X A;  1VEG A;  3FTD A;  3AKZ A;  4DR1 M;  4A3V B;  3J7A S;  4JI6 M;  2DKL A;  3A42 A;  4AKI A;  1G41 A;  4OW0 A;  3C3E A;  3FTF A;  3VDU A;  3U6Q A;  3T6P A;  1GO5 A;  5EXS A;  4B3M M;  3HGI A;  2R44 A;  4Z6Y A;  2R62 A;  3SMS A;  3HJ8 A;  4KO8 A;  2D7H A;  2Q2E B;  1Z6T A;  1DGF A;  3JR5 A;  3SMP A;  2XF3 A;  4R71 A;  3EIE A;  2F5S A;  4OVZ B;  4JI4 M;  4LFC M;  4GHA A;  3AJI B;  3HJS A;  2KRU A;  1A5T A;  1XXH B;  2DVW B;  3I04 M;  3KVW A;  4X66 M;  4ANR A;  2V1C A;  4NXN M;  1IBM M;  2GNO A;  2VDB B;  2JUJ A;  1X37 A;  5ITY A;  3T38 A;  4F2L A;  5FSW A;  3U6S A;  4LJ8 A;  4GRI A;  1VQ1 A;  3AOE A;  3L28 A;  4DR4 M;  1IXS B;  3F92 A;  2MGW A;  3ZQJ A;  2CEA A;  4BLC A;  1W5T A;  3SAT A;  3QYE A;  2CE7 A;  2O01 F;  3RE8 A;  3SHG B;  4JI5 M;  3GLI A;  1QUS A;  1IXZ A;  4W5W A;  1MU5 A;  1TH2 A;  3E46 A;  2R6F A;  1GL6 A;  2RRU A;  1NSF A;  2BNK A;  2ZTD A;  1L8Q A;  3HX3 A;  3QAU A;  4NOO B;  1EE8 A;  4IBB A;  4LCB A;  1N34 M;  3B89 A;  1G8P A;  1WGL A;  1DGB A;  4QNR A;  4L78 A;  2C96 A;  3KOW E;  1WGN A;  2M60 A;  2QEN A;  2D7G A;  1HQC A;  2WSF F;  3BBZ A;  3THG A;  3U61 B;  4OX9 M;  1WXQ A;  2L7I A;  3RGP A;  1G3I A;  3NWL A;  1JB0 F;  4UN2 B;  5F3W A;  3LQR A;  2K9D A;  2KHH A;  5DYG A;  3GPX A;  4KT0 F;  2DWL A;  2UUC M;  3TQS A;  3OTO M;  4DUY M;  4I81 A;  4OVZ A;  4REZ A;  1IM2 A;  1L1Z A;  3SBJ A;  4DV1 M;  5LMU M;  2R0I A;  3IG8 A;  2XSZ D;  4FWD A;  4IBE A;  2F5Q A;  4D81 A;  2H5X A;  5ITQ A;  5KQ8 A;  3FE3 A;  4TUW A;  1RU3 A;  5ITT A;  1IN5 A;  3MHV C;  4IBI A;  4IBC A;  4BBA A;  1Y8G A;  1QYR A;  5ITR A;  1GL7 A;  3NBX X;  1HNX M;  1DGH A;  1TGU A;  3E9S A;  2L6O A;  3I4Y A;  1G59 A;  1E9R A;  1OFH A;  4X65 M;  4MGY E;  2F5N A;  1GJS A;  3SHF A;  2KW0 A;  4OU7 A;  3K9O A;  3PNY A;  1HNW M;  2Y0T A;  1AUA A;  4DR6 M;  2FH0 A;  3J81 S;  3KSJ A;  4II7 A;  3GQ4 A;  2RGH A;  1NJG A;  2DAE A;  1N75 A;  3U6C A;  1Q39 A;  3GRR A;  1EIJ A;  1ORY B;  2QSF X;  1FNN A;  2Z8Y M;  2M5Z A;  3Q8G A;  3DZD A;  4RF0 A;  4AG6 A;  5C18 A;  3GQ5 A;  3GPP A;  2I7N A;  1N33 M;  4B08 A;  3DFZ A;  1CUK A;  2C98 A;  2QCU A;  4LZZ A;  3VDP A;  2FS1 A;  4B7F A;  2OQ4 A;  3U61 A;  4NXM M;  4KOD A;  3SAS A;  1EFU B;  2QPA A;  4X64 M;  2DWZ B;  4JI2 M;  1HT2 E;  4JXJ A;  1SXJ D;  2QBY A;  4S12 A;  4DV6 M;  1PJI A;  1IQP A;  4GKK M;  1VDD A;  4QOZ C;  4PDG A;  1JR3 E;  2GQF A;  2G5G X;  2CFO A;  3UMM A;  5FTM A;  2MJ5 B;  5FLX S;  1XXH E;  2L4E A;  2G8L A;  3SAW A;  3SAV A;  2XZU A;  3MJ5 A;  1KFV A;  2QNJ A;  3GP1 A;  4HEO A;  4QOS A;  2K6B A;  1J09 A;  3VLF B;  3GLI B;  2LH0 A;  1XWI A;  2VF8 A;  4D82 A;  5GKN A;  3KFU G;  3KOZ E;  5E6J A;  1XHB A;  3GRY A;  3W67 A;  1T6O A;  1Z5C A;  2KEB A;  3GRV A;  1D0L A;  3A98 B;  2CWB A;  1Q02 A;  4AKG A;  3U6P A;  3HHW A;  3C9P A;  3FUV A;  2KZU A;  1IN8 A;  5JI2 E;  3FUU A;  3SC3 A;  1K3X A;  4M9Z A;  2JY5 A;  1Q3C A;  1T3T A;  2LVQ D;  1JR3 D;  2OO9 A;  2DNA A;  1VEJ A;  4I5S A;  4KHP M;  2C9O A;  1MX0 A;  1NV9 A;  2APL A;  4FWG A;  2DWN A;  2Z7J A;  1NNJ A;  2LVO C;  3GO8 A;  2LBC A;  3HJQ A;  1PJQ A;  1HQY E;  1MJG M; 
#chains in the Genus database with same CATH homology
 1QAM A;  3AFH A;  1HNZ M;  3VK8 A;  4L8R C;  3KXE C;  1PM5 A;  1IY1 A;  1E94 E;  4R3D A;  1DO0 A;  3FKE A;  2XGN A;  4LF4 M;  4GC5 A;  4AG5 A;  1QAN A;  3SYK A;  1QVR A;  3T1Y M;  4L16 A;  4GH9 A;  1ZAE A;  4LZJ A;  4X62 M;  1DGH B;  5KPZ A;  4LGM A;  5FTK A;  2VQE M;  3KS8 A;  3M6A A;  1IN7 A;  3KOX E;  4DR5 M;  4GKJ M;  5KPR A;  1E9S A;  4QHT A;  3UGJ A;  4DV3 M;  1KYI A;  2KZS A;  3TPZ A;  4FCV A;  5C1B A;  2UU9 M;  3E4R A;  4GIP A;  5EXP A;  5H37 D;  1YSY A;  2FE8 A;  3HU1 A;  1Z5B A;  3PNV A;  2UXC M;  4YY3 M;  4DR3 M;  1NY6 A;  2X8A A;  5ITX A;  5IZ7 D;  4LFA M;  1NHW C;  5FTN A;  1NNU C;  4JYA M;  2BJV A;  3B9P A;  2Y0Q A;  3SYL A;  2R18 A;  2P5T A;  2YQZ A;  1J5E M;  2ZBK B;  2QBY B;  2F4V M;  4B3R M;  1G4A E;  2KA6 B;  4DV4 M;  2D7E A;  1LV7 A;  3I4V A;  2DWM A;  4LJ5 A;  3VKG A;  4LJ9 A;  5LMN M;  3CF6 E;  3RFW A;  2L09 A;  1D2N A;  3BOS A;  4FVM A;  2CHG A;  2DZO B;  2JA2 A;  3HWS A;  4AKH A;  1QZM A;  2Z4S A;  4FW9 A;  5KPT A;  1E32 A;  2AHM A;  1N36 M;  5IWA M;  3I51 A;  2HL7 A;  4B7G A;  3MK6 A;  1SXJ E;  4MGI E;  2ZM6 M;  2EA0 A;  2A5Y B;  4IIW A;  1TDH A;  3L27 A;  3GLF A;  5EP1 A;  3ZC7 B;  2X4A A;  2EUC A;  2V1U A;  4IBK A;  2V6Z M;  4MGZ E;  1ZQ9 A;  4G4R A;  1L2D A;  2UXB M;  1JR3 A;  2R65 A;  1IY0 A;  1J7K A;  3M7G A;  2DXI A;  2F5P A;  3LMM A;  3T15 A;  3JAM S;  4B3S M;  2UUB M;  1TH4 A;  4CGY B;  2KRK A;  3M0E A;  4IBD A;  2QZ4 A;  3PFI A;  4LF8 M;  3L25 A;  5EP4 A;  1L2B A;  3LVV A;  2F5O A;  2CV0 A;  1IXR C;  3UK6 A;  3D8L A;  4NRV A;  3ZH9 B;  5EXT A;  3PXG A;  4AI6 A;  4JI1 M;  1N32 M;  4FWH A;  4MGH A;  5E26 A;  3TWL A;  2BJW A;  3L29 A;  3WHL A;  3UZU A;  2Y20 A;  3KOY E;  3DOA A;  1R7R A;  2RGO A;  3FD9 A;  2X49 A;  4AW4 A;  4LJA A;  5BR8 M;  2W82 A;  5FTL A;  4G4N A;  3U60 A;  4LFB M;  3K1J A;  3CTW B;  3VKH A;  2YNM D;  3TWK A;  4AZF A;  4CIS A;  3HHX A;  2Y21 A;  4FCT A;  1TH3 A;  1Z5A A;  2Z4R A;  3J27 B;  3FUX A;  3RGS A;  2Z3X A;  4GMQ A;  4LG2 A;  1QAO A;  2NQ8 C;  4IJE A;  4IBG A;  1YE9 A;  1KSF X;  2KXE A;  2YFQ A;  3QWL A;  4XGI A;  1XMQ M;  1NHG C;  2VQF M;  4R7G A;  1DO2 A;  3AV0 A;  3GLH A;  3KSX A;  4EIW A;  3C58 A;  3U5Z B;  1TDZ A;  4XBO A;  4LF9 M;  3AOE C;  1NVM A;  3J2P B;  3Q8X A;  2XSZ A;  1PJJ A;  4IBF A;  4M9S A;  2ZAO A;  3NBI A;  4JN6 A;  1XC8 A;  1SXJ C;  2H1R A;  4KLN A;  3JR4 A;  3DA1 A;  3U6O A;  1IY2 A;  1Z59 A;  2HHH M;  4JI8 M;  4PCZ A;  1XNR M;  2C9C A;  3SFZ A;  3R8F A;  4PT5 A;  3U6L A;  3VFD A;  1OFI A;  3PVS A;  5JI3 E;  3L2A A;  2FOI C;  3HHY A;  1HT1 E;  3K2L A;  3GLF B;  2CV2 A;  2EO2 A;  2R46 A;  3HHZ A;  1K82 A;  4JI7 M;  4MM3 B;  2CHV A;  2ERC A;  3TL4 X;  5EP2 A;  4B3T M;  3UJN A;  3AOG A;  3R9X B;  2XZF A;  3CF0 A;  1OJL A;  5FTJ A;  1L1T A;  1IN6 A;  4GC9 A;  2OPF A;  3U6D A;  3IG5 A;  4DV5 M;  5BPV A;  1HR0 M;  1DGG A;  4L4U A;  2R45 A;  5EP3 A;  3HU3 A;  1N77 A;  4LF5 M;  4LRT A;  2ZAM A;  5DYI A;  1SXJ A;  1K3W A;  3U5Z A;  1Q3B A;  2K47 A;  1GLN A;  3W0L B;  2L7H A;  4I8O A;  3LQQ A;  3LVW A;  2XEP A;  2FNA A;  3GLG A;  4DR2 M;  4K0K M;  2XFS A;  1R6B X;  3ILK A;  2R4E A;  4NSO B;  4WW0 A;  4GHL A;  3SAU A;  3U60 B;  4MB7 A;  3J80 S;  2C99 A;  2CHQ A;  4P16 A;  3GPY A;  3ZCB B;  1I4W A;  1IBL M;  4GIT A;  4M0D A;  4ZPX A;  4LY6 A;  1W5S A;  2HCB A;  4B7H A;  3KS4 A;  5DNY A;  4M0W A;  4LF6 M;  4D80 A;  2C5R A;  4RNA A;  3K92 A;  2CUZ A;  4LRS A;  4QNM A;  4I4L A;  4JI3 M;  3FTE A;  4NL4 H;  4DUZ M;  1NY5 A;  3FYD A;  5KQD A;  2E5L M;  4HL4 A;  1GKI A;  3A46 A;  1XXH A;  4HLQ A;  5ITX E;  1S3S A;  1R2Y A;  3GLH B;  1QQW A;  3KW6 A;  4NSR A;  2UXD M;  2QP9 X;  5KO3 A;  5IRE B;  2YR0 A;  2XH9 A;  3HU2 A;  3GRU A;  2O5R A;  2LWX A;  2ZAN A;  2J7N A;  1XMO M;  4L15 A;  1L2C A;  5A2Q S;  3L26 A;  1IBK M;  3GQ3 A;  3KP0 E;  3J7B A;  2LXE A;  4PDI A;  4JI0 M;  4M9X A;  3FUW A;  1JQJ C;  3KP1 E;  2VII A;  4G4Q A;  3EIH A;  5EQT A;  2DHR A;  3WHK A;  4YHH M;  4PD2 A;  4DV2 M;  3A45 A;  5ITU A;  1N78 A;  1FJG M;  4DR7 M;  2LNH C;  4LJ4 A;  2FFJ A;  4DV0 M;  4G4O A;  3W0F A;  4BB9 A;  3H4M A;  4G6Z A;  4FCW A;  1UM8 A;  1GVN A;  4IBJ A;  2XLJ A;  3TWM A;  3U6M A;  4LGY A;  4MGK E;  4IJF A;  4LF7 M;  3FUT A;  1QAQ A;  4FD2 A;  1IN4 A;  3GPU A;  3K8Z A;  3T1H M;  2J7O A;  3KDS E;  4DV7 M;  3U6E A;  1XNQ M;  2R4J A;  4RF1 A;  2HKJ A;  3FYC A;  4WUR A;  3D8B A;  1C1K A;  2I7P A;  1H6U A;  3VK7 A;  4ITQ A;  4NRW A;  1YUB A;  2RKO A;  4AQY M;  3TE6 A;  5EXX A;  4LJ6 A;  2UUA M;  4JV5 M;  4MH0 E;  1I94 M;  3AL0 C;  1SXJ B;  3FTC A;  4LJ7 A;  4CHT B;  5EJC A;  8CAT A;  5IT9 S;  1R2Z A;  2DZN B;  3CF2 A;  2CV1 A;  3HKP A;  4QHS A;  3SAR A;  7CAT A;  3GLG B;  1NJF A;  2XFT A;  4Z8X A;  3FTD A;  3AKZ A;  4DR1 M;  4A3V B;  3J7A S;  4JI6 M;  3A42 A;  4AKI A;  1G41 A;  4OW0 A;  3FTF A;  3VDU A;  3U6Q A;  5EXS A;  4B3M M;  3HGI A;  4Z6Y A;  2R62 A;  3SMS A;  4KO8 A;  2D7H A;  2Q2E B;  1Z6T A;  1DGF A;  3JR5 A;  3SMP A;  2XF3 A;  3EIE A;  2F5S A;  4JI4 M;  4LFC M;  4GHA A;  3AJI B;  3HJS A;  2KRU A;  2DVW B;  1XXH B;  3KVW A;  4X66 M;  2V1C A;  4NXN M;  1IBM M;  1X37 A;  5ITY A;  3T38 A;  5FSW A;  3U6S A;  4LJ8 A;  4GRI A;  3AOE A;  4DR4 M;  3L28 A;  1IXS B;  2CEA A;  4BLC A;  1W5T A;  3SAT A;  2CE7 A;  3RE8 A;  3SHG B;  4JI5 M;  3GLI A;  1IXZ A;  4W5W A;  1MU5 A;  1TH2 A;  1GL6 A;  1NSF A;  2BNK A;  3QAU A;  1L8Q A;  4NOO B;  1EE8 A;  4IBB A;  4LCB A;  1N34 M;  1G8P A;  1DGB A;  4QNR A;  4L78 A;  2C96 A;  3KOW E;  2M60 A;  2QEN A;  2D7G A;  1HQC A;  3THG A;  3U61 B;  4OX9 M;  1WXQ A;  2L7I A;  3RGP A;  1G3I A;  3NWL A;  5F3W A;  3LQR A;  5DYG A;  3GPX A;  2DWL A;  2UUC M;  3TQS A;  3OTO M;  4DUY M;  4I81 A;  4OVZ A;  4REZ A;  1IM2 A;  1L1Z A;  3SBJ A;  4DV1 M;  5LMU M;  3IG8 A;  2XSZ D;  4FWD A;  4IBE A;  2F5Q A;  4D81 A;  5ITQ A;  5KQ8 A;  4TUW A;  5ITT A;  1IN5 A;  3MHV C;  4IBI A;  4IBC A;  4BBA A;  1QYR A;  5ITR A;  1GL7 A;  1HNX M;  1DGH A;  1TGU A;  3E9S A;  2L6O A;  3I4Y A;  1HQY E;  1G59 A;  1E9R A;  1OFH A;  4X65 M;  4MGY E;  2F5N A;  3SHF A;  2KW0 A;  4OU7 A;  3PNY A;  1HNW M;  2Y0T A;  4DR6 M;  3J81 S;  3KSJ A;  4II7 A;  3GQ4 A;  2RGH A;  1NJG A;  1N75 A;  3U6C A;  1Q39 A;  3GRR A;  1ORY B;  1FNN A;  2M5Z A;  4RF0 A;  3DZD A;  4AG6 A;  5C18 A;  3GQ5 A;  3GPP A;  2I7N A;  1N33 M;  4B08 A;  3DFZ A;  2C98 A;  3VDP A;  2QCU A;  4LZZ A;  4B7F A;  2OQ4 A;  3U61 A;  4NXM M;  4KOD A;  3SAS A;  2QPA A;  4X64 M;  2DWZ B;  4JI2 M;  1HT2 E;  4JXJ A;  1SXJ D;  2QBY A;  4S12 A;  4DV6 M;  1PJI A;  1IQP A;  4GKK M;  1VDD A;  4QOZ C;  4PDG A;  2G5G X;  2CFO A;  3UMM A;  5FTM A;  5FLX S;  3SAW A;  1KFV A;  2G8L A;  3SAV A;  2XZU A;  3MJ5 A;  3GP1 A;  4QOS A;  1J09 A;  3VLF B;  3GLI B;  2LH0 A;  1XWI A;  4D82 A;  5GKN A;  3KFU G;  3KOZ E;  5E6J A;  1XHB A;  3GRY A;  1Z5C A;  2KEB A;  3GRV A;  3A98 B;  4AKG A;  3U6P A;  3HHW A;  3FUV A;  2KZU A;  1IN8 A;  5JI2 E;  3FUU A;  3SC3 A;  1K3X A;  4M9Z A;  1Q3C A;  1T3T A;  1JR3 D;  4I5S A;  4KHP M;  2C9O A;  1MX0 A;  4FWG A;  2DWN A;  2Z7J A;  1NNJ A;  3GO8 A;  4OVZ B;  3HJQ A;  3HJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...