4KHPM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4khpM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4khpM02
4OX9M 1J5EM 1Z59A 5ITTA 2E5LM 2F4VM 4DV2M 3SAWA 3J7AS 2F5SA 1N32M 4AQYM 1L1TA 3JAMS 3U6PA 1K82A 4NRWA 1I94M 4JI6M 3C58A 1MU5A 5ITXE 2Q2EB 4JI3M 4PCZA 2F5NA 4PD2A 3GQ3A 5ITXA 4GKKM 5ITQA 5IT9S 1KFVA 4DR4M 4X62M 2ZBKB 4JYAM 3OTOM 4JI4M 3U6LA 2OQ4A 4DR6M 2HHHM 3SARA 1IBKM 3U6EA 3JR5A 4JI7M 4NXMM 2UU9M 4LFAM 4DV0M 3GPUA 2VQEM 4G4RA 1HR0M 4X65M 3JR4A 2UUAM 1MX0A 4B3TM 4JI8M 3J81S 1XNQM 3J80S 1L1ZA 3GPXA 4DV7M 3U6DA 1N33M 1XMOM 4DV6M 4G4QA 4KHPM 1HNWM 4G4NA 3U6CA 4B3MM 4JI5M 2XZFA 3A42A 1N36M 4CISA 3GQ5A 3T1YM 3GO8A 1L2CA 4JI2M 4DV3M 4DR1M 4MB7A 1Q3BA 2OPFA 1K3WA 3SATA 2VQFM 5ITYA 3TWLA 5A2QS 4YHHM 4DR3M 4LF5M 4DR5M 1IBMM 4K0KM 3TWKA 4DV1M 3TWMA 3GP1A 5BR8M 3A46A 1PM5A 2F5OA 1R2ZA 5FLXS 5LMUM 4YY3M 1XC8A 2UUCM 1L2DA 2UXDM 3SAUA 1XMQM 1R2YA 3SAVA 4B3SM 1XNRM 1L2BA 4B3RM 2UUBM 5ITRA 1Q3CA 1K3XA 3GQ4A 2XZUA 4DUYM 4JI0M 3U6SA 1Z5AA 2EA0A 2UXBM 3U6QA 4DUZM 4LFBM 4LF4M 4G4OA 1IBLM 1FJGM 5LMNM 4PDGA 4DV4M 2F5PA 5IWAM 4NRVA 1HNXM 1N34M 1EE8A 3GPYA 4JV5M 3SASA 3GPPA 3T1HM 1TDZA 1Q39A 3A45A 2UXCM 1TDHA 2HKJA 1NNJA 1Z5CA 3U6MA 4LF7M 3W0FA 1Z5BA 3U6OA 4LFCM 4LF9M 2ZM6M 3VK8A 1PJIA 4X66M 1HNZM 4JI1M 3SBJA 3VK7A 4NXNM 4LF6M 3DOAA 5ITUA 4X64M 2F5QA 4LF8M 4DV5M 4GKJM 4DR2M 4ITQA 4DR7M 1PJJA 4PDIA
chains in the Genus database with same CATH superfamily
1DGGA 4OX9M 2JZ0A 3H4MA 4GITA 2F4VM 2Y0TA 1D0MA 4AG5A 2R46A 3GLFE 1E32A 4RF1A 3AFHA 4AW4A 3UGJA 2OO9A 2L6OA 1PJSA 3B7NA 4XBOA 2VDBB 4B7FA 3KVWA 4D82A 1F4IA 2CP8A 4OW0A 2Q2EB 3GQ3A 4GKKM 4GHAA 1P3QQ 1HJPA 2LBCA 3GLIE 2W82A 3RE8A 2FOIC 4X62M 1KFVA 2FNAA 1SXJE 2H5XA 4I4LA 1TR8A 2R45A 3THGA 3U6LA 1OAOC 2KNZA 4MM3B 1G4AE 2XLJA 1OKSA 3JR5A 1DGHB 2C98A 4JI7M 4NXMM 2CEAA 1L8QA 3PFIA 3PXGA 1S3SA 4G4RA 2J7OA 3HJSA 2KRKA 1HR0M 1IN5A 1Y8GA 4R7GA 3IECA 4LCBA 4AG6A 2DXIA 4B3TM 4JI8M 3J81S 1XNQM 4HLQA 3J80S 3GPXA 2K6BA 1N33M 1XMOM 4KHPM 1FNNA 3SMPA 1HNWM 2LVAA 1HT1E 4G4NA 3U6CA 4B3MM 4NOOB 3GLGB 1WIVA 2XZFA 1N36M 1GJSA 3HHWA 2XH9A 4MGZE 4RKUF 4LJ7A 3HU2A 3E46A 1OJLA 4DR1M 1TH2A 3L25A 3SHGB 5E26A 4LF5M 1NHGC 1QAOA 4R3DA 5FSWA 1IBMM 4B7GA 1N78A 4DV1M 1R7RA 1IY0A 3TWMA 5EXXA 1WHCA 3R8FA 2DWLA 1D2NA 1ZMWA 1KYIA 4FCVA 3SYKA 3L29A 3E4RA 2HL7A 1L2DA 2Z3XA 1R2YA 3KDSE 4RF0A 1NY5A 4B3SM 3FTFA 1VEGA 5IREB 2JA2A 1MN3A 2QSFX 4QOSA 5FTKA 5JI2E 5ITRA 1LV7A 3LVWA 1K3XA 4DUYM 3K1JA 4NSRA 4JI0M 1NSFA 3IG5A 1GO5A 2KZUA 4LF4M 2XF3A 1Q02A 4LZJA 3IHPA 4BB9A 1JQJC 4DV4M 2JY8A 1BVSA 2CRUA 2RRUA 1PRBA 4KO8A 2I7PA 3SASA 4MH0E 5EQTA 3GPPA 1G71A 5H37D 2GQFA 3QYBA 2QP9X 5GKNA 1TDZA 1VEJA 1DO0A 3E9SA 3LMMA 1QVRA 3I4VA 3A45A 3Q8GA 1QAQA 1QYRA 2HKJA 1SG9A 1Z5CA 1TGUA 2BNKA 1J7KA 3W0FA 3U6MA 1NNJA 4HEOA 4LF7M 3I01M 5EP1A 2J7NA 4OVZB 2BWBA 2ZM6M 2LVPC 2Y21A 3FYDA 1A5TA 4X66M 3AOEC 1HNZM 4BLCA 3LCUA 3SBJA 4LF6M 1VQ1A 2CFOA 2G8LA 4Z6YA 5JI3E 5EP3A 3FTEA 1NVMA 1NO1A 4ITQA 1GLNA 1YUBA 5IZ7D 3WHKA 4IBIA 1PJJA 4IBGA 3KSJA 4LGYA 1TTEA 3SYLA 2DAIA 2E5LM 3E21A 3AJIB 4AZFA 1HQYE 3SAWA 3J7AS 2WZJA 3M6AA 4L78A 3IG8A 5EP4A 1K82A 4AI6A 4JI6M 2Z7JA 3UZUA 1MU5A 2EO2A 3W0LB 2F5NA 1YE9A 2LHCA 3H4JA 3NWLA 1TF0B 2KHHA 3FUUA 4MGIE 2R65A 4G3OA 4JYAM 3GLHB 1QZEA 2EKFA 4LGMA 2OQ4A 5DYIA 5L8RF 2HHHM 3SARA 4R71A 1DGHA 3U6EA 3U60B 4IBBA 2DZOB 4IBCA 3GPUA 1AUAA 1E94E 4IBJA 3MMPA 3JR4A 2UUAM 2CHQA 1MX0A 1X37A 3DA1A 1E9RA 2JY5A 2RKOA 3ZH9B 4QNRA 1WXQA 1L1ZA 2JXNA 2K9DA 3FYCA 3GLGE 3U6DA 2J5YA 1IN4A 4FWDA 5C1BA 1QUTA 4KT0F 1NV9A 2R44A 1CUKA 3GLGA 2YFQA 4JI5M 2V1CA 3L28A 4M9SA 2BJVA 3VDUA 3T1YM 2AHMA 1V92A 3CTWB 3KOXE 4LJ5A 3RGPA 2M60A 1Q3BA 2OPFA 1K3WA 2LVNC 3TWLA 4YHHM 1SXJC 1W5SA 2LTUA 4GIPA 2Z8YM 3ZC7B 2LVQD 2EUCA 1JB0F 2FS1A 5EXSA 4K0KM 2N35A 2QZ4A 2ZTCA 3ILKA 1T43A 3D8BA 3M0EA 4FD2A 2FE8A 2F5OA 4LJ6A 5FLXS 5LMUM 1GJTA 3FUTA 3FTCA 1YLAA 3J2PB 5EP2A 4DBGB 2UUCM 3VKHA 1OTRA 1L2BA 1XWIA 2NQ8C 5C18A 2R0IA 3VFDA 4AKGA 1OQYA 3KFUG 3FUVA 4FWHA 3GQ4A 4Q7JA 1Z5AA 4F1IA 2DWNA 3U6QA 3KXEC 1NJFA 4S12A 4NC6A 3SMSA 2FFJA 1OIPA 3SC3A 5LMNM 2I7NA 3FRIA 3KP0E 3FTDA 1OFHA 1C7YA 3T6PA 3CF2A 2WSEF 4LJ9A 2EKKA 1SXJD 3B89A 3HU3A 1LTMA 3QYEA 3GPYA 4QNMA 1WR1B 2MR9A 5FTNA 2Z4RA 3T1HM 3L26A 3BBZA 4L15A 1Q39A 1G59A 2X4AA 4G6ZA 1TH3A 3KSXA 4M0WA 2VF7A 4L6V6 2D7GA 3GLFB 1Z5BA 2GNOA 1GABA 3W67A 4KLNA 3HHZA 4LFCM 2DAEA 4OVZA 3KS4A 3UJNA 2QENA 4WW0A 1PJIA 2CE7A 2WSFF 2R4JA 2CUZA 3K2LA 4NXNM 5F3WA 2CV0A 4DR7M 3FRHA 2HWJA 3GRUA 2HAKA 3T38A 4X64M 1C1KA 3GLIB 2ZAMA 3UK6A 1V33A 4DR2M 2HCBA 1SXJB 1IQPA 1G8PA 3FUWA 4M0DA 1GVNA 4XK8F 1OAIA 3TQSA 3HHXA 2LXEA 2L09A 1IXSB 4EIWA 1H6UA 3HY5A 4IBEA 3U61B 4QHTA 4NL4H 3KS8A 3QAUA 1Z59A 2QBYB 1XHBA 8CATA 2QHOB 4DV2M 3F92A 2YR0A 2WSCF 1XB2B 3KOZE 1N32M 2C5RA 2C99A 4I5SA 3I4YA 3JAMS 1R4GA 3J7BA 3U6PA 1I94M 1DV0A 1R6BX 1UFZA 5BPVA 5DYGA 2P5TA 2FH0A 3B7ZA 2ERCA 4PCZA 4PD2A 2MROB 4OU7A 2G3QA 1XXHB 1ZQ9A 2EJSA 2ZTDA 2BWEA 2OOBA 4A3VB 1EFUB 4RNAA 3B7QA 3GLHA 1AIPC 3HHYA 4IIWA 3NBXX 2L2DA 3C3EA 4DR6M 3K9PA 2VF8A 3LCVB 3K92A 3DZDA 1VDDA 3BOSA 3LQQA 1ZAEA 3T15A 1T6OA 4I81A 1IXZA 2YNMD 1PJTA 4X65M 1ZMVA 2Y0QA 3FUXA 2MH8A 4MGHA 4PDIA 3AL0C 4GH9A 1NV8A 1N77A 2KW0A 1IFYA 3D8LA 2Z4SA 3NBIA 4DV6M 4IJEA 2CV1A 3AOEA 5KPRA 4FWGA 4CHTB 2DWZB 5KPZA 3AV0A 4BBAA 2DZNB 4FVMA 4CIZA 2L7IA 1L2CA 4DV3M 2LVOC 2KA6B 1VG5A 4FCWA 5ITYA 5DNYA 2VQFM 4DR3M 1GL7A 3LW5F 1E9SA 3AKZA 4FW9A 1IY1A 4QHSA 1PM5A 3SHFA 5BR8M 3A46A 1KSFX 1R2ZA 1JR3D 2R6FA 1XC8A 3MK6A 2UXDM 3HWSA 2ZAOA 1GKIA 2V6ZM 2JY7A 2MJ5B 3RGSA 5KPTA 1XNRM 2K47A 4B3RM 1D0KA 2UUBM 1IN6A 1DGFA 2XSZA 4KODA 1Q3CA 3VKGA 2CHVA 3LQRA 1QQWA 2EA0A 2UXBM 2C9OA 2XSZD 3L2AA 4LJ4A 3MJ5A 1TH4A 4LFBM 4GC9A 4IBDA 1FJGM 1QANA 3KP1E 1WJ7A 1ZMUA 5FTJA 3B74A 2O5RA 1HNXM 1NY6A 1EE8A 4JV5M 3CF6E 1J09A 1YSYA 2DAMA 4W5WA 4GHLA 2XEPA 2Y20A 4LY6A 1QAMA 2R18A 3U5ZB 1Z6TA 2UXCM 1TDHA 1IY2A 3KOWE 2QCUA 2RGHA 3GLFA 2QQ8A 2D7EA 2JUJA 2X49A 3CF0A 3U6OA 3SFZA 4B7HA 5FTLA 1RU3A 5KO3A 2KRUA 2DKLA 4IJFA 3HKPA 4GRIA 3VK8A 4HL4A 4MGKE 4JI1M 3VK7A 3J27B 1NJGA 4LJ8A 4ZPXA 2DVWB 2KXEA 3DOAA 1IN7A 4I8OA 2KDLA 4Y28F 1I4WA 2OOAA 3GLIA 4DV5M 2LNHC 4GKJM 2DWMA 2A5YB 2APLA 3LVVA 2L4EA 1SXJA 1N75A 1DGBA 1GL6A 3TPZA 1ORYB 5KQDA 2L7HA 4P16A 1ZV1A 1IXSA 2QNJA 3U61A 4PT5A 5FTMA 1J5EM 1IM2A 4QOZC 1NHWC 2QBYA 2B3TA 1NNUC 1V34A 5ITTA 2DHYA 1W5TA 4D80A 2C9CA 3BXWA 2F5SA 2D7HA 4UN2B 1QZMA 3EIHA 1IN8A 3KOYE 4AQYM 1L1TA 3ZCBB 4NRWA 3C9PA 1OFIA 2DHRA 3V76A 3C58A 2V1UA 3FD9A 5ITXE 1XXHE 4JI3M 2JNHA 4CGYB 5ITXA 1XXHA 3AOGA 3B9PA 4IBKA 4JN6A 5ITQA 5IT9S 4GEWA 3M7GA 4DR4M 4CJ6A 2ZBKB 3DFZA 3MHVC 3VDPA 3OTOM 1HQCA 4P17A 4JI4M 2YQZA 2JP7A 2XFTA 1IBKM 3HJ8A 3GRYA 4M9XA 3FKEA 5KQ8A 2UU9M 3PNYA 2XGNA 1PJQA 4LFAM 4DV0M 1IXRC 2VQEM 2CV2A 4Z8XA 1EIJA 4LZZA 5DFLA 4AKHA 3I51A 2KNVA 7CATA 2KZSA 2XFSA 3KW6A 2VIIA 4B08A 3CGWA 4DV7M 4D81A 1DO2A 4G4QA 4LRSA 2O01F 4REZA 1WGNA 3A42A 4CISA 2G5GX 3WHLA 3GQ5A 3GO8A 4JI2M 3GLHE 4MB7A 3W68A 3SATA 1G3IA 5A2QS 3HX3A 4NSOB 3HGIA 1MJGM 2DI0A 4JXJA 5EJCA 4DR5M 1G41A 1OIZA 3U60A 3TWKA 1HT2E 5EXPA 5E6JA 2CWBA 3GP1A 2DNAA 4GMQA 2H1RA 1VEKA 2QPAA 4YY3M 1QDTA 2DAKA 2MGWA 3SAUA 1XMQM 3SAVA 3GRVA 3PNVA 4TUWA 1R5LA 4IBFA 3ZQJA 2DENA 2R4EA 2XZUA 3U6SA 4WP2A 2BJWA 3HJQA 5EXTA 4LJAA 4DUZM 1PGYA 4G4OA 1IBLM 2CHGA 2RGOA 4PDGA 4M9ZA 3VLFB 4LRTA 4NRVA 5IWAM 2F5PA 4L8RC 4L4UA 3K9OA 2JZ1A 3RFWA 3A98B 4WURA 1QDRA 1N34M 2M5ZA 2DZLA 2O25A 2ZANA 3HU1A 4MGYE 3UMMA 1JR3E 1QUSA 2JY6B 1JR3A 3U5ZA 4GC5A 3TL4X 2LHGA 3I04M 4II7A 2KEBA 3FE3A 3PVSA 3R9XB 4ANRA 4XGIA 4L16A 1UM8A 4LF9M 1T3TA 2LWXA 2DAGA 4F2LA 3C3DA 4AKIA 3Q8XA 3K8ZA 3QWLA 4LG2A 2X8AA 3L27A 2LH0A 5ITUA 2F5QA 4FCTA 4LF8M 3HZJA 1D0LA 2R62A 2C96A 1VDLA 1WGLA 2K0BX 3EIEA 3TE6A 2JWSA 2L4FA 2KNAA 3GRRA
chains in the Genus database with same CATH topology
1DGGA 4OX9M 3H4MA 4GITA 2F4VM 2Y0TA 4AG5A 2R46A 1E32A 4RF1A 3AFHA 4AW4A 3UGJA 2L6OA 4XBOA 4B7FA 3KVWA 4D82A 4OW0A 2Q2EB 3GQ3A 4GKKM 4GHAA 2W82A 3RE8A 2FOIC 4X62M 1KFVA 2FNAA 1SXJE 4I4LA 2R45A 3THGA 3U6LA 4MM3B 2XLJA 1G4AE 3JR5A 1DGHB 2C98A 4JI7M 4NXMM 2CEAA 1L8QA 3PFIA 3PXGA 1S3SA 4G4RA 2J7OA 3HJSA 2KRKA 1HR0M 1IN5A 4R7GA 4LCBA 4AG6A 2DXIA 4B3TM 4JI8M 3J81S 1XNQM 4HLQA 3J80S 3GPXA 1N33M 1XMOM 4KHPM 1FNNA 3SMPA 1HNWM 1HT1E 4G4NA 3U6CA 4B3MM 4NOOB 3GLGB 2XZFA 1N36M 3HHWA 2XH9A 4MGZE 4LJ7A 3HU2A 1OJLA 4DR1M 1TH2A 3L25A 3SHGB 5E26A 4LF5M 1NHGC 1QAOA 4R3DA 5FSWA 1IBMM 4B7GA 1N78A 4DV1M 1R7RA 1IY0A 3TWMA 5EXXA 3R8FA 1D2NA 1KYIA 4FCVA 3SYKA 3L29A 3E4RA 2HL7A 1L2DA 2Z3XA 1R2YA 3KDSE 4RF0A 1NY5A 4B3SM 3FTFA 5IREB 2JA2A 5ITRA 4QOSA 5FTKA 5JI2E 1K3XA 1LV7A 3LVWA 4DUYM 3K1JA 4NSRA 4JI0M 1NSFA 3IG5A 2KZUA 4LF4M 2XF3A 4LZJA 4BB9A 4DV4M 1JQJC 4KO8A 2I7PA 3SASA 4MH0E 5EQTA 3GPPA 5H37D 2QP9X 5GKNA 1TDZA 1DO0A 3E9SA 3LMMA 1QVRA 3I4VA 3A45A 1QAQA 1QYRA 2BNKA 2HKJA 1Z5CA 1TGUA 3U6MA 1J7KA 3W0FA 1NNJA 4LF7M 5EP1A 2J7NA 4OVZB 2ZM6M 2Y21A 3FYDA 4X66M 3AOEC 1HNZM 4BLCA 3SBJA 4LF6M 2CFOA 2G8LA 4Z6YA 5JI3E 5EP3A 3FTEA 1NVMA 4ITQA 1GLNA 1YUBA 5IZ7D 3WHKA 4IBIA 1PJJA 4IBGA 3KSJA 4LGYA 3SYLA 2E5LM 4AZFA 3AJIB 3SAWA 1HQYE 3J7AS 3M6AA 4L78A 3IG8A 5EP4A 1K82A 4AI6A 4JI6M 2Z7JA 3UZUA 1MU5A 2EO2A 3W0LB 2F5NA 1YE9A 3NWLA 3FUUA 4MGIE 2R65A 4JYAM 3GLHB 4LGMA 2OQ4A 5DYIA 2HHHM 3SARA 1DGHA 3U6EA 3U60B 4IBBA 2DZOB 4IBCA 3GPUA 1E94E 4IBJA 3JR4A 2UUAM 2CHQA 1MX0A 1X37A 3DA1A 1E9RA 2RKOA 3ZH9B 4QNRA 1WXQA 1L1ZA 3U6DA 3FYCA 1IN4A 4FWDA 5C1BA 3GLGA 4JI5M 2YFQA 2V1CA 3L28A 4M9SA 2BJVA 3VDUA 3T1YM 2AHMA 3KOXE 3CTWB 4LJ5A 3RGPA 2M60A 1Q3BA 2OPFA 1K3WA 3TWLA 4YHHM 1SXJC 1W5SA 4GIPA 3ZC7B 4K0KM 2EUCA 5EXSA 2QZ4A 3ILKA 3D8BA 3M0EA 4FD2A 2FE8A 2F5OA 4LJ6A 5FLXS 5LMUM 2UUCM 3FUTA 3FTCA 3J2PB 5EP2A 3VKHA 1L2BA 1XWIA 2NQ8C 5C18A 3VFDA 4AKGA 3KFUG 3FUVA 4FWHA 3GQ4A 1Z5AA 2DWNA 3U6QA 3KXEC 1NJFA 4S12A 3SMSA 2FFJA 3SC3A 5LMNM 2I7NA 3KP0E 3FTDA 1OFHA 3CF2A 4LJ9A 1SXJD 3HU3A 3GPYA 4QNMA 5FTNA 2Z4RA 3T1HM 3L26A 4L15A 1Q39A 1G59A 2X4AA 4G6ZA 3KSXA 1TH3A 4M0WA 2D7GA 3GLFB 1Z5BA 3HHZA 4KLNA 4LFCM 4OVZA 3KS4A 3UJNA 2QENA 4WW0A 1PJIA 2CE7A 2R4JA 2CUZA 3K2LA 4NXNM 5F3WA 2CV0A 4DR7M 3GRUA 3T38A 4X64M 1C1KA 3GLIB 2ZAMA 3UK6A 4DR2M 2HCBA 3FUWA 1IQPA 1G8PA 1SXJB 4M0DA 1GVNA 3TQSA 3HHXA 2LXEA 2L09A 1IXSB 4EIWA 1H6UA 4IBEA 3U61B 2DWLA 4QHTA 4NL4H 3KS8A 3QAUA 1Z59A 2QBYB 1XHBA 8CATA 4DV2M 2YR0A 1N32M 3KOZE 2C5RA 2C99A 4I5SA 3I4YA 3JAMS 3J7BA 3U6PA 1I94M 1R6BX 5BPVA 5DYGA 2P5TA 4PCZA 2ERCA 4PD2A 4OU7A 1XXHB 1ZQ9A 4A3VB 4RNAA 3GLHA 3HHYA 4IIWA 4DR6M 3K92A 3DZDA 1VDDA 3BOSA 3LQQA 1ZAEA 3T15A 4I81A 1IXZA 2YNMD 4X65M 2Y0QA 3FUXA 4MGHA 3AL0C 4GH9A 1N77A 2KW0A 3D8LA 2Z4SA 3NBIA 4DV6M 4IJEA 2CV1A 3AOEA 5KPRA 4FWGA 4CHTB 2DWZB 5KPZA 3AV0A 4BBAA 2DZNB 4FVMA 1L2CA 2L7IA 4DV3M 2KA6B 4FCWA 2VQFM 5ITYA 5DNYA 4DR3M 1GL7A 1E9SA 3AKZA 4FW9A 1IY1A 4QHSA 1PM5A 3SHFA 5BR8M 3A46A 1KSFX 1R2ZA 1JR3D 1XC8A 3MK6A 2UXDM 3HWSA 2ZAOA 1GKIA 2V6ZM 5KPTA 1XNRM 3RGSA 2K47A 4B3RM 2UUBM 1IN6A 1DGFA 2XSZA 4KODA 1Q3CA 3VKGA 2CHVA 3LQRA 1QQWA 2EA0A 2UXBM 2C9OA 2XSZD 3L2AA 4LJ4A 3MJ5A 1TH4A 4LFBM 4GC9A 4IBDA 1FJGM 1QANA 3KP1E 5FTJA 2O5RA 1HNXM 1NY6A 1EE8A 4JV5M 3CF6E 1J09A 1YSYA 4GHLA 4W5WA 2XEPA 2Y20A 4LY6A 1QAMA 2R18A 3U5ZB 1Z6TA 2UXCM 1TDHA 1IY2A 3KOWE 2QCUA 2RGHA 3GLFA 2D7EA 2X49A 3CF0A 3U6OA 3SFZA 4B7HA 5FTLA 5KO3A 2KRUA 4IJFA 3HKPA 4GRIA 3VK8A 4HL4A 4MGKE 4JI1M 3VK7A 3J27B 1NJGA 4LJ8A 4ZPXA 2DVWB 2KXEA 3DOAA 1IN7A 4I8OA 1I4WA 3GLIA 4DV5M 2LNHC 4GKJM 2DWMA 2A5YB 3LVVA 1N75A 1DGBA 1SXJA 3TPZA 1GL6A 1ORYB 5KQDA 2L7HA 4P16A 3U61A 4PT5A 5FTMA 1J5EM 1IM2A 4QOZC 1NHWC 2QBYA 1NNUC 5ITTA 4D80A 1W5TA 2C9CA 2F5SA 2D7HA 4AQYM 1QZMA 3EIHA 1IN8A 3KOYE 1L1TA 3ZCBB 4NRWA 1OFIA 2DHRA 3C58A 2V1UA 3FD9A 5ITXE 4JI3M 4CGYB 5ITXA 1XXHA 3AOGA 3B9PA 4IBKA 4JN6A 5ITQA 5IT9S 3M7GA 4DR4M 2ZBKB 3DFZA 3MHVC 3VDPA 3OTOM 1HQCA 4JI4M 2YQZA 2XFTA 1IBKM 3HJ8A 3GRYA 4M9XA 3FKEA 5KQ8A 2UU9M 3PNYA 2XGNA 4LFAM 4DV0M 1IXRC 2VQEM 2CV2A 4Z8XA 4LZZA 4AKHA 3I51A 7CATA 2KZSA 2XFSA 3KW6A 2VIIA 4B08A 4DV7M 4D81A 1DO2A 4G4QA 4LRSA 4REZA 3A42A 4CISA 2G5GX 3WHLA 3GQ5A 3GO8A 4JI2M 4MB7A 3SATA 1G3IA 5A2QS 4NSOB 3HGIA 4JXJA 5EJCA 4DR5M 1G41A 3U60A 3TWKA 1HT2E 5EXPA 5E6JA 3GP1A 4GMQA 2H1RA 2QPAA 4YY3M 3SAUA 1XMQM 3SAVA 3GRVA 3PNVA 4TUWA 4IBFA 2R4EA 2XZUA 3U6SA 2BJWA 3HJQA 5EXTA 4LJAA 4DUZM 4G4OA 1IBLM 2CHGA 2RGOA 4PDGA 4M9ZA 3VLFB 4LRTA 4NRVA 5IWAM 2F5PA 4L8RC 4L4UA 3RFWA 3A98B 4WURA 1N34M 2M5ZA 3HU1A 2ZANA 4MGYE 3UMMA 1JR3A 3U5ZA 4GC5A 3TL4X 4II7A 2KEBA 3PVSA 3R9XB 4XGIA 4L16A 1UM8A 4LF9M 1T3TA 2LWXA 4AKIA 3Q8XA 3K8ZA 3QWLA 4LG2A 2X8AA 3L27A 2LH0A 5ITUA 2F5QA 4FCTA 4LF8M 2R62A 2C96A 3EIEA 3TE6A 4PDIA 3GRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 M;  1J5E M;  1Z59 A;  5ITT A;  2E5L M;  2F4V M;  4DV2 M;  3SAW A;  3J7A S;  2F5S A;  1N32 M;  4AQY M;  1L1T A;  3JAM S;  3U6P A;  1K82 A;  4NRW A;  1I94 M;  4JI6 M;  3C58 A;  1MU5 A;  5ITX E;  2Q2E B;  4JI3 M;  4PCZ A;  2F5N A;  4PD2 A;  3GQ3 A;  5ITX A;  4GKK M;  5ITQ A;  5IT9 S;  1KFV A;  4DR4 M;  4X62 M;  2ZBK B;  4JYA M;  3OTO M;  4JI4 M;  3U6L A;  2OQ4 A;  4DR6 M;  2HHH M;  3SAR A;  1IBK M;  3U6E A;  3JR5 A;  4JI7 M;  4NXM M;  2UU9 M;  4LFA M;  4DV0 M;  3GPU A;  2VQE M;  4G4R A;  1HR0 M;  4X65 M;  3JR4 A;  2UUA M;  1MX0 A;  4B3T M;  4JI8 M;  3J81 S;  1XNQ M;  3J80 S;  1L1Z A;  3GPX A;  4DV7 M;  3U6D A;  1N33 M;  1XMO M;  4DV6 M;  4G4Q A;  4KHP M;  1HNW M;  4G4N A;  3U6C A;  4B3M M;  4JI5 M;  2XZF A;  3A42 A;  1N36 M;  4CIS A;  3GQ5 A;  3T1Y M;  3GO8 A;  1L2C A;  4JI2 M;  4DV3 M;  4DR1 M;  4MB7 A;  1Q3B A;  2OPF A;  1K3W A;  3SAT A;  2VQF M;  5ITY A;  3TWL A;  5A2Q S;  4YHH M;  4DR3 M;  4LF5 M;  4DR5 M;  1IBM M;  4K0K M;  3TWK A;  4DV1 M;  3TWM A;  3GP1 A;  5BR8 M;  3A46 A;  1PM5 A;  2F5O A;  1R2Z A;  5FLX S;  5LMU M;  4YY3 M;  1XC8 A;  2UUC M;  1L2D A;  2UXD M;  3SAU A;  1XMQ M;  1R2Y A;  3SAV A;  4B3S M;  1XNR M;  1L2B A;  4B3R M;  2UUB M;  5ITR A;  1Q3C A;  1K3X A;  3GQ4 A;  2XZU A;  4DUY M;  4JI0 M;  3U6S A;  1Z5A A;  2EA0 A;  2UXB M;  3U6Q A;  4DUZ M;  4LFB M;  4LF4 M;  4G4O A;  1IBL M;  1FJG M;  5LMN M;  4PDG A;  4DV4 M;  2F5P A;  5IWA M;  4NRV A;  1HNX M;  1N34 M;  1EE8 A;  3GPY A;  4JV5 M;  3SAS A;  3GPP A;  3T1H M;  1TDZ A;  1Q39 A;  3A45 A;  2UXC M;  1TDH A;  2HKJ A;  1NNJ A;  1Z5C A;  3U6M A;  4LF7 M;  3W0F A;  1Z5B A;  3U6O A;  4LFC M;  4LF9 M;  2ZM6 M;  3VK8 A;  1PJI A;  4X66 M;  1HNZ M;  4JI1 M;  3SBJ A;  3VK7 A;  4NXN M;  4LF6 M;  3DOA A;  5ITU A;  4X64 M;  2F5Q A;  4LF8 M;  4DV5 M;  4GKJ M;  4DR2 M;  4ITQ A;  4DR7 M;  1PJJ A;  4PDI A; 
#chains in the Genus database with same CATH topology
 1DGG A;  4OX9 M;  2JZ0 A;  3H4M A;  4GIT A;  2F4V M;  2Y0T A;  1D0M A;  4AG5 A;  2R46 A;  3GLF E;  1E32 A;  4RF1 A;  3AFH A;  4AW4 A;  3UGJ A;  2OO9 A;  2L6O A;  1PJS A;  3B7N A;  4XBO A;  2VDB B;  4B7F A;  3KVW A;  4D82 A;  1F4I A;  2CP8 A;  4OW0 A;  2Q2E B;  3GQ3 A;  4GKK M;  4GHA A;  1P3Q Q;  1HJP A;  2LBC A;  3GLI E;  2W82 A;  3RE8 A;  2FOI C;  4X62 M;  1KFV A;  2FNA A;  1SXJ E;  2H5X A;  4I4L A;  1TR8 A;  2R45 A;  3THG A;  3U6L A;  1OAO C;  2KNZ A;  4MM3 B;  1G4A E;  2XLJ A;  1OKS A;  3JR5 A;  1DGH B;  2C98 A;  4JI7 M;  4NXM M;  2CEA A;  1L8Q A;  3PFI A;  3PXG A;  1S3S A;  4G4R A;  2J7O A;  3HJS A;  2KRK A;  1HR0 M;  1IN5 A;  1Y8G A;  4R7G A;  3IEC A;  4LCB A;  4AG6 A;  2DXI A;  4B3T M;  4JI8 M;  3J81 S;  1XNQ M;  4HLQ A;  3J80 S;  3GPX A;  2K6B A;  1N33 M;  1XMO M;  4KHP M;  1FNN A;  3SMP A;  1HNW M;  2LVA A;  1HT1 E;  4G4N A;  3U6C A;  4B3M M;  4NOO B;  3GLG B;  1WIV A;  2XZF A;  1N36 M;  1GJS A;  3HHW A;  2XH9 A;  4MGZ E;  4RKU F;  4LJ7 A;  3HU2 A;  3E46 A;  1OJL A;  4DR1 M;  1TH2 A;  3L25 A;  3SHG B;  5E26 A;  4LF5 M;  1NHG C;  1QAO A;  4R3D A;  5FSW A;  1IBM M;  4B7G A;  1N78 A;  4DV1 M;  1R7R A;  1IY0 A;  3TWM A;  5EXX A;  1WHC A;  3R8F A;  2DWL A;  1D2N A;  1ZMW A;  1KYI A;  4FCV A;  3SYK A;  3L29 A;  3E4R A;  2HL7 A;  1L2D A;  2Z3X A;  1R2Y A;  3KDS E;  4RF0 A;  1NY5 A;  4B3S M;  3FTF A;  1VEG A;  5IRE B;  2JA2 A;  1MN3 A;  2QSF X;  4QOS A;  5FTK A;  5JI2 E;  5ITR A;  1LV7 A;  3LVW A;  1K3X A;  4DUY M;  3K1J A;  4NSR A;  4JI0 M;  1NSF A;  3IG5 A;  1GO5 A;  2KZU A;  4LF4 M;  2XF3 A;  1Q02 A;  4LZJ A;  3IHP A;  4BB9 A;  1JQJ C;  4DV4 M;  2JY8 A;  1BVS A;  2CRU A;  2RRU A;  1PRB A;  4KO8 A;  2I7P A;  3SAS A;  4MH0 E;  5EQT A;  3GPP A;  1G71 A;  5H37 D;  2GQF A;  3QYB A;  2QP9 X;  5GKN A;  1TDZ A;  1VEJ A;  1DO0 A;  3E9S A;  3LMM A;  1QVR A;  3I4V A;  3A45 A;  3Q8G A;  1QAQ A;  1QYR A;  2HKJ A;  1SG9 A;  1Z5C A;  1TGU A;  2BNK A;  1J7K A;  3W0F A;  3U6M A;  1NNJ A;  4HEO A;  4LF7 M;  3I01 M;  5EP1 A;  2J7N A;  4OVZ B;  2BWB A;  2ZM6 M;  2LVP C;  2Y21 A;  3FYD A;  1A5T A;  4X66 M;  3AOE C;  1HNZ M;  4BLC A;  3LCU A;  3SBJ A;  4LF6 M;  1VQ1 A;  2CFO A;  2G8L A;  4Z6Y A;  5JI3 E;  5EP3 A;  3FTE A;  1NVM A;  1NO1 A;  4ITQ A;  1GLN A;  1YUB A;  5IZ7 D;  3WHK A;  4IBI A;  1PJJ A;  4IBG A;  3KSJ A;  4LGY A;  1TTE A;  3SYL A;  2DAI A;  2E5L M;  3E21 A;  3AJI B;  4AZF A;  1HQY E;  3SAW A;  3J7A S;  2WZJ A;  3M6A A;  4L78 A;  3IG8 A;  5EP4 A;  1K82 A;  4AI6 A;  4JI6 M;  2Z7J A;  3UZU A;  1MU5 A;  2EO2 A;  3W0L B;  2F5N A;  1YE9 A;  2LHC A;  3H4J A;  3NWL A;  1TF0 B;  2KHH A;  3FUU A;  4MGI E;  2R65 A;  4G3O A;  4JYA M;  3GLH B;  1QZE A;  2EKF A;  4LGM A;  2OQ4 A;  5DYI A;  5L8R F;  2HHH M;  3SAR A;  4R71 A;  1DGH A;  3U6E A;  3U60 B;  4IBB A;  2DZO B;  4IBC A;  3GPU A;  1AUA A;  1E94 E;  4IBJ A;  3MMP A;  3JR4 A;  2UUA M;  2CHQ A;  1MX0 A;  1X37 A;  3DA1 A;  1E9R A;  2JY5 A;  2RKO A;  3ZH9 B;  4QNR A;  1WXQ A;  1L1Z A;  2JXN A;  2K9D A;  3FYC A;  3GLG E;  3U6D A;  2J5Y A;  1IN4 A;  4FWD A;  5C1B A;  1QUT A;  4KT0 F;  1NV9 A;  2R44 A;  1CUK A;  3GLG A;  2YFQ A;  4JI5 M;  2V1C A;  3L28 A;  4M9S A;  2BJV A;  3VDU A;  3T1Y M;  2AHM A;  1V92 A;  3CTW B;  3KOX E;  4LJ5 A;  3RGP A;  2M60 A;  1Q3B A;  2OPF A;  1K3W A;  2LVN C;  3TWL A;  4YHH M;  1SXJ C;  1W5S A;  2LTU A;  4GIP A;  2Z8Y M;  3ZC7 B;  2LVQ D;  2EUC A;  1JB0 F;  2FS1 A;  5EXS A;  4K0K M;  2N35 A;  2QZ4 A;  2ZTC A;  3ILK A;  1T43 A;  3D8B A;  3M0E A;  4FD2 A;  2FE8 A;  2F5O A;  4LJ6 A;  5FLX S;  5LMU M;  1GJT A;  3FUT A;  3FTC A;  1YLA A;  3J2P B;  5EP2 A;  4DBG B;  2UUC M;  3VKH A;  1OTR A;  1L2B A;  1XWI A;  2NQ8 C;  5C18 A;  2R0I A;  3VFD A;  4AKG A;  1OQY A;  3KFU G;  3FUV A;  4FWH A;  3GQ4 A;  4Q7J A;  1Z5A A;  4F1I A;  2DWN A;  3U6Q A;  3KXE C;  1NJF A;  4S12 A;  4NC6 A;  3SMS A;  2FFJ A;  1OIP A;  3SC3 A;  5LMN M;  2I7N A;  3FRI A;  3KP0 E;  3FTD A;  1OFH A;  1C7Y A;  3T6P A;  3CF2 A;  2WSE F;  4LJ9 A;  2EKK A;  1SXJ D;  3B89 A;  3HU3 A;  1LTM A;  3QYE A;  3GPY A;  4QNM A;  1WR1 B;  2MR9 A;  5FTN A;  2Z4R A;  3T1H M;  3L26 A;  3BBZ A;  4L15 A;  1Q39 A;  1G59 A;  2X4A A;  4G6Z A;  1TH3 A;  3KSX A;  4M0W A;  2VF7 A;  4L6V 6;  2D7G A;  3GLF B;  1Z5B A;  2GNO A;  1GAB A;  3W67 A;  4KLN A;  3HHZ A;  4LFC M;  2DAE A;  4OVZ A;  3KS4 A;  3UJN A;  2QEN A;  4WW0 A;  1PJI A;  2CE7 A;  2WSF F;  2R4J A;  2CUZ A;  3K2L A;  4NXN M;  5F3W A;  2CV0 A;  4DR7 M;  3FRH A;  2HWJ A;  3GRU A;  2HAK A;  3T38 A;  4X64 M;  1C1K A;  3GLI B;  2ZAM A;  3UK6 A;  1V33 A;  4DR2 M;  2HCB A;  1SXJ B;  1IQP A;  1G8P A;  3FUW A;  4M0D A;  1GVN A;  4XK8 F;  1OAI A;  3TQS A;  3HHX A;  2LXE A;  2L09 A;  1IXS B;  4EIW A;  1H6U A;  3HY5 A;  4IBE A;  3U61 B;  4QHT A;  4NL4 H;  3KS8 A;  3QAU A;  1Z59 A;  2QBY B;  1XHB A;  8CAT A;  2QHO B;  4DV2 M;  3F92 A;  2YR0 A;  2WSC F;  1XB2 B;  3KOZ E;  1N32 M;  2C5R A;  2C99 A;  4I5S A;  3I4Y A;  3JAM S;  1R4G A;  3J7B A;  3U6P A;  1I94 M;  1DV0 A;  1R6B X;  1UFZ A;  5BPV A;  5DYG A;  2P5T A;  2FH0 A;  3B7Z A;  2ERC A;  4PCZ A;  4PD2 A;  2MRO B;  4OU7 A;  2G3Q A;  1XXH B;  1ZQ9 A;  2EJS A;  2ZTD A;  2BWE A;  2OOB A;  4A3V B;  1EFU B;  4RNA A;  3B7Q A;  3GLH A;  1AIP C;  3HHY A;  4IIW A;  3NBX X;  2L2D A;  3C3E A;  4DR6 M;  3K9P A;  2VF8 A;  3LCV B;  3K92 A;  3DZD A;  1VDD A;  3BOS A;  3LQQ A;  1ZAE A;  3T15 A;  1T6O A;  4I81 A;  1IXZ A;  2YNM D;  1PJT A;  4X65 M;  1ZMV A;  2Y0Q A;  3FUX A;  2MH8 A;  4MGH A;  4PDI A;  3AL0 C;  4GH9 A;  1NV8 A;  1N77 A;  2KW0 A;  1IFY A;  3D8L A;  2Z4S A;  3NBI A;  4DV6 M;  4IJE A;  2CV1 A;  3AOE A;  5KPR A;  4FWG A;  4CHT B;  2DWZ B;  5KPZ A;  3AV0 A;  4BBA A;  2DZN B;  4FVM A;  4CIZ A;  2L7I A;  1L2C A;  4DV3 M;  2LVO C;  2KA6 B;  1VG5 A;  4FCW A;  5ITY A;  5DNY A;  2VQF M;  4DR3 M;  1GL7 A;  3LW5 F;  1E9S A;  3AKZ A;  4FW9 A;  1IY1 A;  4QHS A;  1PM5 A;  3SHF A;  5BR8 M;  3A46 A;  1KSF X;  1R2Z A;  1JR3 D;  2R6F A;  1XC8 A;  3MK6 A;  2UXD M;  3HWS A;  2ZAO A;  1GKI A;  2V6Z M;  2JY7 A;  2MJ5 B;  3RGS A;  5KPT A;  1XNR M;  2K47 A;  4B3R M;  1D0K A;  2UUB M;  1IN6 A;  1DGF A;  2XSZ A;  4KOD A;  1Q3C A;  3VKG A;  2CHV A;  3LQR A;  1QQW A;  2EA0 A;  2UXB M;  2C9O A;  2XSZ D;  3L2A A;  4LJ4 A;  3MJ5 A;  1TH4 A;  4LFB M;  4GC9 A;  4IBD A;  1FJG M;  1QAN A;  3KP1 E;  1WJ7 A;  1ZMU A;  5FTJ A;  3B74 A;  2O5R A;  1HNX M;  1NY6 A;  1EE8 A;  4JV5 M;  3CF6 E;  1J09 A;  1YSY A;  2DAM A;  4W5W A;  4GHL A;  2XEP A;  2Y20 A;  4LY6 A;  1QAM A;  2R18 A;  3U5Z B;  1Z6T A;  2UXC M;  1TDH A;  1IY2 A;  3KOW E;  2QCU A;  2RGH A;  3GLF A;  2QQ8 A;  2D7E A;  2JUJ A;  2X49 A;  3CF0 A;  3U6O A;  3SFZ A;  4B7H A;  5FTL A;  1RU3 A;  5KO3 A;  2KRU A;  2DKL A;  4IJF A;  3HKP A;  4GRI A;  3VK8 A;  4HL4 A;  4MGK E;  4JI1 M;  3VK7 A;  3J27 B;  1NJG A;  4LJ8 A;  4ZPX A;  2DVW B;  2KXE A;  3DOA A;  1IN7 A;  4I8O A;  2KDL A;  4Y28 F;  1I4W A;  2OOA A;  3GLI A;  4DV5 M;  2LNH C;  4GKJ M;  2DWM A;  2A5Y B;  2APL A;  3LVV A;  2L4E A;  1SXJ A;  1N75 A;  1DGB A;  1GL6 A;  3TPZ A;  1ORY B;  5KQD A;  2L7H A;  4P16 A;  1ZV1 A;  1IXS A;  2QNJ A;  3U61 A;  4PT5 A;  5FTM A;  1J5E M;  1IM2 A;  4QOZ C;  1NHW C;  2QBY A;  2B3T A;  1NNU C;  1V34 A;  5ITT A;  2DHY A;  1W5T A;  4D80 A;  2C9C A;  3BXW A;  2F5S A;  2D7H A;  4UN2 B;  1QZM A;  3EIH A;  1IN8 A;  3KOY E;  4AQY M;  1L1T A;  3ZCB B;  4NRW A;  3C9P A;  1OFI A;  2DHR A;  3V76 A;  3C58 A;  2V1U A;  3FD9 A;  5ITX E;  1XXH E;  4JI3 M;  2JNH A;  4CGY B;  5ITX A;  1XXH A;  3AOG A;  3B9P A;  4IBK A;  4JN6 A;  5ITQ A;  5IT9 S;  4GEW A;  3M7G A;  4DR4 M;  4CJ6 A;  2ZBK B;  3DFZ A;  3MHV C;  3VDP A;  3OTO M;  1HQC A;  4P17 A;  4JI4 M;  2YQZ A;  2JP7 A;  2XFT A;  1IBK M;  3HJ8 A;  3GRY A;  4M9X A;  3FKE A;  5KQ8 A;  2UU9 M;  3PNY A;  2XGN A;  1PJQ A;  4LFA M;  4DV0 M;  1IXR C;  2VQE M;  2CV2 A;  4Z8X A;  1EIJ A;  4LZZ A;  5DFL A;  4AKH A;  3I51 A;  2KNV A;  7CAT A;  2KZS A;  2XFS A;  3KW6 A;  2VII A;  4B08 A;  3CGW A;  4DV7 M;  4D81 A;  1DO2 A;  4G4Q A;  4LRS A;  2O01 F;  4REZ A;  1WGN A;  3A42 A;  4CIS A;  2G5G X;  3WHL A;  3GQ5 A;  3GO8 A;  4JI2 M;  3GLH E;  4MB7 A;  3W68 A;  3SAT A;  1G3I A;  5A2Q S;  3HX3 A;  4NSO B;  3HGI A;  1MJG M;  2DI0 A;  4JXJ A;  5EJC A;  4DR5 M;  1G41 A;  1OIZ A;  3U60 A;  3TWK A;  1HT2 E;  5EXP A;  5E6J A;  2CWB A;  3GP1 A;  2DNA A;  4GMQ A;  2H1R A;  1VEK A;  2QPA A;  4YY3 M;  1QDT A;  2DAK A;  2MGW A;  3SAU A;  1XMQ M;  3SAV A;  3GRV A;  3PNV A;  4TUW A;  1R5L A;  4IBF A;  3ZQJ A;  2DEN A;  2R4E A;  2XZU A;  3U6S A;  4WP2 A;  2BJW A;  3HJQ A;  5EXT A;  4LJA A;  4DUZ M;  1PGY A;  4G4O A;  1IBL M;  2CHG A;  2RGO A;  4PDG A;  4M9Z A;  3VLF B;  4LRT A;  4NRV A;  5IWA M;  2F5P A;  4L8R C;  4L4U A;  3K9O A;  2JZ1 A;  3RFW A;  3A98 B;  4WUR A;  1QDR A;  1N34 M;  2M5Z A;  2DZL A;  2O25 A;  2ZAN A;  3HU1 A;  4MGY E;  3UMM A;  1JR3 E;  1QUS A;  2JY6 B;  1JR3 A;  3U5Z A;  4GC5 A;  3TL4 X;  2LHG A;  3I04 M;  4II7 A;  2KEB A;  3FE3 A;  3PVS A;  3R9X B;  4ANR A;  4XGI A;  4L16 A;  1UM8 A;  4LF9 M;  1T3T A;  2LWX A;  2DAG A;  4F2L A;  3C3D A;  4AKI A;  3Q8X A;  3K8Z A;  3QWL A;  4LG2 A;  2X8A A;  3L27 A;  2LH0 A;  5ITU A;  2F5Q A;  4FCT A;  4LF8 M;  3HZJ A;  1D0L A;  2R62 A;  2C96 A;  1VDL A;  1WGL A;  2K0B X;  3EIE A;  3TE6 A;  2JWS A;  2L4F A;  2KNA A;  3GRR A; 
#chains in the Genus database with same CATH homology
 1DGG A;  4OX9 M;  3H4M A;  4GIT A;  2F4V M;  2Y0T A;  4AG5 A;  2R46 A;  1E32 A;  4RF1 A;  3AFH A;  4AW4 A;  3UGJ A;  2L6O A;  4XBO A;  4B7F A;  3KVW A;  4D82 A;  4OW0 A;  2Q2E B;  3GQ3 A;  4GKK M;  4GHA A;  2W82 A;  3RE8 A;  2FOI C;  4X62 M;  1KFV A;  2FNA A;  1SXJ E;  4I4L A;  2R45 A;  3THG A;  3U6L A;  4MM3 B;  2XLJ A;  1G4A E;  3JR5 A;  1DGH B;  2C98 A;  4JI7 M;  4NXM M;  2CEA A;  1L8Q A;  3PFI A;  3PXG A;  1S3S A;  4G4R A;  2J7O A;  3HJS A;  2KRK A;  1HR0 M;  1IN5 A;  4R7G A;  4LCB A;  4AG6 A;  2DXI A;  4B3T M;  4JI8 M;  3J81 S;  1XNQ M;  4HLQ A;  3J80 S;  3GPX A;  1N33 M;  1XMO M;  4KHP M;  1FNN A;  3SMP A;  1HNW M;  1HT1 E;  4G4N A;  3U6C A;  4B3M M;  4NOO B;  3GLG B;  2XZF A;  1N36 M;  3HHW A;  2XH9 A;  4MGZ E;  4LJ7 A;  3HU2 A;  1OJL A;  4DR1 M;  1TH2 A;  3L25 A;  3SHG B;  5E26 A;  4LF5 M;  1NHG C;  1QAO A;  4R3D A;  5FSW A;  1IBM M;  4B7G A;  1N78 A;  4DV1 M;  1R7R A;  1IY0 A;  3TWM A;  5EXX A;  3R8F A;  1D2N A;  1KYI A;  4FCV A;  3SYK A;  3L29 A;  3E4R A;  2HL7 A;  1L2D A;  2Z3X A;  1R2Y A;  3KDS E;  4RF0 A;  1NY5 A;  4B3S M;  3FTF A;  5IRE B;  2JA2 A;  5ITR A;  4QOS A;  5FTK A;  5JI2 E;  1K3X A;  1LV7 A;  3LVW A;  4DUY M;  3K1J A;  4NSR A;  4JI0 M;  1NSF A;  3IG5 A;  2KZU A;  4LF4 M;  2XF3 A;  4LZJ A;  4BB9 A;  4DV4 M;  1JQJ C;  4KO8 A;  2I7P A;  3SAS A;  4MH0 E;  5EQT A;  3GPP A;  5H37 D;  2QP9 X;  5GKN A;  1TDZ A;  1DO0 A;  3E9S A;  3LMM A;  1QVR A;  3I4V A;  3A45 A;  1QAQ A;  1QYR A;  2BNK A;  2HKJ A;  1Z5C A;  1TGU A;  3U6M A;  1J7K A;  3W0F A;  1NNJ A;  4LF7 M;  5EP1 A;  2J7N A;  4OVZ B;  2ZM6 M;  2Y21 A;  3FYD A;  4X66 M;  3AOE C;  1HNZ M;  4BLC A;  3SBJ A;  4LF6 M;  2CFO A;  2G8L A;  4Z6Y A;  5JI3 E;  5EP3 A;  3FTE A;  1NVM A;  4ITQ A;  1GLN A;  1YUB A;  5IZ7 D;  3WHK A;  4IBI A;  1PJJ A;  4IBG A;  3KSJ A;  4LGY A;  3SYL A;  2E5L M;  4AZF A;  3AJI B;  3SAW A;  1HQY E;  3J7A S;  3M6A A;  4L78 A;  3IG8 A;  5EP4 A;  1K82 A;  4AI6 A;  4JI6 M;  2Z7J A;  3UZU A;  1MU5 A;  2EO2 A;  3W0L B;  2F5N A;  1YE9 A;  3NWL A;  3FUU A;  4MGI E;  2R65 A;  4JYA M;  3GLH B;  4LGM A;  2OQ4 A;  5DYI A;  2HHH M;  3SAR A;  1DGH A;  3U6E A;  3U60 B;  4IBB A;  2DZO B;  4IBC A;  3GPU A;  1E94 E;  4IBJ A;  3JR4 A;  2UUA M;  2CHQ A;  1MX0 A;  1X37 A;  3DA1 A;  1E9R A;  2RKO A;  3ZH9 B;  4QNR A;  1WXQ A;  1L1Z A;  3U6D A;  3FYC A;  1IN4 A;  4FWD A;  5C1B A;  3GLG A;  4JI5 M;  2YFQ A;  2V1C A;  3L28 A;  4M9S A;  2BJV A;  3VDU A;  3T1Y M;  2AHM A;  3KOX E;  3CTW B;  4LJ5 A;  3RGP A;  2M60 A;  1Q3B A;  2OPF A;  1K3W A;  3TWL A;  4YHH M;  1SXJ C;  1W5S A;  4GIP A;  3ZC7 B;  4K0K M;  2EUC A;  5EXS A;  2QZ4 A;  3ILK A;  3D8B A;  3M0E A;  4FD2 A;  2FE8 A;  2F5O A;  4LJ6 A;  5FLX S;  5LMU M;  2UUC M;  3FUT A;  3FTC A;  3J2P B;  5EP2 A;  3VKH A;  1L2B A;  1XWI A;  2NQ8 C;  5C18 A;  3VFD A;  4AKG A;  3KFU G;  3FUV A;  4FWH A;  3GQ4 A;  1Z5A A;  2DWN A;  3U6Q A;  3KXE C;  1NJF A;  4S12 A;  3SMS A;  2FFJ A;  3SC3 A;  5LMN M;  2I7N A;  3KP0 E;  3FTD A;  1OFH A;  3CF2 A;  4LJ9 A;  1SXJ D;  3HU3 A;  3GPY A;  4QNM A;  5FTN A;  2Z4R A;  3T1H M;  3L26 A;  4L15 A;  1Q39 A;  1G59 A;  2X4A A;  4G6Z A;  3KSX A;  1TH3 A;  4M0W A;  2D7G A;  3GLF B;  1Z5B A;  3HHZ A;  4KLN A;  4LFC M;  4OVZ A;  3KS4 A;  3UJN A;  2QEN A;  4WW0 A;  1PJI A;  2CE7 A;  2R4J A;  2CUZ A;  3K2L A;  4NXN M;  5F3W A;  2CV0 A;  4DR7 M;  3GRU A;  3T38 A;  4X64 M;  1C1K A;  3GLI B;  2ZAM A;  3UK6 A;  4DR2 M;  2HCB A;  3FUW A;  1IQP A;  1G8P A;  1SXJ B;  4M0D A;  1GVN A;  3TQS A;  3HHX A;  2LXE A;  2L09 A;  1IXS B;  4EIW A;  1H6U A;  4IBE A;  3U61 B;  2DWL A;  4QHT A;  4NL4 H;  3KS8 A;  3QAU A;  1Z59 A;  2QBY B;  1XHB A;  8CAT A;  4DV2 M;  2YR0 A;  1N32 M;  3KOZ E;  2C5R A;  2C99 A;  4I5S A;  3I4Y A;  3JAM S;  3J7B A;  3U6P A;  1I94 M;  1R6B X;  5BPV A;  5DYG A;  2P5T A;  4PCZ A;  2ERC A;  4PD2 A;  4OU7 A;  1XXH B;  1ZQ9 A;  4A3V B;  4RNA A;  3GLH A;  3HHY A;  4IIW A;  4DR6 M;  3K92 A;  3DZD A;  1VDD A;  3BOS A;  3LQQ A;  1ZAE A;  3T15 A;  4I81 A;  1IXZ A;  2YNM D;  4X65 M;  2Y0Q A;  3FUX A;  4MGH A;  3AL0 C;  4GH9 A;  1N77 A;  2KW0 A;  3D8L A;  2Z4S A;  3NBI A;  4DV6 M;  4IJE A;  2CV1 A;  3AOE A;  5KPR A;  4FWG A;  4CHT B;  2DWZ B;  5KPZ A;  3AV0 A;  4BBA A;  2DZN B;  4FVM A;  1L2C A;  2L7I A;  4DV3 M;  2KA6 B;  4FCW A;  2VQF M;  5ITY A;  5DNY A;  4DR3 M;  1GL7 A;  1E9S A;  3AKZ A;  4FW9 A;  1IY1 A;  4QHS A;  1PM5 A;  3SHF A;  5BR8 M;  3A46 A;  1KSF X;  1R2Z A;  1JR3 D;  1XC8 A;  3MK6 A;  2UXD M;  3HWS A;  2ZAO A;  1GKI A;  2V6Z M;  5KPT A;  1XNR M;  3RGS A;  2K47 A;  4B3R M;  2UUB M;  1IN6 A;  1DGF A;  2XSZ A;  4KOD A;  1Q3C A;  3VKG A;  2CHV A;  3LQR A;  1QQW A;  2EA0 A;  2UXB M;  2C9O A;  2XSZ D;  3L2A A;  4LJ4 A;  3MJ5 A;  1TH4 A;  4LFB M;  4GC9 A;  4IBD A;  1FJG M;  1QAN A;  3KP1 E;  5FTJ A;  2O5R A;  1HNX M;  1NY6 A;  1EE8 A;  4JV5 M;  3CF6 E;  1J09 A;  1YSY A;  4GHL A;  4W5W A;  2XEP A;  2Y20 A;  4LY6 A;  1QAM A;  2R18 A;  3U5Z B;  1Z6T A;  2UXC M;  1TDH A;  1IY2 A;  3KOW E;  2QCU A;  2RGH A;  3GLF A;  2D7E A;  2X49 A;  3CF0 A;  3U6O A;  3SFZ A;  4B7H A;  5FTL A;  5KO3 A;  2KRU A;  4IJF A;  3HKP A;  4GRI A;  3VK8 A;  4HL4 A;  4MGK E;  4JI1 M;  3VK7 A;  3J27 B;  1NJG A;  4LJ8 A;  4ZPX A;  2DVW B;  2KXE A;  3DOA A;  1IN7 A;  4I8O A;  1I4W A;  3GLI A;  4DV5 M;  2LNH C;  4GKJ M;  2DWM A;  2A5Y B;  3LVV A;  1N75 A;  1DGB A;  1SXJ A;  3TPZ A;  1GL6 A;  1ORY B;  5KQD A;  2L7H A;  4P16 A;  3U61 A;  4PT5 A;  5FTM A;  1J5E M;  1IM2 A;  4QOZ C;  1NHW C;  2QBY A;  1NNU C;  5ITT A;  4D80 A;  1W5T A;  2C9C A;  2F5S A;  2D7H A;  4AQY M;  1QZM A;  3EIH A;  1IN8 A;  3KOY E;  1L1T A;  3ZCB B;  4NRW A;  1OFI A;  2DHR A;  3C58 A;  2V1U A;  3FD9 A;  5ITX E;  4JI3 M;  4CGY B;  5ITX A;  1XXH A;  3AOG A;  3B9P A;  4IBK A;  4JN6 A;  5ITQ A;  5IT9 S;  3M7G A;  4DR4 M;  2ZBK B;  3DFZ A;  3MHV C;  3VDP A;  3OTO M;  1HQC A;  4JI4 M;  2YQZ A;  2XFT A;  1IBK M;  3HJ8 A;  3GRY A;  4M9X A;  3FKE A;  5KQ8 A;  2UU9 M;  3PNY A;  2XGN A;  4LFA M;  4DV0 M;  1IXR C;  2VQE M;  2CV2 A;  4Z8X A;  4LZZ A;  4AKH A;  3I51 A;  7CAT A;  2KZS A;  2XFS A;  3KW6 A;  2VII A;  4B08 A;  4DV7 M;  4D81 A;  1DO2 A;  4G4Q A;  4LRS A;  4REZ A;  3A42 A;  4CIS A;  2G5G X;  3WHL A;  3GQ5 A;  3GO8 A;  4JI2 M;  4MB7 A;  3SAT A;  1G3I A;  5A2Q S;  4NSO B;  3HGI A;  4JXJ A;  5EJC A;  4DR5 M;  1G41 A;  3U60 A;  3TWK A;  1HT2 E;  5EXP A;  5E6J A;  3GP1 A;  4GMQ A;  2H1R A;  2QPA A;  4YY3 M;  3SAU A;  1XMQ M;  3SAV A;  3GRV A;  3PNV A;  4TUW A;  4IBF A;  2R4E A;  2XZU A;  3U6S A;  2BJW A;  3HJQ A;  5EXT A;  4LJA A;  4DUZ M;  4G4O A;  1IBL M;  2CHG A;  2RGO A;  4PDG A;  4M9Z A;  3VLF B;  4LRT A;  4NRV A;  5IWA M;  2F5P A;  4L8R C;  4L4U A;  3RFW A;  3A98 B;  4WUR A;  1N34 M;  2M5Z A;  3HU1 A;  2ZAN A;  4MGY E;  3UMM A;  1JR3 A;  3U5Z A;  4GC5 A;  3TL4 X;  4II7 A;  2KEB A;  3PVS A;  3R9X B;  4XGI A;  4L16 A;  1UM8 A;  4LF9 M;  1T3T A;  2LWX A;  4AKI A;  3Q8X A;  3K8Z A;  3QWL A;  4LG2 A;  2X8A A;  3L27 A;  2LH0 A;  5ITU A;  2F5Q A;  4FCT A;  4LF8 M;  2R62 A;  2C96 A;  3EIE A;  3TE6 A;  4PDI A;  3GRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...