1OAIA

Complex between tap uba domain and fxfg nucleoporin peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR RNA EXPORT FACTOR
publication title Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
total genus 24
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oaiA00
2K0BX 4G3OA 1XXHE 1QZEA 2H5XA 4DBGB 1ZMVA 2BWBA 3FE3A 1WHCA 3FRIA 1EFUB 3GLFE 1DO0A 4F1IA 2JY6B 1VEKA 4Q7JA 3IHPA 2DAMA 2K9DA 1VEGA 4UN2B 1G3IA 2WZJA 3K9OA 4GEWA 1HJPA 1WGLA 1VG5A 2OO9A 3BBZA 4WP2A 2JNHA 1E94E 1KYIA 1R4GA 1HT2E 1VQ1A 3FRHA 2QHOB 2DAGA 1XB2B 1P3QQ 2KNAA 2MGWA 1F4IA 1DO2A 1OTRA 1HT1E 2MJ5B 1A5TA 2DI0A 1Y8GA 1VDLA 2LBCA 2LVPC 5JI2E 1ZMWA 1JR3E 2JY8A 1WJ7A 1YLAA 1WGNA 1T6OA 2MROB 4R71A 2JP7A 1UFZA 1DV0A 2LVQD 1ZV1A 2L4EA 2EKFA 2L4FA 1WIVA 2DENA 1BVSA 1GO5A 1WR1B 3E21A 2DNAA 2DAIA 3GLGE 4F2LA 2LVNC 1NV9A 2BWEA 2DAKA 1VEJA 2LVAA 2LVOC 3LCUA 2HWJA 2QNJA 2ZTCA 1Q02A 1OKSA 2JY7A 2JZ0A 1OAIA 2O25A 3B89A 2DKLA 3E46A 2KNVA 1MN3A 2G3QA 1CUKA 3H4JA 1IXSA 2OOBA 3GLHE 2MR9A 3LCVB 3T6PA 2HAKA 1TTEA 1OQYA 2DZLA 3GLIE 1HQYE 1C7YA 2L2DA 2KNZA 1IFYA 2LTUA 2JUJA 2JY5A 2JZ1A 1T43A 2B3TA 3MMPA 1AIPC 2R0IA 3IECA 1V92A 1TR8A 2DHYA 1PGYA 1G41A 3F92A 1NV8A 2RRUA 2CP8A 4HEOA 2EKKA 1G4AE 2QSFX 1SG9A 2OOAA 3K9PA 2EJSA 2ZTDA 2CWBA 2KHHA 1IM2A 1ZMUA 2DAEA 5DFLA
chains in the Genus database with same CATH superfamily
3U61A 1SXJA 4DV4M 3AOGA 3CF6E 1QZEA 2H5XA 5IZ7D 1TDZA 3I4YA 1GL7A 4FWHA 1J09A 1PJSA 3KVWA 1WHCA 3GLIB 4NSOB 1OAOC 5E26A 4LF6M 3GLFE 3GRUA 4F1IA 1OFHA 3W0LB 4M9ZA 3NWLA 3BOSA 5EP1A 1N36M 4GKKM 4AG6A 3H4MA 1D0LA 4PT5A 4CJ6A 2ZM6M 4GMQA 5EXXA 1WXQA 1HNWM 1Z5CA 2DWZB 4NL4H 2WSCF 2OQ4A 1Q39A 2H1RA 4GEWA 4L4UA 4Z8XA 4I81A 4DV1M 5DYGA 3FYCA 1R2YA 1QAMA 5EP2A 3L25A 3EIEA 5KPTA 3UGJA 2Z4RA 1HT2E 4IBIA 2P5TA 2FE8A 1I94M 1G71A 3J80S 1NJGA 2O01F 2Y0QA 2BNKA 1K82A 4MGZE 2MGWA 2R44A 4ITQA 1F4IA 2HHHM 2LBCA 2LVPC 4IBFA 5DYIA 4Z6YA 3GPPA 2F5NA 3KDSE 1LV7A 4HL4A 4JV5M 1SXJE 1TDHA 1YLAA 3SHFA 4PCZA 2NQ8C 4FCTA 4R71A 4S12A 2JP7A 3ZH9B 3K1JA 2VF8A 4DR2M 1YE9A 2C99A 1L8QA 2LVQD 1QUSA 3JR4A 2E5LM 4OU7A 1V34A 2KDLA 1BVSA 3V76A 3SBJA 2XH9A 1GO5A 4XK8F 1WR1B 3E21A 4DV5M 2C96A 4JI7M 3ZQJA 2CEAA 3D8LA 5L8RF 2JXNA 4W5WA 3FUUA 4LF7M 2K47A 3PFIA 4Y28F 2Z3XA 1R5LA 2K6BA 2KW0A 3LCUA 1QVRA 4G4OA 2X8AA 3SHGB 3HY5A 3FTEA 2ZTCA 4REZA 5FTMA 4G4NA 1Q02A 4YY3M 3C3DA 1MJGM 2J5YA 1PM5A 2O25A 3J7AS 3HJSA 3AOEC 1JB0F 4GIPA 2VF7A 3L27A 3QAUA 4OW0A 4MH0E 1J7KA 2KNVA 5EP3A 3C9PA 1GJSA 1Z5BA 3VKGA 3TL4X 3KOXE 2N35A 2OOBA 5C18A 3K2LA 1OFIA 2MR9A 3VDPA 1HNZM 2DZLA 3GLIE 1N78A 3HHYA 1Z59A 3SATA 1C7YA 2L2DA 4FWDA 3U60B 1NNJA 5LMUM 3HU2A 3HU1A 4JI5M 4M9SA 2LTUA 4JI4M 2R65A 3FUTA 1T43A 3HKPA 4NRVA 4ZPXA 2MH8A 5A2QS 3BXWA 4JYAM 3K92A 3IECA 5FLXS 3WHKA 2VQFM 3RGSA 1N77A 3F92A 2Y20A 2V1UA 2D7HA 4GHAA 3CTWB 2FOIC 3M6AA 4HEOA 3UZUA 4LJ8A 2CV1A 1G4AE 3GQ3A 4G4QA 3KSJA 4PDGA 2F5OA 3SARA 4HLQA 1ZMUA 4GITA 2C98A 4M0WA 5ITYA 2L09A 1SXJC 2F4VM 2ZAMA 3GLFA 4WURA 2LWXA 2ZBKB 2K0BX 3U6SA 4KODA 3CF0A 2XLJA 1GVNA 4II7A 3L26A 3GLHB 4G3OA 1L2BA 3TWLA 3TWMA 1QAQA 1PJIA 2KA6B 2OPFA 3SASA 1QANA 2CE7A 1EFUB 4LY6A 1DO0A 4IJEA 2RGOA 1I4WA 3JAMS 1SXJD 1PJQA 3LVVA 1VEKA 2J7OA 3J27B 2EA0A 2DAMA 3PNVA 3NBIA 2KRKA 1J5EM 4LCBA 4KHPM 3QWLA 1WGLA 1V33A 2OO9A 4DV0M 4LF5M 1W5SA 3FYDA 1TF0B 1E94E 3W68A 5EXPA 3U6LA 2W82A 1PRBA 5KPZA 1PJTA 3OTOM 5FTKA 2R4EA 4LRTA 2R6FA 1S3SA 2QBYB 1P3QQ 3U6DA 3QYEA 3VKHA 5FSWA 3SAWA 1A5TA 1OJLA 1N33M 1DGFA 1Y8GA 2CV0A 2AHMA 4X65M 1ZMWA 2GQFA 1JR3E 2R4JA 4X66M 1WJ7A 3GRYA 1L1ZA 2LHGA 1IBMM 4LGMA 4B3SM 8CATA 4OX9M 1FNNA 1R7RA 2VDBB 3CGWA 4L16A 4JI3M 3HZJA 1EE8A 1FJGM 1DGHB 2KZUA 4DV7M 1XMOM 1XMQM 1K3XA 2X49A 1ZV1A 3UMMA 1TH2A 2F5QA 4DR4M 1DGGA 2M5ZA 2APLA 4CIZA 1IXZA 3AFHA 4QNRA 2VQEM 5ITRA 4DV3M 3R9XB 3B9PA 2XEPA 1L1TA 2DWMA 2JA2A 3I51A 2DHRA 2I7PA 2BWEA 4BLCA 4NOOB 2LHCA 3RFWA 4JXJA 4DR7M 2HWJA 3KP0E 3SAUA 3K8ZA 3CF2A 2EO2A 1W5TA 4R3DA 3U6CA 2QBYA 3SMPA 4AZFA 4CISA 4PDIA 3GLIA 1NHGC 1MN3A 1OIPA 5FTNA 2HKJA 4QNMA 3GLHE 4LJ4A 3HHWA 1NVMA 1TTEA 3VDUA 1QUTA 5IREB 2YR0A 1HQYE 2CFOA 1QYRA 3GRVA 5IT9S 2KNZA 4QHSA 3W67A 5C1BA 1GL6A 1HR0M 2JUJA 2JY5A 3MMPA 2B3TA 3U6PA 2R0IA 1NHWC 4JI0M 4X62M 1X37A 2DHYA 4JN6A 5EXTA 1L2DA 4L15A 1PGYA 5BR8M 1TH4A 3TPZA 3U6MA 2C9OA 2RRUA 3VFDA 2UUCM 3KFUG 2XF3A 1E9RA 1IN4A 1NY6A 3IG8A 1IQPA 3LQRA 4M9XA 1IBKM 5BPVA 3U6OA 4G6ZA 3THGA 4LFCM 3KXEC 2EJSA 1N75A 2KHHA 1IM2A 4DR1M 2I7NA 2Z4SA 3PVSA 4KO8A 5FTJA 4LF4M 3RGPA 4LJAA 3KSXA 3B7NA 4DR6M 3MJ5A 4FVMA 3HJQA 3FKEA 4IBBA 2YQZA 1YSYA 4I5SA 2BWBA 3GO8A 3FE3A 3DZDA 5EQTA 3ZCBB 3FRIA 3M0EA 3TQSA 1XC8A 2DVWB 4NXMM 2WSEF 3U6EA 5JI3E 2JY6B 3SC3A 3WHLA 2D7GA 5FTLA 3IHPA 2C9CA 1NSFA 1VEGA 3HU3A 4UN2B 4B3TM 4JI6M 1G3IA 1JQJC 2WZJA 3K9OA 1HJPA 4AKIA 2KEBA 1VG5A 4FD2A 1K3WA 4OVZB 4GHLA 3T1YM 4WP2A 5KO3A 1T3TA 2JNHA 1KYIA 4GH9A 4P17A 1VQ1A 4GC9A 1H6UA 2RGHA 1EIJA 1JR3A 2DAGA 3T38A 4AG5A 3JR5A 1NJFA 5DNYA 1KFVA 1IN6A 2KNAA 4YHHM 1DO2A 2V1CA 3ZC7B 2MJ5B 1IBLM 1XXHB 4X64M 3B7ZA 2JY8A 3J81S 1N34M 3LQQA 2CRUA 1ZAEA 1IY1A 2Q2EB 3I01M 1GJTA 3VLFB 5ITTA 3GPYA 4L8RC 4RNAA 5KPRA 3L2AA 1UFZA 3U60A 1QDRA 4NXNM 4L78A 1GABA 4G4RA 1DV0A 2X4AA 5H37D 4PD2A 3D8BA 1XNQM 2KXEA 4WW0A 2EKFA 3FTDA 1GLNA 3SYKA 2DENA 3FD9A 4LJ9A 3GQ5A 4DUYM 4IBGA 1IXRC 2DNAA 2Z7JA 2XSZA 1HNXM 1NV9A 3I4VA 1TGUA 3DOAA 1G8PA 3HX3A 3NBXX 2DAKA 4XGIA 1VEJA 2LVAA 4D80A 4LG2A 3LMMA 3Q8XA 2JY7A 4AKGA 2JZ0A 4LFBM 3GLHA 1OAIA 4XBOA 3Q8GA 2DKLA 5EXSA 4IJFA 4B7FA 2ZANA 2DZOB 1Q3CA 2LXEA 5KQDA 5ITUA 3E4RA 4A3VB 5EJCA 3I04M 4IBCA 3UK6A 2YNMD 1CUKA 4MGHA 4LZJA 3H4JA 2CUZA 2XGNA 3LCVB 1IN8A 2O5RA 2M60A 3T6PA 2HAKA 1LTMA 1ORYB 1IY0A 2DWNA 2LH0A 3KP1E 3LVWA 2RKOA 4FWGA 3FUVA 3TE6A 3HHXA 4AW4A 4DR3M 1L2CA 3FUWA 1GKIA 2R46A 2JZ1A 4NC6A 4RF0A 2R62A 3GLGB 4DV2M 2Y0TA 1KSFX 1V92A 4R7GA 1XHBA 4FCVA 1NY5A 3T1HM 3PNYA 3KS8A 4K0KM 4B7HA 3DA1A 4JI1M 3MHVC 3GPXA 1MX0A 2QSFX 3SMSA 4TUWA 1SG9A 5EP4A 5ITXA 2OOAA 1XNRM 4AKHA 2XZFA 2L7IA 1QQWA 2Y21A 3IG5A 3GP1A 2CWBA 4B7GA 2FH0A 2DAEA 1HQCA 1R2ZA 2HL7A 4MGYE 3L29A 4FW9A 3GPUA 4CGYB 4IBEA 2A5YB 4GC5A 3SYLA 4LJ5A 4L6V6 4I8OA 1G59A 1XXHE 4DBGB 1DGHA 4LF9M 1ZMVA 4D81A 1YUBA 2UXBM 1QAOA 3KOWE 2CV2A 2UUBM 4Q7JA 2GNOA 2QZ4A 1UM8A 2KZSA 2ERCA 3A45A 2K9DA 3KOYE 5LMNM 1D0KA 4AQYM 3J7BA 1R6BX 1Q3BA 2QENA 3GLGA 2DWLA 4BBAA 4KT0F 1D2NA 3AKZA 1ZQ9A 4LFAM 2R18A 3BBZA 1Z6TA 1R4GA 1E9SA 4IBDA 3M7GA 3FRHA 2V6ZM 3A98B 4IIWA 2QHOB 2L6OA 2Z8YM 4P16A 4RF1A 3RE8A 3HHZA 1XB2B 5ITXE 3DFZA 5ITQA 3ILKA 1IY2A 1OTRA 2CHGA 3HGIA 1HT1E 2G8LA 1IN5A 1AUAA 2DI0A 1VDLA 4DV6M 2QPAA 1PJJA 3AJIB 3VK7A 4EIWA 5JI2E 3GQ4A 2XZUA 4M0DA 1JR3D 1WGNA 1IXSB 1T6OA 7CATA 3U5ZB 2C5RA 2QP9X 3GLFB 2LNHC 2UU9M 3C3EA 3R8FA 2MROB 3LW5F 5F3WA 4CHTB 4KLNA 2ZAOA 1QZMA 3AL0C 3KOZE 4RKUF 3KS4A 4LJ6A 4BB9A 1VDDA 3U6QA 2QQ8A 4MB7A 4GKJM 2L4EA 4ANRA 2UUAM 1OIZA 1NO1A 1WIVA 2D7EA 2FNAA 2HCBA 2L4FA 3B74A 1IN7A 3QYBA 4B08A 1N32M 3MK6A 3W0FA 4DR5M 2DAIA 3GLGE 2BJWA 4NSRA 2F5SA 4F2LA 3J2PB 4LZZA 2DZNB 2LVNC 2DXIA 4GRIA 3L28A 2CHQA 3B7QA 4LRSA 2EUCA 2LVOC 3VK8A 1RU3A 2QNJA 4I4LA 4MGIE 2J7NA 4QHTA 2FFJA 2R45A 4JI2M 1OKSA 4NRWA 2UXCM 3T15A 4JI8M 5GKNA 3U61B 1SXJB 2XSZD 3B89A 3E46A 1Z5AA 3EIHA 3AOEA 2XFTA 3UJNA 4IBJA 2G3QA 2JWSA 3PXGA 1DGBA 3A42A 1IXSA 3FTFA 3U5ZA 3FTCA 1C1KA 3HWSA 1MU5A 1OQYA 1NNUC 4IBKA 4LJ7A 2FS1A 2F5PA 2XFSA 2WSFF 4B3MM 1IFYA 3SAVA 2QCUA 3TWKA 1TH3A 4OVZA 4QOZC 3AV0A 1D0MA 2CHVA 1AIPC 3SFZA 5IWAM 4B3RM 1TR8A 2G5GX 1E32A 4DUZM 2YFQA 3FUXA 1G41A 3C58A 4AI6A 4LGYA 1NV8A 3KW6A 2CP8A 4LF8M 3E9SA 1QDTA 5E6JA 2UXDM 2EKKA 3A46A 3GRRA 3K9PA 2L7HA 1XXHA 2BJVA 2ZTDA 5KQ8A 4QOSA 4FCWA 2VIIA 4MGKE 4D82A 3HJ8A 5DFLA 1XWIA 4MM3B 2KRUA
chains in the Genus database with same CATH topology
2K0BX 4G3OA 1XXHE 1QZEA 2H5XA 4DBGB 1ZMVA 2BWBA 3FE3A 1WHCA 3FRIA 1EFUB 3GLFE 1DO0A 4F1IA 2JY6B 1VEKA 4Q7JA 3IHPA 2DAMA 2K9DA 1VEGA 4UN2B 1G3IA 2WZJA 3K9OA 4GEWA 1HJPA 1WGLA 1VG5A 2OO9A 3BBZA 4WP2A 2JNHA 1E94E 1KYIA 1R4GA 1HT2E 1VQ1A 3FRHA 2QHOB 2DAGA 1XB2B 1P3QQ 2KNAA 2MGWA 1F4IA 1DO2A 1OTRA 1HT1E 2MJ5B 1A5TA 2DI0A 1Y8GA 1VDLA 2LBCA 2LVPC 5JI2E 1ZMWA 1JR3E 2JY8A 1WJ7A 1YLAA 1WGNA 1T6OA 2MROB 4R71A 2JP7A 1UFZA 1DV0A 2LVQD 1ZV1A 2L4EA 2EKFA 2L4FA 1WIVA 2DENA 1BVSA 1GO5A 1WR1B 3E21A 2DNAA 2DAIA 3GLGE 4F2LA 2LVNC 1NV9A 2BWEA 2DAKA 1VEJA 2LVAA 2LVOC 3LCUA 2HWJA 2QNJA 2ZTCA 1Q02A 1OKSA 2JY7A 2JZ0A 1OAIA 2O25A 3B89A 2DKLA 3E46A 2KNVA 1MN3A 2G3QA 1CUKA 3H4JA 1IXSA 2OOBA 3GLHE 2MR9A 3LCVB 3T6PA 2HAKA 1TTEA 1OQYA 2DZLA 3GLIE 1HQYE 1C7YA 2L2DA 2KNZA 1IFYA 2LTUA 2JUJA 2JY5A 2JZ1A 1T43A 2B3TA 3MMPA 1AIPC 2R0IA 3IECA 1V92A 1TR8A 2DHYA 1PGYA 1G41A 3F92A 1NV8A 2RRUA 2CP8A 4HEOA 2EKKA 1G4AE 2QSFX 1SG9A 2OOAA 3K9PA 2EJSA 2ZTDA 2CWBA 2KHHA 1IM2A 1ZMUA 2DAEA 5DFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0B X;  4G3O A;  1XXH E;  1QZE A;  2H5X A;  4DBG B;  1ZMV A;  2BWB A;  3FE3 A;  1WHC A;  3FRI A;  1EFU B;  3GLF E;  1DO0 A;  4F1I A;  2JY6 B;  1VEK A;  4Q7J A;  3IHP A;  2DAM A;  2K9D A;  1VEG A;  4UN2 B;  1G3I A;  2WZJ A;  3K9O A;  4GEW A;  1HJP A;  1WGL A;  1VG5 A;  2OO9 A;  3BBZ A;  4WP2 A;  2JNH A;  1E94 E;  1KYI A;  1R4G A;  1HT2 E;  1VQ1 A;  3FRH A;  2QHO B;  2DAG A;  1XB2 B;  1P3Q Q;  2KNA A;  2MGW A;  1F4I A;  1DO2 A;  1OTR A;  1HT1 E;  2MJ5 B;  1A5T A;  2DI0 A;  1Y8G A;  1VDL A;  2LBC A;  2LVP C;  5JI2 E;  1ZMW A;  1JR3 E;  2JY8 A;  1WJ7 A;  1YLA A;  1WGN A;  1T6O A;  2MRO B;  4R71 A;  2JP7 A;  1UFZ A;  1DV0 A;  2LVQ D;  1ZV1 A;  2L4E A;  2EKF A;  2L4F A;  1WIV A;  2DEN A;  1BVS A;  1GO5 A;  1WR1 B;  3E21 A;  2DNA A;  2DAI A;  3GLG E;  4F2L A;  2LVN C;  1NV9 A;  2BWE A;  2DAK A;  1VEJ A;  2LVA A;  2LVO C;  3LCU A;  2HWJ A;  2QNJ A;  2ZTC A;  1Q02 A;  1OKS A;  2JY7 A;  2JZ0 A;  1OAI A;  2O25 A;  3B89 A;  2DKL A;  3E46 A;  2KNV A;  1MN3 A;  2G3Q A;  1CUK A;  3H4J A;  1IXS A;  2OOB A;  3GLH E;  2MR9 A;  3LCV B;  3T6P A;  2HAK A;  1TTE A;  1OQY A;  2DZL A;  3GLI E;  1HQY E;  1C7Y A;  2L2D A;  2KNZ A;  1IFY A;  2LTU A;  2JUJ A;  2JY5 A;  2JZ1 A;  1T43 A;  2B3T A;  3MMP A;  1AIP C;  2R0I A;  3IEC A;  1V92 A;  1TR8 A;  2DHY A;  1PGY A;  1G41 A;  3F92 A;  1NV8 A;  2RRU A;  2CP8 A;  4HEO A;  2EKK A;  1G4A E;  2QSF X;  1SG9 A;  2OOA A;  3K9P A;  2EJS A;  2ZTD A;  2CWB A;  2KHH A;  1IM2 A;  1ZMU A;  2DAE A;  5DFL A; 
#chains in the Genus database with same CATH topology
 3U61 A;  1SXJ A;  4DV4 M;  3AOG A;  3CF6 E;  1QZE A;  2H5X A;  5IZ7 D;  1TDZ A;  3I4Y A;  1GL7 A;  4FWH A;  1J09 A;  1PJS A;  3KVW A;  1WHC A;  3GLI B;  4NSO B;  1OAO C;  5E26 A;  4LF6 M;  3GLF E;  3GRU A;  4F1I A;  1OFH A;  3W0L B;  4M9Z A;  3NWL A;  3BOS A;  5EP1 A;  1N36 M;  4GKK M;  4AG6 A;  3H4M A;  1D0L A;  4PT5 A;  4CJ6 A;  2ZM6 M;  4GMQ A;  5EXX A;  1WXQ A;  1HNW M;  1Z5C A;  2DWZ B;  4NL4 H;  2WSC F;  2OQ4 A;  1Q39 A;  2H1R A;  4GEW A;  4L4U A;  4Z8X A;  4I81 A;  4DV1 M;  5DYG A;  3FYC A;  1R2Y A;  1QAM A;  5EP2 A;  3L25 A;  3EIE A;  5KPT A;  3UGJ A;  2Z4R A;  1HT2 E;  4IBI A;  2P5T A;  2FE8 A;  1I94 M;  1G71 A;  3J80 S;  1NJG A;  2O01 F;  2Y0Q A;  2BNK A;  1K82 A;  4MGZ E;  2MGW A;  2R44 A;  4ITQ A;  1F4I A;  2HHH M;  2LBC A;  2LVP C;  4IBF A;  5DYI A;  4Z6Y A;  3GPP A;  2F5N A;  3KDS E;  1LV7 A;  4HL4 A;  4JV5 M;  1SXJ E;  1TDH A;  1YLA A;  3SHF A;  4PCZ A;  2NQ8 C;  4FCT A;  4R71 A;  4S12 A;  2JP7 A;  3ZH9 B;  3K1J A;  2VF8 A;  4DR2 M;  1YE9 A;  2C99 A;  1L8Q A;  2LVQ D;  1QUS A;  3JR4 A;  2E5L M;  4OU7 A;  1V34 A;  2KDL A;  1BVS A;  3V76 A;  3SBJ A;  2XH9 A;  1GO5 A;  4XK8 F;  1WR1 B;  3E21 A;  4DV5 M;  2C96 A;  4JI7 M;  3ZQJ A;  2CEA A;  3D8L A;  5L8R F;  2JXN A;  4W5W A;  3FUU A;  4LF7 M;  2K47 A;  3PFI A;  4Y28 F;  2Z3X A;  1R5L A;  2K6B A;  2KW0 A;  3LCU A;  1QVR A;  4G4O A;  2X8A A;  3SHG B;  3HY5 A;  3FTE A;  2ZTC A;  4REZ A;  5FTM A;  4G4N A;  1Q02 A;  4YY3 M;  3C3D A;  1MJG M;  2J5Y A;  1PM5 A;  2O25 A;  3J7A S;  3HJS A;  3AOE C;  1JB0 F;  4GIP A;  2VF7 A;  3L27 A;  3QAU A;  4OW0 A;  4MH0 E;  1J7K A;  2KNV A;  5EP3 A;  3C9P A;  1GJS A;  1Z5B A;  3VKG A;  3TL4 X;  3KOX E;  2N35 A;  2OOB A;  5C18 A;  3K2L A;  1OFI A;  2MR9 A;  3VDP A;  1HNZ M;  2DZL A;  3GLI E;  1N78 A;  3HHY A;  1Z59 A;  3SAT A;  1C7Y A;  2L2D A;  4FWD A;  3U60 B;  1NNJ A;  5LMU M;  3HU2 A;  3HU1 A;  4JI5 M;  4M9S A;  2LTU A;  4JI4 M;  2R65 A;  3FUT A;  1T43 A;  3HKP A;  4NRV A;  4ZPX A;  2MH8 A;  5A2Q S;  3BXW A;  4JYA M;  3K92 A;  3IEC A;  5FLX S;  3WHK A;  2VQF M;  3RGS A;  1N77 A;  3F92 A;  2Y20 A;  2V1U A;  2D7H A;  4GHA A;  3CTW B;  2FOI C;  3M6A A;  4HEO A;  3UZU A;  4LJ8 A;  2CV1 A;  1G4A E;  3GQ3 A;  4G4Q A;  3KSJ A;  4PDG A;  2F5O A;  3SAR A;  4HLQ A;  1ZMU A;  4GIT A;  2C98 A;  4M0W A;  5ITY A;  2L09 A;  1SXJ C;  2F4V M;  2ZAM A;  3GLF A;  4WUR A;  2LWX A;  2ZBK B;  2K0B X;  3U6S A;  4KOD A;  3CF0 A;  2XLJ A;  1GVN A;  4II7 A;  3L26 A;  3GLH B;  4G3O A;  1L2B A;  3TWL A;  3TWM A;  1QAQ A;  1PJI A;  2KA6 B;  2OPF A;  3SAS A;  1QAN A;  2CE7 A;  1EFU B;  4LY6 A;  1DO0 A;  4IJE A;  2RGO A;  1I4W A;  3JAM S;  1SXJ D;  1PJQ A;  3LVV A;  1VEK A;  2J7O A;  3J27 B;  2EA0 A;  2DAM A;  3PNV A;  3NBI A;  2KRK A;  1J5E M;  4LCB A;  4KHP M;  3QWL A;  1WGL A;  1V33 A;  2OO9 A;  4DV0 M;  4LF5 M;  1W5S A;  3FYD A;  1TF0 B;  1E94 E;  3W68 A;  5EXP A;  3U6L A;  2W82 A;  1PRB A;  5KPZ A;  1PJT A;  3OTO M;  5FTK A;  2R4E A;  4LRT A;  2R6F A;  1S3S A;  2QBY B;  1P3Q Q;  3U6D A;  3QYE A;  3VKH A;  5FSW A;  3SAW A;  1A5T A;  1OJL A;  1N33 M;  1DGF A;  1Y8G A;  2CV0 A;  2AHM A;  4X65 M;  1ZMW A;  2GQF A;  1JR3 E;  2R4J A;  4X66 M;  1WJ7 A;  3GRY A;  1L1Z A;  2LHG A;  1IBM M;  4LGM A;  4B3S M;  8CAT A;  4OX9 M;  1FNN A;  1R7R A;  2VDB B;  3CGW A;  4L16 A;  4JI3 M;  3HZJ A;  1EE8 A;  1FJG M;  1DGH B;  2KZU A;  4DV7 M;  1XMO M;  1XMQ M;  1K3X A;  2X49 A;  1ZV1 A;  3UMM A;  1TH2 A;  2F5Q A;  4DR4 M;  1DGG A;  2M5Z A;  2APL A;  4CIZ A;  1IXZ A;  3AFH A;  4QNR A;  2VQE M;  5ITR A;  4DV3 M;  3R9X B;  3B9P A;  2XEP A;  1L1T A;  2DWM A;  2JA2 A;  3I51 A;  2DHR A;  2I7P A;  2BWE A;  4BLC A;  4NOO B;  2LHC A;  3RFW A;  4JXJ A;  4DR7 M;  2HWJ A;  3KP0 E;  3SAU A;  3K8Z A;  3CF2 A;  2EO2 A;  1W5T A;  4R3D A;  3U6C A;  2QBY A;  3SMP A;  4AZF A;  4CIS A;  4PDI A;  3GLI A;  1NHG C;  1MN3 A;  1OIP A;  5FTN A;  2HKJ A;  4QNM A;  3GLH E;  4LJ4 A;  3HHW A;  1NVM A;  1TTE A;  3VDU A;  1QUT A;  5IRE B;  2YR0 A;  1HQY E;  2CFO A;  1QYR A;  3GRV A;  5IT9 S;  2KNZ A;  4QHS A;  3W67 A;  5C1B A;  1GL6 A;  1HR0 M;  2JUJ A;  2JY5 A;  3MMP A;  2B3T A;  3U6P A;  2R0I A;  1NHW C;  4JI0 M;  4X62 M;  1X37 A;  2DHY A;  4JN6 A;  5EXT A;  1L2D A;  4L15 A;  1PGY A;  5BR8 M;  1TH4 A;  3TPZ A;  3U6M A;  2C9O A;  2RRU A;  3VFD A;  2UUC M;  3KFU G;  2XF3 A;  1E9R A;  1IN4 A;  1NY6 A;  3IG8 A;  1IQP A;  3LQR A;  4M9X A;  1IBK M;  5BPV A;  3U6O A;  4G6Z A;  3THG A;  4LFC M;  3KXE C;  2EJS A;  1N75 A;  2KHH A;  1IM2 A;  4DR1 M;  2I7N A;  2Z4S A;  3PVS A;  4KO8 A;  5FTJ A;  4LF4 M;  3RGP A;  4LJA A;  3KSX A;  3B7N A;  4DR6 M;  3MJ5 A;  4FVM A;  3HJQ A;  3FKE A;  4IBB A;  2YQZ A;  1YSY A;  4I5S A;  2BWB A;  3GO8 A;  3FE3 A;  3DZD A;  5EQT A;  3ZCB B;  3FRI A;  3M0E A;  3TQS A;  1XC8 A;  2DVW B;  4NXM M;  2WSE F;  3U6E A;  5JI3 E;  2JY6 B;  3SC3 A;  3WHL A;  2D7G A;  5FTL A;  3IHP A;  2C9C A;  1NSF A;  1VEG A;  3HU3 A;  4UN2 B;  4B3T M;  4JI6 M;  1G3I A;  1JQJ C;  2WZJ A;  3K9O A;  1HJP A;  4AKI A;  2KEB A;  1VG5 A;  4FD2 A;  1K3W A;  4OVZ B;  4GHL A;  3T1Y M;  4WP2 A;  5KO3 A;  1T3T A;  2JNH A;  1KYI A;  4GH9 A;  4P17 A;  1VQ1 A;  4GC9 A;  1H6U A;  2RGH A;  1EIJ A;  1JR3 A;  2DAG A;  3T38 A;  4AG5 A;  3JR5 A;  1NJF A;  5DNY A;  1KFV A;  1IN6 A;  2KNA A;  4YHH M;  1DO2 A;  2V1C A;  3ZC7 B;  2MJ5 B;  1IBL M;  1XXH B;  4X64 M;  3B7Z A;  2JY8 A;  3J81 S;  1N34 M;  3LQQ A;  2CRU A;  1ZAE A;  1IY1 A;  2Q2E B;  3I01 M;  1GJT A;  3VLF B;  5ITT A;  3GPY A;  4L8R C;  4RNA A;  5KPR A;  3L2A A;  1UFZ A;  3U60 A;  1QDR A;  4NXN M;  4L78 A;  1GAB A;  4G4R A;  1DV0 A;  2X4A A;  5H37 D;  4PD2 A;  3D8B A;  1XNQ M;  2KXE A;  4WW0 A;  2EKF A;  3FTD A;  1GLN A;  3SYK A;  2DEN A;  3FD9 A;  4LJ9 A;  3GQ5 A;  4DUY M;  4IBG A;  1IXR C;  2DNA A;  2Z7J A;  2XSZ A;  1HNX M;  1NV9 A;  3I4V A;  1TGU A;  3DOA A;  1G8P A;  3HX3 A;  3NBX X;  2DAK A;  4XGI A;  1VEJ A;  2LVA A;  4D80 A;  4LG2 A;  3LMM A;  3Q8X A;  2JY7 A;  4AKG A;  2JZ0 A;  4LFB M;  3GLH A;  1OAI A;  4XBO A;  3Q8G A;  2DKL A;  5EXS A;  4IJF A;  4B7F A;  2ZAN A;  2DZO B;  1Q3C A;  2LXE A;  5KQD A;  5ITU A;  3E4R A;  4A3V B;  5EJC A;  3I04 M;  4IBC A;  3UK6 A;  2YNM D;  1CUK A;  4MGH A;  4LZJ A;  3H4J A;  2CUZ A;  2XGN A;  3LCV B;  1IN8 A;  2O5R A;  2M60 A;  3T6P A;  2HAK A;  1LTM A;  1ORY B;  1IY0 A;  2DWN A;  2LH0 A;  3KP1 E;  3LVW A;  2RKO A;  4FWG A;  3FUV A;  3TE6 A;  3HHX A;  4AW4 A;  4DR3 M;  1L2C A;  3FUW A;  1GKI A;  2R46 A;  2JZ1 A;  4NC6 A;  4RF0 A;  2R62 A;  3GLG B;  4DV2 M;  2Y0T A;  1KSF X;  1V92 A;  4R7G A;  1XHB A;  4FCV A;  1NY5 A;  3T1H M;  3PNY A;  3KS8 A;  4K0K M;  4B7H A;  3DA1 A;  4JI1 M;  3MHV C;  3GPX A;  1MX0 A;  2QSF X;  3SMS A;  4TUW A;  1SG9 A;  5EP4 A;  5ITX A;  2OOA A;  1XNR M;  4AKH A;  2XZF A;  2L7I A;  1QQW A;  2Y21 A;  3IG5 A;  3GP1 A;  2CWB A;  4B7G A;  2FH0 A;  2DAE A;  1HQC A;  1R2Z A;  2HL7 A;  4MGY E;  3L29 A;  4FW9 A;  3GPU A;  4CGY B;  4IBE A;  2A5Y B;  4GC5 A;  3SYL A;  4LJ5 A;  4L6V 6;  4I8O A;  1G59 A;  1XXH E;  4DBG B;  1DGH A;  4LF9 M;  1ZMV A;  4D81 A;  1YUB A;  2UXB M;  1QAO A;  3KOW E;  2CV2 A;  2UUB M;  4Q7J A;  2GNO A;  2QZ4 A;  1UM8 A;  2KZS A;  2ERC A;  3A45 A;  2K9D A;  3KOY E;  5LMN M;  1D0K A;  4AQY M;  3J7B A;  1R6B X;  1Q3B A;  2QEN A;  3GLG A;  2DWL A;  4BBA A;  4KT0 F;  1D2N A;  3AKZ A;  1ZQ9 A;  4LFA M;  2R18 A;  3BBZ A;  1Z6T A;  1R4G A;  1E9S A;  4IBD A;  3M7G A;  3FRH A;  2V6Z M;  3A98 B;  4IIW A;  2QHO B;  2L6O A;  2Z8Y M;  4P16 A;  4RF1 A;  3RE8 A;  3HHZ A;  1XB2 B;  5ITX E;  3DFZ A;  5ITQ A;  3ILK A;  1IY2 A;  1OTR A;  2CHG A;  3HGI A;  1HT1 E;  2G8L A;  1IN5 A;  1AUA A;  2DI0 A;  1VDL A;  4DV6 M;  2QPA A;  1PJJ A;  3AJI B;  3VK7 A;  4EIW A;  5JI2 E;  3GQ4 A;  2XZU A;  4M0D A;  1JR3 D;  1WGN A;  1IXS B;  1T6O A;  7CAT A;  3U5Z B;  2C5R A;  2QP9 X;  3GLF B;  2LNH C;  2UU9 M;  3C3E A;  3R8F A;  2MRO B;  3LW5 F;  5F3W A;  4CHT B;  4KLN A;  2ZAO A;  1QZM A;  3AL0 C;  3KOZ E;  4RKU F;  3KS4 A;  4LJ6 A;  4BB9 A;  1VDD A;  3U6Q A;  2QQ8 A;  4MB7 A;  4GKJ M;  2L4E A;  4ANR A;  2UUA M;  1OIZ A;  1NO1 A;  1WIV A;  2D7E A;  2FNA A;  2HCB A;  2L4F A;  3B74 A;  1IN7 A;  3QYB A;  4B08 A;  1N32 M;  3MK6 A;  3W0F A;  4DR5 M;  2DAI A;  3GLG E;  2BJW A;  4NSR A;  2F5S A;  4F2L A;  3J2P B;  4LZZ A;  2DZN B;  2LVN C;  2DXI A;  4GRI A;  3L28 A;  2CHQ A;  3B7Q A;  4LRS A;  2EUC A;  2LVO C;  3VK8 A;  1RU3 A;  2QNJ A;  4I4L A;  4MGI E;  2J7N A;  4QHT A;  2FFJ A;  2R45 A;  4JI2 M;  1OKS A;  4NRW A;  2UXC M;  3T15 A;  4JI8 M;  5GKN A;  3U61 B;  1SXJ B;  2XSZ D;  3B89 A;  3E46 A;  1Z5A A;  3EIH A;  3AOE A;  2XFT A;  3UJN A;  4IBJ A;  2G3Q A;  2JWS A;  3PXG A;  1DGB A;  3A42 A;  1IXS A;  3FTF A;  3U5Z A;  3FTC A;  1C1K A;  3HWS A;  1MU5 A;  1OQY A;  1NNU C;  4IBK A;  4LJ7 A;  2FS1 A;  2F5P A;  2XFS A;  2WSF F;  4B3M M;  1IFY A;  3SAV A;  2QCU A;  3TWK A;  1TH3 A;  4OVZ A;  4QOZ C;  3AV0 A;  1D0M A;  2CHV A;  1AIP C;  3SFZ A;  5IWA M;  4B3R M;  1TR8 A;  2G5G X;  1E32 A;  4DUZ M;  2YFQ A;  3FUX A;  1G41 A;  3C58 A;  4AI6 A;  4LGY A;  1NV8 A;  3KW6 A;  2CP8 A;  4LF8 M;  3E9S A;  1QDT A;  5E6J A;  2UXD M;  2EKK A;  3A46 A;  3GRR A;  3K9P A;  2L7H A;  1XXH A;  2BJV A;  2ZTD A;  5KQ8 A;  4QOS A;  4FCW A;  2VII A;  4MGK E;  4D82 A;  3HJ8 A;  5DFL A;  1XWI A;  4MM3 B;  2KRU A; 
#chains in the Genus database with same CATH homology
 2K0B X;  4G3O A;  1XXH E;  1QZE A;  2H5X A;  4DBG B;  1ZMV A;  2BWB A;  3FE3 A;  1WHC A;  3FRI A;  1EFU B;  3GLF E;  1DO0 A;  4F1I A;  2JY6 B;  1VEK A;  4Q7J A;  3IHP A;  2DAM A;  2K9D A;  1VEG A;  4UN2 B;  1G3I A;  2WZJ A;  3K9O A;  4GEW A;  1HJP A;  1WGL A;  1VG5 A;  2OO9 A;  3BBZ A;  4WP2 A;  2JNH A;  1E94 E;  1KYI A;  1R4G A;  1HT2 E;  1VQ1 A;  3FRH A;  2QHO B;  2DAG A;  1XB2 B;  1P3Q Q;  2KNA A;  2MGW A;  1F4I A;  1DO2 A;  1OTR A;  1HT1 E;  2MJ5 B;  1A5T A;  2DI0 A;  1Y8G A;  1VDL A;  2LBC A;  2LVP C;  5JI2 E;  1ZMW A;  1JR3 E;  2JY8 A;  1WJ7 A;  1YLA A;  1WGN A;  1T6O A;  2MRO B;  4R71 A;  2JP7 A;  1UFZ A;  1DV0 A;  2LVQ D;  1ZV1 A;  2L4E A;  2EKF A;  2L4F A;  1WIV A;  2DEN A;  1BVS A;  1GO5 A;  1WR1 B;  3E21 A;  2DNA A;  2DAI A;  3GLG E;  4F2L A;  2LVN C;  1NV9 A;  2BWE A;  2DAK A;  1VEJ A;  2LVA A;  2LVO C;  3LCU A;  2HWJ A;  2QNJ A;  2ZTC A;  1Q02 A;  1OKS A;  2JY7 A;  2JZ0 A;  1OAI A;  2O25 A;  3B89 A;  2DKL A;  3E46 A;  2KNV A;  1MN3 A;  2G3Q A;  1CUK A;  3H4J A;  1IXS A;  2OOB A;  3GLH E;  2MR9 A;  3LCV B;  3T6P A;  2HAK A;  1TTE A;  1OQY A;  2DZL A;  3GLI E;  1HQY E;  1C7Y A;  2L2D A;  2KNZ A;  1IFY A;  2LTU A;  2JUJ A;  2JY5 A;  2JZ1 A;  1T43 A;  2B3T A;  3MMP A;  1AIP C;  2R0I A;  3IEC A;  1V92 A;  1TR8 A;  2DHY A;  1PGY A;  1G41 A;  3F92 A;  1NV8 A;  2RRU A;  2CP8 A;  4HEO A;  2EKK A;  1G4A E;  2QSF X;  1SG9 A;  2OOA A;  3K9P A;  2EJS A;  2ZTD A;  2CWB A;  2KHH A;  1IM2 A;  1ZMU A;  2DAE A;  5DFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...