4DV1M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv1M02
1N32M 4X64M 4YY3M 4JI0M 3A42A 3SAUA 2UUBM 4JI3M 4B3SM 2UUCM 4MB7A 4X62M 3JR4A 1KFVA 2VQFM 2HHHM 3J81S 3U6EA 4G4NA 4B3MM 4PDIA 2ZBKB 3TWMA 4G4QA 3A46A 2VQEM 2F5PA 1L2BA 2OPFA 4DV3M 3SASA 1Q3BA 1XNQM 1Z5CA 4GKJM 4B3TM 3GQ3A 2ZM6M 4JI7M 5ITQA 4DR3M 1XMQM 3SAVA 1R2ZA 5IWAM 4LF6M 1N34M 3J7AS 2Q2EB 3GPPA 4DV4M 1N36M 2XZUA 2UXCM 4DUYM 4DR7M 5ITUA 4LF8M 4LFCM 1K3WA 1HNZM 5ITTA 4DR6M 1Q39A 2OQ4A 2XZFA 5IT9S 1IBKM 1IBLM 5LMNM 3TWLA 4JV5M 1L1TA 5ITXA 1Z5AA 1PJJA 3U6OA 3SBJA 5BR8M 4LF5M 4PDGA 4LF9M 2UXBM 4DR2M 3U6CA 3T1HM 3J80S 1L1ZA 4JYAM 1MU5A 3JAMS 4DUZM 1XC8A 1TDZA 4NXMM 2F5QA 4DR1M 4OX9M 3TWKA 2F5SA 5FLXS 2F4VM 5ITYA 1NNJA 4NRVA 1HNWM 3U6MA 3A45A 3U6LA 1K3XA 1PJIA 4CISA 3C58A 3VK8A 1XMOM 4B3RM 4LF4M 5ITXE 4DV1M 3VK7A 1HR0M 4LFBM 3T1YM 4PCZA 4AQYM 3U6PA 1J5EM 3W0FA 3JR5A 4K0KM 4ITQA 3GPYA 1Q3CA 4JI2M 3U6QA 4LFAM 3GQ4A 4DR4M 4JI1M 1PM5A 3DOAA 3GP1A 4DR5M 2E5LM 4NXNM 1TDHA 4PD2A 4JI5M 1FJGM 1IBMM 4DV2M 1EE8A 2EA0A 1N33M 5A2QS 3U6SA 3GO8A 1MX0A 4NRWA 2HKJA 3GQ5A 4DV6M 1Z5BA 1K82A 4LF7M 1HNXM 4G4OA 5LMUM 4DV0M 4X66M 4DV5M 1I94M 1Z59A 3GPUA 3SAWA 4DV7M 4JI8M 1XNRM 4GKKM 4YHHM 3SATA 4JI6M 1L2DA 4X65M 3OTOM 3U6DA 3SARA 1L2CA 4G4RA 2UUAM 1R2YA 2F5NA 3GPXA 2UU9M 2UXDM 4JI4M 5ITRA 2F5OA 4KHPM
chains in the Genus database with same CATH superfamily
1W5TA 3A42A 1NV9A 3GRUA 2UUBM 2C98A 2QQ8A 3U5ZA 3M6AA 1QYRA 3LVWA 2X49A 2D7EA 5F3WA 2L4FA 2LNHC 3GLIA 1KFVA 2KEBA 2CE7A 3U6EA 2C9OA 1DGFA 1SXJC 2C99A 5DYGA 4B3MM 4FVMA 2CV2A 1L2BA 3F92A 3QYBA 1Q3BA 3M7GA 3DFZA 2NQ8C 4LJAA 1HT1E 1PGYA 3CF2A 8CATA 1VQ1A 4D82A 2Y21A 3KOYE 1D2NA 3AOEA 4DV4M 3U60A 2XZUA 5IZ7D 2G5GX 4DUYM 3AL0C 4DR7M 1IY0A 1DGHB 4DR6M 5ITTA 2JXNA 2KNVA 1PJQA 3FTDA 4L6V6 2QSFX 4S12A 4F1IA 1VEJA 4LG2A 1Z5AA 2YFQA 3PNYA 4RF1A 5EXSA 2MH8A 3KDSE 2H1RA 5BR8M 4LF5M 4PDGA 4LF9M 4DR2M 3HZJA 1AIPC 3NBIA 2JNHA 1LV7A 3CGWA 4M9ZA 4GC5A 1MN3A 1H6UA 4RNAA 4LGYA 4LJ8A 1GL6A 2DAGA 3FD9A 3GLHE 3AFHA 3EIHA 3HWSA 2XLJA 4DR1M 2CHQA 5EXXA 4A3VB 1SXJA 2KZUA 4LJ7A 4D80A 4NC6A 5FLXS 5ITYA 2F4VM 2JA2A 2LH0A 4IBCA 3T15A 4NRVA 3E46A 2MR9A 3CF0A 3D8BA 2BJVA 4JN6A 2OOAA 3Q8GA 3AJIB 1WJ7A 1WGNA 3C58A 1HR0M 3HU3A 4NL4H 1SXJD 3T1YM 1TGUA 1NSFA 4GIPA 2C96A 1J5EM 2DZNB 3K92A 3KP0E 4IBKA 2LXEA 1IFYA 1Q3CA 4QHSA 3HGIA 3B89A 2CP8A 1TH2A 2JZ0A 3CTWB 3HX3A 2JZ1A 3T38A 3GQ4A 4TUWA 1PM5A 1VDDA 4DR5M 3VDUA 2E5LM 2KXEA 4CHTB 4P16A 4NXNM 4PD2A 1TH3A 3K2LA 2ZTDA 5KPTA 4JI5M 2QP9X 1GJTA 4AW4A 1IBMM 2LVAA 3IECA 2QNJA 5KO3A 2MROB 3GLFB 3IG5A 2HKJA 4XK8F 2L7HA 4DV6M 4LJ9A 4Z8XA 2DWMA 2DWNA 1GVNA 1ZV1A 3GRYA 1TTEA 1VEGA 2LWXA 2JP7A 3TPZA 4FCWA 3GPUA 3SAWA 3R9XB 3QAUA 3IHPA 1OKSA 2R65A 3FYDA 4Z6YA 3V76A 2UUAM 2QZ4A 2ZANA 2XGNA 4LGMA 1D0LA 4R7GA 5EXTA 2R4JA 5FTLA 3ZC7B 2N35A 2UU9M 2CUZA 1PJTA 3Q8XA 4IIWA 1L8QA 2JWSA 2CV1A 4JI4M 1E9RA 2L09A 1DGHA 3IG8A 5FTNA 1GKIA 4KHPM 3QYEA 2CFOA 4X64M 1WR1B 3L27A 3L2AA 2DI0A 4B3SM 2DXIA 1IXZA 2YR0A 4IBBA 2UUCM 3D8LA 3HHZA 4IJEA 3MMPA 4X62M 4IBGA 2KNZA 4XGIA 2CV0A 2YQZA 1QAOA 1NJFA 2DVWB 1SG9A 3KOXE 2HHHM 1G59A 2R62A 4HL4A 3W67A 3J81S 1VEKA 4OU7A 1IN8A 3VFDA 1G3IA 4LJ5A 3TWMA 2F5PA 1TR8A 2OOBA 2O01F 3SASA 3WHLA 3NWLA 1YSYA 4KO8A 2DZOB 4GKJM 1IY1A 3GQ3A 3LCVB 4B3TM 1T43A 4FD2A 4IBIA 3GRRA 4DR3M 1VG5A 1QDTA 2G3QA 5IWAM 2CHGA 2YNMD 2Z8YM 4LY6A 1QUSA 3GLGE 1D0KA 3AV0A 1N34M 4BB9A 3LW5F 2DAIA 1OQYA 1N36M 1HQYE 2V1CA 2UXCM 1JR3A 4LF8M 2KW0A 1K3WA 4AKHA 1Q39A 4FCTA 1N75A 2B3TA 3FYCA 5KPZA 1IBKM 1IBLM 1J09A 1E32A 3GRVA 5LMNM 5H37D 4JV5M 1L1TA 1JQJC 3KSJA 1YUBA 3I4VA 1OTRA 4GHLA 2H5XA 1W5SA 4JXJA 1C7YA 1OAOC 3VDPA 3SBJA 1JR3D 3C3DA 1NY6A 4ZPXA 2XEPA 2UXBM 3TQSA 1IN4A 3A98B 5E26A 3T1HM 4B7HA 5DFLA 4JYAM 1QAMA 1TDZA 4LCBA 3KOZE 2F5QA 5EQTA 2Z4SA 3GLFA 2ZAOA 3ZCBB 1QQWA 1R7RA 3GLHB 4MGZE 1IN5A 2LVNC 1JB0F 2VDBB 3FUXA 4ANRA 1N77A 1LTMA 3VLFB 3U6LA 3FRIA 1K3XA 2DAMA 4CISA 3AOGA 4QOZC 4B3RM 4AG5A 5ITXE 4LF4M 3KS8A 3H4JA 2DKLA 1XB2B 2APLA 1DO2A 2DAEA 1KYIA 2J7NA 3BXWA 2V6ZM 3HJQA 4D81A 3U6PA 1ZMWA 4OVZB 7CATA 4ITQA 2Y0QA 1R6BX 2D7HA 1P3QQ 2CHVA 4KLNA 1EIJA 2BJWA 3E4RA 2L2DA 3NBXX 2WZJA 1G8PA 1V33A 2LHGA 3I4YA 1A5TA 3UK6A 3L26A 3GO8A 2MGWA 4M9XA 4NRWA 3BBZA 2A5YB 3HJ8A 4L4UA 3GQ5A 4CIZA 3ILKA 1Z5BA 3FUWA 4KODA 1K82A 1C1KA 1WGLA 1HNXM 3U61B 4G4OA 3HU2A 1HT2E 5LMUM 1KSFX 1QZEA 4PT5A 4DV5M 4G6ZA 4DV7M 2R6FA 3TL4X 1AUAA 4YHHM 4JI6M 4M9SA 2O5RA 4X65M 1YE9A 3L25A 1QZMA 4GRIA 1R2YA 1FNNA 4REZA 2DWLA 2EO2A 3GPXA 4LRTA 2XF3A 1RU3A 2M5ZA 1G4AE 1VDLA 3BOSA 1Y8GA 4GC9A 1HQCA 4HLQA 5ITRA 2F5OA 3C9PA 5KQ8A 1N32M 1F4IA 5EP1A 4YY3M 3SAUA 4NSRA 4JI3M 2K0BX 2ZTCA 2LHCA 4MB7A 2VF7A 2KRKA 1XXHE 2LVOC 4NOOB 2LBCA 5BPVA 3DZDA 2JY5A 2L6OA 2WSCF 4PDIA 2ZBKB 4G4QA 4IBFA 1R4GA 4DV3M 4I4LA 4AKIA 2ZM6M 4P17A 3RGPA 4JI7M 2QCUA 5ITQA 1XMQM 3SAVA 1G41A 1R2ZA 4GHAA 3GLHA 3FTEA 1NHWC 3RGSA 3FUUA 3R8FA 1NY5A 3HHYA 1T3TA 1QAQA 1YLAA 3GLGB 5ITUA 1TF0B 2EKFA 2M60A 3K1JA 3ZH9B 2XH9A 5KPRA 2OQ4A 2XZFA 5IT9S 2QBYB 3MK6A 3J27B 4M0DA 4RF0A 2EKKA 5FTJA 3TWLA 4OVZA 5FTKA 3GLIE 4L16A 3FE3A 3T6PA 4JI2M 1PJJA 3U6OA 1E94E 2CEAA 3LMMA 1E9SA 3DA1A 1UFZA 3U6CA 3J80S 5EXPA 4R71A 1N78A 2Z3XA 3FTFA 2DNAA 1MU5A 2DZLA 2I7NA 2X8AA 3LQRA 3JAMS 4BLCA 4DUZM 1XC8A 4NXMM 2P5TA 3SMSA 3KOWE 3TE6A 4OX9M 2GQFA 2RKOA 2ZAMA 3C3EA 3W0LB 2F5SA 2FOIC 1NNJA 3HHWA 2BWEA 4MGYE 3J7BA 2WSEF 2Y20A 4MGIE 3U61A 2MJ5B 1NNUC 4II7A 3RFWA 4CGYB 1V34A 4FCVA 5IREB 2K47A 2Z4RA 1XMOM 4LFBM 4FWGA 4DV1M 3VK7A 2D7GA 2JY6B 2QENA 3E21A 2AHMA 1DO0A 1NVMA 3K9PA 4MGHA 3W0FA 3JR5A 3QWLA 3AKZA 3GPYA 1NV8A 2LVQD 3CF6E 2R45A 4GITA 5EP4A 3U6QA 4DR4M 3SHFA 1EFUB 2HWJA 3DOAA 2DAKA 2C5RA 4FWDA 2Z7JA 2XFTA 1QDRA 3VKGA 5C18A 1SXJE 1IQPA 4DV2M 3SFZA 2EA0A 5A2QS 5E6JA 3U6SA 4GEWA 4GMQA 4FW9A 2L7IA 3M0EA 2I7PA 4LF7M 3WHKA 1OAIA 1IY2A 2R46A 3L29A 4IBDA 4QNRA 1I94M 1Z59A 1IXRC 2OO9A 4WW0A 2KNAA 1PRBA 4JI8M 3LCUA 4DBGB 3SATA 4GKKM 3FUVA 4AKGA 3THGA 4G3OA 1L2CA 1ZQ9A 4LRSA 1OFHA 1I4WA 1G71A 5KQDA 4IBJA 3I04M 3GLGA 4B7GA 5FTMA 1GLNA 2DENA 4EIWA 1IXSB 4WURA 4AG6A 2QBYA 3UMMA 1NHGC 4JI0M 2J7OA 2KZSA 1S3SA 1Z6TA 3SC3A 3MHVC 4BBAA 5JI2E 2EJSA 1ZMUA 2QHOB 4B08A 2O25A 5EP2A 4NSOB 4KT0F 3JR4A 2VQFM 2L4EA 1XXHB 2CRUA 4G4NA 4RKUF 2BWBA 2RRUA 4OW0A 3A46A 2VQEM 1MJGM 4QOSA 2OPFA 4AI6A 1XNQM 2W82A 1HJPA 1Z5CA 3HU1A 2JY7A 4LZJA 4MGKE 4CJ6A 3LQQA 1T6OA 1GO5A 3K9OA 3K8ZA 1IN6A 4LF6M 3RE8A 3B7ZA 1OIPA 3J7AS 2Q2EB 3GPPA 3HJSA 3KP1E 1IN7A 2FFJA 3B7QA 2FS1A 2J5YA 4LFCM 1HNZM 3FRHA 3VKHA 4IBEA 4B7FA 2HCBA 2GNOA 1WXQA 2K9DA 5FSWA 5ITXA 1J7KA 2VF8A 2DHRA 3U5ZB 2FH0A 4L78A 3L28A 4I5SA 2DHYA 3B9PA 3J2PB 1D0MA 3B74A 3GLIB 4LJ6A 2KRUA 1NJGA 5GKNA 1XWIA 3SYLA 1OFIA 3LVVA 1QVRA 3KW6A 1L1ZA 2KHHA 1OIZA 2HL7A 2V1UA 3FKEA 1DV0A 1X37A 4FWHA 3PXGA 4I81A 3TWKA 1DGGA 4HEOA 1ZAEA 4MM3B 1DGBA 3FUTA 3KVWA 2C9CA 4GH9A 4LJ4A 3W68A 1TH4A 2KDLA 2LVPC 1IM2A 1JR3E 1HNWM 3U6MA 3KXEC 3U60B 4QNMA 2HAKA 3A45A 4W5WA 2X4AA 5DYIA 1PJIA 3KFUG 1GL7A 5EP3A 3VK8A 2CWBA 2R18A 3I01M 2JUJA 2G8LA 4PCZA 4AQYM 2QPAA 2R4EA 2R44A 3PNVA 4MH0E 4M0WA 1ORYB 4K0KM 1QUTA 3EIEA 1GABA 4Q7JA 4Y28F 2R0IA 2RGOA 4WP2A 3UZUA 2VIIA 4F2LA 3HHXA 1IXSA 2KA6B 2Y0TA 2XFSA 4LFAM 5JI3E 4JI1M 2LTUA 2JY8A 4I8OA 3SMPA 4L15A 3GP1A 3H4MA 1BVSA 3HY5A 4XBOA 5EJCA 1TDHA 1ZMVA 2K6BA 4LZZA 5L8RF 1GJSA 1FJGM 4AZFA 1WHCA 3GLFE 4L8RC 1EE8A 3PFIA 1N33M 3B7NA 3MJ5A 1MX0A 3PVSA 2DWZB 1SXJB 1XXHA 1WIVA 2XSZA 3SYKA 3E9SA 4DV0M 2EUCA 1UM8A 1XHBA 4X66M 3AOEC 4IJFA 3ZQJA 2RGHA 3KS4A 3UJNA 4QHTA 1XNRM 3UGJA 2FNAA 3SHGB 1L2DA 3I51A 3OTOM 3U6DA 1Q02A 1V92A 3FTCA 2WSFF 3KSXA 4UN2B 1QANA 4G4RA 2F5NA 3SARA 1NO1A 2BNKA 2XSZD 1OJLA 1R5LA 1PJSA 5DNYA 2UXDM 2FE8A 3HKPA 5C1BA 4R3DA 1CUKA 2ERCA
chains in the Genus database with same CATH topology
1W5TA 3A42A 3GRUA 2UUBM 2C98A 3U5ZA 3M6AA 1QYRA 3LVWA 2X49A 2D7EA 5F3WA 2LNHC 3GLIA 1KFVA 2KEBA 2CE7A 3U6EA 2C9OA 1DGFA 1SXJC 2C99A 5DYGA 4B3MM 4FVMA 2CV2A 1L2BA 1Q3BA 3M7GA 3DFZA 2NQ8C 4LJAA 1HT1E 3CF2A 8CATA 4D82A 2Y21A 3KOYE 1D2NA 3AOEA 4DV4M 3U60A 2XZUA 5IZ7D 2G5GX 4DUYM 3AL0C 4DR7M 1IY0A 1DGHB 4DR6M 5ITTA 3FTDA 4S12A 4LG2A 1Z5AA 2YFQA 3PNYA 4RF1A 5EXSA 3KDSE 2H1RA 5BR8M 4LF5M 4PDGA 4LF9M 4DR2M 3NBIA 1LV7A 4M9ZA 4GC5A 4RNAA 1H6UA 4LGYA 4LJ8A 1GL6A 3FD9A 3AFHA 3EIHA 3HWSA 2XLJA 4DR1M 2CHQA 5EXXA 4A3VB 1SXJA 2KZUA 4LJ7A 4D80A 5FLXS 2F4VM 5ITYA 2JA2A 2LH0A 4IBCA 3T15A 4NRVA 3CF0A 3D8BA 2BJVA 4JN6A 3AJIB 3C58A 1HR0M 3HU3A 4NL4H 1SXJD 3T1YM 1TGUA 1NSFA 4GIPA 2C96A 1J5EM 2DZNB 3K92A 3KP0E 4IBKA 2LXEA 1Q3CA 4QHSA 3HGIA 1TH2A 3GQ4A 3CTWB 3T38A 4TUWA 1PM5A 1VDDA 4DR5M 3VDUA 2E5LM 2KXEA 4CHTB 4P16A 4NXNM 4PD2A 1TH3A 3K2LA 5KPTA 4JI5M 2QP9X 4AW4A 1IBMM 5KO3A 3GLFB 3IG5A 2HKJA 2L7HA 4DV6M 4LJ9A 4Z8XA 2DWMA 2DWNA 1GVNA 3GRYA 2LWXA 3TPZA 4FCWA 3GPUA 3SAWA 3R9XB 3QAUA 2R65A 3FYDA 4Z6YA 2UUAM 2QZ4A 2ZANA 2XGNA 4LGMA 4R7GA 5EXTA 2R4JA 5FTLA 3ZC7B 2UU9M 2CUZA 3Q8XA 4IIWA 1L8QA 2CV1A 4JI4M 1E9RA 1DGHA 2L09A 3IG8A 5FTNA 1GKIA 4KHPM 2CFOA 4X64M 3L27A 3L2AA 4B3SM 2DXIA 1IXZA 2YR0A 4IBBA 2UUCM 3D8LA 3HHZA 4IJEA 4X62M 4IBGA 4XGIA 2CV0A 2YQZA 1QAOA 1NJFA 2DVWB 3KOXE 2HHHM 1G59A 2R62A 4HL4A 3J81S 4OU7A 1IN8A 3VFDA 1G3IA 4LJ5A 3TWMA 2F5PA 3SASA 3WHLA 3NWLA 1YSYA 4KO8A 2DZOB 4GKJM 1IY1A 3GQ3A 4B3TM 4FD2A 4IBIA 4DR3M 3GRRA 5IWAM 2CHGA 2YNMD 4LY6A 1N34M 3AV0A 4BB9A 1N36M 1HQYE 2V1CA 2UXCM 1JR3A 4LF8M 2KW0A 1K3WA 4AKHA 1Q39A 4FCTA 1N75A 3FYCA 5KPZA 1IBKM 1IBLM 1J09A 1E32A 3GRVA 5LMNM 5H37D 4JV5M 1L1TA 1JQJC 3KSJA 1YUBA 3I4VA 4GHLA 1W5SA 4JXJA 3VDPA 3SBJA 1JR3D 1NY6A 4ZPXA 2XEPA 2UXBM 3TQSA 1IN4A 3A98B 5E26A 3T1HM 4B7HA 4JYAM 1QAMA 1TDZA 4LCBA 3KOZE 2F5QA 5EQTA 2Z4SA 3GLFA 2ZAOA 3ZCBB 1QQWA 1R7RA 3GLHB 4MGZE 1IN5A 3FUXA 1N77A 3VLFB 3U6LA 1K3XA 4CISA 3AOGA 4QOZC 4B3RM 4AG5A 5ITXE 4LF4M 3KS8A 3HJQA 2J7NA 1DO2A 3U6PA 1KYIA 2V6ZM 4D81A 4OVZB 7CATA 4ITQA 2Y0QA 1R6BX 2D7HA 2CHVA 4KLNA 2BJWA 3E4RA 1G8PA 3I4YA 3UK6A 3L26A 3GO8A 4NRWA 4M9XA 2A5YB 3HJ8A 4L4UA 3GQ5A 3ILKA 1Z5BA 3FUWA 4KODA 1K82A 1C1KA 1HNXM 3U61B 4G4OA 3HU2A 1HT2E 5LMUM 1KSFX 4DV5M 4PT5A 4G6ZA 4DV7M 3TL4X 4YHHM 4JI6M 4M9SA 2O5RA 4X65M 1YE9A 3L25A 1QZMA 4GRIA 1R2YA 1FNNA 4REZA 2DWLA 2EO2A 3GPXA 4LRTA 2XF3A 2M5ZA 1G4AE 3BOSA 4GC9A 1HQCA 4HLQA 5ITRA 2F5OA 5KQ8A 1N32M 5EP1A 4YY3M 3SAUA 4NSRA 4JI3M 4MB7A 2KRKA 4NOOB 5BPVA 3DZDA 2L6OA 4PDIA 2ZBKB 4G4QA 4IBFA 4DV3M 4I4LA 4AKIA 2ZM6M 3RGPA 4JI7M 2QCUA 5ITQA 1XMQM 3SAVA 1G41A 1R2ZA 4GHAA 3GLHA 3FTEA 1NHWC 3RGSA 3FUUA 3R8FA 1NY5A 3HHYA 1T3TA 1QAQA 3GLGB 5ITUA 2M60A 3K1JA 3ZH9B 2XH9A 5KPRA 2OQ4A 2XZFA 5IT9S 2QBYB 3MK6A 3J27B 4M0DA 4RF0A 3TWLA 5FTJA 4OVZA 5FTKA 4L16A 1PJJA 3U6OA 1E94E 2CEAA 3LMMA 1E9SA 3DA1A 3U6CA 3J80S 5EXPA 1N78A 2Z3XA 3FTFA 1MU5A 2I7NA 2X8AA 3LQRA 3JAMS 4DUZM 4BLCA 1XC8A 4NXMM 2P5TA 3SMSA 3KOWE 3TE6A 4OX9M 2RKOA 3W0LB 2ZAMA 2F5SA 2FOIC 1NNJA 3HHWA 4MGYE 3J7BA 2Y20A 4MGIE 3U61A 4II7A 1NNUC 3RFWA 4CGYB 4FCVA 5IREB 2K47A 2Z4RA 1XMOM 4LFBM 4FWGA 4DV1M 3VK7A 2D7GA 2QENA 2AHMA 1DO0A 1NVMA 4MGHA 3W0FA 3JR5A 3QWLA 3AKZA 3GPYA 3CF6E 2R45A 4GITA 5EP4A 3U6QA 4DR4M 3SHFA 3DOAA 2C5RA 4FWDA 2Z7JA 2XFTA 3VKGA 5C18A 1SXJE 1IQPA 4DV2M 3SFZA 2EA0A 5A2QS 5E6JA 3U6SA 4GMQA 4FW9A 2L7IA 3M0EA 2I7PA 4LF7M 3WHKA 1IY2A 2R46A 3L29A 4IBDA 4QNRA 1I94M 1Z59A 1IXRC 4WW0A 4JI8M 4GKKM 3SATA 3FUVA 4AKGA 3THGA 1L2CA 1ZQ9A 4LRSA 1OFHA 1I4WA 5KQDA 4IBJA 3GLGA 4B7GA 5FTMA 1GLNA 4EIWA 1IXSB 4WURA 4AG6A 2QBYA 3UMMA 1NHGC 4JI0M 2J7OA 2KZSA 1S3SA 1Z6TA 3SC3A 3MHVC 4BBAA 5JI2E 4B08A 5EP2A 4NSOB 3JR4A 2VQFM 1XXHB 4G4NA 4OW0A 3A46A 2VQEM 4QOSA 2OPFA 4AI6A 1XNQM 2W82A 1Z5CA 3HU1A 4LZJA 4MGKE 3LQQA 3K8ZA 1IN6A 4LF6M 3RE8A 3J7AS 2Q2EB 3GPPA 3HJSA 3KP1E 1IN7A 2FFJA 4LFCM 1HNZM 3VKHA 4IBEA 4B7FA 2HCBA 1WXQA 5FSWA 5ITXA 1J7KA 2DHRA 3U5ZB 4L78A 3L28A 4I5SA 3B9PA 3J2PB 3GLIB 4LJ6A 2KRUA 1NJGA 5GKNA 1XWIA 3SYLA 1OFIA 3LVVA 1QVRA 3KW6A 1L1ZA 2HL7A 2V1UA 3FKEA 1X37A 4FWHA 3PXGA 4I81A 3TWKA 1DGGA 1ZAEA 4MM3B 1DGBA 3FUTA 3KVWA 2C9CA 4GH9A 4LJ4A 1TH4A 1HNWM 1IM2A 3U6MA 3KXEC 3U60B 4QNMA 3A45A 4W5WA 2X4AA 5DYIA 1PJIA 3KFUG 1GL7A 5EP3A 3VK8A 2R18A 2G8LA 4PCZA 4AQYM 2QPAA 2R4EA 3PNVA 4MH0E 4M0WA 1ORYB 4K0KM 3EIEA 2RGOA 3UZUA 4JI2M 2VIIA 3HHXA 2KA6B 5JI3E 2Y0TA 2XFSA 4LFAM 4JI1M 4I8OA 3SMPA 4L15A 3GP1A 3H4MA 4XBOA 5EJCA 1TDHA 4LZZA 1FJGM 4AZFA 4L8RC 1EE8A 3PFIA 1N33M 3MJ5A 1MX0A 3PVSA 2DWZB 1SXJB 1XXHA 2XSZA 3SYKA 3E9SA 4DV0M 2EUCA 1UM8A 1XHBA 4X66M 3AOEC 4IJFA 2RGHA 3KS4A 3UJNA 4QHTA 1XNRM 3UGJA 2FNAA 3SHGB 1L2DA 3I51A 3OTOM 3U6DA 3KSXA 3SARA 3FTCA 4G4RA 1QANA 2F5NA 2BNKA 2XSZD 1OJLA 5DNYA 2UXDM 2FE8A 3HKPA 5C1BA 4R3DA 2ERCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 M;  4X64 M;  4YY3 M;  4JI0 M;  3A42 A;  3SAU A;  2UUB M;  4JI3 M;  4B3S M;  2UUC M;  4MB7 A;  4X62 M;  3JR4 A;  1KFV A;  2VQF M;  2HHH M;  3J81 S;  3U6E A;  4G4N A;  4B3M M;  4PDI A;  2ZBK B;  3TWM A;  4G4Q A;  3A46 A;  2VQE M;  2F5P A;  1L2B A;  2OPF A;  4DV3 M;  3SAS A;  1Q3B A;  1XNQ M;  1Z5C A;  4GKJ M;  4B3T M;  3GQ3 A;  2ZM6 M;  4JI7 M;  5ITQ A;  4DR3 M;  1XMQ M;  3SAV A;  1R2Z A;  5IWA M;  4LF6 M;  1N34 M;  3J7A S;  2Q2E B;  3GPP A;  4DV4 M;  1N36 M;  2XZU A;  2UXC M;  4DUY M;  4DR7 M;  5ITU A;  4LF8 M;  4LFC M;  1K3W A;  1HNZ M;  5ITT A;  4DR6 M;  1Q39 A;  2OQ4 A;  2XZF A;  5IT9 S;  1IBK M;  1IBL M;  5LMN M;  3TWL A;  4JV5 M;  1L1T A;  5ITX A;  1Z5A A;  1PJJ A;  3U6O A;  3SBJ A;  5BR8 M;  4LF5 M;  4PDG A;  4LF9 M;  2UXB M;  4DR2 M;  3U6C A;  3T1H M;  3J80 S;  1L1Z A;  4JYA M;  1MU5 A;  3JAM S;  4DUZ M;  1XC8 A;  1TDZ A;  4NXM M;  2F5Q A;  4DR1 M;  4OX9 M;  3TWK A;  2F5S A;  5FLX S;  2F4V M;  5ITY A;  1NNJ A;  4NRV A;  1HNW M;  3U6M A;  3A45 A;  3U6L A;  1K3X A;  1PJI A;  4CIS A;  3C58 A;  3VK8 A;  1XMO M;  4B3R M;  4LF4 M;  5ITX E;  4DV1 M;  3VK7 A;  1HR0 M;  4LFB M;  3T1Y M;  4PCZ A;  4AQY M;  3U6P A;  1J5E M;  3W0F A;  3JR5 A;  4K0K M;  4ITQ A;  3GPY A;  1Q3C A;  4JI2 M;  3U6Q A;  4LFA M;  3GQ4 A;  4DR4 M;  4JI1 M;  1PM5 A;  3DOA A;  3GP1 A;  4DR5 M;  2E5L M;  4NXN M;  1TDH A;  4PD2 A;  4JI5 M;  1FJG M;  1IBM M;  4DV2 M;  1EE8 A;  2EA0 A;  1N33 M;  5A2Q S;  3U6S A;  3GO8 A;  1MX0 A;  4NRW A;  2HKJ A;  3GQ5 A;  4DV6 M;  1Z5B A;  1K82 A;  4LF7 M;  1HNX M;  4G4O A;  5LMU M;  4DV0 M;  4X66 M;  4DV5 M;  1I94 M;  1Z59 A;  3GPU A;  3SAW A;  4DV7 M;  4JI8 M;  1XNR M;  4GKK M;  4YHH M;  3SAT A;  4JI6 M;  1L2D A;  4X65 M;  3OTO M;  3U6D A;  3SAR A;  1L2C A;  4G4R A;  2UUA M;  1R2Y A;  2F5N A;  3GPX A;  2UU9 M;  2UXD M;  4JI4 M;  5ITR A;  2F5O A;  4KHP M; 
#chains in the Genus database with same CATH topology
 1W5T A;  3A42 A;  1NV9 A;  3GRU A;  2UUB M;  2C98 A;  2QQ8 A;  3U5Z A;  3M6A A;  1QYR A;  3LVW A;  2X49 A;  2D7E A;  5F3W A;  2L4F A;  2LNH C;  3GLI A;  1KFV A;  2KEB A;  2CE7 A;  3U6E A;  2C9O A;  1DGF A;  1SXJ C;  2C99 A;  5DYG A;  4B3M M;  4FVM A;  2CV2 A;  1L2B A;  3F92 A;  3QYB A;  1Q3B A;  3M7G A;  3DFZ A;  2NQ8 C;  4LJA A;  1HT1 E;  1PGY A;  3CF2 A;  8CAT A;  1VQ1 A;  4D82 A;  2Y21 A;  3KOY E;  1D2N A;  3AOE A;  4DV4 M;  3U60 A;  2XZU A;  5IZ7 D;  2G5G X;  4DUY M;  3AL0 C;  4DR7 M;  1IY0 A;  1DGH B;  4DR6 M;  5ITT A;  2JXN A;  2KNV A;  1PJQ A;  3FTD A;  4L6V 6;  2QSF X;  4S12 A;  4F1I A;  1VEJ A;  4LG2 A;  1Z5A A;  2YFQ A;  3PNY A;  4RF1 A;  5EXS A;  2MH8 A;  3KDS E;  2H1R A;  5BR8 M;  4LF5 M;  4PDG A;  4LF9 M;  4DR2 M;  3HZJ A;  1AIP C;  3NBI A;  2JNH A;  1LV7 A;  3CGW A;  4M9Z A;  4GC5 A;  1MN3 A;  1H6U A;  4RNA A;  4LGY A;  4LJ8 A;  1GL6 A;  2DAG A;  3FD9 A;  3GLH E;  3AFH A;  3EIH A;  3HWS A;  2XLJ A;  4DR1 M;  2CHQ A;  5EXX A;  4A3V B;  1SXJ A;  2KZU A;  4LJ7 A;  4D80 A;  4NC6 A;  5FLX S;  5ITY A;  2F4V M;  2JA2 A;  2LH0 A;  4IBC A;  3T15 A;  4NRV A;  3E46 A;  2MR9 A;  3CF0 A;  3D8B A;  2BJV A;  4JN6 A;  2OOA A;  3Q8G A;  3AJI B;  1WJ7 A;  1WGN A;  3C58 A;  1HR0 M;  3HU3 A;  4NL4 H;  1SXJ D;  3T1Y M;  1TGU A;  1NSF A;  4GIP A;  2C96 A;  1J5E M;  2DZN B;  3K92 A;  3KP0 E;  4IBK A;  2LXE A;  1IFY A;  1Q3C A;  4QHS A;  3HGI A;  3B89 A;  2CP8 A;  1TH2 A;  2JZ0 A;  3CTW B;  3HX3 A;  2JZ1 A;  3T38 A;  3GQ4 A;  4TUW A;  1PM5 A;  1VDD A;  4DR5 M;  3VDU A;  2E5L M;  2KXE A;  4CHT B;  4P16 A;  4NXN M;  4PD2 A;  1TH3 A;  3K2L A;  2ZTD A;  5KPT A;  4JI5 M;  2QP9 X;  1GJT A;  4AW4 A;  1IBM M;  2LVA A;  3IEC A;  2QNJ A;  5KO3 A;  2MRO B;  3GLF B;  3IG5 A;  2HKJ A;  4XK8 F;  2L7H A;  4DV6 M;  4LJ9 A;  4Z8X A;  2DWM A;  2DWN A;  1GVN A;  1ZV1 A;  3GRY A;  1TTE A;  1VEG A;  2LWX A;  2JP7 A;  3TPZ A;  4FCW A;  3GPU A;  3SAW A;  3R9X B;  3QAU A;  3IHP A;  1OKS A;  2R65 A;  3FYD A;  4Z6Y A;  3V76 A;  2UUA M;  2QZ4 A;  2ZAN A;  2XGN A;  4LGM A;  1D0L A;  4R7G A;  5EXT A;  2R4J A;  5FTL A;  3ZC7 B;  2N35 A;  2UU9 M;  2CUZ A;  1PJT A;  3Q8X A;  4IIW A;  1L8Q A;  2JWS A;  2CV1 A;  4JI4 M;  1E9R A;  2L09 A;  1DGH A;  3IG8 A;  5FTN A;  1GKI A;  4KHP M;  3QYE A;  2CFO A;  4X64 M;  1WR1 B;  3L27 A;  3L2A A;  2DI0 A;  4B3S M;  2DXI A;  1IXZ A;  2YR0 A;  4IBB A;  2UUC M;  3D8L A;  3HHZ A;  4IJE A;  3MMP A;  4X62 M;  4IBG A;  2KNZ A;  4XGI A;  2CV0 A;  2YQZ A;  1QAO A;  1NJF A;  2DVW B;  1SG9 A;  3KOX E;  2HHH M;  1G59 A;  2R62 A;  4HL4 A;  3W67 A;  3J81 S;  1VEK A;  4OU7 A;  1IN8 A;  3VFD A;  1G3I A;  4LJ5 A;  3TWM A;  2F5P A;  1TR8 A;  2OOB A;  2O01 F;  3SAS A;  3WHL A;  3NWL A;  1YSY A;  4KO8 A;  2DZO B;  4GKJ M;  1IY1 A;  3GQ3 A;  3LCV B;  4B3T M;  1T43 A;  4FD2 A;  4IBI A;  3GRR A;  4DR3 M;  1VG5 A;  1QDT A;  2G3Q A;  5IWA M;  2CHG A;  2YNM D;  2Z8Y M;  4LY6 A;  1QUS A;  3GLG E;  1D0K A;  3AV0 A;  1N34 M;  4BB9 A;  3LW5 F;  2DAI A;  1OQY A;  1N36 M;  1HQY E;  2V1C A;  2UXC M;  1JR3 A;  4LF8 M;  2KW0 A;  1K3W A;  4AKH A;  1Q39 A;  4FCT A;  1N75 A;  2B3T A;  3FYC A;  5KPZ A;  1IBK M;  1IBL M;  1J09 A;  1E32 A;  3GRV A;  5LMN M;  5H37 D;  4JV5 M;  1L1T A;  1JQJ C;  3KSJ A;  1YUB A;  3I4V A;  1OTR A;  4GHL A;  2H5X A;  1W5S A;  4JXJ A;  1C7Y A;  1OAO C;  3VDP A;  3SBJ A;  1JR3 D;  3C3D A;  1NY6 A;  4ZPX A;  2XEP A;  2UXB M;  3TQS A;  1IN4 A;  3A98 B;  5E26 A;  3T1H M;  4B7H A;  5DFL A;  4JYA M;  1QAM A;  1TDZ A;  4LCB A;  3KOZ E;  2F5Q A;  5EQT A;  2Z4S A;  3GLF A;  2ZAO A;  3ZCB B;  1QQW A;  1R7R A;  3GLH B;  4MGZ E;  1IN5 A;  2LVN C;  1JB0 F;  2VDB B;  3FUX A;  4ANR A;  1N77 A;  1LTM A;  3VLF B;  3U6L A;  3FRI A;  1K3X A;  2DAM A;  4CIS A;  3AOG A;  4QOZ C;  4B3R M;  4AG5 A;  5ITX E;  4LF4 M;  3KS8 A;  3H4J A;  2DKL A;  1XB2 B;  2APL A;  1DO2 A;  2DAE A;  1KYI A;  2J7N A;  3BXW A;  2V6Z M;  3HJQ A;  4D81 A;  3U6P A;  1ZMW A;  4OVZ B;  7CAT A;  4ITQ A;  2Y0Q A;  1R6B X;  2D7H A;  1P3Q Q;  2CHV A;  4KLN A;  1EIJ A;  2BJW A;  3E4R A;  2L2D A;  3NBX X;  2WZJ A;  1G8P A;  1V33 A;  2LHG A;  3I4Y A;  1A5T A;  3UK6 A;  3L26 A;  3GO8 A;  2MGW A;  4M9X A;  4NRW A;  3BBZ A;  2A5Y B;  3HJ8 A;  4L4U A;  3GQ5 A;  4CIZ A;  3ILK A;  1Z5B A;  3FUW A;  4KOD A;  1K82 A;  1C1K A;  1WGL A;  1HNX M;  3U61 B;  4G4O A;  3HU2 A;  1HT2 E;  5LMU M;  1KSF X;  1QZE A;  4PT5 A;  4DV5 M;  4G6Z A;  4DV7 M;  2R6F A;  3TL4 X;  1AUA A;  4YHH M;  4JI6 M;  4M9S A;  2O5R A;  4X65 M;  1YE9 A;  3L25 A;  1QZM A;  4GRI A;  1R2Y A;  1FNN A;  4REZ A;  2DWL A;  2EO2 A;  3GPX A;  4LRT A;  2XF3 A;  1RU3 A;  2M5Z A;  1G4A E;  1VDL A;  3BOS A;  1Y8G A;  4GC9 A;  1HQC A;  4HLQ A;  5ITR A;  2F5O A;  3C9P A;  5KQ8 A;  1N32 M;  1F4I A;  5EP1 A;  4YY3 M;  3SAU A;  4NSR A;  4JI3 M;  2K0B X;  2ZTC A;  2LHC A;  4MB7 A;  2VF7 A;  2KRK A;  1XXH E;  2LVO C;  4NOO B;  2LBC A;  5BPV A;  3DZD A;  2JY5 A;  2L6O A;  2WSC F;  4PDI A;  2ZBK B;  4G4Q A;  4IBF A;  1R4G A;  4DV3 M;  4I4L A;  4AKI A;  2ZM6 M;  4P17 A;  3RGP A;  4JI7 M;  2QCU A;  5ITQ A;  1XMQ M;  3SAV A;  1G41 A;  1R2Z A;  4GHA A;  3GLH A;  3FTE A;  1NHW C;  3RGS A;  3FUU A;  3R8F A;  1NY5 A;  3HHY A;  1T3T A;  1QAQ A;  1YLA A;  3GLG B;  5ITU A;  1TF0 B;  2EKF A;  2M60 A;  3K1J A;  3ZH9 B;  2XH9 A;  5KPR A;  2OQ4 A;  2XZF A;  5IT9 S;  2QBY B;  3MK6 A;  3J27 B;  4M0D A;  4RF0 A;  2EKK A;  5FTJ A;  3TWL A;  4OVZ A;  5FTK A;  3GLI E;  4L16 A;  3FE3 A;  3T6P A;  4JI2 M;  1PJJ A;  3U6O A;  1E94 E;  2CEA A;  3LMM A;  1E9S A;  3DA1 A;  1UFZ A;  3U6C A;  3J80 S;  5EXP A;  4R71 A;  1N78 A;  2Z3X A;  3FTF A;  2DNA A;  1MU5 A;  2DZL A;  2I7N A;  2X8A A;  3LQR A;  3JAM S;  4BLC A;  4DUZ M;  1XC8 A;  4NXM M;  2P5T A;  3SMS A;  3KOW E;  3TE6 A;  4OX9 M;  2GQF A;  2RKO A;  2ZAM A;  3C3E A;  3W0L B;  2F5S A;  2FOI C;  1NNJ A;  3HHW A;  2BWE A;  4MGY E;  3J7B A;  2WSE F;  2Y20 A;  4MGI E;  3U61 A;  2MJ5 B;  1NNU C;  4II7 A;  3RFW A;  4CGY B;  1V34 A;  4FCV A;  5IRE B;  2K47 A;  2Z4R A;  1XMO M;  4LFB M;  4FWG A;  4DV1 M;  3VK7 A;  2D7G A;  2JY6 B;  2QEN A;  3E21 A;  2AHM A;  1DO0 A;  1NVM A;  3K9P A;  4MGH A;  3W0F A;  3JR5 A;  3QWL A;  3AKZ A;  3GPY A;  1NV8 A;  2LVQ D;  3CF6 E;  2R45 A;  4GIT A;  5EP4 A;  3U6Q A;  4DR4 M;  3SHF A;  1EFU B;  2HWJ A;  3DOA A;  2DAK A;  2C5R A;  4FWD A;  2Z7J A;  2XFT A;  1QDR A;  3VKG A;  5C18 A;  1SXJ E;  1IQP A;  4DV2 M;  3SFZ A;  2EA0 A;  5A2Q S;  5E6J A;  3U6S A;  4GEW A;  4GMQ A;  4FW9 A;  2L7I A;  3M0E A;  2I7P A;  4LF7 M;  3WHK A;  1OAI A;  1IY2 A;  2R46 A;  3L29 A;  4IBD A;  4QNR A;  1I94 M;  1Z59 A;  1IXR C;  2OO9 A;  4WW0 A;  2KNA A;  1PRB A;  4JI8 M;  3LCU A;  4DBG B;  3SAT A;  4GKK M;  3FUV A;  4AKG A;  3THG A;  4G3O A;  1L2C A;  1ZQ9 A;  4LRS A;  1OFH A;  1I4W A;  1G71 A;  5KQD A;  4IBJ A;  3I04 M;  3GLG A;  4B7G A;  5FTM A;  1GLN A;  2DEN A;  4EIW A;  1IXS B;  4WUR A;  4AG6 A;  2QBY A;  3UMM A;  1NHG C;  4JI0 M;  2J7O A;  2KZS A;  1S3S A;  1Z6T A;  3SC3 A;  3MHV C;  4BBA A;  5JI2 E;  2EJS A;  1ZMU A;  2QHO B;  4B08 A;  2O25 A;  5EP2 A;  4NSO B;  4KT0 F;  3JR4 A;  2VQF M;  2L4E A;  1XXH B;  2CRU A;  4G4N A;  4RKU F;  2BWB A;  2RRU A;  4OW0 A;  3A46 A;  2VQE M;  1MJG M;  4QOS A;  2OPF A;  4AI6 A;  1XNQ M;  2W82 A;  1HJP A;  1Z5C A;  3HU1 A;  2JY7 A;  4LZJ A;  4MGK E;  4CJ6 A;  3LQQ A;  1T6O A;  1GO5 A;  3K9O A;  3K8Z A;  1IN6 A;  4LF6 M;  3RE8 A;  3B7Z A;  1OIP A;  3J7A S;  2Q2E B;  3GPP A;  3HJS A;  3KP1 E;  1IN7 A;  2FFJ A;  3B7Q A;  2FS1 A;  2J5Y A;  4LFC M;  1HNZ M;  3FRH A;  3VKH A;  4IBE A;  4B7F A;  2HCB A;  2GNO A;  1WXQ A;  2K9D A;  5FSW A;  5ITX A;  1J7K A;  2VF8 A;  2DHR A;  3U5Z B;  2FH0 A;  4L78 A;  3L28 A;  4I5S A;  2DHY A;  3B9P A;  3J2P B;  1D0M A;  3B74 A;  3GLI B;  4LJ6 A;  2KRU A;  1NJG A;  5GKN A;  1XWI A;  3SYL A;  1OFI A;  3LVV A;  1QVR A;  3KW6 A;  1L1Z A;  2KHH A;  1OIZ A;  2HL7 A;  2V1U A;  3FKE A;  1DV0 A;  1X37 A;  4FWH A;  3PXG A;  4I81 A;  3TWK A;  1DGG A;  4HEO A;  1ZAE A;  4MM3 B;  1DGB A;  3FUT A;  3KVW A;  2C9C A;  4GH9 A;  4LJ4 A;  3W68 A;  1TH4 A;  2KDL A;  2LVP C;  1IM2 A;  1JR3 E;  1HNW M;  3U6M A;  3KXE C;  3U60 B;  4QNM A;  2HAK A;  3A45 A;  4W5W A;  2X4A A;  5DYI A;  1PJI A;  3KFU G;  1GL7 A;  5EP3 A;  3VK8 A;  2CWB A;  2R18 A;  3I01 M;  2JUJ A;  2G8L A;  4PCZ A;  4AQY M;  2QPA A;  2R4E A;  2R44 A;  3PNV A;  4MH0 E;  4M0W A;  1ORY B;  4K0K M;  1QUT A;  3EIE A;  1GAB A;  4Q7J A;  4Y28 F;  2R0I A;  2RGO A;  4WP2 A;  3UZU A;  2VII A;  4F2L A;  3HHX A;  1IXS A;  2KA6 B;  2Y0T A;  2XFS A;  4LFA M;  5JI3 E;  4JI1 M;  2LTU A;  2JY8 A;  4I8O A;  3SMP A;  4L15 A;  3GP1 A;  3H4M A;  1BVS A;  3HY5 A;  4XBO A;  5EJC A;  1TDH A;  1ZMV A;  2K6B A;  4LZZ A;  5L8R F;  1GJS A;  1FJG M;  4AZF A;  1WHC A;  3GLF E;  4L8R C;  1EE8 A;  3PFI A;  1N33 M;  3B7N A;  3MJ5 A;  1MX0 A;  3PVS A;  2DWZ B;  1SXJ B;  1XXH A;  1WIV A;  2XSZ A;  3SYK A;  3E9S A;  4DV0 M;  2EUC A;  1UM8 A;  1XHB A;  4X66 M;  3AOE C;  4IJF A;  3ZQJ A;  2RGH A;  3KS4 A;  3UJN A;  4QHT A;  1XNR M;  3UGJ A;  2FNA A;  3SHG B;  1L2D A;  3I51 A;  3OTO M;  3U6D A;  1Q02 A;  1V92 A;  3FTC A;  2WSF F;  3KSX A;  4UN2 B;  1QAN A;  4G4R A;  2F5N A;  3SAR A;  1NO1 A;  2BNK A;  2XSZ D;  1OJL A;  1R5L A;  1PJS A;  5DNY A;  2UXD M;  2FE8 A;  3HKP A;  5C1B A;  4R3D A;  1CUK A;  2ERC A; 
#chains in the Genus database with same CATH homology
 1W5T A;  3A42 A;  3GRU A;  2UUB M;  2C98 A;  3U5Z A;  3M6A A;  1QYR A;  3LVW A;  2X49 A;  2D7E A;  5F3W A;  2LNH C;  3GLI A;  1KFV A;  2KEB A;  2CE7 A;  3U6E A;  2C9O A;  1DGF A;  1SXJ C;  2C99 A;  5DYG A;  4B3M M;  4FVM A;  2CV2 A;  1L2B A;  1Q3B A;  3M7G A;  3DFZ A;  2NQ8 C;  4LJA A;  1HT1 E;  3CF2 A;  8CAT A;  4D82 A;  2Y21 A;  3KOY E;  1D2N A;  3AOE A;  4DV4 M;  3U60 A;  2XZU A;  5IZ7 D;  2G5G X;  4DUY M;  3AL0 C;  4DR7 M;  1IY0 A;  1DGH B;  4DR6 M;  5ITT A;  3FTD A;  4S12 A;  4LG2 A;  1Z5A A;  2YFQ A;  3PNY A;  4RF1 A;  5EXS A;  3KDS E;  2H1R A;  5BR8 M;  4LF5 M;  4PDG A;  4LF9 M;  4DR2 M;  3NBI A;  1LV7 A;  4M9Z A;  4GC5 A;  4RNA A;  1H6U A;  4LGY A;  4LJ8 A;  1GL6 A;  3FD9 A;  3AFH A;  3EIH A;  3HWS A;  2XLJ A;  4DR1 M;  2CHQ A;  5EXX A;  4A3V B;  1SXJ A;  2KZU A;  4LJ7 A;  4D80 A;  5FLX S;  2F4V M;  5ITY A;  2JA2 A;  2LH0 A;  4IBC A;  3T15 A;  4NRV A;  3CF0 A;  3D8B A;  2BJV A;  4JN6 A;  3AJI B;  3C58 A;  1HR0 M;  3HU3 A;  4NL4 H;  1SXJ D;  3T1Y M;  1TGU A;  1NSF A;  4GIP A;  2C96 A;  1J5E M;  2DZN B;  3K92 A;  3KP0 E;  4IBK A;  2LXE A;  1Q3C A;  4QHS A;  3HGI A;  1TH2 A;  3GQ4 A;  3CTW B;  3T38 A;  4TUW A;  1PM5 A;  1VDD A;  4DR5 M;  3VDU A;  2E5L M;  2KXE A;  4CHT B;  4P16 A;  4NXN M;  4PD2 A;  1TH3 A;  3K2L A;  5KPT A;  4JI5 M;  2QP9 X;  4AW4 A;  1IBM M;  5KO3 A;  3GLF B;  3IG5 A;  2HKJ A;  2L7H A;  4DV6 M;  4LJ9 A;  4Z8X A;  2DWM A;  2DWN A;  1GVN A;  3GRY A;  2LWX A;  3TPZ A;  4FCW A;  3GPU A;  3SAW A;  3R9X B;  3QAU A;  2R65 A;  3FYD A;  4Z6Y A;  2UUA M;  2QZ4 A;  2ZAN A;  2XGN A;  4LGM A;  4R7G A;  5EXT A;  2R4J A;  5FTL A;  3ZC7 B;  2UU9 M;  2CUZ A;  3Q8X A;  4IIW A;  1L8Q A;  2CV1 A;  4JI4 M;  1E9R A;  1DGH A;  2L09 A;  3IG8 A;  5FTN A;  1GKI A;  4KHP M;  2CFO A;  4X64 M;  3L27 A;  3L2A A;  4B3S M;  2DXI A;  1IXZ A;  2YR0 A;  4IBB A;  2UUC M;  3D8L A;  3HHZ A;  4IJE A;  4X62 M;  4IBG A;  4XGI A;  2CV0 A;  2YQZ A;  1QAO A;  1NJF A;  2DVW B;  3KOX E;  2HHH M;  1G59 A;  2R62 A;  4HL4 A;  3J81 S;  4OU7 A;  1IN8 A;  3VFD A;  1G3I A;  4LJ5 A;  3TWM A;  2F5P A;  3SAS A;  3WHL A;  3NWL A;  1YSY A;  4KO8 A;  2DZO B;  4GKJ M;  1IY1 A;  3GQ3 A;  4B3T M;  4FD2 A;  4IBI A;  4DR3 M;  3GRR A;  5IWA M;  2CHG A;  2YNM D;  4LY6 A;  1N34 M;  3AV0 A;  4BB9 A;  1N36 M;  1HQY E;  2V1C A;  2UXC M;  1JR3 A;  4LF8 M;  2KW0 A;  1K3W A;  4AKH A;  1Q39 A;  4FCT A;  1N75 A;  3FYC A;  5KPZ A;  1IBK M;  1IBL M;  1J09 A;  1E32 A;  3GRV A;  5LMN M;  5H37 D;  4JV5 M;  1L1T A;  1JQJ C;  3KSJ A;  1YUB A;  3I4V A;  4GHL A;  1W5S A;  4JXJ A;  3VDP A;  3SBJ A;  1JR3 D;  1NY6 A;  4ZPX A;  2XEP A;  2UXB M;  3TQS A;  1IN4 A;  3A98 B;  5E26 A;  3T1H M;  4B7H A;  4JYA M;  1QAM A;  1TDZ A;  4LCB A;  3KOZ E;  2F5Q A;  5EQT A;  2Z4S A;  3GLF A;  2ZAO A;  3ZCB B;  1QQW A;  1R7R A;  3GLH B;  4MGZ E;  1IN5 A;  3FUX A;  1N77 A;  3VLF B;  3U6L A;  1K3X A;  4CIS A;  3AOG A;  4QOZ C;  4B3R M;  4AG5 A;  5ITX E;  4LF4 M;  3KS8 A;  3HJQ A;  2J7N A;  1DO2 A;  3U6P A;  1KYI A;  2V6Z M;  4D81 A;  4OVZ B;  7CAT A;  4ITQ A;  2Y0Q A;  1R6B X;  2D7H A;  2CHV A;  4KLN A;  2BJW A;  3E4R A;  1G8P A;  3I4Y A;  3UK6 A;  3L26 A;  3GO8 A;  4NRW A;  4M9X A;  2A5Y B;  3HJ8 A;  4L4U A;  3GQ5 A;  3ILK A;  1Z5B A;  3FUW A;  4KOD A;  1K82 A;  1C1K A;  1HNX M;  3U61 B;  4G4O A;  3HU2 A;  1HT2 E;  5LMU M;  1KSF X;  4DV5 M;  4PT5 A;  4G6Z A;  4DV7 M;  3TL4 X;  4YHH M;  4JI6 M;  4M9S A;  2O5R A;  4X65 M;  1YE9 A;  3L25 A;  1QZM A;  4GRI A;  1R2Y A;  1FNN A;  4REZ A;  2DWL A;  2EO2 A;  3GPX A;  4LRT A;  2XF3 A;  2M5Z A;  1G4A E;  3BOS A;  4GC9 A;  1HQC A;  4HLQ A;  5ITR A;  2F5O A;  5KQ8 A;  1N32 M;  5EP1 A;  4YY3 M;  3SAU A;  4NSR A;  4JI3 M;  4MB7 A;  2KRK A;  4NOO B;  5BPV A;  3DZD A;  2L6O A;  4PDI A;  2ZBK B;  4G4Q A;  4IBF A;  4DV3 M;  4I4L A;  4AKI A;  2ZM6 M;  3RGP A;  4JI7 M;  2QCU A;  5ITQ A;  1XMQ M;  3SAV A;  1G41 A;  1R2Z A;  4GHA A;  3GLH A;  3FTE A;  1NHW C;  3RGS A;  3FUU A;  3R8F A;  1NY5 A;  3HHY A;  1T3T A;  1QAQ A;  3GLG B;  5ITU A;  2M60 A;  3K1J A;  3ZH9 B;  2XH9 A;  5KPR A;  2OQ4 A;  2XZF A;  5IT9 S;  2QBY B;  3MK6 A;  3J27 B;  4M0D A;  4RF0 A;  3TWL A;  5FTJ A;  4OVZ A;  5FTK A;  4L16 A;  1PJJ A;  3U6O A;  1E94 E;  2CEA A;  3LMM A;  1E9S A;  3DA1 A;  3U6C A;  3J80 S;  5EXP A;  1N78 A;  2Z3X A;  3FTF A;  1MU5 A;  2I7N A;  2X8A A;  3LQR A;  3JAM S;  4DUZ M;  4BLC A;  1XC8 A;  4NXM M;  2P5T A;  3SMS A;  3KOW E;  3TE6 A;  4OX9 M;  2RKO A;  3W0L B;  2ZAM A;  2F5S A;  2FOI C;  1NNJ A;  3HHW A;  4MGY E;  3J7B A;  2Y20 A;  4MGI E;  3U61 A;  4II7 A;  1NNU C;  3RFW A;  4CGY B;  4FCV A;  5IRE B;  2K47 A;  2Z4R A;  1XMO M;  4LFB M;  4FWG A;  4DV1 M;  3VK7 A;  2D7G A;  2QEN A;  2AHM A;  1DO0 A;  1NVM A;  4MGH A;  3W0F A;  3JR5 A;  3QWL A;  3AKZ A;  3GPY A;  3CF6 E;  2R45 A;  4GIT A;  5EP4 A;  3U6Q A;  4DR4 M;  3SHF A;  3DOA A;  2C5R A;  4FWD A;  2Z7J A;  2XFT A;  3VKG A;  5C18 A;  1SXJ E;  1IQP A;  4DV2 M;  3SFZ A;  2EA0 A;  5A2Q S;  5E6J A;  3U6S A;  4GMQ A;  4FW9 A;  2L7I A;  3M0E A;  2I7P A;  4LF7 M;  3WHK A;  1IY2 A;  2R46 A;  3L29 A;  4IBD A;  4QNR A;  1I94 M;  1Z59 A;  1IXR C;  4WW0 A;  4JI8 M;  4GKK M;  3SAT A;  3FUV A;  4AKG A;  3THG A;  1L2C A;  1ZQ9 A;  4LRS A;  1OFH A;  1I4W A;  5KQD A;  4IBJ A;  3GLG A;  4B7G A;  5FTM A;  1GLN A;  4EIW A;  1IXS B;  4WUR A;  4AG6 A;  2QBY A;  3UMM A;  1NHG C;  4JI0 M;  2J7O A;  2KZS A;  1S3S A;  1Z6T A;  3SC3 A;  3MHV C;  4BBA A;  5JI2 E;  4B08 A;  5EP2 A;  4NSO B;  3JR4 A;  2VQF M;  1XXH B;  4G4N A;  4OW0 A;  3A46 A;  2VQE M;  4QOS A;  2OPF A;  4AI6 A;  1XNQ M;  2W82 A;  1Z5C A;  3HU1 A;  4LZJ A;  4MGK E;  3LQQ A;  3K8Z A;  1IN6 A;  4LF6 M;  3RE8 A;  3J7A S;  2Q2E B;  3GPP A;  3HJS A;  3KP1 E;  1IN7 A;  2FFJ A;  4LFC M;  1HNZ M;  3VKH A;  4IBE A;  4B7F A;  2HCB A;  1WXQ A;  5FSW A;  5ITX A;  1J7K A;  2DHR A;  3U5Z B;  4L78 A;  3L28 A;  4I5S A;  3B9P A;  3J2P B;  3GLI B;  4LJ6 A;  2KRU A;  1NJG A;  5GKN A;  1XWI A;  3SYL A;  1OFI A;  3LVV A;  1QVR A;  3KW6 A;  1L1Z A;  2HL7 A;  2V1U A;  3FKE A;  1X37 A;  4FWH A;  3PXG A;  4I81 A;  3TWK A;  1DGG A;  1ZAE A;  4MM3 B;  1DGB A;  3FUT A;  3KVW A;  2C9C A;  4GH9 A;  4LJ4 A;  1TH4 A;  1HNW M;  1IM2 A;  3U6M A;  3KXE C;  3U60 B;  4QNM A;  3A45 A;  4W5W A;  2X4A A;  5DYI A;  1PJI A;  3KFU G;  1GL7 A;  5EP3 A;  3VK8 A;  2R18 A;  2G8L A;  4PCZ A;  4AQY M;  2QPA A;  2R4E A;  3PNV A;  4MH0 E;  4M0W A;  1ORY B;  4K0K M;  3EIE A;  2RGO A;  3UZU A;  4JI2 M;  2VII A;  3HHX A;  2KA6 B;  5JI3 E;  2Y0T A;  2XFS A;  4LFA M;  4JI1 M;  4I8O A;  3SMP A;  4L15 A;  3GP1 A;  3H4M A;  4XBO A;  5EJC A;  1TDH A;  4LZZ A;  1FJG M;  4AZF A;  4L8R C;  1EE8 A;  3PFI A;  1N33 M;  3MJ5 A;  1MX0 A;  3PVS A;  2DWZ B;  1SXJ B;  1XXH A;  2XSZ A;  3SYK A;  3E9S A;  4DV0 M;  2EUC A;  1UM8 A;  1XHB A;  4X66 M;  3AOE C;  4IJF A;  2RGH A;  3KS4 A;  3UJN A;  4QHT A;  1XNR M;  3UGJ A;  2FNA A;  3SHG B;  1L2D A;  3I51 A;  3OTO M;  3U6D A;  3KSX A;  3SAR A;  3FTC A;  4G4R A;  1QAN A;  2F5N A;  2BNK A;  2XSZ D;  1OJL A;  5DNY A;  2UXD M;  2FE8 A;  3HKP A;  5C1B A;  4R3D A;  2ERC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...