4KHPM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4khpM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4khpM02
3JR4A 4DUYM 1TDZA 2UXBM 3U6LA 4DR2M 3GP1A 4LF6M 1IBKM 5LMNM 3U6PA 1L1TA 4LFAM 4PD2A 2XZFA 3J7AS 4JYAM 2F4VM 1L2DA 4GKJM 4OX9M 4DV7M 4DV1M 1XNQM 3JAMS 1HNZM 1PM5A 1N36M 4B3SM 4G4RA 1J5EM 1Z5AA 1N32M 4X66M 4DV2M 1HR0M 2VQEM 3SAUA 3T1HM 2HHHM 2UUBM 4YHHM 2F5QA 5ITXA 5BR8M 3U6SA 3VK8A 2UXCM 3GQ3A 3GPXA 3SATA 1NNJA 4AQYM 4G4QA 1IBMM 1XNRM 5ITQA 5FLXS 1EE8A 4YY3M 2UU9M 4NRWA 4DV5M 4JI8M 4JI7M 4DR7M 1Q3BA 3SAVA 4LF7M 4B3MM 4DR6M 2OQ4A 2ZM6M 1Q3CA 3GPUA 4DR5M 3TWLA 1PJJA 2E5LM 2HKJA 4PDGA 4NXMM 5A2QS 4DR3M 2VQFM 4MB7A 4NRVA 3JR5A 5ITYA 1I94M 5ITTA 3A46A 3J81S 4DV4M 3SARA 4LF5M 4JV5M 4JI4M 4DV0M 4X64M 4ITQA 3U6MA 4B3TM 4K0KM 4JI3M 2OPFA 4PCZA 1Q39A 4JI0M 3U6CA 5IT9S 4B3RM 1R2YA 4G4NA 3OTOM 3SBJA 3GO8A 5ITRA 2F5SA 4DV6M 3VK7A 3U6EA 5ITUA 4JI1M 1TDHA 3T1YM 5IWAM 1N33M 3GQ5A 3GPPA 1L2BA 4DR4M 1Z59A 1Z5CA 1L1ZA 4JI5M 3W0FA 1N34M 2Q2EB 1MX0A 1XMQM 5LMUM 4LF4M 3C58A 4JI2M 4DR1M 2UUCM 1HNWM 3SAWA 4GKKM 2UXDM 3U6DA 4X62M 1K3WA 4PDIA 4CISA 2F5NA 1HNXM 2EA0A 3U6QA 3A45A 3A42A 3TWMA 1XC8A 3SASA 3J80S 2XZUA 2F5PA 4DV3M 4G4OA 1FJGM 4LF9M 3U6OA 4LF8M 2F5OA 1XMOM 1KFVA 1MU5A 4NXNM 4X65M 4DUZM 3DOAA 4JI6M 1PJIA 1L2CA 3GPYA 2UUAM 3GQ4A 5ITXE 4LFBM 3TWKA 1R2ZA 4KHPM 1Z5BA 2ZBKB 1IBLM 4LFCM 1K3XA 1K82A
chains in the Genus database with same CATH superfamily
3JR4A 2R45A 2UXBM 3M7GA 1QYRA 3MK6A 2CHQA 1P3QQ 4GH9A 1IBKM 4LFAM 2DAKA 4PD2A 4OVZB 1S3SA 1DGHA 2DNAA 2F4VM 3TQSA 4DV7M 1DGGA 4FWHA 4WURA 3GLHE 4XBOA 2VDBB 3KP0E 3KP1E 2JY7A 5C1BA 1PM5A 1OTRA 1WHCA 4IBIA 3FD9A 3LQRA 3K9OA 5KQDA 5EXSA 1WIVA 4TUWA 5DYGA 2CE7A 4A3VB 3K1JA 2XEPA 1NHGC 1NY5A 3CTWB 3SAUA 3T1HM 1NY6A 2X49A 1TH3A 1H6UA 2V6ZM 3C9PA 2VF8A 2RGOA 4I4LA 2DZOB 3WHKA 1UM8A 2DWNA 2CV2A 1EFUB 3F92A 4LZZA 1NNJA 5KPTA 1GJTA 2D7HA 1HJPA 4L8RC 4F2LA 3T15A 1W5SA 3FTDA 5ITQA 5FLXS 1EE8A 1XNRM 1DO2A 3B7ZA 4ZPXA 1ZQ9A 2YNMD 4JI7M 5EXXA 2XF3A 4FVMA 4LF7M 1IN6A 1HQCA 3FYCA 1TGUA 1GKIA 3M0EA 2QENA 1Z6TA 2JXNA 3TWLA 4KT0F 4G3OA 4LJ9A 2LTUA 1QDTA 3AFHA 3PNYA 4MB7A 1OFIA 1TTEA 2LVQD 2ZTDA 1SXJD 2QPAA 5ITYA 4NSRA 2L4EA 4GC5A 4Q7JA 5KPZA 2KNAA 3I4VA 3J81S 2MGWA 4X64M 2MH8A 1TH4A 4LJ5A 3U6MA 4JI3M 2HL7A 1AIPC 1E9RA 2L4FA 3B7QA 4AKIA 4G4NA 2VIIA 3LQQA 3OTOM 1QANA 1IXZA 3PVSA 2FOIC 4HLQA 4QOSA 5ITRA 3GO8A 2F5SA 2MROB 1LTMA 2FNAA 3NWLA 4DV6M 1LV7A 5KQ8A 3U6EA 3I4YA 2KRKA 1IQPA 1OAIA 3FKEA 1TDHA 1VEJA 4KODA 3ILKA 3KS4A 2C99A 2DAGA 3GPPA 3M6AA 3GLGA 1L2BA 2EJSA 4RF0A 1L1ZA 3HHZA 1SXJB 1V92A 3K2LA 1DV0A 2Q2EB 5LMUM 2UUCM 3D8LA 3LVWA 3HHYA 4GKKM 2Y20A 2ZANA 3FE3A 1NVMA 5FSWA 3DA1A 3V76A 5L8RF 1K3WA 2QHOB 1IN4A 3K8ZA 2L7IA 2EA0A 3E21A 3A45A 1XC8A 3SASA 1Y8GA 1R7RA 3TE6A 3L25A 3HU3A 1IM2A 4P17A 4W5WA 2C9CA 2RGHA 3KSXA 4FCTA 1FJGM 3GRRA 1QZEA 3SYKA 4LF8M 1KFVA 1MU5A 2DAEA 4NL4H 4NXNM 3C3EA 3TPZA 1QDRA 2O01F 4RF1A 1N78A 1RU3A 4JI6M 2H1RA 1IY2A 1PJIA 3HKPA 1NV8A 4RNAA 4IBGA 3KW6A 1G3IA 2CHGA 3TWKA 4LRTA 2CUZA 2DZNB 2ZBKB 4LFCM 3FYDA 3NBIA 3T38A 4M9SA 4HL4A 1K3XA 3IECA 1GO5A 1VQ1A 1TF0B 3SYLA 5JI3E 1DGFA 2DAIA 2KEBA 3ZH9B 2K0BX 3GP1A 4LJ6A 4LF6M 1OAOC 2P5TA 3U6PA 2H5XA 4L78A 2XZFA 2J5YA 2JP7A 3J7AS 1L2DA 1E32A 4AZFA 4OX9M 7CATA 1QAOA 3R9XB 4LJ8A 3L27A 3FRIA 2V1CA 1ZV1A 4GMQA 3CF2A 2RKOA 3B89A 3HJ8A 4G4RA 1J5EM 1N32M 1C1KA 5DFLA 1EIJA 2LVPC 1NV9A 1TH2A 4MGHA 4LGMA 3ZQJA 5KO3A 2A5YB 1CUKA 3CGWA 4L16A 4YHHM 5BR8M 2R65A 5E6JA 2Z7JA 3E9SA 2CRUA 4AI6A 4IBFA 3GPXA 3SATA 4GIPA 1XXHA 1IY0A 1AUAA 1XHBA 1PJQA 2HCBA 4G4QA 2JY8A 4R7GA 1VDLA 4IJFA 1SG9A 4DR7M 5EP2A 1OIZA 3SAVA 2EKFA 3LCUA 1WJ7A 3U61A 4GEWA 2CV0A 4B3MM 5KPRA 4GC9A 3D8BA 1G8PA 2C9OA 4DR5M 2JUJA 3L29A 2CHVA 2KNZA 3B7NA 3SMPA 2WSCF 3CF0A 2VQFM 2LBCA 4DR3M 5JI2E 1IN7A 1BVSA 3UJNA 4IBBA 2R6FA 4RKUF 1I94M 4LF5M 3FUXA 1QAMA 4AKGA 2KNVA 4QNRA 4B08A 3GLFB 4GHAA 3AOEC 2K6BA 2BJVA 2C96A 1IXSB 4OU7A 2KZSA 3FTCA 3H4JA 1DO0A 1VG5A 5IT9S 4MGZE 1GVNA 1IN5A 2LHCA 2R62A 3HX3A 2R44A 3SBJA 1G41A 4R71A 1X37A 2I7PA 2HAKA 4REZA 4LJ4A 3W68A 2FE8A 4LJAA 5E26A 2R4EA 5ITUA 3FTEA 1IXRC 2DWLA 3GRYA 1YUBA 3GQ5A 1PJTA 3TL4X 1G4AE 5FTJA 2QBYB 4FWGA 4MGYE 1N34M 4FCWA 2XFSA 4BLCA 1MX0A 1D0LA 1N75A 3RGPA 4LF4M 3VDUA 1GJSA 1TR8A 4ANRA 1HNWM 3SAWA 3L2AA 4IBDA 3U5ZB 2JA2A 3I51A 3C3DA 3EIHA 4G6ZA 1ZMVA 3U6DA 2EKKA 3LMMA 3QWLA 2JY6B 4DBGB 1IY1A 1XXHB 2F5NA 3FUTA 1ZMWA 2BJWA 3J80S 2KZUA 3L26A 2XZUA 2WZJA 2F5PA 4G4OA 5EJCA 4LF9M 4B7GA 1DGHB 1R6BX 3U60A 1MN3A 4NSOB 3THGA 2L7HA 2ZAMA 2KDLA 4FD2A 1L2CA 2BNKA 4Z6YA 3GQ4A 2L09A 1N77A 4LFBM 1R2ZA 1D0MA 1Z5BA 2NQ8C 1IBLM 4FWDA 2Z8YM 4KLNA 4CIZA 2GQFA 5EXPA 1QAQA 2Y0TA 3HJSA 8CATA 4DR2M 2AHMA 1PJSA 1WGNA 2DKLA 1WR1B 2EUCA 2Z4SA 1I4WA 5LMNM 2DVWB 4JXJA 5F3WA 2DXIA 3VKHA 3BBZA 1G59A 4JYAM 2OO9A 3W0LB 2KRUA 2XH9A 3UZUA 4QHTA 4GKJM 3IG5A 1V34A 4B7HA 1PRBA 3JAMS 3IG8A 1HNZM 2XSZA 1R5LA 3B9PA 1N36M 1ZMUA 3KSJA 4X66M 2G3QA 1VEKA 2JZ0A 3FRHA 4BB9A 2VQEM 2HHHM 2LNHC 2F5QA 5ITXA 2JZ1A 2L6OA 2APLA 4I81A 3VK8A 2UXCM 3KDSE 2LWXA 5EXTA 2LVNC 2KHHA 3L28A 4D82A 4FW9A 4AQYM 2DENA 4CHTB 1IBMM 4WW0A 4DV5M 2YQZA 5GKNA 2KXEA 2CFOA 4MGKE 3QYBA 2WSEF 5FTLA 4XK8F 4S12A 3SFZA 1YSYA 2Y0QA 2OQ4A 4MGIE 1Q3CA 3GPUA 2L2DA 2OOAA 3RE8A 1PJJA 4F1IA 1UFZA 2HKJA 3GRUA 5A2QS 3UK6A 3B74A 4FCVA 4NRVA 1QVRA 4MM3B 3K9PA 4IIWA 2X8AA 1DGBA 4M0DA 5ITTA 3GLIB 4DV4M 2DWZB 2KA6B 4IBEA 4JI4M 3H4MA 3HU2A 3Q8XA 3VDPA 4DV0M 1NHWC 1NJGA 3HHWA 4AG6A 1NO1A 4D80A 5EP4A 2FS1A 2VF7A 2ZTCA 2R0IA 2MR9A 2QP9X 3K92A 1YE9A 4LCBA 1Q39A 4PCZA 2QCUA 2LHGA 2XGNA 4QOZC 5EP3A 4L6V6 2YFQA 3QYEA 1L8QA 5FTMA 1J7KA 1OFHA 3HGIA 3VK7A 2LH0A 5C18A 3UMMA 1HT1E 3T6PA 3W67A 1W5TA 4JI1M 4I8OA 3KS8A 4Y28F 3T1YM 2LVOC 2FH0A 3WHLA 2OOBA 1C7YA 4DR4M 1Z59A 1Z5CA 2JNHA 3E46A 2CP8A 3HU1A 4B7FA 3BOSA 4QNMA 4D81A 5EP1A 1G71A 1NJFA 3BXWA 4AKHA 4II7A 1ZAEA 2R18A 2WSFF 2KW0A 1XMQM 4EIWA 4PT5A 3RFWA 3GLHA 3AKZA 3C58A 4Z8XA 3GLFA 4DR1M 1GL7A 3QAUA 1WGLA 4L15A 1QUTA 3SHGB 1E94E 1QZMA 2UXDM 3SHFA 4X62M 4AG5A 4PDIA 2M5ZA 5IREB 1HT2E 1HNXM 3HZJA 1D0KA 1KYIA 3UGJA 3A42A 3TWMA 3U6QA 3CF6E 3U61B 3MMPA 4JN6A 2DZLA 4DV3M 2DAMA 4GRIA 3AL0C 1VEGA 4X65M 2O25A 4QHSA 2D7GA 3FTFA 3GRVA 4DUZM 3DOAA 3I01M 2Z3XA 4AW4A 2QBYA 2O5RA 2C98A 3GPYA 3MHVC 2UUAM 4LZJA 2DWMA 2CEAA 4NOOB 4KHPM 1OIPA 4P16A 1OJLA 3KOWE 1GABA 2K9DA 1K82A 1F4IA 2C5RA 1Q02A 4DUYM 3NBXX 1TDZA 3U6LA 3A98B 3DFZA 1L1TA 3ZC7B 1IFYA 3HHXA 3DZDA 1NNUC 2K47A 3KFUG 2DHYA 4GHLA 1OKSA 4DV1M 1GLNA 3GLGE 1XNQM 3LCVB 3VLFB 3SMSA 2Z4RA 4B3SM 2BWEA 1Z5AA 5FTKA 4LG2A 1JR3D 2B3TA 4DV2M 1JR3E 1HR0M 2UUBM 2RRUA 1WXQA 2R4JA 4XGIA 1T3TA 4M0WA 2W82A 1PGYA 3U6SA 1QQWA 4IJEA 3KOZE 4UN2B 3GQ3A 3AOEA 1JQJC 2QZ4A 3LW5F 4LRSA 3GLHB 4OW0A 2MJ5B 3SC3A 3GLIE 4YY3M 2UU9M 4NRWA 2HWJA 4JI8M 2V1UA 1V33A 1IXSA 3AOGA 3HJQA 1Q3BA 3IHPA 3J2PB 3J27B 1D2NA 2JY5A 3MJ5A 4R3DA 2D7EA 4DR6M 3R8FA 1XWIA 2ZM6M 4LJ7A 2E5LM 2M60A 4PDGA 1R4GA 2DI0A 4NXMM 3KOXE 1XXHE 4CGYB 1T6OA 5DNYA 1J09A 3KXEC 5EQTA 3JR5A 3FUUA 3HWSA 3A46A 1HQYE 5FTNA 4BBAA 3SARA 4JV5M 3I04M 1E9SA 1XB2B 3RGSA 2G8LA 3KVWA 2QQ8A 3E4RA 4LGYA 1QUSA 2XSZD 4NC6A 2GNOA 1NSFA 2CWBA 2YR0A 3AJIB 4B3TM 4ITQA 2OPFA 4MH0E 4K0KM 4JI0M 3U6CA 4B3RM 1SXJC 3EIEA 4HEOA 4IBJA 1R2YA 3FUWA 2FFJA 2QSFX 1OQYA 3ZCBB 4GITA 1T43A 2G5GX 4CJ6A 3Q8GA 1YLAA 5IWAM 1N33M 1JR3A 3PFIA 1KSFX 3HY5A 4JI5M 1MJGM 2X4AA 3PXGA 1VDDA 4IBCA 3W0FA 4M9XA 3U60B 3KOYE 2CV1A 4JI2M 1FNNA 2QNJA 5DYIA 4L4UA 1IN8A 2ERCA 2EO2A 4CISA 3FUVA 2LVAA 1SXJE 3AV0A 5IZ7D 2N35A 3GLFE 4WP2A 2XFTA 1A5TA 2J7OA 2I7NA 3U6OA 3U5ZA 1JB0F 4M9ZA 2F5OA 2R46A 5H37D 3J7BA 4IBKA 1XMOM 3PNVA 2LXEA 1ORYB 3VFDA 2DHRA 2JWSA 3GLIA 3LVVA 1SXJA 4LY6A 2ZAOA 4KO8A 3VKGA 2XLJA 5ITXE 3GLGB 4OVZA 1GL6A 2Y21A 5BPVA 2BWBA 2J7NA 4I5SA
chains in the Genus database with same CATH topology
3JR4A 2R45A 2UXBM 3M7GA 1QYRA 3MK6A 2CHQA 4GH9A 1IBKM 4LFAM 4PD2A 4OVZB 1S3SA 1DGHA 2F4VM 3TQSA 4DV7M 1DGGA 4FWHA 4WURA 4XBOA 3KP0E 3KP1E 5C1BA 1PM5A 4IBIA 3FD9A 3LQRA 5KQDA 5EXSA 4TUWA 5DYGA 2CE7A 4A3VB 3K1JA 2XEPA 1NHGC 1NY5A 3CTWB 3SAUA 3T1HM 1NY6A 2X49A 1TH3A 1H6UA 2V6ZM 3WHKA 4I4LA 2RGOA 2DWNA 2DZOB 2CV2A 1UM8A 4LZZA 1NNJA 5KPTA 2D7HA 4L8RC 3T15A 1W5SA 3FTDA 5ITQA 5FLXS 1EE8A 1XNRM 1DO2A 4ZPXA 1ZQ9A 2YNMD 4JI7M 5EXXA 2XF3A 4FVMA 4LF7M 1IN6A 1HQCA 3FYCA 1TGUA 1GKIA 3M0EA 2QENA 1Z6TA 3TWLA 4LJ9A 3PNYA 3AFHA 4MB7A 1OFIA 1SXJD 2QPAA 5ITYA 4NSRA 5KPZA 4GC5A 3J81S 3I4VA 4X64M 1TH4A 4LJ5A 3U6MA 4JI3M 2HL7A 1E9RA 4AKIA 4G4NA 3LQQA 2VIIA 3OTOM 1QANA 1IXZA 3PVSA 2FOIC 4HLQA 4QOSA 5ITRA 3GO8A 2F5SA 2FNAA 3NWLA 4DV6M 1LV7A 5KQ8A 3U6EA 3I4YA 2KRKA 1IQPA 3FKEA 1TDHA 4KODA 3ILKA 3KS4A 2C99A 3GPPA 3M6AA 3GLGA 1L2BA 4RF0A 1L1ZA 3HHZA 1SXJB 3K2LA 2Q2EB 5LMUM 2UUCM 3D8LA 3LVWA 3HHYA 4GKKM 2Y20A 2ZANA 1NVMA 5FSWA 3DA1A 1K3WA 1IN4A 3K8ZA 2L7IA 2EA0A 3A45A 1XC8A 3SASA 1R7RA 3TE6A 3L25A 3HU3A 1IM2A 4W5WA 2C9CA 2RGHA 3KSXA 4FCTA 1FJGM 3GRRA 3SYKA 4LF8M 1KFVA 1MU5A 4NL4H 4NXNM 3TPZA 1N78A 4RF1A 4JI6M 2H1RA 1IY2A 1PJIA 3HKPA 4RNAA 4IBGA 3KW6A 1G3IA 2CHGA 3TWKA 4LRTA 2CUZA 2DZNB 2ZBKB 4LFCM 3FYDA 3NBIA 3T38A 4M9SA 4HL4A 1K3XA 3SYLA 5JI3E 1DGFA 2KEBA 3ZH9B 3GP1A 4LJ6A 4LF6M 2P5TA 3U6PA 4L78A 2XZFA 3J7AS 1L2DA 1E32A 4AZFA 4OX9M 7CATA 1QAOA 3R9XB 4LJ8A 3L27A 2V1CA 4GMQA 3CF2A 2RKOA 3HJ8A 4G4RA 1J5EM 1N32M 1C1KA 1TH2A 4MGHA 4LGMA 5KO3A 4YHHM 2A5YB 4L16A 5BR8M 2R65A 5E6JA 2Z7JA 3E9SA 4AI6A 4IBFA 3GPXA 3SATA 4GIPA 1XXHA 1IY0A 1XHBA 2HCBA 4G4QA 4R7GA 4IJFA 4DR7M 3SAVA 4B3MM 3U61A 2CV0A 5KPRA 4GC9A 3D8BA 1G8PA 2C9OA 4DR5M 3L29A 2CHVA 3SMPA 3CF0A 4DR3M 2VQFM 5JI2E 1IN7A 3UJNA 4IBBA 1I94M 4LF5M 3FUXA 1QAMA 4AKGA 4QNRA 4B08A 3GLFB 4GHAA 3AOEC 2BJVA 2C96A 1IXSB 4OU7A 2KZSA 3FTCA 1DO0A 5IT9S 4MGZE 1GVNA 1IN5A 2R62A 3SBJA 1G41A 1X37A 2I7PA 4REZA 4LJ4A 2FE8A 4LJAA 5E26A 2R4EA 5ITUA 3FTEA 1IXRC 2DWLA 3GRYA 1YUBA 3GQ5A 3TL4X 1G4AE 5FTJA 2QBYB 4FWGA 4MGYE 1N34M 4FCWA 2XFSA 4BLCA 1MX0A 1N75A 3RGPA 4LF4M 3VDUA 1HNWM 3SAWA 3L2AA 4IBDA 3U5ZB 2JA2A 3I51A 3EIHA 4G6ZA 3U6DA 3LMMA 3QWLA 1IY1A 1XXHB 2F5NA 3FUTA 2BJWA 3J80S 2KZUA 3L26A 2XZUA 2F5PA 4G4OA 5EJCA 4LF9M 4B7GA 1DGHB 1R6BX 3U60A 4NSOB 3THGA 2L7HA 2ZAMA 4FD2A 1L2CA 2BNKA 4Z6YA 3GQ4A 2L09A 1N77A 4LFBM 1R2ZA 1Z5BA 2NQ8C 1IBLM 4FWDA 4KLNA 5EXPA 1QAQA 2Y0TA 3HJSA 8CATA 4DR2M 2AHMA 2EUCA 2Z4SA 5LMNM 2DXIA 1I4WA 5F3WA 2DVWB 4JXJA 3VKHA 1G59A 4JYAM 3W0LB 2KRUA 2XH9A 3UZUA 4QHTA 4GKJM 3IG5A 4B7HA 3JAMS 3IG8A 1HNZM 2XSZA 3B9PA 1N36M 3KSJA 4X66M 4BB9A 2VQEM 2HHHM 2LNHC 2F5QA 5ITXA 2L6OA 3VK8A 4I81A 2UXCM 3KDSE 2LWXA 5EXTA 3L28A 4D82A 4AQYM 4FW9A 4CHTB 1IBMM 4WW0A 4DV5M 2YQZA 5GKNA 2KXEA 2CFOA 4MGKE 5FTLA 4S12A 3SFZA 1YSYA 2Y0QA 2OQ4A 4MGIE 1Q3CA 3GPUA 3RE8A 1PJJA 3GRUA 2HKJA 5A2QS 3UK6A 4FCVA 4NRVA 1QVRA 4MM3B 4IIWA 2X8AA 1DGBA 4M0DA 5ITTA 3GLIB 4DV4M 2DWZB 2KA6B 4IBEA 4JI4M 3H4MA 3HU2A 3Q8XA 3VDPA 4DV0M 1NHWC 1NJGA 3HHWA 4AG6A 4D80A 5EP4A 2QP9X 3K92A 1YE9A 4LCBA 1Q39A 4PCZA 2QCUA 2XGNA 4QOZC 5EP3A 2YFQA 5FTMA 1L8QA 3VK7A 1J7KA 1OFHA 3HGIA 2LH0A 5C18A 3UMMA 1HT1E 1W5TA 4JI1M 4I8OA 3KS8A 3T1YM 3WHLA 4DR4M 1Z59A 1Z5CA 3HU1A 4B7FA 3BOSA 4QNMA 4D81A 5EP1A 1NJFA 4AKHA 4II7A 1ZAEA 2R18A 2KW0A 1XMQM 4EIWA 4PT5A 3RFWA 3GLHA 3AKZA 3C58A 4Z8XA 3GLFA 4DR1M 1GL7A 3QAUA 4L15A 3SHGB 1E94E 1QZMA 2UXDM 3SHFA 4X62M 4AG5A 4PDIA 2M5ZA 5IREB 1HT2E 1HNXM 3UGJA 1KYIA 3U6QA 3A42A 3TWMA 3CF6E 3U61B 4JN6A 4DV3M 4GRIA 3AL0C 4X65M 4QHSA 2D7GA 3FTFA 3GRVA 4DUZM 3DOAA 2Z3XA 4AW4A 2QBYA 2O5RA 2C98A 3GPYA 3MHVC 2UUAM 4LZJA 2DWMA 2CEAA 4NOOB 4KHPM 4P16A 1OJLA 3KOWE 1K82A 2C5RA 4DUYM 1TDZA 3U6LA 3A98B 3DFZA 1L1TA 3ZC7B 3HHXA 3DZDA 1NNUC 2K47A 3KFUG 4GHLA 4DV1M 1GLNA 1XNQM 3VLFB 3SMSA 2Z4RA 4B3SM 1Z5AA 5FTKA 4LG2A 1JR3D 4DV2M 1HR0M 2UUBM 1WXQA 2R4JA 4XGIA 1T3TA 4M0WA 2W82A 3U6SA 1QQWA 4IJEA 3KOZE 3GQ3A 3AOEA 1JQJC 2QZ4A 4LRSA 3GLHB 4OW0A 3SC3A 2UU9M 4YY3M 4NRWA 4JI8M 2V1UA 3AOGA 3HJQA 1Q3BA 3J2PB 3J27B 1D2NA 3MJ5A 4R3DA 4DR6M 2D7EA 3R8FA 1XWIA 2ZM6M 4LJ7A 2E5LM 2M60A 4PDGA 4NXMM 3KOXE 4CGYB 5DNYA 1J09A 3KXEC 5EQTA 3JR5A 3FUUA 3HWSA 3A46A 1HQYE 5FTNA 4BBAA 3SARA 4JV5M 1E9SA 3RGSA 2G8LA 3KVWA 3E4RA 4LGYA 2XSZD 4ITQA 1NSFA 2YR0A 3AJIB 4B3TM 4K0KM 2OPFA 4MH0E 4JI0M 3U6CA 4B3RM 1SXJC 3EIEA 1R2YA 4IBJA 3FUWA 2FFJA 3ZCBB 4GITA 2G5GX 5IWAM 1N33M 1JR3A 3PFIA 1KSFX 4JI5M 2X4AA 3PXGA 1VDDA 4IBCA 3W0FA 4M9XA 3U60B 3KOYE 2CV1A 4JI2M 1FNNA 5DYIA 4L4UA 1IN8A 2ERCA 2EO2A 4CISA 3FUVA 1SXJE 3AV0A 5IZ7D 2XFTA 2J7OA 2I7NA 3U6OA 3U5ZA 4M9ZA 2F5OA 2R46A 5H37D 3J7BA 4IBKA 1XMOM 3PNVA 2LXEA 1ORYB 3VFDA 2DHRA 3GLIA 3LVVA 1SXJA 4LY6A 2ZAOA 4KO8A 3VKGA 2XLJA 5ITXE 3GLGB 4OVZA 1GL6A 2Y21A 5BPVA 5EP2A 2J7NA 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR4 A;  4DUY M;  1TDZ A;  2UXB M;  3U6L A;  4DR2 M;  3GP1 A;  4LF6 M;  1IBK M;  5LMN M;  3U6P A;  1L1T A;  4LFA M;  4PD2 A;  2XZF A;  3J7A S;  4JYA M;  2F4V M;  1L2D A;  4GKJ M;  4OX9 M;  4DV7 M;  4DV1 M;  1XNQ M;  3JAM S;  1HNZ M;  1PM5 A;  1N36 M;  4B3S M;  4G4R A;  1J5E M;  1Z5A A;  1N32 M;  4X66 M;  4DV2 M;  1HR0 M;  2VQE M;  3SAU A;  3T1H M;  2HHH M;  2UUB M;  4YHH M;  2F5Q A;  5ITX A;  5BR8 M;  3U6S A;  3VK8 A;  2UXC M;  3GQ3 A;  3GPX A;  3SAT A;  1NNJ A;  4AQY M;  4G4Q A;  1IBM M;  1XNR M;  5ITQ A;  5FLX S;  1EE8 A;  4YY3 M;  2UU9 M;  4NRW A;  4DV5 M;  4JI8 M;  4JI7 M;  4DR7 M;  1Q3B A;  3SAV A;  4LF7 M;  4B3M M;  4DR6 M;  2OQ4 A;  2ZM6 M;  1Q3C A;  3GPU A;  4DR5 M;  3TWL A;  1PJJ A;  2E5L M;  2HKJ A;  4PDG A;  4NXM M;  5A2Q S;  4DR3 M;  2VQF M;  4MB7 A;  4NRV A;  3JR5 A;  5ITY A;  1I94 M;  5ITT A;  3A46 A;  3J81 S;  4DV4 M;  3SAR A;  4LF5 M;  4JV5 M;  4JI4 M;  4DV0 M;  4X64 M;  4ITQ A;  3U6M A;  4B3T M;  4K0K M;  4JI3 M;  2OPF A;  4PCZ A;  1Q39 A;  4JI0 M;  3U6C A;  5IT9 S;  4B3R M;  1R2Y A;  4G4N A;  3OTO M;  3SBJ A;  3GO8 A;  5ITR A;  2F5S A;  4DV6 M;  3VK7 A;  3U6E A;  5ITU A;  4JI1 M;  1TDH A;  3T1Y M;  5IWA M;  1N33 M;  3GQ5 A;  3GPP A;  1L2B A;  4DR4 M;  1Z59 A;  1Z5C A;  1L1Z A;  4JI5 M;  3W0F A;  1N34 M;  2Q2E B;  1MX0 A;  1XMQ M;  5LMU M;  4LF4 M;  3C58 A;  4JI2 M;  4DR1 M;  2UUC M;  1HNW M;  3SAW A;  4GKK M;  2UXD M;  3U6D A;  4X62 M;  1K3W A;  4PDI A;  4CIS A;  2F5N A;  1HNX M;  2EA0 A;  3U6Q A;  3A45 A;  3A42 A;  3TWM A;  1XC8 A;  3SAS A;  3J80 S;  2XZU A;  2F5P A;  4DV3 M;  4G4O A;  1FJG M;  4LF9 M;  3U6O A;  4LF8 M;  2F5O A;  1XMO M;  1KFV A;  1MU5 A;  4NXN M;  4X65 M;  4DUZ M;  3DOA A;  4JI6 M;  1PJI A;  1L2C A;  3GPY A;  2UUA M;  3GQ4 A;  5ITX E;  4LFB M;  3TWK A;  1R2Z A;  4KHP M;  1Z5B A;  2ZBK B;  1IBL M;  4LFC M;  1K3X A;  1K82 A; 
#chains in the Genus database with same CATH topology
 3JR4 A;  2R45 A;  2UXB M;  3M7G A;  1QYR A;  3MK6 A;  2CHQ A;  1P3Q Q;  4GH9 A;  1IBK M;  4LFA M;  2DAK A;  4PD2 A;  4OVZ B;  1S3S A;  1DGH A;  2DNA A;  2F4V M;  3TQS A;  4DV7 M;  1DGG A;  4FWH A;  4WUR A;  3GLH E;  4XBO A;  2VDB B;  3KP0 E;  3KP1 E;  2JY7 A;  5C1B A;  1PM5 A;  1OTR A;  1WHC A;  4IBI A;  3FD9 A;  3LQR A;  3K9O A;  5KQD A;  5EXS A;  1WIV A;  4TUW A;  5DYG A;  2CE7 A;  4A3V B;  3K1J A;  2XEP A;  1NHG C;  1NY5 A;  3CTW B;  3SAU A;  3T1H M;  1NY6 A;  2X49 A;  1TH3 A;  1H6U A;  2V6Z M;  3C9P A;  2VF8 A;  2RGO A;  4I4L A;  2DZO B;  3WHK A;  1UM8 A;  2DWN A;  2CV2 A;  1EFU B;  3F92 A;  4LZZ A;  1NNJ A;  5KPT A;  1GJT A;  2D7H A;  1HJP A;  4L8R C;  4F2L A;  3T15 A;  1W5S A;  3FTD A;  5ITQ A;  5FLX S;  1EE8 A;  1XNR M;  1DO2 A;  3B7Z A;  4ZPX A;  1ZQ9 A;  2YNM D;  4JI7 M;  5EXX A;  2XF3 A;  4FVM A;  4LF7 M;  1IN6 A;  1HQC A;  3FYC A;  1TGU A;  1GKI A;  3M0E A;  2QEN A;  1Z6T A;  2JXN A;  3TWL A;  4KT0 F;  4G3O A;  4LJ9 A;  2LTU A;  1QDT A;  3AFH A;  3PNY A;  4MB7 A;  1OFI A;  1TTE A;  2LVQ D;  2ZTD A;  1SXJ D;  2QPA A;  5ITY A;  4NSR A;  2L4E A;  4GC5 A;  4Q7J A;  5KPZ A;  2KNA A;  3I4V A;  3J81 S;  2MGW A;  4X64 M;  2MH8 A;  1TH4 A;  4LJ5 A;  3U6M A;  4JI3 M;  2HL7 A;  1AIP C;  1E9R A;  2L4F A;  3B7Q A;  4AKI A;  4G4N A;  2VII A;  3LQQ A;  3OTO M;  1QAN A;  1IXZ A;  3PVS A;  2FOI C;  4HLQ A;  4QOS A;  5ITR A;  3GO8 A;  2F5S A;  2MRO B;  1LTM A;  2FNA A;  3NWL A;  4DV6 M;  1LV7 A;  5KQ8 A;  3U6E A;  3I4Y A;  2KRK A;  1IQP A;  1OAI A;  3FKE A;  1TDH A;  1VEJ A;  4KOD A;  3ILK A;  3KS4 A;  2C99 A;  2DAG A;  3GPP A;  3M6A A;  3GLG A;  1L2B A;  2EJS A;  4RF0 A;  1L1Z A;  3HHZ A;  1SXJ B;  1V92 A;  3K2L A;  1DV0 A;  2Q2E B;  5LMU M;  2UUC M;  3D8L A;  3LVW A;  3HHY A;  4GKK M;  2Y20 A;  2ZAN A;  3FE3 A;  1NVM A;  5FSW A;  3DA1 A;  3V76 A;  5L8R F;  1K3W A;  2QHO B;  1IN4 A;  3K8Z A;  2L7I A;  2EA0 A;  3E21 A;  3A45 A;  1XC8 A;  3SAS A;  1Y8G A;  1R7R A;  3TE6 A;  3L25 A;  3HU3 A;  1IM2 A;  4P17 A;  4W5W A;  2C9C A;  2RGH A;  3KSX A;  4FCT A;  1FJG M;  3GRR A;  1QZE A;  3SYK A;  4LF8 M;  1KFV A;  1MU5 A;  2DAE A;  4NL4 H;  4NXN M;  3C3E A;  3TPZ A;  1QDR A;  2O01 F;  4RF1 A;  1N78 A;  1RU3 A;  4JI6 M;  2H1R A;  1IY2 A;  1PJI A;  3HKP A;  1NV8 A;  4RNA A;  4IBG A;  3KW6 A;  1G3I A;  2CHG A;  3TWK A;  4LRT A;  2CUZ A;  2DZN B;  2ZBK B;  4LFC M;  3FYD A;  3NBI A;  3T38 A;  4M9S A;  4HL4 A;  1K3X A;  3IEC A;  1GO5 A;  1VQ1 A;  1TF0 B;  3SYL A;  5JI3 E;  1DGF A;  2DAI A;  2KEB A;  3ZH9 B;  2K0B X;  3GP1 A;  4LJ6 A;  4LF6 M;  1OAO C;  2P5T A;  3U6P A;  2H5X A;  4L78 A;  2XZF A;  2J5Y A;  2JP7 A;  3J7A S;  1L2D A;  1E32 A;  4AZF A;  4OX9 M;  7CAT A;  1QAO A;  3R9X B;  4LJ8 A;  3L27 A;  3FRI A;  2V1C A;  1ZV1 A;  4GMQ A;  3CF2 A;  2RKO A;  3B89 A;  3HJ8 A;  4G4R A;  1J5E M;  1N32 M;  1C1K A;  5DFL A;  1EIJ A;  2LVP C;  1NV9 A;  1TH2 A;  4MGH A;  4LGM A;  3ZQJ A;  5KO3 A;  2A5Y B;  1CUK A;  3CGW A;  4L16 A;  4YHH M;  5BR8 M;  2R65 A;  5E6J A;  2Z7J A;  3E9S A;  2CRU A;  4AI6 A;  4IBF A;  3GPX A;  3SAT A;  4GIP A;  1XXH A;  1IY0 A;  1AUA A;  1XHB A;  1PJQ A;  2HCB A;  4G4Q A;  2JY8 A;  4R7G A;  1VDL A;  4IJF A;  1SG9 A;  4DR7 M;  5EP2 A;  1OIZ A;  3SAV A;  2EKF A;  3LCU A;  1WJ7 A;  3U61 A;  4GEW A;  2CV0 A;  4B3M M;  5KPR A;  4GC9 A;  3D8B A;  1G8P A;  2C9O A;  4DR5 M;  2JUJ A;  3L29 A;  2CHV A;  2KNZ A;  3B7N A;  3SMP A;  2WSC F;  3CF0 A;  2VQF M;  2LBC A;  4DR3 M;  5JI2 E;  1IN7 A;  1BVS A;  3UJN A;  4IBB A;  2R6F A;  4RKU F;  1I94 M;  4LF5 M;  3FUX A;  1QAM A;  4AKG A;  2KNV A;  4QNR A;  4B08 A;  3GLF B;  4GHA A;  3AOE C;  2K6B A;  2BJV A;  2C96 A;  1IXS B;  4OU7 A;  2KZS A;  3FTC A;  3H4J A;  1DO0 A;  1VG5 A;  5IT9 S;  4MGZ E;  1GVN A;  1IN5 A;  2LHC A;  2R62 A;  3HX3 A;  2R44 A;  3SBJ A;  1G41 A;  4R71 A;  1X37 A;  2I7P A;  2HAK A;  4REZ A;  4LJ4 A;  3W68 A;  2FE8 A;  4LJA A;  5E26 A;  2R4E A;  5ITU A;  3FTE A;  1IXR C;  2DWL A;  3GRY A;  1YUB A;  3GQ5 A;  1PJT A;  3TL4 X;  1G4A E;  5FTJ A;  2QBY B;  4FWG A;  4MGY E;  1N34 M;  4FCW A;  2XFS A;  4BLC A;  1MX0 A;  1D0L A;  1N75 A;  3RGP A;  4LF4 M;  3VDU A;  1GJS A;  1TR8 A;  4ANR A;  1HNW M;  3SAW A;  3L2A A;  4IBD A;  3U5Z B;  2JA2 A;  3I51 A;  3C3D A;  3EIH A;  4G6Z A;  1ZMV A;  3U6D A;  2EKK A;  3LMM A;  3QWL A;  2JY6 B;  4DBG B;  1IY1 A;  1XXH B;  2F5N A;  3FUT A;  1ZMW A;  2BJW A;  3J80 S;  2KZU A;  3L26 A;  2XZU A;  2WZJ A;  2F5P A;  4G4O A;  5EJC A;  4LF9 M;  4B7G A;  1DGH B;  1R6B X;  3U60 A;  1MN3 A;  4NSO B;  3THG A;  2L7H A;  2ZAM A;  2KDL A;  4FD2 A;  1L2C A;  2BNK A;  4Z6Y A;  3GQ4 A;  2L09 A;  1N77 A;  4LFB M;  1R2Z A;  1D0M A;  1Z5B A;  2NQ8 C;  1IBL M;  4FWD A;  2Z8Y M;  4KLN A;  4CIZ A;  2GQF A;  5EXP A;  1QAQ A;  2Y0T A;  3HJS A;  8CAT A;  4DR2 M;  2AHM A;  1PJS A;  1WGN A;  2DKL A;  1WR1 B;  2EUC A;  2Z4S A;  1I4W A;  5LMN M;  2DVW B;  4JXJ A;  5F3W A;  2DXI A;  3VKH A;  3BBZ A;  1G59 A;  4JYA M;  2OO9 A;  3W0L B;  2KRU A;  2XH9 A;  3UZU A;  4QHT A;  4GKJ M;  3IG5 A;  1V34 A;  4B7H A;  1PRB A;  3JAM S;  3IG8 A;  1HNZ M;  2XSZ A;  1R5L A;  3B9P A;  1N36 M;  1ZMU A;  3KSJ A;  4X66 M;  2G3Q A;  1VEK A;  2JZ0 A;  3FRH A;  4BB9 A;  2VQE M;  2HHH M;  2LNH C;  2F5Q A;  5ITX A;  2JZ1 A;  2L6O A;  2APL A;  4I81 A;  3VK8 A;  2UXC M;  3KDS E;  2LWX A;  5EXT A;  2LVN C;  2KHH A;  3L28 A;  4D82 A;  4FW9 A;  4AQY M;  2DEN A;  4CHT B;  1IBM M;  4WW0 A;  4DV5 M;  2YQZ A;  5GKN A;  2KXE A;  2CFO A;  4MGK E;  3QYB A;  2WSE F;  5FTL A;  4XK8 F;  4S12 A;  3SFZ A;  1YSY A;  2Y0Q A;  2OQ4 A;  4MGI E;  1Q3C A;  3GPU A;  2L2D A;  2OOA A;  3RE8 A;  1PJJ A;  4F1I A;  1UFZ A;  2HKJ A;  3GRU A;  5A2Q S;  3UK6 A;  3B74 A;  4FCV A;  4NRV A;  1QVR A;  4MM3 B;  3K9P A;  4IIW A;  2X8A A;  1DGB A;  4M0D A;  5ITT A;  3GLI B;  4DV4 M;  2DWZ B;  2KA6 B;  4IBE A;  4JI4 M;  3H4M A;  3HU2 A;  3Q8X A;  3VDP A;  4DV0 M;  1NHW C;  1NJG A;  3HHW A;  4AG6 A;  1NO1 A;  4D80 A;  5EP4 A;  2FS1 A;  2VF7 A;  2ZTC A;  2R0I A;  2MR9 A;  2QP9 X;  3K92 A;  1YE9 A;  4LCB A;  1Q39 A;  4PCZ A;  2QCU A;  2LHG A;  2XGN A;  4QOZ C;  5EP3 A;  4L6V 6;  2YFQ A;  3QYE A;  1L8Q A;  5FTM A;  1J7K A;  1OFH A;  3HGI A;  3VK7 A;  2LH0 A;  5C18 A;  3UMM A;  1HT1 E;  3T6P A;  3W67 A;  1W5T A;  4JI1 M;  4I8O A;  3KS8 A;  4Y28 F;  3T1Y M;  2LVO C;  2FH0 A;  3WHL A;  2OOB A;  1C7Y A;  4DR4 M;  1Z59 A;  1Z5C A;  2JNH A;  3E46 A;  2CP8 A;  3HU1 A;  4B7F A;  3BOS A;  4QNM A;  4D81 A;  5EP1 A;  1G71 A;  1NJF A;  3BXW A;  4AKH A;  4II7 A;  1ZAE A;  2R18 A;  2WSF F;  2KW0 A;  1XMQ M;  4EIW A;  4PT5 A;  3RFW A;  3GLH A;  3AKZ A;  3C58 A;  4Z8X A;  3GLF A;  4DR1 M;  1GL7 A;  3QAU A;  1WGL A;  4L15 A;  1QUT A;  3SHG B;  1E94 E;  1QZM A;  2UXD M;  3SHF A;  4X62 M;  4AG5 A;  4PDI A;  2M5Z A;  5IRE B;  1HT2 E;  1HNX M;  3HZJ A;  1D0K A;  1KYI A;  3UGJ A;  3A42 A;  3TWM A;  3U6Q A;  3CF6 E;  3U61 B;  3MMP A;  4JN6 A;  2DZL A;  4DV3 M;  2DAM A;  4GRI A;  3AL0 C;  1VEG A;  4X65 M;  2O25 A;  4QHS A;  2D7G A;  3FTF A;  3GRV A;  4DUZ M;  3DOA A;  3I01 M;  2Z3X A;  4AW4 A;  2QBY A;  2O5R A;  2C98 A;  3GPY A;  3MHV C;  2UUA M;  4LZJ A;  2DWM A;  2CEA A;  4NOO B;  4KHP M;  1OIP A;  4P16 A;  1OJL A;  3KOW E;  1GAB A;  2K9D A;  1K82 A;  1F4I A;  2C5R A;  1Q02 A;  4DUY M;  3NBX X;  1TDZ A;  3U6L A;  3A98 B;  3DFZ A;  1L1T A;  3ZC7 B;  1IFY A;  3HHX A;  3DZD A;  1NNU C;  2K47 A;  3KFU G;  2DHY A;  4GHL A;  1OKS A;  4DV1 M;  1GLN A;  3GLG E;  1XNQ M;  3LCV B;  3VLF B;  3SMS A;  2Z4R A;  4B3S M;  2BWE A;  1Z5A A;  5FTK A;  4LG2 A;  1JR3 D;  2B3T A;  4DV2 M;  1JR3 E;  1HR0 M;  2UUB M;  2RRU A;  1WXQ A;  2R4J A;  4XGI A;  1T3T A;  4M0W A;  2W82 A;  1PGY A;  3U6S A;  1QQW A;  4IJE A;  3KOZ E;  4UN2 B;  3GQ3 A;  3AOE A;  1JQJ C;  2QZ4 A;  3LW5 F;  4LRS A;  3GLH B;  4OW0 A;  2MJ5 B;  3SC3 A;  3GLI E;  4YY3 M;  2UU9 M;  4NRW A;  2HWJ A;  4JI8 M;  2V1U A;  1V33 A;  1IXS A;  3AOG A;  3HJQ A;  1Q3B A;  3IHP A;  3J2P B;  3J27 B;  1D2N A;  2JY5 A;  3MJ5 A;  4R3D A;  2D7E A;  4DR6 M;  3R8F A;  1XWI A;  2ZM6 M;  4LJ7 A;  2E5L M;  2M60 A;  4PDG A;  1R4G A;  2DI0 A;  4NXM M;  3KOX E;  1XXH E;  4CGY B;  1T6O A;  5DNY A;  1J09 A;  3KXE C;  5EQT A;  3JR5 A;  3FUU A;  3HWS A;  3A46 A;  1HQY E;  5FTN A;  4BBA A;  3SAR A;  4JV5 M;  3I04 M;  1E9S A;  1XB2 B;  3RGS A;  2G8L A;  3KVW A;  2QQ8 A;  3E4R A;  4LGY A;  1QUS A;  2XSZ D;  4NC6 A;  2GNO A;  1NSF A;  2CWB A;  2YR0 A;  3AJI B;  4B3T M;  4ITQ A;  2OPF A;  4MH0 E;  4K0K M;  4JI0 M;  3U6C A;  4B3R M;  1SXJ C;  3EIE A;  4HEO A;  4IBJ A;  1R2Y A;  3FUW A;  2FFJ A;  2QSF X;  1OQY A;  3ZCB B;  4GIT A;  1T43 A;  2G5G X;  4CJ6 A;  3Q8G A;  1YLA A;  5IWA M;  1N33 M;  1JR3 A;  3PFI A;  1KSF X;  3HY5 A;  4JI5 M;  1MJG M;  2X4A A;  3PXG A;  1VDD A;  4IBC A;  3W0F A;  4M9X A;  3U60 B;  3KOY E;  2CV1 A;  4JI2 M;  1FNN A;  2QNJ A;  5DYI A;  4L4U A;  1IN8 A;  2ERC A;  2EO2 A;  4CIS A;  3FUV A;  2LVA A;  1SXJ E;  3AV0 A;  5IZ7 D;  2N35 A;  3GLF E;  4WP2 A;  2XFT A;  1A5T A;  2J7O A;  2I7N A;  3U6O A;  3U5Z A;  1JB0 F;  4M9Z A;  2F5O A;  2R46 A;  5H37 D;  3J7B A;  4IBK A;  1XMO M;  3PNV A;  2LXE A;  1ORY B;  3VFD A;  2DHR A;  2JWS A;  3GLI A;  3LVV A;  1SXJ A;  4LY6 A;  2ZAO A;  4KO8 A;  3VKG A;  2XLJ A;  5ITX E;  3GLG B;  4OVZ A;  1GL6 A;  2Y21 A;  5BPV A;  2BWB A;  2J7N A;  4I5S A; 
#chains in the Genus database with same CATH homology
 3JR4 A;  2R45 A;  2UXB M;  3M7G A;  1QYR A;  3MK6 A;  2CHQ A;  4GH9 A;  1IBK M;  4LFA M;  4PD2 A;  4OVZ B;  1S3S A;  1DGH A;  2F4V M;  3TQS A;  4DV7 M;  1DGG A;  4FWH A;  4WUR A;  4XBO A;  3KP0 E;  3KP1 E;  5C1B A;  1PM5 A;  4IBI A;  3FD9 A;  3LQR A;  5KQD A;  5EXS A;  4TUW A;  5DYG A;  2CE7 A;  4A3V B;  3K1J A;  2XEP A;  1NHG C;  1NY5 A;  3CTW B;  3SAU A;  3T1H M;  1NY6 A;  2X49 A;  1TH3 A;  1H6U A;  2V6Z M;  3WHK A;  4I4L A;  2RGO A;  2DWN A;  2DZO B;  2CV2 A;  1UM8 A;  4LZZ A;  1NNJ A;  5KPT A;  2D7H A;  4L8R C;  3T15 A;  1W5S A;  3FTD A;  5ITQ A;  5FLX S;  1EE8 A;  1XNR M;  1DO2 A;  4ZPX A;  1ZQ9 A;  2YNM D;  4JI7 M;  5EXX A;  2XF3 A;  4FVM A;  4LF7 M;  1IN6 A;  1HQC A;  3FYC A;  1TGU A;  1GKI A;  3M0E A;  2QEN A;  1Z6T A;  3TWL A;  4LJ9 A;  3PNY A;  3AFH A;  4MB7 A;  1OFI A;  1SXJ D;  2QPA A;  5ITY A;  4NSR A;  5KPZ A;  4GC5 A;  3J81 S;  3I4V A;  4X64 M;  1TH4 A;  4LJ5 A;  3U6M A;  4JI3 M;  2HL7 A;  1E9R A;  4AKI A;  4G4N A;  3LQQ A;  2VII A;  3OTO M;  1QAN A;  1IXZ A;  3PVS A;  2FOI C;  4HLQ A;  4QOS A;  5ITR A;  3GO8 A;  2F5S A;  2FNA A;  3NWL A;  4DV6 M;  1LV7 A;  5KQ8 A;  3U6E A;  3I4Y A;  2KRK A;  1IQP A;  3FKE A;  1TDH A;  4KOD A;  3ILK A;  3KS4 A;  2C99 A;  3GPP A;  3M6A A;  3GLG A;  1L2B A;  4RF0 A;  1L1Z A;  3HHZ A;  1SXJ B;  3K2L A;  2Q2E B;  5LMU M;  2UUC M;  3D8L A;  3LVW A;  3HHY A;  4GKK M;  2Y20 A;  2ZAN A;  1NVM A;  5FSW A;  3DA1 A;  1K3W A;  1IN4 A;  3K8Z A;  2L7I A;  2EA0 A;  3A45 A;  1XC8 A;  3SAS A;  1R7R A;  3TE6 A;  3L25 A;  3HU3 A;  1IM2 A;  4W5W A;  2C9C A;  2RGH A;  3KSX A;  4FCT A;  1FJG M;  3GRR A;  3SYK A;  4LF8 M;  1KFV A;  1MU5 A;  4NL4 H;  4NXN M;  3TPZ A;  1N78 A;  4RF1 A;  4JI6 M;  2H1R A;  1IY2 A;  1PJI A;  3HKP A;  4RNA A;  4IBG A;  3KW6 A;  1G3I A;  2CHG A;  3TWK A;  4LRT A;  2CUZ A;  2DZN B;  2ZBK B;  4LFC M;  3FYD A;  3NBI A;  3T38 A;  4M9S A;  4HL4 A;  1K3X A;  3SYL A;  5JI3 E;  1DGF A;  2KEB A;  3ZH9 B;  3GP1 A;  4LJ6 A;  4LF6 M;  2P5T A;  3U6P A;  4L78 A;  2XZF A;  3J7A S;  1L2D A;  1E32 A;  4AZF A;  4OX9 M;  7CAT A;  1QAO A;  3R9X B;  4LJ8 A;  3L27 A;  2V1C A;  4GMQ A;  3CF2 A;  2RKO A;  3HJ8 A;  4G4R A;  1J5E M;  1N32 M;  1C1K A;  1TH2 A;  4MGH A;  4LGM A;  5KO3 A;  4YHH M;  2A5Y B;  4L16 A;  5BR8 M;  2R65 A;  5E6J A;  2Z7J A;  3E9S A;  4AI6 A;  4IBF A;  3GPX A;  3SAT A;  4GIP A;  1XXH A;  1IY0 A;  1XHB A;  2HCB A;  4G4Q A;  4R7G A;  4IJF A;  4DR7 M;  3SAV A;  4B3M M;  3U61 A;  2CV0 A;  5KPR A;  4GC9 A;  3D8B A;  1G8P A;  2C9O A;  4DR5 M;  3L29 A;  2CHV A;  3SMP A;  3CF0 A;  4DR3 M;  2VQF M;  5JI2 E;  1IN7 A;  3UJN A;  4IBB A;  1I94 M;  4LF5 M;  3FUX A;  1QAM A;  4AKG A;  4QNR A;  4B08 A;  3GLF B;  4GHA A;  3AOE C;  2BJV A;  2C96 A;  1IXS B;  4OU7 A;  2KZS A;  3FTC A;  1DO0 A;  5IT9 S;  4MGZ E;  1GVN A;  1IN5 A;  2R62 A;  3SBJ A;  1G41 A;  1X37 A;  2I7P A;  4REZ A;  4LJ4 A;  2FE8 A;  4LJA A;  5E26 A;  2R4E A;  5ITU A;  3FTE A;  1IXR C;  2DWL A;  3GRY A;  1YUB A;  3GQ5 A;  3TL4 X;  1G4A E;  5FTJ A;  2QBY B;  4FWG A;  4MGY E;  1N34 M;  4FCW A;  2XFS A;  4BLC A;  1MX0 A;  1N75 A;  3RGP A;  4LF4 M;  3VDU A;  1HNW M;  3SAW A;  3L2A A;  4IBD A;  3U5Z B;  2JA2 A;  3I51 A;  3EIH A;  4G6Z A;  3U6D A;  3LMM A;  3QWL A;  1IY1 A;  1XXH B;  2F5N A;  3FUT A;  2BJW A;  3J80 S;  2KZU A;  3L26 A;  2XZU A;  2F5P A;  4G4O A;  5EJC A;  4LF9 M;  4B7G A;  1DGH B;  1R6B X;  3U60 A;  4NSO B;  3THG A;  2L7H A;  2ZAM A;  4FD2 A;  1L2C A;  2BNK A;  4Z6Y A;  3GQ4 A;  2L09 A;  1N77 A;  4LFB M;  1R2Z A;  1Z5B A;  2NQ8 C;  1IBL M;  4FWD A;  4KLN A;  5EXP A;  1QAQ A;  2Y0T A;  3HJS A;  8CAT A;  4DR2 M;  2AHM A;  2EUC A;  2Z4S A;  5LMN M;  2DXI A;  1I4W A;  5F3W A;  2DVW B;  4JXJ A;  3VKH A;  1G59 A;  4JYA M;  3W0L B;  2KRU A;  2XH9 A;  3UZU A;  4QHT A;  4GKJ M;  3IG5 A;  4B7H A;  3JAM S;  3IG8 A;  1HNZ M;  2XSZ A;  3B9P A;  1N36 M;  3KSJ A;  4X66 M;  4BB9 A;  2VQE M;  2HHH M;  2LNH C;  2F5Q A;  5ITX A;  2L6O A;  3VK8 A;  4I81 A;  2UXC M;  3KDS E;  2LWX A;  5EXT A;  3L28 A;  4D82 A;  4AQY M;  4FW9 A;  4CHT B;  1IBM M;  4WW0 A;  4DV5 M;  2YQZ A;  5GKN A;  2KXE A;  2CFO A;  4MGK E;  5FTL A;  4S12 A;  3SFZ A;  1YSY A;  2Y0Q A;  2OQ4 A;  4MGI E;  1Q3C A;  3GPU A;  3RE8 A;  1PJJ A;  3GRU A;  2HKJ A;  5A2Q S;  3UK6 A;  4FCV A;  4NRV A;  1QVR A;  4MM3 B;  4IIW A;  2X8A A;  1DGB A;  4M0D A;  5ITT A;  3GLI B;  4DV4 M;  2DWZ B;  2KA6 B;  4IBE A;  4JI4 M;  3H4M A;  3HU2 A;  3Q8X A;  3VDP A;  4DV0 M;  1NHW C;  1NJG A;  3HHW A;  4AG6 A;  4D80 A;  5EP4 A;  2QP9 X;  3K92 A;  1YE9 A;  4LCB A;  1Q39 A;  4PCZ A;  2QCU A;  2XGN A;  4QOZ C;  5EP3 A;  2YFQ A;  5FTM A;  1L8Q A;  3VK7 A;  1J7K A;  1OFH A;  3HGI A;  2LH0 A;  5C18 A;  3UMM A;  1HT1 E;  1W5T A;  4JI1 M;  4I8O A;  3KS8 A;  3T1Y M;  3WHL A;  4DR4 M;  1Z59 A;  1Z5C A;  3HU1 A;  4B7F A;  3BOS A;  4QNM A;  4D81 A;  5EP1 A;  1NJF A;  4AKH A;  4II7 A;  1ZAE A;  2R18 A;  2KW0 A;  1XMQ M;  4EIW A;  4PT5 A;  3RFW A;  3GLH A;  3AKZ A;  3C58 A;  4Z8X A;  3GLF A;  4DR1 M;  1GL7 A;  3QAU A;  4L15 A;  3SHG B;  1E94 E;  1QZM A;  2UXD M;  3SHF A;  4X62 M;  4AG5 A;  4PDI A;  2M5Z A;  5IRE B;  1HT2 E;  1HNX M;  3UGJ A;  1KYI A;  3U6Q A;  3A42 A;  3TWM A;  3CF6 E;  3U61 B;  4JN6 A;  4DV3 M;  4GRI A;  3AL0 C;  4X65 M;  4QHS A;  2D7G A;  3FTF A;  3GRV A;  4DUZ M;  3DOA A;  2Z3X A;  4AW4 A;  2QBY A;  2O5R A;  2C98 A;  3GPY A;  3MHV C;  2UUA M;  4LZJ A;  2DWM A;  2CEA A;  4NOO B;  4KHP M;  4P16 A;  1OJL A;  3KOW E;  1K82 A;  2C5R A;  4DUY M;  1TDZ A;  3U6L A;  3A98 B;  3DFZ A;  1L1T A;  3ZC7 B;  3HHX A;  3DZD A;  1NNU C;  2K47 A;  3KFU G;  4GHL A;  4DV1 M;  1GLN A;  1XNQ M;  3VLF B;  3SMS A;  2Z4R A;  4B3S M;  1Z5A A;  5FTK A;  4LG2 A;  1JR3 D;  4DV2 M;  1HR0 M;  2UUB M;  1WXQ A;  2R4J A;  4XGI A;  1T3T A;  4M0W A;  2W82 A;  3U6S A;  1QQW A;  4IJE A;  3KOZ E;  3GQ3 A;  3AOE A;  1JQJ C;  2QZ4 A;  4LRS A;  3GLH B;  4OW0 A;  3SC3 A;  2UU9 M;  4YY3 M;  4NRW A;  4JI8 M;  2V1U A;  3AOG A;  3HJQ A;  1Q3B A;  3J2P B;  3J27 B;  1D2N A;  3MJ5 A;  4R3D A;  4DR6 M;  2D7E A;  3R8F A;  1XWI A;  2ZM6 M;  4LJ7 A;  2E5L M;  2M60 A;  4PDG A;  4NXM M;  3KOX E;  4CGY B;  5DNY A;  1J09 A;  3KXE C;  5EQT A;  3JR5 A;  3FUU A;  3HWS A;  3A46 A;  1HQY E;  5FTN A;  4BBA A;  3SAR A;  4JV5 M;  1E9S A;  3RGS A;  2G8L A;  3KVW A;  3E4R A;  4LGY A;  2XSZ D;  4ITQ A;  1NSF A;  2YR0 A;  3AJI B;  4B3T M;  4K0K M;  2OPF A;  4MH0 E;  4JI0 M;  3U6C A;  4B3R M;  1SXJ C;  3EIE A;  1R2Y A;  4IBJ A;  3FUW A;  2FFJ A;  3ZCB B;  4GIT A;  2G5G X;  5IWA M;  1N33 M;  1JR3 A;  3PFI A;  1KSF X;  4JI5 M;  2X4A A;  3PXG A;  1VDD A;  4IBC A;  3W0F A;  4M9X A;  3U60 B;  3KOY E;  2CV1 A;  4JI2 M;  1FNN A;  5DYI A;  4L4U A;  1IN8 A;  2ERC A;  2EO2 A;  4CIS A;  3FUV A;  1SXJ E;  3AV0 A;  5IZ7 D;  2XFT A;  2J7O A;  2I7N A;  3U6O A;  3U5Z A;  4M9Z A;  2F5O A;  2R46 A;  5H37 D;  3J7B A;  4IBK A;  1XMO M;  3PNV A;  2LXE A;  1ORY B;  3VFD A;  2DHR A;  3GLI A;  3LVV A;  1SXJ A;  4LY6 A;  2ZAO A;  4KO8 A;  3VKG A;  2XLJ A;  5ITX E;  3GLG B;  4OVZ A;  1GL6 A;  2Y21 A;  5BPV A;  5EP2 A;  2J7N A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...