1OAIA

Complex between tap uba domain and fxfg nucleoporin peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
b'PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR RNA EXPORT FACTOR
publication title Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
total genus 24
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oaiA00
1NV8A 3GLFE 4GEWA 2KNAA 4R71A 1PGYA 1DV0A 1CUKA 1BVSA 2O25A 2OOBA 3FRHA 3K9OA 2QNJA 2LVPC 2LVNC 1UFZA 3IECA 3FE3A 1DO2A 2EKFA 2WZJA 2H5XA 1VDLA 2MJ5B 1IFYA 1OAIA 3E46A 2L4FA 2QSFX 3GLIE 3B89A 2HWJA 1IM2A 1TR8A 1HT1E 1Y8GA 2K9DA 2JY8A 2DENA 2L2DA 1VEGA 2HAKA 2L4EA 1TTEA 1OKSA 2JY5A 4G3OA 2CWBA 2DAEA 4F1IA 1OQYA 3T6PA 2DAKA 3H4JA 2DKLA 4F2LA 2JZ0A 2MGWA 3LCVB 1T6OA 1F4IA 1XB2B 2KHHA 1WR1B 3F92A 1AIPC 1A5TA 3MMPA 1P3QQ 1R4GA 4Q7JA 2R0IA 1XXHE 1YLAA 1G4AE 1V92A 1G41A 2JUJA 1WGNA 1OTRA 1VEJA 2BWBA 1HJPA 3GLGE 1MN3A 1WJ7A 2EJSA 1VEKA 1SG9A 1IXSA 2DZLA 1Q02A 3LCUA 2DAIA 3E21A 1WGLA 1NV9A 2QHOB 2DAMA 1EFUB 2DI0A 2LVQD 2JZ1A 1HQYE 1QZEA 1JR3E 2LBCA 3GLHE 2G3QA 1ZMVA 4HEOA 1HT2E 1VQ1A 2ZTDA 1ZMUA 2LVOC 1ZMWA 1ZV1A 1E94E 2K0BX 4WP2A 2OO9A 3FRIA 2OOAA 2KNZA 2LVAA 2DNAA 2LTUA 2MROB 2MR9A 1GO5A 2EKKA 1T43A 3BBZA 1DO0A 2DHYA 2JY6B 1C7YA 4DBGB 2BWEA 4UN2B 2DAGA 2CP8A 2JP7A 5DFLA 2ZTCA 2B3TA 3IHPA 2JY7A 2JNHA 1WIVA 1KYIA 2RRUA 1WHCA 2KNVA 3K9PA 1G3IA 1VG5A 5JI2E
chains in the Genus database with same CATH superfamily
3GO8A 1IBKM 3GLFE 4OVZB 3SAVA 2G5GX 3TWLA 4LF9M 2OQ4A 2LNHC 5DYIA 5ITYA 2K47A 3J2PB 4A3VB 3U61A 4KODA 3AL0C 4I81A 4LJ6A 1OAOC 1I4WA 3HU1A 2UXBM 1IN8A 2FOIC 3MHVC 2BNKA 2LVPC 2N35A 1UFZA 3AJIB 4MM3B 4RF0A 5EP3A 2UXCM 4DR7M 5ITXE 3B74A 2MJ5B 3FTCA 2X8AA 2J7NA 1R2YA 4ITQA 2HKJA 3CGWA 3GP1A 2UXDM 5E6JA 1DGBA 4QNRA 2HWJA 4LGYA 5LMUM 3A45A 1IM2A 1Y8GA 3HU2A 3VFDA 3ILKA 2XLJA 2XSZD 2JY8A 1VEGA 3VDPA 4FD2A 2HCBA 3GPPA 5KPTA 4JI6M 4GKKM 3T6PA 2DAKA 4GC9A 2CFOA 3UJNA 1PRBA 1TDHA 2JZ0A 3GRUA 3SYLA 1D0MA 3LMMA 4GHAA 1W5SA 1FJGM 8CATA 1F4IA 1XB2B 2BJWA 2XH9A 3DZDA 1HNXM 2KRUA 2YR0A 2D7HA 4JI1M 3GRVA 3GRYA 3J81S 3MMPA 4L4UA 2DWZB 2APLA 4IBIA 2C5RA 4LJ8A 3SMSA 2Q2EB 4LJAA 1QDTA 4BB9A 1S3SA 2HHHM 4K0KM 2JWSA 1OJLA 2M60A 1KSFX 3D8LA 4QHTA 3GLIB 2CHQA 2UUCM 1OTRA 2F5PA 3KW6A 4LF5M 1GVNA 4WW0A 1VEJA 5EP1A 4DV7M 2BWBA 1HJPA 4TUWA 2VF7A 2DWLA 2DXIA 1OIZA 2LXEA 1OFIA 1R6BX 3W68A 1QDRA 2ZM6M 5BPVA 4B3RM 3HZJA 3A98B 4LRTA 2DZLA 3VLFB 3LCUA 2QQ8A 1R2ZA 3GLIA 3E21A 3U6DA 4XGIA 1XHBA 5EP4A 4I4LA 3WHLA 4DV2M 3W0LB 1Z5BA 3GPUA 4NSRA 4G6ZA 4DR6M 4GHLA 3IG5A 2G3QA 3E9SA 3VK8A 3VKGA 2L7IA 3L27A 4XBOA 4JI8M 1N32M 3I01M 2CHVA 2OPFA 1E9RA 4DV5M 2CRUA 2LWXA 4CISA 2X49A 3A46A 5H37D 3KSXA 5DNYA 2Z8YM 3J80S 1ZV1A 2V6ZM 2V1UA 3C58A 2KRKA 4FWDA 4MGKE 3FRIA 3TL4X 3PNYA 1FNNA 2KNZA 4MGZE 1DGGA 4L78A 1X37A 2DNAA 2LTUA 2MROB 4W5WA 1GO5A 2EKKA 2DHYA 4CIZA 1QAOA 3FYDA 4DBGB 4LF6M 2VQFM 5BR8M 2JP7A 2C98A 4DUYM 1G71A 4DV6M 2DWNA 3IHPA 1GJTA 3K8ZA 3QAUA 1WIVA 4FVMA 4L15A 2RRUA 2CV0A 3FUWA 1HNWM 2FH0A 1G3IA 2F4VM 1C1KA 4NRWA 4B7GA 4P17A 3DFZA 2BJVA 4GEWA 1SXJD 2FE8A 3HKPA 3I04M 4R71A 3GLGA 1RU3A 2VQEM 2FNAA 1CUKA 3FUVA 1J09A 4FWGA 2QZ4A 1E9SA 2O25A 3SMPA 2YNMD 5JI3E 4QNMA 3FRHA 3J7BA 4NC6A 3M6AA 4G4OA 4AKIA 3V76A 4G4NA 3U60A 1PJJA 1IBLM 4LFCM 5KQDA 3IECA 4GKJM 3I4VA 2EKFA 5FTMA 3GLHA 5IWAM 3SFZA 3JAMS 3D8BA 2DWMA 1N78A 3T38A 2WSCF 2I7NA 2R4EA 4LCBA 4EIWA 3U6EA 4IIWA 3GLIE 3KS8A 1MU5A 4MH0E 4M0WA 2XFTA 3SAUA 4B3SM 1GLNA 1D0LA 1PJTA 1TTEA 1OKSA 2JY5A 4G3OA 5FTLA 3UMMA 4F1IA 1OQYA 1OIPA 4ZPXA 3L2AA 4X66M 3U5ZB 3H4JA 2DKLA 5ITUA 2MGWA 4GH9A 3LCVB 3PXGA 2G8LA 1T6OA 1GJSA 3NWLA 1HR0M 3KOZE 1WR1B 1AIPC 2KZUA 1DGHB 2UU9M 4OVZA 2C96A 3AOGA 1P3QQ 1QVRA 2QCUA 3C3EA 2K6BA 1XC8A 2JA2A 3HWSA 4X65M 4Q7JA 2KEBA 3FTDA 4DV1M 4FCTA 1W5TA 5KPRA 2V1CA 4AI6A 3GQ3A 2ZAOA 2J5YA 1V92A 1JR3D 5EXXA 3U6SA 1G41A 1IY0A 3FTEA 3J27B 3U6MA 1XNQM 1HNZM 1L2BA 1NJFA 1NY5A 3KOWE 3GLGE 1WJ7A 2CV2A 1Q3BA 3R9XB 4HL4A 5EXTA 1SG9A 1PJQA 2XF3A 3KOYE 3Q8GA 4JI3M 1NV9A 4PCZA 1YSYA 2QENA 1Z59A 2R6FA 4M9ZA 3FUUA 2QPAA 3RGSA 2F5QA 2D7GA 4IBBA 1QZEA 4KLNA 5L8RF 3GLHE 3KSJA 4JN6A 4QOZC 4P16A 3HHWA 4HEOA 5C1BA 5ITRA 2VF8A 2CE7A 4D81A 3MK6A 2CHGA 1IXRC 1LV7A 4DV4M 1JQJC 3SARA 1IY1A 3KVWA 3HU3A 4GC5A 4QHSA 2F5SA 2WSFF 2K0BX 3QYBA 2R4JA 5FTJA 3PNVA 4LRSA 3FUTA 2JXNA 5F3WA 1HQCA 3BBZA 3T15A 3R8FA 1J5EM 1N33M 2C99A 2RGOA 4NOOB 2BWEA 2XSZA 1N77A 3CF0A 4UN2B 1L1ZA 1UM8A 4LG2A 2ZTCA 4IBFA 5FSWA 2Z7JA 2KA6B 1ZQ9A 2JNHA 2XZUA 3TPZA 2GQFA 4AG6A 1IXZA 2KXEA 3K9PA 3U6CA 3B7QA 3QYEA 2DHRA 2R45A 4IBEA 3AOEA 4KO8A 1TDZA 2KNAA 2UUAM 2KDLA 4OX9M 2CEAA 3CF6E 3GLFB 2QBYB 3U6PA 1KFVA 1NVMA 4CHTB 4OU7A 4RNAA 4DR2M 1IN5A 4BBAA 3H4MA 3FUXA 2L09A 3K9OA 3U6QA 4AKHA 2VIIA 1QZMA 2QNJA 1L8QA 3I51A 2LVNC 3BOSA 1GL6A 3AOEC 1K82A 1D0KA 4YHHM 1DO2A 1ZAEA 2QBYA 7CATA 1VDLA 1IFYA 1IN6A 1Q3CA 1TGUA 1IBMM 1QQWA 1OAIA 1GKIA 3U6OA 3L25A 2W82A 3B89A 2A5YB 4D80A 2NQ8C 4L16A 1TR8A 3SATA 1EE8A 2MH8A 2ZANA 3KDSE 4IBGA 4DV0M 3U6LA 4M9XA 1JB0F 2L4EA 2DENA 3SHGB 5FLXS 2ZBKB 3SBJA 2LH0A 3FKEA 2CWBA 4B3MM 4B7HA 3DOAA 1XWIA 4NL4H 4PD2A 4F2LA 3FD9A 4MGYE 2XFSA 1N34M 2KHHA 4II7A 3HHZA 3Q8XA 1QAQA 4GMQA 2Y20A 4IBKA 4PDIA 3FYCA 4JI2M 1Q39A 1R4GA 5E26A 2H1RA 4I5SA 2RGHA 3TQSA 2LHCA 2QP9X 2R0IA 4LGMA 1NO1A 4Y28F 1PJIA 3SAWA 5KO3A 1R5LA 5EP2A 3QWLA 1IN4A 3DA1A 4Z8XA 3B7ZA 4DR5M 1SXJB 2FS1A 3RFWA 4LF4M 4NXMM 4NRVA 3CF2A 1Z6TA 2XZFA 1MN3A 3JR5A 3KOXE 5EXPA 4IJEA 4L6V6 2EJSA 3SYKA 1XMQM 3NBIA 2DAIA 3ZH9B 1NHGC 1SXJA 2CUZA 4IJFA 2QHOB 1NHWC 2DI0A 2GNOA 3K92A 2Y0TA 4LJ4A 2RKOA 2LVQD 2WSEF 3HHXA 1N75A 1HQYE 3THGA 3FTFA 3KFUG 1V33A 3LW5F 4LJ7A 5KPZA 3U5ZA 2LBCA 2FFJA 3HY5A 4FW9A 3UZUA 1N36M 2X4AA 1K3XA 1XXHB 1Z5AA 1DGHA 3IG8A 2R44A 1SXJC 4MB7A 1ZMWA 4OW0A 1E94E 2YFQA 4FCWA 2OO9A 3LVVA 4XK8F 5IT9S 4G4RA 2VDBB 5IZ7D 2LVAA 2KW0A 4MGHA 5EJCA 3SASA 4M9SA 4DR4M 1T43A 3L26A 1C7YA 2JY6B 3TWKA 4JI5M 4NSOB 4YY3M 4G4QA 5C18A 1XXHA 2R65A 2O5RA 5DYGA 4LFAM 2J7OA 4JXJA 2KZSA 2DAGA 2CP8A 3M0EA 5DFLA 1G8PA 2B3TA 5ITQA 2D7EA 1R7RA 2XEPA 3L28A 5GKNA 1EIJA 1KYIA 1V34A 2CV1A 4LZJA 3ZCBB 4JYAM 2DZNB 4PT5A 3TWMA 1VG5A 3C9PA 5JI2E 1NV8A 5FTKA 1NJGA 3TE6A 4Z6YA 4AZFA 1L2DA 3GQ5A 1GL7A 3C3DA 1PGYA 3KP1E 3UGJA 4B7FA 1NSFA 2XGNA 1DV0A 4AKGA 3WHKA 1BVSA 1ORYB 2E5LM 3VK7A 2O01F 3T1YM 2OOBA 4LJ9A 2LHGA 4X64M 4ANRA 1G59A 1MJGM 4HLQA 3M7GA 3CTWB 2HL7A 3B7NA 2UUBM 3RE8A 2ZAMA 3FE3A 3LQRA 3GRRA 1LTMA 2WZJA 3UK6A 1JR3A 4R3DA 2H5XA 3VDUA 1OFHA 4NXNM 3AFHA 3K2LA 3E46A 5LMNM 2R18A 2L4FA 2QSFX 4AG5A 3I4YA 1SXJE 1HT1E 3KS4A 1J7KA 3VKHA 2K9DA 2L2DA 2DVWB 2HAKA 3GPXA 3JR4A 1K3WA 1QUSA 1YE9A 3KXEC 2DAEA 2EO2A 2L6OA 4KHPM 3B9PA 4D82A 3HJ8A 4IBJA 4R7GA 5FTNA 4JI7M 3F92A 1NNUC 1T3TA 4FCVA 2F5NA 4JV5M 1AUAA 1A5TA 4B08A 3SC3A 3PVSA 2F5OA 3GLFA 4MGIE 3HX3A 2Z4RA 2R46A 3AKZA 3GQ4A 1D2NA 3NBXX 1XXHE 4RF1A 1YLAA 4DR3M 2M5ZA 1IXSB 1G4AE 1VDDA 2JUJA 4LF7M 2YQZA 1WGNA 4S12A 5EXSA 4JI0M 2L7HA 4M0DA 1TF0B 4DUZM 4PDGA 2EA0A 3W67A 3T1HM 4I8OA 1E32A 4FWHA 4AW4A 1XMOM 4GITA 5IREB 5ITXA 3GLGB 3HHYA 5ITTA 1GABA 2AHMA 1VEKA 1IY2A 1H6UA 1IXSA 3E4RA 4LY6A 3L29A 1Q02A 1NNJA 3A42A 1WGLA 1PM5A 1PJSA 3W0FA 2ERCA 3ZQJA 3KP0E 2DZOB 2DAMA 1EFUB 5KQ8A 1IQPA 2JZ1A 3LQQA 4IBDA 4CJ6A 2R62A 4X62M 3U60B 2I7PA 4KT0F 2C9OA 3EIEA 1JR3E 2Z4SA 3RGPA 1ZMVA 2Z3XA 4REZA 1DGFA 3GLHB 1HT2E 1VQ1A 4LZZA 4DR1M 3PFIA 2ZTDA 4LFBM 2Y0QA 3GPYA 1ZMUA 4CGYB 1L2CA 2Y21A 4LF8M 2LVOC 4LJ5A 4BLCA 1TH3A 4WP2A 1L1TA 3LVWA 1QYRA 4AQYM 2EUCA 2OOAA 1I94M 1TH2A 4L8RC 5EQTA 2MR9A 3BXWA 1WXQA 4QOSA 4RKUF 3ZC7B 1DO0A 1QANA 3AV0A 4GIPA 2C9CA 2P5TA 1TH4A 1YUBA 3OTOM 3U61B 1MX0A 4GRIA 4WURA 3EIHA 3SHFA 3HGIA 1QAMA 1XNRM 3MJ5A 4JI4M 4B3TM 2JY7A 3J7AS 1NY6A 5A2QS 1IN7A 1QUTA 1WHCA 1Z5CA 2KNVA 3HJQA 3HJSA 4IBCA 4DV3M 3K1JA
chains in the Genus database with same CATH topology
1NV8A 3GLFE 4GEWA 2KNAA 4R71A 1PGYA 1DV0A 1CUKA 1BVSA 2O25A 2OOBA 3FRHA 3K9OA 2QNJA 2LVPC 2LVNC 1UFZA 3IECA 3FE3A 1DO2A 2EKFA 2WZJA 2H5XA 1VDLA 2MJ5B 1IFYA 1OAIA 3E46A 2L4FA 2QSFX 3GLIE 3B89A 2HWJA 1IM2A 1TR8A 1HT1E 1Y8GA 2K9DA 2JY8A 2DENA 2L2DA 1VEGA 2HAKA 2L4EA 1TTEA 1OKSA 2JY5A 4G3OA 2CWBA 2DAEA 4F1IA 1OQYA 3T6PA 2DAKA 3H4JA 2DKLA 4F2LA 2JZ0A 2MGWA 3LCVB 1T6OA 1F4IA 1XB2B 2KHHA 1WR1B 3F92A 1AIPC 1A5TA 3MMPA 1P3QQ 1R4GA 4Q7JA 2R0IA 1XXHE 1YLAA 1G4AE 1V92A 1G41A 2JUJA 1WGNA 1OTRA 1VEJA 2BWBA 1HJPA 3GLGE 1MN3A 1WJ7A 2EJSA 1VEKA 1SG9A 1IXSA 2DZLA 1Q02A 3LCUA 2DAIA 3E21A 1WGLA 1NV9A 2QHOB 2DAMA 1EFUB 2DI0A 2LVQD 2JZ1A 1HQYE 1QZEA 1JR3E 2LBCA 3GLHE 2G3QA 1ZMVA 4HEOA 1HT2E 1VQ1A 2ZTDA 1ZMUA 2LVOC 1ZMWA 1ZV1A 1E94E 2K0BX 4WP2A 2OO9A 3FRIA 2OOAA 2KNZA 2LVAA 2DNAA 2LTUA 2MROB 2MR9A 1GO5A 2EKKA 1T43A 3BBZA 1DO0A 2DHYA 2JY6B 1C7YA 4DBGB 2BWEA 4UN2B 2DAGA 2CP8A 2JP7A 5DFLA 2ZTCA 2B3TA 3IHPA 2JY7A 2JNHA 1WIVA 1KYIA 2RRUA 1WHCA 2KNVA 3K9PA 1G3IA 1VG5A 5JI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV8 A;  3GLF E;  4GEW A;  2KNA A;  4R71 A;  1PGY A;  1DV0 A;  1CUK A;  1BVS A;  2O25 A;  2OOB A;  3FRH A;  3K9O A;  2QNJ A;  2LVP C;  2LVN C;  1UFZ A;  3IEC A;  3FE3 A;  1DO2 A;  2EKF A;  2WZJ A;  2H5X A;  1VDL A;  2MJ5 B;  1IFY A;  1OAI A;  3E46 A;  2L4F A;  2QSF X;  3GLI E;  3B89 A;  2HWJ A;  1IM2 A;  1TR8 A;  1HT1 E;  1Y8G A;  2K9D A;  2JY8 A;  2DEN A;  2L2D A;  1VEG A;  2HAK A;  2L4E A;  1TTE A;  1OKS A;  2JY5 A;  4G3O A;  2CWB A;  2DAE A;  4F1I A;  1OQY A;  3T6P A;  2DAK A;  3H4J A;  2DKL A;  4F2L A;  2JZ0 A;  2MGW A;  3LCV B;  1T6O A;  1F4I A;  1XB2 B;  2KHH A;  1WR1 B;  3F92 A;  1AIP C;  1A5T A;  3MMP A;  1P3Q Q;  1R4G A;  4Q7J A;  2R0I A;  1XXH E;  1YLA A;  1G4A E;  1V92 A;  1G41 A;  2JUJ A;  1WGN A;  1OTR A;  1VEJ A;  2BWB A;  1HJP A;  3GLG E;  1MN3 A;  1WJ7 A;  2EJS A;  1VEK A;  1SG9 A;  1IXS A;  2DZL A;  1Q02 A;  3LCU A;  2DAI A;  3E21 A;  1WGL A;  1NV9 A;  2QHO B;  2DAM A;  1EFU B;  2DI0 A;  2LVQ D;  2JZ1 A;  1HQY E;  1QZE A;  1JR3 E;  2LBC A;  3GLH E;  2G3Q A;  1ZMV A;  4HEO A;  1HT2 E;  1VQ1 A;  2ZTD A;  1ZMU A;  2LVO C;  1ZMW A;  1ZV1 A;  1E94 E;  2K0B X;  4WP2 A;  2OO9 A;  3FRI A;  2OOA A;  2KNZ A;  2LVA A;  2DNA A;  2LTU A;  2MRO B;  2MR9 A;  1GO5 A;  2EKK A;  1T43 A;  3BBZ A;  1DO0 A;  2DHY A;  2JY6 B;  1C7Y A;  4DBG B;  2BWE A;  4UN2 B;  2DAG A;  2CP8 A;  2JP7 A;  5DFL A;  2ZTC A;  2B3T A;  3IHP A;  2JY7 A;  2JNH A;  1WIV A;  1KYI A;  2RRU A;  1WHC A;  2KNV A;  3K9P A;  1G3I A;  1VG5 A;  5JI2 E; 
#chains in the Genus database with same CATH topology
 3GO8 A;  1IBK M;  3GLF E;  4OVZ B;  3SAV A;  2G5G X;  3TWL A;  4LF9 M;  2OQ4 A;  2LNH C;  5DYI A;  5ITY A;  2K47 A;  3J2P B;  4A3V B;  3U61 A;  4KOD A;  3AL0 C;  4I81 A;  4LJ6 A;  1OAO C;  1I4W A;  3HU1 A;  2UXB M;  1IN8 A;  2FOI C;  3MHV C;  2BNK A;  2LVP C;  2N35 A;  1UFZ A;  3AJI B;  4MM3 B;  4RF0 A;  5EP3 A;  2UXC M;  4DR7 M;  5ITX E;  3B74 A;  2MJ5 B;  3FTC A;  2X8A A;  2J7N A;  1R2Y A;  4ITQ A;  2HKJ A;  3CGW A;  3GP1 A;  2UXD M;  5E6J A;  1DGB A;  4QNR A;  2HWJ A;  4LGY A;  5LMU M;  3A45 A;  1IM2 A;  1Y8G A;  3HU2 A;  3VFD A;  3ILK A;  2XLJ A;  2XSZ D;  2JY8 A;  1VEG A;  3VDP A;  4FD2 A;  2HCB A;  3GPP A;  5KPT A;  4JI6 M;  4GKK M;  3T6P A;  2DAK A;  4GC9 A;  2CFO A;  3UJN A;  1PRB A;  1TDH A;  2JZ0 A;  3GRU A;  3SYL A;  1D0M A;  3LMM A;  4GHA A;  1W5S A;  1FJG M;  8CAT A;  1F4I A;  1XB2 B;  2BJW A;  2XH9 A;  3DZD A;  1HNX M;  2KRU A;  2YR0 A;  2D7H A;  4JI1 M;  3GRV A;  3GRY A;  3J81 S;  3MMP A;  4L4U A;  2DWZ B;  2APL A;  4IBI A;  2C5R A;  4LJ8 A;  3SMS A;  2Q2E B;  4LJA A;  1QDT A;  4BB9 A;  1S3S A;  2HHH M;  4K0K M;  2JWS A;  1OJL A;  2M60 A;  1KSF X;  3D8L A;  4QHT A;  3GLI B;  2CHQ A;  2UUC M;  1OTR A;  2F5P A;  3KW6 A;  4LF5 M;  1GVN A;  4WW0 A;  1VEJ A;  5EP1 A;  4DV7 M;  2BWB A;  1HJP A;  4TUW A;  2VF7 A;  2DWL A;  2DXI A;  1OIZ A;  2LXE A;  1OFI A;  1R6B X;  3W68 A;  1QDR A;  2ZM6 M;  5BPV A;  4B3R M;  3HZJ A;  3A98 B;  4LRT A;  2DZL A;  3VLF B;  3LCU A;  2QQ8 A;  1R2Z A;  3GLI A;  3E21 A;  3U6D A;  4XGI A;  1XHB A;  5EP4 A;  4I4L A;  3WHL A;  4DV2 M;  3W0L B;  1Z5B A;  3GPU A;  4NSR A;  4G6Z A;  4DR6 M;  4GHL A;  3IG5 A;  2G3Q A;  3E9S A;  3VK8 A;  3VKG A;  2L7I A;  3L27 A;  4XBO A;  4JI8 M;  1N32 M;  3I01 M;  2CHV A;  2OPF A;  1E9R A;  4DV5 M;  2CRU A;  2LWX A;  4CIS A;  2X49 A;  3A46 A;  5H37 D;  3KSX A;  5DNY A;  2Z8Y M;  3J80 S;  1ZV1 A;  2V6Z M;  2V1U A;  3C58 A;  2KRK A;  4FWD A;  4MGK E;  3FRI A;  3TL4 X;  3PNY A;  1FNN A;  2KNZ A;  4MGZ E;  1DGG A;  4L78 A;  1X37 A;  2DNA A;  2LTU A;  2MRO B;  4W5W A;  1GO5 A;  2EKK A;  2DHY A;  4CIZ A;  1QAO A;  3FYD A;  4DBG B;  4LF6 M;  2VQF M;  5BR8 M;  2JP7 A;  2C98 A;  4DUY M;  1G71 A;  4DV6 M;  2DWN A;  3IHP A;  1GJT A;  3K8Z A;  3QAU A;  1WIV A;  4FVM A;  4L15 A;  2RRU A;  2CV0 A;  3FUW A;  1HNW M;  2FH0 A;  1G3I A;  2F4V M;  1C1K A;  4NRW A;  4B7G A;  4P17 A;  3DFZ A;  2BJV A;  4GEW A;  1SXJ D;  2FE8 A;  3HKP A;  3I04 M;  4R71 A;  3GLG A;  1RU3 A;  2VQE M;  2FNA A;  1CUK A;  3FUV A;  1J09 A;  4FWG A;  2QZ4 A;  1E9S A;  2O25 A;  3SMP A;  2YNM D;  5JI3 E;  4QNM A;  3FRH A;  3J7B A;  4NC6 A;  3M6A A;  4G4O A;  4AKI A;  3V76 A;  4G4N A;  3U60 A;  1PJJ A;  1IBL M;  4LFC M;  5KQD A;  3IEC A;  4GKJ M;  3I4V A;  2EKF A;  5FTM A;  3GLH A;  5IWA M;  3SFZ A;  3JAM S;  3D8B A;  2DWM A;  1N78 A;  3T38 A;  2WSC F;  2I7N A;  2R4E A;  4LCB A;  4EIW A;  3U6E A;  4IIW A;  3GLI E;  3KS8 A;  1MU5 A;  4MH0 E;  4M0W A;  2XFT A;  3SAU A;  4B3S M;  1GLN A;  1D0L A;  1PJT A;  1TTE A;  1OKS A;  2JY5 A;  4G3O A;  5FTL A;  3UMM A;  4F1I A;  1OQY A;  1OIP A;  4ZPX A;  3L2A A;  4X66 M;  3U5Z B;  3H4J A;  2DKL A;  5ITU A;  2MGW A;  4GH9 A;  3LCV B;  3PXG A;  2G8L A;  1T6O A;  1GJS A;  3NWL A;  1HR0 M;  3KOZ E;  1WR1 B;  1AIP C;  2KZU A;  1DGH B;  2UU9 M;  4OVZ A;  2C96 A;  3AOG A;  1P3Q Q;  1QVR A;  2QCU A;  3C3E A;  2K6B A;  1XC8 A;  2JA2 A;  3HWS A;  4X65 M;  4Q7J A;  2KEB A;  3FTD A;  4DV1 M;  4FCT A;  1W5T A;  5KPR A;  2V1C A;  4AI6 A;  3GQ3 A;  2ZAO A;  2J5Y A;  1V92 A;  1JR3 D;  5EXX A;  3U6S A;  1G41 A;  1IY0 A;  3FTE A;  3J27 B;  3U6M A;  1XNQ M;  1HNZ M;  1L2B A;  1NJF A;  1NY5 A;  3KOW E;  3GLG E;  1WJ7 A;  2CV2 A;  1Q3B A;  3R9X B;  4HL4 A;  5EXT A;  1SG9 A;  1PJQ A;  2XF3 A;  3KOY E;  3Q8G A;  4JI3 M;  1NV9 A;  4PCZ A;  1YSY A;  2QEN A;  1Z59 A;  2R6F A;  4M9Z A;  3FUU A;  2QPA A;  3RGS A;  2F5Q A;  2D7G A;  4IBB A;  1QZE A;  4KLN A;  5L8R F;  3GLH E;  3KSJ A;  4JN6 A;  4QOZ C;  4P16 A;  3HHW A;  4HEO A;  5C1B A;  5ITR A;  2VF8 A;  2CE7 A;  4D81 A;  3MK6 A;  2CHG A;  1IXR C;  1LV7 A;  4DV4 M;  1JQJ C;  3SAR A;  1IY1 A;  3KVW A;  3HU3 A;  4GC5 A;  4QHS A;  2F5S A;  2WSF F;  2K0B X;  3QYB A;  2R4J A;  5FTJ A;  3PNV A;  4LRS A;  3FUT A;  2JXN A;  5F3W A;  1HQC A;  3BBZ A;  3T15 A;  3R8F A;  1J5E M;  1N33 M;  2C99 A;  2RGO A;  4NOO B;  2BWE A;  2XSZ A;  1N77 A;  3CF0 A;  4UN2 B;  1L1Z A;  1UM8 A;  4LG2 A;  2ZTC A;  4IBF A;  5FSW A;  2Z7J A;  2KA6 B;  1ZQ9 A;  2JNH A;  2XZU A;  3TPZ A;  2GQF A;  4AG6 A;  1IXZ A;  2KXE A;  3K9P A;  3U6C A;  3B7Q A;  3QYE A;  2DHR A;  2R45 A;  4IBE A;  3AOE A;  4KO8 A;  1TDZ A;  2KNA A;  2UUA M;  2KDL A;  4OX9 M;  2CEA A;  3CF6 E;  3GLF B;  2QBY B;  3U6P A;  1KFV A;  1NVM A;  4CHT B;  4OU7 A;  4RNA A;  4DR2 M;  1IN5 A;  4BBA A;  3H4M A;  3FUX A;  2L09 A;  3K9O A;  3U6Q A;  4AKH A;  2VII A;  1QZM A;  2QNJ A;  1L8Q A;  3I51 A;  2LVN C;  3BOS A;  1GL6 A;  3AOE C;  1K82 A;  1D0K A;  4YHH M;  1DO2 A;  1ZAE A;  2QBY A;  7CAT A;  1VDL A;  1IFY A;  1IN6 A;  1Q3C A;  1TGU A;  1IBM M;  1QQW A;  1OAI A;  1GKI A;  3U6O A;  3L25 A;  2W82 A;  3B89 A;  2A5Y B;  4D80 A;  2NQ8 C;  4L16 A;  1TR8 A;  3SAT A;  1EE8 A;  2MH8 A;  2ZAN A;  3KDS E;  4IBG A;  4DV0 M;  3U6L A;  4M9X A;  1JB0 F;  2L4E A;  2DEN A;  3SHG B;  5FLX S;  2ZBK B;  3SBJ A;  2LH0 A;  3FKE A;  2CWB A;  4B3M M;  4B7H A;  3DOA A;  1XWI A;  4NL4 H;  4PD2 A;  4F2L A;  3FD9 A;  4MGY E;  2XFS A;  1N34 M;  2KHH A;  4II7 A;  3HHZ A;  3Q8X A;  1QAQ A;  4GMQ A;  2Y20 A;  4IBK A;  4PDI A;  3FYC A;  4JI2 M;  1Q39 A;  1R4G A;  5E26 A;  2H1R A;  4I5S A;  2RGH A;  3TQS A;  2LHC A;  2QP9 X;  2R0I A;  4LGM A;  1NO1 A;  4Y28 F;  1PJI A;  3SAW A;  5KO3 A;  1R5L A;  5EP2 A;  3QWL A;  1IN4 A;  3DA1 A;  4Z8X A;  3B7Z A;  4DR5 M;  1SXJ B;  2FS1 A;  3RFW A;  4LF4 M;  4NXM M;  4NRV A;  3CF2 A;  1Z6T A;  2XZF A;  1MN3 A;  3JR5 A;  3KOX E;  5EXP A;  4IJE A;  4L6V 6;  2EJS A;  3SYK A;  1XMQ M;  3NBI A;  2DAI A;  3ZH9 B;  1NHG C;  1SXJ A;  2CUZ A;  4IJF A;  2QHO B;  1NHW C;  2DI0 A;  2GNO A;  3K92 A;  2Y0T A;  4LJ4 A;  2RKO A;  2LVQ D;  2WSE F;  3HHX A;  1N75 A;  1HQY E;  3THG A;  3FTF A;  3KFU G;  1V33 A;  3LW5 F;  4LJ7 A;  5KPZ A;  3U5Z A;  2LBC A;  2FFJ A;  3HY5 A;  4FW9 A;  3UZU A;  1N36 M;  2X4A A;  1K3X A;  1XXH B;  1Z5A A;  1DGH A;  3IG8 A;  2R44 A;  1SXJ C;  4MB7 A;  1ZMW A;  4OW0 A;  1E94 E;  2YFQ A;  4FCW A;  2OO9 A;  3LVV A;  4XK8 F;  5IT9 S;  4G4R A;  2VDB B;  5IZ7 D;  2LVA A;  2KW0 A;  4MGH A;  5EJC A;  3SAS A;  4M9S A;  4DR4 M;  1T43 A;  3L26 A;  1C7Y A;  2JY6 B;  3TWK A;  4JI5 M;  4NSO B;  4YY3 M;  4G4Q A;  5C18 A;  1XXH A;  2R65 A;  2O5R A;  5DYG A;  4LFA M;  2J7O A;  4JXJ A;  2KZS A;  2DAG A;  2CP8 A;  3M0E A;  5DFL A;  1G8P A;  2B3T A;  5ITQ A;  2D7E A;  1R7R A;  2XEP A;  3L28 A;  5GKN A;  1EIJ A;  1KYI A;  1V34 A;  2CV1 A;  4LZJ A;  3ZCB B;  4JYA M;  2DZN B;  4PT5 A;  3TWM A;  1VG5 A;  3C9P A;  5JI2 E;  1NV8 A;  5FTK A;  1NJG A;  3TE6 A;  4Z6Y A;  4AZF A;  1L2D A;  3GQ5 A;  1GL7 A;  3C3D A;  1PGY A;  3KP1 E;  3UGJ A;  4B7F A;  1NSF A;  2XGN A;  1DV0 A;  4AKG A;  3WHK A;  1BVS A;  1ORY B;  2E5L M;  3VK7 A;  2O01 F;  3T1Y M;  2OOB A;  4LJ9 A;  2LHG A;  4X64 M;  4ANR A;  1G59 A;  1MJG M;  4HLQ A;  3M7G A;  3CTW B;  2HL7 A;  3B7N A;  2UUB M;  3RE8 A;  2ZAM A;  3FE3 A;  3LQR A;  3GRR A;  1LTM A;  2WZJ A;  3UK6 A;  1JR3 A;  4R3D A;  2H5X A;  3VDU A;  1OFH A;  4NXN M;  3AFH A;  3K2L A;  3E46 A;  5LMN M;  2R18 A;  2L4F A;  2QSF X;  4AG5 A;  3I4Y A;  1SXJ E;  1HT1 E;  3KS4 A;  1J7K A;  3VKH A;  2K9D A;  2L2D A;  2DVW B;  2HAK A;  3GPX A;  3JR4 A;  1K3W A;  1QUS A;  1YE9 A;  3KXE C;  2DAE A;  2EO2 A;  2L6O A;  4KHP M;  3B9P A;  4D82 A;  3HJ8 A;  4IBJ A;  4R7G A;  5FTN A;  4JI7 M;  3F92 A;  1NNU C;  1T3T A;  4FCV A;  2F5N A;  4JV5 M;  1AUA A;  1A5T A;  4B08 A;  3SC3 A;  3PVS A;  2F5O A;  3GLF A;  4MGI E;  3HX3 A;  2Z4R A;  2R46 A;  3AKZ A;  3GQ4 A;  1D2N A;  3NBX X;  1XXH E;  4RF1 A;  1YLA A;  4DR3 M;  2M5Z A;  1IXS B;  1G4A E;  1VDD A;  2JUJ A;  4LF7 M;  2YQZ A;  1WGN A;  4S12 A;  5EXS A;  4JI0 M;  2L7H A;  4M0D A;  1TF0 B;  4DUZ M;  4PDG A;  2EA0 A;  3W67 A;  3T1H M;  4I8O A;  1E32 A;  4FWH A;  4AW4 A;  1XMO M;  4GIT A;  5IRE B;  5ITX A;  3GLG B;  3HHY A;  5ITT A;  1GAB A;  2AHM A;  1VEK A;  1IY2 A;  1H6U A;  1IXS A;  3E4R A;  4LY6 A;  3L29 A;  1Q02 A;  1NNJ A;  3A42 A;  1WGL A;  1PM5 A;  1PJS A;  3W0F A;  2ERC A;  3ZQJ A;  3KP0 E;  2DZO B;  2DAM A;  1EFU B;  5KQ8 A;  1IQP A;  2JZ1 A;  3LQQ A;  4IBD A;  4CJ6 A;  2R62 A;  4X62 M;  3U60 B;  2I7P A;  4KT0 F;  2C9O A;  3EIE A;  1JR3 E;  2Z4S A;  3RGP A;  1ZMV A;  2Z3X A;  4REZ A;  1DGF A;  3GLH B;  1HT2 E;  1VQ1 A;  4LZZ A;  4DR1 M;  3PFI A;  2ZTD A;  4LFB M;  2Y0Q A;  3GPY A;  1ZMU A;  4CGY B;  1L2C A;  2Y21 A;  4LF8 M;  2LVO C;  4LJ5 A;  4BLC A;  1TH3 A;  4WP2 A;  1L1T A;  3LVW A;  1QYR A;  4AQY M;  2EUC A;  2OOA A;  1I94 M;  1TH2 A;  4L8R C;  5EQT A;  2MR9 A;  3BXW A;  1WXQ A;  4QOS A;  4RKU F;  3ZC7 B;  1DO0 A;  1QAN A;  3AV0 A;  4GIP A;  2C9C A;  2P5T A;  1TH4 A;  1YUB A;  3OTO M;  3U61 B;  1MX0 A;  4GRI A;  4WUR A;  3EIH A;  3SHF A;  3HGI A;  1QAM A;  1XNR M;  3MJ5 A;  4JI4 M;  4B3T M;  2JY7 A;  3J7A S;  1NY6 A;  5A2Q S;  1IN7 A;  1QUT A;  1WHC A;  1Z5C A;  2KNV A;  3HJQ A;  3HJS A;  4IBC A;  4DV3 M;  3K1J A; 
#chains in the Genus database with same CATH homology
 1NV8 A;  3GLF E;  4GEW A;  2KNA A;  4R71 A;  1PGY A;  1DV0 A;  1CUK A;  1BVS A;  2O25 A;  2OOB A;  3FRH A;  3K9O A;  2QNJ A;  2LVP C;  2LVN C;  1UFZ A;  3IEC A;  3FE3 A;  1DO2 A;  2EKF A;  2WZJ A;  2H5X A;  1VDL A;  2MJ5 B;  1IFY A;  1OAI A;  3E46 A;  2L4F A;  2QSF X;  3GLI E;  3B89 A;  2HWJ A;  1IM2 A;  1TR8 A;  1HT1 E;  1Y8G A;  2K9D A;  2JY8 A;  2DEN A;  2L2D A;  1VEG A;  2HAK A;  2L4E A;  1TTE A;  1OKS A;  2JY5 A;  4G3O A;  2CWB A;  2DAE A;  4F1I A;  1OQY A;  3T6P A;  2DAK A;  3H4J A;  2DKL A;  4F2L A;  2JZ0 A;  2MGW A;  3LCV B;  1T6O A;  1F4I A;  1XB2 B;  2KHH A;  1WR1 B;  3F92 A;  1AIP C;  1A5T A;  3MMP A;  1P3Q Q;  1R4G A;  4Q7J A;  2R0I A;  1XXH E;  1YLA A;  1G4A E;  1V92 A;  1G41 A;  2JUJ A;  1WGN A;  1OTR A;  1VEJ A;  2BWB A;  1HJP A;  3GLG E;  1MN3 A;  1WJ7 A;  2EJS A;  1VEK A;  1SG9 A;  1IXS A;  2DZL A;  1Q02 A;  3LCU A;  2DAI A;  3E21 A;  1WGL A;  1NV9 A;  2QHO B;  2DAM A;  1EFU B;  2DI0 A;  2LVQ D;  2JZ1 A;  1HQY E;  1QZE A;  1JR3 E;  2LBC A;  3GLH E;  2G3Q A;  1ZMV A;  4HEO A;  1HT2 E;  1VQ1 A;  2ZTD A;  1ZMU A;  2LVO C;  1ZMW A;  1ZV1 A;  1E94 E;  2K0B X;  4WP2 A;  2OO9 A;  3FRI A;  2OOA A;  2KNZ A;  2LVA A;  2DNA A;  2LTU A;  2MRO B;  2MR9 A;  1GO5 A;  2EKK A;  1T43 A;  3BBZ A;  1DO0 A;  2DHY A;  2JY6 B;  1C7Y A;  4DBG B;  2BWE A;  4UN2 B;  2DAG A;  2CP8 A;  2JP7 A;  5DFL A;  2ZTC A;  2B3T A;  3IHP A;  2JY7 A;  2JNH A;  1WIV A;  1KYI A;  2RRU A;  1WHC A;  2KNV A;  3K9P A;  1G3I A;  1VG5 A;  5JI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...