2KZSA

Daxx helical bundle (dhb) domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
b'GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-associated protein 6
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzsA00
2KZSA 2KZUA
chains in the Genus database with same CATH superfamily
2LVQD 2BJVA 3E4RA 3GRYA 4QHTA 4JI3M 1JR3E 1MJGM 4P17A 4L15A 1VDLA 4FCTA 1W5SA 1OTRA 3A98B 3QYEA 2O25A 3ILKA 3KSXA 2Z7JA 4MH0E 4REZA 4DR3M 4GHAA 1ZQ9A 2CRUA 2QENA 1T43A 3KFUG 3TPZA 4LZJA 2JA2A 4G4RA 4D80A 3LCUA 1OQYA 2UXCM 2XF3A 1YSYA 2BWEA 2C98A 3HGIA 3SMSA 1QAQA 1V33A 4QHSA 4L78A 2UUCM 3U6DA 2Y21A 5JI2E 3IECA 1WGLA 1L1ZA 1QVRA 2QZ4A 4GMQA 3PNVA 1SXJB 5ITXA 2LHCA 1DGGA 2R45A 5KPTA 3JR5A 3U5ZA 3KSJA 4IBIA 4IBCA 1OIPA 4CGYB 1HT2E 2KZSA 3C3EA 3J2PB 3FYDA 3WHLA 4GKJM 5KQDA 1HQCA 5EP4A 1VEGA 3GLGA 3VFDA 1GABA 1NO1A 3TWKA 1PJTA 4IIWA 5DYGA 1HQYE 4DV3M 1Z5CA 2CWBA 4L16A 2ZAMA 1ZMWA 4IBEA 4X66M 5KQ8A 5IREB 1N75A 1KSFX 4CJ6A 1JQJC 4DUZM 4LFCM 4PCZA 2ZAOA 3T15A 1OJLA 4LJ5A 1K3WA 2KRKA 2QCUA 4GEWA 2KXEA 3HZJA 3HY5A 4L4UA 4NOOB 3B7ZA 3HU1A 3THGA 1IXZA 2ZANA 3FKEA 2UUBM 2ZM6M 4JI6M 4MB7A 1DGFA 2J7OA 2M5ZA 1IN8A 5DNYA 1KFVA 1GLNA 2RRUA 1AIPC 1E32A 2J7NA 3M6AA 1G3IA 4KODA 1X37A 4PDIA 3J81S 2OO9A 2X4AA 1I94M 4B3TM 2LBCA 4ITQA 1WIVA 3CTWB 5IZ7D 4Z6YA 2N35A 1IXRC 1MU5A 2L7IA 4S12A 3GLFE 3BOSA 3FYCA 3VDPA 3AJIB 1QZEA 1DV0A 4P16A 1N32M 4LFAM 3KXEC 1N33M 2ZTCA 2XFSA 2JXNA 3SYKA 3U5ZB 1IN4A 4MGKE 4G4NA 5H37D 2FE8A 4NXNM 2MGWA 2XFTA 3GLHB 1NHGC 2XGNA 2BJWA 5FSWA 4M9SA 3VK8A 3EIEA 3T38A 2FS1A 3BXWA 1W5TA 3GLGB 3MK6A 3FD9A 2KW0A 4JI7M 3FTEA 3GPXA 4LGMA 5IT9S 4LG2A 1GVNA 5C18A 3KS4A 4R71A 3TWLA 4LF6M 4DUYM 3JR4A 3BBZA 4HL4A 3U6OA 2F5OA 5GKNA 1GL6A 2BNKA 2WSEF 2KA6B 3HWSA 1QYRA 4LJ6A 4JI0M 2QNJA 4LF5M 1K3XA 2QP9X 2MH8A 1QDTA 2QHOB 3M7GA 4RF1A 2DZLA 3AOGA 3AV0A 4IBKA 2F5SA 2HAKA 2LHGA 3Q8XA 2RKOA 3UK6A 4NRWA 4FWDA 3K8ZA 2WSCF 3GPYA 4MGYE 3RGSA 2UXBM 1ZAEA 2XLJA 1NY6A 3OTOM 1OAIA 1XXHA 3I01M 4M0DA 2DXIA 4JN6A 2DAGA 4AKHA 1IXSA 3K92A 1HT1E 4GITA 4IBFA 3R9XB 1J7KA 3K9OA 4X62M 1C7YA 2CHQA 3SBJA 4LF8M 1SXJC 2R18A 3LW5F 3FE3A 1RU3A 1Z5AA 2VQEM 1XWIA 2XSZD 4GC9A 4QNMA 2DWNA 1WXQA 4B08A 3SAVA 3TQSA 2VF8A 1V92A 4B7GA 1J5EM 3KOWE 2K47A 3SMPA 2JY6B 5FTKA 1BVSA 2WZJA 1SXJE 2LXEA 2APLA 4DV4M 4IJFA 1ORYB 1IQPA 1WHCA 3FUXA 1KYIA 3GO8A 3FRIA 1DGHA 1I4WA 3KW6A 2YNMD 2LVPC 3VKGA 4NXMM 1J09A 1NV8A 2KHHA 4QOSA 4FVMA 2DVWB 2C99A 3I4YA 3L27A 1XHBA 4XGIA 3L28A 2XH9A 4ANRA 4IBBA 1VEKA 3CF6E 5ITQA 4DR4M 1TF0B 3CF2A 4PD2A 7CATA 3PFIA 5DFLA 5BPVA 1NVMA 2CV1A 2W82A 2DAKA 3T1YM 4GRIA 4LJ7A 4GHLA 3L29A 2DWLA 2D7HA 1L1TA 1EFUB 1Q02A 1TH3A 2OOAA 2X49A 3CF0A 2FOIC 4G6ZA 4JI8M 4LFBM 1DO2A 4CHTB 2BWBA 3DA1A 3UGJA 4AKIA 2G3QA 1R5LA 4WW0A 1XXHB 3L2AA 3K2LA 2L6OA 3JAMS 3FUWA 1XMQM 1Y8GA 4Y28F 1R2ZA 4IBDA 1IXSB 2YQZA 3AOEA 2OOBA 3NWLA 3IG8A 1G4AE 1JR3D 4BBAA 4B3SM 1NNUC 1PJSA 3GPPA 1SXJD 4A3VB 1PJJA 3DZDA 4I5SA 5FTLA 4AG6A 1GJSA 2JY7A 1QQWA 4JV5M 3UJNA 3DOAA 3W0LB 2DHRA 3EIHA 3HJ8A 4AW4A 1HNWM 4QOZC 3H4JA 3ZCBB 4LJAA 5ITXE 4XBOA 1TDHA 2X8AA 3KVWA 1XMOM 2UXDM 1IN6A 4JI2M 1OIZA 2ERCA 1Z59A 3SATA 1EIJA 3A46A 1DGHB 4LJ8A 5KO3A 3GLHE 3TE6A 2M60A 2Z4RA 3PVSA 1D2NA 5JI3E 1VEJA 4PT5A 5FTNA 3VLFB 2V1UA 1NJGA 3GLGE 2O5RA 4R3DA 4GIPA 2DAEA 5ITUA 2WSFF 5E6JA 3Q8GA 3HJQA 2R4EA 2FNAA 1HNZM 5FLXS 1YE9A 2XSZA 2Z4SA 2G8LA 3NBIA 4LRSA 3TL4X 4CIZA 4M9XA 5ITRA 1VQ1A 2DAMA 3DFZA 4WURA 4OVZA 4AZFA 4II7A 3A42A 4LF9M 3E9SA 3HHWA 3FUTA 1QANA 5FTJA 3VK7A 3ZH9B 2F5NA 3GLIA 1LTMA 3ZQJA 2H1RA 1E9RA 1TR8A 2DNAA 2FH0A 3QAUA 4FWGA 3GQ5A 2XZFA 1L2DA 4DR2M 1G71A 3R8FA 2NQ8C 3HHXA 1MX0A 2E5LM 1YUBA 2R6FA 2JP7A 1T3TA 2JY5A 3PNYA 1A5TA 1NV9A 4FCVA 3RFWA 3GPUA 1HNXM 1E94E 3GRUA 3I04M 3WHKA 2EKFA 3D8BA 3GRRA 4BLCA 3B9PA 3T6PA 1PGYA 4F2LA 2MR9A 1DGBA 2C9CA 4NRVA 1FJGM 3KOZE 4OW0A 4Z8XA 3HX3A 2GNOA 4JI5M 2ZBKB 3QWLA 3SAWA 1R2YA 1IN5A 4D81A 2CEAA 1MN3A 2O01F 3U6LA 2YR0A 4EIWA 1GO5A 2EO2A 4AQYM 1QAOA 2I7PA 1T6OA 4KHPM 4X64M 3E46A 2AHMA 2XZUA 4I4LA 4MGHA 2CV2A 3FTDA 1C1KA 3B89A 1AUAA 2GQFA 2F5QA 2F4VM 1PRBA 3D8LA 4LY6A 1PJIA 2XEPA 4DR1M 4RF0A 2KDLA 2HL7A 3B74A 3L25A 1OKSA 3J27B 3LMMA 3SFZA 3W68A 4B3RM 4W5WA 4YY3M 1JR3A 4JXJA 2CUZA 2JWSA 2H5XA 4B7FA 4LRTA 3AKZA 1ZMUA 1D0LA 2Z3XA 1QDRA 3FTFA 2EUCA 4DR5M 4AI6A 3C3DA 3NBXX 4LJ4A 1S3SA 4MGIE 4DBGB 4MM3B 4OVZB 5FTMA 3KOYE 3KP0E 2DZOB 3GLIB 1QUTA 4OX9M 4FW9A 4MGZE 3HHZA 5A2QS 5EJCA 2DKLA 2KRUA 2Q2EB 2G5GX 4IJEA 4B7HA 2QBYA 3HU2A 1L2CA 1QAMA 1Z5BA 4Q7JA 1F4IA 4LZZA 3U61A 4JI4M 2ZTDA 1OFIA 1P3QQ 4I81A 2MROB 2D7GA 3IG5A 1NJFA 4G4QA 2DWMA 4KT0F 2EJSA 2CP8A 4ZPXA 2Y0TA 1XXHE 2HCBA 1IN7A 2LWXA 2V1CA 3CGWA 1IY1A 2FFJA 2I7NA 4X65M 4NSRA 4GC5A 2B3TA 3SYLA 4JYAM 3RE8A 4DV7M 1E9SA 4HEOA 3L26A 4DV2M 5IWAM 2J5YA 4DV1M 1NY5A 5KPZA 1WGNA 5F3WA 1IY2A 1IBLM 2CFOA 3PXGA 1YLAA 2Y0QA 3I4VA 1PM5A 3FRHA 3A45A 5KPRA 1IM2A 4GH9A 4FCWA 2KZUA 1EE8A 5EXSA 4FWHA 1GJTA 3MHVC 4L6V6 2V6ZM 1VG5A 3QYBA 1H6UA 1N36M 5EXPA 3W0FA 1D0MA 2R4JA 2CHVA 2VIIA 1SG9A 4WP2A 4BB9A 3TWMA 1GKIA 1Q39A 2C5RA 2L4EA 3GLHA 3LCVB 1NHWC 5E26A 4CISA 2L4FA 3KS8A 2K6BA 3RGPA 2R44A 3E21A 3F92A 1IFYA 3C9PA 1R6BX 1OAOC 1XC8A 1FNNA 2QPAA 1IY0A 3SHFA 3GLFA 5LMUM 1WR1B 2QBYB 2DENA 4DV6M 1Q3BA 1JB0F 2HKJA 2VQFM 3U61B 2KNZA 3AOEC 2QQ8A 4R7GA 1TDZA 2Y20A 3J7AS 2D7EA 1QUSA 2DWZB 3HJSA 3SARA 1WJ7A 2CE7A 3LVWA 3V76A 3U60A 8CATA 5EXTA 3HKPA 3KP1E 3U6EA 4TUWA 1TTEA 2HWJA 3M0EA 4FD2A 3B7NA 4IBJA 4HLQA 2KNAA 3J7BA 2LVNC 3I51A 1UFZA 2JUJA 2K0BX 4DR7M 3C58A 4NSOB 3GP1A 5DYIA 2EA0A 2Z8YM 2R0IA 3UZUA 1VDDA 4M0WA 5L8RF 2C96A 5ITTA 4L8RC 4GKKM 4IBGA 4DV5M 3U6MA 4KO8A 1TH4A 4PDGA 4XK8F 2DHYA 2R46A 4LCBA 2DZNB 2DAIA 2RGHA 3FUUA 2OQ4A 3J80S 1DO0A 3KDSE 1V34A 2EKKA 4G4OA 2UU9M 2JZ0A 2LTUA 3SC3A 2LH0A 2F5PA 3AL0C 1R4GA 1R7RA 2DI0A 3MJ5A 4LGYA 4K0KM 1HJPA 1N77A 3VDUA 4B3MM 2KNVA 5EXXA 1NNJA 4F1IA 3K1JA 2L09A 1G59A 3AFHA 2CHGA 1ZMVA 4RKUF 5LMNM 3GLFB 1LV7A 2YFQA 2QSFX 3GLIE 3U6CA 1TH2A 5EP3A 1QZMA 1N78A 1G41A 4OU7A 2JY8A 5EQTA 1OFHA 1XNRM 1PJQA 1TGUA 3U6QA 2JZ1A 3HHYA 3LVVA 4QNRA 3KOXE 1NSFA 2R62A 4AKGA 1IBMM 3FTCA 3U60B 1SXJA 2VDBB 2UUAM 1K82A 2OPFA 3GQ3A 3T1HM 2C9OA 4G3OA 2A5YB 3ZC7B 3W67A 3U6PA 4KLNA 4DR6M 4I8OA 5BR8M 3SAUA 3HU3A 5ITYA 2K9DA 2LVAA 3MMPA 3LQQA 4UN2B 4JI1M 2VF7A 2HHHM 1ZV1A 3B7QA 4RNAA 2LVOC 1HR0M 1CUKA 1XNQM 3VKHA 2MJ5B 1D0KA 3FUVA 3SHGB 4D82A 3GRVA 4NC6A 5C1BA 3U6SA 2CV0A 1Q3CA 1GL7A 1G8PA 3LQRA 5EP2A 4LF7M 4NL4H 1N34M 1UM8A 5EP1A 2L7HA 3IHPA 4YHHM 1L2BA 3SASA 2RGOA 2KEBA 2R65A 1L8QA 3GQ4A 3UMMA 2JNHA 4LF4M 3H4MA 2LNHC 2P5TA 1XB2B 4DV0M 4AG5A 4M9ZA 4LJ9A 1IBKM 3K9PA 2L2DA 1Z6TA
chains in the Genus database with same CATH topology
2BJVA 3E4RA 3GRYA 4QHTA 4JI3M 4L15A 4FCTA 1W5SA 3A98B 4GHAA 3ILKA 3KSXA 2Z7JA 4MH0E 4REZA 4DR3M 1ZQ9A 2QENA 3KFUG 3TPZA 4LZJA 2JA2A 4G4RA 4D80A 2UXCM 2XF3A 1YSYA 2C98A 3HGIA 3SMSA 1QAQA 4QHSA 4L78A 2UUCM 3U6DA 2Y21A 5JI2E 1L1ZA 1QVRA 2QZ4A 4GMQA 3PNVA 1SXJB 5ITXA 5KPTA 1DGGA 2R45A 3JR5A 3U5ZA 3KSJA 4IBIA 4IBCA 4CGYB 1HT2E 2KZSA 3J2PB 3FYDA 3WHLA 4GKJM 5KQDA 1HQCA 5EP4A 3GLGA 3VFDA 3TWKA 4IIWA 5DYGA 1HQYE 4DV3M 1Z5CA 4L16A 2ZAMA 4IBEA 5KQ8A 4X66M 5IREB 1N75A 1KSFX 1JQJC 4DUZM 4LFCM 4PCZA 2ZAOA 3T15A 1OJLA 4LJ5A 1K3WA 2KRKA 2QCUA 2KXEA 4L4UA 4NOOB 3HU1A 3THGA 1IXZA 2ZANA 3FKEA 2UUBM 2ZM6M 4JI6M 4MB7A 1DGFA 2J7OA 2M5ZA 1IN8A 5DNYA 1KFVA 1GLNA 1E32A 2J7NA 3M6AA 1G3IA 4KODA 1X37A 4PDIA 3J81S 1I94M 2X4AA 4B3TM 3CTWB 5IZ7D 4Z6YA 1IXRC 1MU5A 2L7IA 4S12A 3BOSA 3FYCA 3VDPA 3AJIB 4P16A 1N32M 4LFAM 3KXEC 1N33M 2XFSA 3SYKA 3U5ZB 1IN4A 4MGKE 5H37D 2FE8A 4NXNM 2XFTA 3GLHB 1NHGC 2XGNA 2BJWA 5FSWA 4M9SA 3VK8A 3EIEA 3T38A 3GLGB 1W5TA 3MK6A 3FD9A 2KW0A 4JI7M 3FTEA 3GPXA 4LGMA 5IT9S 4LG2A 1GVNA 5C18A 3KS4A 3TWLA 4LF6M 4DUYM 3JR4A 4HL4A 3U6OA 2F5OA 5GKNA 1GL6A 2BNKA 2KA6B 3HWSA 1QYRA 4LJ6A 4JI0M 4LF5M 1K3XA 2QP9X 3M7GA 4RF1A 3AOGA 3AV0A 4IBKA 2F5SA 3Q8XA 2RKOA 3UK6A 4NRWA 4FWDA 3K8ZA 3GPYA 4MGYE 3RGSA 2UXBM 1ZAEA 2XLJA 1NY6A 3OTOM 1XXHA 2DXIA 4M0DA 4JN6A 4AKHA 3K92A 1HT1E 4GITA 4IBFA 3R9XB 1J7KA 4X62M 2CHQA 3SBJA 4LF8M 1SXJC 2R18A 1Z5AA 2VQEM 1XWIA 2XSZD 4GC9A 4QNMA 2DWNA 1WXQA 4B08A 3SAVA 3TQSA 4B7GA 1J5EM 3KOWE 2K47A 3SMPA 5FTKA 1SXJE 2LXEA 4DV4M 4IJFA 1ORYB 1IQPA 3FUXA 1KYIA 3GO8A 1DGHA 1I4WA 3KW6A 2YNMD 3VKGA 4NXMM 1J09A 4QOSA 4FVMA 2DVWB 2C99A 3I4YA 3L27A 1XHBA 4XGIA 3L28A 2XH9A 4IBBA 3CF6E 5ITQA 4DR4M 7CATA 3CF2A 4PD2A 3PFIA 5BPVA 1NVMA 2CV1A 2W82A 3T1YM 4GRIA 4LJ7A 4GHLA 3L29A 2DWLA 2D7HA 1L1TA 1TH3A 2X49A 3CF0A 2FOIC 4G6ZA 4JI8M 4LFBM 1DO2A 4CHTB 3DA1A 3UGJA 4AKIA 4WW0A 1XXHB 3L2AA 3K2LA 2L6OA 3JAMS 3FUWA 1XMQM 1R2ZA 4IBDA 1IXSB 2YQZA 3AOEA 3NWLA 3IG8A 1G4AE 1JR3D 4BBAA 4B3SM 1NNUC 3GPPA 1SXJD 4A3VB 1PJJA 3DZDA 4I5SA 5FTLA 4AG6A 1QQWA 4JV5M 3UJNA 3DOAA 3W0LB 2DHRA 3EIHA 3HJ8A 4AW4A 1HNWM 4QOZC 3ZCBB 4LJAA 5ITXE 4XBOA 1TDHA 2X8AA 3KVWA 1XMOM 2UXDM 1IN6A 4JI2M 2ERCA 1Z59A 3SATA 3A46A 1DGHB 4LJ8A 5KO3A 3TE6A 2M60A 2Z4RA 3PVSA 1D2NA 5JI3E 5FTNA 4PT5A 3VLFB 2V1UA 1NJGA 2O5RA 4R3DA 4GIPA 5ITUA 5E6JA 3HJQA 2R4EA 2FNAA 1HNZM 5FLXS 1YE9A 2XSZA 2Z4SA 2G8LA 3NBIA 4LRSA 3TL4X 5ITRA 4M9XA 4JI1M 3DFZA 4WURA 4OVZA 4AZFA 4II7A 3A42A 4LF9M 3E9SA 3HHWA 3FUTA 1QANA 5FTJA 3VK7A 3ZH9B 2F5NA 3GLIA 2H1RA 1E9RA 3GQ5A 3QAUA 2XZFA 4FWGA 1L2DA 4DR2M 3R8FA 2NQ8C 3HHXA 1MX0A 2E5LM 1YUBA 3PNYA 1T3TA 4FCVA 3RFWA 3GPUA 1HNXM 1E94E 3GRUA 3WHKA 4BLCA 3D8BA 3GRRA 3B9PA 1DGBA 2C9CA 4NRVA 1FJGM 3KOZE 4OW0A 4Z8XA 4JI5M 2ZBKB 3QWLA 3SAWA 1R2YA 1IN5A 4D81A 2CEAA 3U6LA 2YR0A 2EO2A 4AQYM 1QAOA 2I7PA 4KHPM 4X64M 2AHMA 2XZUA 4I4LA 4MGHA 2CV2A 3FTDA 1C1KA 2F4VM 2F5QA 3D8LA 4LY6A 1PJIA 2XEPA 4DR1M 4RF0A 2HL7A 3L25A 4B3RM 3J27B 3LMMA 3SFZA 4W5WA 4YY3M 1JR3A 4JXJA 2CUZA 3AKZA 4B7FA 4LRTA 2Z3XA 3FTFA 2EUCA 4DR5M 4AI6A 4LJ4A 1S3SA 4MGIE 4MM3B 4OVZB 5FTMA 3KOYE 3KP0E 2DZOB 3GLIB 4OX9M 4FW9A 4MGZE 3HHZA 5A2QS 5EJCA 2KRUA 2Q2EB 2G5GX 4IJEA 4B7HA 2QBYA 3HU2A 1L2CA 1QAMA 1Z5BA 4LZZA 3U61A 4JI4M 1OFIA 4I81A 2D7GA 3IG5A 1NJFA 4G4QA 2DWMA 4ZPXA 4G4NA 4EIWA 2Y0TA 2LWXA 2HCBA 1IN7A 2V1CA 4GH9A 4X65M 1IY1A 2FFJA 2I7NA 4NSRA 4GC5A 3SYLA 4JYAM 3RE8A 4DV7M 1E9SA 3L26A 4DV2M 5IWAM 4DV1M 1NY5A 5KPZA 5F3WA 1IY2A 1IBLM 2CFOA 3PXGA 3I4VA 2Y0QA 1PM5A 3A45A 5KPRA 1IM2A 4FCWA 2KZUA 1EE8A 5EXSA 4FWHA 3MHVC 2V6ZM 1H6UA 1N36M 5EXPA 3W0FA 2VIIA 2R4JA 2CHVA 3TWMA 4ITQA 4BB9A 2C5RA 1GKIA 1Q39A 4CISA 3GLHA 5E26A 1NHWC 3KS8A 3RGPA 1R6BX 1XC8A 1FNNA 2QPAA 1IY0A 3SHFA 3GLFA 5LMUM 2QBYB 4DV6M 1Q3BA 2VQFM 2HKJA 3U61B 3AOEC 4R7GA 1TDZA 2Y20A 3J7AS 2D7EA 2DWZB 3HJSA 3SARA 2CE7A 3LVWA 3U60A 8CATA 5EXTA 3HKPA 3KP1E 3U6EA 4TUWA 4FD2A 3M0EA 4IBJA 4HLQA 3J7BA 3I51A 4DR7M 3C58A 4NSOB 3GP1A 5DYIA 2EA0A 3UZUA 1VDDA 4M0WA 2C96A 5ITTA 4L8RC 4GKKM 4IBGA 4DV5M 3U6MA 4KO8A 1TH4A 4PDGA 2R46A 4LCBA 2DZNB 2RGHA 3FUUA 2OQ4A 3J80S 1DO0A 3KDSE 4G4OA 2UU9M 3SC3A 2LH0A 2F5PA 3AL0C 1R7RA 3MJ5A 4LGYA 4K0KM 1N77A 3VDUA 4B3MM 5EXXA 1NNJA 3K1JA 2L09A 1G59A 3AFHA 2CHGA 5LMNM 3GLFB 1LV7A 2YFQA 3U6CA 1TH2A 5EP3A 1QZMA 1N78A 1G41A 4OU7A 5EQTA 1OFHA 1XNRM 1TGUA 3U6QA 3HHYA 3LVVA 4QNRA 3KOXE 1NSFA 2R62A 4AKGA 1IBMM 3FTCA 3U60B 1SXJA 2UUAM 1K82A 2OPFA 3GQ3A 3T1HM 2C9OA 2A5YB 3ZC7B 3U6PA 4KLNA 4DR6M 4I8OA 5BR8M 3SAUA 3HU3A 5ITYA 3LQQA 2HHHM 4RNAA 1XNQM 1HR0M 3VKHA 5C1BA 3FUVA 4D82A 3SHGB 3U6SA 3GRVA 2CV0A 1Q3CA 1GL7A 1G8PA 3LQRA 5EP2A 4LF7M 4NL4H 1N34M 1UM8A 5EP1A 2L7HA 4YHHM 1L2BA 3SASA 2RGOA 2KEBA 2R65A 1L8QA 3GQ4A 3UMMA 4LF4M 3H4MA 2LNHC 2P5TA 4DV0M 4AG5A 4M9ZA 4LJ9A 1IBKM 1Z6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZS A;  2KZU A; 
#chains in the Genus database with same CATH topology
 2LVQ D;  2BJV A;  3E4R A;  3GRY A;  4QHT A;  4JI3 M;  1JR3 E;  1MJG M;  4P17 A;  4L15 A;  1VDL A;  4FCT A;  1W5S A;  1OTR A;  3A98 B;  3QYE A;  2O25 A;  3ILK A;  3KSX A;  2Z7J A;  4MH0 E;  4REZ A;  4DR3 M;  4GHA A;  1ZQ9 A;  2CRU A;  2QEN A;  1T43 A;  3KFU G;  3TPZ A;  4LZJ A;  2JA2 A;  4G4R A;  4D80 A;  3LCU A;  1OQY A;  2UXC M;  2XF3 A;  1YSY A;  2BWE A;  2C98 A;  3HGI A;  3SMS A;  1QAQ A;  1V33 A;  4QHS A;  4L78 A;  2UUC M;  3U6D A;  2Y21 A;  5JI2 E;  3IEC A;  1WGL A;  1L1Z A;  1QVR A;  2QZ4 A;  4GMQ A;  3PNV A;  1SXJ B;  5ITX A;  2LHC A;  1DGG A;  2R45 A;  5KPT A;  3JR5 A;  3U5Z A;  3KSJ A;  4IBI A;  4IBC A;  1OIP A;  4CGY B;  1HT2 E;  2KZS A;  3C3E A;  3J2P B;  3FYD A;  3WHL A;  4GKJ M;  5KQD A;  1HQC A;  5EP4 A;  1VEG A;  3GLG A;  3VFD A;  1GAB A;  1NO1 A;  3TWK A;  1PJT A;  4IIW A;  5DYG A;  1HQY E;  4DV3 M;  1Z5C A;  2CWB A;  4L16 A;  2ZAM A;  1ZMW A;  4IBE A;  4X66 M;  5KQ8 A;  5IRE B;  1N75 A;  1KSF X;  4CJ6 A;  1JQJ C;  4DUZ M;  4LFC M;  4PCZ A;  2ZAO A;  3T15 A;  1OJL A;  4LJ5 A;  1K3W A;  2KRK A;  2QCU A;  4GEW A;  2KXE A;  3HZJ A;  3HY5 A;  4L4U A;  4NOO B;  3B7Z A;  3HU1 A;  3THG A;  1IXZ A;  2ZAN A;  3FKE A;  2UUB M;  2ZM6 M;  4JI6 M;  4MB7 A;  1DGF A;  2J7O A;  2M5Z A;  1IN8 A;  5DNY A;  1KFV A;  1GLN A;  2RRU A;  1AIP C;  1E32 A;  2J7N A;  3M6A A;  1G3I A;  4KOD A;  1X37 A;  4PDI A;  3J81 S;  2OO9 A;  2X4A A;  1I94 M;  4B3T M;  2LBC A;  4ITQ A;  1WIV A;  3CTW B;  5IZ7 D;  4Z6Y A;  2N35 A;  1IXR C;  1MU5 A;  2L7I A;  4S12 A;  3GLF E;  3BOS A;  3FYC A;  3VDP A;  3AJI B;  1QZE A;  1DV0 A;  4P16 A;  1N32 M;  4LFA M;  3KXE C;  1N33 M;  2ZTC A;  2XFS A;  2JXN A;  3SYK A;  3U5Z B;  1IN4 A;  4MGK E;  4G4N A;  5H37 D;  2FE8 A;  4NXN M;  2MGW A;  2XFT A;  3GLH B;  1NHG C;  2XGN A;  2BJW A;  5FSW A;  4M9S A;  3VK8 A;  3EIE A;  3T38 A;  2FS1 A;  3BXW A;  1W5T A;  3GLG B;  3MK6 A;  3FD9 A;  2KW0 A;  4JI7 M;  3FTE A;  3GPX A;  4LGM A;  5IT9 S;  4LG2 A;  1GVN A;  5C18 A;  3KS4 A;  4R71 A;  3TWL A;  4LF6 M;  4DUY M;  3JR4 A;  3BBZ A;  4HL4 A;  3U6O A;  2F5O A;  5GKN A;  1GL6 A;  2BNK A;  2WSE F;  2KA6 B;  3HWS A;  1QYR A;  4LJ6 A;  4JI0 M;  2QNJ A;  4LF5 M;  1K3X A;  2QP9 X;  2MH8 A;  1QDT A;  2QHO B;  3M7G A;  4RF1 A;  2DZL A;  3AOG A;  3AV0 A;  4IBK A;  2F5S A;  2HAK A;  2LHG A;  3Q8X A;  2RKO A;  3UK6 A;  4NRW A;  4FWD A;  3K8Z A;  2WSC F;  3GPY A;  4MGY E;  3RGS A;  2UXB M;  1ZAE A;  2XLJ A;  1NY6 A;  3OTO M;  1OAI A;  1XXH A;  3I01 M;  4M0D A;  2DXI A;  4JN6 A;  2DAG A;  4AKH A;  1IXS A;  3K92 A;  1HT1 E;  4GIT A;  4IBF A;  3R9X B;  1J7K A;  3K9O A;  4X62 M;  1C7Y A;  2CHQ A;  3SBJ A;  4LF8 M;  1SXJ C;  2R18 A;  3LW5 F;  3FE3 A;  1RU3 A;  1Z5A A;  2VQE M;  1XWI A;  2XSZ D;  4GC9 A;  4QNM A;  2DWN A;  1WXQ A;  4B08 A;  3SAV A;  3TQS A;  2VF8 A;  1V92 A;  4B7G A;  1J5E M;  3KOW E;  2K47 A;  3SMP A;  2JY6 B;  5FTK A;  1BVS A;  2WZJ A;  1SXJ E;  2LXE A;  2APL A;  4DV4 M;  4IJF A;  1ORY B;  1IQP A;  1WHC A;  3FUX A;  1KYI A;  3GO8 A;  3FRI A;  1DGH A;  1I4W A;  3KW6 A;  2YNM D;  2LVP C;  3VKG A;  4NXM M;  1J09 A;  1NV8 A;  2KHH A;  4QOS A;  4FVM A;  2DVW B;  2C99 A;  3I4Y A;  3L27 A;  1XHB A;  4XGI A;  3L28 A;  2XH9 A;  4ANR A;  4IBB A;  1VEK A;  3CF6 E;  5ITQ A;  4DR4 M;  1TF0 B;  3CF2 A;  4PD2 A;  7CAT A;  3PFI A;  5DFL A;  5BPV A;  1NVM A;  2CV1 A;  2W82 A;  2DAK A;  3T1Y M;  4GRI A;  4LJ7 A;  4GHL A;  3L29 A;  2DWL A;  2D7H A;  1L1T A;  1EFU B;  1Q02 A;  1TH3 A;  2OOA A;  2X49 A;  3CF0 A;  2FOI C;  4G6Z A;  4JI8 M;  4LFB M;  1DO2 A;  4CHT B;  2BWB A;  3DA1 A;  3UGJ A;  4AKI A;  2G3Q A;  1R5L A;  4WW0 A;  1XXH B;  3L2A A;  3K2L A;  2L6O A;  3JAM S;  3FUW A;  1XMQ M;  1Y8G A;  4Y28 F;  1R2Z A;  4IBD A;  1IXS B;  2YQZ A;  3AOE A;  2OOB A;  3NWL A;  3IG8 A;  1G4A E;  1JR3 D;  4BBA A;  4B3S M;  1NNU C;  1PJS A;  3GPP A;  1SXJ D;  4A3V B;  1PJJ A;  3DZD A;  4I5S A;  5FTL A;  4AG6 A;  1GJS A;  2JY7 A;  1QQW A;  4JV5 M;  3UJN A;  3DOA A;  3W0L B;  2DHR A;  3EIH A;  3HJ8 A;  4AW4 A;  1HNW M;  4QOZ C;  3H4J A;  3ZCB B;  4LJA A;  5ITX E;  4XBO A;  1TDH A;  2X8A A;  3KVW A;  1XMO M;  2UXD M;  1IN6 A;  4JI2 M;  1OIZ A;  2ERC A;  1Z59 A;  3SAT A;  1EIJ A;  3A46 A;  1DGH B;  4LJ8 A;  5KO3 A;  3GLH E;  3TE6 A;  2M60 A;  2Z4R A;  3PVS A;  1D2N A;  5JI3 E;  1VEJ A;  4PT5 A;  5FTN A;  3VLF B;  2V1U A;  1NJG A;  3GLG E;  2O5R A;  4R3D A;  4GIP A;  2DAE A;  5ITU A;  2WSF F;  5E6J A;  3Q8G A;  3HJQ A;  2R4E A;  2FNA A;  1HNZ M;  5FLX S;  1YE9 A;  2XSZ A;  2Z4S A;  2G8L A;  3NBI A;  4LRS A;  3TL4 X;  4CIZ A;  4M9X A;  5ITR A;  1VQ1 A;  2DAM A;  3DFZ A;  4WUR A;  4OVZ A;  4AZF A;  4II7 A;  3A42 A;  4LF9 M;  3E9S A;  3HHW A;  3FUT A;  1QAN A;  5FTJ A;  3VK7 A;  3ZH9 B;  2F5N A;  3GLI A;  1LTM A;  3ZQJ A;  2H1R A;  1E9R A;  1TR8 A;  2DNA A;  2FH0 A;  3QAU A;  4FWG A;  3GQ5 A;  2XZF A;  1L2D A;  4DR2 M;  1G71 A;  3R8F A;  2NQ8 C;  3HHX A;  1MX0 A;  2E5L M;  1YUB A;  2R6F A;  2JP7 A;  1T3T A;  2JY5 A;  3PNY A;  1A5T A;  1NV9 A;  4FCV A;  3RFW A;  3GPU A;  1HNX M;  1E94 E;  3GRU A;  3I04 M;  3WHK A;  2EKF A;  3D8B A;  3GRR A;  4BLC A;  3B9P A;  3T6P A;  1PGY A;  4F2L A;  2MR9 A;  1DGB A;  2C9C A;  4NRV A;  1FJG M;  3KOZ E;  4OW0 A;  4Z8X A;  3HX3 A;  2GNO A;  4JI5 M;  2ZBK B;  3QWL A;  3SAW A;  1R2Y A;  1IN5 A;  4D81 A;  2CEA A;  1MN3 A;  2O01 F;  3U6L A;  2YR0 A;  4EIW A;  1GO5 A;  2EO2 A;  4AQY M;  1QAO A;  2I7P A;  1T6O A;  4KHP M;  4X64 M;  3E46 A;  2AHM A;  2XZU A;  4I4L A;  4MGH A;  2CV2 A;  3FTD A;  1C1K A;  3B89 A;  1AUA A;  2GQF A;  2F5Q A;  2F4V M;  1PRB A;  3D8L A;  4LY6 A;  1PJI A;  2XEP A;  4DR1 M;  4RF0 A;  2KDL A;  2HL7 A;  3B74 A;  3L25 A;  1OKS A;  3J27 B;  3LMM A;  3SFZ A;  3W68 A;  4B3R M;  4W5W A;  4YY3 M;  1JR3 A;  4JXJ A;  2CUZ A;  2JWS A;  2H5X A;  4B7F A;  4LRT A;  3AKZ A;  1ZMU A;  1D0L A;  2Z3X A;  1QDR A;  3FTF A;  2EUC A;  4DR5 M;  4AI6 A;  3C3D A;  3NBX X;  4LJ4 A;  1S3S A;  4MGI E;  4DBG B;  4MM3 B;  4OVZ B;  5FTM A;  3KOY E;  3KP0 E;  2DZO B;  3GLI B;  1QUT A;  4OX9 M;  4FW9 A;  4MGZ E;  3HHZ A;  5A2Q S;  5EJC A;  2DKL A;  2KRU A;  2Q2E B;  2G5G X;  4IJE A;  4B7H A;  2QBY A;  3HU2 A;  1L2C A;  1QAM A;  1Z5B A;  4Q7J A;  1F4I A;  4LZZ A;  3U61 A;  4JI4 M;  2ZTD A;  1OFI A;  1P3Q Q;  4I81 A;  2MRO B;  2D7G A;  3IG5 A;  1NJF A;  4G4Q A;  2DWM A;  4KT0 F;  2EJS A;  2CP8 A;  4ZPX A;  2Y0T A;  1XXH E;  2HCB A;  1IN7 A;  2LWX A;  2V1C A;  3CGW A;  1IY1 A;  2FFJ A;  2I7N A;  4X65 M;  4NSR A;  4GC5 A;  2B3T A;  3SYL A;  4JYA M;  3RE8 A;  4DV7 M;  1E9S A;  4HEO A;  3L26 A;  4DV2 M;  5IWA M;  2J5Y A;  4DV1 M;  1NY5 A;  5KPZ A;  1WGN A;  5F3W A;  1IY2 A;  1IBL M;  2CFO A;  3PXG A;  1YLA A;  2Y0Q A;  3I4V A;  1PM5 A;  3FRH A;  3A45 A;  5KPR A;  1IM2 A;  4GH9 A;  4FCW A;  2KZU A;  1EE8 A;  5EXS A;  4FWH A;  1GJT A;  3MHV C;  4L6V 6;  2V6Z M;  1VG5 A;  3QYB A;  1H6U A;  1N36 M;  5EXP A;  3W0F A;  1D0M A;  2R4J A;  2CHV A;  2VII A;  1SG9 A;  4WP2 A;  4BB9 A;  3TWM A;  1GKI A;  1Q39 A;  2C5R A;  2L4E A;  3GLH A;  3LCV B;  1NHW C;  5E26 A;  4CIS A;  2L4F A;  3KS8 A;  2K6B A;  3RGP A;  2R44 A;  3E21 A;  3F92 A;  1IFY A;  3C9P A;  1R6B X;  1OAO C;  1XC8 A;  1FNN A;  2QPA A;  1IY0 A;  3SHF A;  3GLF A;  5LMU M;  1WR1 B;  2QBY B;  2DEN A;  4DV6 M;  1Q3B A;  1JB0 F;  2HKJ A;  2VQF M;  3U61 B;  2KNZ A;  3AOE C;  2QQ8 A;  4R7G A;  1TDZ A;  2Y20 A;  3J7A S;  2D7E A;  1QUS A;  2DWZ B;  3HJS A;  3SAR A;  1WJ7 A;  2CE7 A;  3LVW A;  3V76 A;  3U60 A;  8CAT A;  5EXT A;  3HKP A;  3KP1 E;  3U6E A;  4TUW A;  1TTE A;  2HWJ A;  3M0E A;  4FD2 A;  3B7N A;  4IBJ A;  4HLQ A;  2KNA A;  3J7B A;  2LVN C;  3I51 A;  1UFZ A;  2JUJ A;  2K0B X;  4DR7 M;  3C58 A;  4NSO B;  3GP1 A;  5DYI A;  2EA0 A;  2Z8Y M;  2R0I A;  3UZU A;  1VDD A;  4M0W A;  5L8R F;  2C96 A;  5ITT A;  4L8R C;  4GKK M;  4IBG A;  4DV5 M;  3U6M A;  4KO8 A;  1TH4 A;  4PDG A;  4XK8 F;  2DHY A;  2R46 A;  4LCB A;  2DZN B;  2DAI A;  2RGH A;  3FUU A;  2OQ4 A;  3J80 S;  1DO0 A;  3KDS E;  1V34 A;  2EKK A;  4G4O A;  2UU9 M;  2JZ0 A;  2LTU A;  3SC3 A;  2LH0 A;  2F5P A;  3AL0 C;  1R4G A;  1R7R A;  2DI0 A;  3MJ5 A;  4LGY A;  4K0K M;  1HJP A;  1N77 A;  3VDU A;  4B3M M;  2KNV A;  5EXX A;  1NNJ A;  4F1I A;  3K1J A;  2L09 A;  1G59 A;  3AFH A;  2CHG A;  1ZMV A;  4RKU F;  5LMN M;  3GLF B;  1LV7 A;  2YFQ A;  2QSF X;  3GLI E;  3U6C A;  1TH2 A;  5EP3 A;  1QZM A;  1N78 A;  1G41 A;  4OU7 A;  2JY8 A;  5EQT A;  1OFH A;  1XNR M;  1PJQ A;  1TGU A;  3U6Q A;  2JZ1 A;  3HHY A;  3LVV A;  4QNR A;  3KOX E;  1NSF A;  2R62 A;  4AKG A;  1IBM M;  3FTC A;  3U60 B;  1SXJ A;  2VDB B;  2UUA M;  1K82 A;  2OPF A;  3GQ3 A;  3T1H M;  2C9O A;  4G3O A;  2A5Y B;  3ZC7 B;  3W67 A;  3U6P A;  4KLN A;  4DR6 M;  4I8O A;  5BR8 M;  3SAU A;  3HU3 A;  5ITY A;  2K9D A;  2LVA A;  3MMP A;  3LQQ A;  4UN2 B;  4JI1 M;  2VF7 A;  2HHH M;  1ZV1 A;  3B7Q A;  4RNA A;  2LVO C;  1HR0 M;  1CUK A;  1XNQ M;  3VKH A;  2MJ5 B;  1D0K A;  3FUV A;  3SHG B;  4D82 A;  3GRV A;  4NC6 A;  5C1B A;  3U6S A;  2CV0 A;  1Q3C A;  1GL7 A;  1G8P A;  3LQR A;  5EP2 A;  4LF7 M;  4NL4 H;  1N34 M;  1UM8 A;  5EP1 A;  2L7H A;  3IHP A;  4YHH M;  1L2B A;  3SAS A;  2RGO A;  2KEB A;  2R65 A;  1L8Q A;  3GQ4 A;  3UMM A;  2JNH A;  4LF4 M;  3H4M A;  2LNH C;  2P5T A;  1XB2 B;  4DV0 M;  4AG5 A;  4M9Z A;  4LJ9 A;  1IBK M;  3K9P A;  2L2D A;  1Z6T A; 
#chains in the Genus database with same CATH homology
 2BJV A;  3E4R A;  3GRY A;  4QHT A;  4JI3 M;  4L15 A;  4FCT A;  1W5S A;  3A98 B;  4GHA A;  3ILK A;  3KSX A;  2Z7J A;  4MH0 E;  4REZ A;  4DR3 M;  1ZQ9 A;  2QEN A;  3KFU G;  3TPZ A;  4LZJ A;  2JA2 A;  4G4R A;  4D80 A;  2UXC M;  2XF3 A;  1YSY A;  2C98 A;  3HGI A;  3SMS A;  1QAQ A;  4QHS A;  4L78 A;  2UUC M;  3U6D A;  2Y21 A;  5JI2 E;  1L1Z A;  1QVR A;  2QZ4 A;  4GMQ A;  3PNV A;  1SXJ B;  5ITX A;  5KPT A;  1DGG A;  2R45 A;  3JR5 A;  3U5Z A;  3KSJ A;  4IBI A;  4IBC A;  4CGY B;  1HT2 E;  2KZS A;  3J2P B;  3FYD A;  3WHL A;  4GKJ M;  5KQD A;  1HQC A;  5EP4 A;  3GLG A;  3VFD A;  3TWK A;  4IIW A;  5DYG A;  1HQY E;  4DV3 M;  1Z5C A;  4L16 A;  2ZAM A;  4IBE A;  5KQ8 A;  4X66 M;  5IRE B;  1N75 A;  1KSF X;  1JQJ C;  4DUZ M;  4LFC M;  4PCZ A;  2ZAO A;  3T15 A;  1OJL A;  4LJ5 A;  1K3W A;  2KRK A;  2QCU A;  2KXE A;  4L4U A;  4NOO B;  3HU1 A;  3THG A;  1IXZ A;  2ZAN A;  3FKE A;  2UUB M;  2ZM6 M;  4JI6 M;  4MB7 A;  1DGF A;  2J7O A;  2M5Z A;  1IN8 A;  5DNY A;  1KFV A;  1GLN A;  1E32 A;  2J7N A;  3M6A A;  1G3I A;  4KOD A;  1X37 A;  4PDI A;  3J81 S;  1I94 M;  2X4A A;  4B3T M;  3CTW B;  5IZ7 D;  4Z6Y A;  1IXR C;  1MU5 A;  2L7I A;  4S12 A;  3BOS A;  3FYC A;  3VDP A;  3AJI B;  4P16 A;  1N32 M;  4LFA M;  3KXE C;  1N33 M;  2XFS A;  3SYK A;  3U5Z B;  1IN4 A;  4MGK E;  5H37 D;  2FE8 A;  4NXN M;  2XFT A;  3GLH B;  1NHG C;  2XGN A;  2BJW A;  5FSW A;  4M9S A;  3VK8 A;  3EIE A;  3T38 A;  3GLG B;  1W5T A;  3MK6 A;  3FD9 A;  2KW0 A;  4JI7 M;  3FTE A;  3GPX A;  4LGM A;  5IT9 S;  4LG2 A;  1GVN A;  5C18 A;  3KS4 A;  3TWL A;  4LF6 M;  4DUY M;  3JR4 A;  4HL4 A;  3U6O A;  2F5O A;  5GKN A;  1GL6 A;  2BNK A;  2KA6 B;  3HWS A;  1QYR A;  4LJ6 A;  4JI0 M;  4LF5 M;  1K3X A;  2QP9 X;  3M7G A;  4RF1 A;  3AOG A;  3AV0 A;  4IBK A;  2F5S A;  3Q8X A;  2RKO A;  3UK6 A;  4NRW A;  4FWD A;  3K8Z A;  3GPY A;  4MGY E;  3RGS A;  2UXB M;  1ZAE A;  2XLJ A;  1NY6 A;  3OTO M;  1XXH A;  2DXI A;  4M0D A;  4JN6 A;  4AKH A;  3K92 A;  1HT1 E;  4GIT A;  4IBF A;  3R9X B;  1J7K A;  4X62 M;  2CHQ A;  3SBJ A;  4LF8 M;  1SXJ C;  2R18 A;  1Z5A A;  2VQE M;  1XWI A;  2XSZ D;  4GC9 A;  4QNM A;  2DWN A;  1WXQ A;  4B08 A;  3SAV A;  3TQS A;  4B7G A;  1J5E M;  3KOW E;  2K47 A;  3SMP A;  5FTK A;  1SXJ E;  2LXE A;  4DV4 M;  4IJF A;  1ORY B;  1IQP A;  3FUX A;  1KYI A;  3GO8 A;  1DGH A;  1I4W A;  3KW6 A;  2YNM D;  3VKG A;  4NXM M;  1J09 A;  4QOS A;  4FVM A;  2DVW B;  2C99 A;  3I4Y A;  3L27 A;  1XHB A;  4XGI A;  3L28 A;  2XH9 A;  4IBB A;  3CF6 E;  5ITQ A;  4DR4 M;  7CAT A;  3CF2 A;  4PD2 A;  3PFI A;  5BPV A;  1NVM A;  2CV1 A;  2W82 A;  3T1Y M;  4GRI A;  4LJ7 A;  4GHL A;  3L29 A;  2DWL A;  2D7H A;  1L1T A;  1TH3 A;  2X49 A;  3CF0 A;  2FOI C;  4G6Z A;  4JI8 M;  4LFB M;  1DO2 A;  4CHT B;  3DA1 A;  3UGJ A;  4AKI A;  4WW0 A;  1XXH B;  3L2A A;  3K2L A;  2L6O A;  3JAM S;  3FUW A;  1XMQ M;  1R2Z A;  4IBD A;  1IXS B;  2YQZ A;  3AOE A;  3NWL A;  3IG8 A;  1G4A E;  1JR3 D;  4BBA A;  4B3S M;  1NNU C;  3GPP A;  1SXJ D;  4A3V B;  1PJJ A;  3DZD A;  4I5S A;  5FTL A;  4AG6 A;  1QQW A;  4JV5 M;  3UJN A;  3DOA A;  3W0L B;  2DHR A;  3EIH A;  3HJ8 A;  4AW4 A;  1HNW M;  4QOZ C;  3ZCB B;  4LJA A;  5ITX E;  4XBO A;  1TDH A;  2X8A A;  3KVW A;  1XMO M;  2UXD M;  1IN6 A;  4JI2 M;  2ERC A;  1Z59 A;  3SAT A;  3A46 A;  1DGH B;  4LJ8 A;  5KO3 A;  3TE6 A;  2M60 A;  2Z4R A;  3PVS A;  1D2N A;  5JI3 E;  5FTN A;  4PT5 A;  3VLF B;  2V1U A;  1NJG A;  2O5R A;  4R3D A;  4GIP A;  5ITU A;  5E6J A;  3HJQ A;  2R4E A;  2FNA A;  1HNZ M;  5FLX S;  1YE9 A;  2XSZ A;  2Z4S A;  2G8L A;  3NBI A;  4LRS A;  3TL4 X;  5ITR A;  4M9X A;  4JI1 M;  3DFZ A;  4WUR A;  4OVZ A;  4AZF A;  4II7 A;  3A42 A;  4LF9 M;  3E9S A;  3HHW A;  3FUT A;  1QAN A;  5FTJ A;  3VK7 A;  3ZH9 B;  2F5N A;  3GLI A;  2H1R A;  1E9R A;  3GQ5 A;  3QAU A;  2XZF A;  4FWG A;  1L2D A;  4DR2 M;  3R8F A;  2NQ8 C;  3HHX A;  1MX0 A;  2E5L M;  1YUB A;  3PNY A;  1T3T A;  4FCV A;  3RFW A;  3GPU A;  1HNX M;  1E94 E;  3GRU A;  3WHK A;  4BLC A;  3D8B A;  3GRR A;  3B9P A;  1DGB A;  2C9C A;  4NRV A;  1FJG M;  3KOZ E;  4OW0 A;  4Z8X A;  4JI5 M;  2ZBK B;  3QWL A;  3SAW A;  1R2Y A;  1IN5 A;  4D81 A;  2CEA A;  3U6L A;  2YR0 A;  2EO2 A;  4AQY M;  1QAO A;  2I7P A;  4KHP M;  4X64 M;  2AHM A;  2XZU A;  4I4L A;  4MGH A;  2CV2 A;  3FTD A;  1C1K A;  2F4V M;  2F5Q A;  3D8L A;  4LY6 A;  1PJI A;  2XEP A;  4DR1 M;  4RF0 A;  2HL7 A;  3L25 A;  4B3R M;  3J27 B;  3LMM A;  3SFZ A;  4W5W A;  4YY3 M;  1JR3 A;  4JXJ A;  2CUZ A;  3AKZ A;  4B7F A;  4LRT A;  2Z3X A;  3FTF A;  2EUC A;  4DR5 M;  4AI6 A;  4LJ4 A;  1S3S A;  4MGI E;  4MM3 B;  4OVZ B;  5FTM A;  3KOY E;  3KP0 E;  2DZO B;  3GLI B;  4OX9 M;  4FW9 A;  4MGZ E;  3HHZ A;  5A2Q S;  5EJC A;  2KRU A;  2Q2E B;  2G5G X;  4IJE A;  4B7H A;  2QBY A;  3HU2 A;  1L2C A;  1QAM A;  1Z5B A;  4LZZ A;  3U61 A;  4JI4 M;  1OFI A;  4I81 A;  2D7G A;  3IG5 A;  1NJF A;  4G4Q A;  2DWM A;  4ZPX A;  4G4N A;  4EIW A;  2Y0T A;  2LWX A;  2HCB A;  1IN7 A;  2V1C A;  4GH9 A;  4X65 M;  1IY1 A;  2FFJ A;  2I7N A;  4NSR A;  4GC5 A;  3SYL A;  4JYA M;  3RE8 A;  4DV7 M;  1E9S A;  3L26 A;  4DV2 M;  5IWA M;  4DV1 M;  1NY5 A;  5KPZ A;  5F3W A;  1IY2 A;  1IBL M;  2CFO A;  3PXG A;  3I4V A;  2Y0Q A;  1PM5 A;  3A45 A;  5KPR A;  1IM2 A;  4FCW A;  2KZU A;  1EE8 A;  5EXS A;  4FWH A;  3MHV C;  2V6Z M;  1H6U A;  1N36 M;  5EXP A;  3W0F A;  2VII A;  2R4J A;  2CHV A;  3TWM A;  4ITQ A;  4BB9 A;  2C5R A;  1GKI A;  1Q39 A;  4CIS A;  3GLH A;  5E26 A;  1NHW C;  3KS8 A;  3RGP A;  1R6B X;  1XC8 A;  1FNN A;  2QPA A;  1IY0 A;  3SHF A;  3GLF A;  5LMU M;  2QBY B;  4DV6 M;  1Q3B A;  2VQF M;  2HKJ A;  3U61 B;  3AOE C;  4R7G A;  1TDZ A;  2Y20 A;  3J7A S;  2D7E A;  2DWZ B;  3HJS A;  3SAR A;  2CE7 A;  3LVW A;  3U60 A;  8CAT A;  5EXT A;  3HKP A;  3KP1 E;  3U6E A;  4TUW A;  4FD2 A;  3M0E A;  4IBJ A;  4HLQ A;  3J7B A;  3I51 A;  4DR7 M;  3C58 A;  4NSO B;  3GP1 A;  5DYI A;  2EA0 A;  3UZU A;  1VDD A;  4M0W A;  2C96 A;  5ITT A;  4L8R C;  4GKK M;  4IBG A;  4DV5 M;  3U6M A;  4KO8 A;  1TH4 A;  4PDG A;  2R46 A;  4LCB A;  2DZN B;  2RGH A;  3FUU A;  2OQ4 A;  3J80 S;  1DO0 A;  3KDS E;  4G4O A;  2UU9 M;  3SC3 A;  2LH0 A;  2F5P A;  3AL0 C;  1R7R A;  3MJ5 A;  4LGY A;  4K0K M;  1N77 A;  3VDU A;  4B3M M;  5EXX A;  1NNJ A;  3K1J A;  2L09 A;  1G59 A;  3AFH A;  2CHG A;  5LMN M;  3GLF B;  1LV7 A;  2YFQ A;  3U6C A;  1TH2 A;  5EP3 A;  1QZM A;  1N78 A;  1G41 A;  4OU7 A;  5EQT A;  1OFH A;  1XNR M;  1TGU A;  3U6Q A;  3HHY A;  3LVV A;  4QNR A;  3KOX E;  1NSF A;  2R62 A;  4AKG A;  1IBM M;  3FTC A;  3U60 B;  1SXJ A;  2UUA M;  1K82 A;  2OPF A;  3GQ3 A;  3T1H M;  2C9O A;  2A5Y B;  3ZC7 B;  3U6P A;  4KLN A;  4DR6 M;  4I8O A;  5BR8 M;  3SAU A;  3HU3 A;  5ITY A;  3LQQ A;  2HHH M;  4RNA A;  1XNQ M;  1HR0 M;  3VKH A;  5C1B A;  3FUV A;  4D82 A;  3SHG B;  3U6S A;  3GRV A;  2CV0 A;  1Q3C A;  1GL7 A;  1G8P A;  3LQR A;  5EP2 A;  4LF7 M;  4NL4 H;  1N34 M;  1UM8 A;  5EP1 A;  2L7H A;  4YHH M;  1L2B A;  3SAS A;  2RGO A;  2KEB A;  2R65 A;  1L8Q A;  3GQ4 A;  3UMM A;  4LF4 M;  3H4M A;  2LNH C;  2P5T A;  4DV0 M;  4AG5 A;  4M9Z A;  4LJ9 A;  1IBK M;  1Z6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...