4KHPM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4khpM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4khpM02
4DV1M 4OX9M 4NRWA 5FLXS 3A42A 1XMQM 2F5QA 4PDGA 1HNWM 2F5SA 2OQ4A 4AQYM 4LF8M 1IBLM 4YY3M 3W0FA 5BR8M 3VK8A 1J5EM 1EE8A 1N36M 1HR0M 4PCZA 4DR3M 3SATA 4LFAM 5ITXA 5ITXE 5ITRA 3T1HM 1K3XA 4GKKM 4DV0M 2F5OA 1PM5A 3U6MA 3J7AS 3GQ5A 2UXDM 3VK7A 1MX0A 4G4NA 1L2DA 1KFVA 4B3TM 4NRVA 4G4QA 1Z5CA 1HNXM 2UUBM 2ZBKB 4DV2M 3OTOM 1L2CA 2VQFM 1Z5BA 4B3SM 1HNZM 4X64M 3GQ3A 3U6LA 4DR6M 5ITTA 1NNJA 4JI6M 5LMNM 4DR5M 4JI4M 1XNRM 2HKJA 2UUAM 3SASA 2XZUA 4JI0M 4LFCM 1I94M 1PJIA 2VQEM 4G4RA 5ITYA 4B3MM 4DR7M 4X62M 2F5NA 1N33M 3GPPA 2Q2EB 1N34M 1IBMM 3U6DA 4JI7M 1IBKM 1XC8A 4LF7M 5IWAM 2OPFA 4JYAM 5IT9S 2F4VM 4LF6M 3JR4A 1R2ZA 4B3RM 4DUZM 1Z5AA 5LMUM 4MB7A 1L2BA 1Z59A 1R2YA 4NXMM 4DV7M 3J80S 3JR5A 3U6CA 2ZM6M 4DR2M 4DV3M 4DV6M 4JI3M 1L1TA 3TWKA 4LF9M 3JAMS 4G4OA 1L1ZA 4YHHM 3U6EA 4ITQA 3GO8A 4K0KM 3SARA 1Q3CA 1TDZA 1Q3BA 4DUYM 3GPYA 3SAUA 3GP1A 2EA0A 1PJJA 4CISA 3U6QA 4JI1M 4DR1M 4X66M 4PDIA 4DV5M 3SAVA 2E5LM 3GPUA 2UUCM 1FJGM 2XZFA 3DOAA 3U6OA 3J81S 4LF4M 4DR4M 3U6PA 3TWMA 3A45A 2HHHM 4LF5M 5ITQA 4JI8M 1XMOM 4NXNM 1Q39A 4PD2A 3SBJA 1XNQM 3C58A 5A2QS 3GPXA 3A46A 3TWLA 2UXCM 4JI2M 3SAWA 3U6SA 4JI5M 2F5PA 4JV5M 4X65M 4LFBM 1TDHA 5ITUA 2UU9M 1K3WA 1K82A 3GQ4A 1MU5A 4KHPM 2UXBM 4GKJM 3T1YM 4DV4M 1N32M
chains in the Genus database with same CATH superfamily
3B9PA 4OX9M 1TR8A 4LJAA 1SXJE 2F5QA 2CP8A 4PT5A 4PDGA 1HNWM 3KS4A 2OQ4A 1QVRA 2N35A 1G3IA 1IBLM 4I81A 3L27A 1G8PA 3SATA 4DR3M 4LFAM 3K9OA 2C5RA 2CV0A 4B7HA 1K3XA 1H6UA 4GKKM 4HL4A 4OVZB 1R4GA 1ZV1A 1NHWC 2M60A 3LQRA 1NV9A 4HEOA 3GQ5A 1MX0A 3FD9A 2CWBA 3SMPA 2O5RA 4AI6A 1Z5CA 1DGHB 2R4JA 3KS8A 2ZBKB 4DV2M 3KW6A 2GQFA 4M9XA 1AIPC 3KP1E 1J09A 3HHWA 3E9SA 1VEKA 2DHRA 3LW5F 4B3SM 1HNZM 2CV1A 3HJQA 4GEWA 3A98B 1NVMA 5ITTA 4S12A 4Z6YA 1VDDA 4JI6M 1NY6A 5LMNM 4IIWA 4JI4M 4M9SA 2HKJA 3SASA 3VKGA 3HZJA 4FCVA 2R4EA 2XFSA 1GABA 3BXWA 3GLGA 3U60A 3U5ZB 1IN6A 3DFZA 2VQEM 1T43A 4FWHA 3HX3A 3FUUA 4X62M 4WURA 2JWSA 1ZMUA 1N34M 1IBMM 2CHQA 1NNUC 2DHYA 2BJVA 2L4EA 3D8BA 4LRSA 3UK6A 3L28A 4CGYB 2QCUA 3ZC7B 4JYAM 4IBKA 2F4VM 2ZTCA 3JR4A 2QQ8A 2R46A 3IG5A 4MB7A 3RGPA 3AV0A 5FTJA 5BPVA 4NXMM 1ZQ9A 2L7HA 1JR3E 3U61A 3IHPA 1Y8GA 2LVNC 3KOYE 3JR5A 3I4YA 4DR2M 4DV3M 4Y28F 4QNMA 1MN3A 4DV6M 4JI3M 1L1TA 3J27B 3TWKA 3FTCA 1I4WA 4FW9A 2R44A 1DGFA 3VDUA 4IBBA 4B08A 4G3OA 3AL0C 3Q8XA 5KO3A 2LVAA 1NO1A 4G6ZA 4GMQA 2R65A 2JUJA 2XFTA 4QOZC 2FH0A 5EP2A 2NQ8C 2RKOA 2DI0A 4IBCA 3HHYA 4PDIA 1VG5A 2DAGA 4DV5M 2KNVA 3B89A 1SXJB 1SXJC 4MGYE 4R71A 3GLHA 3GLHE 1YLAA 4OU7A 2C96A 3GPUA 4GHLA 2UUCM 2QBYB 1GLNA 2DNAA 1GO5A 3TPZA 3H4JA 3HU3A 2C9OA 3KOZE 2YR0A 2YQZA 4MH0E 2L09A 4NSRA 2ZAMA 2HHHM 4D80A 5E26A 2MROB 2CEAA 1WIVA 2G3QA 3WHLA 1D0MA 2KEBA 3KDSE 1L8QA 2CRUA 5JI2E 1XNQM 3D8LA 3RE8A 2JZ1A 3GRYA 2JY6B 3A46A 4DBGB 5FTLA 2F5PA 3M0EA 1OAOC 4JV5M 1G71A 4LJ8A 3MHVC 4CIZA 5DNYA 1E9SA 3U5ZA 2ERCA 2UU9M 3UMMA 3J2PB 1ZMVA 4FWGA 1GKIA 2FE8A 2VF8A 4MGZE 1PGYA 3CTWB 4DV1M 2FFJA 2XEPA 3GRRA 5FLXS 5DYIA 3SHGB 1D0LA 3ZQJA 4AQYM 1QQWA 4LF8M 1IFYA 2D7GA 4R3DA 4R7GA 2JA2A 1E9RA 1QANA 2KDLA 3AJIB 1W5SA 3NBXX 4HLQA 3M6AA 4MM3B 1JB0F 4WP2A 1HR0M 1V34A 4IBGA 4P17A 2EO2A 1V92A 2KRKA 4IBIA 3C9PA 4KT0F 5EP4A 1QAMA 3SYKA 2V1CA 5E6JA 2F5OA 3VK7A 3J7AS 1OKSA 3W68A 2RGHA 4G4NA 3EIHA 2MH8A 4NRVA 3TE6A 2UUBM 2B3TA 3HJSA 3OTOM 2JY5A 3VLFB 5KPRA 1Z5BA 2BJWA 1IY1A 3QWLA 1HT2E 2EKFA 1OAIA 4L15A 3B7QA 2Y0TA 2L6OA 2J7OA 3KSJA 4L4UA 3GQ3A 3U6LA 2DZNB 1PJQA 3HHXA 2G5GX 1NNJA 4AKIA 1SXJA 4RKUF 4LJ7A 1XNRM 3GLIE 5EXXA 5EXTA 4JI0M 3W0LB 1GJTA 2QBYA 1S3SA 1PJIA 3GLHB 3L2AA 5ITYA 3QAUA 2O01F 4QHSA 1AUAA 4XK8F 1RU3A 1TF0B 2Q2EB 4IJFA 1J7KA 1KSFX 2HCBA 1IBKM 3GLFE 4LF7M 3SC3A 1W5TA 2OPFA 3TL4X 2DAMA 3HJ8A 2DZOB 3RGSA 5IT9S 4LF6M 3LCUA 5H37D 4II7A 1OFIA 2OOBA 5FTNA 1T6OA 4IBJA 1Z5AA 4OW0A 1G4AE 4LJ6A 4L16A 1UFZA 1R2YA 4WW0A 2JP7A 1SXJD 3DA1A 2JY7A 1QZEA 3LVVA 1EIJA 1FNNA 2LWXA 1MJGM 1NJFA 4KODA 3KFUG 3JAMS 2OO9A 2LVPC 5C18A 2LVQD 1HQCA 1NV8A 4YHHM 3U6EA 1ORYB 2EKKA 4AKHA 2APLA 3K9PA 3I51A 3GO8A 1QZMA 2J7NA 1Q3CA 4AG6A 2R18A 5IREB 1Q3BA 1OIZA 2WSCF 1PJJA 3H4MA 4DR1M 4X66M 4D82A 1PJSA 3SAVA 3HKPA 2EUCA 1GL6A 2E5LM 3LCVB 8CATA 1R7RA 2KNAA 2RGOA 3FUVA 3MK6A 1X37A 3DOAA 4B7FA 2DAIA 3E4RA 3FTFA 4MGHA 3J81S 4KLNA 2QSFX 3PVSA 4BBAA 1NHGC 2DWZB 3K8ZA 4IJEA 3B74A 1IN7A 3U6PA 4LF4M 4L78A 2KXEA 1JR3A 2J5YA 3SHFA 3KOXE 1XMOM 2A5YB 2DWMA 2LBCA 2ZANA 1OIPA 1QUTA 3CF6E 5FTKA 2DXIA 1WGNA 5A2QS 3FRIA 1QAOA 2M5ZA 2WSFF 3HGIA 5DFLA 4I4LA 1NJGA 1QDRA 3SAWA 3U6SA 1XXHA 1XXHE 4X65M 3ILKA 4GH9A 1YUBA 4LFBM 1TDHA 3I4VA 1GJSA 2KZSA 1K3WA 1BVSA 3FTEA 3GLIB 2UXBM 2MGWA 2DVWB 1WR1B 5FTMA 4LRTA 4FCWA 2K9DA 2KRUA 1JR3D 3A42A 1XMQM 5KPZA 4GHAA 4ZPXA 3BOSA 2OOAA 1GL7A 2O25A 3T6PA 5C1BA 1JQJC 3W0FA 3T38A 1XB2B 5BR8M 1EE8A 3GLFB 3VKHA 3Q8GA 1N36M 1IN8A 4GC9A 4QNRA 4FWDA 4RF1A 5ITXA 5ITXE 2BWEA 5ITRA 3QYEA 3T1HM 4Q7JA 1SG9A 1Z6TA 1IXZA 4LZZA 4A3VB 4Z8XA 2CHGA 2UXDM 4P16A 2VDBB 2YFQA 1L2DA 4W5WA 4B3TM 4G4QA 1OQYA 4M9ZA 1VDLA 2HWJA 1T3TA 2ZTDA 1LTMA 4GC5A 3R9XB 3FYDA 1L2CA 2VQFM 1EFUB 3CGWA 4MGIE 2D7HA 5IZ7D 3AOEC 4L8RC 3M7GA 2K47A 4D81A 3KOWE 2LTUA 4DR5M 5EQTA 1XHBA 2C99A 2FS1A 2UUAM 1TH2A 3L26A 1HT1E 4LFCM 4BLCA 4LGYA 2RRUA 4G4RA 4IBFA 4DR7M 1N77A 1IXSB 2H5XA 3HWSA 5JI3E 4I5SA 2F5NA 1ZMWA 1VEJA 3SYLA 3U6DA 2VIIA 4JI7M 1XC8A 4LGMA 5L8RF 2LHGA 4LCBA 5IWAM 1QYRA 2G8LA 2Y21A 3KP0E 1HQYE 4NC6A 4F2LA 1VEGA 1R2ZA 4B3RM 2QPAA 4FD2A 1V33A 1PRBA 1TTEA 2LHCA 5LMUM 1IXRC 3NWLA 3HU1A 1L2BA 1Z59A 1NSFA 1OJLA 4FCTA 4TUWA 1CUKA 2CE7A 4AKGA 2V1UA 2Z7JA 1XXHB 2V6ZM 1HJPA 2QHOB 3GLIA 1F4IA 5EXPA 4G4OA 1L1ZA 4NL4H 4UN2B 1E32A 4ITQA 2C9CA 4K0KM 4EIWA 3UZUA 5DYGA 3GPYA 3SAUA 1IM2A 4FVMA 4RNAA 1WXQA 3PNYA 3U6QA 4CISA 2MJ5B 3K2LA 2BNKA 2R45A 3UGJA 2R62A 3GLFA 1NY5A 2XF3A 4M0WA 1PJTA 1Q02A 1DGGA 1R6BX 1IN4A 3B7ZA 3KVWA 3U6OA 3GRVA 1TH3A 4DR4M 3EIEA 3AOGA 2L7IA 2JNHA 3A45A 3E46A 4LF5M 4BB9A 5EP1A 4JI8M 3MJ5A 1Q39A 5EXSA 3PNVA 3E21A 2LVOC 3VDPA 3AOEA 2QP9X 2X4AA 2FOIC 2JXNA 4KO8A 3GPXA 4QOSA 2UXCM 3PFIA 3C3EA 4JI2M 3LVWA 3AKZA 2DZLA 4ANRA 2QENA 2K6BA 3C3DA 3AFHA 2CHVA 3SFZA 3W67A 3FUWA 4AZFA 2X8AA 1D2NA 5EP3A 1K82A 3GQ4A 3GRUA 1IXSA 4GKJM 4GRIA 2XSZA 3CF0A 3IECA 2Y0QA 5KQ8A 3T1YM 4LJ5A 4NRWA 4NSOB 3FYCA 2F5SA 3PXGA 4CHTB 3V76A 2EJSA 3ZCBB 2MR9A 3FUXA 4YY3M 2C98A 3GLGE 3VK8A 2QNJA 2L2DA 1J5EM 2D7EA 3I04M 3TQSA 2DKLA 4PCZA 1GVNA 3BBZA 2JZ0A 1QAQA 3MMPA 5GKNA 2CV2A 3DZDA 2Z8YM 4DV0M 1PM5A 3WHKA 3U6MA 1XWIA 2WZJA 3LQQA 1KFVA 3L25A 1HNXM 1E94E 2XH9A 4LJ9A 4L6V6 5FSWA 1G41A 2K0BX 2BWBA 4QHTA 1DO2A 1OFHA 2XSZD 2FNAA 4LY6A 1IY0A 2QZ4A 4X64M 3T15A 4DR6M 4LZJA 1TH4A 3FRHA 2H1RA 3NBIA 3FTDA 5F3WA 1G59A 2WSEF 2R0IA 4MGKE 4B7GA 4F1IA 3F92A 5KQDA 2VF7A 2XZUA 3L29A 1KYIA 1I94M 1ZAEA 2KW0A 1IN5A 4B3MM 4AG5A 1N33M 1WHCA 3GPPA 2KNZA 4NOOB 3FKEA 2X49A 2XGNA 2P5TA 1D0KA 4IBDA 1R5LA 1YSYA 3K1JA 2DENA 4I8OA 1IQPA 2I7PA 2ZAOA 7CATA 4DUZM 4OVZA 1N75A 5EJCA 4DV7M 3J80S 2LXEA 1DGHA 3U6CA 3HU2A 2ZM6M 3HHZA 2KA6B 4M0DA 1QDTA 2L4FA 4LF9M 2HAKA 2KZUA 2LNHC 4AW4A 1A5TA 3R8FA 1VQ1A 3SARA 3SMSA 2R6FA 1TDZA 1TGUA 1WJ7A 1OTRA 4JXJA 2XLJA 4DUYM 1C1KA 3GP1A 3ZH9B 2DAKA 2EA0A 1C7YA 4JN6A 1UM8A 4GIPA 4JI1M 3QYBA 3RFWA 2LH0A 4GITA 1FJGM 3K92A 4CJ6A 5KPTA 2Z3XA 2XZFA 4REZA 2GNOA 2Z4SA 3GLGB 1P3QQ 2HL7A 4XGIA 3U60B 2DWNA 1DV0A 2DWLA 3FUTA 3TWMA 2YNMD 3VFDA 1N78A 5ITQA 1WGLA 3HY5A 3KSXA 4NXNM 3IG8A 4IBEA 1LV7A 4LJ4A 1QUSA 3KXEC 4XBOA 4PD2A 2I7NA 2Y20A 3SBJA 3C58A 1DGBA 3B7NA 2AHMA 3TWLA 2Z4RA 2DAEA 3CF2A 3THGA 4JI5M 2KHHA 2CUZA 3J7BA 2CFOA 3U61B 1DO0A 3FE3A 3LMMA 4RF0A 5ITUA 3UJNA 1YE9A 3I01M 2W82A 1MU5A 4KHPM 2JY8A 4LG2A 4DV4M 1N32M 1IY2A
chains in the Genus database with same CATH topology
3B9PA 4OX9M 4LJAA 1SXJE 2F5QA 4PDGA 4PT5A 1HNWM 3KS4A 2OQ4A 1QVRA 1G3IA 1IBLM 4I81A 3L27A 1G8PA 3SATA 4DR3M 4LFAM 2C5RA 2CV0A 4B7HA 1K3XA 1H6UA 4GKKM 4HL4A 4OVZB 2M60A 3GQ5A 1NHWC 3LQRA 1MX0A 3FD9A 3SMPA 2O5RA 4AI6A 1Z5CA 1DGHB 2R4JA 3KS8A 2ZBKB 4DV2M 3KW6A 4M9XA 3KP1E 1J09A 3HHWA 3E9SA 4B3SM 2DHRA 1HNZM 2CV1A 3HJQA 5ITTA 3A98B 1NVMA 4S12A 4Z6YA 1VDDA 4JI6M 1NY6A 5LMNM 4IIWA 4JI4M 4M9SA 2HKJA 3SASA 3VKGA 4FCVA 2R4EA 2XFSA 3GLGA 3U60A 3U5ZB 1IN6A 3DFZA 2VQEM 4FWHA 3FUUA 4X62M 4WURA 1N34M 1IBMM 2CHQA 1NNUC 2BJVA 3D8BA 4LRSA 3UK6A 3L28A 4CGYB 2QCUA 3ZC7B 4JYAM 4IBKA 2F4VM 3JR4A 2R46A 3IG5A 4MB7A 3RGPA 3AV0A 5FTJA 5BPVA 4NXMM 1ZQ9A 2L7HA 3U61A 3KOYE 3JR5A 3I4YA 4DR2M 4DV3M 4QNMA 4DV6M 4JI3M 1L1TA 3J27B 3TWKA 3FTCA 1I4WA 4FW9A 1DGFA 3VDUA 4IBBA 4B08A 3AL0C 3Q8XA 5KO3A 4G6ZA 4GMQA 2R65A 2XFTA 4QOZC 5EP2A 2NQ8C 2RKOA 4IBCA 3HHYA 4PDIA 4DV5M 1SXJB 1SXJC 4MGYE 3GLHA 4OU7A 2C96A 3GPUA 4GHLA 2UUCM 2QBYB 1GLNA 3TPZA 3HU3A 2C9OA 3KOZE 2YR0A 2YQZA 4MH0E 2L09A 4NSRA 2ZAMA 2HHHM 4D80A 5E26A 2CEAA 3WHLA 2KEBA 3KDSE 1L8QA 5JI2E 1XNQM 3D8LA 3RE8A 3GRYA 3A46A 5FTLA 2F5PA 3M0EA 4JV5M 4LJ8A 3MHVC 5DNYA 1E9SA 3U5ZA 2ERCA 2UU9M 3UMMA 3J2PB 4FWGA 1GKIA 2FE8A 4MGZE 4DV1M 3CTWB 2FFJA 2XEPA 3GRRA 5FLXS 5DYIA 3SHGB 4AQYM 4LF8M 1QQWA 2D7GA 4R3DA 4R7GA 2JA2A 1E9RA 1QANA 3AJIB 4HLQA 1W5SA 4MM3B 1HR0M 3M6AA 4IBGA 2EO2A 2KRKA 4IBIA 2F5OA 5EP4A 1QAMA 3SYKA 2V1CA 5E6JA 3J7AS 3VK7A 4G4NA 2RGHA 3EIHA 4NRVA 3TE6A 2UUBM 3HJSA 3OTOM 3VLFB 5KPRA 1Z5BA 2BJWA 1IY1A 3QWLA 1HT2E 4L15A 2Y0TA 2L6OA 2J7OA 3KSJA 4L4UA 3GQ3A 3U6LA 2DZNB 3HHXA 2G5GX 1NNJA 4AKIA 1SXJA 4LJ7A 1XNRM 5EXXA 5EXTA 4JI0M 3W0LB 2QBYA 1S3SA 1PJIA 3GLHB 3L2AA 5ITYA 3QAUA 4QHSA 2Q2EB 4IJFA 1J7KA 1KSFX 2HCBA 1IBKM 4LF7M 3SC3A 1W5TA 2OPFA 3TL4X 3HJ8A 2DZOB 3RGSA 5IT9S 4LF6M 5H37D 4II7A 1OFIA 5FTNA 4IBJA 4OW0A 1Z5AA 1G4AE 4LJ6A 4L16A 1R2YA 4WW0A 1SXJD 3DA1A 3LVVA 1FNNA 2LWXA 1NJFA 4KODA 3KFUG 3JAMS 5C18A 1HQCA 4YHHM 3U6EA 1ORYB 4AKHA 3I51A 3GO8A 1QZMA 2J7NA 1Q3CA 4AG6A 2R18A 5IREB 1Q3BA 1PJJA 3H4MA 4DR1M 4X66M 4D82A 3SAVA 3HKPA 2EUCA 1GL6A 2E5LM 8CATA 1R7RA 3FUVA 2RGOA 3MK6A 1X37A 3DOAA 4B7FA 3E4RA 3FTFA 4MGHA 3J81S 4KLNA 3PVSA 4BBAA 1NHGC 2DWZB 3K8ZA 4IJEA 3U6PA 1IN7A 4LF4M 4L78A 2KXEA 1JR3A 3SHFA 3KOXE 1XMOM 2A5YB 2DWMA 2ZANA 3CF6E 5FTKA 2DXIA 5A2QS 1QAOA 2M5ZA 3HGIA 4I4LA 1NJGA 3SAWA 3U6SA 1XXHA 4X65M 3ILKA 4GH9A 1YUBA 4LFBM 1TDHA 3I4VA 2KZSA 1K3WA 3FTEA 3GLIB 2UXBM 2DVWB 5FTMA 4LRTA 4FCWA 2KRUA 1JR3D 3A42A 1XMQM 5KPZA 4GHAA 4ZPXA 3BOSA 1GL7A 5C1BA 1JQJC 3W0FA 3T38A 5BR8M 3VKHA 1EE8A 3GLFB 1N36M 1IN8A 4GC9A 4QNRA 4FWDA 4RF1A 5ITXA 5ITXE 5ITRA 3T1HM 1Z6TA 1IXZA 4LZZA 4A3VB 4Z8XA 2CHGA 2UXDM 4P16A 2YFQA 1L2DA 4W5WA 4B3TM 4G4QA 4M9ZA 1T3TA 4GC5A 3R9XB 3FYDA 1L2CA 2VQFM 4MGIE 2D7HA 5IZ7D 3AOEC 4L8RC 3M7GA 2K47A 4D81A 3KOWE 4DR5M 5EQTA 1XHBA 2C99A 2UUAM 1TH2A 3L26A 1HT1E 4LFCM 4BLCA 4LGYA 4G4RA 4IBFA 4DR7M 1N77A 1IXSB 5JI3E 3HWSA 2F5NA 4I5SA 3SYLA 3U6DA 2VIIA 4JI7M 1XC8A 4LGMA 4LCBA 5IWAM 1QYRA 2G8LA 2Y21A 3KP0E 1HQYE 1R2ZA 4B3RM 2QPAA 4FD2A 5LMUM 1IXRC 3NWLA 3HU1A 1L2BA 1Z59A 1NSFA 1OJLA 4FCTA 4TUWA 2CE7A 4AKGA 2V1UA 2Z7JA 1XXHB 2V6ZM 3GLIA 5EXPA 4G4OA 1L1ZA 4NL4H 4ITQA 1E32A 2C9CA 4K0KM 4EIWA 3UZUA 5DYGA 3GPYA 3SAUA 1IM2A 4FVMA 4RNAA 1WXQA 3PNYA 3U6QA 4CISA 3K2LA 2BNKA 2R45A 3UGJA 2R62A 3GLFA 1NY5A 2XF3A 4M0WA 1DGGA 1R6BX 1IN4A 3KVWA 3U6OA 3GRVA 1TH3A 4DR4M 3EIEA 3AOGA 2L7IA 3A45A 4LF5M 4BB9A 5EP1A 4JI8M 3MJ5A 1Q39A 5EXSA 3PNVA 3VDPA 3AOEA 2QP9X 2X4AA 2FOIC 4KO8A 3GPXA 4QOSA 2UXCM 3PFIA 4JI2M 3LVWA 3AKZA 2QENA 3AFHA 2CHVA 3SFZA 4AZFA 3FUWA 2X8AA 1D2NA 5EP3A 1K82A 3GQ4A 3GRUA 4GKJM 4GRIA 2XSZA 3CF0A 5KQ8A 2Y0QA 3T1YM 4LJ5A 4NRWA 4NSOB 3FYCA 2F5SA 3PXGA 4CHTB 3ZCBB 4YY3M 3FUXA 2C98A 3VK8A 1J5EM 2D7EA 3TQSA 4PCZA 1GVNA 1QAQA 5GKNA 2CV2A 3DZDA 4DV0M 1PM5A 3WHKA 3U6MA 1XWIA 3LQQA 1KFVA 3L25A 1HNXM 1E94E 2XH9A 4LJ9A 5FSWA 1G41A 4QHTA 1DO2A 1OFHA 2XSZD 2FNAA 4LY6A 1IY0A 2QZ4A 4X64M 3T15A 4DR6M 4LZJA 1TH4A 2H1RA 3NBIA 3FTDA 5F3WA 1G59A 4MGKE 4B7GA 5KQDA 2XZUA 3L29A 1KYIA 1I94M 1ZAEA 2KW0A 1IN5A 4B3MM 4AG5A 1N33M 3GPPA 4NOOB 3FKEA 2X49A 2XGNA 2P5TA 4IBDA 1YSYA 3K1JA 4I8OA 1IQPA 2I7PA 2ZAOA 7CATA 4DUZM 4OVZA 1N75A 5EJCA 4DV7M 3J80S 2LXEA 1DGHA 3U6CA 3HU2A 2ZM6M 3HHZA 2KA6B 4M0DA 4LF9M 2KZUA 2LNHC 4AW4A 3R8FA 3SARA 3SMSA 1TDZA 1TGUA 4JXJA 2XLJA 4DUYM 1C1KA 3GP1A 3ZH9B 2EA0A 4JN6A 1UM8A 4GIPA 4JI1M 3RFWA 2LH0A 4GITA 1FJGM 3K92A 5KPTA 2XZFA 2Z3XA 4REZA 2Z4SA 3GLGB 3U60B 2HL7A 4XGIA 2DWNA 2DWLA 3FUTA 3TWMA 2YNMD 3VFDA 1N78A 5ITQA 3KSXA 4NXNM 3IG8A 4IBEA 1LV7A 4LJ4A 3KXEC 4PD2A 4XBOA 3SBJA 2I7NA 2Y20A 3C58A 1DGBA 2AHMA 3TWLA 2Z4RA 3CF2A 3THGA 4JI5M 2CUZA 3J7BA 2CFOA 3U61B 1DO0A 3LMMA 4RF0A 5ITUA 3UJNA 1YE9A 2W82A 1MU5A 4KHPM 4LG2A 4DV4M 1N32M 1IY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 M;  4OX9 M;  4NRW A;  5FLX S;  3A42 A;  1XMQ M;  2F5Q A;  4PDG A;  1HNW M;  2F5S A;  2OQ4 A;  4AQY M;  4LF8 M;  1IBL M;  4YY3 M;  3W0F A;  5BR8 M;  3VK8 A;  1J5E M;  1EE8 A;  1N36 M;  1HR0 M;  4PCZ A;  4DR3 M;  3SAT A;  4LFA M;  5ITX A;  5ITX E;  5ITR A;  3T1H M;  1K3X A;  4GKK M;  4DV0 M;  2F5O A;  1PM5 A;  3U6M A;  3J7A S;  3GQ5 A;  2UXD M;  3VK7 A;  1MX0 A;  4G4N A;  1L2D A;  1KFV A;  4B3T M;  4NRV A;  4G4Q A;  1Z5C A;  1HNX M;  2UUB M;  2ZBK B;  4DV2 M;  3OTO M;  1L2C A;  2VQF M;  1Z5B A;  4B3S M;  1HNZ M;  4X64 M;  3GQ3 A;  3U6L A;  4DR6 M;  5ITT A;  1NNJ A;  4JI6 M;  5LMN M;  4DR5 M;  4JI4 M;  1XNR M;  2HKJ A;  2UUA M;  3SAS A;  2XZU A;  4JI0 M;  4LFC M;  1I94 M;  1PJI A;  2VQE M;  4G4R A;  5ITY A;  4B3M M;  4DR7 M;  4X62 M;  2F5N A;  1N33 M;  3GPP A;  2Q2E B;  1N34 M;  1IBM M;  3U6D A;  4JI7 M;  1IBK M;  1XC8 A;  4LF7 M;  5IWA M;  2OPF A;  4JYA M;  5IT9 S;  2F4V M;  4LF6 M;  3JR4 A;  1R2Z A;  4B3R M;  4DUZ M;  1Z5A A;  5LMU M;  4MB7 A;  1L2B A;  1Z59 A;  1R2Y A;  4NXM M;  4DV7 M;  3J80 S;  3JR5 A;  3U6C A;  2ZM6 M;  4DR2 M;  4DV3 M;  4DV6 M;  4JI3 M;  1L1T A;  3TWK A;  4LF9 M;  3JAM S;  4G4O A;  1L1Z A;  4YHH M;  3U6E A;  4ITQ A;  3GO8 A;  4K0K M;  3SAR A;  1Q3C A;  1TDZ A;  1Q3B A;  4DUY M;  3GPY A;  3SAU A;  3GP1 A;  2EA0 A;  1PJJ A;  4CIS A;  3U6Q A;  4JI1 M;  4DR1 M;  4X66 M;  4PDI A;  4DV5 M;  3SAV A;  2E5L M;  3GPU A;  2UUC M;  1FJG M;  2XZF A;  3DOA A;  3U6O A;  3J81 S;  4LF4 M;  4DR4 M;  3U6P A;  3TWM A;  3A45 A;  2HHH M;  4LF5 M;  5ITQ A;  4JI8 M;  1XMO M;  4NXN M;  1Q39 A;  4PD2 A;  3SBJ A;  1XNQ M;  3C58 A;  5A2Q S;  3GPX A;  3A46 A;  3TWL A;  2UXC M;  4JI2 M;  3SAW A;  3U6S A;  4JI5 M;  2F5P A;  4JV5 M;  4X65 M;  4LFB M;  1TDH A;  5ITU A;  2UU9 M;  1K3W A;  1K82 A;  3GQ4 A;  1MU5 A;  4KHP M;  2UXB M;  4GKJ M;  3T1Y M;  4DV4 M;  1N32 M; 
#chains in the Genus database with same CATH topology
 3B9P A;  4OX9 M;  1TR8 A;  4LJA A;  1SXJ E;  2F5Q A;  2CP8 A;  4PT5 A;  4PDG A;  1HNW M;  3KS4 A;  2OQ4 A;  1QVR A;  2N35 A;  1G3I A;  1IBL M;  4I81 A;  3L27 A;  1G8P A;  3SAT A;  4DR3 M;  4LFA M;  3K9O A;  2C5R A;  2CV0 A;  4B7H A;  1K3X A;  1H6U A;  4GKK M;  4HL4 A;  4OVZ B;  1R4G A;  1ZV1 A;  1NHW C;  2M60 A;  3LQR A;  1NV9 A;  4HEO A;  3GQ5 A;  1MX0 A;  3FD9 A;  2CWB A;  3SMP A;  2O5R A;  4AI6 A;  1Z5C A;  1DGH B;  2R4J A;  3KS8 A;  2ZBK B;  4DV2 M;  3KW6 A;  2GQF A;  4M9X A;  1AIP C;  3KP1 E;  1J09 A;  3HHW A;  3E9S A;  1VEK A;  2DHR A;  3LW5 F;  4B3S M;  1HNZ M;  2CV1 A;  3HJQ A;  4GEW A;  3A98 B;  1NVM A;  5ITT A;  4S12 A;  4Z6Y A;  1VDD A;  4JI6 M;  1NY6 A;  5LMN M;  4IIW A;  4JI4 M;  4M9S A;  2HKJ A;  3SAS A;  3VKG A;  3HZJ A;  4FCV A;  2R4E A;  2XFS A;  1GAB A;  3BXW A;  3GLG A;  3U60 A;  3U5Z B;  1IN6 A;  3DFZ A;  2VQE M;  1T43 A;  4FWH A;  3HX3 A;  3FUU A;  4X62 M;  4WUR A;  2JWS A;  1ZMU A;  1N34 M;  1IBM M;  2CHQ A;  1NNU C;  2DHY A;  2BJV A;  2L4E A;  3D8B A;  4LRS A;  3UK6 A;  3L28 A;  4CGY B;  2QCU A;  3ZC7 B;  4JYA M;  4IBK A;  2F4V M;  2ZTC A;  3JR4 A;  2QQ8 A;  2R46 A;  3IG5 A;  4MB7 A;  3RGP A;  3AV0 A;  5FTJ A;  5BPV A;  4NXM M;  1ZQ9 A;  2L7H A;  1JR3 E;  3U61 A;  3IHP A;  1Y8G A;  2LVN C;  3KOY E;  3JR5 A;  3I4Y A;  4DR2 M;  4DV3 M;  4Y28 F;  4QNM A;  1MN3 A;  4DV6 M;  4JI3 M;  1L1T A;  3J27 B;  3TWK A;  3FTC A;  1I4W A;  4FW9 A;  2R44 A;  1DGF A;  3VDU A;  4IBB A;  4B08 A;  4G3O A;  3AL0 C;  3Q8X A;  5KO3 A;  2LVA A;  1NO1 A;  4G6Z A;  4GMQ A;  2R65 A;  2JUJ A;  2XFT A;  4QOZ C;  2FH0 A;  5EP2 A;  2NQ8 C;  2RKO A;  2DI0 A;  4IBC A;  3HHY A;  4PDI A;  1VG5 A;  2DAG A;  4DV5 M;  2KNV A;  3B89 A;  1SXJ B;  1SXJ C;  4MGY E;  4R71 A;  3GLH A;  3GLH E;  1YLA A;  4OU7 A;  2C96 A;  3GPU A;  4GHL A;  2UUC M;  2QBY B;  1GLN A;  2DNA A;  1GO5 A;  3TPZ A;  3H4J A;  3HU3 A;  2C9O A;  3KOZ E;  2YR0 A;  2YQZ A;  4MH0 E;  2L09 A;  4NSR A;  2ZAM A;  2HHH M;  4D80 A;  5E26 A;  2MRO B;  2CEA A;  1WIV A;  2G3Q A;  3WHL A;  1D0M A;  2KEB A;  3KDS E;  1L8Q A;  2CRU A;  5JI2 E;  1XNQ M;  3D8L A;  3RE8 A;  2JZ1 A;  3GRY A;  2JY6 B;  3A46 A;  4DBG B;  5FTL A;  2F5P A;  3M0E A;  1OAO C;  4JV5 M;  1G71 A;  4LJ8 A;  3MHV C;  4CIZ A;  5DNY A;  1E9S A;  3U5Z A;  2ERC A;  2UU9 M;  3UMM A;  3J2P B;  1ZMV A;  4FWG A;  1GKI A;  2FE8 A;  2VF8 A;  4MGZ E;  1PGY A;  3CTW B;  4DV1 M;  2FFJ A;  2XEP A;  3GRR A;  5FLX S;  5DYI A;  3SHG B;  1D0L A;  3ZQJ A;  4AQY M;  1QQW A;  4LF8 M;  1IFY A;  2D7G A;  4R3D A;  4R7G A;  2JA2 A;  1E9R A;  1QAN A;  2KDL A;  3AJI B;  1W5S A;  3NBX X;  4HLQ A;  3M6A A;  4MM3 B;  1JB0 F;  4WP2 A;  1HR0 M;  1V34 A;  4IBG A;  4P17 A;  2EO2 A;  1V92 A;  2KRK A;  4IBI A;  3C9P A;  4KT0 F;  5EP4 A;  1QAM A;  3SYK A;  2V1C A;  5E6J A;  2F5O A;  3VK7 A;  3J7A S;  1OKS A;  3W68 A;  2RGH A;  4G4N A;  3EIH A;  2MH8 A;  4NRV A;  3TE6 A;  2UUB M;  2B3T A;  3HJS A;  3OTO M;  2JY5 A;  3VLF B;  5KPR A;  1Z5B A;  2BJW A;  1IY1 A;  3QWL A;  1HT2 E;  2EKF A;  1OAI A;  4L15 A;  3B7Q A;  2Y0T A;  2L6O A;  2J7O A;  3KSJ A;  4L4U A;  3GQ3 A;  3U6L A;  2DZN B;  1PJQ A;  3HHX A;  2G5G X;  1NNJ A;  4AKI A;  1SXJ A;  4RKU F;  4LJ7 A;  1XNR M;  3GLI E;  5EXX A;  5EXT A;  4JI0 M;  3W0L B;  1GJT A;  2QBY A;  1S3S A;  1PJI A;  3GLH B;  3L2A A;  5ITY A;  3QAU A;  2O01 F;  4QHS A;  1AUA A;  4XK8 F;  1RU3 A;  1TF0 B;  2Q2E B;  4IJF A;  1J7K A;  1KSF X;  2HCB A;  1IBK M;  3GLF E;  4LF7 M;  3SC3 A;  1W5T A;  2OPF A;  3TL4 X;  2DAM A;  3HJ8 A;  2DZO B;  3RGS A;  5IT9 S;  4LF6 M;  3LCU A;  5H37 D;  4II7 A;  1OFI A;  2OOB A;  5FTN A;  1T6O A;  4IBJ A;  1Z5A A;  4OW0 A;  1G4A E;  4LJ6 A;  4L16 A;  1UFZ A;  1R2Y A;  4WW0 A;  2JP7 A;  1SXJ D;  3DA1 A;  2JY7 A;  1QZE A;  3LVV A;  1EIJ A;  1FNN A;  2LWX A;  1MJG M;  1NJF A;  4KOD A;  3KFU G;  3JAM S;  2OO9 A;  2LVP C;  5C18 A;  2LVQ D;  1HQC A;  1NV8 A;  4YHH M;  3U6E A;  1ORY B;  2EKK A;  4AKH A;  2APL A;  3K9P A;  3I51 A;  3GO8 A;  1QZM A;  2J7N A;  1Q3C A;  4AG6 A;  2R18 A;  5IRE B;  1Q3B A;  1OIZ A;  2WSC F;  1PJJ A;  3H4M A;  4DR1 M;  4X66 M;  4D82 A;  1PJS A;  3SAV A;  3HKP A;  2EUC A;  1GL6 A;  2E5L M;  3LCV B;  8CAT A;  1R7R A;  2KNA A;  2RGO A;  3FUV A;  3MK6 A;  1X37 A;  3DOA A;  4B7F A;  2DAI A;  3E4R A;  3FTF A;  4MGH A;  3J81 S;  4KLN A;  2QSF X;  3PVS A;  4BBA A;  1NHG C;  2DWZ B;  3K8Z A;  4IJE A;  3B74 A;  1IN7 A;  3U6P A;  4LF4 M;  4L78 A;  2KXE A;  1JR3 A;  2J5Y A;  3SHF A;  3KOX E;  1XMO M;  2A5Y B;  2DWM A;  2LBC A;  2ZAN A;  1OIP A;  1QUT A;  3CF6 E;  5FTK A;  2DXI A;  1WGN A;  5A2Q S;  3FRI A;  1QAO A;  2M5Z A;  2WSF F;  3HGI A;  5DFL A;  4I4L A;  1NJG A;  1QDR A;  3SAW A;  3U6S A;  1XXH A;  1XXH E;  4X65 M;  3ILK A;  4GH9 A;  1YUB A;  4LFB M;  1TDH A;  3I4V A;  1GJS A;  2KZS A;  1K3W A;  1BVS A;  3FTE A;  3GLI B;  2UXB M;  2MGW A;  2DVW B;  1WR1 B;  5FTM A;  4LRT A;  4FCW A;  2K9D A;  2KRU A;  1JR3 D;  3A42 A;  1XMQ M;  5KPZ A;  4GHA A;  4ZPX A;  3BOS A;  2OOA A;  1GL7 A;  2O25 A;  3T6P A;  5C1B A;  1JQJ C;  3W0F A;  3T38 A;  1XB2 B;  5BR8 M;  1EE8 A;  3GLF B;  3VKH A;  3Q8G A;  1N36 M;  1IN8 A;  4GC9 A;  4QNR A;  4FWD A;  4RF1 A;  5ITX A;  5ITX E;  2BWE A;  5ITR A;  3QYE A;  3T1H M;  4Q7J A;  1SG9 A;  1Z6T A;  1IXZ A;  4LZZ A;  4A3V B;  4Z8X A;  2CHG A;  2UXD M;  4P16 A;  2VDB B;  2YFQ A;  1L2D A;  4W5W A;  4B3T M;  4G4Q A;  1OQY A;  4M9Z A;  1VDL A;  2HWJ A;  1T3T A;  2ZTD A;  1LTM A;  4GC5 A;  3R9X B;  3FYD A;  1L2C A;  2VQF M;  1EFU B;  3CGW A;  4MGI E;  2D7H A;  5IZ7 D;  3AOE C;  4L8R C;  3M7G A;  2K47 A;  4D81 A;  3KOW E;  2LTU A;  4DR5 M;  5EQT A;  1XHB A;  2C99 A;  2FS1 A;  2UUA M;  1TH2 A;  3L26 A;  1HT1 E;  4LFC M;  4BLC A;  4LGY A;  2RRU A;  4G4R A;  4IBF A;  4DR7 M;  1N77 A;  1IXS B;  2H5X A;  3HWS A;  5JI3 E;  4I5S A;  2F5N A;  1ZMW A;  1VEJ A;  3SYL A;  3U6D A;  2VII A;  4JI7 M;  1XC8 A;  4LGM A;  5L8R F;  2LHG A;  4LCB A;  5IWA M;  1QYR A;  2G8L A;  2Y21 A;  3KP0 E;  1HQY E;  4NC6 A;  4F2L A;  1VEG A;  1R2Z A;  4B3R M;  2QPA A;  4FD2 A;  1V33 A;  1PRB A;  1TTE A;  2LHC A;  5LMU M;  1IXR C;  3NWL A;  3HU1 A;  1L2B A;  1Z59 A;  1NSF A;  1OJL A;  4FCT A;  4TUW A;  1CUK A;  2CE7 A;  4AKG A;  2V1U A;  2Z7J A;  1XXH B;  2V6Z M;  1HJP A;  2QHO B;  3GLI A;  1F4I A;  5EXP A;  4G4O A;  1L1Z A;  4NL4 H;  4UN2 B;  1E32 A;  4ITQ A;  2C9C A;  4K0K M;  4EIW A;  3UZU A;  5DYG A;  3GPY A;  3SAU A;  1IM2 A;  4FVM A;  4RNA A;  1WXQ A;  3PNY A;  3U6Q A;  4CIS A;  2MJ5 B;  3K2L A;  2BNK A;  2R45 A;  3UGJ A;  2R62 A;  3GLF A;  1NY5 A;  2XF3 A;  4M0W A;  1PJT A;  1Q02 A;  1DGG A;  1R6B X;  1IN4 A;  3B7Z A;  3KVW A;  3U6O A;  3GRV A;  1TH3 A;  4DR4 M;  3EIE A;  3AOG A;  2L7I A;  2JNH A;  3A45 A;  3E46 A;  4LF5 M;  4BB9 A;  5EP1 A;  4JI8 M;  3MJ5 A;  1Q39 A;  5EXS A;  3PNV A;  3E21 A;  2LVO C;  3VDP A;  3AOE A;  2QP9 X;  2X4A A;  2FOI C;  2JXN A;  4KO8 A;  3GPX A;  4QOS A;  2UXC M;  3PFI A;  3C3E A;  4JI2 M;  3LVW A;  3AKZ A;  2DZL A;  4ANR A;  2QEN A;  2K6B A;  3C3D A;  3AFH A;  2CHV A;  3SFZ A;  3W67 A;  3FUW A;  4AZF A;  2X8A A;  1D2N A;  5EP3 A;  1K82 A;  3GQ4 A;  3GRU A;  1IXS A;  4GKJ M;  4GRI A;  2XSZ A;  3CF0 A;  3IEC A;  2Y0Q A;  5KQ8 A;  3T1Y M;  4LJ5 A;  4NRW A;  4NSO B;  3FYC A;  2F5S A;  3PXG A;  4CHT B;  3V76 A;  2EJS A;  3ZCB B;  2MR9 A;  3FUX A;  4YY3 M;  2C98 A;  3GLG E;  3VK8 A;  2QNJ A;  2L2D A;  1J5E M;  2D7E A;  3I04 M;  3TQS A;  2DKL A;  4PCZ A;  1GVN A;  3BBZ A;  2JZ0 A;  1QAQ A;  3MMP A;  5GKN A;  2CV2 A;  3DZD A;  2Z8Y M;  4DV0 M;  1PM5 A;  3WHK A;  3U6M A;  1XWI A;  2WZJ A;  3LQQ A;  1KFV A;  3L25 A;  1HNX M;  1E94 E;  2XH9 A;  4LJ9 A;  4L6V 6;  5FSW A;  1G41 A;  2K0B X;  2BWB A;  4QHT A;  1DO2 A;  1OFH A;  2XSZ D;  2FNA A;  4LY6 A;  1IY0 A;  2QZ4 A;  4X64 M;  3T15 A;  4DR6 M;  4LZJ A;  1TH4 A;  3FRH A;  2H1R A;  3NBI A;  3FTD A;  5F3W A;  1G59 A;  2WSE F;  2R0I A;  4MGK E;  4B7G A;  4F1I A;  3F92 A;  5KQD A;  2VF7 A;  2XZU A;  3L29 A;  1KYI A;  1I94 M;  1ZAE A;  2KW0 A;  1IN5 A;  4B3M M;  4AG5 A;  1N33 M;  1WHC A;  3GPP A;  2KNZ A;  4NOO B;  3FKE A;  2X49 A;  2XGN A;  2P5T A;  1D0K A;  4IBD A;  1R5L A;  1YSY A;  3K1J A;  2DEN A;  4I8O A;  1IQP A;  2I7P A;  2ZAO A;  7CAT A;  4DUZ M;  4OVZ A;  1N75 A;  5EJC A;  4DV7 M;  3J80 S;  2LXE A;  1DGH A;  3U6C A;  3HU2 A;  2ZM6 M;  3HHZ A;  2KA6 B;  4M0D A;  1QDT A;  2L4F A;  4LF9 M;  2HAK A;  2KZU A;  2LNH C;  4AW4 A;  1A5T A;  3R8F A;  1VQ1 A;  3SAR A;  3SMS A;  2R6F A;  1TDZ A;  1TGU A;  1WJ7 A;  1OTR A;  4JXJ A;  2XLJ A;  4DUY M;  1C1K A;  3GP1 A;  3ZH9 B;  2DAK A;  2EA0 A;  1C7Y A;  4JN6 A;  1UM8 A;  4GIP A;  4JI1 M;  3QYB A;  3RFW A;  2LH0 A;  4GIT A;  1FJG M;  3K92 A;  4CJ6 A;  5KPT A;  2Z3X A;  2XZF A;  4REZ A;  2GNO A;  2Z4S A;  3GLG B;  1P3Q Q;  2HL7 A;  4XGI A;  3U60 B;  2DWN A;  1DV0 A;  2DWL A;  3FUT A;  3TWM A;  2YNM D;  3VFD A;  1N78 A;  5ITQ A;  1WGL A;  3HY5 A;  3KSX A;  4NXN M;  3IG8 A;  4IBE A;  1LV7 A;  4LJ4 A;  1QUS A;  3KXE C;  4XBO A;  4PD2 A;  2I7N A;  2Y20 A;  3SBJ A;  3C58 A;  1DGB A;  3B7N A;  2AHM A;  3TWL A;  2Z4R A;  2DAE A;  3CF2 A;  3THG A;  4JI5 M;  2KHH A;  2CUZ A;  3J7B A;  2CFO A;  3U61 B;  1DO0 A;  3FE3 A;  3LMM A;  4RF0 A;  5ITU A;  3UJN A;  1YE9 A;  3I01 M;  2W82 A;  1MU5 A;  4KHP M;  2JY8 A;  4LG2 A;  4DV4 M;  1N32 M;  1IY2 A; 
#chains in the Genus database with same CATH homology
 3B9P A;  4OX9 M;  4LJA A;  1SXJ E;  2F5Q A;  4PDG A;  4PT5 A;  1HNW M;  3KS4 A;  2OQ4 A;  1QVR A;  1G3I A;  1IBL M;  4I81 A;  3L27 A;  1G8P A;  3SAT A;  4DR3 M;  4LFA M;  2C5R A;  2CV0 A;  4B7H A;  1K3X A;  1H6U A;  4GKK M;  4HL4 A;  4OVZ B;  2M60 A;  3GQ5 A;  1NHW C;  3LQR A;  1MX0 A;  3FD9 A;  3SMP A;  2O5R A;  4AI6 A;  1Z5C A;  1DGH B;  2R4J A;  3KS8 A;  2ZBK B;  4DV2 M;  3KW6 A;  4M9X A;  3KP1 E;  1J09 A;  3HHW A;  3E9S A;  4B3S M;  2DHR A;  1HNZ M;  2CV1 A;  3HJQ A;  5ITT A;  3A98 B;  1NVM A;  4S12 A;  4Z6Y A;  1VDD A;  4JI6 M;  1NY6 A;  5LMN M;  4IIW A;  4JI4 M;  4M9S A;  2HKJ A;  3SAS A;  3VKG A;  4FCV A;  2R4E A;  2XFS A;  3GLG A;  3U60 A;  3U5Z B;  1IN6 A;  3DFZ A;  2VQE M;  4FWH A;  3FUU A;  4X62 M;  4WUR A;  1N34 M;  1IBM M;  2CHQ A;  1NNU C;  2BJV A;  3D8B A;  4LRS A;  3UK6 A;  3L28 A;  4CGY B;  2QCU A;  3ZC7 B;  4JYA M;  4IBK A;  2F4V M;  3JR4 A;  2R46 A;  3IG5 A;  4MB7 A;  3RGP A;  3AV0 A;  5FTJ A;  5BPV A;  4NXM M;  1ZQ9 A;  2L7H A;  3U61 A;  3KOY E;  3JR5 A;  3I4Y A;  4DR2 M;  4DV3 M;  4QNM A;  4DV6 M;  4JI3 M;  1L1T A;  3J27 B;  3TWK A;  3FTC A;  1I4W A;  4FW9 A;  1DGF A;  3VDU A;  4IBB A;  4B08 A;  3AL0 C;  3Q8X A;  5KO3 A;  4G6Z A;  4GMQ A;  2R65 A;  2XFT A;  4QOZ C;  5EP2 A;  2NQ8 C;  2RKO A;  4IBC A;  3HHY A;  4PDI A;  4DV5 M;  1SXJ B;  1SXJ C;  4MGY E;  3GLH A;  4OU7 A;  2C96 A;  3GPU A;  4GHL A;  2UUC M;  2QBY B;  1GLN A;  3TPZ A;  3HU3 A;  2C9O A;  3KOZ E;  2YR0 A;  2YQZ A;  4MH0 E;  2L09 A;  4NSR A;  2ZAM A;  2HHH M;  4D80 A;  5E26 A;  2CEA A;  3WHL A;  2KEB A;  3KDS E;  1L8Q A;  5JI2 E;  1XNQ M;  3D8L A;  3RE8 A;  3GRY A;  3A46 A;  5FTL A;  2F5P A;  3M0E A;  4JV5 M;  4LJ8 A;  3MHV C;  5DNY A;  1E9S A;  3U5Z A;  2ERC A;  2UU9 M;  3UMM A;  3J2P B;  4FWG A;  1GKI A;  2FE8 A;  4MGZ E;  4DV1 M;  3CTW B;  2FFJ A;  2XEP A;  3GRR A;  5FLX S;  5DYI A;  3SHG B;  4AQY M;  4LF8 M;  1QQW A;  2D7G A;  4R3D A;  4R7G A;  2JA2 A;  1E9R A;  1QAN A;  3AJI B;  4HLQ A;  1W5S A;  4MM3 B;  1HR0 M;  3M6A A;  4IBG A;  2EO2 A;  2KRK A;  4IBI A;  2F5O A;  5EP4 A;  1QAM A;  3SYK A;  2V1C A;  5E6J A;  3J7A S;  3VK7 A;  4G4N A;  2RGH A;  3EIH A;  4NRV A;  3TE6 A;  2UUB M;  3HJS A;  3OTO M;  3VLF B;  5KPR A;  1Z5B A;  2BJW A;  1IY1 A;  3QWL A;  1HT2 E;  4L15 A;  2Y0T A;  2L6O A;  2J7O A;  3KSJ A;  4L4U A;  3GQ3 A;  3U6L A;  2DZN B;  3HHX A;  2G5G X;  1NNJ A;  4AKI A;  1SXJ A;  4LJ7 A;  1XNR M;  5EXX A;  5EXT A;  4JI0 M;  3W0L B;  2QBY A;  1S3S A;  1PJI A;  3GLH B;  3L2A A;  5ITY A;  3QAU A;  4QHS A;  2Q2E B;  4IJF A;  1J7K A;  1KSF X;  2HCB A;  1IBK M;  4LF7 M;  3SC3 A;  1W5T A;  2OPF A;  3TL4 X;  3HJ8 A;  2DZO B;  3RGS A;  5IT9 S;  4LF6 M;  5H37 D;  4II7 A;  1OFI A;  5FTN A;  4IBJ A;  4OW0 A;  1Z5A A;  1G4A E;  4LJ6 A;  4L16 A;  1R2Y A;  4WW0 A;  1SXJ D;  3DA1 A;  3LVV A;  1FNN A;  2LWX A;  1NJF A;  4KOD A;  3KFU G;  3JAM S;  5C18 A;  1HQC A;  4YHH M;  3U6E A;  1ORY B;  4AKH A;  3I51 A;  3GO8 A;  1QZM A;  2J7N A;  1Q3C A;  4AG6 A;  2R18 A;  5IRE B;  1Q3B A;  1PJJ A;  3H4M A;  4DR1 M;  4X66 M;  4D82 A;  3SAV A;  3HKP A;  2EUC A;  1GL6 A;  2E5L M;  8CAT A;  1R7R A;  3FUV A;  2RGO A;  3MK6 A;  1X37 A;  3DOA A;  4B7F A;  3E4R A;  3FTF A;  4MGH A;  3J81 S;  4KLN A;  3PVS A;  4BBA A;  1NHG C;  2DWZ B;  3K8Z A;  4IJE A;  3U6P A;  1IN7 A;  4LF4 M;  4L78 A;  2KXE A;  1JR3 A;  3SHF A;  3KOX E;  1XMO M;  2A5Y B;  2DWM A;  2ZAN A;  3CF6 E;  5FTK A;  2DXI A;  5A2Q S;  1QAO A;  2M5Z A;  3HGI A;  4I4L A;  1NJG A;  3SAW A;  3U6S A;  1XXH A;  4X65 M;  3ILK A;  4GH9 A;  1YUB A;  4LFB M;  1TDH A;  3I4V A;  2KZS A;  1K3W A;  3FTE A;  3GLI B;  2UXB M;  2DVW B;  5FTM A;  4LRT A;  4FCW A;  2KRU A;  1JR3 D;  3A42 A;  1XMQ M;  5KPZ A;  4GHA A;  4ZPX A;  3BOS A;  1GL7 A;  5C1B A;  1JQJ C;  3W0F A;  3T38 A;  5BR8 M;  3VKH A;  1EE8 A;  3GLF B;  1N36 M;  1IN8 A;  4GC9 A;  4QNR A;  4FWD A;  4RF1 A;  5ITX A;  5ITX E;  5ITR A;  3T1H M;  1Z6T A;  1IXZ A;  4LZZ A;  4A3V B;  4Z8X A;  2CHG A;  2UXD M;  4P16 A;  2YFQ A;  1L2D A;  4W5W A;  4B3T M;  4G4Q A;  4M9Z A;  1T3T A;  4GC5 A;  3R9X B;  3FYD A;  1L2C A;  2VQF M;  4MGI E;  2D7H A;  5IZ7 D;  3AOE C;  4L8R C;  3M7G A;  2K47 A;  4D81 A;  3KOW E;  4DR5 M;  5EQT A;  1XHB A;  2C99 A;  2UUA M;  1TH2 A;  3L26 A;  1HT1 E;  4LFC M;  4BLC A;  4LGY A;  4G4R A;  4IBF A;  4DR7 M;  1N77 A;  1IXS B;  5JI3 E;  3HWS A;  2F5N A;  4I5S A;  3SYL A;  3U6D A;  2VII A;  4JI7 M;  1XC8 A;  4LGM A;  4LCB A;  5IWA M;  1QYR A;  2G8L A;  2Y21 A;  3KP0 E;  1HQY E;  1R2Z A;  4B3R M;  2QPA A;  4FD2 A;  5LMU M;  1IXR C;  3NWL A;  3HU1 A;  1L2B A;  1Z59 A;  1NSF A;  1OJL A;  4FCT A;  4TUW A;  2CE7 A;  4AKG A;  2V1U A;  2Z7J A;  1XXH B;  2V6Z M;  3GLI A;  5EXP A;  4G4O A;  1L1Z A;  4NL4 H;  4ITQ A;  1E32 A;  2C9C A;  4K0K M;  4EIW A;  3UZU A;  5DYG A;  3GPY A;  3SAU A;  1IM2 A;  4FVM A;  4RNA A;  1WXQ A;  3PNY A;  3U6Q A;  4CIS A;  3K2L A;  2BNK A;  2R45 A;  3UGJ A;  2R62 A;  3GLF A;  1NY5 A;  2XF3 A;  4M0W A;  1DGG A;  1R6B X;  1IN4 A;  3KVW A;  3U6O A;  3GRV A;  1TH3 A;  4DR4 M;  3EIE A;  3AOG A;  2L7I A;  3A45 A;  4LF5 M;  4BB9 A;  5EP1 A;  4JI8 M;  3MJ5 A;  1Q39 A;  5EXS A;  3PNV A;  3VDP A;  3AOE A;  2QP9 X;  2X4A A;  2FOI C;  4KO8 A;  3GPX A;  4QOS A;  2UXC M;  3PFI A;  4JI2 M;  3LVW A;  3AKZ A;  2QEN A;  3AFH A;  2CHV A;  3SFZ A;  4AZF A;  3FUW A;  2X8A A;  1D2N A;  5EP3 A;  1K82 A;  3GQ4 A;  3GRU A;  4GKJ M;  4GRI A;  2XSZ A;  3CF0 A;  5KQ8 A;  2Y0Q A;  3T1Y M;  4LJ5 A;  4NRW A;  4NSO B;  3FYC A;  2F5S A;  3PXG A;  4CHT B;  3ZCB B;  4YY3 M;  3FUX A;  2C98 A;  3VK8 A;  1J5E M;  2D7E A;  3TQS A;  4PCZ A;  1GVN A;  1QAQ A;  5GKN A;  2CV2 A;  3DZD A;  4DV0 M;  1PM5 A;  3WHK A;  3U6M A;  1XWI A;  3LQQ A;  1KFV A;  3L25 A;  1HNX M;  1E94 E;  2XH9 A;  4LJ9 A;  5FSW A;  1G41 A;  4QHT A;  1DO2 A;  1OFH A;  2XSZ D;  2FNA A;  4LY6 A;  1IY0 A;  2QZ4 A;  4X64 M;  3T15 A;  4DR6 M;  4LZJ A;  1TH4 A;  2H1R A;  3NBI A;  3FTD A;  5F3W A;  1G59 A;  4MGK E;  4B7G A;  5KQD A;  2XZU A;  3L29 A;  1KYI A;  1I94 M;  1ZAE A;  2KW0 A;  1IN5 A;  4B3M M;  4AG5 A;  1N33 M;  3GPP A;  4NOO B;  3FKE A;  2X49 A;  2XGN A;  2P5T A;  4IBD A;  1YSY A;  3K1J A;  4I8O A;  1IQP A;  2I7P A;  2ZAO A;  7CAT A;  4DUZ M;  4OVZ A;  1N75 A;  5EJC A;  4DV7 M;  3J80 S;  2LXE A;  1DGH A;  3U6C A;  3HU2 A;  2ZM6 M;  3HHZ A;  2KA6 B;  4M0D A;  4LF9 M;  2KZU A;  2LNH C;  4AW4 A;  3R8F A;  3SAR A;  3SMS A;  1TDZ A;  1TGU A;  4JXJ A;  2XLJ A;  4DUY M;  1C1K A;  3GP1 A;  3ZH9 B;  2EA0 A;  4JN6 A;  1UM8 A;  4GIP A;  4JI1 M;  3RFW A;  2LH0 A;  4GIT A;  1FJG M;  3K92 A;  5KPT A;  2XZF A;  2Z3X A;  4REZ A;  2Z4S A;  3GLG B;  3U60 B;  2HL7 A;  4XGI A;  2DWN A;  2DWL A;  3FUT A;  3TWM A;  2YNM D;  3VFD A;  1N78 A;  5ITQ A;  3KSX A;  4NXN M;  3IG8 A;  4IBE A;  1LV7 A;  4LJ4 A;  3KXE C;  4PD2 A;  4XBO A;  3SBJ A;  2I7N A;  2Y20 A;  3C58 A;  1DGB A;  2AHM A;  3TWL A;  2Z4R A;  3CF2 A;  3THG A;  4JI5 M;  2CUZ A;  3J7B A;  2CFO A;  3U61 B;  1DO0 A;  3LMM A;  4RF0 A;  5ITU A;  3UJN A;  1YE9 A;  2W82 A;  1MU5 A;  4KHP M;  4LG2 A;  4DV4 M;  1N32 M;  1IY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...