1OAIA

Complex between tap uba domain and fxfg nucleoporin peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR RNA EXPORT FACTOR
publication title Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
total genus 24
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oaiA00
2L4FA 1DO2A 2QHOB 2JY5A 1DV0A 2JY8A 1WIVA 3LCVB 1P3QQ 1XB2B 2DAGA 2CP8A 2OO9A 1VG5A 1BVSA 1IFYA 1ZMVA 1IXSA 2DHYA 2LTUA 2QNJA 2RRUA 3GLHE 1JR3E 2K0BX 2DZLA 2JY6B 2KNAA 2L2DA 3LCUA 1TR8A 3B89A 2MGWA 1TTEA 2JP7A 1G41A 2DAMA 1F4IA 2JZ1A 4R71A 3T6PA 2OOAA 1OTRA 2JUJA 1VEJA 2MR9A 1VEKA 3GLFE 1GO5A 1EFUB 3E21A 1E94E 2R0IA 3FRIA 4UN2B 1YLAA 4F1IA 3GLGE 3F92A 1A5TA 2DENA 1IM2A 2K9DA 4WP2A 2ZTDA 1UFZA 1Y8GA 1NV8A 1SG9A 3H4JA 2LVNC 3IHPA 3MMPA 2QSFX 3K9PA 2LBCA 1HQYE 1T6OA 2DKLA 1VEGA 2LVQD 1G4AE 2BWEA 1OKSA 2B3TA 5JI2E 2MJ5B 1HT2E 1AIPC 4GEWA 1HJPA 2HAKA 1C7YA 1WHCA 1R4GA 1V92A 1KYIA 2KNZA 1MN3A 4DBGB 2DAEA 1NV9A 2O25A 3K9OA 2WZJA 1T43A 1CUKA 2BWBA 2G3QA 5DFLA 1ZMUA 4Q7JA 3BBZA 1VQ1A 2HWJA 2OOBA 1VDLA 1WJ7A 2EJSA 2EKKA 1DO0A 3FRHA 2LVPC 1PGYA 2JY7A 1ZV1A 2KNVA 2KHHA 1ZMWA 2L4EA 3IECA 1WGLA 3FE3A 2ZTCA 4G3OA 1WGNA 2CWBA 2DI0A 1OQYA 2MROB 1G3IA 2DAKA 2EKFA 4F2LA 2LVOC 4HEOA 3GLIE 1HT1E 2DNAA 3E46A 2JNHA 2JZ0A 2DAIA 2H5XA 1XXHE 1QZEA 1OAIA 1Q02A 1WR1B 2LVAA
chains in the Genus database with same CATH superfamily
4LRSA 3D8LA 2EA0A 4JI4M 1IXZA 1N75A 1QAQA 3GLFA 3FYDA 3WHKA 4X65M 2HHHM 1DV0A 1XHBA 2XFTA 3LCVB 4GC5A 3SASA 1T3TA 3C3DA 1KFVA 4MGHA 2DHYA 5KPRA 3GLGA 3Q8XA 2UXCM 2QNJA 2Z7JA 5ITTA 3GLHE 2K0BX 3FTFA 3H4MA 3J27B 2DZLA 4DUZM 3L28A 1TDHA 4LFCM 1L2BA 3B89A 2XZFA 2WSCF 2JP7A 1DGGA 3KSJA 4OVZB 4DV2M 2D7GA 3FYCA 4JI1M 1VEKA 3W67A 1QYRA 1GO5A 3MJ5A 3ZC7B 2QPAA 1N34M 2Z4SA 2CV1A 1E94E 3SHFA 4FCWA 5KQDA 4FCTA 2R0IA 1DGHA 1L1ZA 4S12A 2M60A 4UN2B 2H1RA 4F1IA 4LF4M 1HNWM 4RKUF 2G8LA 1IM2A 2K9DA 3K92A 4LJ5A 3FTDA 4JI2M 3IHPA 4LGYA 3W0LB 1NO1A 3LQQA 2QSFX 3LQRA 1PJIA 3K1JA 4R3DA 3CF6E 2LBCA 1T6OA 4A3VB 4IBCA 1OKSA 4HLQA 3RGPA 3FTCA 1XC8A 1D2NA 1OIZA 2FH0A 2FFJA 1YUBA 4L15A 4NSRA 4CJ6A 4P17A 4D81A 2ZM6M 4G4OA 3E9SA 4BBAA 4DV1M 1QQWA 4DV5M 3GQ4A 3AL0C 4AG5A 1R6BX 2KNZA 2R6FA 4XGIA 2OPFA 3T38A 1PJQA 2DAEA 2VF8A 3AV0A 1EIJA 1TH3A 3W0FA 2O01F 3GRUA 3I4VA 2K6BA 3SFZA 1XMOM 2F5OA 1CUKA 4DR4M 1IQPA 4JI7M 3KSXA 1ZMUA 5DFLA 4B7GA 3HHYA 4PCZA 3ZQJA 2UUAM 1ZQ9A 1J09A 4GHLA 3JR4A 1JQJC 1VDLA 4B7FA 2QCUA 2EKKA 2KZSA 2R62A 3NBIA 4W5WA 5IZ7D 2YR0A 1DO0A 2CFOA 3FRHA 4IBKA 3JR5A 3I51A 2DWNA 1PGYA 7CATA 4TUWA 3SMPA 2C9CA 2KNVA 2I7NA 2R46A 4DR1M 1DGFA 3IECA 4LFAM 2APLA 1R5LA 5ITXA 2KXEA 2RGHA 1OIPA 1UM8A 4RNAA 1FJGM 1H6UA 4IBEA 3C3EA 3T1HM 1WGNA 1D0KA 2CWBA 1N33M 2UXBM 5KPTA 4LF5M 2DI0A 1L1TA 4JI8M 2MROB 1R7RA 4GIPA 2UXDM 4F2LA 5LMNM 4OU7A 1K82A 4HEOA 2M5ZA 1HT1E 1JR3D 4Z8XA 1JB0F 4B3SM 3E46A 3A45A 5C1BA 3PXGA 4G4QA 1SXJE 1NNJA 1NJGA 3UK6A 2DAIA 1GABA 5KPZA 3L2AA 2H5XA 1AUAA 3AOEC 2HCBA 3HJ8A 1QZEA 4FWDA 5ITUA 1WR1B 2LVAA 1EE8A 2L4FA 3J81S 4DUYM 3THGA 1DO2A 3B9PA 3UJNA 2CV0A 3VKGA 2JY5A 3L26A 3CGWA 3GPYA 3U5ZB 3PVSA 1NVMA 1P3QQ 2QBYB 4AKGA 3B7ZA 1VG5A 5EXTA 4MH0E 2Q2EB 4GKJM 2XF3A 1XWIA 3TWMA 2F5SA 1QDRA 5ITQA 3HJQA 1JR3E 4DV4M 1Q3CA 3WHLA 1PJJA 2L2DA 2JWSA 4HL4A 3UMMA 1N78A 4GC9A 5ITYA 1IY1A 1TR8A 3GPPA 3GLIB 3SATA 1GL6A 3I04M 1G41A 3ILKA 2DAMA 1HQCA 4LJAA 4AG6A 3U6OA 3HHWA 3KXEC 2BJWA 3T6PA 2FNAA 1OTRA 2JUJA 1OJLA 2MR9A 3HU1A 3RFWA 2LHGA 3TPZA 3GQ5A 3GLFE 4ZPXA 1K3WA 2CV2A 1OAOC 1GJSA 3E21A 4Y28F 1NY6A 2R18A 2XGNA 3TQSA 3GP1A 2DWLA 2F5QA 1YLAA 2CHVA 5IWAM 2VF7A 3GLGE 3F92A 3R8FA 4L6V6 1IXSB 2XFSA 4WP2A 4MGIE 4DV3M 5JI3E 2ZTDA 1UFZA 3J7BA 5BPVA 3QWLA 4LZJA 4M0DA 1Z5BA 3AKZA 4B3MM 3KOWE 3K9PA 3SYKA 4NRWA 1HQYE 3KOXE 2HKJA 1IN5A 1VEGA 1G4AE 3FUUA 3HZJA 2G5GX 4KLNA 4I4LA 4AW4A 2MJ5B 4EIWA 4B3TM 4QHTA 3AJIB 4KHPM 4CHTB 1GLNA 1HT2E 4RF0A 1I4WA 1HJPA 2HAKA 2WSFF 3GPXA 4X64M 4BB9A 2X49A 3U5ZA 1C7YA 1IBLM 1WHCA 4DV7M 2UUBM 2QBYA 4M9XA 4FVMA 2J7NA 3K2LA 4IBGA 4LJ8A 2Y21A 2CHGA 5FTNA 1QDTA 3K9OA 1NY5A 1TF0B 2WZJA 5H37D 3AFHA 4JI0M 4JI6M 2BWBA 4Q7JA 2Z4RA 2C96A 1NNUC 4FWHA 4M0WA 1ZAEA 5L8RF 1IN6A 3AOEA 3QAUA 2OOBA 3GLIA 4B3RM 1N32M 1XNQM 4KO8A 1WJ7A 4X62M 4MM3B 5FTKA 3T1YM 4LF6M 1IY2A 3J2PB 1NJFA 2L6OA 2LVPC 5BR8M 1SXJC 4OW0A 1J7KA 4MB7A 2LWXA 1ZV1A 3M7GA 1ZMWA 2L4EA 3HKPA 1WGLA 3HGIA 2W82A 4L78A 2ZTCA 1HNXM 2FE8A 4MGYE 3HWSA 4G3OA 1E32A 1K3XA 4DR2M 3SHGB 2VQEM 4RF1A 1I94M 2LHCA 2FS1A 1MX0A 4YY3M 3J7AS 1R2ZA 3KP1E 2DAKA 2LH0A 3HJSA 2N35A 5E6JA 4DV6M 3TL4X 3FUTA 3U61B 2KZUA 2DNAA 4LG2A 1S3SA 2BNKA 2DXIA 3IG5A 2YNMD 2ZAOA 2XSZA 3Q8GA 1IBMM 2DZOB 2Y20A 2QP9X 1SXJB 4OVZA 2VIIA 3KS8A 3KS4A 4AI6A 5KQ8A 2XLJA 1OAIA 1Q02A 1LTMA 5KO3A 3KOZE 3ZH9B 5ITXE 5EP4A 4AKHA 2X8AA 4LY6A 1KSFX 2CP8A 2FOIC 2OO9A 1BVSA 3SYLA 1ZMVA 4DV0M 3U6CA 3CTWB 1G59A 4Z6YA 4XK8F 1MU5A 4LZZA 5F3WA 4FCVA 2C99A 3GPUA 4G4NA 1PJSA 1YSYA 2ZAMA 2XH9A 4ANRA 2Z3XA 3LCUA 5GKNA 4FW9A 1QUTA 2F5NA 1TTEA 2LXEA 3A46A 3BXWA 2I7PA 1F4IA 2V1CA 3SC3A 3VDPA 3GQ3A 5DYGA 1L2DA 2OOAA 3TWLA 4WW0A 1XXHB 3SMSA 2ZANA 2D7EA 2UUCM 1XMQM 2DZNB 3IG8A 5EP2A 3MK6A 3KOYE 2C98A 3FRIA 2VDBB 1IN7A 3FTEA 4JV5M 4JYAM 5DNYA 4DR3M 1Z5AA 2DENA 3LVVA 3EIEA 2K47A 2HL7A 1IXRC 4QHSA 4R7GA 1NV8A 1SG9A 3H4JA 2RGOA 3GLHB 1N77A 3NWLA 4LJ9A 2KW0A 2Y0QA 4IBFA 2R65A 1SXJA 1XNRM 4ITQA 3R9XB 2NQ8C 2YFQA 1WXQA 2J5YA 2BWEA 4REZA 5JI2E 3FUXA 3FD9A 5EXSA 3U6LA 4NC6A 1E9RA 2C5RA 3U60B 1TH2A 2LNHC 2V6ZM 3LVWA 1R4GA 3CF2A 2DVWB 1G71A 1QZMA 3DA1A 4DBGB 4AKIA 4PDIA 3U6PA 2BJVA 1GKIA 3DFZA 3GO8A 2G3QA 2CEAA 3A98B 4IJFA 1G8PA 1NHGC 3M0EA 4MGZE 1VQ1A 4LF8M 4L16A 4NXNM 3KW6A 2J7OA 2AHMA 2EJSA 3PNYA 5FTLA 1PRBA 2JXNA 2L7IA 4IBIA 5C18A 4DR5M 4GKKM 1E9SA 3SAVA 3L25A 1XXHA 2R44A 2JY7A 2KDLA 4M9ZA 3J80S 4KODA 4NL4H 5FLXS 5FTMA 2KHHA 4L8RC 3FE3A 3AOGA 3RGSA 1PM5A 5ITRA 3HX3A 3K8ZA 1L8QA 2R4JA 5FSWA 3MHVC 3TWKA 4NXMM 3C9PA 1NHWC 4IBJA 1OQYA 4M9SA 4QNRA 4X66M 1C1KA 2EKFA 2O5RA 3GLHA 2F4VM 2F5PA 1YE9A 3GLIE 3D8BA 4B7HA 3SAWA 3U6DA 1IN8A 3QYEA 4BLCA 3HU2A 4GRIA 3W68A 1Q39A 1RU3A 3U6MA 5IT9S 2XSZD 3VK7A 1V34A 4JI5M 3U60A 2EUCA 3T15A 4IBDA 2CUZA 3FKEA 4PDGA 4IBBA 2QHOB 1MJGM 4PD2A 1Z59A 2CRUA 2JY8A 1WIVA 3M6AA 3DZDA 2E5LM 3KFUG 3GRRA 1XB2B 2DAGA 2P5TA 3LMMA 3VFDA 1IFYA 3U6EA 1IXSA 4FD2A 2LTUA 2QQ8A 3KP0E 4JI3M 3CF0A 2RRUA 4LFBM 2A5YB 2KA6B 2WSEF 4PT5A 4LGMA 4XBOA 2MH8A 1QVRA 3HHXA 4MGKE 5EQTA 4CGYB 2GNOA 1IBKM 2JY6B 4LRTA 1L2CA 2KNAA 1V33A 4FWGA 3UGJA 3FUVA 3UZUA 2V1UA 1IY0A 3RE8A 3VDUA 1GVNA 2MGWA 2DHRA 3TE6A 2R4EA 4QNMA 2L7HA 4II7A 2JZ1A 1LV7A 4R71A 4I5SA 2GQFA 2VQFM 1Q3BA 2D7HA 1VEJA 2OQ4A 3KVWA 1EFUB 2ERCA 2KRUA 1TGUA 1R2YA 3NBXX 4NSOB 3BOSA 3HY5A 3GRVA 4G6ZA 2XZUA 3FUWA 4GMQA 5EXPA 1A5TA 3B7QA 3KDSE 1TDZA 5EXXA 1Z5CA 1Y8GA 2LVNC 3A42A 1J5EM 4LF7M 3I4YA 3I01M 1ORYB 3MMPA 3VK8A 2QENA 2L09A 2ZBKB 4LF9M 3C58A 5A2QS 1DGBA 4K0KM 2DKLA 4LJ7A 1SXJD 2LVQD 4D82A 3B7NA 2B3TA 5E26A 2KRKA 5FTJA 1D0MA 4AZFA 4LJ6A 1AIPC 4GEWA 4CISA 4B08A 3SARA 1V92A 1KYIA 1PJTA 1D0LA 5DYIA 3GLFB 1MN3A 2UU9M 1VDDA 3JAMS 3PFIA 1NV9A 5EP1A 4LJ4A 2O25A 1FNNA 2X4AA 1T43A 2DWZB 3EIHA 4QOZC 1QAMA 4QOSA 5EP3A 3GLGB 4YHHM 4JN6A 2Z8YM 3L27A 3LW5F 3U61A 4NOOB 2CHQA 3BBZA 5EJCA 1Z6TA 2HWJA 1OFHA 3GRYA 4OX9M 3VLFB 4NRVA 2QZ4A 4I81A 1GJTA 4JXJA 2EO2A 3B74A 1X37A 4IIWA 2C9OA 4G4RA 3L29A 1N36M 4DR7M 2Y0TA 3HU3A 3ZCBB 1HNZM 2JA2A 2RKOA 2YQZA 3HHZA 3U6SA 3SBJA 4KT0F 1QANA 3E4RA 2R45A 2KEBA 2XEPA 4GITA 4IJEA 5IREB 2DWMA 3PNVA 4I8OA 1DGHB 3SAUA 3V76A 8CATA 1G3IA 1HR0M 1W5SA 3DOAA 1JR3A 4D80A 4DR6M 3VKHA 2LVOC 4L4UA 2CE7A 1IN4A 4LCBA 3U6QA 1QAOA 1NSFA 2JNHA 1GL7A 2JZ0A 3OTOM 4AQYM 1QUSA 4GHAA 1OFIA 3QYBA 4WURA 4P16A 1XXHE 1TH4A 4GH9A 5LMUM 4CIZA 1W5TA
chains in the Genus database with same CATH topology
2L4FA 1DO2A 2QHOB 2JY5A 1DV0A 2JY8A 1WIVA 3LCVB 1P3QQ 1XB2B 2DAGA 2CP8A 2OO9A 1VG5A 1BVSA 1IFYA 1ZMVA 1IXSA 2DHYA 2LTUA 2QNJA 2RRUA 3GLHE 1JR3E 2K0BX 2DZLA 2JY6B 2KNAA 2L2DA 3LCUA 1TR8A 3B89A 2MGWA 1TTEA 2JP7A 1G41A 2DAMA 1F4IA 2JZ1A 4R71A 3T6PA 2OOAA 1OTRA 2JUJA 1VEJA 2MR9A 1VEKA 3GLFE 1GO5A 1EFUB 3E21A 1E94E 2R0IA 3FRIA 4UN2B 1YLAA 4F1IA 3GLGE 3F92A 1A5TA 2DENA 1IM2A 2K9DA 4WP2A 2ZTDA 1UFZA 1Y8GA 1NV8A 1SG9A 3H4JA 2LVNC 3IHPA 3MMPA 2QSFX 3K9PA 2LBCA 1HQYE 1T6OA 2DKLA 1VEGA 2LVQD 1G4AE 2BWEA 1OKSA 2B3TA 5JI2E 2MJ5B 1HT2E 1AIPC 4GEWA 1HJPA 2HAKA 1C7YA 1WHCA 1R4GA 1V92A 1KYIA 2KNZA 1MN3A 4DBGB 2DAEA 1NV9A 2O25A 3K9OA 2WZJA 1T43A 1CUKA 2BWBA 2G3QA 5DFLA 1ZMUA 4Q7JA 3BBZA 1VQ1A 2HWJA 2OOBA 1VDLA 1WJ7A 2EJSA 2EKKA 1DO0A 3FRHA 2LVPC 1PGYA 2JY7A 1ZV1A 2KNVA 2KHHA 1ZMWA 2L4EA 3IECA 1WGLA 3FE3A 2ZTCA 4G3OA 1WGNA 2CWBA 2DI0A 1OQYA 2MROB 1G3IA 2DAKA 2EKFA 4F2LA 2LVOC 4HEOA 3GLIE 1HT1E 2DNAA 3E46A 2JNHA 2JZ0A 2DAIA 2H5XA 1XXHE 1QZEA 1OAIA 1Q02A 1WR1B 2LVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4F A;  1DO2 A;  2QHO B;  2JY5 A;  1DV0 A;  2JY8 A;  1WIV A;  3LCV B;  1P3Q Q;  1XB2 B;  2DAG A;  2CP8 A;  2OO9 A;  1VG5 A;  1BVS A;  1IFY A;  1ZMV A;  1IXS A;  2DHY A;  2LTU A;  2QNJ A;  2RRU A;  3GLH E;  1JR3 E;  2K0B X;  2DZL A;  2JY6 B;  2KNA A;  2L2D A;  3LCU A;  1TR8 A;  3B89 A;  2MGW A;  1TTE A;  2JP7 A;  1G41 A;  2DAM A;  1F4I A;  2JZ1 A;  4R71 A;  3T6P A;  2OOA A;  1OTR A;  2JUJ A;  1VEJ A;  2MR9 A;  1VEK A;  3GLF E;  1GO5 A;  1EFU B;  3E21 A;  1E94 E;  2R0I A;  3FRI A;  4UN2 B;  1YLA A;  4F1I A;  3GLG E;  3F92 A;  1A5T A;  2DEN A;  1IM2 A;  2K9D A;  4WP2 A;  2ZTD A;  1UFZ A;  1Y8G A;  1NV8 A;  1SG9 A;  3H4J A;  2LVN C;  3IHP A;  3MMP A;  2QSF X;  3K9P A;  2LBC A;  1HQY E;  1T6O A;  2DKL A;  1VEG A;  2LVQ D;  1G4A E;  2BWE A;  1OKS A;  2B3T A;  5JI2 E;  2MJ5 B;  1HT2 E;  1AIP C;  4GEW A;  1HJP A;  2HAK A;  1C7Y A;  1WHC A;  1R4G A;  1V92 A;  1KYI A;  2KNZ A;  1MN3 A;  4DBG B;  2DAE A;  1NV9 A;  2O25 A;  3K9O A;  2WZJ A;  1T43 A;  1CUK A;  2BWB A;  2G3Q A;  5DFL A;  1ZMU A;  4Q7J A;  3BBZ A;  1VQ1 A;  2HWJ A;  2OOB A;  1VDL A;  1WJ7 A;  2EJS A;  2EKK A;  1DO0 A;  3FRH A;  2LVP C;  1PGY A;  2JY7 A;  1ZV1 A;  2KNV A;  2KHH A;  1ZMW A;  2L4E A;  3IEC A;  1WGL A;  3FE3 A;  2ZTC A;  4G3O A;  1WGN A;  2CWB A;  2DI0 A;  1OQY A;  2MRO B;  1G3I A;  2DAK A;  2EKF A;  4F2L A;  2LVO C;  4HEO A;  3GLI E;  1HT1 E;  2DNA A;  3E46 A;  2JNH A;  2JZ0 A;  2DAI A;  2H5X A;  1XXH E;  1QZE A;  1OAI A;  1Q02 A;  1WR1 B;  2LVA A; 
#chains in the Genus database with same CATH topology
 4LRS A;  3D8L A;  2EA0 A;  4JI4 M;  1IXZ A;  1N75 A;  1QAQ A;  3GLF A;  3FYD A;  3WHK A;  4X65 M;  2HHH M;  1DV0 A;  1XHB A;  2XFT A;  3LCV B;  4GC5 A;  3SAS A;  1T3T A;  3C3D A;  1KFV A;  4MGH A;  2DHY A;  5KPR A;  3GLG A;  3Q8X A;  2UXC M;  2QNJ A;  2Z7J A;  5ITT A;  3GLH E;  2K0B X;  3FTF A;  3H4M A;  3J27 B;  2DZL A;  4DUZ M;  3L28 A;  1TDH A;  4LFC M;  1L2B A;  3B89 A;  2XZF A;  2WSC F;  2JP7 A;  1DGG A;  3KSJ A;  4OVZ B;  4DV2 M;  2D7G A;  3FYC A;  4JI1 M;  1VEK A;  3W67 A;  1QYR A;  1GO5 A;  3MJ5 A;  3ZC7 B;  2QPA A;  1N34 M;  2Z4S A;  2CV1 A;  1E94 E;  3SHF A;  4FCW A;  5KQD A;  4FCT A;  2R0I A;  1DGH A;  1L1Z A;  4S12 A;  2M60 A;  4UN2 B;  2H1R A;  4F1I A;  4LF4 M;  1HNW M;  4RKU F;  2G8L A;  1IM2 A;  2K9D A;  3K92 A;  4LJ5 A;  3FTD A;  4JI2 M;  3IHP A;  4LGY A;  3W0L B;  1NO1 A;  3LQQ A;  2QSF X;  3LQR A;  1PJI A;  3K1J A;  4R3D A;  3CF6 E;  2LBC A;  1T6O A;  4A3V B;  4IBC A;  1OKS A;  4HLQ A;  3RGP A;  3FTC A;  1XC8 A;  1D2N A;  1OIZ A;  2FH0 A;  2FFJ A;  1YUB A;  4L15 A;  4NSR A;  4CJ6 A;  4P17 A;  4D81 A;  2ZM6 M;  4G4O A;  3E9S A;  4BBA A;  4DV1 M;  1QQW A;  4DV5 M;  3GQ4 A;  3AL0 C;  4AG5 A;  1R6B X;  2KNZ A;  2R6F A;  4XGI A;  2OPF A;  3T38 A;  1PJQ A;  2DAE A;  2VF8 A;  3AV0 A;  1EIJ A;  1TH3 A;  3W0F A;  2O01 F;  3GRU A;  3I4V A;  2K6B A;  3SFZ A;  1XMO M;  2F5O A;  1CUK A;  4DR4 M;  1IQP A;  4JI7 M;  3KSX A;  1ZMU A;  5DFL A;  4B7G A;  3HHY A;  4PCZ A;  3ZQJ A;  2UUA M;  1ZQ9 A;  1J09 A;  4GHL A;  3JR4 A;  1JQJ C;  1VDL A;  4B7F A;  2QCU A;  2EKK A;  2KZS A;  2R62 A;  3NBI A;  4W5W A;  5IZ7 D;  2YR0 A;  1DO0 A;  2CFO A;  3FRH A;  4IBK A;  3JR5 A;  3I51 A;  2DWN A;  1PGY A;  7CAT A;  4TUW A;  3SMP A;  2C9C A;  2KNV A;  2I7N A;  2R46 A;  4DR1 M;  1DGF A;  3IEC A;  4LFA M;  2APL A;  1R5L A;  5ITX A;  2KXE A;  2RGH A;  1OIP A;  1UM8 A;  4RNA A;  1FJG M;  1H6U A;  4IBE A;  3C3E A;  3T1H M;  1WGN A;  1D0K A;  2CWB A;  1N33 M;  2UXB M;  5KPT A;  4LF5 M;  2DI0 A;  1L1T A;  4JI8 M;  2MRO B;  1R7R A;  4GIP A;  2UXD M;  4F2L A;  5LMN M;  4OU7 A;  1K82 A;  4HEO A;  2M5Z A;  1HT1 E;  1JR3 D;  4Z8X A;  1JB0 F;  4B3S M;  3E46 A;  3A45 A;  5C1B A;  3PXG A;  4G4Q A;  1SXJ E;  1NNJ A;  1NJG A;  3UK6 A;  2DAI A;  1GAB A;  5KPZ A;  3L2A A;  2H5X A;  1AUA A;  3AOE C;  2HCB A;  3HJ8 A;  1QZE A;  4FWD A;  5ITU A;  1WR1 B;  2LVA A;  1EE8 A;  2L4F A;  3J81 S;  4DUY M;  3THG A;  1DO2 A;  3B9P A;  3UJN A;  2CV0 A;  3VKG A;  2JY5 A;  3L26 A;  3CGW A;  3GPY A;  3U5Z B;  3PVS A;  1NVM A;  1P3Q Q;  2QBY B;  4AKG A;  3B7Z A;  1VG5 A;  5EXT A;  4MH0 E;  2Q2E B;  4GKJ M;  2XF3 A;  1XWI A;  3TWM A;  2F5S A;  1QDR A;  5ITQ A;  3HJQ A;  1JR3 E;  4DV4 M;  1Q3C A;  3WHL A;  1PJJ A;  2L2D A;  2JWS A;  4HL4 A;  3UMM A;  1N78 A;  4GC9 A;  5ITY A;  1IY1 A;  1TR8 A;  3GPP A;  3GLI B;  3SAT A;  1GL6 A;  3I04 M;  1G41 A;  3ILK A;  2DAM A;  1HQC A;  4LJA A;  4AG6 A;  3U6O A;  3HHW A;  3KXE C;  2BJW A;  3T6P A;  2FNA A;  1OTR A;  2JUJ A;  1OJL A;  2MR9 A;  3HU1 A;  3RFW A;  2LHG A;  3TPZ A;  3GQ5 A;  3GLF E;  4ZPX A;  1K3W A;  2CV2 A;  1OAO C;  1GJS A;  3E21 A;  4Y28 F;  1NY6 A;  2R18 A;  2XGN A;  3TQS A;  3GP1 A;  2DWL A;  2F5Q A;  1YLA A;  2CHV A;  5IWA M;  2VF7 A;  3GLG E;  3F92 A;  3R8F A;  4L6V 6;  1IXS B;  2XFS A;  4WP2 A;  4MGI E;  4DV3 M;  5JI3 E;  2ZTD A;  1UFZ A;  3J7B A;  5BPV A;  3QWL A;  4LZJ A;  4M0D A;  1Z5B A;  3AKZ A;  4B3M M;  3KOW E;  3K9P A;  3SYK A;  4NRW A;  1HQY E;  3KOX E;  2HKJ A;  1IN5 A;  1VEG A;  1G4A E;  3FUU A;  3HZJ A;  2G5G X;  4KLN A;  4I4L A;  4AW4 A;  2MJ5 B;  4EIW A;  4B3T M;  4QHT A;  3AJI B;  4KHP M;  4CHT B;  1GLN A;  1HT2 E;  4RF0 A;  1I4W A;  1HJP A;  2HAK A;  2WSF F;  3GPX A;  4X64 M;  4BB9 A;  2X49 A;  3U5Z A;  1C7Y A;  1IBL M;  1WHC A;  4DV7 M;  2UUB M;  2QBY A;  4M9X A;  4FVM A;  2J7N A;  3K2L A;  4IBG A;  4LJ8 A;  2Y21 A;  2CHG A;  5FTN A;  1QDT A;  3K9O A;  1NY5 A;  1TF0 B;  2WZJ A;  5H37 D;  3AFH A;  4JI0 M;  4JI6 M;  2BWB A;  4Q7J A;  2Z4R A;  2C96 A;  1NNU C;  4FWH A;  4M0W A;  1ZAE A;  5L8R F;  1IN6 A;  3AOE A;  3QAU A;  2OOB A;  3GLI A;  4B3R M;  1N32 M;  1XNQ M;  4KO8 A;  1WJ7 A;  4X62 M;  4MM3 B;  5FTK A;  3T1Y M;  4LF6 M;  1IY2 A;  3J2P B;  1NJF A;  2L6O A;  2LVP C;  5BR8 M;  1SXJ C;  4OW0 A;  1J7K A;  4MB7 A;  2LWX A;  1ZV1 A;  3M7G A;  1ZMW A;  2L4E A;  3HKP A;  1WGL A;  3HGI A;  2W82 A;  4L78 A;  2ZTC A;  1HNX M;  2FE8 A;  4MGY E;  3HWS A;  4G3O A;  1E32 A;  1K3X A;  4DR2 M;  3SHG B;  2VQE M;  4RF1 A;  1I94 M;  2LHC A;  2FS1 A;  1MX0 A;  4YY3 M;  3J7A S;  1R2Z A;  3KP1 E;  2DAK A;  2LH0 A;  3HJS A;  2N35 A;  5E6J A;  4DV6 M;  3TL4 X;  3FUT A;  3U61 B;  2KZU A;  2DNA A;  4LG2 A;  1S3S A;  2BNK A;  2DXI A;  3IG5 A;  2YNM D;  2ZAO A;  2XSZ A;  3Q8G A;  1IBM M;  2DZO B;  2Y20 A;  2QP9 X;  1SXJ B;  4OVZ A;  2VII A;  3KS8 A;  3KS4 A;  4AI6 A;  5KQ8 A;  2XLJ A;  1OAI A;  1Q02 A;  1LTM A;  5KO3 A;  3KOZ E;  3ZH9 B;  5ITX E;  5EP4 A;  4AKH A;  2X8A A;  4LY6 A;  1KSF X;  2CP8 A;  2FOI C;  2OO9 A;  1BVS A;  3SYL A;  1ZMV A;  4DV0 M;  3U6C A;  3CTW B;  1G59 A;  4Z6Y A;  4XK8 F;  1MU5 A;  4LZZ A;  5F3W A;  4FCV A;  2C99 A;  3GPU A;  4G4N A;  1PJS A;  1YSY A;  2ZAM A;  2XH9 A;  4ANR A;  2Z3X A;  3LCU A;  5GKN A;  4FW9 A;  1QUT A;  2F5N A;  1TTE A;  2LXE A;  3A46 A;  3BXW A;  2I7P A;  1F4I A;  2V1C A;  3SC3 A;  3VDP A;  3GQ3 A;  5DYG A;  1L2D A;  2OOA A;  3TWL A;  4WW0 A;  1XXH B;  3SMS A;  2ZAN A;  2D7E A;  2UUC M;  1XMQ M;  2DZN B;  3IG8 A;  5EP2 A;  3MK6 A;  3KOY E;  2C98 A;  3FRI A;  2VDB B;  1IN7 A;  3FTE A;  4JV5 M;  4JYA M;  5DNY A;  4DR3 M;  1Z5A A;  2DEN A;  3LVV A;  3EIE A;  2K47 A;  2HL7 A;  1IXR C;  4QHS A;  4R7G A;  1NV8 A;  1SG9 A;  3H4J A;  2RGO A;  3GLH B;  1N77 A;  3NWL A;  4LJ9 A;  2KW0 A;  2Y0Q A;  4IBF A;  2R65 A;  1SXJ A;  1XNR M;  4ITQ A;  3R9X B;  2NQ8 C;  2YFQ A;  1WXQ A;  2J5Y A;  2BWE A;  4REZ A;  5JI2 E;  3FUX A;  3FD9 A;  5EXS A;  3U6L A;  4NC6 A;  1E9R A;  2C5R A;  3U60 B;  1TH2 A;  2LNH C;  2V6Z M;  3LVW A;  1R4G A;  3CF2 A;  2DVW B;  1G71 A;  1QZM A;  3DA1 A;  4DBG B;  4AKI A;  4PDI A;  3U6P A;  2BJV A;  1GKI A;  3DFZ A;  3GO8 A;  2G3Q A;  2CEA A;  3A98 B;  4IJF A;  1G8P A;  1NHG C;  3M0E A;  4MGZ E;  1VQ1 A;  4LF8 M;  4L16 A;  4NXN M;  3KW6 A;  2J7O A;  2AHM A;  2EJS A;  3PNY A;  5FTL A;  1PRB A;  2JXN A;  2L7I A;  4IBI A;  5C18 A;  4DR5 M;  4GKK M;  1E9S A;  3SAV A;  3L25 A;  1XXH A;  2R44 A;  2JY7 A;  2KDL A;  4M9Z A;  3J80 S;  4KOD A;  4NL4 H;  5FLX S;  5FTM A;  2KHH A;  4L8R C;  3FE3 A;  3AOG A;  3RGS A;  1PM5 A;  5ITR A;  3HX3 A;  3K8Z A;  1L8Q A;  2R4J A;  5FSW A;  3MHV C;  3TWK A;  4NXM M;  3C9P A;  1NHW C;  4IBJ A;  1OQY A;  4M9S A;  4QNR A;  4X66 M;  1C1K A;  2EKF A;  2O5R A;  3GLH A;  2F4V M;  2F5P A;  1YE9 A;  3GLI E;  3D8B A;  4B7H A;  3SAW A;  3U6D A;  1IN8 A;  3QYE A;  4BLC A;  3HU2 A;  4GRI A;  3W68 A;  1Q39 A;  1RU3 A;  3U6M A;  5IT9 S;  2XSZ D;  3VK7 A;  1V34 A;  4JI5 M;  3U60 A;  2EUC A;  3T15 A;  4IBD A;  2CUZ A;  3FKE A;  4PDG A;  4IBB A;  2QHO B;  1MJG M;  4PD2 A;  1Z59 A;  2CRU A;  2JY8 A;  1WIV A;  3M6A A;  3DZD A;  2E5L M;  3KFU G;  3GRR A;  1XB2 B;  2DAG A;  2P5T A;  3LMM A;  3VFD A;  1IFY A;  3U6E A;  1IXS A;  4FD2 A;  2LTU A;  2QQ8 A;  3KP0 E;  4JI3 M;  3CF0 A;  2RRU A;  4LFB M;  2A5Y B;  2KA6 B;  2WSE F;  4PT5 A;  4LGM A;  4XBO A;  2MH8 A;  1QVR A;  3HHX A;  4MGK E;  5EQT A;  4CGY B;  2GNO A;  1IBK M;  2JY6 B;  4LRT A;  1L2C A;  2KNA A;  1V33 A;  4FWG A;  3UGJ A;  3FUV A;  3UZU A;  2V1U A;  1IY0 A;  3RE8 A;  3VDU A;  1GVN A;  2MGW A;  2DHR A;  3TE6 A;  2R4E A;  4QNM A;  2L7H A;  4II7 A;  2JZ1 A;  1LV7 A;  4R71 A;  4I5S A;  2GQF A;  2VQF M;  1Q3B A;  2D7H A;  1VEJ A;  2OQ4 A;  3KVW A;  1EFU B;  2ERC A;  2KRU A;  1TGU A;  1R2Y A;  3NBX X;  4NSO B;  3BOS A;  3HY5 A;  3GRV A;  4G6Z A;  2XZU A;  3FUW A;  4GMQ A;  5EXP A;  1A5T A;  3B7Q A;  3KDS E;  1TDZ A;  5EXX A;  1Z5C A;  1Y8G A;  2LVN C;  3A42 A;  1J5E M;  4LF7 M;  3I4Y A;  3I01 M;  1ORY B;  3MMP A;  3VK8 A;  2QEN A;  2L09 A;  2ZBK B;  4LF9 M;  3C58 A;  5A2Q S;  1DGB A;  4K0K M;  2DKL A;  4LJ7 A;  1SXJ D;  2LVQ D;  4D82 A;  3B7N A;  2B3T A;  5E26 A;  2KRK A;  5FTJ A;  1D0M A;  4AZF A;  4LJ6 A;  1AIP C;  4GEW A;  4CIS A;  4B08 A;  3SAR A;  1V92 A;  1KYI A;  1PJT A;  1D0L A;  5DYI A;  3GLF B;  1MN3 A;  2UU9 M;  1VDD A;  3JAM S;  3PFI A;  1NV9 A;  5EP1 A;  4LJ4 A;  2O25 A;  1FNN A;  2X4A A;  1T43 A;  2DWZ B;  3EIH A;  4QOZ C;  1QAM A;  4QOS A;  5EP3 A;  3GLG B;  4YHH M;  4JN6 A;  2Z8Y M;  3L27 A;  3LW5 F;  3U61 A;  4NOO B;  2CHQ A;  3BBZ A;  5EJC A;  1Z6T A;  2HWJ A;  1OFH A;  3GRY A;  4OX9 M;  3VLF B;  4NRV A;  2QZ4 A;  4I81 A;  1GJT A;  4JXJ A;  2EO2 A;  3B74 A;  1X37 A;  4IIW A;  2C9O A;  4G4R A;  3L29 A;  1N36 M;  4DR7 M;  2Y0T A;  3HU3 A;  3ZCB B;  1HNZ M;  2JA2 A;  2RKO A;  2YQZ A;  3HHZ A;  3U6S A;  3SBJ A;  4KT0 F;  1QAN A;  3E4R A;  2R45 A;  2KEB A;  2XEP A;  4GIT A;  4IJE A;  5IRE B;  2DWM A;  3PNV A;  4I8O A;  1DGH B;  3SAU A;  3V76 A;  8CAT A;  1G3I A;  1HR0 M;  1W5S A;  3DOA A;  1JR3 A;  4D80 A;  4DR6 M;  3VKH A;  2LVO C;  4L4U A;  2CE7 A;  1IN4 A;  4LCB A;  3U6Q A;  1QAO A;  1NSF A;  2JNH A;  1GL7 A;  2JZ0 A;  3OTO M;  4AQY M;  1QUS A;  4GHA A;  1OFI A;  3QYB A;  4WUR A;  4P16 A;  1XXH E;  1TH4 A;  4GH9 A;  5LMU M;  4CIZ A;  1W5T A; 
#chains in the Genus database with same CATH homology
 2L4F A;  1DO2 A;  2QHO B;  2JY5 A;  1DV0 A;  2JY8 A;  1WIV A;  3LCV B;  1P3Q Q;  1XB2 B;  2DAG A;  2CP8 A;  2OO9 A;  1VG5 A;  1BVS A;  1IFY A;  1ZMV A;  1IXS A;  2DHY A;  2LTU A;  2QNJ A;  2RRU A;  3GLH E;  1JR3 E;  2K0B X;  2DZL A;  2JY6 B;  2KNA A;  2L2D A;  3LCU A;  1TR8 A;  3B89 A;  2MGW A;  1TTE A;  2JP7 A;  1G41 A;  2DAM A;  1F4I A;  2JZ1 A;  4R71 A;  3T6P A;  2OOA A;  1OTR A;  2JUJ A;  1VEJ A;  2MR9 A;  1VEK A;  3GLF E;  1GO5 A;  1EFU B;  3E21 A;  1E94 E;  2R0I A;  3FRI A;  4UN2 B;  1YLA A;  4F1I A;  3GLG E;  3F92 A;  1A5T A;  2DEN A;  1IM2 A;  2K9D A;  4WP2 A;  2ZTD A;  1UFZ A;  1Y8G A;  1NV8 A;  1SG9 A;  3H4J A;  2LVN C;  3IHP A;  3MMP A;  2QSF X;  3K9P A;  2LBC A;  1HQY E;  1T6O A;  2DKL A;  1VEG A;  2LVQ D;  1G4A E;  2BWE A;  1OKS A;  2B3T A;  5JI2 E;  2MJ5 B;  1HT2 E;  1AIP C;  4GEW A;  1HJP A;  2HAK A;  1C7Y A;  1WHC A;  1R4G A;  1V92 A;  1KYI A;  2KNZ A;  1MN3 A;  4DBG B;  2DAE A;  1NV9 A;  2O25 A;  3K9O A;  2WZJ A;  1T43 A;  1CUK A;  2BWB A;  2G3Q A;  5DFL A;  1ZMU A;  4Q7J A;  3BBZ A;  1VQ1 A;  2HWJ A;  2OOB A;  1VDL A;  1WJ7 A;  2EJS A;  2EKK A;  1DO0 A;  3FRH A;  2LVP C;  1PGY A;  2JY7 A;  1ZV1 A;  2KNV A;  2KHH A;  1ZMW A;  2L4E A;  3IEC A;  1WGL A;  3FE3 A;  2ZTC A;  4G3O A;  1WGN A;  2CWB A;  2DI0 A;  1OQY A;  2MRO B;  1G3I A;  2DAK A;  2EKF A;  4F2L A;  2LVO C;  4HEO A;  3GLI E;  1HT1 E;  2DNA A;  3E46 A;  2JNH A;  2JZ0 A;  2DAI A;  2H5X A;  1XXH E;  1QZE A;  1OAI A;  1Q02 A;  1WR1 B;  2LVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...