1OAIA

Complex between tap uba domain and fxfg nucleoporin peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear transport
molecule keywords NUCLEAR RNA EXPORT FACTOR
publication title Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oaiA00
3B89A 3H4JA 5DFLA 3GLFE 1OQYA 1XB2B 2EKKA 2QNJA 2HAKA 1HT1E 2MROB 1HT2E 4F2LA 1Q02A 4G3OA 1G3IA 4UN2B 2DAEA 2JY7A 1WJ7A 3GLHE 1P3QQ 2DENA 3LCVB 1ZMWA 2DAMA 2CP8A 2LVPC 1WGNA 2ZTDA 1VEJA 2DAKA 1T43A 1ZV1A 2DZLA 1TTEA 1HQYE 1T6OA 3IECA 1HJPA 2G3QA 1IXSA 1IFYA 2MGWA 2ZTCA 1VG5A 2H5XA 3E46A 1OKSA 2JUJA 1DO0A 1QZEA 2JP7A 3LCUA 2KNAA 2K9DA 2KNVA 3GLIE 1WGLA 1UFZA 2KHHA 2K0BX 2DNAA 2LVAA 1NV8A 1VEGA 4R71A 4GEWA 2CWBA 1WR1B 2JY6B 2BWEA 2QSFX 2MR9A 1VEKA 2WZJA 1KYIA 1WIVA 1ZMVA 1VQ1A 3FRHA 2O25A 1DV0A 2DI0A 4DBGB 1MN3A 2QHOB 1YLAA 2BWBA 2LVQD 1BVSA 3FE3A 1G41A 3T6PA 1Y8GA 2DKLA 1V92A 2R0IA 5JI2E 2L4FA 1DO2A 1WHCA 1TR8A 2DHYA 2JZ1A 3GLGE 1SG9A 1VDLA 1AIPC 2OOAA 3K9OA 1G4AE 4HEOA 4Q7JA 2L2DA 2LVOC 2OOBA 2OO9A 4F1IA 1CUKA 2LBCA 1PGYA 1R4GA 3F92A 2LTUA 2JY5A 1E94E 2DAGA 1JR3E 2EJSA 1IM2A 2RRUA 2JNHA 3BBZA 2MJ5B 1ZMUA 2EKFA 3MMPA 2B3TA 2LVNC 3FRIA 1OAIA 2DAIA 1EFUB 2HWJA 3E21A 1XXHE 2JY8A 3IHPA 1A5TA 2KNZA 4WP2A 1GO5A 2L4EA 1C7YA 1OTRA 2JZ0A 3K9PA 1NV9A 1F4IA
chains in the Genus database with same CATH superfamily
3FTCA 2D7HA 4MGIE 4D82A 1L2BA 3SARA 2GQFA 4QHTA 3U6QA 2EKKA 2QNJA 4B3RM 3GLIA 2CEAA 2I7NA 3PNYA 1V34A 4F2LA 1IXRC 1HT2E 4OX9M 3HU3A 4G3OA 4BB9A 2DAEA 2JY7A 3KVWA 4FWGA 3UGJA 2VQEM 1P3QQ 2DENA 2R4EA 4M9XA 3SYKA 1DGHB 1J09A 1W5SA 4DV2M 2CP8A 5FLXS 1WGNA 5ITQA 1T43A 1ZV1A 3U61B 1QQWA 1SXJB 1TTEA 4I8OA 4ANRA 3BXWA 1XNQM 4TUWA 2JXNA 1JB0F 1IXSA 2C98A 1IFYA 2ZTCA 3AJIB 3E46A 1XNRM 3T15A 1OKSA 4LF4M 3J27B 3ZH9B 3LCUA 5FTJA 2R46A 3U60A 2FOIC 2K9DA 1HR0M 1WGLA 1EIJA 1UFZA 2K0BX 2V1CA 2UU9M 2HL7A 3GLFB 2EO2A 4REZA 1SXJD 3J7AS 3SYLA 1MJGM 3FUTA 4JN6A 2X49A 2D7EA 5LMNM 2JY6B 1TH4A 2XSZA 2QSFX 4GIPA 1IN7A 3T1HM 1H6UA 3NWLA 4LRTA 2XLJA 1N75A 3I04M 4DV5M 4GKJM 2O25A 4A3VB 1QVRA 1YE9A 1JR3A 2DI0A 2G8LA 2QPAA 4W5WA 3SAVA 1YLAA 2UXCM 5H37D 3E9SA 5EXSA 4RKUF 2Z4SA 3J80S 2DKLA 2R0IA 4OVZA 4DV7M 1YUBA 2L4FA 7CATA 2L7HA 1QAOA 3HJ8A 1OIPA 1W5TA 3I01M 4DR1M 5IZ7D 2KRKA 1SG9A 2EUCA 2X4AA 1E32A 4WW0A 3TE6A 4B3SM 1G71A 1QZMA 4IBDA 2OOAA 4DV6M 2Y0TA 4LF8M 4DR7M 4LGMA 3J2PB 5DNYA 2X8AA 2DWMA 3SBJA 3AL0C 1GL6A 1EE8A 2LVOC 3HU2A 3KS4A 3SHGB 1TF0B 2J7OA 3GLIB 4AKGA 1Q3CA 2LBCA 2MH8A 3HX3A 4XGIA 1PGYA 3Q8XA 3TL4X 1R4GA 2DXIA 4IIWA 2DHRA 3RGPA 4DV1M 2FH0A 2JY5A 3U6OA 1YSYA 4NRWA 1DGHA 4L4UA 3KSXA 2M60A 4LY6A 3JR5A 1OFIA 3SFZA 1TH3A 2J7NA 1IY2A 4L6V6 1G8PA 1T3TA 4MGZE 2R44A 2ZM6M 1TDZA 1ZMUA 1D0MA 1SXJA 4BLCA 4CHTB 3U61A 3E4RA 1SXJE 2BJVA 3MMPA 3GPPA 3VK7A 2WSCF 1WXQA 1NY5A 4LJ9A 1IXSB 5KPTA 2UUBM 1J7KA 1EFUB 2KZSA 3T38A 3E21A 2JY8A 1D2NA 1A5TA 3IHPA 4WP2A 5ITRA 2E5LM 2N35A 5DYIA 3HJQA 5IREB 3U60B 1FJGM 3B74A 3BOSA 1NV9A 4QNMA 1F4IA 1QAQA 3B89A 4IBIA 3GLFE 3U6PA 4DV0M 1XB2B 2BJWA 4FW9A 3SATA 1ORYB 3UJNA 2HAKA 1R2ZA 4I81A 2VF8A 5KO3A 1Q02A 4CISA 4X66M 3AFHA 1NSFA 4GRIA 4XBOA 1WJ7A 2LXEA 2YFQA 4AZFA 4L8RC 3PXGA 4QNRA 4QOSA 4X62M 3M7GA 4NXMM 3KDSE 4LJ4A 4L78A 1I94M 1ZMWA 2DAMA 2LVPC 4JV5M 1VEJA 2LHGA 2C99A 4OVZB 3NBXX 1L8QA 5KPZA 2XSZD 4LRSA 3U6DA 5F3WA 1T6OA 3VKGA 2G3QA 2XFSA 3THGA 2DWZB 1NJFA 2YNMD 2HCBA 3A42A 3L29A 3UK6A 1DO0A 2K47A 4MGYE 2XH9A 1QZEA 2C9OA 5DYGA 1JR3D 3GLIE 4NXNM 3FUWA 1S3SA 4AKHA 3HWSA 2LVAA 2HHHM 1VEGA 2Y0QA 4R71A 3NBIA 4LGYA 4GEWA 4JXJA 3LW5F 3GPXA 2CUZA 2ZANA 3HHXA 2R65A 3GO8A 3HGIA 1WR1B 2APLA 3AKZA 3U6SA 2MR9A 1TDHA 3GQ5A 3A98B 2WZJA 2KXEA 4IBBA 4KLNA 3VKHA 1ZMVA 4YY3M 3JR4A 1HNXM 4LF9M 2R4JA 3QWLA 1OJLA 2VIIA 3AV0A 4M9ZA 2EA0A 3FRHA 3K8ZA 4B7FA 3K1JA 3U6MA 1IN5A 2Z3XA 1DV0A 1QDTA 2LVQD 4OW0A 4G4RA 3V76A 1R2YA 1KFVA 1NNJA 1VDDA 2OQ4A 3U5ZA 3HKPA 1OFHA 1TR8A 2JZ1A 3CGWA 4I4LA 4P17A 4FCVA 1GKIA 1V33A 2D7GA 2DWLA 3AOEC 4LF5M 1XXHA 4AI6A 3K9OA 1G4AE 3QYEA 1DGBA 1NHWC 4FCWA 2F5QA 1IN4A 2KA6B 3KFUG 3I4VA 1N34M 1CUKA 2QCUA 3C3EA 4JI4M 4KHPM 4DV3M 3VK8A 4K0KM 3SMSA 4CGYB 3SMPA 3GRVA 3GRUA 3L2AA 1E94E 1IY1A 2L6OA 3H4MA 1R7RA 5EP4A 1JR3E 2EJSA 1N32M 3BBZA 2ERCA 2XEPA 1Z5BA 3W0LB 4IBJA 5KPRA 2ZBKB 1L2DA 3DFZA 3GLHA 3FYDA 4AG6A 1R6BX 1DGFA 1ZQ9A 2W82A 1PJSA 4JI6M 3HU1A 5EP2A 3FTEA 1XC8A 2DAIA 4G4NA 3KW6A 1K3XA 3KS8A 4II7A 2KNZA 3DA1A 2RGHA 5EJCA 3GPUA 3TWKA 2CE7A 3K9PA 4OU7A 4X64M 1GJSA 1XHBA 1XWIA 2DZNB 1NO1A 2BNKA 4DUYM 3HHWA 4LJ6A 3UZUA 5DFLA 2JA2A 3U6LA 2F5NA 3L27A 4JI1M 2LHCA 4JI3M 5BR8M 2MROB 2YR0A 1IXZA 4R7GA 3UMMA 2Q2EB 1G3IA 2JWSA 2FNAA 3KXEC 3J81S 4GHLA 1TGUA 2WSFF 3VLFB 5LMUM 2H1RA 3QYBA 3U6CA 3KP1E 2I7PA 4IBGA 4DV4M 3CTWB 2DAKA 4NSRA 4DR2M 5ITTA 3U5ZB 4HLQA 1PM5A 1HQYE 3A46A 2A5YB 1GVNA 4LJAA 3MHVC 2C9CA 3IECA 1HJPA 3GQ4A 1NHGC 4QOZC 1XXHB 1MU5A 1J5EM 5ITXA 2V1UA 5FTKA 1C1KA 5GKNA 4EIWA 4Y28F 2JP7A 5FTNA 2KNAA 3RFWA 3FUXA 4NSOB 2KNVA 2J5YA 2KEBA 2KHHA 4YHHM 3GLGA 2F5SA 4P16A 1X37A 2XFTA 2DNAA 2LNHC 1NV8A 4M9SA 3W67A 2Z7JA 3CF6E 2R62A 2FE8A 2P5TA 3LVWA 2C5RA 2CWBA 4NC6A 4KODA 3FYCA 1SXJC 5BPVA 4LF7M 1QUTA 2XF3A 4GH9A 3RGSA 3GP1A 1WIVA 4B3MM 2XZFA 5A2QS 1ZAEA 3GLHB 4RF1A 4GITA 1OAOC 3ILKA 4PDGA 3GQ3A 8CATA 2R18A 3L28A 4L15A 1N36M 2BWBA 3C3DA 2QQ8A 1G41A 3T6PA 2YQZA 5JI2E 4AQYM 1NJGA 3LQRA 1PJIA 4PCZA 2L09A 1L2CA 4MGHA 1WHCA 1IY0A 4NRVA 1TH2A 2DHYA 1N78A 2O01F 4LJ5A 1VDLA 4AG5A 1AIPC 2DWNA 2R6FA 3L26A 1HNZM 1N77A 3GRRA 4M0DA 5ITYA 4Q7JA 2GNOA 4LZZA 5IWAM 2CRUA 2C96A 2OO9A 1E9SA 3MJ5A 4F1IA 2CHVA 3PFIA 3C9PA 2CV1A 1GLNA 3TWLA 3SAWA 2KDLA 4FCTA 1FNNA 2XGNA 3EIEA 2LTUA 1Q3BA 5EXTA 1QDRA 1N33M 1AUAA 1D0LA 2DAGA 4LZJA 1Z6TA 3GRYA 3AOEA 2RRUA 2JNHA 4IJEA 4PD2A 2QBYB 2HKJA 2MJ5B 3K92A 4D81A 4S12A 5EXXA 4MH0E 4MM3B 1K82A 4DR6M 1PRBA 4LG2A 3SASA 2Y21A 2CV2A 3LQQA 2B3TA 2CFOA 3KP0E 2O5RA 3LVVA 4Z8XA 4LJ7A 3SC3A 1XMQM 1PJJA 2UUCM 1LTMA 2HWJA 3M6AA 4G4OA 3VFDA 1XXHE 2V6ZM 3A45A 4RF0A 5KQDA 4NL4H 1I4WA 3HHZA 4AKIA 4JI2M 2L4EA 1C7YA 3TWMA 5FTMA 1OTRA 2QP9X 4XK8F 3GLGB 1UM8A 4GC9A 4DR4M 4JI7M 1Z5AA 3CF0A 3B7ZA 3KOYE 1DGGA 4JYAM 4GKKM 3WHKA 1IQPA 3CF2A 3H4JA 1OQYA 2M5ZA 3PVSA 3JAMS 1QYRA 2UUAM 3QAUA 1NNUC 3ZCBB 3M0EA 1HT1E 2VF7A 5JI3E 2VQFM 4ITQA 4JI5M 2XZUA 4LFCM 2AHMA 4UN2B 3B7NA 1HQCA 3TQSA 2QENA 3DZDA 4LF6M 4NOOB 4PT5A 4DR3M 3GLHE 1NVMA 5EP3A 2NQ8C 3FTFA 3LCVB 3VDPA 4B08A 4FWHA 4FVMA 1K3WA 1PJTA 1Q39A 3PNVA 4FD2A 2ZTDA 3R8FA 3W0FA 2DZOB 4MB7A 2Z8YM 4GMQA 3AOGA 2UXDM 2DZLA 2RKOA 3IG8A 2KZUA 5EXPA 5L8RF 1IBMM 3KSJA 4LFBM 3IG5A 2MGWA 1QANA 1VG5A 1RU3A 2H5XA 2Z4RA 3SHFA 1G59A 2JUJA 1L1TA 3ZC7B 4CIZA 2F5PA 2KRUA 4IBKA 1GABA 5E6JA 1HNWM 4MGKE 1D0KA 1Z5CA 4IJFA 1IBLM 4ZPXA 3GPYA 5C1BA 4G6ZA 3R9XB 4R3DA 3FKEA 2VDBB 1JQJC 4HL4A 3LMMA 4IBFA 5IT9S 2CV0A 3RE8A 3DOAA 1GL7A 3Q8GA 4LJ8A 3W68A 2LH0A 2UXBM 2BWEA 2QBYA 1VEKA 2RGOA 1KYIA 3U6EA 1Z59A 1VQ1A 2QZ4A 4FWDA 2FFJA 3C58A 3ZQJA 3TPZA 4KT0F 1GJTA 1E9RA 2OPFA 4DBGB 1R5LA 1MN3A 2QHOB 1PJQA 4B7HA 1BVSA 3FE3A 2CHQA 5ITXE 1Y8GA 4AW4A 1V92A 3I4YA 4X65M 1XMOM 2F5OA 3MK6A 2K6BA 1DO2A 4PDIA 4G4QA 3K2LA 3VDUA 3GLGE 4GC5A 4GHAA 1LV7A 2L7IA 4RNAA 3FTDA 4KO8A 4WURA 1MX0A 4DUZM 1OIZA 4HEOA 1IN6A 3I51A 1NY6A 2KW0A 2L2DA 2OOBA 2ZAMA 1L1ZA 3HZJA 3FUUA 3SAUA 3FUVA 2R45A 3HHYA 3EIHA 4BBAA 1QAMA 3F92A 4L16A 2CHGA 5E26A 3GLFA 3WHLA 2Y20A 5ITUA 2FS1A 4JI0M 3OTOM 1IM2A 3KOZE 3B7QA 4IBEA 3KOXE 2G5GX 4B7GA 5EQTA 4IBCA 4DR5M 2DVWB 5EP1A 4JI8M 2ZAOA 1QUSA 4D80A 3T1YM 4LFAM 3KOWE 1IN8A 4CJ6A 2EKFA 4LCBA 3D8LA 2LVNC 3FRIA 1OAIA 3HJSA 3J7BA 5C18A 5KQ8A 1IBKM 3D8BA 1KSFX 4B3TM 3FD9A 5FSWA 2F4VM 1GO5A 4I5SA 3B9PA 4M0WA 3L25A 3HY5A 2JZ0A 2WSEF 5FTLA 2LWXA 4QHSA 4Z6YA
chains in the Genus database with same CATH topology
3B89A 3H4JA 5DFLA 3GLFE 1OQYA 1XB2B 2EKKA 2QNJA 2HAKA 1HT1E 2MROB 1HT2E 4F2LA 1Q02A 4G3OA 1G3IA 4UN2B 2DAEA 2JY7A 1WJ7A 3GLHE 1P3QQ 2DENA 3LCVB 1ZMWA 2DAMA 2CP8A 2LVPC 1WGNA 2ZTDA 1VEJA 2DAKA 1T43A 1ZV1A 2DZLA 1TTEA 1HQYE 1T6OA 3IECA 1HJPA 2G3QA 1IXSA 1IFYA 2MGWA 2ZTCA 1VG5A 2H5XA 3E46A 1OKSA 2JUJA 1DO0A 1QZEA 2JP7A 3LCUA 2KNAA 2K9DA 2KNVA 3GLIE 1WGLA 1UFZA 2KHHA 2K0BX 2DNAA 2LVAA 1NV8A 1VEGA 4R71A 4GEWA 2CWBA 1WR1B 2JY6B 2BWEA 2QSFX 2MR9A 1VEKA 2WZJA 1KYIA 1WIVA 1ZMVA 1VQ1A 3FRHA 2O25A 1DV0A 2DI0A 4DBGB 1MN3A 2QHOB 1YLAA 2BWBA 2LVQD 1BVSA 3FE3A 1G41A 3T6PA 1Y8GA 2DKLA 1V92A 2R0IA 5JI2E 2L4FA 1DO2A 1WHCA 1TR8A 2DHYA 2JZ1A 3GLGE 1SG9A 1VDLA 1AIPC 2OOAA 3K9OA 1G4AE 4HEOA 4Q7JA 2L2DA 2LVOC 2OOBA 2OO9A 4F1IA 1CUKA 2LBCA 1PGYA 1R4GA 3F92A 2LTUA 2JY5A 1E94E 2DAGA 1JR3E 2EJSA 1IM2A 2RRUA 2JNHA 3BBZA 2MJ5B 1ZMUA 2EKFA 3MMPA 2B3TA 2LVNC 3FRIA 1OAIA 2DAIA 1EFUB 2HWJA 3E21A 1XXHE 2JY8A 3IHPA 1A5TA 2KNZA 4WP2A 1GO5A 2L4EA 1C7YA 1OTRA 2JZ0A 3K9PA 1NV9A 1F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B89 A;  3H4J A;  5DFL A;  3GLF E;  1OQY A;  1XB2 B;  2EKK A;  2QNJ A;  2HAK A;  1HT1 E;  2MRO B;  1HT2 E;  4F2L A;  1Q02 A;  4G3O A;  1G3I A;  4UN2 B;  2DAE A;  2JY7 A;  1WJ7 A;  3GLH E;  1P3Q Q;  2DEN A;  3LCV B;  1ZMW A;  2DAM A;  2CP8 A;  2LVP C;  1WGN A;  2ZTD A;  1VEJ A;  2DAK A;  1T43 A;  1ZV1 A;  2DZL A;  1TTE A;  1HQY E;  1T6O A;  3IEC A;  1HJP A;  2G3Q A;  1IXS A;  1IFY A;  2MGW A;  2ZTC A;  1VG5 A;  2H5X A;  3E46 A;  1OKS A;  2JUJ A;  1DO0 A;  1QZE A;  2JP7 A;  3LCU A;  2KNA A;  2K9D A;  2KNV A;  3GLI E;  1WGL A;  1UFZ A;  2KHH A;  2K0B X;  2DNA A;  2LVA A;  1NV8 A;  1VEG A;  4R71 A;  4GEW A;  2CWB A;  1WR1 B;  2JY6 B;  2BWE A;  2QSF X;  2MR9 A;  1VEK A;  2WZJ A;  1KYI A;  1WIV A;  1ZMV A;  1VQ1 A;  3FRH A;  2O25 A;  1DV0 A;  2DI0 A;  4DBG B;  1MN3 A;  2QHO B;  1YLA A;  2BWB A;  2LVQ D;  1BVS A;  3FE3 A;  1G41 A;  3T6P A;  1Y8G A;  2DKL A;  1V92 A;  2R0I A;  5JI2 E;  2L4F A;  1DO2 A;  1WHC A;  1TR8 A;  2DHY A;  2JZ1 A;  3GLG E;  1SG9 A;  1VDL A;  1AIP C;  2OOA A;  3K9O A;  1G4A E;  4HEO A;  4Q7J A;  2L2D A;  2LVO C;  2OOB A;  2OO9 A;  4F1I A;  1CUK A;  2LBC A;  1PGY A;  1R4G A;  3F92 A;  2LTU A;  2JY5 A;  1E94 E;  2DAG A;  1JR3 E;  2EJS A;  1IM2 A;  2RRU A;  2JNH A;  3BBZ A;  2MJ5 B;  1ZMU A;  2EKF A;  3MMP A;  2B3T A;  2LVN C;  3FRI A;  1OAI A;  2DAI A;  1EFU B;  2HWJ A;  3E21 A;  1XXH E;  2JY8 A;  3IHP A;  1A5T A;  2KNZ A;  4WP2 A;  1GO5 A;  2L4E A;  1C7Y A;  1OTR A;  2JZ0 A;  3K9P A;  1NV9 A;  1F4I A; 
#chains in the Genus database with same CATH topology
 3FTC A;  2D7H A;  4MGI E;  4D82 A;  1L2B A;  3SAR A;  2GQF A;  4QHT A;  3U6Q A;  2EKK A;  2QNJ A;  4B3R M;  3GLI A;  2CEA A;  2I7N A;  3PNY A;  1V34 A;  4F2L A;  1IXR C;  1HT2 E;  4OX9 M;  3HU3 A;  4G3O A;  4BB9 A;  2DAE A;  2JY7 A;  3KVW A;  4FWG A;  3UGJ A;  2VQE M;  1P3Q Q;  2DEN A;  2R4E A;  4M9X A;  3SYK A;  1DGH B;  1J09 A;  1W5S A;  4DV2 M;  2CP8 A;  5FLX S;  1WGN A;  5ITQ A;  1T43 A;  1ZV1 A;  3U61 B;  1QQW A;  1SXJ B;  1TTE A;  4I8O A;  4ANR A;  3BXW A;  1XNQ M;  4TUW A;  2JXN A;  1JB0 F;  1IXS A;  2C98 A;  1IFY A;  2ZTC A;  3AJI B;  3E46 A;  1XNR M;  3T15 A;  1OKS A;  4LF4 M;  3J27 B;  3ZH9 B;  3LCU A;  5FTJ A;  2R46 A;  3U60 A;  2FOI C;  2K9D A;  1HR0 M;  1WGL A;  1EIJ A;  1UFZ A;  2K0B X;  2V1C A;  2UU9 M;  2HL7 A;  3GLF B;  2EO2 A;  4REZ A;  1SXJ D;  3J7A S;  3SYL A;  1MJG M;  3FUT A;  4JN6 A;  2X49 A;  2D7E A;  5LMN M;  2JY6 B;  1TH4 A;  2XSZ A;  2QSF X;  4GIP A;  1IN7 A;  3T1H M;  1H6U A;  3NWL A;  4LRT A;  2XLJ A;  1N75 A;  3I04 M;  4DV5 M;  4GKJ M;  2O25 A;  4A3V B;  1QVR A;  1YE9 A;  1JR3 A;  2DI0 A;  2G8L A;  2QPA A;  4W5W A;  3SAV A;  1YLA A;  2UXC M;  5H37 D;  3E9S A;  5EXS A;  4RKU F;  2Z4S A;  3J80 S;  2DKL A;  2R0I A;  4OVZ A;  4DV7 M;  1YUB A;  2L4F A;  7CAT A;  2L7H A;  1QAO A;  3HJ8 A;  1OIP A;  1W5T A;  3I01 M;  4DR1 M;  5IZ7 D;  2KRK A;  1SG9 A;  2EUC A;  2X4A A;  1E32 A;  4WW0 A;  3TE6 A;  4B3S M;  1G71 A;  1QZM A;  4IBD A;  2OOA A;  4DV6 M;  2Y0T A;  4LF8 M;  4DR7 M;  4LGM A;  3J2P B;  5DNY A;  2X8A A;  2DWM A;  3SBJ A;  3AL0 C;  1GL6 A;  1EE8 A;  2LVO C;  3HU2 A;  3KS4 A;  3SHG B;  1TF0 B;  2J7O A;  3GLI B;  4AKG A;  1Q3C A;  2LBC A;  2MH8 A;  3HX3 A;  4XGI A;  1PGY A;  3Q8X A;  3TL4 X;  1R4G A;  2DXI A;  4IIW A;  2DHR A;  3RGP A;  4DV1 M;  2FH0 A;  2JY5 A;  3U6O A;  1YSY A;  4NRW A;  1DGH A;  4L4U A;  3KSX A;  2M60 A;  4LY6 A;  3JR5 A;  1OFI A;  3SFZ A;  1TH3 A;  2J7N A;  1IY2 A;  4L6V 6;  1G8P A;  1T3T A;  4MGZ E;  2R44 A;  2ZM6 M;  1TDZ A;  1ZMU A;  1D0M A;  1SXJ A;  4BLC A;  4CHT B;  3U61 A;  3E4R A;  1SXJ E;  2BJV A;  3MMP A;  3GPP A;  3VK7 A;  2WSC F;  1WXQ A;  1NY5 A;  4LJ9 A;  1IXS B;  5KPT A;  2UUB M;  1J7K A;  1EFU B;  2KZS A;  3T38 A;  3E21 A;  2JY8 A;  1D2N A;  1A5T A;  3IHP A;  4WP2 A;  5ITR A;  2E5L M;  2N35 A;  5DYI A;  3HJQ A;  5IRE B;  3U60 B;  1FJG M;  3B74 A;  3BOS A;  1NV9 A;  4QNM A;  1F4I A;  1QAQ A;  3B89 A;  4IBI A;  3GLF E;  3U6P A;  4DV0 M;  1XB2 B;  2BJW A;  4FW9 A;  3SAT A;  1ORY B;  3UJN A;  2HAK A;  1R2Z A;  4I81 A;  2VF8 A;  5KO3 A;  1Q02 A;  4CIS A;  4X66 M;  3AFH A;  1NSF A;  4GRI A;  4XBO A;  1WJ7 A;  2LXE A;  2YFQ A;  4AZF A;  4L8R C;  3PXG A;  4QNR A;  4QOS A;  4X62 M;  3M7G A;  4NXM M;  3KDS E;  4LJ4 A;  4L78 A;  1I94 M;  1ZMW A;  2DAM A;  2LVP C;  4JV5 M;  1VEJ A;  2LHG A;  2C99 A;  4OVZ B;  3NBX X;  1L8Q A;  5KPZ A;  2XSZ D;  4LRS A;  3U6D A;  5F3W A;  1T6O A;  3VKG A;  2G3Q A;  2XFS A;  3THG A;  2DWZ B;  1NJF A;  2YNM D;  2HCB A;  3A42 A;  3L29 A;  3UK6 A;  1DO0 A;  2K47 A;  4MGY E;  2XH9 A;  1QZE A;  2C9O A;  5DYG A;  1JR3 D;  3GLI E;  4NXN M;  3FUW A;  1S3S A;  4AKH A;  3HWS A;  2LVA A;  2HHH M;  1VEG A;  2Y0Q A;  4R71 A;  3NBI A;  4LGY A;  4GEW A;  4JXJ A;  3LW5 F;  3GPX A;  2CUZ A;  2ZAN A;  3HHX A;  2R65 A;  3GO8 A;  3HGI A;  1WR1 B;  2APL A;  3AKZ A;  3U6S A;  2MR9 A;  1TDH A;  3GQ5 A;  3A98 B;  2WZJ A;  2KXE A;  4IBB A;  4KLN A;  3VKH A;  1ZMV A;  4YY3 M;  3JR4 A;  1HNX M;  4LF9 M;  2R4J A;  3QWL A;  1OJL A;  2VII A;  3AV0 A;  4M9Z A;  2EA0 A;  3FRH A;  3K8Z A;  4B7F A;  3K1J A;  3U6M A;  1IN5 A;  2Z3X A;  1DV0 A;  1QDT A;  2LVQ D;  4OW0 A;  4G4R A;  3V76 A;  1R2Y A;  1KFV A;  1NNJ A;  1VDD A;  2OQ4 A;  3U5Z A;  3HKP A;  1OFH A;  1TR8 A;  2JZ1 A;  3CGW A;  4I4L A;  4P17 A;  4FCV A;  1GKI A;  1V33 A;  2D7G A;  2DWL A;  3AOE C;  4LF5 M;  1XXH A;  4AI6 A;  3K9O A;  1G4A E;  3QYE A;  1DGB A;  1NHW C;  4FCW A;  2F5Q A;  1IN4 A;  2KA6 B;  3KFU G;  3I4V A;  1N34 M;  1CUK A;  2QCU A;  3C3E A;  4JI4 M;  4KHP M;  4DV3 M;  3VK8 A;  4K0K M;  3SMS A;  4CGY B;  3SMP A;  3GRV A;  3GRU A;  3L2A A;  1E94 E;  1IY1 A;  2L6O A;  3H4M A;  1R7R A;  5EP4 A;  1JR3 E;  2EJS A;  1N32 M;  3BBZ A;  2ERC A;  2XEP A;  1Z5B A;  3W0L B;  4IBJ A;  5KPR A;  2ZBK B;  1L2D A;  3DFZ A;  3GLH A;  3FYD A;  4AG6 A;  1R6B X;  1DGF A;  1ZQ9 A;  2W82 A;  1PJS A;  4JI6 M;  3HU1 A;  5EP2 A;  3FTE A;  1XC8 A;  2DAI A;  4G4N A;  3KW6 A;  1K3X A;  3KS8 A;  4II7 A;  2KNZ A;  3DA1 A;  2RGH A;  5EJC A;  3GPU A;  3TWK A;  2CE7 A;  3K9P A;  4OU7 A;  4X64 M;  1GJS A;  1XHB A;  1XWI A;  2DZN B;  1NO1 A;  2BNK A;  4DUY M;  3HHW A;  4LJ6 A;  3UZU A;  5DFL A;  2JA2 A;  3U6L A;  2F5N A;  3L27 A;  4JI1 M;  2LHC A;  4JI3 M;  5BR8 M;  2MRO B;  2YR0 A;  1IXZ A;  4R7G A;  3UMM A;  2Q2E B;  1G3I A;  2JWS A;  2FNA A;  3KXE C;  3J81 S;  4GHL A;  1TGU A;  2WSF F;  3VLF B;  5LMU M;  2H1R A;  3QYB A;  3U6C A;  3KP1 E;  2I7P A;  4IBG A;  4DV4 M;  3CTW B;  2DAK A;  4NSR A;  4DR2 M;  5ITT A;  3U5Z B;  4HLQ A;  1PM5 A;  1HQY E;  3A46 A;  2A5Y B;  1GVN A;  4LJA A;  3MHV C;  2C9C A;  3IEC A;  1HJP A;  3GQ4 A;  1NHG C;  4QOZ C;  1XXH B;  1MU5 A;  1J5E M;  5ITX A;  2V1U A;  5FTK A;  1C1K A;  5GKN A;  4EIW A;  4Y28 F;  2JP7 A;  5FTN A;  2KNA A;  3RFW A;  3FUX A;  4NSO B;  2KNV A;  2J5Y A;  2KEB A;  2KHH A;  4YHH M;  3GLG A;  2F5S A;  4P16 A;  1X37 A;  2XFT A;  2DNA A;  2LNH C;  1NV8 A;  4M9S A;  3W67 A;  2Z7J A;  3CF6 E;  2R62 A;  2FE8 A;  2P5T A;  3LVW A;  2C5R A;  2CWB A;  4NC6 A;  4KOD A;  3FYC A;  1SXJ C;  5BPV A;  4LF7 M;  1QUT A;  2XF3 A;  4GH9 A;  3RGS A;  3GP1 A;  1WIV A;  4B3M M;  2XZF A;  5A2Q S;  1ZAE A;  3GLH B;  4RF1 A;  4GIT A;  1OAO C;  3ILK A;  4PDG A;  3GQ3 A;  8CAT A;  2R18 A;  3L28 A;  4L15 A;  1N36 M;  2BWB A;  3C3D A;  2QQ8 A;  1G41 A;  3T6P A;  2YQZ A;  5JI2 E;  4AQY M;  1NJG A;  3LQR A;  1PJI A;  4PCZ A;  2L09 A;  1L2C A;  4MGH A;  1WHC A;  1IY0 A;  4NRV A;  1TH2 A;  2DHY A;  1N78 A;  2O01 F;  4LJ5 A;  1VDL A;  4AG5 A;  1AIP C;  2DWN A;  2R6F A;  3L26 A;  1HNZ M;  1N77 A;  3GRR A;  4M0D A;  5ITY A;  4Q7J A;  2GNO A;  4LZZ A;  5IWA M;  2CRU A;  2C96 A;  2OO9 A;  1E9S A;  3MJ5 A;  4F1I A;  2CHV A;  3PFI A;  3C9P A;  2CV1 A;  1GLN A;  3TWL A;  3SAW A;  2KDL A;  4FCT A;  1FNN A;  2XGN A;  3EIE A;  2LTU A;  1Q3B A;  5EXT A;  1QDR A;  1N33 M;  1AUA A;  1D0L A;  2DAG A;  4LZJ A;  1Z6T A;  3GRY A;  3AOE A;  2RRU A;  2JNH A;  4IJE A;  4PD2 A;  2QBY B;  2HKJ A;  2MJ5 B;  3K92 A;  4D81 A;  4S12 A;  5EXX A;  4MH0 E;  4MM3 B;  1K82 A;  4DR6 M;  1PRB A;  4LG2 A;  3SAS A;  2Y21 A;  2CV2 A;  3LQQ A;  2B3T A;  2CFO A;  3KP0 E;  2O5R A;  3LVV A;  4Z8X A;  4LJ7 A;  3SC3 A;  1XMQ M;  1PJJ A;  2UUC M;  1LTM A;  2HWJ A;  3M6A A;  4G4O A;  3VFD A;  1XXH E;  2V6Z M;  3A45 A;  4RF0 A;  5KQD A;  4NL4 H;  1I4W A;  3HHZ A;  4AKI A;  4JI2 M;  2L4E A;  1C7Y A;  3TWM A;  5FTM A;  1OTR A;  2QP9 X;  4XK8 F;  3GLG B;  1UM8 A;  4GC9 A;  4DR4 M;  4JI7 M;  1Z5A A;  3CF0 A;  3B7Z A;  3KOY E;  1DGG A;  4JYA M;  4GKK M;  3WHK A;  1IQP A;  3CF2 A;  3H4J A;  1OQY A;  2M5Z A;  3PVS A;  3JAM S;  1QYR A;  2UUA M;  3QAU A;  1NNU C;  3ZCB B;  3M0E A;  1HT1 E;  2VF7 A;  5JI3 E;  2VQF M;  4ITQ A;  4JI5 M;  2XZU A;  4LFC M;  2AHM A;  4UN2 B;  3B7N A;  1HQC A;  3TQS A;  2QEN A;  3DZD A;  4LF6 M;  4NOO B;  4PT5 A;  4DR3 M;  3GLH E;  1NVM A;  5EP3 A;  2NQ8 C;  3FTF A;  3LCV B;  3VDP A;  4B08 A;  4FWH A;  4FVM A;  1K3W A;  1PJT A;  1Q39 A;  3PNV A;  4FD2 A;  2ZTD A;  3R8F A;  3W0F A;  2DZO B;  4MB7 A;  2Z8Y M;  4GMQ A;  3AOG A;  2UXD M;  2DZL A;  2RKO A;  3IG8 A;  2KZU A;  5EXP A;  5L8R F;  1IBM M;  3KSJ A;  4LFB M;  3IG5 A;  2MGW A;  1QAN A;  1VG5 A;  1RU3 A;  2H5X A;  2Z4R A;  3SHF A;  1G59 A;  2JUJ A;  1L1T A;  3ZC7 B;  4CIZ A;  2F5P A;  2KRU A;  4IBK A;  1GAB A;  5E6J A;  1HNW M;  4MGK E;  1D0K A;  1Z5C A;  4IJF A;  1IBL M;  4ZPX A;  3GPY A;  5C1B A;  4G6Z A;  3R9X B;  4R3D A;  3FKE A;  2VDB B;  1JQJ C;  4HL4 A;  3LMM A;  4IBF A;  5IT9 S;  2CV0 A;  3RE8 A;  3DOA A;  1GL7 A;  3Q8G A;  4LJ8 A;  3W68 A;  2LH0 A;  2UXB M;  2BWE A;  2QBY A;  1VEK A;  2RGO A;  1KYI A;  3U6E A;  1Z59 A;  1VQ1 A;  2QZ4 A;  4FWD A;  2FFJ A;  3C58 A;  3ZQJ A;  3TPZ A;  4KT0 F;  1GJT A;  1E9R A;  2OPF A;  4DBG B;  1R5L A;  1MN3 A;  2QHO B;  1PJQ A;  4B7H A;  1BVS A;  3FE3 A;  2CHQ A;  5ITX E;  1Y8G A;  4AW4 A;  1V92 A;  3I4Y A;  4X65 M;  1XMO M;  2F5O A;  3MK6 A;  2K6B A;  1DO2 A;  4PDI A;  4G4Q A;  3K2L A;  3VDU A;  3GLG E;  4GC5 A;  4GHA A;  1LV7 A;  2L7I A;  4RNA A;  3FTD A;  4KO8 A;  4WUR A;  1MX0 A;  4DUZ M;  1OIZ A;  4HEO A;  1IN6 A;  3I51 A;  1NY6 A;  2KW0 A;  2L2D A;  2OOB A;  2ZAM A;  1L1Z A;  3HZJ A;  3FUU A;  3SAU A;  3FUV A;  2R45 A;  3HHY A;  3EIH A;  4BBA A;  1QAM A;  3F92 A;  4L16 A;  2CHG A;  5E26 A;  3GLF A;  3WHL A;  2Y20 A;  5ITU A;  2FS1 A;  4JI0 M;  3OTO M;  1IM2 A;  3KOZ E;  3B7Q A;  4IBE A;  3KOX E;  2G5G X;  4B7G A;  5EQT A;  4IBC A;  4DR5 M;  2DVW B;  5EP1 A;  4JI8 M;  2ZAO A;  1QUS A;  4D80 A;  3T1Y M;  4LFA M;  3KOW E;  1IN8 A;  4CJ6 A;  2EKF A;  4LCB A;  3D8L A;  2LVN C;  3FRI A;  1OAI A;  3HJS A;  3J7B A;  5C18 A;  5KQ8 A;  1IBK M;  3D8B A;  1KSF X;  4B3T M;  3FD9 A;  5FSW A;  2F4V M;  1GO5 A;  4I5S A;  3B9P A;  4M0W A;  3L25 A;  3HY5 A;  2JZ0 A;  2WSE F;  5FTL A;  2LWX A;  4QHS A;  4Z6Y A; 
#chains in the Genus database with same CATH homology
 3B89 A;  3H4J A;  5DFL A;  3GLF E;  1OQY A;  1XB2 B;  2EKK A;  2QNJ A;  2HAK A;  1HT1 E;  2MRO B;  1HT2 E;  4F2L A;  1Q02 A;  4G3O A;  1G3I A;  4UN2 B;  2DAE A;  2JY7 A;  1WJ7 A;  3GLH E;  1P3Q Q;  2DEN A;  3LCV B;  1ZMW A;  2DAM A;  2CP8 A;  2LVP C;  1WGN A;  2ZTD A;  1VEJ A;  2DAK A;  1T43 A;  1ZV1 A;  2DZL A;  1TTE A;  1HQY E;  1T6O A;  3IEC A;  1HJP A;  2G3Q A;  1IXS A;  1IFY A;  2MGW A;  2ZTC A;  1VG5 A;  2H5X A;  3E46 A;  1OKS A;  2JUJ A;  1DO0 A;  1QZE A;  2JP7 A;  3LCU A;  2KNA A;  2K9D A;  2KNV A;  3GLI E;  1WGL A;  1UFZ A;  2KHH A;  2K0B X;  2DNA A;  2LVA A;  1NV8 A;  1VEG A;  4R71 A;  4GEW A;  2CWB A;  1WR1 B;  2JY6 B;  2BWE A;  2QSF X;  2MR9 A;  1VEK A;  2WZJ A;  1KYI A;  1WIV A;  1ZMV A;  1VQ1 A;  3FRH A;  2O25 A;  1DV0 A;  2DI0 A;  4DBG B;  1MN3 A;  2QHO B;  1YLA A;  2BWB A;  2LVQ D;  1BVS A;  3FE3 A;  1G41 A;  3T6P A;  1Y8G A;  2DKL A;  1V92 A;  2R0I A;  5JI2 E;  2L4F A;  1DO2 A;  1WHC A;  1TR8 A;  2DHY A;  2JZ1 A;  3GLG E;  1SG9 A;  1VDL A;  1AIP C;  2OOA A;  3K9O A;  1G4A E;  4HEO A;  4Q7J A;  2L2D A;  2LVO C;  2OOB A;  2OO9 A;  4F1I A;  1CUK A;  2LBC A;  1PGY A;  1R4G A;  3F92 A;  2LTU A;  2JY5 A;  1E94 E;  2DAG A;  1JR3 E;  2EJS A;  1IM2 A;  2RRU A;  2JNH A;  3BBZ A;  2MJ5 B;  1ZMU A;  2EKF A;  3MMP A;  2B3T A;  2LVN C;  3FRI A;  1OAI A;  2DAI A;  1EFU B;  2HWJ A;  3E21 A;  1XXH E;  2JY8 A;  3IHP A;  1A5T A;  2KNZ A;  4WP2 A;  1GO5 A;  2L4E A;  1C7Y A;  1OTR A;  2JZ0 A;  3K9P A;  1NV9 A;  1F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...