4KHPM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4khpM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4khpM02
4X62M 4PDIA 1FJGM 2ZBKB 3A42A 2VQFM 4DR6M 1XC8A 4JI3M 1Q3CA 4JI0M 4DUZM 4OX9M 5ITXE 3SATA 4DR3M 4JI4M 5ITTA 4JI7M 2F5PA 3SBJA 3T1YM 1PM5A 4NXNM 1N33M 4DR1M 1HNZM 4DV0M 3GPYA 2XZUA 1HR0M 2F4VM 1Q3BA 4DV4M 3A45A 5BR8M 3GPUA 1L2CA 4LF7M 4YHHM 1L2DA 4PCZA 2EA0A 4LF9M 2OPFA 1XNQM 3T1HM 4G4NA 4JI5M 4JI6M 2UUBM 5IT9S 2VQEM 4G4RA 3GPXA 4LF4M 2UU9M 3SAUA 4AQYM 3GQ4A 2HHHM 4NXMM 4LF5M 5LMUM 1MU5A 4MB7A 1IBKM 4DUYM 1Z59A 5ITXA 3TWKA 4LFBM 1L1TA 1K3WA 4K0KM 4DV6M 3W0FA 1TDHA 3TWLA 4PD2A 4X64M 5FLXS 5ITUA 5A2QS 4DV2M 3U6EA 1J5EM 3U6CA 4B3RM 4PDGA 1K82A 1HNXM 4B3TM 2E5LM 4G4OA 2UUAM 3GQ3A 4B3MM 4DR2M 5ITYA 4LF6M 4JI8M 4GKKM 5ITRA 1N34M 4DV5M 1N36M 3GP1A 1EE8A 5LMNM 3U6DA 1NNJA 4B3SM 3C58A 3GQ5A 1XMOM 4YY3M 1Z5BA 3SARA 1L1ZA 1Q39A 4DR5M 4DV1M 3GPPA 3U6OA 1IBMM 4CISA 1L2BA 2UUCM 4DV3M 4JV5M 4LFCM 5IWAM 3SAWA 5ITQA 3SASA 4DR4M 3GO8A 2F5SA 4JI1M 1MX0A 2UXBM 3VK8A 3DOAA 4KHPM 3A46A 1TDZA 3JAMS 2XZFA 1PJIA 3JR5A 3VK7A 2UXDM 2OQ4A 4LF8M 3OTOM 3J81S 1KFVA 4DR7M 4JYAM 2HKJA 1IBLM 4LFAM 4NRVA 3U6QA 3JR4A 4X65M 2F5OA 1Z5AA 4X66M 4GKJM 1R2YA 1Z5CA 2F5QA 4NRWA 2UXCM 2F5NA 1R2ZA 3U6PA 1PJJA 3TWMA 3SAVA 2ZM6M 1XNRM 2Q2EB 3J7AS 1HNWM 1N32M 4JI2M 3U6SA 4ITQA 3U6MA 3U6LA 1K3XA 1XMQM 4DV7M 4G4QA 3J80S 1I94M
chains in the Genus database with same CATH superfamily
1PJTA 1JB0F 3A42A 4IBEA 2VQFM 4DR6M 4JI0M 1HQCA 2DAKA 3T38A 2BWBA 3GRUA 3RFWA 4IBCA 3SC3A 4GC9A 5ITTA 3T1YM 1N75A 1PM5A 3B7ZA 1ZMWA 3F92A 1NO1A 4D80A 1R4GA 2DI0A 4D82A 4DV0M 3GPYA 1T43A 2M5ZA 4MM3B 4L16A 3GLFA 1G59A 2KEBA 2MR9A 2X4AA 4IBBA 5KPZA 3GPUA 1L2CA 1ZMVA 3FUTA 1OFIA 1OKSA 1MJGM 3RGPA 3VDPA 3VFDA 3WHKA 1XNQM 1XB2B 3UJNA 2FFJA 4JI6M 5IT9S 4IBIA 1QUSA 1QUTA 3E9SA 4Z6YA 5KQDA 2DWNA 4CGYB 1IN4A 4LF4M 2R45A 7CATA 3SAUA 3KXEC 3LCVB 2C96A 2C9CA 3MMPA 3HHZA 2DZLA 4NOOB 4KO8A 4GITA 1D0MA 4FWHA 4LF5M 1MU5A 1XWIA 2CP8A 3M6AA 3IG8A 4DBGB 2L4EA 2CRUA 4RNAA 3HWSA 1GO5A 3TWKA 4IBDA 1L1TA 3HU2A 3NBIA 5E26A 1HT1E 2QZ4A 2Z4SA 2V1UA 1TDHA 4QHTA 1XHBA 3TWLA 4PD2A 4DV2M 1IXSB 1HQYE 5EJCA 5EXPA 1HNXM 4G6ZA 2QPAA 2K0BX 5EQTA 5KO3A 4PT5A 1DGHB 3THGA 3GQ3A 1V33A 2R0IA 4M9SA 4GKKM 5ITRA 1NHGC 2KZSA 4M9XA 1VQ1A 2I7NA 1ZAEA 2ZTCA 3VDUA 3U6DA 4LG2A 2R44A 1AIPC 2R6FA 2CFOA 4OW0A 1QDRA 1XXHB 4L8RC 2J7NA 1G71A 1IN5A 3HHWA 2CHVA 2Y0QA 2DKLA 2K6BA 2XFSA 4QOSA 3TL4X 4DV3M 3U6OA 1IBMM 1TH3A 4IBGA 2KHHA 4UN2B 3U5ZA 4LJ8A 3W67A 1VEJA 2JY5A 4BLCA 3SAWA 3I01M 3ZC7B 4DR4M 4P16A 2F5SA 4FW9A 2DHRA 1IY0A 3WHLA 1UM8A 3DOAA 3A46A 1ZMUA 3KS8A 5JI2E 2BJVA 1NY5A 2XZFA 4Y28F 1GVNA 1BVSA 1DGGA 2OQ4A 4OU7A 2DZOB 1KFVA 1MN3A 3NBXX 1PRBA 4JYAM 2HKJA 1IBLM 2VF8A 1DV0A 3LQQA 1WGNA 2R62A 2JP7A 5EXSA 1GJTA 2OOBA 3I51A 2KZUA 1A5TA 1D2NA 4X66M 5FTNA 2JNHA 1QQWA 4LJ4A 3U61A 2XH9A 1JQJC 1WXQA 3B7NA 3Q8GA 2QP9X 2F5NA 3U6PA 1YUBA 4XK8F 3GLGE 1NJGA 3TWMA 3FTCA 3U60A 3J7BA 2JY7A 1HNWM 2V6ZM 4AKGA 3HHXA 3SFZA 3ZCBB 2FNAA 2C5RA 3B74A 4II7A 4L4UA 3U6LA 2OO9A 3AFHA 3QAUA 3HHYA 4DV7M 1IFYA 2O25A 3J80S 2YR0A 2G8LA 1FJGM 4HLQA 5EP4A 2EKFA 3GLHA 1WHCA 1TTEA 3HZJA 5FTMA 5ITXE 2XEPA 4DR3M 1JR3A 2KNZA 3SMPA 2F5PA 4DR1M 3KP1E 1DGBA 3GLFB 3FKEA 1QAOA 5KQ8A 2N35A 1QVRA 3A45A 1TH2A 2JWSA 4OVZB 2XGNA 2L09A 4YHHM 1ZQ9A 2VDBB 3DFZA 4BB9A 4PCZA 3IECA 1OQYA 2OPFA 4G4NA 2FH0A 3GRRA 2RKOA 4IBJA 2J7OA 3CGWA 4FCTA 1GL6A 1IQPA 3K8ZA 2VQEM 3U60B 3HU1A 2RGHA 5F3WA 2Z8YM 3FUWA 1ORYB 2R4JA 3KSJA 3HJQA 5FTKA 3T6PA 4AQYM 2UU9M 3GRVA 3GQ4A 1IY2A 2VIIA 4MGYE 4LJ5A 2D7EA 2RRUA 4M9ZA 4MB7A 3SYLA 1IBKM 5DNYA 4JXJA 1IXSA 1Z59A 4I8OA 1W5TA 3AOGA 1JR3E 1IN8A 4ANRA 1IN6A 4FCVA 4FWDA 4AG6A 4LFBM 3KFUG 2LH0A 2GQFA 3CTWB 3LCUA 3FTEA 4AG5A 2V1CA 2JXNA 1CUKA 4AW4A 3L29A 3TPZA 1GL7A 1J5EM 1NVMA 1J09A 1YLAA 4PDGA 1K82A 5H37D 2M60A 2E5LM 4QHSA 2AHMA 2WSCF 2JY6B 2L6OA 1D0LA 3CF0A 1J7KA 3EIHA 4G4OA 3KS4A 4AKIA 2ERCA 2P5TA 4B7GA 4JI4M 4M0WA 1NNUC 3TE6A 2CWBA 1NHWC 1Q02A 1N34M 1LTMA 4LCBA 2A5YB 2Y20A 5DYGA 1E9SA 3V76A 3GP1A 4DV5M 1SXJB 3FE3A 3HGIA 3PFIA 1NNJA 3U5ZB 3C58A 3GLHE 3AV0A 3CF6E 1SXJC 2LVPC 3GQ5A 8CATA 2L2DA 1R7RA 3FYCA 3GLIE 2LXEA 3GPPA 1GKIA 2UUCM 4JV5M 2MROB 3I4YA 2CE7A 5GKNA 4JN6A 3HX3A 4IIWA 3R9XB 5IWAM 5ITQA 4HL4A 3SASA 4JI1M 3H4MA 3VK8A 3PXGA 4RF0A 4CJ6A 2CHQA 3FD9A 2J5YA 1LV7A 1IXRC 3H4JA 5IREB 2APLA 2RGOA 3FUVA 3JR5A 4Q7JA 2JY8A 4LF8M 1JR3D 4GC5A 4LJAA 2H5XA 4LJ7A 2QBYB 3DZDA 4REZA 4DR7M 4KT0F 3LVWA 2KNVA 2VF7A 3U6QA 3FTFA 1QANA 2F5OA 4CHTB 4GKJM 2DZNB 3AJIB 4I4LA 3UZUA 1G3IA 2JUJA 2KRUA 2K47A 3D8LA 4NRWA 2W82A 2FS1A 2YNMD 2UXCM 3RGSA 1P3QQ 2WZJA 1R2ZA 4GHAA 1GABA 1PJJA 2QHOB 4GRIA 1SXJD 2Y0TA 4MH0E 2EO2A 3IG5A 3SAVA 3QYEA 4GHLA 4XGIA 4LGMA 4JI2M 4B08A 4LZZA 3GLHB 3U6SA 1VDLA 1HJPA 1XMQM 1X37A 3NWLA 2ZANA 3LMMA 2DWLA 1I94M 5EP3A 1UFZA 2H1RA 2WSEF 1NY6A 3EIEA 3K2LA 2X49A 3J27B 3T15A 4PDIA 4X62M 5IZ7D 4OX9M 3FRHA 4DUZM 2R46A 2LVAA 4JI7M 1AUAA 1E9RA 3I04M 1R6BX 2X8AA 3L28A 4NXNM 2QBYA 1N78A 2OOAA 1HNZM 2XZUA 2KA6B 1HR0M 3FTDA 2Y21A 2Z7JA 5BR8M 2HL7A 1E32A 4RKUF 1OFHA 1XXHA 2KW0A 5EXTA 2EA0A 3M7GA 1WJ7A 3DA1A 2LVNC 1SG9A 3KOZE 2UUBM 3GRYA 3VKHA 4GEWA 5DYIA 4G4RA 3GLIB 2MH8A 3GPXA 1F4IA 3UGJA 2CV1A 1OIZA 3CF2A 1QZEA 1NV9A 1SXJE 2DAMA 3K1JA 4NL4H 2ZAMA 4B7HA 4DUYM 1N77A 4KLNA 4NSOB 5ITXA 2DAGA 1IXZA 4MGKE 3U61B 1KYIA 1K3WA 1R5LA 3C9PA 5C18A 3A98B 3LVVA 4R7GA 5FTJA 3W0FA 5EP2A 5FLXS 3U6EA 5ITUA 1G8PA 3KOWE 1IY1A 4FCWA 2EUCA 1EIJA 1H6UA 3AOEA 3SHGB 2CV0A 3PNVA 1XXHE 2UUAM 4B3MM 3L26A 5ITYA 3K92A 1QZMA 4IJEA 4QNMA 1WGLA 4JI8M 1N36M 4FVMA 4QNRA 3GLIA 2G5GX 4R3DA 2XLJA 1EE8A 1Y8GA 5LMNM 1C7YA 3R8FA 3B7QA 3AOEC 2JZ0A 3QYBA 3TQSA 1OAIA 3MHVC 4YY3M 1Z5BA 2I7PA 1NV8A 1L1ZA 4MGIE 1Q39A 4DV1M 4CISA 3GLGB 2MGWA 4LRSA 1L2BA 3HJSA 1YE9A 3BXWA 3LQRA 4LFCM 1PJQA 1G4AE 1G41A 2XSZD 3GO8A 2HAKA 1V34A 3C3EA 4LRTA 2LVOC 2UXBM 2KXEA 2KNAA 3HU3A 4WW0A 2LWXA 1HT2E 2BJWA 3Q8XA 5E6JA 2Z3XA 1PJSA 3HKPA 2UXDM 1RU3A 1C1KA 3OTOM 3J81S 2ZTDA 4L6V6 4NSRA 1TF0B 4LFAM 2LHCA 4NRVA 4IBFA 2Z4RA 4FWGA 3SMSA 3AKZA 1Z5AA 4LY6A 2CHGA 1Z5CA 2F5QA 1W5SA 1TR8A 1NJFA 2L7IA 4Z8XA 4F2LA 1Z6TA 2DAIA 4IBKA 5BPVA 2DWZB 3KOXE 5KPRA 3KSXA 1E94E 1OAOC 2ZM6M 1XNRM 1TH4A 3MJ5A 2DENA 4D81A 4ITQA 1S3SA 3U6MA 3MK6A 1QAQA 2CEAA 2DVWB 1T3TA 3FUXA 1OTRA 4A3VB 2HCBA 2R18A 2LVQD 2LBCA 1KSFX 2R65A 2DWMA 2ZBKB 1VEGA 2B3TA 3C3DA 4NC6A 1XC8A 4JI3M 1Q3CA 4F1IA 2D7HA 2LHGA 3K9OA 3SATA 1DGFA 3SBJA 4AKHA 3AL0C 1N33M 3J2PB 1QDTA 5FSWA 2O5RA 2C99A 2QQ8A 3SYKA 3BBZA 4L78A 1Q3BA 4BBAA 4DV4M 3M0EA 2F4VM 4I5SA 3BOSA 4LF7M 4R71A 1L2DA 4W5WA 4LF9M 1EFUB 3VKGA 2XSZA 3T1HM 3GLFE 4JI5M 2DNAA 2FE8A 2KDLA 2DAEA 4LJ6A 3IHPA 2WSFF 4OVZA 2JA2A 4IJFA 1V92A 4GIPA 3KVWA 2HHHM 5FTLA 1I4WA 4NXMM 4S12A 5LMUM 2BWEA 4M0DA 3KP0E 2DHYA 5KPTA 3QWLA 4RF1A 4K0KM 4DV6M 3UMMA 1TGUA 5EP1A 3ZQJA 4L15A 2L4FA 3HJ8A 3ZH9B 4X64M 5A2QS 1GLNA 3K9PA 3FYDA 4LZJA 4B3RM 3U6CA 2CUZA 2YFQA 3B89A 4B3TM 1QAMA 3E4RA 1WR1B 1T6OA 2EJSA 4CIZA 4EIWA 3KOYE 1DO0A 1VDDA 4DR2M 1DGHA 4MGHA 3RE8A 2CV2A 4LF6M 1VEKA 2JZ1A 4LJ9A 3L27A 5C1BA 2KRKA 4HEOA 1D0KA 4G3OA 2K9DA 2QSFX 4B3SM 2YQZA 3L25A 4LGYA 1XMOM 2D7GA 1PGYA 1OJLA 2G3QA 3GLGA 3SARA 2ZAOA 5DFLA 2R4EA 3HY5A 4DR5M 1ZV1A 2O01F 2L7HA 3PVSA 3L2AA 2BNKA 5L8RF 1VG5A 3FUUA 5EXXA 4XBOA 3KDSE 2C98A 1IM2A 4WP2A 1QYRA 1IN7A 1WIVA 3UK6A 3VLFB 2XFTA 1MX0A 4AZFA 3W68A 2GNOA 4GMQA 4ZPXA 4KHPM 1YSYA 1TDZA 2QNJA 2HWJA 4WURA 3JAMS 2EKKA 3LW5F 1PJIA 1NSFA 3VK7A 4KODA 2XF3A 1DO2A 3I4VA 4QOZC 4B7FA 3SHFA 4TUWA 3FRIA 2QCUA 4FD2A 4X65M 3W0LB 3JR4A 1R2YA 4AI6A 2DXIA 3ILKA 3B9PA 2QENA 2LNHC 3D8BA 3PNYA 1L8QA 2FOIC 2Q2EB 3J7AS 1N32M 2MJ5B 1GJSA 2NQ8C 5JI3E 2C9OA 1FNNA 3KW6A 3E21A 4MGZE 1K3XA 1SXJA 4P17A 4G4QA 4I81A 2LTUA 3E46A 4GH9A 1OIPA
chains in the Genus database with same CATH topology
3A42A 4IBEA 2VQFM 4DR6M 4JI0M 1HQCA 3T38A 4JI4M 5ITTA 3GRUA 3RFWA 4IBCA 3SC3A 4GC9A 3T1YM 1N75A 1PM5A 4D80A 4D82A 4DV0M 3GPYA 4MM3B 2M5ZA 4L16A 3GLFA 1G59A 2KEBA 2X4AA 4IBBA 3GPUA 5KPZA 1L2CA 3FUTA 1OFIA 3RGPA 3VDPA 3VFDA 3WHKA 1XNQM 3UJNA 2FFJA 4JI6M 5IT9S 4IBIA 4Z6YA 5KQDA 3E9SA 2DWNA 4CGYB 1IN4A 4LF4M 2R45A 7CATA 3SAUA 3KXEC 3HHZA 2C96A 2C9CA 4NOOB 4KO8A 4GITA 4FWHA 4LF5M 1MU5A 1XWIA 3M6AA 3IG8A 4RNAA 3HWSA 3TWKA 4IBDA 1L1TA 3HU2A 3NBIA 5E26A 1HT1E 2QZ4A 2Z4SA 2V1UA 1TDHA 4QHTA 1XHBA 3TWLA 4PD2A 4DV2M 1IXSB 1HQYE 5EJCA 5EXPA 1HNXM 4G6ZA 2QPAA 5EQTA 5KO3A 4PT5A 1DGHB 3THGA 3GQ3A 4M9SA 4GKKM 5ITRA 1NHGC 2KZSA 4M9XA 2I7NA 4LG2A 1ZAEA 3VDUA 3U6DA 2CFOA 4OW0A 1XXHB 4L8RC 2J7NA 1IN5A 3HHWA 2CHVA 2Y0QA 3U6OA 1IBMM 2XFSA 4QOSA 3TL4X 4DV3M 1TH3A 4IBGA 3U5ZA 4LJ8A 4BLCA 3SAWA 3ZC7B 4DR4M 4P16A 2F5SA 4FW9A 2DHRA 1IY0A 3WHLA 1UM8A 3DOAA 3A46A 3KS8A 5JI2E 2BJVA 1NY5A 2XZFA 1GVNA 1DGGA 2OQ4A 4OU7A 2DZOB 1KFVA 4JYAM 2HKJA 1IBLM 3LQQA 2R62A 5EXSA 3I51A 2KZUA 1D2NA 4X66M 5FTNA 1QQWA 4LJ4A 3U61A 2XH9A 1JQJC 1WXQA 2QP9X 2F5NA 3U6PA 1YUBA 1NJGA 3TWMA 3FTCA 3U60A 3J7BA 4AKGA 1HNWM 2V6ZM 3HHXA 3SFZA 3ZCBB 2FNAA 2C5RA 4II7A 4L4UA 3U6LA 3AFHA 3QAUA 3HHYA 4DV7M 3J80S 2YR0A 2G8LA 1FJGM 4HLQA 5EP4A 3GLHA 5FTMA 5ITXE 2XEPA 4DR3M 1JR3A 3SMPA 2F5PA 4DR1M 3KP1E 1DGBA 3GLFB 3FKEA 1QAOA 5KQ8A 1QVRA 3A45A 1TH2A 4OVZB 2XGNA 2L09A 4YHHM 1ZQ9A 3DFZA 4BB9A 4PCZA 2OPFA 4G4NA 3GRRA 2RKOA 4IBJA 2J7OA 4FCTA 2VQEM 1GL6A 1IQPA 3K8ZA 3U60B 5F3WA 3HU1A 2RGHA 3FUWA 5FTKA 1ORYB 2R4JA 3KSJA 3HJQA 2UU9M 4AQYM 3GRVA 3GQ4A 1IY2A 2VIIA 4MGYE 4LJ5A 2D7EA 4M9ZA 4MB7A 3SYLA 1IBKM 5DNYA 4JXJA 1Z59A 4I8OA 1W5TA 3AOGA 1IN8A 1IN6A 4FCVA 4FWDA 4AG6A 4LFBM 3KFUG 2LH0A 3CTWB 3FTEA 4AG5A 2V1CA 4AW4A 3L29A 3TPZA 1GL7A 1J5EM 1NVMA 1J09A 4PDGA 1K82A 5H37D 2M60A 2E5LM 4QHSA 2AHMA 3CF0A 2L6OA 3EIHA 4G4OA 1J7KA 4AKIA 3KS4A 2ERCA 2P5TA 4B7GA 4M0WA 1NNUC 3TE6A 1NHWC 1N34M 4LCBA 5DYGA 2A5YB 2Y20A 3GP1A 1E9SA 4DV5M 4AKHA 1SXJB 3HGIA 3PFIA 1NNJA 3U5ZB 3C58A 3GQ5A 3AV0A 3CF6E 1SXJC 8CATA 1R7RA 3FYCA 2LXEA 3GPPA 1GKIA 2UUCM 4JV5M 3I4YA 2CE7A 5GKNA 4JN6A 4IIWA 3R9XB 5IWAM 5ITQA 4HL4A 3SASA 4JI1M 3H4MA 3VK8A 3PXGA 4RF0A 2CHQA 3FD9A 1LV7A 1IXRC 5IREB 3JR5A 2RGOA 3FUVA 4LF8M 1JR3D 4GC5A 4LJAA 4DR7M 4LJ7A 2QBYB 3DZDA 4REZA 3LVWA 3U6QA 3FTFA 1QANA 2F5OA 4CHTB 4GKJM 2DZNB 3AJIB 4I4LA 3UZUA 1G3IA 2KRUA 2K47A 3D8LA 4NRWA 2W82A 2YNMD 2UXCM 3RGSA 1R2ZA 4GHAA 1PJJA 4GRIA 1SXJD 2Y0TA 4MH0E 2EO2A 3IG5A 3SAVA 4GHLA 4XGIA 4LGMA 4JI2M 4B08A 4LZZA 3GLHB 3U6SA 1XMQM 1X37A 3NWLA 2ZANA 3LMMA 2DWLA 1I94M 5EP3A 2H1RA 4X62M 3T15A 1NY6A 3EIEA 3K2LA 2X49A 3J27B 4PDIA 5IZ7D 4OX9M 4DUZM 2R46A 4JI7M 1E9RA 3L28A 1R6BX 2X8AA 4NXNM 2QBYA 1N78A 1HNZM 2XZUA 2KA6B 1HR0M 3FTDA 2Y21A 2Z7JA 5BR8M 2HL7A 1E32A 1OFHA 1XXHA 2KW0A 5EXTA 2EA0A 3M7GA 3DA1A 3KOZE 2UUBM 3GRYA 3VKHA 5DYIA 4G4RA 3GLIB 3GPXA 3UGJA 2CV1A 3CF2A 1SXJE 3K1JA 4NL4H 2ZAMA 4B7HA 4DUYM 1N77A 4KLNA 4NSOB 5ITXA 1IXZA 4MGKE 3U61B 1KYIA 1K3WA 5C18A 3A98B 3LVVA 4R7GA 5FTJA 3W0FA 5EP2A 5FLXS 3U6EA 5ITUA 1G8PA 3KOWE 1IY1A 4FCWA 2EUCA 1H6UA 3AOEA 3SHGB 2CV0A 3PNVA 2UUAM 4B3MM 3L26A 5ITYA 3K92A 1QZMA 4IJEA 4QNMA 4JI8M 1N36M 4FVMA 4QNRA 3GLIA 2G5GX 4R3DA 2XLJA 1EE8A 5LMNM 3R8FA 3AOEC 3TQSA 3MHVC 4YY3M 1Z5BA 2I7PA 1L1ZA 4MGIE 1Q39A 4DV1M 4CISA 3GLGB 4LRSA 1L2BA 3HJSA 1YE9A 3LQRA 4LFCM 2XSZD 1G4AE 1G41A 3GO8A 4LRTA 2UXBM 2KXEA 3HU3A 4WW0A 2LWXA 1HT2E 2BJWA 3Q8XA 5E6JA 2Z3XA 3HKPA 2UXDM 1C1KA 3OTOM 3J81S 4NSRA 4LFAM 4NRVA 4IBFA 2Z4RA 4FWGA 3SMSA 3AKZA 1Z5AA 4LY6A 2CHGA 1Z5CA 2F5QA 1W5SA 1NJFA 2L7IA 4Z8XA 1Z6TA 4IBKA 5BPVA 2DWZB 3KOXE 5KPRA 3KSXA 1E94E 2ZM6M 1XNRM 1TH4A 3MJ5A 4ITQA 4D81A 1S3SA 3U6MA 3MK6A 1QAQA 2CEAA 2DVWB 1T3TA 3FUXA 4A3VB 2HCBA 2R18A 1KSFX 2R65A 2DWMA 2ZBKB 1XC8A 4JI3M 1Q3CA 2D7HA 3SATA 1DGFA 3SBJA 3AL0C 1N33M 3J2PB 5FSWA 2O5RA 2C99A 3SYKA 4L78A 1Q3BA 4BBAA 4DV4M 3M0EA 2F4VM 4I5SA 3BOSA 4LF7M 1L2DA 4W5WA 4LF9M 3VKGA 2XSZA 3T1HM 4JI5M 2FE8A 4LJ6A 4OVZA 2JA2A 4IJFA 4GIPA 3KVWA 2HHHM 5FTLA 1I4WA 4NXMM 4S12A 5LMUM 4M0DA 3KP0E 5KPTA 3QWLA 4RF1A 4K0KM 4DV6M 3UMMA 1TGUA 5EP1A 4L15A 3HJ8A 3ZH9B 4X64M 5A2QS 1GLNA 4LZJA 3FYDA 4B3RM 3U6CA 2CUZA 2YFQA 4B3TM 1QAMA 3E4RA 4EIWA 3KOYE 1DO0A 1VDDA 4DR2M 1DGHA 4MGHA 3RE8A 2CV2A 4LF6M 4LJ9A 3L27A 5C1BA 2KRKA 4B3SM 2YQZA 3L25A 4LGYA 1XMOM 2D7GA 1OJLA 3GLGA 3SARA 2ZAOA 2R4EA 4DR5M 2L7HA 3PVSA 3L2AA 2BNKA 3FUUA 5EXXA 4XBOA 3KDSE 2C98A 1IM2A 1QYRA 1IN7A 3VLFB 3UK6A 4AZFA 2XFTA 1MX0A 4GMQA 4ZPXA 4KHPM 1YSYA 1TDZA 3JAMS 4WURA 1PJIA 1NSFA 3VK7A 4KODA 2XF3A 1DO2A 3I4VA 4QOZC 4B7FA 3SHFA 4TUWA 4FD2A 2QCUA 3JR4A 4X65M 3W0LB 1R2YA 4AI6A 2DXIA 3ILKA 3B9PA 2QENA 2LNHC 3D8BA 3PNYA 1L8QA 2FOIC 2Q2EB 3J7AS 1N32M 2NQ8C 5JI3E 2C9OA 1FNNA 3KW6A 4MGZE 1K3XA 1SXJA 4G4QA 4I81A 4GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 M;  4PDI A;  1FJG M;  2ZBK B;  3A42 A;  2VQF M;  4DR6 M;  1XC8 A;  4JI3 M;  1Q3C A;  4JI0 M;  4DUZ M;  4OX9 M;  5ITX E;  3SAT A;  4DR3 M;  4JI4 M;  5ITT A;  4JI7 M;  2F5P A;  3SBJ A;  3T1Y M;  1PM5 A;  4NXN M;  1N33 M;  4DR1 M;  1HNZ M;  4DV0 M;  3GPY A;  2XZU A;  1HR0 M;  2F4V M;  1Q3B A;  4DV4 M;  3A45 A;  5BR8 M;  3GPU A;  1L2C A;  4LF7 M;  4YHH M;  1L2D A;  4PCZ A;  2EA0 A;  4LF9 M;  2OPF A;  1XNQ M;  3T1H M;  4G4N A;  4JI5 M;  4JI6 M;  2UUB M;  5IT9 S;  2VQE M;  4G4R A;  3GPX A;  4LF4 M;  2UU9 M;  3SAU A;  4AQY M;  3GQ4 A;  2HHH M;  4NXM M;  4LF5 M;  5LMU M;  1MU5 A;  4MB7 A;  1IBK M;  4DUY M;  1Z59 A;  5ITX A;  3TWK A;  4LFB M;  1L1T A;  1K3W A;  4K0K M;  4DV6 M;  3W0F A;  1TDH A;  3TWL A;  4PD2 A;  4X64 M;  5FLX S;  5ITU A;  5A2Q S;  4DV2 M;  3U6E A;  1J5E M;  3U6C A;  4B3R M;  4PDG A;  1K82 A;  1HNX M;  4B3T M;  2E5L M;  4G4O A;  2UUA M;  3GQ3 A;  4B3M M;  4DR2 M;  5ITY A;  4LF6 M;  4JI8 M;  4GKK M;  5ITR A;  1N34 M;  4DV5 M;  1N36 M;  3GP1 A;  1EE8 A;  5LMN M;  3U6D A;  1NNJ A;  4B3S M;  3C58 A;  3GQ5 A;  1XMO M;  4YY3 M;  1Z5B A;  3SAR A;  1L1Z A;  1Q39 A;  4DR5 M;  4DV1 M;  3GPP A;  3U6O A;  1IBM M;  4CIS A;  1L2B A;  2UUC M;  4DV3 M;  4JV5 M;  4LFC M;  5IWA M;  3SAW A;  5ITQ A;  3SAS A;  4DR4 M;  3GO8 A;  2F5S A;  4JI1 M;  1MX0 A;  2UXB M;  3VK8 A;  3DOA A;  4KHP M;  3A46 A;  1TDZ A;  3JAM S;  2XZF A;  1PJI A;  3JR5 A;  3VK7 A;  2UXD M;  2OQ4 A;  4LF8 M;  3OTO M;  3J81 S;  1KFV A;  4DR7 M;  4JYA M;  2HKJ A;  1IBL M;  4LFA M;  4NRV A;  3U6Q A;  3JR4 A;  4X65 M;  2F5O A;  1Z5A A;  4X66 M;  4GKJ M;  1R2Y A;  1Z5C A;  2F5Q A;  4NRW A;  2UXC M;  2F5N A;  1R2Z A;  3U6P A;  1PJJ A;  3TWM A;  3SAV A;  2ZM6 M;  1XNR M;  2Q2E B;  3J7A S;  1HNW M;  1N32 M;  4JI2 M;  3U6S A;  4ITQ A;  3U6M A;  3U6L A;  1K3X A;  1XMQ M;  4DV7 M;  4G4Q A;  3J80 S;  1I94 M; 
#chains in the Genus database with same CATH topology
 1PJT A;  1JB0 F;  3A42 A;  4IBE A;  2VQF M;  4DR6 M;  4JI0 M;  1HQC A;  2DAK A;  3T38 A;  2BWB A;  3GRU A;  3RFW A;  4IBC A;  3SC3 A;  4GC9 A;  5ITT A;  3T1Y M;  1N75 A;  1PM5 A;  3B7Z A;  1ZMW A;  3F92 A;  1NO1 A;  4D80 A;  1R4G A;  2DI0 A;  4D82 A;  4DV0 M;  3GPY A;  1T43 A;  2M5Z A;  4MM3 B;  4L16 A;  3GLF A;  1G59 A;  2KEB A;  2MR9 A;  2X4A A;  4IBB A;  5KPZ A;  3GPU A;  1L2C A;  1ZMV A;  3FUT A;  1OFI A;  1OKS A;  1MJG M;  3RGP A;  3VDP A;  3VFD A;  3WHK A;  1XNQ M;  1XB2 B;  3UJN A;  2FFJ A;  4JI6 M;  5IT9 S;  4IBI A;  1QUS A;  1QUT A;  3E9S A;  4Z6Y A;  5KQD A;  2DWN A;  4CGY B;  1IN4 A;  4LF4 M;  2R45 A;  7CAT A;  3SAU A;  3KXE C;  3LCV B;  2C96 A;  2C9C A;  3MMP A;  3HHZ A;  2DZL A;  4NOO B;  4KO8 A;  4GIT A;  1D0M A;  4FWH A;  4LF5 M;  1MU5 A;  1XWI A;  2CP8 A;  3M6A A;  3IG8 A;  4DBG B;  2L4E A;  2CRU A;  4RNA A;  3HWS A;  1GO5 A;  3TWK A;  4IBD A;  1L1T A;  3HU2 A;  3NBI A;  5E26 A;  1HT1 E;  2QZ4 A;  2Z4S A;  2V1U A;  1TDH A;  4QHT A;  1XHB A;  3TWL A;  4PD2 A;  4DV2 M;  1IXS B;  1HQY E;  5EJC A;  5EXP A;  1HNX M;  4G6Z A;  2QPA A;  2K0B X;  5EQT A;  5KO3 A;  4PT5 A;  1DGH B;  3THG A;  3GQ3 A;  1V33 A;  2R0I A;  4M9S A;  4GKK M;  5ITR A;  1NHG C;  2KZS A;  4M9X A;  1VQ1 A;  2I7N A;  1ZAE A;  2ZTC A;  3VDU A;  3U6D A;  4LG2 A;  2R44 A;  1AIP C;  2R6F A;  2CFO A;  4OW0 A;  1QDR A;  1XXH B;  4L8R C;  2J7N A;  1G71 A;  1IN5 A;  3HHW A;  2CHV A;  2Y0Q A;  2DKL A;  2K6B A;  2XFS A;  4QOS A;  3TL4 X;  4DV3 M;  3U6O A;  1IBM M;  1TH3 A;  4IBG A;  2KHH A;  4UN2 B;  3U5Z A;  4LJ8 A;  3W67 A;  1VEJ A;  2JY5 A;  4BLC A;  3SAW A;  3I01 M;  3ZC7 B;  4DR4 M;  4P16 A;  2F5S A;  4FW9 A;  2DHR A;  1IY0 A;  3WHL A;  1UM8 A;  3DOA A;  3A46 A;  1ZMU A;  3KS8 A;  5JI2 E;  2BJV A;  1NY5 A;  2XZF A;  4Y28 F;  1GVN A;  1BVS A;  1DGG A;  2OQ4 A;  4OU7 A;  2DZO B;  1KFV A;  1MN3 A;  3NBX X;  1PRB A;  4JYA M;  2HKJ A;  1IBL M;  2VF8 A;  1DV0 A;  3LQQ A;  1WGN A;  2R62 A;  2JP7 A;  5EXS A;  1GJT A;  2OOB A;  3I51 A;  2KZU A;  1A5T A;  1D2N A;  4X66 M;  5FTN A;  2JNH A;  1QQW A;  4LJ4 A;  3U61 A;  2XH9 A;  1JQJ C;  1WXQ A;  3B7N A;  3Q8G A;  2QP9 X;  2F5N A;  3U6P A;  1YUB A;  4XK8 F;  3GLG E;  1NJG A;  3TWM A;  3FTC A;  3U60 A;  3J7B A;  2JY7 A;  1HNW M;  2V6Z M;  4AKG A;  3HHX A;  3SFZ A;  3ZCB B;  2FNA A;  2C5R A;  3B74 A;  4II7 A;  4L4U A;  3U6L A;  2OO9 A;  3AFH A;  3QAU A;  3HHY A;  4DV7 M;  1IFY A;  2O25 A;  3J80 S;  2YR0 A;  2G8L A;  1FJG M;  4HLQ A;  5EP4 A;  2EKF A;  3GLH A;  1WHC A;  1TTE A;  3HZJ A;  5FTM A;  5ITX E;  2XEP A;  4DR3 M;  1JR3 A;  2KNZ A;  3SMP A;  2F5P A;  4DR1 M;  3KP1 E;  1DGB A;  3GLF B;  3FKE A;  1QAO A;  5KQ8 A;  2N35 A;  1QVR A;  3A45 A;  1TH2 A;  2JWS A;  4OVZ B;  2XGN A;  2L09 A;  4YHH M;  1ZQ9 A;  2VDB B;  3DFZ A;  4BB9 A;  4PCZ A;  3IEC A;  1OQY A;  2OPF A;  4G4N A;  2FH0 A;  3GRR A;  2RKO A;  4IBJ A;  2J7O A;  3CGW A;  4FCT A;  1GL6 A;  1IQP A;  3K8Z A;  2VQE M;  3U60 B;  3HU1 A;  2RGH A;  5F3W A;  2Z8Y M;  3FUW A;  1ORY B;  2R4J A;  3KSJ A;  3HJQ A;  5FTK A;  3T6P A;  4AQY M;  2UU9 M;  3GRV A;  3GQ4 A;  1IY2 A;  2VII A;  4MGY E;  4LJ5 A;  2D7E A;  2RRU A;  4M9Z A;  4MB7 A;  3SYL A;  1IBK M;  5DNY A;  4JXJ A;  1IXS A;  1Z59 A;  4I8O A;  1W5T A;  3AOG A;  1JR3 E;  1IN8 A;  4ANR A;  1IN6 A;  4FCV A;  4FWD A;  4AG6 A;  4LFB M;  3KFU G;  2LH0 A;  2GQF A;  3CTW B;  3LCU A;  3FTE A;  4AG5 A;  2V1C A;  2JXN A;  1CUK A;  4AW4 A;  3L29 A;  3TPZ A;  1GL7 A;  1J5E M;  1NVM A;  1J09 A;  1YLA A;  4PDG A;  1K82 A;  5H37 D;  2M60 A;  2E5L M;  4QHS A;  2AHM A;  2WSC F;  2JY6 B;  2L6O A;  1D0L A;  3CF0 A;  1J7K A;  3EIH A;  4G4O A;  3KS4 A;  4AKI A;  2ERC A;  2P5T A;  4B7G A;  4JI4 M;  4M0W A;  1NNU C;  3TE6 A;  2CWB A;  1NHW C;  1Q02 A;  1N34 M;  1LTM A;  4LCB A;  2A5Y B;  2Y20 A;  5DYG A;  1E9S A;  3V76 A;  3GP1 A;  4DV5 M;  1SXJ B;  3FE3 A;  3HGI A;  3PFI A;  1NNJ A;  3U5Z B;  3C58 A;  3GLH E;  3AV0 A;  3CF6 E;  1SXJ C;  2LVP C;  3GQ5 A;  8CAT A;  2L2D A;  1R7R A;  3FYC A;  3GLI E;  2LXE A;  3GPP A;  1GKI A;  2UUC M;  4JV5 M;  2MRO B;  3I4Y A;  2CE7 A;  5GKN A;  4JN6 A;  3HX3 A;  4IIW A;  3R9X B;  5IWA M;  5ITQ A;  4HL4 A;  3SAS A;  4JI1 M;  3H4M A;  3VK8 A;  3PXG A;  4RF0 A;  4CJ6 A;  2CHQ A;  3FD9 A;  2J5Y A;  1LV7 A;  1IXR C;  3H4J A;  5IRE B;  2APL A;  2RGO A;  3FUV A;  3JR5 A;  4Q7J A;  2JY8 A;  4LF8 M;  1JR3 D;  4GC5 A;  4LJA A;  2H5X A;  4LJ7 A;  2QBY B;  3DZD A;  4REZ A;  4DR7 M;  4KT0 F;  3LVW A;  2KNV A;  2VF7 A;  3U6Q A;  3FTF A;  1QAN A;  2F5O A;  4CHT B;  4GKJ M;  2DZN B;  3AJI B;  4I4L A;  3UZU A;  1G3I A;  2JUJ A;  2KRU A;  2K47 A;  3D8L A;  4NRW A;  2W82 A;  2FS1 A;  2YNM D;  2UXC M;  3RGS A;  1P3Q Q;  2WZJ A;  1R2Z A;  4GHA A;  1GAB A;  1PJJ A;  2QHO B;  4GRI A;  1SXJ D;  2Y0T A;  4MH0 E;  2EO2 A;  3IG5 A;  3SAV A;  3QYE A;  4GHL A;  4XGI A;  4LGM A;  4JI2 M;  4B08 A;  4LZZ A;  3GLH B;  3U6S A;  1VDL A;  1HJP A;  1XMQ M;  1X37 A;  3NWL A;  2ZAN A;  3LMM A;  2DWL A;  1I94 M;  5EP3 A;  1UFZ A;  2H1R A;  2WSE F;  1NY6 A;  3EIE A;  3K2L A;  2X49 A;  3J27 B;  3T15 A;  4PDI A;  4X62 M;  5IZ7 D;  4OX9 M;  3FRH A;  4DUZ M;  2R46 A;  2LVA A;  4JI7 M;  1AUA A;  1E9R A;  3I04 M;  1R6B X;  2X8A A;  3L28 A;  4NXN M;  2QBY A;  1N78 A;  2OOA A;  1HNZ M;  2XZU A;  2KA6 B;  1HR0 M;  3FTD A;  2Y21 A;  2Z7J A;  5BR8 M;  2HL7 A;  1E32 A;  4RKU F;  1OFH A;  1XXH A;  2KW0 A;  5EXT A;  2EA0 A;  3M7G A;  1WJ7 A;  3DA1 A;  2LVN C;  1SG9 A;  3KOZ E;  2UUB M;  3GRY A;  3VKH A;  4GEW A;  5DYI A;  4G4R A;  3GLI B;  2MH8 A;  3GPX A;  1F4I A;  3UGJ A;  2CV1 A;  1OIZ A;  3CF2 A;  1QZE A;  1NV9 A;  1SXJ E;  2DAM A;  3K1J A;  4NL4 H;  2ZAM A;  4B7H A;  4DUY M;  1N77 A;  4KLN A;  4NSO B;  5ITX A;  2DAG A;  1IXZ A;  4MGK E;  3U61 B;  1KYI A;  1K3W A;  1R5L A;  3C9P A;  5C18 A;  3A98 B;  3LVV A;  4R7G A;  5FTJ A;  3W0F A;  5EP2 A;  5FLX S;  3U6E A;  5ITU A;  1G8P A;  3KOW E;  1IY1 A;  4FCW A;  2EUC A;  1EIJ A;  1H6U A;  3AOE A;  3SHG B;  2CV0 A;  3PNV A;  1XXH E;  2UUA M;  4B3M M;  3L26 A;  5ITY A;  3K92 A;  1QZM A;  4IJE A;  4QNM A;  1WGL A;  4JI8 M;  1N36 M;  4FVM A;  4QNR A;  3GLI A;  2G5G X;  4R3D A;  2XLJ A;  1EE8 A;  1Y8G A;  5LMN M;  1C7Y A;  3R8F A;  3B7Q A;  3AOE C;  2JZ0 A;  3QYB A;  3TQS A;  1OAI A;  3MHV C;  4YY3 M;  1Z5B A;  2I7P A;  1NV8 A;  1L1Z A;  4MGI E;  1Q39 A;  4DV1 M;  4CIS A;  3GLG B;  2MGW A;  4LRS A;  1L2B A;  3HJS A;  1YE9 A;  3BXW A;  3LQR A;  4LFC M;  1PJQ A;  1G4A E;  1G41 A;  2XSZ D;  3GO8 A;  2HAK A;  1V34 A;  3C3E A;  4LRT A;  2LVO C;  2UXB M;  2KXE A;  2KNA A;  3HU3 A;  4WW0 A;  2LWX A;  1HT2 E;  2BJW A;  3Q8X A;  5E6J A;  2Z3X A;  1PJS A;  3HKP A;  2UXD M;  1RU3 A;  1C1K A;  3OTO M;  3J81 S;  2ZTD A;  4L6V 6;  4NSR A;  1TF0 B;  4LFA M;  2LHC A;  4NRV A;  4IBF A;  2Z4R A;  4FWG A;  3SMS A;  3AKZ A;  1Z5A A;  4LY6 A;  2CHG A;  1Z5C A;  2F5Q A;  1W5S A;  1TR8 A;  1NJF A;  2L7I A;  4Z8X A;  4F2L A;  1Z6T A;  2DAI A;  4IBK A;  5BPV A;  2DWZ B;  3KOX E;  5KPR A;  3KSX A;  1E94 E;  1OAO C;  2ZM6 M;  1XNR M;  1TH4 A;  3MJ5 A;  2DEN A;  4D81 A;  4ITQ A;  1S3S A;  3U6M A;  3MK6 A;  1QAQ A;  2CEA A;  2DVW B;  1T3T A;  3FUX A;  1OTR A;  4A3V B;  2HCB A;  2R18 A;  2LVQ D;  2LBC A;  1KSF X;  2R65 A;  2DWM A;  2ZBK B;  1VEG A;  2B3T A;  3C3D A;  4NC6 A;  1XC8 A;  4JI3 M;  1Q3C A;  4F1I A;  2D7H A;  2LHG A;  3K9O A;  3SAT A;  1DGF A;  3SBJ A;  4AKH A;  3AL0 C;  1N33 M;  3J2P B;  1QDT A;  5FSW A;  2O5R A;  2C99 A;  2QQ8 A;  3SYK A;  3BBZ A;  4L78 A;  1Q3B A;  4BBA A;  4DV4 M;  3M0E A;  2F4V M;  4I5S A;  3BOS A;  4LF7 M;  4R71 A;  1L2D A;  4W5W A;  4LF9 M;  1EFU B;  3VKG A;  2XSZ A;  3T1H M;  3GLF E;  4JI5 M;  2DNA A;  2FE8 A;  2KDL A;  2DAE A;  4LJ6 A;  3IHP A;  2WSF F;  4OVZ A;  2JA2 A;  4IJF A;  1V92 A;  4GIP A;  3KVW A;  2HHH M;  5FTL A;  1I4W A;  4NXM M;  4S12 A;  5LMU M;  2BWE A;  4M0D A;  3KP0 E;  2DHY A;  5KPT A;  3QWL A;  4RF1 A;  4K0K M;  4DV6 M;  3UMM A;  1TGU A;  5EP1 A;  3ZQJ A;  4L15 A;  2L4F A;  3HJ8 A;  3ZH9 B;  4X64 M;  5A2Q S;  1GLN A;  3K9P A;  3FYD A;  4LZJ A;  4B3R M;  3U6C A;  2CUZ A;  2YFQ A;  3B89 A;  4B3T M;  1QAM A;  3E4R A;  1WR1 B;  1T6O A;  2EJS A;  4CIZ A;  4EIW A;  3KOY E;  1DO0 A;  1VDD A;  4DR2 M;  1DGH A;  4MGH A;  3RE8 A;  2CV2 A;  4LF6 M;  1VEK A;  2JZ1 A;  4LJ9 A;  3L27 A;  5C1B A;  2KRK A;  4HEO A;  1D0K A;  4G3O A;  2K9D A;  2QSF X;  4B3S M;  2YQZ A;  3L25 A;  4LGY A;  1XMO M;  2D7G A;  1PGY A;  1OJL A;  2G3Q A;  3GLG A;  3SAR A;  2ZAO A;  5DFL A;  2R4E A;  3HY5 A;  4DR5 M;  1ZV1 A;  2O01 F;  2L7H A;  3PVS A;  3L2A A;  2BNK A;  5L8R F;  1VG5 A;  3FUU A;  5EXX A;  4XBO A;  3KDS E;  2C98 A;  1IM2 A;  4WP2 A;  1QYR A;  1IN7 A;  1WIV A;  3UK6 A;  3VLF B;  2XFT A;  1MX0 A;  4AZF A;  3W68 A;  2GNO A;  4GMQ A;  4ZPX A;  4KHP M;  1YSY A;  1TDZ A;  2QNJ A;  2HWJ A;  4WUR A;  3JAM S;  2EKK A;  3LW5 F;  1PJI A;  1NSF A;  3VK7 A;  4KOD A;  2XF3 A;  1DO2 A;  3I4V A;  4QOZ C;  4B7F A;  3SHF A;  4TUW A;  3FRI A;  2QCU A;  4FD2 A;  4X65 M;  3W0L B;  3JR4 A;  1R2Y A;  4AI6 A;  2DXI A;  3ILK A;  3B9P A;  2QEN A;  2LNH C;  3D8B A;  3PNY A;  1L8Q A;  2FOI C;  2Q2E B;  3J7A S;  1N32 M;  2MJ5 B;  1GJS A;  2NQ8 C;  5JI3 E;  2C9O A;  1FNN A;  3KW6 A;  3E21 A;  4MGZ E;  1K3X A;  1SXJ A;  4P17 A;  4G4Q A;  4I81 A;  2LTU A;  3E46 A;  4GH9 A;  1OIP A; 
#chains in the Genus database with same CATH homology
 3A42 A;  4IBE A;  2VQF M;  4DR6 M;  4JI0 M;  1HQC A;  3T38 A;  4JI4 M;  5ITT A;  3GRU A;  3RFW A;  4IBC A;  3SC3 A;  4GC9 A;  3T1Y M;  1N75 A;  1PM5 A;  4D80 A;  4D82 A;  4DV0 M;  3GPY A;  4MM3 B;  2M5Z A;  4L16 A;  3GLF A;  1G59 A;  2KEB A;  2X4A A;  4IBB A;  3GPU A;  5KPZ A;  1L2C A;  3FUT A;  1OFI A;  3RGP A;  3VDP A;  3VFD A;  3WHK A;  1XNQ M;  3UJN A;  2FFJ A;  4JI6 M;  5IT9 S;  4IBI A;  4Z6Y A;  5KQD A;  3E9S A;  2DWN A;  4CGY B;  1IN4 A;  4LF4 M;  2R45 A;  7CAT A;  3SAU A;  3KXE C;  3HHZ A;  2C96 A;  2C9C A;  4NOO B;  4KO8 A;  4GIT A;  4FWH A;  4LF5 M;  1MU5 A;  1XWI A;  3M6A A;  3IG8 A;  4RNA A;  3HWS A;  3TWK A;  4IBD A;  1L1T A;  3HU2 A;  3NBI A;  5E26 A;  1HT1 E;  2QZ4 A;  2Z4S A;  2V1U A;  1TDH A;  4QHT A;  1XHB A;  3TWL A;  4PD2 A;  4DV2 M;  1IXS B;  1HQY E;  5EJC A;  5EXP A;  1HNX M;  4G6Z A;  2QPA A;  5EQT A;  5KO3 A;  4PT5 A;  1DGH B;  3THG A;  3GQ3 A;  4M9S A;  4GKK M;  5ITR A;  1NHG C;  2KZS A;  4M9X A;  2I7N A;  4LG2 A;  1ZAE A;  3VDU A;  3U6D A;  2CFO A;  4OW0 A;  1XXH B;  4L8R C;  2J7N A;  1IN5 A;  3HHW A;  2CHV A;  2Y0Q A;  3U6O A;  1IBM M;  2XFS A;  4QOS A;  3TL4 X;  4DV3 M;  1TH3 A;  4IBG A;  3U5Z A;  4LJ8 A;  4BLC A;  3SAW A;  3ZC7 B;  4DR4 M;  4P16 A;  2F5S A;  4FW9 A;  2DHR A;  1IY0 A;  3WHL A;  1UM8 A;  3DOA A;  3A46 A;  3KS8 A;  5JI2 E;  2BJV A;  1NY5 A;  2XZF A;  1GVN A;  1DGG A;  2OQ4 A;  4OU7 A;  2DZO B;  1KFV A;  4JYA M;  2HKJ A;  1IBL M;  3LQQ A;  2R62 A;  5EXS A;  3I51 A;  2KZU A;  1D2N A;  4X66 M;  5FTN A;  1QQW A;  4LJ4 A;  3U61 A;  2XH9 A;  1JQJ C;  1WXQ A;  2QP9 X;  2F5N A;  3U6P A;  1YUB A;  1NJG A;  3TWM A;  3FTC A;  3U60 A;  3J7B A;  4AKG A;  1HNW M;  2V6Z M;  3HHX A;  3SFZ A;  3ZCB B;  2FNA A;  2C5R A;  4II7 A;  4L4U A;  3U6L A;  3AFH A;  3QAU A;  3HHY A;  4DV7 M;  3J80 S;  2YR0 A;  2G8L A;  1FJG M;  4HLQ A;  5EP4 A;  3GLH A;  5FTM A;  5ITX E;  2XEP A;  4DR3 M;  1JR3 A;  3SMP A;  2F5P A;  4DR1 M;  3KP1 E;  1DGB A;  3GLF B;  3FKE A;  1QAO A;  5KQ8 A;  1QVR A;  3A45 A;  1TH2 A;  4OVZ B;  2XGN A;  2L09 A;  4YHH M;  1ZQ9 A;  3DFZ A;  4BB9 A;  4PCZ A;  2OPF A;  4G4N A;  3GRR A;  2RKO A;  4IBJ A;  2J7O A;  4FCT A;  2VQE M;  1GL6 A;  1IQP A;  3K8Z A;  3U60 B;  5F3W A;  3HU1 A;  2RGH A;  3FUW A;  5FTK A;  1ORY B;  2R4J A;  3KSJ A;  3HJQ A;  2UU9 M;  4AQY M;  3GRV A;  3GQ4 A;  1IY2 A;  2VII A;  4MGY E;  4LJ5 A;  2D7E A;  4M9Z A;  4MB7 A;  3SYL A;  1IBK M;  5DNY A;  4JXJ A;  1Z59 A;  4I8O A;  1W5T A;  3AOG A;  1IN8 A;  1IN6 A;  4FCV A;  4FWD A;  4AG6 A;  4LFB M;  3KFU G;  2LH0 A;  3CTW B;  3FTE A;  4AG5 A;  2V1C A;  4AW4 A;  3L29 A;  3TPZ A;  1GL7 A;  1J5E M;  1NVM A;  1J09 A;  4PDG A;  1K82 A;  5H37 D;  2M60 A;  2E5L M;  4QHS A;  2AHM A;  3CF0 A;  2L6O A;  3EIH A;  4G4O A;  1J7K A;  4AKI A;  3KS4 A;  2ERC A;  2P5T A;  4B7G A;  4M0W A;  1NNU C;  3TE6 A;  1NHW C;  1N34 M;  4LCB A;  5DYG A;  2A5Y B;  2Y20 A;  3GP1 A;  1E9S A;  4DV5 M;  4AKH A;  1SXJ B;  3HGI A;  3PFI A;  1NNJ A;  3U5Z B;  3C58 A;  3GQ5 A;  3AV0 A;  3CF6 E;  1SXJ C;  8CAT A;  1R7R A;  3FYC A;  2LXE A;  3GPP A;  1GKI A;  2UUC M;  4JV5 M;  3I4Y A;  2CE7 A;  5GKN A;  4JN6 A;  4IIW A;  3R9X B;  5IWA M;  5ITQ A;  4HL4 A;  3SAS A;  4JI1 M;  3H4M A;  3VK8 A;  3PXG A;  4RF0 A;  2CHQ A;  3FD9 A;  1LV7 A;  1IXR C;  5IRE B;  3JR5 A;  2RGO A;  3FUV A;  4LF8 M;  1JR3 D;  4GC5 A;  4LJA A;  4DR7 M;  4LJ7 A;  2QBY B;  3DZD A;  4REZ A;  3LVW A;  3U6Q A;  3FTF A;  1QAN A;  2F5O A;  4CHT B;  4GKJ M;  2DZN B;  3AJI B;  4I4L A;  3UZU A;  1G3I A;  2KRU A;  2K47 A;  3D8L A;  4NRW A;  2W82 A;  2YNM D;  2UXC M;  3RGS A;  1R2Z A;  4GHA A;  1PJJ A;  4GRI A;  1SXJ D;  2Y0T A;  4MH0 E;  2EO2 A;  3IG5 A;  3SAV A;  4GHL A;  4XGI A;  4LGM A;  4JI2 M;  4B08 A;  4LZZ A;  3GLH B;  3U6S A;  1XMQ M;  1X37 A;  3NWL A;  2ZAN A;  3LMM A;  2DWL A;  1I94 M;  5EP3 A;  2H1R A;  4X62 M;  3T15 A;  1NY6 A;  3EIE A;  3K2L A;  2X49 A;  3J27 B;  4PDI A;  5IZ7 D;  4OX9 M;  4DUZ M;  2R46 A;  4JI7 M;  1E9R A;  3L28 A;  1R6B X;  2X8A A;  4NXN M;  2QBY A;  1N78 A;  1HNZ M;  2XZU A;  2KA6 B;  1HR0 M;  3FTD A;  2Y21 A;  2Z7J A;  5BR8 M;  2HL7 A;  1E32 A;  1OFH A;  1XXH A;  2KW0 A;  5EXT A;  2EA0 A;  3M7G A;  3DA1 A;  3KOZ E;  2UUB M;  3GRY A;  3VKH A;  5DYI A;  4G4R A;  3GLI B;  3GPX A;  3UGJ A;  2CV1 A;  3CF2 A;  1SXJ E;  3K1J A;  4NL4 H;  2ZAM A;  4B7H A;  4DUY M;  1N77 A;  4KLN A;  4NSO B;  5ITX A;  1IXZ A;  4MGK E;  3U61 B;  1KYI A;  1K3W A;  5C18 A;  3A98 B;  3LVV A;  4R7G A;  5FTJ A;  3W0F A;  5EP2 A;  5FLX S;  3U6E A;  5ITU A;  1G8P A;  3KOW E;  1IY1 A;  4FCW A;  2EUC A;  1H6U A;  3AOE A;  3SHG B;  2CV0 A;  3PNV A;  2UUA M;  4B3M M;  3L26 A;  5ITY A;  3K92 A;  1QZM A;  4IJE A;  4QNM A;  4JI8 M;  1N36 M;  4FVM A;  4QNR A;  3GLI A;  2G5G X;  4R3D A;  2XLJ A;  1EE8 A;  5LMN M;  3R8F A;  3AOE C;  3TQS A;  3MHV C;  4YY3 M;  1Z5B A;  2I7P A;  1L1Z A;  4MGI E;  1Q39 A;  4DV1 M;  4CIS A;  3GLG B;  4LRS A;  1L2B A;  3HJS A;  1YE9 A;  3LQR A;  4LFC M;  2XSZ D;  1G4A E;  1G41 A;  3GO8 A;  4LRT A;  2UXB M;  2KXE A;  3HU3 A;  4WW0 A;  2LWX A;  1HT2 E;  2BJW A;  3Q8X A;  5E6J A;  2Z3X A;  3HKP A;  2UXD M;  1C1K A;  3OTO M;  3J81 S;  4NSR A;  4LFA M;  4NRV A;  4IBF A;  2Z4R A;  4FWG A;  3SMS A;  3AKZ A;  1Z5A A;  4LY6 A;  2CHG A;  1Z5C A;  2F5Q A;  1W5S A;  1NJF A;  2L7I A;  4Z8X A;  1Z6T A;  4IBK A;  5BPV A;  2DWZ B;  3KOX E;  5KPR A;  3KSX A;  1E94 E;  2ZM6 M;  1XNR M;  1TH4 A;  3MJ5 A;  4ITQ A;  4D81 A;  1S3S A;  3U6M A;  3MK6 A;  1QAQ A;  2CEA A;  2DVW B;  1T3T A;  3FUX A;  4A3V B;  2HCB A;  2R18 A;  1KSF X;  2R65 A;  2DWM A;  2ZBK B;  1XC8 A;  4JI3 M;  1Q3C A;  2D7H A;  3SAT A;  1DGF A;  3SBJ A;  3AL0 C;  1N33 M;  3J2P B;  5FSW A;  2O5R A;  2C99 A;  3SYK A;  4L78 A;  1Q3B A;  4BBA A;  4DV4 M;  3M0E A;  2F4V M;  4I5S A;  3BOS A;  4LF7 M;  1L2D A;  4W5W A;  4LF9 M;  3VKG A;  2XSZ A;  3T1H M;  4JI5 M;  2FE8 A;  4LJ6 A;  4OVZ A;  2JA2 A;  4IJF A;  4GIP A;  3KVW A;  2HHH M;  5FTL A;  1I4W A;  4NXM M;  4S12 A;  5LMU M;  4M0D A;  3KP0 E;  5KPT A;  3QWL A;  4RF1 A;  4K0K M;  4DV6 M;  3UMM A;  1TGU A;  5EP1 A;  4L15 A;  3HJ8 A;  3ZH9 B;  4X64 M;  5A2Q S;  1GLN A;  4LZJ A;  3FYD A;  4B3R M;  3U6C A;  2CUZ A;  2YFQ A;  4B3T M;  1QAM A;  3E4R A;  4EIW A;  3KOY E;  1DO0 A;  1VDD A;  4DR2 M;  1DGH A;  4MGH A;  3RE8 A;  2CV2 A;  4LF6 M;  4LJ9 A;  3L27 A;  5C1B A;  2KRK A;  4B3S M;  2YQZ A;  3L25 A;  4LGY A;  1XMO M;  2D7G A;  1OJL A;  3GLG A;  3SAR A;  2ZAO A;  2R4E A;  4DR5 M;  2L7H A;  3PVS A;  3L2A A;  2BNK A;  3FUU A;  5EXX A;  4XBO A;  3KDS E;  2C98 A;  1IM2 A;  1QYR A;  1IN7 A;  3VLF B;  3UK6 A;  4AZF A;  2XFT A;  1MX0 A;  4GMQ A;  4ZPX A;  4KHP M;  1YSY A;  1TDZ A;  3JAM S;  4WUR A;  1PJI A;  1NSF A;  3VK7 A;  4KOD A;  2XF3 A;  1DO2 A;  3I4V A;  4QOZ C;  4B7F A;  3SHF A;  4TUW A;  4FD2 A;  2QCU A;  3JR4 A;  4X65 M;  3W0L B;  1R2Y A;  4AI6 A;  2DXI A;  3ILK A;  3B9P A;  2QEN A;  2LNH C;  3D8B A;  3PNY A;  1L8Q A;  2FOI C;  2Q2E B;  3J7A S;  1N32 M;  2NQ8 C;  5JI3 E;  2C9O A;  1FNN A;  3KW6 A;  4MGZ E;  1K3X A;  1SXJ A;  4G4Q A;  4I81 A;  4GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...