2KZSA

Daxx helical bundle (dhb) domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Death-associated protein 6
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzsA00
2KZUA 2KZSA
chains in the Genus database with same CATH superfamily
3SC3A 4ZPXA 2WZJA 2UUCM 2BNKA 1Q3BA 1ZV1A 1DGBA 3MK6A 3KS4A 2OPFA 3MHVC 4DV6M 4K0KM 2F5PA 2FH0A 1OIZA 4QOZC 1WXQA 2XZFA 3KOXE 3U6CA 4AKGA 3HHXA 3KXEC 1L2DA 3K9OA 3KP1E 5FTKA 3B7QA 3OTOM 4IBCA 4GHLA 5EQTA 2DHRA 2EKKA 2R4JA 5JI2E 2D7HA 3A45A 2GQFA 2HWJA 4CGYB 3NBXX 3SFZA 4GH9A 3R9XB 3KFUG 4MGIE 1IN7A 4P16A 2M60A 3J80S 1QAQA 2LVNC 5ITYA 4DUZM 4DR6M 4BBAA 1Z6TA 2CRUA 1Q3CA 4KHPM 4OX9M 5EXTA 2CV0A 1TGUA 4KT0F 2KNAA 4IBEA 2M5ZA 4CIZA 2CFOA 4BB9A 4OVZB 3SAWA 5E6JA 1Q02A 3AV0A 4MB7A 1NV9A 4NOOB 3DA1A 1D0KA 4A3VB 3GPXA 2ZBKB 4FWHA 1G3IA 4G4RA 2JP7A 4M9XA 4DR5M 3TWKA 1J5EM 3IG8A 4Z6YA 4WURA 2CV2A 1SXJD 3L2AA 5GKNA 3GRRA 3M7GA 3UGJA 3GPUA 3A46A 2C99A 3U6SA 2UXCM 2H5XA 3RFWA 4MGHA 2BJWA 2R65A 4AG6A 3GPPA 3T6PA 1ORYB 1I4WA 3FUUA 2VQFM 1FNNA 3FTEA 4LFBM 2NQ8C 3GLIB 5A2QS 1I94M 4FCTA 1V33A 5IZ7D 3KOYE 1R2YA 4G6ZA 1YSYA 2K9DA 2R18A 1IY0A 2F5OA 4FWGA 4X65M 3GLHA 1R7RA 5KPRA 1IFYA 1VEGA 4LFAM 3WHKA 1IXRC 1VEJA 1YE9A 4IBDA 5F3WA 5C1BA 2DXIA 3MMPA 3AOEA 4IBFA 1PJQA 2V1UA 3I04M 1WR1B 1G71A 3T1YM 2LBCA 4HL4A 2QCUA 2W82A 4F1IA 2Y0TA 2C9CA 2L6OA 2QPAA 2XLJA 4IBJA 5E26A 2ERCA 3PXGA 1VG5A 2MROB 2Z3XA 3FTDA 5EXSA 1TR8A 1J7KA 1SXJA 5L8RF 3SYKA 2LNHC 1NHGC 1H6UA 3C9PA 3DOAA 1ZMVA 1WHCA 1D0MA 1F4IA 3U6DA 4LF6M 2JXNA 3AJIB 4PD2A 4LRSA 1Z59A 2V1CA 4NC6A 4REZA 2DAIA 3CTWB 1IBKM 2F5NA 3GRVA 1D0LA 3QAUA 3GLGB 1G41A 1YUBA 2EJSA 4W5WA 3U6MA 4B3MM 2YNMD 2KNVA 3AOEC 4LGYA 4DV3M 1C1KA 2UUAM 2K47A 2DI0A 4XK8F 4PDIA 4MGZE 2R44A 1QAMA 4PCZA 1QYRA 4I8OA 2EO2A 2O5RA 3T38A 3D8LA 3ZCBB 4LGMA 4RF0A 3K1JA 3SMPA 3HJSA 2C98A 3SYLA 2OQ4A 4KO8A 2DNAA 2CWBA 3I4VA 1Z5AA 3JR4A 1R4GA 3EIHA 5FTNA 2L2DA 5DYIA 3RGPA 1PM5A 3QYEA 3GRYA 2YQZA 4KLNA 3HY5A 3SBJA 3FTCA 2BWBA 1XC8A 2QQ8A 4LF8M 4TUWA 3IHPA 3WHLA 2CHQA 1PJJA 1Z5BA 2DENA 1MU5A 5DYGA 2F4VM 1N75A 4WW0A 1PJIA 1DV0A 2OOBA 3H4JA 4LJ7A 1T3TA 1K3XA 4LF7M 3LMMA 2QBYB 2Z8YM 1L1ZA 4JYAM 1MN3A 2JY5A 1TH3A 3BXWA 2VIIA 1NJFA 4OVZA 2MJ5B 3VFDA 1QVRA 5ITXE 1OFHA 3TPZA 4RF1A 3PVSA 2VF7A 1XNQM 3C3EA 1SG9A 2DAEA 2C5RA 1XNRM 1P3QQ 4GKKM 4XBOA 3FYCA 2R4EA 3CGWA 4IJEA 4D81A 3B7ZA 4EIWA 2K6BA 1XXHB 3GQ4A 4GIPA 3AL0C 1DO2A 1JB0F 3GLFA 3W68A 2DAGA 3I51A 2X49A 4DBGB 3GLIA 4DR2M 5EP1A 2KW0A 1TDHA 3FUXA 2DAKA 4DR1M 3QYBA 1DGHB 1ZMWA 2EUCA 2CHVA 4GEWA 4GITA 1QUTA 2HCBA 1W5SA 1OIPA 1IXZA 2R46A 5EP2A 5KQ8A 3LCVB 4B3TM 3HGIA 2E5LM 3L25A 2DWLA 3V76A 4LZJA 5KO3A 3SHGB 1VQ1A 4B7FA 2L7HA 2EKFA 3J27B 3C58A 3HU1A 4YY3M 2ZTCA 4LF5M 4R71A 1HQCA 3E9SA 2FFJA 4LJ8A 1L2BA 1OAIA 1PJSA 1VEKA 3FTFA 1KSFX 3DFZA 2FNAA 3Q8XA 3K92A 4IBBA 1TH2A 2F5SA 5C18A 4PDGA 1QUSA 3NBIA 4M0DA 4NXNM 3T15A 4GKJM 4GC5A 2JY8A 5EXXA 2XFTA 3HJ8A 5KPTA 1KYIA 2DZLA 5ITTA 3SAUA 3GLGA 1IXSB 2ZAMA 4CJ6A 3W0FA 1NHWC 1GLNA 2UU9M 3HU3A 4QHTA 3SHFA 3IECA 3KDSE 2MH8A 4IIWA 4JI0M 2QP9X 3LW5F 2QSFX 2ZM6M 1NO1A 2KZSA 2KNZA 2Y0QA 3H4MA 2CUZA 3KVWA 3RE8A 5H37D 3IG5A 3E46A 2Z4RA 4DV1M 1XMOM 1OTRA 3GLHE 4GRIA 3GO8A 3LQRA 2Y21A 2MGWA 2O01F 2R62A 4QNMA 3AKZA 2A5YB 3SMSA 2LVAA 3UZUA 2KDLA 2VF8A 3TL4X 3KW6A 5KPZA 4L6V6 1S3SA 3SATA 3J2PB 1IN8A 4AQYM 1N32M 2O25A 3PNYA 2JWSA 3HHYA 1SXJE 2DWZB 1NSFA 3FRIA 3B9PA 1IY1A 4P17A 4DV2M 2DWNA 3VKHA 2JY6B 2APLA 1MJGM 5EP3A 2L4FA 2QBYA 1XMQM 3FUVA 4DR3M 2HHHM 4MM3B 2ZANA 4DV5M 2OOAA 1E9RA 3LQQA 1NVMA 4I81A 3KOZE 4GC9A 4X64M 1C7YA 3KSXA 1UM8A 1JQJC 2KXEA 3JAMS 2MR9A 2EA0A 3QWLA 3VK7A 1T43A 1R6BX 2G8LA 3HHWA 5FTJA 3VDUA 1GJTA 1IY2A 3F92A 3LVWA 1XXHA 1GO5A 2J7OA 3B74A 3L29A 5EP4A 1LV7A 1DGFA 2J5YA 1N78A 3FUWA 1SXJC 4F2LA 5FSWA 1MX0A 3K8ZA 1G4AE 2K0BX 3PNVA 1HJPA 2D7GA 4I5SA 4LF4M 5IREB 1N36M 1GABA 5EJCA 2LH0A 1OKSA 2LVQD 2QZ4A 4IBIA 1GKIA 2DVWB 3D8BA 1HNXM 2GNOA 5JI3E 2ZAOA 2JZ0A 1PRBA 2OO9A 4CHTB 4JI3M 3FD9A 1X37A 4I4LA 3E21A 2WSCF 3GQ5A 3CF2A 1AIPC 3VK8A 2XSZD 3B89A 5ITUA 3RGSA 3TWLA 3R8FA 4G4OA 5KQDA 1VDDA 3FUTA 4II7A 4D80A 5BPVA 2BWEA 4LY6A 3U5ZB 3L26A 3HHZA 2KA6B 4L78A 1L2CA 3KP0E 4B7HA 2FE8A 2I7NA 2JNHA 3M6AA 1JR3D 2XZUA 4LF9M 3BOSA 1KFVA 3U61B 3GPYA 1NJGA 2DHYA 4LJ5A 4OW0A 4IBKA 1IXSA 2L4EA 4R7GA 4ANRA 2L7IA 3KSJA 3L27A 4LG2A 3AOGA 5EXPA 3TE6A 1ZQ9A 3I4YA 3GQ3A 2CHGA 2CE7A 3DZDA 1XWIA 3GLFE 1VDLA 3FYDA 3PFIA 2BJVA 3GLIE 1PJTA 4LFCM 4XGIA 1AUAA 2JZ1A 2HAKA 1K82A 2JUJA 2HKJA 4HLQA 3CF6E 1HNWM 2LWXA 3W0LB 1BVSA 2UUBM 4S12A 4DV4M 4B3SM 4JI5M 1IBMM 3CF0A 1GJSA 8CATA 2DZNB 5DNYA 1JR3A 2CP8A 2KZUA 1IM2A 2VQEM 3HKPA 3U6QA 4MGYE 2H1RA 4G4NA 4B7GA 4M9SA 1HNZM 1QANA 3M0EA 1DO0A 2DWMA 4JI8M 3L28A 1V92A 3ILKA 4NSRA 4NRVA 2F5QA 1OQYA 3FRHA 1Q39A 2WSFF 1V34A 1NNJA 4LCBA 2DZOB 2LVOC 4MH0E 3ZH9B 1TTEA 1N34M 4JI6M 3VDPA 1NY6A 1QDTA 4JXJA 2XFSA 2KRUA 4LRTA 3FKEA 4B08A 1UFZA 1E9SA 1HQYE 2J7NA 3W67A 3GLGE 3VLFB 1IQPA 2WSEF 4JI1M 2R0IA 1XB2B 2QENA 1IN5A 1NY5A 2VDBB 2DAMA 3J7BA 4FWDA 4PT5A 2XEPA 2YFQA 4AKHA 3K9PA 5FLXS 2UXBM 2R6FA 4DV7M 2N35A 2C96A 3HWSA 2R45A 4RNAA 1R5LA 1N33M 3U6LA 3U6PA 1HT1E 1Z5CA 3U60B 2UXDM 2XGNA 2G3QA 3THGA 1DGGA 4M9ZA 4B3RM 4Y28F 1WJ7A 2QHOB 1GL6A 2KHHA 1IBLM 1GL7A 3T1HM 3HU2A 4KODA 2YR0A 3A98B 3MJ5A 5DFLA 5LMUM 4AZFA 2QNJA 3SARA 4LJ4A 1K3WA 4IBGA 2JY7A 4GMQA 7CATA 1R2ZA 4L8RC 2Z7JA 3GLFB 1NNUC 3KOWE 3U5ZA 3B7NA 3HX3A 5IT9S 1T6OA 1WGLA 5ITQA 1NV8A 2X4AA 2RKOA 3K2LA 1EE8A 4L15A 1QAOA 1OJLA 3UK6A 3U61A 4DR7M 4OU7A 1PGYA 2RGHA 2L09A 4QOSA 3TQSA 5BR8M 4HEOA 3TWMA 4M0WA 4WP2A 4NSOB 2V6ZM 4DUYM 1TF0B 2XH9A 3I01M 4G4QA 2Q2EB 2CEAA 5LMNM 4AKIA 1XXHE 4FCVA 3U6OA 5IWAM 2Y20A 3VKGA 1LTMA 1WIVA 4X66M 1IN4A 4QNRA 4R3DA 1J09A 2HL7A 1N77A 1FJGM 4NL4H 3KS8A 1L1TA 2AHMA 5FTLA 1IN6A 2B3TA 1GVNA 3GRUA 4Q7JA 1HR0M 3NWLA 2FOIC 1DGHA 4LZZA 4AW4A 1RU3A 3U6EA 3EIEA 1ZMUA 3A42A 3LCUA 4L16A 4X62M 3UJNA 2LTUA 4Z8XA 1QZMA 3LVVA 1Y8GA 4NRWA 4DV0M 3J81S 1TH4A 3HZJA 4GHAA 1EFUB 1QZEA 2C9OA 2LXEA 3JR5A 2P5TA 2RRUA 4AG5A 4IJFA 2LVPC 4YHHM 1E94E 4UN2B 2JA2A 2LHGA 4FVMA 2Z4SA 1G59A 3AFHA 2FS1A 3SAVA 3UMMA 2CV1A 3BBZA 2D7EA 3C3DA 4FCWA 4D82A 3SASA 3ZQJA 1HT2E 3GLHB 1OFIA 1W5TA 3J7AS 4JV5M 1OAOC 4CISA 4FD2A 4JN6A 1TDZA 4DR4M 1CUKA 1L8QA 1XHBA 1D2NA 2G5GX 3FE3A 4G3OA 3ZC7B 5ITRA 1YLAA 4RKUF 1QQWA 2KEBA 1QDRA 2I7PA 5FTMA 2ZTDA 3U60A 4JI2M 4ITQA 3HJQA 1SXJB 2XF3A 4JI7M 2KRKA 1EIJA 4JI4M 1ZAEA 2X8AA 2XSZA 3Q8GA 1WGNA 4LJ6A 2RGOA 4LJAA 4BLCA 4QHSA 5ITXA 4FW9A 3E4RA 2LHCA 1E32A 4L4UA 4LJ9A 4NXMM 4AI6A 4MGKE 1G8PA 3GP1A 1A5TA 1JR3E 2DKLA
chains in the Genus database with same CATH topology
3SC3A 4ZPXA 2UUCM 2BNKA 1Q3BA 1DGBA 3MK6A 3KS4A 2OPFA 3MHVC 4DV6M 4K0KM 2F5PA 4QOZC 1WXQA 2XZFA 3KOXE 3U6CA 4AKGA 3HHXA 3KXEC 1L2DA 3KP1E 3OTOM 4IBCA 4GHLA 5EQTA 2DHRA 2R4JA 5JI2E 2D7HA 3A45A 4CGYB 3SFZA 4GH9A 3R9XB 3KFUG 4MGIE 1IN7A 4P16A 2M60A 3J80S 1QAQA 5ITYA 4DUZM 4DR6M 4BBAA 1Z6TA 1Q3CA 4KHPM 4OX9M 5EXTA 2CV0A 1TGUA 4IBEA 2M5ZA 2CFOA 4BB9A 4OVZB 3SAWA 5E6JA 3AV0A 4MB7A 4NOOB 3DA1A 4A3VB 3GPXA 2ZBKB 4FWHA 1G3IA 4G4RA 4M9XA 4DR5M 3TWKA 1J5EM 3IG8A 4Z6YA 4WURA 2CV2A 1SXJD 3L2AA 5GKNA 3GRRA 3M7GA 3UGJA 3GPUA 3A46A 2C99A 3U6SA 2UXCM 3RFWA 4MGHA 2BJWA 2R65A 4AG6A 3GPPA 1ORYB 1I4WA 3FUUA 2VQFM 1FNNA 3FTEA 4LFBM 2NQ8C 3GLIB 5A2QS 1I94M 4FCTA 5IZ7D 1R2YA 3KOYE 4G6ZA 1YSYA 2R18A 1IY0A 2F5OA 4FWGA 4X65M 3GLHA 1R7RA 5KPRA 4LFAM 3WHKA 1IXRC 1YE9A 4IBDA 5F3WA 5C1BA 2DXIA 3AOEA 4IBFA 2V1UA 3T1YM 4HL4A 2QCUA 2W82A 2Y0TA 2C9CA 2L6OA 2QPAA 2XLJA 4IBJA 5E26A 2ERCA 3PXGA 2Z3XA 3FTDA 5EXSA 1J7KA 1SXJA 3SYKA 2LNHC 1NHGC 1H6UA 3DOAA 3U6DA 4LF6M 3AJIB 4PD2A 4LRSA 1Z59A 2V1CA 4REZA 3CTWB 1IBKM 2F5NA 3GRVA 3QAUA 3GLGB 1G41A 1YUBA 4W5WA 4B3MM 3U6MA 2YNMD 3AOEC 4LGYA 4DV3M 1C1KA 2UUAM 2K47A 4PDIA 4MGZE 1QAMA 4PCZA 1QYRA 4I8OA 2EO2A 2O5RA 3T38A 3D8LA 3ZCBB 4LGMA 4RF0A 3K1JA 3SMPA 3HJSA 2C98A 3SYLA 2OQ4A 4KO8A 3I4VA 1Z5AA 3JR4A 3EIHA 5FTNA 5DYIA 3RGPA 1PM5A 3SBJA 3GRYA 2YQZA 4KLNA 1XC8A 4LF8M 3FTCA 4TUWA 3WHLA 2CHQA 1Z5BA 5DYGA 1MU5A 2F4VM 1N75A 4WW0A 1PJIA 4LJ7A 1T3TA 1K3XA 4LF7M 3LMMA 2QBYB 1L1ZA 4JYAM 1TH3A 4OVZA 2VIIA 1NJFA 3VFDA 1QVRA 5ITXE 1OFHA 3TPZA 4RF1A 3PVSA 1XNQM 1XNRM 2C5RA 4GKKM 4XBOA 3FYCA 2R4EA 4IJEA 4D81A 4EIWA 1XXHB 3GQ4A 4GIPA 3AL0C 1DO2A 3GLFA 3I51A 2X49A 3GLIA 4DR2M 5EP1A 2KW0A 1TDHA 3FUXA 4DR1M 1DGHB 2EUCA 2CHVA 4GITA 2HCBA 1W5SA 2R46A 1IXZA 5EP2A 3L25A 5KQ8A 4B3TM 3HGIA 2E5LM 2DWLA 4LZJA 5KO3A 3SHGB 4B7FA 2L7HA 3J27B 3C58A 3HU1A 4YY3M 4LF5M 1HQCA 3E9SA 2FFJA 4LJ8A 1L2BA 3FTFA 1KSFX 3DFZA 2FNAA 3Q8XA 3K92A 4IBBA 1TH2A 2F5SA 5C18A 4PDGA 3NBIA 4M0DA 4NXNM 3T15A 4GKJM 4GC5A 5EXXA 2XFTA 3HJ8A 5KPTA 1KYIA 5ITTA 3SAUA 3GLGA 1IXSB 2ZAMA 3W0FA 1NHWC 1GLNA 2UU9M 3HU3A 4QHTA 3SHFA 3KDSE 4IIWA 4JI0M 2QP9X 2ZM6M 2KZSA 2Y0QA 3H4MA 2CUZA 3KVWA 3RE8A 5H37D 3IG5A 4DV1M 2Z4RA 1XMOM 4GRIA 3GO8A 3LQRA 2Y21A 3AKZA 2R62A 4QNMA 2A5YB 3SMSA 3UZUA 3TL4X 3KW6A 5KPZA 3SATA 1S3SA 3J2PB 1IN8A 4AQYM 1N32M 3PNYA 3HHYA 1SXJE 2DWZB 1NSFA 2DWNA 3B9PA 1IY1A 3VKHA 4DV2M 2QBYA 5EP3A 1XMQM 3FUVA 4DR3M 2HHHM 4MM3B 2ZANA 4DV5M 3LQQA 1E9RA 1NVMA 4I81A 3KOZE 4GC9A 4X64M 3KSXA 1UM8A 1JQJC 2KXEA 3JAMS 2EA0A 3QWLA 3VK7A 1R6BX 2G8LA 3HHWA 5FTJA 3VDUA 1IY2A 3LVWA 1XXHA 2J7OA 3L29A 5EP4A 1LV7A 1DGFA 1N78A 3FUWA 1SXJC 5FSWA 1MX0A 3K8ZA 1G4AE 3PNVA 4I5SA 2D7GA 4LF4M 5IREB 1N36M 5EJCA 2LH0A 2QZ4A 4IBIA 1GKIA 2DVWB 3D8BA 1HNXM 5JI3E 2ZAOA 4CHTB 4JI3M 3FD9A 1X37A 4I4LA 3GQ5A 3CF2A 3VK8A 2XSZD 5ITUA 3RGSA 3TWLA 3R8FA 4G4OA 5KQDA 1VDDA 3FUTA 4II7A 4D80A 5BPVA 4LY6A 3U5ZB 3L26A 3HHZA 2KA6B 4L78A 1L2CA 3KP0E 4B7HA 2FE8A 2I7NA 3M6AA 1JR3D 2XZUA 4LF9M 3BOSA 1KFVA 3U61B 3GPYA 1NJGA 4LJ5A 4OW0A 4IBKA 4R7GA 2L7IA 3KSJA 3L27A 4LG2A 3AOGA 5EXPA 3TE6A 1ZQ9A 3I4YA 3GQ3A 2CHGA 2CE7A 3DZDA 1XWIA 3FYDA 3PFIA 2BJVA 4LFCM 4XGIA 1K82A 2HKJA 4HLQA 3CF6E 1HNWM 2LWXA 3W0LB 2UUBM 4S12A 4DV4M 4B3SM 4JI5M 1IBMM 3CF0A 8CATA 2DZNB 5DNYA 1JR3A 2KZUA 1IM2A 2VQEM 3HKPA 3U6QA 4MGYE 2H1RA 4G4NA 4B7GA 4M9SA 1HNZM 1QANA 3M0EA 1DO0A 2DWMA 4JI8M 3L28A 3ILKA 4NSRA 4NRVA 2F5QA 1Q39A 1NNJA 4LCBA 2DZOB 4MH0E 3ZH9B 1N34M 4JI6M 3VDPA 1NY6A 4JXJA 2XFSA 2KRUA 4LRTA 3FKEA 4B08A 1E9SA 1HQYE 2J7NA 3VLFB 1IQPA 4JI1M 2QENA 1IN5A 1NY5A 3J7BA 4FWDA 5FTKA 4PT5A 2XEPA 2YFQA 4AKHA 2UXBM 5FLXS 4DV7M 2C96A 3HWSA 2R45A 4RNAA 1N33M 3U6LA 3U6PA 1HT1E 1Z5CA 3U60B 2UXDM 2XGNA 3THGA 1DGGA 4M9ZA 4B3RM 1GL6A 1IBLM 1GL7A 3T1HM 3HU2A 4KODA 2YR0A 3A98B 3MJ5A 5LMUM 4AZFA 3SARA 4LJ4A 1K3WA 4IBGA 4GMQA 7CATA 1R2ZA 4L8RC 2Z7JA 3GLFB 1NNUC 3KOWE 3U5ZA 5IT9S 5ITQA 2X4AA 2RKOA 3K2LA 1EE8A 4L15A 1QAOA 1OJLA 3UK6A 3U61A 4DR7M 4OU7A 2RGHA 2L09A 4QOSA 3TQSA 5BR8M 3TWMA 4M0WA 4NSOB 2V6ZM 4DUYM 2XH9A 4G4QA 2Q2EB 2CEAA 5LMNM 4AKIA 4FCVA 3U6OA 5IWAM 2Y20A 3VKGA 4X66M 1IN4A 4QNRA 4R3DA 1J09A 2HL7A 1N77A 1FJGM 4NL4H 3KS8A 1L1TA 2AHMA 5FTLA 1IN6A 1GVNA 3GRUA 1HR0M 3NWLA 2FOIC 1DGHA 4LZZA 4AW4A 3U6EA 3EIEA 3A42A 4L16A 4X62M 3UJNA 4Z8XA 1QZMA 3LVVA 4NRWA 4DV0M 3J81S 1TH4A 4GHAA 2C9OA 2LXEA 3JR5A 2P5TA 4AG5A 4IJFA 4YHHM 1E94E 2JA2A 4FVMA 2Z4SA 1G59A 3AFHA 3SAVA 3UMMA 2CV1A 2D7EA 4FCWA 4D82A 3SASA 1HT2E 3GLHB 1OFIA 1W5TA 3J7AS 4JV5M 4CISA 4FD2A 4JN6A 1TDZA 4DR4M 1L8QA 1XHBA 1D2NA 2G5GX 5ITRA 3ZC7B 1QQWA 2KEBA 4JI2M 2I7PA 5FTMA 3U60A 4ITQA 3HJQA 1SXJB 2XF3A 4JI7M 2KRKA 4JI4M 1ZAEA 2X8AA 2XSZA 4LJ6A 2RGOA 4LJAA 4BLCA 4QHSA 5ITXA 4FW9A 3E4RA 1E32A 4L4UA 4LJ9A 4NXMM 4AI6A 4MGKE 1G8PA 3GP1A 1PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZU A;  2KZS A; 
#chains in the Genus database with same CATH topology
 3SC3 A;  4ZPX A;  2WZJ A;  2UUC M;  2BNK A;  1Q3B A;  1ZV1 A;  1DGB A;  3MK6 A;  3KS4 A;  2OPF A;  3MHV C;  4DV6 M;  4K0K M;  2F5P A;  2FH0 A;  1OIZ A;  4QOZ C;  1WXQ A;  2XZF A;  3KOX E;  3U6C A;  4AKG A;  3HHX A;  3KXE C;  1L2D A;  3K9O A;  3KP1 E;  5FTK A;  3B7Q A;  3OTO M;  4IBC A;  4GHL A;  5EQT A;  2DHR A;  2EKK A;  2R4J A;  5JI2 E;  2D7H A;  3A45 A;  2GQF A;  2HWJ A;  4CGY B;  3NBX X;  3SFZ A;  4GH9 A;  3R9X B;  3KFU G;  4MGI E;  1IN7 A;  4P16 A;  2M60 A;  3J80 S;  1QAQ A;  2LVN C;  5ITY A;  4DUZ M;  4DR6 M;  4BBA A;  1Z6T A;  2CRU A;  1Q3C A;  4KHP M;  4OX9 M;  5EXT A;  2CV0 A;  1TGU A;  4KT0 F;  2KNA A;  4IBE A;  2M5Z A;  4CIZ A;  2CFO A;  4BB9 A;  4OVZ B;  3SAW A;  5E6J A;  1Q02 A;  3AV0 A;  4MB7 A;  1NV9 A;  4NOO B;  3DA1 A;  1D0K A;  4A3V B;  3GPX A;  2ZBK B;  4FWH A;  1G3I A;  4G4R A;  2JP7 A;  4M9X A;  4DR5 M;  3TWK A;  1J5E M;  3IG8 A;  4Z6Y A;  4WUR A;  2CV2 A;  1SXJ D;  3L2A A;  5GKN A;  3GRR A;  3M7G A;  3UGJ A;  3GPU A;  3A46 A;  2C99 A;  3U6S A;  2UXC M;  2H5X A;  3RFW A;  4MGH A;  2BJW A;  2R65 A;  4AG6 A;  3GPP A;  3T6P A;  1ORY B;  1I4W A;  3FUU A;  2VQF M;  1FNN A;  3FTE A;  4LFB M;  2NQ8 C;  3GLI B;  5A2Q S;  1I94 M;  4FCT A;  1V33 A;  5IZ7 D;  3KOY E;  1R2Y A;  4G6Z A;  1YSY A;  2K9D A;  2R18 A;  1IY0 A;  2F5O A;  4FWG A;  4X65 M;  3GLH A;  1R7R A;  5KPR A;  1IFY A;  1VEG A;  4LFA M;  3WHK A;  1IXR C;  1VEJ A;  1YE9 A;  4IBD A;  5F3W A;  5C1B A;  2DXI A;  3MMP A;  3AOE A;  4IBF A;  1PJQ A;  2V1U A;  3I04 M;  1WR1 B;  1G71 A;  3T1Y M;  2LBC A;  4HL4 A;  2QCU A;  2W82 A;  4F1I A;  2Y0T A;  2C9C A;  2L6O A;  2QPA A;  2XLJ A;  4IBJ A;  5E26 A;  2ERC A;  3PXG A;  1VG5 A;  2MRO B;  2Z3X A;  3FTD A;  5EXS A;  1TR8 A;  1J7K A;  1SXJ A;  5L8R F;  3SYK A;  2LNH C;  1NHG C;  1H6U A;  3C9P A;  3DOA A;  1ZMV A;  1WHC A;  1D0M A;  1F4I A;  3U6D A;  4LF6 M;  2JXN A;  3AJI B;  4PD2 A;  4LRS A;  1Z59 A;  2V1C A;  4NC6 A;  4REZ A;  2DAI A;  3CTW B;  1IBK M;  2F5N A;  3GRV A;  1D0L A;  3QAU A;  3GLG B;  1G41 A;  1YUB A;  2EJS A;  4W5W A;  3U6M A;  4B3M M;  2YNM D;  2KNV A;  3AOE C;  4LGY A;  4DV3 M;  1C1K A;  2UUA M;  2K47 A;  2DI0 A;  4XK8 F;  4PDI A;  4MGZ E;  2R44 A;  1QAM A;  4PCZ A;  1QYR A;  4I8O A;  2EO2 A;  2O5R A;  3T38 A;  3D8L A;  3ZCB B;  4LGM A;  4RF0 A;  3K1J A;  3SMP A;  3HJS A;  2C98 A;  3SYL A;  2OQ4 A;  4KO8 A;  2DNA A;  2CWB A;  3I4V A;  1Z5A A;  3JR4 A;  1R4G A;  3EIH A;  5FTN A;  2L2D A;  5DYI A;  3RGP A;  1PM5 A;  3QYE A;  3GRY A;  2YQZ A;  4KLN A;  3HY5 A;  3SBJ A;  3FTC A;  2BWB A;  1XC8 A;  2QQ8 A;  4LF8 M;  4TUW A;  3IHP A;  3WHL A;  2CHQ A;  1PJJ A;  1Z5B A;  2DEN A;  1MU5 A;  5DYG A;  2F4V M;  1N75 A;  4WW0 A;  1PJI A;  1DV0 A;  2OOB A;  3H4J A;  4LJ7 A;  1T3T A;  1K3X A;  4LF7 M;  3LMM A;  2QBY B;  2Z8Y M;  1L1Z A;  4JYA M;  1MN3 A;  2JY5 A;  1TH3 A;  3BXW A;  2VII A;  1NJF A;  4OVZ A;  2MJ5 B;  3VFD A;  1QVR A;  5ITX E;  1OFH A;  3TPZ A;  4RF1 A;  3PVS A;  2VF7 A;  1XNQ M;  3C3E A;  1SG9 A;  2DAE A;  2C5R A;  1XNR M;  1P3Q Q;  4GKK M;  4XBO A;  3FYC A;  2R4E A;  3CGW A;  4IJE A;  4D81 A;  3B7Z A;  4EIW A;  2K6B A;  1XXH B;  3GQ4 A;  4GIP A;  3AL0 C;  1DO2 A;  1JB0 F;  3GLF A;  3W68 A;  2DAG A;  3I51 A;  2X49 A;  4DBG B;  3GLI A;  4DR2 M;  5EP1 A;  2KW0 A;  1TDH A;  3FUX A;  2DAK A;  4DR1 M;  3QYB A;  1DGH B;  1ZMW A;  2EUC A;  2CHV A;  4GEW A;  4GIT A;  1QUT A;  2HCB A;  1W5S A;  1OIP A;  1IXZ A;  2R46 A;  5EP2 A;  5KQ8 A;  3LCV B;  4B3T M;  3HGI A;  2E5L M;  3L25 A;  2DWL A;  3V76 A;  4LZJ A;  5KO3 A;  3SHG B;  1VQ1 A;  4B7F A;  2L7H A;  2EKF A;  3J27 B;  3C58 A;  3HU1 A;  4YY3 M;  2ZTC A;  4LF5 M;  4R71 A;  1HQC A;  3E9S A;  2FFJ A;  4LJ8 A;  1L2B A;  1OAI A;  1PJS A;  1VEK A;  3FTF A;  1KSF X;  3DFZ A;  2FNA A;  3Q8X A;  3K92 A;  4IBB A;  1TH2 A;  2F5S A;  5C18 A;  4PDG A;  1QUS A;  3NBI A;  4M0D A;  4NXN M;  3T15 A;  4GKJ M;  4GC5 A;  2JY8 A;  5EXX A;  2XFT A;  3HJ8 A;  5KPT A;  1KYI A;  2DZL A;  5ITT A;  3SAU A;  3GLG A;  1IXS B;  2ZAM A;  4CJ6 A;  3W0F A;  1NHW C;  1GLN A;  2UU9 M;  3HU3 A;  4QHT A;  3SHF A;  3IEC A;  3KDS E;  2MH8 A;  4IIW A;  4JI0 M;  2QP9 X;  3LW5 F;  2QSF X;  2ZM6 M;  1NO1 A;  2KZS A;  2KNZ A;  2Y0Q A;  3H4M A;  2CUZ A;  3KVW A;  3RE8 A;  5H37 D;  3IG5 A;  3E46 A;  2Z4R A;  4DV1 M;  1XMO M;  1OTR A;  3GLH E;  4GRI A;  3GO8 A;  3LQR A;  2Y21 A;  2MGW A;  2O01 F;  2R62 A;  4QNM A;  3AKZ A;  2A5Y B;  3SMS A;  2LVA A;  3UZU A;  2KDL A;  2VF8 A;  3TL4 X;  3KW6 A;  5KPZ A;  4L6V 6;  1S3S A;  3SAT A;  3J2P B;  1IN8 A;  4AQY M;  1N32 M;  2O25 A;  3PNY A;  2JWS A;  3HHY A;  1SXJ E;  2DWZ B;  1NSF A;  3FRI A;  3B9P A;  1IY1 A;  4P17 A;  4DV2 M;  2DWN A;  3VKH A;  2JY6 B;  2APL A;  1MJG M;  5EP3 A;  2L4F A;  2QBY A;  1XMQ M;  3FUV A;  4DR3 M;  2HHH M;  4MM3 B;  2ZAN A;  4DV5 M;  2OOA A;  1E9R A;  3LQQ A;  1NVM A;  4I81 A;  3KOZ E;  4GC9 A;  4X64 M;  1C7Y A;  3KSX A;  1UM8 A;  1JQJ C;  2KXE A;  3JAM S;  2MR9 A;  2EA0 A;  3QWL A;  3VK7 A;  1T43 A;  1R6B X;  2G8L A;  3HHW A;  5FTJ A;  3VDU A;  1GJT A;  1IY2 A;  3F92 A;  3LVW A;  1XXH A;  1GO5 A;  2J7O A;  3B74 A;  3L29 A;  5EP4 A;  1LV7 A;  1DGF A;  2J5Y A;  1N78 A;  3FUW A;  1SXJ C;  4F2L A;  5FSW A;  1MX0 A;  3K8Z A;  1G4A E;  2K0B X;  3PNV A;  1HJP A;  2D7G A;  4I5S A;  4LF4 M;  5IRE B;  1N36 M;  1GAB A;  5EJC A;  2LH0 A;  1OKS A;  2LVQ D;  2QZ4 A;  4IBI A;  1GKI A;  2DVW B;  3D8B A;  1HNX M;  2GNO A;  5JI3 E;  2ZAO A;  2JZ0 A;  1PRB A;  2OO9 A;  4CHT B;  4JI3 M;  3FD9 A;  1X37 A;  4I4L A;  3E21 A;  2WSC F;  3GQ5 A;  3CF2 A;  1AIP C;  3VK8 A;  2XSZ D;  3B89 A;  5ITU A;  3RGS A;  3TWL A;  3R8F A;  4G4O A;  5KQD A;  1VDD A;  3FUT A;  4II7 A;  4D80 A;  5BPV A;  2BWE A;  4LY6 A;  3U5Z B;  3L26 A;  3HHZ A;  2KA6 B;  4L78 A;  1L2C A;  3KP0 E;  4B7H A;  2FE8 A;  2I7N A;  2JNH A;  3M6A A;  1JR3 D;  2XZU A;  4LF9 M;  3BOS A;  1KFV A;  3U61 B;  3GPY A;  1NJG A;  2DHY A;  4LJ5 A;  4OW0 A;  4IBK A;  1IXS A;  2L4E A;  4R7G A;  4ANR A;  2L7I A;  3KSJ A;  3L27 A;  4LG2 A;  3AOG A;  5EXP A;  3TE6 A;  1ZQ9 A;  3I4Y A;  3GQ3 A;  2CHG A;  2CE7 A;  3DZD A;  1XWI A;  3GLF E;  1VDL A;  3FYD A;  3PFI A;  2BJV A;  3GLI E;  1PJT A;  4LFC M;  4XGI A;  1AUA A;  2JZ1 A;  2HAK A;  1K82 A;  2JUJ A;  2HKJ A;  4HLQ A;  3CF6 E;  1HNW M;  2LWX A;  3W0L B;  1BVS A;  2UUB M;  4S12 A;  4DV4 M;  4B3S M;  4JI5 M;  1IBM M;  3CF0 A;  1GJS A;  8CAT A;  2DZN B;  5DNY A;  1JR3 A;  2CP8 A;  2KZU A;  1IM2 A;  2VQE M;  3HKP A;  3U6Q A;  4MGY E;  2H1R A;  4G4N A;  4B7G A;  4M9S A;  1HNZ M;  1QAN A;  3M0E A;  1DO0 A;  2DWM A;  4JI8 M;  3L28 A;  1V92 A;  3ILK A;  4NSR A;  4NRV A;  2F5Q A;  1OQY A;  3FRH A;  1Q39 A;  2WSF F;  1V34 A;  1NNJ A;  4LCB A;  2DZO B;  2LVO C;  4MH0 E;  3ZH9 B;  1TTE A;  1N34 M;  4JI6 M;  3VDP A;  1NY6 A;  1QDT A;  4JXJ A;  2XFS A;  2KRU A;  4LRT A;  3FKE A;  4B08 A;  1UFZ A;  1E9S A;  1HQY E;  2J7N A;  3W67 A;  3GLG E;  3VLF B;  1IQP A;  2WSE F;  4JI1 M;  2R0I A;  1XB2 B;  2QEN A;  1IN5 A;  1NY5 A;  2VDB B;  2DAM A;  3J7B A;  4FWD A;  4PT5 A;  2XEP A;  2YFQ A;  4AKH A;  3K9P A;  5FLX S;  2UXB M;  2R6F A;  4DV7 M;  2N35 A;  2C96 A;  3HWS A;  2R45 A;  4RNA A;  1R5L A;  1N33 M;  3U6L A;  3U6P A;  1HT1 E;  1Z5C A;  3U60 B;  2UXD M;  2XGN A;  2G3Q A;  3THG A;  1DGG A;  4M9Z A;  4B3R M;  4Y28 F;  1WJ7 A;  2QHO B;  1GL6 A;  2KHH A;  1IBL M;  1GL7 A;  3T1H M;  3HU2 A;  4KOD A;  2YR0 A;  3A98 B;  3MJ5 A;  5DFL A;  5LMU M;  4AZF A;  2QNJ A;  3SAR A;  4LJ4 A;  1K3W A;  4IBG A;  2JY7 A;  4GMQ A;  7CAT A;  1R2Z A;  4L8R C;  2Z7J A;  3GLF B;  1NNU C;  3KOW E;  3U5Z A;  3B7N A;  3HX3 A;  5IT9 S;  1T6O A;  1WGL A;  5ITQ A;  1NV8 A;  2X4A A;  2RKO A;  3K2L A;  1EE8 A;  4L15 A;  1QAO A;  1OJL A;  3UK6 A;  3U61 A;  4DR7 M;  4OU7 A;  1PGY A;  2RGH A;  2L09 A;  4QOS A;  3TQS A;  5BR8 M;  4HEO A;  3TWM A;  4M0W A;  4WP2 A;  4NSO B;  2V6Z M;  4DUY M;  1TF0 B;  2XH9 A;  3I01 M;  4G4Q A;  2Q2E B;  2CEA A;  5LMN M;  4AKI A;  1XXH E;  4FCV A;  3U6O A;  5IWA M;  2Y20 A;  3VKG A;  1LTM A;  1WIV A;  4X66 M;  1IN4 A;  4QNR A;  4R3D A;  1J09 A;  2HL7 A;  1N77 A;  1FJG M;  4NL4 H;  3KS8 A;  1L1T A;  2AHM A;  5FTL A;  1IN6 A;  2B3T A;  1GVN A;  3GRU A;  4Q7J A;  1HR0 M;  3NWL A;  2FOI C;  1DGH A;  4LZZ A;  4AW4 A;  1RU3 A;  3U6E A;  3EIE A;  1ZMU A;  3A42 A;  3LCU A;  4L16 A;  4X62 M;  3UJN A;  2LTU A;  4Z8X A;  1QZM A;  3LVV A;  1Y8G A;  4NRW A;  4DV0 M;  3J81 S;  1TH4 A;  3HZJ A;  4GHA A;  1EFU B;  1QZE A;  2C9O A;  2LXE A;  3JR5 A;  2P5T A;  2RRU A;  4AG5 A;  4IJF A;  2LVP C;  4YHH M;  1E94 E;  4UN2 B;  2JA2 A;  2LHG A;  4FVM A;  2Z4S A;  1G59 A;  3AFH A;  2FS1 A;  3SAV A;  3UMM A;  2CV1 A;  3BBZ A;  2D7E A;  3C3D A;  4FCW A;  4D82 A;  3SAS A;  3ZQJ A;  1HT2 E;  3GLH B;  1OFI A;  1W5T A;  3J7A S;  4JV5 M;  1OAO C;  4CIS A;  4FD2 A;  4JN6 A;  1TDZ A;  4DR4 M;  1CUK A;  1L8Q A;  1XHB A;  1D2N A;  2G5G X;  3FE3 A;  4G3O A;  3ZC7 B;  5ITR A;  1YLA A;  4RKU F;  1QQW A;  2KEB A;  1QDR A;  2I7P A;  5FTM A;  2ZTD A;  3U60 A;  4JI2 M;  4ITQ A;  3HJQ A;  1SXJ B;  2XF3 A;  4JI7 M;  2KRK A;  1EIJ A;  4JI4 M;  1ZAE A;  2X8A A;  2XSZ A;  3Q8G A;  1WGN A;  4LJ6 A;  2RGO A;  4LJA A;  4BLC A;  4QHS A;  5ITX A;  4FW9 A;  3E4R A;  2LHC A;  1E32 A;  4L4U A;  4LJ9 A;  4NXM M;  4AI6 A;  4MGK E;  1G8P A;  3GP1 A;  1A5T A;  1JR3 E;  2DKL A; 
#chains in the Genus database with same CATH homology
 3SC3 A;  4ZPX A;  2UUC M;  2BNK A;  1Q3B A;  1DGB A;  3MK6 A;  3KS4 A;  2OPF A;  3MHV C;  4DV6 M;  4K0K M;  2F5P A;  4QOZ C;  1WXQ A;  2XZF A;  3KOX E;  3U6C A;  4AKG A;  3HHX A;  3KXE C;  1L2D A;  3KP1 E;  3OTO M;  4IBC A;  4GHL A;  5EQT A;  2DHR A;  2R4J A;  5JI2 E;  2D7H A;  3A45 A;  4CGY B;  3SFZ A;  4GH9 A;  3R9X B;  3KFU G;  4MGI E;  1IN7 A;  4P16 A;  2M60 A;  3J80 S;  1QAQ A;  5ITY A;  4DUZ M;  4DR6 M;  4BBA A;  1Z6T A;  1Q3C A;  4KHP M;  4OX9 M;  5EXT A;  2CV0 A;  1TGU A;  4IBE A;  2M5Z A;  2CFO A;  4BB9 A;  4OVZ B;  3SAW A;  5E6J A;  3AV0 A;  4MB7 A;  4NOO B;  3DA1 A;  4A3V B;  3GPX A;  2ZBK B;  4FWH A;  1G3I A;  4G4R A;  4M9X A;  4DR5 M;  3TWK A;  1J5E M;  3IG8 A;  4Z6Y A;  4WUR A;  2CV2 A;  1SXJ D;  3L2A A;  5GKN A;  3GRR A;  3M7G A;  3UGJ A;  3GPU A;  3A46 A;  2C99 A;  3U6S A;  2UXC M;  3RFW A;  4MGH A;  2BJW A;  2R65 A;  4AG6 A;  3GPP A;  1ORY B;  1I4W A;  3FUU A;  2VQF M;  1FNN A;  3FTE A;  4LFB M;  2NQ8 C;  3GLI B;  5A2Q S;  1I94 M;  4FCT A;  5IZ7 D;  1R2Y A;  3KOY E;  4G6Z A;  1YSY A;  2R18 A;  1IY0 A;  2F5O A;  4FWG A;  4X65 M;  3GLH A;  1R7R A;  5KPR A;  4LFA M;  3WHK A;  1IXR C;  1YE9 A;  4IBD A;  5F3W A;  5C1B A;  2DXI A;  3AOE A;  4IBF A;  2V1U A;  3T1Y M;  4HL4 A;  2QCU A;  2W82 A;  2Y0T A;  2C9C A;  2L6O A;  2QPA A;  2XLJ A;  4IBJ A;  5E26 A;  2ERC A;  3PXG A;  2Z3X A;  3FTD A;  5EXS A;  1J7K A;  1SXJ A;  3SYK A;  2LNH C;  1NHG C;  1H6U A;  3DOA A;  3U6D A;  4LF6 M;  3AJI B;  4PD2 A;  4LRS A;  1Z59 A;  2V1C A;  4REZ A;  3CTW B;  1IBK M;  2F5N A;  3GRV A;  3QAU A;  3GLG B;  1G41 A;  1YUB A;  4W5W A;  4B3M M;  3U6M A;  2YNM D;  3AOE C;  4LGY A;  4DV3 M;  1C1K A;  2UUA M;  2K47 A;  4PDI A;  4MGZ E;  1QAM A;  4PCZ A;  1QYR A;  4I8O A;  2EO2 A;  2O5R A;  3T38 A;  3D8L A;  3ZCB B;  4LGM A;  4RF0 A;  3K1J A;  3SMP A;  3HJS A;  2C98 A;  3SYL A;  2OQ4 A;  4KO8 A;  3I4V A;  1Z5A A;  3JR4 A;  3EIH A;  5FTN A;  5DYI A;  3RGP A;  1PM5 A;  3SBJ A;  3GRY A;  2YQZ A;  4KLN A;  1XC8 A;  4LF8 M;  3FTC A;  4TUW A;  3WHL A;  2CHQ A;  1Z5B A;  5DYG A;  1MU5 A;  2F4V M;  1N75 A;  4WW0 A;  1PJI A;  4LJ7 A;  1T3T A;  1K3X A;  4LF7 M;  3LMM A;  2QBY B;  1L1Z A;  4JYA M;  1TH3 A;  4OVZ A;  2VII A;  1NJF A;  3VFD A;  1QVR A;  5ITX E;  1OFH A;  3TPZ A;  4RF1 A;  3PVS A;  1XNQ M;  1XNR M;  2C5R A;  4GKK M;  4XBO A;  3FYC A;  2R4E A;  4IJE A;  4D81 A;  4EIW A;  1XXH B;  3GQ4 A;  4GIP A;  3AL0 C;  1DO2 A;  3GLF A;  3I51 A;  2X49 A;  3GLI A;  4DR2 M;  5EP1 A;  2KW0 A;  1TDH A;  3FUX A;  4DR1 M;  1DGH B;  2EUC A;  2CHV A;  4GIT A;  2HCB A;  1W5S A;  2R46 A;  1IXZ A;  5EP2 A;  3L25 A;  5KQ8 A;  4B3T M;  3HGI A;  2E5L M;  2DWL A;  4LZJ A;  5KO3 A;  3SHG B;  4B7F A;  2L7H A;  3J27 B;  3C58 A;  3HU1 A;  4YY3 M;  4LF5 M;  1HQC A;  3E9S A;  2FFJ A;  4LJ8 A;  1L2B A;  3FTF A;  1KSF X;  3DFZ A;  2FNA A;  3Q8X A;  3K92 A;  4IBB A;  1TH2 A;  2F5S A;  5C18 A;  4PDG A;  3NBI A;  4M0D A;  4NXN M;  3T15 A;  4GKJ M;  4GC5 A;  5EXX A;  2XFT A;  3HJ8 A;  5KPT A;  1KYI A;  5ITT A;  3SAU A;  3GLG A;  1IXS B;  2ZAM A;  3W0F A;  1NHW C;  1GLN A;  2UU9 M;  3HU3 A;  4QHT A;  3SHF A;  3KDS E;  4IIW A;  4JI0 M;  2QP9 X;  2ZM6 M;  2KZS A;  2Y0Q A;  3H4M A;  2CUZ A;  3KVW A;  3RE8 A;  5H37 D;  3IG5 A;  4DV1 M;  2Z4R A;  1XMO M;  4GRI A;  3GO8 A;  3LQR A;  2Y21 A;  3AKZ A;  2R62 A;  4QNM A;  2A5Y B;  3SMS A;  3UZU A;  3TL4 X;  3KW6 A;  5KPZ A;  3SAT A;  1S3S A;  3J2P B;  1IN8 A;  4AQY M;  1N32 M;  3PNY A;  3HHY A;  1SXJ E;  2DWZ B;  1NSF A;  2DWN A;  3B9P A;  1IY1 A;  3VKH A;  4DV2 M;  2QBY A;  5EP3 A;  1XMQ M;  3FUV A;  4DR3 M;  2HHH M;  4MM3 B;  2ZAN A;  4DV5 M;  3LQQ A;  1E9R A;  1NVM A;  4I81 A;  3KOZ E;  4GC9 A;  4X64 M;  3KSX A;  1UM8 A;  1JQJ C;  2KXE A;  3JAM S;  2EA0 A;  3QWL A;  3VK7 A;  1R6B X;  2G8L A;  3HHW A;  5FTJ A;  3VDU A;  1IY2 A;  3LVW A;  1XXH A;  2J7O A;  3L29 A;  5EP4 A;  1LV7 A;  1DGF A;  1N78 A;  3FUW A;  1SXJ C;  5FSW A;  1MX0 A;  3K8Z A;  1G4A E;  3PNV A;  4I5S A;  2D7G A;  4LF4 M;  5IRE B;  1N36 M;  5EJC A;  2LH0 A;  2QZ4 A;  4IBI A;  1GKI A;  2DVW B;  3D8B A;  1HNX M;  5JI3 E;  2ZAO A;  4CHT B;  4JI3 M;  3FD9 A;  1X37 A;  4I4L A;  3GQ5 A;  3CF2 A;  3VK8 A;  2XSZ D;  5ITU A;  3RGS A;  3TWL A;  3R8F A;  4G4O A;  5KQD A;  1VDD A;  3FUT A;  4II7 A;  4D80 A;  5BPV A;  4LY6 A;  3U5Z B;  3L26 A;  3HHZ A;  2KA6 B;  4L78 A;  1L2C A;  3KP0 E;  4B7H A;  2FE8 A;  2I7N A;  3M6A A;  1JR3 D;  2XZU A;  4LF9 M;  3BOS A;  1KFV A;  3U61 B;  3GPY A;  1NJG A;  4LJ5 A;  4OW0 A;  4IBK A;  4R7G A;  2L7I A;  3KSJ A;  3L27 A;  4LG2 A;  3AOG A;  5EXP A;  3TE6 A;  1ZQ9 A;  3I4Y A;  3GQ3 A;  2CHG A;  2CE7 A;  3DZD A;  1XWI A;  3FYD A;  3PFI A;  2BJV A;  4LFC M;  4XGI A;  1K82 A;  2HKJ A;  4HLQ A;  3CF6 E;  1HNW M;  2LWX A;  3W0L B;  2UUB M;  4S12 A;  4DV4 M;  4B3S M;  4JI5 M;  1IBM M;  3CF0 A;  8CAT A;  2DZN B;  5DNY A;  1JR3 A;  2KZU A;  1IM2 A;  2VQE M;  3HKP A;  3U6Q A;  4MGY E;  2H1R A;  4G4N A;  4B7G A;  4M9S A;  1HNZ M;  1QAN A;  3M0E A;  1DO0 A;  2DWM A;  4JI8 M;  3L28 A;  3ILK A;  4NSR A;  4NRV A;  2F5Q A;  1Q39 A;  1NNJ A;  4LCB A;  2DZO B;  4MH0 E;  3ZH9 B;  1N34 M;  4JI6 M;  3VDP A;  1NY6 A;  4JXJ A;  2XFS A;  2KRU A;  4LRT A;  3FKE A;  4B08 A;  1E9S A;  1HQY E;  2J7N A;  3VLF B;  1IQP A;  4JI1 M;  2QEN A;  1IN5 A;  1NY5 A;  3J7B A;  4FWD A;  5FTK A;  4PT5 A;  2XEP A;  2YFQ A;  4AKH A;  2UXB M;  5FLX S;  4DV7 M;  2C96 A;  3HWS A;  2R45 A;  4RNA A;  1N33 M;  3U6L A;  3U6P A;  1HT1 E;  1Z5C A;  3U60 B;  2UXD M;  2XGN A;  3THG A;  1DGG A;  4M9Z A;  4B3R M;  1GL6 A;  1IBL M;  1GL7 A;  3T1H M;  3HU2 A;  4KOD A;  2YR0 A;  3A98 B;  3MJ5 A;  5LMU M;  4AZF A;  3SAR A;  4LJ4 A;  1K3W A;  4IBG A;  4GMQ A;  7CAT A;  1R2Z A;  4L8R C;  2Z7J A;  3GLF B;  1NNU C;  3KOW E;  3U5Z A;  5IT9 S;  5ITQ A;  2X4A A;  2RKO A;  3K2L A;  1EE8 A;  4L15 A;  1QAO A;  1OJL A;  3UK6 A;  3U61 A;  4DR7 M;  4OU7 A;  2RGH A;  2L09 A;  4QOS A;  3TQS A;  5BR8 M;  3TWM A;  4M0W A;  4NSO B;  2V6Z M;  4DUY M;  2XH9 A;  4G4Q A;  2Q2E B;  2CEA A;  5LMN M;  4AKI A;  4FCV A;  3U6O A;  5IWA M;  2Y20 A;  3VKG A;  4X66 M;  1IN4 A;  4QNR A;  4R3D A;  1J09 A;  2HL7 A;  1N77 A;  1FJG M;  4NL4 H;  3KS8 A;  1L1T A;  2AHM A;  5FTL A;  1IN6 A;  1GVN A;  3GRU A;  1HR0 M;  3NWL A;  2FOI C;  1DGH A;  4LZZ A;  4AW4 A;  3U6E A;  3EIE A;  3A42 A;  4L16 A;  4X62 M;  3UJN A;  4Z8X A;  1QZM A;  3LVV A;  4NRW A;  4DV0 M;  3J81 S;  1TH4 A;  4GHA A;  2C9O A;  2LXE A;  3JR5 A;  2P5T A;  4AG5 A;  4IJF A;  4YHH M;  1E94 E;  2JA2 A;  4FVM A;  2Z4S A;  1G59 A;  3AFH A;  3SAV A;  3UMM A;  2CV1 A;  2D7E A;  4FCW A;  4D82 A;  3SAS A;  1HT2 E;  3GLH B;  1OFI A;  1W5T A;  3J7A S;  4JV5 M;  4CIS A;  4FD2 A;  4JN6 A;  1TDZ A;  4DR4 M;  1L8Q A;  1XHB A;  1D2N A;  2G5G X;  5ITR A;  3ZC7 B;  1QQW A;  2KEB A;  4JI2 M;  2I7P A;  5FTM A;  3U60 A;  4ITQ A;  3HJQ A;  1SXJ B;  2XF3 A;  4JI7 M;  2KRK A;  4JI4 M;  1ZAE A;  2X8A A;  2XSZ A;  4LJ6 A;  2RGO A;  4LJA A;  4BLC A;  4QHS A;  5ITX A;  4FW9 A;  3E4R A;  1E32 A;  4L4U A;  4LJ9 A;  4NXM M;  4AI6 A;  4MGK E;  1G8P A;  3GP1 A;  1PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...