1OAIA

Complex between tap uba domain and fxfg nucleoporin peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
molecule keywords NUCLEAR RNA EXPORT FACTOR
total genus 24
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oaiA00
1E94E 2QNJA 1WR1B 3K9OA 2OO9A 2EKKA 1C7YA 2K9DA 1G41A 3IECA 1KYIA 1MN3A 2MROB 2H5XA 2JY7A 2ZTDA 2JY6B 2HAKA 2DENA 1UFZA 1VQ1A 2DKLA 4F2LA 1VEGA 2BWBA 2DAIA 1Q02A 1ZMWA 2OOAA 4G3OA 2ZTCA 1HJPA 2HWJA 1G3IA 2LTUA 4R71A 3K9PA 2EKFA 1VEJA 3E46A 1Y8GA 2LVAA 1VEKA 2K0BX 1PGYA 2MJ5B 2JP7A 1DV0A 3FRIA 1XB2B 1QZEA 1CUKA 1WHCA 3GLIE 2JZ0A 1OAIA 1A5TA 3H4JA 2O25A 2DAEA 2MR9A 1HQYE 2BWEA 2LVQD 3LCUA 2JNHA 2KHHA 1F4IA 1OTRA 2CP8A 1SG9A 1T6OA 2QHOB 4GEWA 1NV8A 3BBZA 1YLAA 2L2DA 1VDLA 2JY5A 3GLHE 1IXSA 1ZV1A 3LCVB 1T43A 2QSFX 1IM2A 1HT1E 2KNVA 5JI2E 1DO0A 2LVNC 1JR3E 2OOBA 1WIVA 3IHPA 3B89A 3T6PA 3GLFE 2KNAA 4UN2B 1HT2E 1WGNA 2CWBA 2RRUA 3MMPA 2WZJA 2DNAA 3E21A 4Q7JA 2JZ1A 2DAKA 2EJSA 2LVPC 1NV9A 1AIPC 1BVSA 1ZMVA 2KNZA 4WP2A 2G3QA 2MGWA 1G4AE 2DHYA 1OQYA 1P3QQ 2B3TA 1R4GA 2JUJA 1IFYA 1XXHE 3GLGE 4HEOA 1V92A 1TR8A 2DAMA 2LBCA 1EFUB 1OKSA 2JY8A 2L4EA 2L4FA 2LVOC 3F92A 3FE3A 1WJ7A 2DZLA 1WGLA 2DI0A 2R0IA 5DFLA 1ZMUA 4DBGB 1GO5A 1DO2A 2DAGA 1VG5A 1TTEA 3FRHA 4F1IA
chains in the Genus database with same CATH superfamily
4IIWA 2QNJA 3H4MA 4M0WA 2H1RA 1VDDA 2OO9A 2R18A 2C9CA 3B7NA 3GRYA 3J2PB 2Y20A 3HJ8A 4KO8A 2G8LA 4I5SA 3A98B 3I01M 4RF1A 4IBGA 3GPYA 4KHPM 4YHHM 4MGYE 3KFUG 4AKIA 4GC9A 3IECA 1Z5BA 4PDGA 2JY7A 2ZTDA 4G4QA 1TH2A 1SXJE 4LZZA 3A46A 2CHQA 3CGWA 1IN5A 1UFZA 1XNRM 3AV0A 5FTKA 4F2LA 1VEGA 4B7FA 2DAIA 3FTCA 2UXDM 1Q02A 1GJSA 2EUCA 2OOAA 3A45A 2LHGA 1QUTA 1QDRA 3KXEC 4FW9A 4DV6M 3HZJA 2QBYA 2EKFA 2EO2A 4DR5M 5BPVA 1V33A 1VEKA 2K6BA 4R3DA 1DV0A 3U61B 1XB2B 1Q39A 3K1JA 2R4EA 1XXHB 3QYEA 1NY5A 2CV1A 4Z8XA 2JZ0A 2ZANA 5IREB 2F5QA 3Q8GA 5FTNA 5FTJA 1A5TA 3H4JA 4LF9M 3HHYA 2MR9A 1HQYE 4LJ8A 4QOZC 1F4IA 2JNHA 2KHHA 4GRIA 2CP8A 4QNRA 1NHWC 3THGA 1IN7A 1R6BX 3FUTA 2CE7A 3VK8A 1UM8A 1IN6A 2R65A 4LFCM 1VDLA 3PXGA 3OTOM 3GLHE 4GIPA 3EIEA 2XLJA 1DGHB 3I04M 5F3WA 3U6OA 1T43A 5E6JA 4B3RM 1J5EM 1IM2A 3HJSA 1AUAA 3L29A 4DV2M 1N78A 3L2AA 4LF8M 2CEAA 4AQYM 3KOZE 3UK6A 2R45A 1GLNA 4M9ZA 3T6PA 4JI2M 1DGHA 3L28A 4CISA 5EQTA 5EXXA 4HLQA 4S12A 3VKHA 2CWBA 2RRUA 1FNNA 4KLNA 1QAMA 1YUBA 3SAUA 3SAVA 4Q7JA 2JZ1A 3J81S 3RGPA 2F5OA 4DV1M 5LMUM 3E4RA 1IXZA 1Z6TA 4Z6YA 2O5RA 5E26A 5EXSA 4MB7A 2ZM6M 1Z59A 3SMPA 1BVSA 4RKUF 3MHVC 1NJGA 4EIWA 1N34M 2KXEA 2R4JA 1D2NA 1QZMA 4GH9A 1DGBA 3U6DA 2MGWA 2YNMD 1OQYA 5KQDA 1XNQM 1NJFA 4RNAA 4CHTB 3HHZA 1XXHA 3K92A 4LJ9A 3ZC7B 2V1UA 1Q3CA 4JI8M 3U60B 2DAMA 2LBCA 1OFHA 2LXEA 2C5RA 1SXJC 4OVZA 2WSFF 2F4VM 3SAWA 3UMMA 2JY8A 3EIHA 2UU9M 4LRTA 2LVOC 1WJ7A 3K8ZA 4QNMA 5DFLA 1E32A 2D7HA 2L6OA 1LTMA 1TTEA 5GKNA 4X64M 4GKKM 2V1CA 3GLFA 4QHSA 5IT9S 4Y28F 1D0LA 1IN4A 3GP1A 2X4AA 2UXBM 4NL4H 1E9RA 1E94E 3HWSA 4LRSA 4DV0M 2FNAA 4FCWA 3TQSA 1OJLA 2EKKA 2RGOA 3KOXE 3U6CA 3PFIA 3T38A 4B7HA 2K9DA 1SXJB 2Y21A 5IWAM 2C99A 4IBBA 4NRVA 3W67A 1KYIA 1MN3A 2KA6B 2MROB 3TWKA 4MGZE 4JI4M 1IXSB 2XGNA 1HQCA 2APLA 1NNUC 4XK8F 1EIJA 2Y0QA 1L2DA 1NY6A 2DENA 4AG6A 3QYBA 1IY0A 5DYIA 1L8QA 4LGYA 2XH9A 3SHFA 3VDUA 3TL4X 1LV7A 2DKLA 2BWBA 5KQ8A 3GRRA 3HHWA 5DYGA 1PJQA 1HJPA 1J7KA 1G3IA 1NO1A 2LTUA 2BNKA 4FCVA 3K9PA 4JI3M 3UGJA 3T15A 1R7RA 2C9OA 3E46A 1Y8GA 4BBAA 1OIZA 4D81A 4IBJA 4AW4A 2F5NA 3KS8A 1W5SA 2HHHM 4NRWA 3AOGA 3GQ4A 1DGGA 4DV4M 1QZEA 2FOIC 2WSCF 4NXNM 3W68A 2HL7A 2O01F 3Q8XA 4PDIA 3GLIE 1S3SA 2QZ4A 2UUBM 2YQZA 4CIZA 3U6QA 3CF6E 2CHVA 1JR3D 1TDHA 2BWEA 5FLXS 3LCUA 1N32M 3U6EA 4M9XA 1OTRA 3RGSA 4GHAA 4I8OA 3VFDA 3GRVA 3U6LA 4AG5A 1J09A 1KSFX 1ZAEA 4P16A 3BBZA 1W5TA 3PNYA 3HHXA 2ERCA 1PJIA 1MJGM 2VIIA 1MU5A 2QPAA 1IXSA 3C3DA 3CTWB 2QSFX 3AOEC 2G5GX 3LQQA 4L4UA 1HT1E 4LY6A 3SASA 4GKJM 1DO0A 5L8RF 4G4NA 1IXRC 2FE8A 2K47A 2P5TA 1GJTA 3TE6A 5ITTA 1WIVA 2KRUA 3SMSA 3ZQJA 3B89A 1R2ZA 4YY3M 4MGIE 4JYAM 2R62A 4UN2B 2V6ZM 4LG2A 1HT2E 5DNYA 3FYDA 2WZJA 3V76A 4OW0A 2DNAA 2L7IA 2ZBKB 4II7A 4LFAM 4NC6A 3HU2A 4PT5A 3IG8A 1GABA 2D7EA 5C1BA 2DAKA 2HKJA 3GLHB 1N36M 2LVPC 2LH0A 3SATA 4DR7M 1QQWA 1NV9A 3FD9A 3FYCA 3GPUA 1ZMVA 3GRUA 3M6AA 4MM3B 4L6V6 3L27A 4B7GA 3HU3A 3SBJA 1L1ZA 1G4AE 2DHYA 2QP9X 4I4LA 2Z3XA 5FSWA 1P3QQ 2B3TA 2VDBB 4P17A 3U6SA 2JUJA 1H6UA 3CF2A 1XXHE 5LMNM 2DVWB 3I4YA 1ORYB 3J80S 3VKGA 3KDSE 2DZOB 3HU1A 3T1HM 1EFUB 4FVMA 3RE8A 1TGUA 2D7GA 2JXNA 3VK7A 3SYKA 3C9PA 3B7ZA 2L4EA 3KW6A 1JR3A 3KS4A 1HR0M 2AHMA 3NBXX 1L1TA 3LQRA 1DO2A 1G59A 1TH4A 2CRUA 1GL6A 1IY1A 2I7NA 4GC5A 3UJNA 3U60A 1PM5A 3IG5A 3WHLA 2YFQA 3WHKA 2LWXA 4X65M 1IQPA 2FS1A 2OPFA 3QAUA 1WR1B 3HKPA 2VQFM 4AZFA 2DWMA 2XFSA 2ZAMA 4GHLA 2L7HA 3AL0C 4LJ7A 1GVNA 1TH3A 2H5XA 2L09A 2HAKA 4LFBM 1RU3A 4X66M 2KEBA 4AKGA 2UXCM 1PRBA 1DGFA 3AKZA 4MH0E 1T3TA 4G3OA 1QYRA 2ZTCA 1L2BA 3NBIA 2HWJA 1OAOC 1V34A 2CV2A 2KRKA 4GMQA 2E5LM 3D8LA 4BB9A 5KO3A 4DR4M 3FUXA 3GPPA 1PGYA 1D0KA 2C98A 2MJ5B 1QVRA 1ZQ9A 3FRIA 4LJAA 3U61A 1I94M 4JV5M 3GLGB 1Z5CA 2LNHC 1CUKA 4OU7A 1WHCA 3SC3A 1Z5AA 2NQ8C 4BLCA 4JXJA 2QQ8A 2DAEA 2CV0A 3SARA 2LVQD 1XHBA 2J7NA 4B3TM 3FUVA 1SG9A 5EJCA 3HY5A 1T6OA 3U5ZB 2CFOA 4IBFA 1N33M 3JR5A 4G6ZA 2M5ZA 2Q2EB 3DZDA 1YLAA 2L2DA 2XEPA 2JY5A 3I51A 4REZA 2X49A 3W0FA 5FTLA 5IZ7D 4FWGA 1FJGM 1ZV1A 4IJFA 5JI2E 4JI5M 2LVNC 2MH8A 5KPZA 1YE9A 2N35A 4TUWA 2OOBA 1EE8A 1I4WA 3TWLA 2XZUA 4NSOB 4A3VB 4LF5M 1IBKM 4JI0M 5ITQA 1QAOA 4XGIA 2W82A 3LMMA 3GLFE 5ITYA 5ITXA 1KFVA 3LW5F 3B74A 1PJJA 4DV5M 1WGNA 3MMPA 4G4RA 2R44A 3ZCBB 4ZPXA 3E21A 2J7OA 4MGKE 4DR6M 3FUUA 2KDLA 3C58A 3R9XB 1K82A 1QAQA 3JAMS 1XWIA 4IBIA 4FD2A 4IBCA 3E9SA 1IN8A 3K2LA 5EXPA 1TF0B 3ILKA 4FWDA 2KZUA 2X8AA 3D8BA 2UUCM 4JI7M 2OQ4A 2HCBA 5EXTA 2Z4RA 4DR1M 4GITA 3VDPA 2VQEM 4DUZM 1R4GA 1SXJD 1IFYA 4XBOA 3SFZA 2F5PA 5ITRA 3GLGA 4HEOA 3LVVA 3KP1E 4L15A 2RGHA 1TDZA 1HNXM 2UUAM 4JI6M 3QWLA 4OVZB 4CGYB 3FTEA 4LJ4A 4IBDA 2L4FA 1PJSA 3FE3A 4IBKA 1WGLA 2DI0A 1GO5A 1ZMUA 2BJVA 3CF0A 1NNJA 2R46A 3FRHA 3I4VA 4QHTA 5KPTA 4IBEA 4NSRA 2XFTA 3T1YM 2ZAOA 1HNWM 1XMOM 3K9OA 1Q3BA 3HJQA 3GQ3A 1C7YA 3MK6A 4FWHA 3L26A 4K0KM 4D80A 1G41A 1MX0A 7CATA 4LJ5A 3W0LB 1G8PA 3C3EA 4JN6A 1D0MA 2JY6B 3GLHA 4DV7M 3FUWA 1L2CA 2DWNA 2RKOA 1X37A 4PD2A 4LF7M 3SHGB 1VQ1A 3TPZA 5ITXE 4LZJA 5EP3A 3FTFA 5JI3E 1ZMWA 3AJIB 4PCZA 4LCBA 3PVSA 4NOOB 3J7BA 3ZH9B 4MGHA 4R71A 3KOWE 5EP2A 4D82A 3FKEA 3A42A 5H37D 2EA0A 4LF6M 1C1KA 1VEJA 5BR8M 1QDTA 1GKIA 2LVAA 2DXIA 3VLFB 1R5LA 1OFIA 2KZSA 2QCUA 2VF7A 5FTMA 3JR4A 3KOYE 2K0BX 3AOEA 3GPXA 2JP7A 4DV3M 4JI1M 4QOSA 2QENA 3DOAA 3AFHA 2F5SA 4NXMM 2DZNB 3J7AS 1NSFA 1GL7A 3GLIA 1OAIA 4RF0A 4FCTA 2J5YA 2O25A 1QUSA 1OIPA 2A5YB 3KSJA 2KW0A 1G71A 4WW0A 8CATA 4LF4M 2JA2A 5EP1A 2DWLA 2QHOB 3U5ZA 1N75A 4GEWA 3BXWA 1NV8A 5ITUA 1IBMM 2XF3A 4G4OA 3GO8A 3DFZA 2FH0A 2CHGA 4KT0F 2GNOA 3HGIA 3HX3A 1K3XA 4B3MM 3LCVB 1XMQM 3DA1A 4KODA 4OX9M 3M0EA 2KNVA 4DUYM 1JR3E 4B3SM 4IJEA 3BOSA 3GLFB 5EP4A 1IBLM 3SYLA 4X62M 2WSEF 3IHPA 4I81A 1YSYA 2KNAA 4DR2M 4LJ6A 2Z8YM 3U6MA 2XSZD 4L16A 1HNZM 3B7QA 4B08A 2DHRA 4ANRA 2Z7JA 5A2QS 4HL4A 1SXJA 2LHCA 2DWZB 1QANA 3FTDA 4ITQA 1PJTA 3KP0E 3GQ5A 2YR0A 2EJSA 3L25A 1JQJC 4R7GA 2QBYB 3MJ5A 3RFWA 1AIPC 1R2YA 4M9SA 2Y0TA 4L8RC 1E9SA 2KNZA 4WP2A 3U6PA 2C96A 3KSXA 2G3QA 2GQFA 3PNVA 2XZFA 1N77A 1XC8A 2CUZA 1NHGC 5KPRA 3GLGE 3GLIB 4LGMA 3TWMA 1WXQA 1K3WA 1V92A 2FFJA 2XSZA 2Z4SA 1TR8A 4CJ6A 3UZUA 2BJWA 5C18A 4L78A 4AKHA 4AI6A 3M7GA 3NWLA 4WURA 1IY2A 1OKSA 1JB0F 4M0DA 2JWSA 3KVWA 3F92A 2R0IA 2DZLA 3LVWA 4DBGB 3J27B 2DAGA 1VG5A 2VF8A 2M60A 4W5WA 3R8FA 4F1IA 4DR3M 2R6FA 2I7PA 1NVMA 3B9PA
chains in the Genus database with same CATH topology
1E94E 2QNJA 1WR1B 3K9OA 2OO9A 2EKKA 1C7YA 2K9DA 1G41A 3IECA 1KYIA 1MN3A 2MROB 2H5XA 2JY7A 2ZTDA 2JY6B 2HAKA 2DENA 1UFZA 1VQ1A 2DKLA 4F2LA 1VEGA 2BWBA 2DAIA 1Q02A 1ZMWA 2OOAA 4G3OA 2ZTCA 1HJPA 2HWJA 1G3IA 2LTUA 4R71A 3K9PA 2EKFA 1VEJA 3E46A 1Y8GA 2LVAA 1VEKA 2K0BX 1PGYA 2MJ5B 2JP7A 1DV0A 3FRIA 1XB2B 1QZEA 1CUKA 1WHCA 3GLIE 2JZ0A 1OAIA 1A5TA 3H4JA 2O25A 2DAEA 2MR9A 1HQYE 2BWEA 2LVQD 3LCUA 2JNHA 2KHHA 1F4IA 1OTRA 2CP8A 1SG9A 1T6OA 2QHOB 4GEWA 1NV8A 3BBZA 1YLAA 2L2DA 1VDLA 2JY5A 3GLHE 1IXSA 1ZV1A 3LCVB 1T43A 2QSFX 1IM2A 1HT1E 2KNVA 5JI2E 1DO0A 2LVNC 1JR3E 2OOBA 1WIVA 3IHPA 3B89A 3T6PA 3GLFE 2KNAA 4UN2B 1HT2E 1WGNA 2CWBA 2RRUA 3MMPA 2WZJA 2DNAA 3E21A 4Q7JA 2JZ1A 2DAKA 2EJSA 2LVPC 1NV9A 1AIPC 1BVSA 1ZMVA 2KNZA 4WP2A 2G3QA 2MGWA 1G4AE 2DHYA 1OQYA 1P3QQ 2B3TA 1R4GA 2JUJA 1IFYA 1XXHE 3GLGE 4HEOA 1V92A 1TR8A 2DAMA 2LBCA 1EFUB 1OKSA 2JY8A 2L4EA 2L4FA 2LVOC 3F92A 3FE3A 1WJ7A 2DZLA 1WGLA 2DI0A 2R0IA 5DFLA 1ZMUA 4DBGB 1GO5A 1DO2A 2DAGA 1VG5A 1TTEA 3FRHA 4F1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E94 E;  2QNJ A;  1WR1 B;  3K9O A;  2OO9 A;  2EKK A;  1C7Y A;  2K9D A;  1G41 A;  3IEC A;  1KYI A;  1MN3 A;  2MRO B;  2H5X A;  2JY7 A;  2ZTD A;  2JY6 B;  2HAK A;  2DEN A;  1UFZ A;  1VQ1 A;  2DKL A;  4F2L A;  1VEG A;  2BWB A;  2DAI A;  1Q02 A;  1ZMW A;  2OOA A;  4G3O A;  2ZTC A;  1HJP A;  2HWJ A;  1G3I A;  2LTU A;  4R71 A;  3K9P A;  2EKF A;  1VEJ A;  3E46 A;  1Y8G A;  2LVA A;  1VEK A;  2K0B X;  1PGY A;  2MJ5 B;  2JP7 A;  1DV0 A;  3FRI A;  1XB2 B;  1QZE A;  1CUK A;  1WHC A;  3GLI E;  2JZ0 A;  1OAI A;  1A5T A;  3H4J A;  2O25 A;  2DAE A;  2MR9 A;  1HQY E;  2BWE A;  2LVQ D;  3LCU A;  2JNH A;  2KHH A;  1F4I A;  1OTR A;  2CP8 A;  1SG9 A;  1T6O A;  2QHO B;  4GEW A;  1NV8 A;  3BBZ A;  1YLA A;  2L2D A;  1VDL A;  2JY5 A;  3GLH E;  1IXS A;  1ZV1 A;  3LCV B;  1T43 A;  2QSF X;  1IM2 A;  1HT1 E;  2KNV A;  5JI2 E;  1DO0 A;  2LVN C;  1JR3 E;  2OOB A;  1WIV A;  3IHP A;  3B89 A;  3T6P A;  3GLF E;  2KNA A;  4UN2 B;  1HT2 E;  1WGN A;  2CWB A;  2RRU A;  3MMP A;  2WZJ A;  2DNA A;  3E21 A;  4Q7J A;  2JZ1 A;  2DAK A;  2EJS A;  2LVP C;  1NV9 A;  1AIP C;  1BVS A;  1ZMV A;  2KNZ A;  4WP2 A;  2G3Q A;  2MGW A;  1G4A E;  2DHY A;  1OQY A;  1P3Q Q;  2B3T A;  1R4G A;  2JUJ A;  1IFY A;  1XXH E;  3GLG E;  4HEO A;  1V92 A;  1TR8 A;  2DAM A;  2LBC A;  1EFU B;  1OKS A;  2JY8 A;  2L4E A;  2L4F A;  2LVO C;  3F92 A;  3FE3 A;  1WJ7 A;  2DZL A;  1WGL A;  2DI0 A;  2R0I A;  5DFL A;  1ZMU A;  4DBG B;  1GO5 A;  1DO2 A;  2DAG A;  1VG5 A;  1TTE A;  3FRH A;  4F1I A; 
#chains in the Genus database with same CATH topology
 4IIW A;  2QNJ A;  3H4M A;  4M0W A;  2H1R A;  1VDD A;  2OO9 A;  2R18 A;  2C9C A;  3B7N A;  3GRY A;  3J2P B;  2Y20 A;  3HJ8 A;  4KO8 A;  2G8L A;  4I5S A;  3A98 B;  3I01 M;  4RF1 A;  4IBG A;  3GPY A;  4KHP M;  4YHH M;  4MGY E;  3KFU G;  4AKI A;  4GC9 A;  3IEC A;  1Z5B A;  4PDG A;  2JY7 A;  2ZTD A;  4G4Q A;  1TH2 A;  1SXJ E;  4LZZ A;  3A46 A;  2CHQ A;  3CGW A;  1IN5 A;  1UFZ A;  1XNR M;  3AV0 A;  5FTK A;  4F2L A;  1VEG A;  4B7F A;  2DAI A;  3FTC A;  2UXD M;  1Q02 A;  1GJS A;  2EUC A;  2OOA A;  3A45 A;  2LHG A;  1QUT A;  1QDR A;  3KXE C;  4FW9 A;  4DV6 M;  3HZJ A;  2QBY A;  2EKF A;  2EO2 A;  4DR5 M;  5BPV A;  1V33 A;  1VEK A;  2K6B A;  4R3D A;  1DV0 A;  3U61 B;  1XB2 B;  1Q39 A;  3K1J A;  2R4E A;  1XXH B;  3QYE A;  1NY5 A;  2CV1 A;  4Z8X A;  2JZ0 A;  2ZAN A;  5IRE B;  2F5Q A;  3Q8G A;  5FTN A;  5FTJ A;  1A5T A;  3H4J A;  4LF9 M;  3HHY A;  2MR9 A;  1HQY E;  4LJ8 A;  4QOZ C;  1F4I A;  2JNH A;  2KHH A;  4GRI A;  2CP8 A;  4QNR A;  1NHW C;  3THG A;  1IN7 A;  1R6B X;  3FUT A;  2CE7 A;  3VK8 A;  1UM8 A;  1IN6 A;  2R65 A;  4LFC M;  1VDL A;  3PXG A;  3OTO M;  3GLH E;  4GIP A;  3EIE A;  2XLJ A;  1DGH B;  3I04 M;  5F3W A;  3U6O A;  1T43 A;  5E6J A;  4B3R M;  1J5E M;  1IM2 A;  3HJS A;  1AUA A;  3L29 A;  4DV2 M;  1N78 A;  3L2A A;  4LF8 M;  2CEA A;  4AQY M;  3KOZ E;  3UK6 A;  2R45 A;  1GLN A;  4M9Z A;  3T6P A;  4JI2 M;  1DGH A;  3L28 A;  4CIS A;  5EQT A;  5EXX A;  4HLQ A;  4S12 A;  3VKH A;  2CWB A;  2RRU A;  1FNN A;  4KLN A;  1QAM A;  1YUB A;  3SAU A;  3SAV A;  4Q7J A;  2JZ1 A;  3J81 S;  3RGP A;  2F5O A;  4DV1 M;  5LMU M;  3E4R A;  1IXZ A;  1Z6T A;  4Z6Y A;  2O5R A;  5E26 A;  5EXS A;  4MB7 A;  2ZM6 M;  1Z59 A;  3SMP A;  1BVS A;  4RKU F;  3MHV C;  1NJG A;  4EIW A;  1N34 M;  2KXE A;  2R4J A;  1D2N A;  1QZM A;  4GH9 A;  1DGB A;  3U6D A;  2MGW A;  2YNM D;  1OQY A;  5KQD A;  1XNQ M;  1NJF A;  4RNA A;  4CHT B;  3HHZ A;  1XXH A;  3K92 A;  4LJ9 A;  3ZC7 B;  2V1U A;  1Q3C A;  4JI8 M;  3U60 B;  2DAM A;  2LBC A;  1OFH A;  2LXE A;  2C5R A;  1SXJ C;  4OVZ A;  2WSF F;  2F4V M;  3SAW A;  3UMM A;  2JY8 A;  3EIH A;  2UU9 M;  4LRT A;  2LVO C;  1WJ7 A;  3K8Z A;  4QNM A;  5DFL A;  1E32 A;  2D7H A;  2L6O A;  1LTM A;  1TTE A;  5GKN A;  4X64 M;  4GKK M;  2V1C A;  3GLF A;  4QHS A;  5IT9 S;  4Y28 F;  1D0L A;  1IN4 A;  3GP1 A;  2X4A A;  2UXB M;  4NL4 H;  1E9R A;  1E94 E;  3HWS A;  4LRS A;  4DV0 M;  2FNA A;  4FCW A;  3TQS A;  1OJL A;  2EKK A;  2RGO A;  3KOX E;  3U6C A;  3PFI A;  3T38 A;  4B7H A;  2K9D A;  1SXJ B;  2Y21 A;  5IWA M;  2C99 A;  4IBB A;  4NRV A;  3W67 A;  1KYI A;  1MN3 A;  2KA6 B;  2MRO B;  3TWK A;  4MGZ E;  4JI4 M;  1IXS B;  2XGN A;  1HQC A;  2APL A;  1NNU C;  4XK8 F;  1EIJ A;  2Y0Q A;  1L2D A;  1NY6 A;  2DEN A;  4AG6 A;  3QYB A;  1IY0 A;  5DYI A;  1L8Q A;  4LGY A;  2XH9 A;  3SHF A;  3VDU A;  3TL4 X;  1LV7 A;  2DKL A;  2BWB A;  5KQ8 A;  3GRR A;  3HHW A;  5DYG A;  1PJQ A;  1HJP A;  1J7K A;  1G3I A;  1NO1 A;  2LTU A;  2BNK A;  4FCV A;  3K9P A;  4JI3 M;  3UGJ A;  3T15 A;  1R7R A;  2C9O A;  3E46 A;  1Y8G A;  4BBA A;  1OIZ A;  4D81 A;  4IBJ A;  4AW4 A;  2F5N A;  3KS8 A;  1W5S A;  2HHH M;  4NRW A;  3AOG A;  3GQ4 A;  1DGG A;  4DV4 M;  1QZE A;  2FOI C;  2WSC F;  4NXN M;  3W68 A;  2HL7 A;  2O01 F;  3Q8X A;  4PDI A;  3GLI E;  1S3S A;  2QZ4 A;  2UUB M;  2YQZ A;  4CIZ A;  3U6Q A;  3CF6 E;  2CHV A;  1JR3 D;  1TDH A;  2BWE A;  5FLX S;  3LCU A;  1N32 M;  3U6E A;  4M9X A;  1OTR A;  3RGS A;  4GHA A;  4I8O A;  3VFD A;  3GRV A;  3U6L A;  4AG5 A;  1J09 A;  1KSF X;  1ZAE A;  4P16 A;  3BBZ A;  1W5T A;  3PNY A;  3HHX A;  2ERC A;  1PJI A;  1MJG M;  2VII A;  1MU5 A;  2QPA A;  1IXS A;  3C3D A;  3CTW B;  2QSF X;  3AOE C;  2G5G X;  3LQQ A;  4L4U A;  1HT1 E;  4LY6 A;  3SAS A;  4GKJ M;  1DO0 A;  5L8R F;  4G4N A;  1IXR C;  2FE8 A;  2K47 A;  2P5T A;  1GJT A;  3TE6 A;  5ITT A;  1WIV A;  2KRU A;  3SMS A;  3ZQJ A;  3B89 A;  1R2Z A;  4YY3 M;  4MGI E;  4JYA M;  2R62 A;  4UN2 B;  2V6Z M;  4LG2 A;  1HT2 E;  5DNY A;  3FYD A;  2WZJ A;  3V76 A;  4OW0 A;  2DNA A;  2L7I A;  2ZBK B;  4II7 A;  4LFA M;  4NC6 A;  3HU2 A;  4PT5 A;  3IG8 A;  1GAB A;  2D7E A;  5C1B A;  2DAK A;  2HKJ A;  3GLH B;  1N36 M;  2LVP C;  2LH0 A;  3SAT A;  4DR7 M;  1QQW A;  1NV9 A;  3FD9 A;  3FYC A;  3GPU A;  1ZMV A;  3GRU A;  3M6A A;  4MM3 B;  4L6V 6;  3L27 A;  4B7G A;  3HU3 A;  3SBJ A;  1L1Z A;  1G4A E;  2DHY A;  2QP9 X;  4I4L A;  2Z3X A;  5FSW A;  1P3Q Q;  2B3T A;  2VDB B;  4P17 A;  3U6S A;  2JUJ A;  1H6U A;  3CF2 A;  1XXH E;  5LMN M;  2DVW B;  3I4Y A;  1ORY B;  3J80 S;  3VKG A;  3KDS E;  2DZO B;  3HU1 A;  3T1H M;  1EFU B;  4FVM A;  3RE8 A;  1TGU A;  2D7G A;  2JXN A;  3VK7 A;  3SYK A;  3C9P A;  3B7Z A;  2L4E A;  3KW6 A;  1JR3 A;  3KS4 A;  1HR0 M;  2AHM A;  3NBX X;  1L1T A;  3LQR A;  1DO2 A;  1G59 A;  1TH4 A;  2CRU A;  1GL6 A;  1IY1 A;  2I7N A;  4GC5 A;  3UJN A;  3U60 A;  1PM5 A;  3IG5 A;  3WHL A;  2YFQ A;  3WHK A;  2LWX A;  4X65 M;  1IQP A;  2FS1 A;  2OPF A;  3QAU A;  1WR1 B;  3HKP A;  2VQF M;  4AZF A;  2DWM A;  2XFS A;  2ZAM A;  4GHL A;  2L7H A;  3AL0 C;  4LJ7 A;  1GVN A;  1TH3 A;  2H5X A;  2L09 A;  2HAK A;  4LFB M;  1RU3 A;  4X66 M;  2KEB A;  4AKG A;  2UXC M;  1PRB A;  1DGF A;  3AKZ A;  4MH0 E;  1T3T A;  4G3O A;  1QYR A;  2ZTC A;  1L2B A;  3NBI A;  2HWJ A;  1OAO C;  1V34 A;  2CV2 A;  2KRK A;  4GMQ A;  2E5L M;  3D8L A;  4BB9 A;  5KO3 A;  4DR4 M;  3FUX A;  3GPP A;  1PGY A;  1D0K A;  2C98 A;  2MJ5 B;  1QVR A;  1ZQ9 A;  3FRI A;  4LJA A;  3U61 A;  1I94 M;  4JV5 M;  3GLG B;  1Z5C A;  2LNH C;  1CUK A;  4OU7 A;  1WHC A;  3SC3 A;  1Z5A A;  2NQ8 C;  4BLC A;  4JXJ A;  2QQ8 A;  2DAE A;  2CV0 A;  3SAR A;  2LVQ D;  1XHB A;  2J7N A;  4B3T M;  3FUV A;  1SG9 A;  5EJC A;  3HY5 A;  1T6O A;  3U5Z B;  2CFO A;  4IBF A;  1N33 M;  3JR5 A;  4G6Z A;  2M5Z A;  2Q2E B;  3DZD A;  1YLA A;  2L2D A;  2XEP A;  2JY5 A;  3I51 A;  4REZ A;  2X49 A;  3W0F A;  5FTL A;  5IZ7 D;  4FWG A;  1FJG M;  1ZV1 A;  4IJF A;  5JI2 E;  4JI5 M;  2LVN C;  2MH8 A;  5KPZ A;  1YE9 A;  2N35 A;  4TUW A;  2OOB A;  1EE8 A;  1I4W A;  3TWL A;  2XZU A;  4NSO B;  4A3V B;  4LF5 M;  1IBK M;  4JI0 M;  5ITQ A;  1QAO A;  4XGI A;  2W82 A;  3LMM A;  3GLF E;  5ITY A;  5ITX A;  1KFV A;  3LW5 F;  3B74 A;  1PJJ A;  4DV5 M;  1WGN A;  3MMP A;  4G4R A;  2R44 A;  3ZCB B;  4ZPX A;  3E21 A;  2J7O A;  4MGK E;  4DR6 M;  3FUU A;  2KDL A;  3C58 A;  3R9X B;  1K82 A;  1QAQ A;  3JAM S;  1XWI A;  4IBI A;  4FD2 A;  4IBC A;  3E9S A;  1IN8 A;  3K2L A;  5EXP A;  1TF0 B;  3ILK A;  4FWD A;  2KZU A;  2X8A A;  3D8B A;  2UUC M;  4JI7 M;  2OQ4 A;  2HCB A;  5EXT A;  2Z4R A;  4DR1 M;  4GIT A;  3VDP A;  2VQE M;  4DUZ M;  1R4G A;  1SXJ D;  1IFY A;  4XBO A;  3SFZ A;  2F5P A;  5ITR A;  3GLG A;  4HEO A;  3LVV A;  3KP1 E;  4L15 A;  2RGH A;  1TDZ A;  1HNX M;  2UUA M;  4JI6 M;  3QWL A;  4OVZ B;  4CGY B;  3FTE A;  4LJ4 A;  4IBD A;  2L4F A;  1PJS A;  3FE3 A;  4IBK A;  1WGL A;  2DI0 A;  1GO5 A;  1ZMU A;  2BJV A;  3CF0 A;  1NNJ A;  2R46 A;  3FRH A;  3I4V A;  4QHT A;  5KPT A;  4IBE A;  4NSR A;  2XFT A;  3T1Y M;  2ZAO A;  1HNW M;  1XMO M;  3K9O A;  1Q3B A;  3HJQ A;  3GQ3 A;  1C7Y A;  3MK6 A;  4FWH A;  3L26 A;  4K0K M;  4D80 A;  1G41 A;  1MX0 A;  7CAT A;  4LJ5 A;  3W0L B;  1G8P A;  3C3E A;  4JN6 A;  1D0M A;  2JY6 B;  3GLH A;  4DV7 M;  3FUW A;  1L2C A;  2DWN A;  2RKO A;  1X37 A;  4PD2 A;  4LF7 M;  3SHG B;  1VQ1 A;  3TPZ A;  5ITX E;  4LZJ A;  5EP3 A;  3FTF A;  5JI3 E;  1ZMW A;  3AJI B;  4PCZ A;  4LCB A;  3PVS A;  4NOO B;  3J7B A;  3ZH9 B;  4MGH A;  4R71 A;  3KOW E;  5EP2 A;  4D82 A;  3FKE A;  3A42 A;  5H37 D;  2EA0 A;  4LF6 M;  1C1K A;  1VEJ A;  5BR8 M;  1QDT A;  1GKI A;  2LVA A;  2DXI A;  3VLF B;  1R5L A;  1OFI A;  2KZS A;  2QCU A;  2VF7 A;  5FTM A;  3JR4 A;  3KOY E;  2K0B X;  3AOE A;  3GPX A;  2JP7 A;  4DV3 M;  4JI1 M;  4QOS A;  2QEN A;  3DOA A;  3AFH A;  2F5S A;  4NXM M;  2DZN B;  3J7A S;  1NSF A;  1GL7 A;  3GLI A;  1OAI A;  4RF0 A;  4FCT A;  2J5Y A;  2O25 A;  1QUS A;  1OIP A;  2A5Y B;  3KSJ A;  2KW0 A;  1G71 A;  4WW0 A;  8CAT A;  4LF4 M;  2JA2 A;  5EP1 A;  2DWL A;  2QHO B;  3U5Z A;  1N75 A;  4GEW A;  3BXW A;  1NV8 A;  5ITU A;  1IBM M;  2XF3 A;  4G4O A;  3GO8 A;  3DFZ A;  2FH0 A;  2CHG A;  4KT0 F;  2GNO A;  3HGI A;  3HX3 A;  1K3X A;  4B3M M;  3LCV B;  1XMQ M;  3DA1 A;  4KOD A;  4OX9 M;  3M0E A;  2KNV A;  4DUY M;  1JR3 E;  4B3S M;  4IJE A;  3BOS A;  3GLF B;  5EP4 A;  1IBL M;  3SYL A;  4X62 M;  2WSE F;  3IHP A;  4I81 A;  1YSY A;  2KNA A;  4DR2 M;  4LJ6 A;  2Z8Y M;  3U6M A;  2XSZ D;  4L16 A;  1HNZ M;  3B7Q A;  4B08 A;  2DHR A;  4ANR A;  2Z7J A;  5A2Q S;  4HL4 A;  1SXJ A;  2LHC A;  2DWZ B;  1QAN A;  3FTD A;  4ITQ A;  1PJT A;  3KP0 E;  3GQ5 A;  2YR0 A;  2EJS A;  3L25 A;  1JQJ C;  4R7G A;  2QBY B;  3MJ5 A;  3RFW A;  1AIP C;  1R2Y A;  4M9S A;  2Y0T A;  4L8R C;  1E9S A;  2KNZ A;  4WP2 A;  3U6P A;  2C96 A;  3KSX A;  2G3Q A;  2GQF A;  3PNV A;  2XZF A;  1N77 A;  1XC8 A;  2CUZ A;  1NHG C;  5KPR A;  3GLG E;  3GLI B;  4LGM A;  3TWM A;  1WXQ A;  1K3W A;  1V92 A;  2FFJ A;  2XSZ A;  2Z4S A;  1TR8 A;  4CJ6 A;  3UZU A;  2BJW A;  5C18 A;  4L78 A;  4AKH A;  4AI6 A;  3M7G A;  3NWL A;  4WUR A;  1IY2 A;  1OKS A;  1JB0 F;  4M0D A;  2JWS A;  3KVW A;  3F92 A;  2R0I A;  2DZL A;  3LVW A;  4DBG B;  3J27 B;  2DAG A;  1VG5 A;  2VF8 A;  2M60 A;  4W5W A;  3R8F A;  4F1I A;  4DR3 M;  2R6F A;  2I7P A;  1NVM A;  3B9P A; 
#chains in the Genus database with same CATH homology
 1E94 E;  2QNJ A;  1WR1 B;  3K9O A;  2OO9 A;  2EKK A;  1C7Y A;  2K9D A;  1G41 A;  3IEC A;  1KYI A;  1MN3 A;  2MRO B;  2H5X A;  2JY7 A;  2ZTD A;  2JY6 B;  2HAK A;  2DEN A;  1UFZ A;  1VQ1 A;  2DKL A;  4F2L A;  1VEG A;  2BWB A;  2DAI A;  1Q02 A;  1ZMW A;  2OOA A;  4G3O A;  2ZTC A;  1HJP A;  2HWJ A;  1G3I A;  2LTU A;  4R71 A;  3K9P A;  2EKF A;  1VEJ A;  3E46 A;  1Y8G A;  2LVA A;  1VEK A;  2K0B X;  1PGY A;  2MJ5 B;  2JP7 A;  1DV0 A;  3FRI A;  1XB2 B;  1QZE A;  1CUK A;  1WHC A;  3GLI E;  2JZ0 A;  1OAI A;  1A5T A;  3H4J A;  2O25 A;  2DAE A;  2MR9 A;  1HQY E;  2BWE A;  2LVQ D;  3LCU A;  2JNH A;  2KHH A;  1F4I A;  1OTR A;  2CP8 A;  1SG9 A;  1T6O A;  2QHO B;  4GEW A;  1NV8 A;  3BBZ A;  1YLA A;  2L2D A;  1VDL A;  2JY5 A;  3GLH E;  1IXS A;  1ZV1 A;  3LCV B;  1T43 A;  2QSF X;  1IM2 A;  1HT1 E;  2KNV A;  5JI2 E;  1DO0 A;  2LVN C;  1JR3 E;  2OOB A;  1WIV A;  3IHP A;  3B89 A;  3T6P A;  3GLF E;  2KNA A;  4UN2 B;  1HT2 E;  1WGN A;  2CWB A;  2RRU A;  3MMP A;  2WZJ A;  2DNA A;  3E21 A;  4Q7J A;  2JZ1 A;  2DAK A;  2EJS A;  2LVP C;  1NV9 A;  1AIP C;  1BVS A;  1ZMV A;  2KNZ A;  4WP2 A;  2G3Q A;  2MGW A;  1G4A E;  2DHY A;  1OQY A;  1P3Q Q;  2B3T A;  1R4G A;  2JUJ A;  1IFY A;  1XXH E;  3GLG E;  4HEO A;  1V92 A;  1TR8 A;  2DAM A;  2LBC A;  1EFU B;  1OKS A;  2JY8 A;  2L4E A;  2L4F A;  2LVO C;  3F92 A;  3FE3 A;  1WJ7 A;  2DZL A;  1WGL A;  2DI0 A;  2R0I A;  5DFL A;  1ZMU A;  4DBG B;  1GO5 A;  1DO2 A;  2DAG A;  1VG5 A;  1TTE A;  3FRH A;  4F1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...