2KZSA

Daxx helical bundle (dhb) domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Death-associated protein 6
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzsA00
2KZUA 2KZSA
chains in the Genus database with same CATH superfamily
2VQFM 3U6MA 3PXGA 4QOSA 1DGGA 1G41A 2JY8A 3TQSA 1TR8A 3E21A 4NSOB 1QAOA 3M7GA 4FWHA 2LVOC 4K0KM 4HEOA 2C9OA 4GH9A 3PNYA 1OAIA 3U6SA 3BBZA 3IECA 1TF0B 1N77A 1K82A 4F1IA 2RRUA 3AKZA 2OOAA 4I5SA 4G4QA 3CF0A 3LCVB 2QBYA 2HHHM 3FTDA 2UXCM 3SC3A 3T6PA 2Z7JA 1OJLA 3IG5A 3HHYA 4G4NA 4F2LA 3M0EA 3KSJA 4NRVA 1XMQM 3GLIE 2Y20A 5ITRA 4M9XA 2DWZB 2HAKA 4LFCM 3D8LA 3QWLA 2DWNA 4I4LA 1IQPA 3J80S 2FE8A 1QZMA 2L2DA 2LHGA 2J7NA 1E9SA 3RE8A 3ZC7B 3A46A 3EIEA 1AIPC 3CGWA 3GQ5A 4YHHM 1N34M 3AOGA 2KNZA 4D81A 2DZOB 4LFAM 4XBOA 3LMMA 3W0FA 1S3SA 3KVWA 2XFTA 1G59A 1T3TA 2CWBA 1VQ1A 4OW0A 4DV3M 2BWEA 2M5ZA 4FVMA 1J5EM 2Z4RA 2EKKA 3CTWB 2ZTCA 3KXEC 4X66M 2MJ5B 1L1TA 1QVRA 1GJSA 8CATA 1KSFX 4JI5M 2N35A 2YFQA 2DAGA 2R4EA 1NY6A 2ZANA 3TL4X 2QSFX 3GLGE 1F4IA 2UUCM 1JR3E 2JZ1A 3U6DA 1QDRA 3GLFE 4LY6A 2QZ4A 3SASA 2Z3XA 4DR7M 2LBCA 1PJQA 3B7ZA 2VF7A 2R45A 3FUTA 2RGOA 5LMUM 2YR0A 4LF8M 2MROB 4NRWA 1ZQ9A 5IREB 1EIJA 2W82A 4FWGA 1XNRM 3C3DA 2DI0A 2VQEM 1LV7A 3TWMA 1Z5BA 1AUAA 3KP1E 3SAUA 1L2DA 5L8RF 2Z4SA 2WSCF 2YQZA 1NHWC 4DUYM 3NBXX 4LCBA 3VK8A 2KDLA 1N78A 1PJIA 2H5XA 1MN3A 2C96A 3QAUA 1OKSA 1X37A 3KP0E 2DAEA 4LFBM 5LMNM 2QQ8A 3FTFA 4LJ4A 2K9DA 4JYAM 4GKKM 4MH0E 4GC9A 2J7OA 2OPFA 2O25A 1K3WA 4D82A 4A3VB 4L16A 2DXIA 2XSZA 3HU2A 3L26A 3KS8A 4DR6M 1NO1A 1QDTA 4GIPA 1IN8A 5EXSA 4DBGB 1K3XA 1PJJA 2G5GX 5IZ7D 4FD2A 3GLIA 1SG9A 3ZCBB 2K6BA 4AI6A 3I01M 4TUWA 1PRBA 3E46A 3H4MA 2CHQA 2NQ8C 2XH9A 3K9PA 2XEPA 3B89A 4IBBA 5IT9S 4FCTA 4P16A 3SBJA 3KOYE 3U61B 4JI6M 2ERCA 4L78A 2F5NA 2L4FA 3J7BA 2WSFF 2L09A 2JP7A 2R62A 3HKPA 2XGNA 3WHKA 2CV2A 2RKOA 1TDHA 4DV2M 2DAKA 1D0LA 1E32A 4I81A 3K1JA 4OX9M 1W5TA 3L2AA 1BVSA 1NVMA 3D8BA 1TH2A 3C58A 3Q8GA 2QNJA 3UMMA 4LF6M 1V33A 3LCUA 1IFYA 1IN5A 5EQTA 2A5YB 2CHVA 1HJPA 4LG2A 4WURA 3KW6A 3GQ4A 1WIVA 2DAMA 3FTCA 1HNZM 3MHVC 7CATA 2XZUA 2Q2EB 2WZJA 1VG5A 3AFHA 4S12A 2KZSA 3U60A 3DFZA 4IBEA 4GHLA 1XXHB 2R0IA 1N32M 4PDIA 2F5PA 3DOAA 4LF5M 1CUKA 1WGNA 1YE9A 1WR1B 4JI3M 2E5LM 4JI2M 3FRHA 3SYLA 2LNHC 4JI7M 3L27A 3SHGB 2R65A 2Y0TA 1PGYA 4DV4M 2HCBA 4GRIA 1NY5A 1OIPA 4DV5M 2X8AA 3GRUA 3NWLA 4B7GA 3KS4A 2YNMD 1D0MA 4QHSA 4LGYA 3F92A 3T1YM 1JR3A 1IN4A 1SXJA 2DHRA 2LVAA 3VLFB 3WHLA 2H1RA 2P5TA 1YLAA 5BR8M 3MMPA 3HWSA 2BNKA 2CV1A 2XFSA 3MK6A 1IXZA 5ITXE 1HQCA 2FNAA 3GLIB 2F4VM 1Q39A 1G3IA 3HHXA 1KFVA 3HU1A 2LH0A 4JI0M 2GNOA 4X65M 3SARA 3AL0C 4OU7A 4JV5M 3C3EA 3VDPA 1NNUC 4QOZC 4I8OA 1RU3A 2R46A 4B3SM 4DV0M 1GL6A 2DNAA 5E26A 1R2ZA 4AZFA 1KYIA 3SAWA 1D2NA 3I51A 4ZPXA 3R9XB 1L8QA 4G4RA 4X62M 3FUWA 1H6UA 2I7NA 5EXTA 3ZQJA 1XMOM 2BWBA 4OVZA 1SXJE 1V92A 2XF3A 4LJ6A 4R3DA 3HZJA 2CHGA 4LF9M 4DR4M 4ANRA 3DA1A 3E9SA 2XLJA 1HQYE 3Q8XA 2DZLA 4AW4A 2UUAM 5EP3A 2R6FA 4G4OA 1QUTA 3K8ZA 4QNMA 4II7A 4JN6A 5EXPA 4IBGA 2F5QA 1IBLM 1GO5A 1MU5A 1ZMWA 3NBIA 3U5ZA 2C98A 4UN2B 3SMPA 4M9SA 1J09A 4QNRA 1XXHA 2FOIC 1WHCA 1XHBA 4GEWA 4GITA 1GL7A 4PDGA 4W5WA 3B7NA 2CV0A 2EO2A 3AOEC 1DGHA 3JR5A 4NC6A 2QP9X 2JY7A 2DKLA 3HHWA 4OVZB 4GKJM 4IBDA 4BB9A 3T1HM 3TWKA 2QHOB 5DYIA 4NOOB 4CHTB 3VKHA 3CF6E 2JY5A 2CUZA 1SXJC 1Z59A 2CFOA 1FJGM 1NV8A 2LHCA 2Z8YM 1IXSA 1I94M 1EE8A 4XK8F 4B3MM 3LW5F 4RF0A 2R18A 3M6AA 1G71A 1NJGA 3GRRA 4AKIA 4MM3B 2EKFA 1IN6A 2MH8A 3LVWA 3ILKA 1Z5AA 1GVNA 1YSYA 1G4AE 2DVWB 2LVNC 2ZBKB 4KODA 5H37D 1XNQM 1E9RA 4MGZE 4DV6M 3FKEA 2UUBM 1UFZA 5EP1A 4Z8XA 1T43A 3FYDA 2G3QA 3J7AS 1MX0A 2UXBM 2MGWA 3GRYA 1DGFA 2EUCA 1IXRC 2LVQD 3B7QA 3I4YA 4M0WA 3JR4A 5EXXA 1XB2B 4R71A 4NXNM 2R44A 3BXWA 4LZZA 1R2YA 4NXMM 3KDSE 3GPPA 2WSEF 3I04M 1V34A 3LQQA 3U5ZB 1N36M 4GHAA 2KRKA 1IM2A 4MB7A 1TGUA 3UK6A 2L7HA 3SHFA 3AOEA 1VEKA 4BLCA 3GQ3A 2OQ4A 1DV0A 4LF4M 1IY0A 1GABA 3H4JA 3FYCA 1VDDA 3V76A 2X49A 4B7FA 1L2CA 3RGSA 4KLNA 3KOXE 3HJSA 4WP2A 2D7EA 3VDUA 2LTUA 1Q3BA 4G6ZA 5C18A 2L4EA 2C99A 4RF1A 4IBFA 4IBIA 5DFLA 4YY3M 1XXHE 3K2LA 3SYKA 4PD2A 1N75A 3A42A 1HT2E 1OQYA 3U6PA 3U6EA 5F3WA 4MGYE 2ZM6M 1Y8GA 1QZEA 4LJ7A 1QAMA 2K47A 2V1CA 2VDBB 1ZMVA 2CP8A 1QQWA 3U6OA 1IN7A 3UJNA 1NHGC 3T38A 2D7HA 3I4VA 4HLQA 5KPRA 2B3TA 2R4JA 3HX3A 4M9ZA 2OO9A 2CRUA 1L2BA 5E6JA 4DV7M 4AQYM 5KPTA 1VEJA 1EFUB 1QUSA 4GC5A 2LWXA 3B9PA 4KO8A 1L1ZA 4MGKE 2DWLA 3TPZA 1D0KA 1P3QQ 2L7IA 3BOSA 3FE3A 3GPYA 2KNVA 4DR1M 5FSWA 4DR5M 4L6V6 4R7GA 2RGHA 2QCUA 5FTKA 5FTLA 1LTMA 2KNAA 5EJCA 1UM8A 3U6QA 3FUVA 3W67A 4DR3M 4X64M 4KHPM 4FWDA 4B7HA 4Q7JA 4XGIA 1NV9A 3HHZA 4AKHA 5ITXA 4IBJA 5C1BA 2C5RA 4DV1M 2V1UA 3OTOM 3SMSA 1XC8A 3C9PA 1VDLA 3J2PB 2C9CA 1ORYB 4CGYB 4NL4H 4IIWA 1T6OA 2DENA 5KO3A 3LVVA 5FTMA 4CJ6A 4JI4M 1DO0A 2F5OA 3UGJA 4BBAA 4CIZA 5KPZA 4NSRA 3J27B 1PM5A 2LXEA 4DUZM 1TH3A 1C7YA 4B08A 3SAVA 3LQRA 5GKNA 3A45A 4IBKA 1WJ7A 1Z5CA 3B74A 2XZFA 4FW9A 2GQFA 4JXJA 4LRSA 2DHYA 1TH4A 1JQJC 4Y28F 2EA0A 3GLGB 2HL7A 2FFJA 3GPXA 1MJGM 4JI8M 1OAOC 2Y21A 2KA6B 1ZV1A 1PJSA 4GMQA 3VK7A 5KQDA 1DGBA 1HT1E 3KFUG 3VKGA 3QYBA 1ZAEA 2J5YA 4IJEA 2KEBA 5IWAM 4LJ5A 4LF7M 4G3OA 1I4WA 2DZNB 3GLHA 5ITUA 3R8FA 4Z6YA 3FUXA 2APLA 2BJWA 4LGMA 2JNHA 3GLFB 2AHMA 3L25A 3AJIB 2K0BX 4LJ9A 3THGA 3HGIA 2JY6B 3MJ5A 3PNVA 5JI3E 3GLGA 1XWIA 1GLNA 4MGIE 1QANA 2MR9A 5FTNA 4B3TM 3J81S 2OOBA 2JWSA 3L29A 1OFIA 1HNXM 3RFWA 4B3RM 3W0LB 4D80A 2KXEA 4LRTA 1TDZA 2DWMA 4CISA 5FTJA 2ZAMA 1OFHA 1NJFA 1R7RA 2QENA 1R6BX 1Q3CA 4AG5A 3FRIA 3GLHB 2UXDM 3EIHA 1IBKM 2LVPC 3TE6A 1QAQA 5FLXS 2ZTDA 3RGPA 2VF8A 4LJAA 4HL4A 5A2QS 3GLFA 1E94E 1W5SA 3FTEA 2QPAA 4P17A 1NSFA 3HJ8A 1SXJB 2F5SA 1IY1A 1G8PA 1GJTA 1Z6TA 4KT0F 4REZA 4LZJA 4ITQA 1HNWM 1NNJA 3HJQA 4IJFA 4DR2M 2EJSA 3CF2A 3SFZA 2CE7A 3UZUA 4QHTA 1C1KA 2VIIA 1Q02A 1QYRA 1SXJD 5ITYA 2KRUA 3QYEA 4L8RC 1VEGA 1OIZA 2XSZD 3L28A 2I7PA 1JR3D 1R5LA 2KHHA 1WGLA 3GRVA 2JUJA 2G8LA 3T15A 2Y0QA 4EIWA 1A5TA 2O5RA 3FUUA 3PFIA 2BJVA 2JZ0A 1YUBA 2HWJA 3GO8A 4AKGA 2M60A 2CEAA 3U61A 2JA2A 5EP4A 4FCVA 4PT5A 2O01F 3JAMS 1J7KA 4LJ8A 1R4GA 1WXQA 5BPVA 1DGHB 4FCWA 3GP1A 1JB0F 4M0DA 5EP2A 1TTEA 3HU3A 2D7GA 4L15A 3W68A 2HKJA 1DO2A 3GLHE 5JI2E 3KOWE 2UU9M 1N33M 3HY5A 4RNAA 4MGHA 1ZMUA 3K92A 2KZUA 3SATA 4JI1M 1GKIA 1HR0M 3DZDA 3AV0A 3FD9A 3IHPA 5ITTA 3A98B 4WW0A 1OTRA 4IBCA 5DYGA 2L6OA 5KQ8A 4AG6A 1IXSB 3E4RA 4RKUF 3ZH9B 2ZAOA 3KSXA 4PCZA 5DNYA 2FS1A 3U6CA 3VFDA 1PJTA 3K9OA 2V6ZM 3PVSA 3U60B 3GPUA 1IY2A 1IBMM 4L4UA 2X4AA 3IG8A 2JXNA 3TWLA 2FH0A 2QBYB 1FNNA 5ITQA 2KW0A 3U6LA 2DAIA 3KOZE
chains in the Genus database with same CATH topology
2VQFM 3U6MA 3PXGA 4QOSA 1DGGA 1G41A 3TQSA 4NSOB 1QAOA 3M7GA 4FWHA 4K0KM 2C9OA 4GH9A 3PNYA 3U6SA 1N77A 1K82A 3AKZA 4G4QA 4I5SA 3CF0A 2QBYA 2HHHM 3FTDA 2UXCM 3SC3A 2Z7JA 1OJLA 3IG5A 3HHYA 4G4NA 3M0EA 3KSJA 4NRVA 1XMQM 2Y20A 5ITRA 4M9XA 2DWZB 4LFCM 3D8LA 3QWLA 2DWNA 4I4LA 1IQPA 3J80S 2FE8A 1QZMA 3RE8A 2J7NA 1E9SA 3ZC7B 3A46A 3EIEA 3GQ5A 4YHHM 1N34M 3AOGA 4D81A 2DZOB 4LFAM 4XBOA 3LMMA 3W0FA 1S3SA 3KVWA 2XFTA 1G59A 1T3TA 4OW0A 4DV3M 2M5ZA 4FVMA 1J5EM 2Z4RA 3CTWB 3KXEC 4X66M 1L1TA 1QVRA 8CATA 1KSFX 4JI5M 2YFQA 2R4EA 2ZANA 1NY6A 3TL4X 2UUCM 3U6DA 3SASA 4LY6A 2QZ4A 2Z3XA 4DR7M 4LF8M 4NRWA 2R45A 3FUTA 2RGOA 5LMUM 2YR0A 1ZQ9A 5IREB 2W82A 4FWGA 1XNRM 2VQEM 1LV7A 3TWMA 1Z5BA 3KP1E 3SAUA 1L2DA 2Z4SA 2YQZA 1NHWC 4DUYM 4LCBA 3VK8A 1N78A 1PJIA 2C96A 3QAUA 1X37A 3KP0E 4LFBM 5LMNM 3FTFA 4LJ4A 4JYAM 4GKKM 4MH0E 4GC9A 2J7OA 2OPFA 1K3WA 4D82A 4A3VB 4L16A 2DXIA 2XSZA 3HU2A 3KS8A 4DR6M 4GIPA 1IN8A 5EXSA 1K3XA 1PJJA 2G5GX 5IZ7D 4FD2A 3GLIA 3ZCBB 4AI6A 4TUWA 3H4MA 2CHQA 2NQ8C 2XH9A 2XEPA 4IBBA 5IT9S 4FCTA 4P16A 3SBJA 3KOYE 3U61B 4JI6M 2ERCA 4L78A 2F5NA 3J7BA 2L09A 2R62A 3HKPA 3WHKA 2XGNA 2CV2A 2RKOA 1TDHA 4DV2M 1E32A 4I81A 3K1JA 4OX9M 1W5TA 3L2AA 1NVMA 3D8BA 1TH2A 3C58A 3UMMA 4LF6M 1IN5A 5EQTA 2A5YB 2CHVA 4LG2A 4WURA 3KW6A 3GQ4A 3FTCA 1HNZM 3MHVC 7CATA 2XZUA 2Q2EB 4S12A 3AFHA 2KZSA 3U60A 3DFZA 4IBEA 4GHLA 1XXHB 1N32M 4PDIA 2F5PA 3DOAA 1YE9A 4JI3M 2E5LM 4JI2M 4JI7M 3SYLA 2LNHC 3L27A 3SHGB 2R65A 2Y0TA 4DV4M 2HCBA 4GRIA 1NY5A 4DV5M 2X8AA 3GRUA 3NWLA 4B7GA 3KS4A 2YNMD 4QHSA 4LGYA 3T1YM 1JR3A 1IN4A 1SXJA 2DHRA 3VLFB 3WHLA 2H1RA 2P5TA 2CV1A 5BR8M 3HWSA 2BNKA 2XFSA 3MK6A 1IXZA 5ITXE 1HQCA 2FNAA 3GLIB 2F4VM 1Q39A 1G3IA 3HHXA 1KFVA 3HU1A 2LH0A 4JI0M 4X65M 3SARA 3AL0C 4JV5M 4OU7A 3VDPA 1NNUC 4QOZC 4I8OA 2R46A 4B3SM 4DV0M 1GL6A 5E26A 1R2ZA 4AZFA 1KYIA 3SAWA 1D2NA 3I51A 4ZPXA 3R9XB 1L8QA 4G4RA 4X62M 3FUWA 1H6UA 2I7NA 5EXTA 1XMOM 4OVZA 1SXJE 2XF3A 4LJ6A 4R3DA 2CHGA 4LF9M 4DR4M 3DA1A 3E9SA 2XLJA 1HQYE 3Q8XA 4AW4A 2UUAM 5EP3A 4G4OA 3K8ZA 4QNMA 2F5QA 4II7A 4JN6A 5EXPA 4IBGA 1IBLM 1MU5A 3NBIA 3U5ZA 2C98A 3SMPA 4M9SA 1J09A 4QNRA 1XXHA 2FOIC 1XHBA 4GITA 1GL7A 4PDGA 4W5WA 2CV0A 2EO2A 3AOEC 1DGHA 3JR5A 2QP9X 3HHWA 4OVZB 4GKJM 4IBDA 4BB9A 3T1HM 3TWKA 5DYIA 4NOOB 4CHTB 3VKHA 3CF6E 2CUZA 1SXJC 1Z59A 2CFOA 1FJGM 1I94M 1EE8A 4B3MM 4RF0A 2R18A 3M6AA 1NJGA 3GRRA 4AKIA 4MM3B 1IN6A 3LVWA 3ILKA 1Z5AA 1GVNA 1YSYA 1G4AE 2DVWB 2ZBKB 4KODA 1XNQM 5H37D 1E9RA 4MGZE 4DV6M 3FKEA 2UUBM 5EP1A 4Z8XA 3FYDA 3J7AS 1MX0A 2UXBM 3GRYA 1DGFA 2EUCA 1IXRC 3I4YA 4M0WA 3JR4A 5EXXA 4NXNM 4LZZA 1R2YA 4NXMM 3KDSE 3GPPA 3LQQA 3U5ZB 1N36M 4GHAA 2KRKA 1IM2A 4MB7A 1TGUA 3UK6A 2L7HA 3SHFA 3AOEA 4BLCA 2OQ4A 3GQ3A 4LF4M 1IY0A 3FYCA 1VDDA 2X49A 4B7FA 1L2CA 3RGSA 4KLNA 3KOXE 3HJSA 3VDUA 2D7EA 1Q3BA 4G6ZA 5C18A 2C99A 4RF1A 4IBFA 4IBIA 4YY3M 3SYKA 3K2LA 4PD2A 1N75A 3A42A 1HT2E 3U6PA 3U6EA 5F3WA 4MGYE 2ZM6M 4LJ7A 1QAMA 2K47A 2V1CA 1QQWA 3U6OA 1IN7A 3UJNA 1NHGC 3T38A 2D7HA 3I4VA 4HLQA 5KPRA 2R4JA 4M9ZA 1L2BA 5E6JA 4DV7M 4AQYM 5KPTA 4GC5A 2LWXA 3B9PA 4KO8A 1L1ZA 4MGKE 2DWLA 3TPZA 3BOSA 2L7IA 3GPYA 4DR1M 5FSWA 4DR5M 4R7GA 2RGHA 2QCUA 5FTKA 5FTLA 5EJCA 1UM8A 3U6QA 3FUVA 4DR3M 4X64M 4KHPM 4FWDA 4B7HA 4XGIA 3HHZA 4AKHA 5ITXA 4IBJA 5C1BA 2C5RA 4DV1M 2V1UA 3OTOM 3SMSA 1XC8A 3J2PB 2C9CA 1ORYB 4CGYB 4NL4H 4IIWA 5KO3A 3LVVA 5FTMA 4JI4M 1DO0A 2F5OA 3UGJA 4BBAA 5KPZA 4NSRA 3J27B 1PM5A 2LXEA 4DUZM 1TH3A 4B08A 3SAVA 3LQRA 5GKNA 3A45A 4IBKA 1Z5CA 2XZFA 4FW9A 4JXJA 4LRSA 2EA0A 1TH4A 1JQJC 3GLGB 2HL7A 2FFJA 3GPXA 4JI8M 2Y21A 2KA6B 4GMQA 3VK7A 5KQDA 1DGBA 1HT1E 3KFUG 3VKGA 1ZAEA 4IJEA 2KEBA 5IWAM 4LJ5A 4LF7M 1I4WA 2DZNB 3GLHA 5ITUA 3R8FA 4Z6YA 3FUXA 2BJWA 4LGMA 3GLFB 2AHMA 3L25A 3AJIB 4LJ9A 3THGA 3HGIA 3MJ5A 5JI3E 3PNVA 3GLGA 1XWIA 1GLNA 4MGIE 1QANA 5FTNA 4B3TM 3J81S 3L29A 1OFIA 1HNXM 3RFWA 4B3RM 3W0LB 4D80A 2KXEA 4LRTA 1TDZA 2DWMA 4CISA 5FTJA 2ZAMA 1OFHA 1NJFA 1R7RA 2QENA 1R6BX 1Q3CA 4AG5A 3GLHB 2UXDM 3EIHA 1IBKM 3TE6A 1QAQA 5FLXS 3RGPA 4LJAA 4HL4A 5A2QS 3GLFA 1E94E 1W5SA 3FTEA 2QPAA 1NSFA 3HJ8A 1SXJB 2F5SA 1IY1A 1G8PA 1Z6TA 4REZA 4LZJA 4ITQA 1HNWM 1NNJA 3HJQA 4IJFA 4DR2M 3CF2A 3SFZA 2CE7A 3UZUA 4QHTA 1C1KA 2VIIA 1QYRA 1SXJD 5ITYA 2KRUA 4L8RC 2XSZD 3L28A 2I7PA 1JR3D 3GRVA 2G8LA 3T15A 2Y0QA 4EIWA 2O5RA 3FUUA 3PFIA 2BJVA 1YUBA 3GO8A 4AKGA 2M60A 2CEAA 3U61A 2JA2A 5EP4A 4FCVA 4PT5A 3JAMS 1J7KA 4LJ8A 1WXQA 5BPVA 3GP1A 1DGHB 4FCWA 4M0DA 5EP2A 4L15A 3HU3A 2D7GA 2HKJA 1DO2A 5JI2E 3KOWE 2UU9M 1N33M 4RNAA 4MGHA 3K92A 2KZUA 3SATA 4JI1M 1GKIA 1HR0M 3DZDA 3AV0A 3FD9A 5ITTA 3A98B 4WW0A 4IBCA 5DYGA 2L6OA 5KQ8A 4AG6A 1IXSB 3E4RA 3ZH9B 3L26A 2ZAOA 3KSXA 4PCZA 5DNYA 3U6CA 3VFDA 4LF5M 3U60B 2V6ZM 3PVSA 3GPUA 1IY2A 1IBMM 4L4UA 2X4AA 3IG8A 3TWLA 2QBYB 1FNNA 5ITQA 2KW0A 3U6LA 3KOZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZU A;  2KZS A; 
#chains in the Genus database with same CATH topology
 2VQF M;  3U6M A;  3PXG A;  4QOS A;  1DGG A;  1G41 A;  2JY8 A;  3TQS A;  1TR8 A;  3E21 A;  4NSO B;  1QAO A;  3M7G A;  4FWH A;  2LVO C;  4K0K M;  4HEO A;  2C9O A;  4GH9 A;  3PNY A;  1OAI A;  3U6S A;  3BBZ A;  3IEC A;  1TF0 B;  1N77 A;  1K82 A;  4F1I A;  2RRU A;  3AKZ A;  2OOA A;  4I5S A;  4G4Q A;  3CF0 A;  3LCV B;  2QBY A;  2HHH M;  3FTD A;  2UXC M;  3SC3 A;  3T6P A;  2Z7J A;  1OJL A;  3IG5 A;  3HHY A;  4G4N A;  4F2L A;  3M0E A;  3KSJ A;  4NRV A;  1XMQ M;  3GLI E;  2Y20 A;  5ITR A;  4M9X A;  2DWZ B;  2HAK A;  4LFC M;  3D8L A;  3QWL A;  2DWN A;  4I4L A;  1IQP A;  3J80 S;  2FE8 A;  1QZM A;  2L2D A;  2LHG A;  2J7N A;  1E9S A;  3RE8 A;  3ZC7 B;  3A46 A;  3EIE A;  1AIP C;  3CGW A;  3GQ5 A;  4YHH M;  1N34 M;  3AOG A;  2KNZ A;  4D81 A;  2DZO B;  4LFA M;  4XBO A;  3LMM A;  3W0F A;  1S3S A;  3KVW A;  2XFT A;  1G59 A;  1T3T A;  2CWB A;  1VQ1 A;  4OW0 A;  4DV3 M;  2BWE A;  2M5Z A;  4FVM A;  1J5E M;  2Z4R A;  2EKK A;  3CTW B;  2ZTC A;  3KXE C;  4X66 M;  2MJ5 B;  1L1T A;  1QVR A;  1GJS A;  8CAT A;  1KSF X;  4JI5 M;  2N35 A;  2YFQ A;  2DAG A;  2R4E A;  1NY6 A;  2ZAN A;  3TL4 X;  2QSF X;  3GLG E;  1F4I A;  2UUC M;  1JR3 E;  2JZ1 A;  3U6D A;  1QDR A;  3GLF E;  4LY6 A;  2QZ4 A;  3SAS A;  2Z3X A;  4DR7 M;  2LBC A;  1PJQ A;  3B7Z A;  2VF7 A;  2R45 A;  3FUT A;  2RGO A;  5LMU M;  2YR0 A;  4LF8 M;  2MRO B;  4NRW A;  1ZQ9 A;  5IRE B;  1EIJ A;  2W82 A;  4FWG A;  1XNR M;  3C3D A;  2DI0 A;  2VQE M;  1LV7 A;  3TWM A;  1Z5B A;  1AUA A;  3KP1 E;  3SAU A;  1L2D A;  5L8R F;  2Z4S A;  2WSC F;  2YQZ A;  1NHW C;  4DUY M;  3NBX X;  4LCB A;  3VK8 A;  2KDL A;  1N78 A;  1PJI A;  2H5X A;  1MN3 A;  2C96 A;  3QAU A;  1OKS A;  1X37 A;  3KP0 E;  2DAE A;  4LFB M;  5LMN M;  2QQ8 A;  3FTF A;  4LJ4 A;  2K9D A;  4JYA M;  4GKK M;  4MH0 E;  4GC9 A;  2J7O A;  2OPF A;  2O25 A;  1K3W A;  4D82 A;  4A3V B;  4L16 A;  2DXI A;  2XSZ A;  3HU2 A;  3L26 A;  3KS8 A;  4DR6 M;  1NO1 A;  1QDT A;  4GIP A;  1IN8 A;  5EXS A;  4DBG B;  1K3X A;  1PJJ A;  2G5G X;  5IZ7 D;  4FD2 A;  3GLI A;  1SG9 A;  3ZCB B;  2K6B A;  4AI6 A;  3I01 M;  4TUW A;  1PRB A;  3E46 A;  3H4M A;  2CHQ A;  2NQ8 C;  2XH9 A;  3K9P A;  2XEP A;  3B89 A;  4IBB A;  5IT9 S;  4FCT A;  4P16 A;  3SBJ A;  3KOY E;  3U61 B;  4JI6 M;  2ERC A;  4L78 A;  2F5N A;  2L4F A;  3J7B A;  2WSF F;  2L09 A;  2JP7 A;  2R62 A;  3HKP A;  2XGN A;  3WHK A;  2CV2 A;  2RKO A;  1TDH A;  4DV2 M;  2DAK A;  1D0L A;  1E32 A;  4I81 A;  3K1J A;  4OX9 M;  1W5T A;  3L2A A;  1BVS A;  1NVM A;  3D8B A;  1TH2 A;  3C58 A;  3Q8G A;  2QNJ A;  3UMM A;  4LF6 M;  1V33 A;  3LCU A;  1IFY A;  1IN5 A;  5EQT A;  2A5Y B;  2CHV A;  1HJP A;  4LG2 A;  4WUR A;  3KW6 A;  3GQ4 A;  1WIV A;  2DAM A;  3FTC A;  1HNZ M;  3MHV C;  7CAT A;  2XZU A;  2Q2E B;  2WZJ A;  1VG5 A;  3AFH A;  4S12 A;  2KZS A;  3U60 A;  3DFZ A;  4IBE A;  4GHL A;  1XXH B;  2R0I A;  1N32 M;  4PDI A;  2F5P A;  3DOA A;  4LF5 M;  1CUK A;  1WGN A;  1YE9 A;  1WR1 B;  4JI3 M;  2E5L M;  4JI2 M;  3FRH A;  3SYL A;  2LNH C;  4JI7 M;  3L27 A;  3SHG B;  2R65 A;  2Y0T A;  1PGY A;  4DV4 M;  2HCB A;  4GRI A;  1NY5 A;  1OIP A;  4DV5 M;  2X8A A;  3GRU A;  3NWL A;  4B7G A;  3KS4 A;  2YNM D;  1D0M A;  4QHS A;  4LGY A;  3F92 A;  3T1Y M;  1JR3 A;  1IN4 A;  1SXJ A;  2DHR A;  2LVA A;  3VLF B;  3WHL A;  2H1R A;  2P5T A;  1YLA A;  5BR8 M;  3MMP A;  3HWS A;  2BNK A;  2CV1 A;  2XFS A;  3MK6 A;  1IXZ A;  5ITX E;  1HQC A;  2FNA A;  3GLI B;  2F4V M;  1Q39 A;  1G3I A;  3HHX A;  1KFV A;  3HU1 A;  2LH0 A;  4JI0 M;  2GNO A;  4X65 M;  3SAR A;  3AL0 C;  4OU7 A;  4JV5 M;  3C3E A;  3VDP A;  1NNU C;  4QOZ C;  4I8O A;  1RU3 A;  2R46 A;  4B3S M;  4DV0 M;  1GL6 A;  2DNA A;  5E26 A;  1R2Z A;  4AZF A;  1KYI A;  3SAW A;  1D2N A;  3I51 A;  4ZPX A;  3R9X B;  1L8Q A;  4G4R A;  4X62 M;  3FUW A;  1H6U A;  2I7N A;  5EXT A;  3ZQJ A;  1XMO M;  2BWB A;  4OVZ A;  1SXJ E;  1V92 A;  2XF3 A;  4LJ6 A;  4R3D A;  3HZJ A;  2CHG A;  4LF9 M;  4DR4 M;  4ANR A;  3DA1 A;  3E9S A;  2XLJ A;  1HQY E;  3Q8X A;  2DZL A;  4AW4 A;  2UUA M;  5EP3 A;  2R6F A;  4G4O A;  1QUT A;  3K8Z A;  4QNM A;  4II7 A;  4JN6 A;  5EXP A;  4IBG A;  2F5Q A;  1IBL M;  1GO5 A;  1MU5 A;  1ZMW A;  3NBI A;  3U5Z A;  2C98 A;  4UN2 B;  3SMP A;  4M9S A;  1J09 A;  4QNR A;  1XXH A;  2FOI C;  1WHC A;  1XHB A;  4GEW A;  4GIT A;  1GL7 A;  4PDG A;  4W5W A;  3B7N A;  2CV0 A;  2EO2 A;  3AOE C;  1DGH A;  3JR5 A;  4NC6 A;  2QP9 X;  2JY7 A;  2DKL A;  3HHW A;  4OVZ B;  4GKJ M;  4IBD A;  4BB9 A;  3T1H M;  3TWK A;  2QHO B;  5DYI A;  4NOO B;  4CHT B;  3VKH A;  3CF6 E;  2JY5 A;  2CUZ A;  1SXJ C;  1Z59 A;  2CFO A;  1FJG M;  1NV8 A;  2LHC A;  2Z8Y M;  1IXS A;  1I94 M;  1EE8 A;  4XK8 F;  4B3M M;  3LW5 F;  4RF0 A;  2R18 A;  3M6A A;  1G71 A;  1NJG A;  3GRR A;  4AKI A;  4MM3 B;  2EKF A;  1IN6 A;  2MH8 A;  3LVW A;  3ILK A;  1Z5A A;  1GVN A;  1YSY A;  1G4A E;  2DVW B;  2LVN C;  2ZBK B;  4KOD A;  5H37 D;  1XNQ M;  1E9R A;  4MGZ E;  4DV6 M;  3FKE A;  2UUB M;  1UFZ A;  5EP1 A;  4Z8X A;  1T43 A;  3FYD A;  2G3Q A;  3J7A S;  1MX0 A;  2UXB M;  2MGW A;  3GRY A;  1DGF A;  2EUC A;  1IXR C;  2LVQ D;  3B7Q A;  3I4Y A;  4M0W A;  3JR4 A;  5EXX A;  1XB2 B;  4R71 A;  4NXN M;  2R44 A;  3BXW A;  4LZZ A;  1R2Y A;  4NXM M;  3KDS E;  3GPP A;  2WSE F;  3I04 M;  1V34 A;  3LQQ A;  3U5Z B;  1N36 M;  4GHA A;  2KRK A;  1IM2 A;  4MB7 A;  1TGU A;  3UK6 A;  2L7H A;  3SHF A;  3AOE A;  1VEK A;  4BLC A;  3GQ3 A;  2OQ4 A;  1DV0 A;  4LF4 M;  1IY0 A;  1GAB A;  3H4J A;  3FYC A;  1VDD A;  3V76 A;  2X49 A;  4B7F A;  1L2C A;  3RGS A;  4KLN A;  3KOX E;  3HJS A;  4WP2 A;  2D7E A;  3VDU A;  2LTU A;  1Q3B A;  4G6Z A;  5C18 A;  2L4E A;  2C99 A;  4RF1 A;  4IBF A;  4IBI A;  5DFL A;  4YY3 M;  1XXH E;  3K2L A;  3SYK A;  4PD2 A;  1N75 A;  3A42 A;  1HT2 E;  1OQY A;  3U6P A;  3U6E A;  5F3W A;  4MGY E;  2ZM6 M;  1Y8G A;  1QZE A;  4LJ7 A;  1QAM A;  2K47 A;  2V1C A;  2VDB B;  1ZMV A;  2CP8 A;  1QQW A;  3U6O A;  1IN7 A;  3UJN A;  1NHG C;  3T38 A;  2D7H A;  3I4V A;  4HLQ A;  5KPR A;  2B3T A;  2R4J A;  3HX3 A;  4M9Z A;  2OO9 A;  2CRU A;  1L2B A;  5E6J A;  4DV7 M;  4AQY M;  5KPT A;  1VEJ A;  1EFU B;  1QUS A;  4GC5 A;  2LWX A;  3B9P A;  4KO8 A;  1L1Z A;  4MGK E;  2DWL A;  3TPZ A;  1D0K A;  1P3Q Q;  2L7I A;  3BOS A;  3FE3 A;  3GPY A;  2KNV A;  4DR1 M;  5FSW A;  4DR5 M;  4L6V 6;  4R7G A;  2RGH A;  2QCU A;  5FTK A;  5FTL A;  1LTM A;  2KNA A;  5EJC A;  1UM8 A;  3U6Q A;  3FUV A;  3W67 A;  4DR3 M;  4X64 M;  4KHP M;  4FWD A;  4B7H A;  4Q7J A;  4XGI A;  1NV9 A;  3HHZ A;  4AKH A;  5ITX A;  4IBJ A;  5C1B A;  2C5R A;  4DV1 M;  2V1U A;  3OTO M;  3SMS A;  1XC8 A;  3C9P A;  1VDL A;  3J2P B;  2C9C A;  1ORY B;  4CGY B;  4NL4 H;  4IIW A;  1T6O A;  2DEN A;  5KO3 A;  3LVV A;  5FTM A;  4CJ6 A;  4JI4 M;  1DO0 A;  2F5O A;  3UGJ A;  4BBA A;  4CIZ A;  5KPZ A;  4NSR A;  3J27 B;  1PM5 A;  2LXE A;  4DUZ M;  1TH3 A;  1C7Y A;  4B08 A;  3SAV A;  3LQR A;  5GKN A;  3A45 A;  4IBK A;  1WJ7 A;  1Z5C A;  3B74 A;  2XZF A;  4FW9 A;  2GQF A;  4JXJ A;  4LRS A;  2DHY A;  1TH4 A;  1JQJ C;  4Y28 F;  2EA0 A;  3GLG B;  2HL7 A;  2FFJ A;  3GPX A;  1MJG M;  4JI8 M;  1OAO C;  2Y21 A;  2KA6 B;  1ZV1 A;  1PJS A;  4GMQ A;  3VK7 A;  5KQD A;  1DGB A;  1HT1 E;  3KFU G;  3VKG A;  3QYB A;  1ZAE A;  2J5Y A;  4IJE A;  2KEB A;  5IWA M;  4LJ5 A;  4LF7 M;  4G3O A;  1I4W A;  2DZN B;  3GLH A;  5ITU A;  3R8F A;  4Z6Y A;  3FUX A;  2APL A;  2BJW A;  4LGM A;  2JNH A;  3GLF B;  2AHM A;  3L25 A;  3AJI B;  2K0B X;  4LJ9 A;  3THG A;  3HGI A;  2JY6 B;  3MJ5 A;  3PNV A;  5JI3 E;  3GLG A;  1XWI A;  1GLN A;  4MGI E;  1QAN A;  2MR9 A;  5FTN A;  4B3T M;  3J81 S;  2OOB A;  2JWS A;  3L29 A;  1OFI A;  1HNX M;  3RFW A;  4B3R M;  3W0L B;  4D80 A;  2KXE A;  4LRT A;  1TDZ A;  2DWM A;  4CIS A;  5FTJ A;  2ZAM A;  1OFH A;  1NJF A;  1R7R A;  2QEN A;  1R6B X;  1Q3C A;  4AG5 A;  3FRI A;  3GLH B;  2UXD M;  3EIH A;  1IBK M;  2LVP C;  3TE6 A;  1QAQ A;  5FLX S;  2ZTD A;  3RGP A;  2VF8 A;  4LJA A;  4HL4 A;  5A2Q S;  3GLF A;  1E94 E;  1W5S A;  3FTE A;  2QPA A;  4P17 A;  1NSF A;  3HJ8 A;  1SXJ B;  2F5S A;  1IY1 A;  1G8P A;  1GJT A;  1Z6T A;  4KT0 F;  4REZ A;  4LZJ A;  4ITQ A;  1HNW M;  1NNJ A;  3HJQ A;  4IJF A;  4DR2 M;  2EJS A;  3CF2 A;  3SFZ A;  2CE7 A;  3UZU A;  4QHT A;  1C1K A;  2VII A;  1Q02 A;  1QYR A;  1SXJ D;  5ITY A;  2KRU A;  3QYE A;  4L8R C;  1VEG A;  1OIZ A;  2XSZ D;  3L28 A;  2I7P A;  1JR3 D;  1R5L A;  2KHH A;  1WGL A;  3GRV A;  2JUJ A;  2G8L A;  3T15 A;  2Y0Q A;  4EIW A;  1A5T A;  2O5R A;  3FUU A;  3PFI A;  2BJV A;  2JZ0 A;  1YUB A;  2HWJ A;  3GO8 A;  4AKG A;  2M60 A;  2CEA A;  3U61 A;  2JA2 A;  5EP4 A;  4FCV A;  4PT5 A;  2O01 F;  3JAM S;  1J7K A;  4LJ8 A;  1R4G A;  1WXQ A;  5BPV A;  1DGH B;  4FCW A;  3GP1 A;  1JB0 F;  4M0D A;  5EP2 A;  1TTE A;  3HU3 A;  2D7G A;  4L15 A;  3W68 A;  2HKJ A;  1DO2 A;  3GLH E;  5JI2 E;  3KOW E;  2UU9 M;  1N33 M;  3HY5 A;  4RNA A;  4MGH A;  1ZMU A;  3K92 A;  2KZU A;  3SAT A;  4JI1 M;  1GKI A;  1HR0 M;  3DZD A;  3AV0 A;  3FD9 A;  3IHP A;  5ITT A;  3A98 B;  4WW0 A;  1OTR A;  4IBC A;  5DYG A;  2L6O A;  5KQ8 A;  4AG6 A;  1IXS B;  3E4R A;  4RKU F;  3ZH9 B;  2ZAO A;  3KSX A;  4PCZ A;  5DNY A;  2FS1 A;  3U6C A;  3VFD A;  1PJT A;  3K9O A;  2V6Z M;  3PVS A;  3U60 B;  3GPU A;  1IY2 A;  1IBM M;  4L4U A;  2X4A A;  3IG8 A;  2JXN A;  3TWL A;  2FH0 A;  2QBY B;  1FNN A;  5ITQ A;  2KW0 A;  3U6L A;  2DAI A;  3KOZ E; 
#chains in the Genus database with same CATH homology
 2VQF M;  3U6M A;  3PXG A;  4QOS A;  1DGG A;  1G41 A;  3TQS A;  4NSO B;  1QAO A;  3M7G A;  4FWH A;  4K0K M;  2C9O A;  4GH9 A;  3PNY A;  3U6S A;  1N77 A;  1K82 A;  3AKZ A;  4G4Q A;  4I5S A;  3CF0 A;  2QBY A;  2HHH M;  3FTD A;  2UXC M;  3SC3 A;  2Z7J A;  1OJL A;  3IG5 A;  3HHY A;  4G4N A;  3M0E A;  3KSJ A;  4NRV A;  1XMQ M;  2Y20 A;  5ITR A;  4M9X A;  2DWZ B;  4LFC M;  3D8L A;  3QWL A;  2DWN A;  4I4L A;  1IQP A;  3J80 S;  2FE8 A;  1QZM A;  3RE8 A;  2J7N A;  1E9S A;  3ZC7 B;  3A46 A;  3EIE A;  3GQ5 A;  4YHH M;  1N34 M;  3AOG A;  4D81 A;  2DZO B;  4LFA M;  4XBO A;  3LMM A;  3W0F A;  1S3S A;  3KVW A;  2XFT A;  1G59 A;  1T3T A;  4OW0 A;  4DV3 M;  2M5Z A;  4FVM A;  1J5E M;  2Z4R A;  3CTW B;  3KXE C;  4X66 M;  1L1T A;  1QVR A;  8CAT A;  1KSF X;  4JI5 M;  2YFQ A;  2R4E A;  2ZAN A;  1NY6 A;  3TL4 X;  2UUC M;  3U6D A;  3SAS A;  4LY6 A;  2QZ4 A;  2Z3X A;  4DR7 M;  4LF8 M;  4NRW A;  2R45 A;  3FUT A;  2RGO A;  5LMU M;  2YR0 A;  1ZQ9 A;  5IRE B;  2W82 A;  4FWG A;  1XNR M;  2VQE M;  1LV7 A;  3TWM A;  1Z5B A;  3KP1 E;  3SAU A;  1L2D A;  2Z4S A;  2YQZ A;  1NHW C;  4DUY M;  4LCB A;  3VK8 A;  1N78 A;  1PJI A;  2C96 A;  3QAU A;  1X37 A;  3KP0 E;  4LFB M;  5LMN M;  3FTF A;  4LJ4 A;  4JYA M;  4GKK M;  4MH0 E;  4GC9 A;  2J7O A;  2OPF A;  1K3W A;  4D82 A;  4A3V B;  4L16 A;  2DXI A;  2XSZ A;  3HU2 A;  3KS8 A;  4DR6 M;  4GIP A;  1IN8 A;  5EXS A;  1K3X A;  1PJJ A;  2G5G X;  5IZ7 D;  4FD2 A;  3GLI A;  3ZCB B;  4AI6 A;  4TUW A;  3H4M A;  2CHQ A;  2NQ8 C;  2XH9 A;  2XEP A;  4IBB A;  5IT9 S;  4FCT A;  4P16 A;  3SBJ A;  3KOY E;  3U61 B;  4JI6 M;  2ERC A;  4L78 A;  2F5N A;  3J7B A;  2L09 A;  2R62 A;  3HKP A;  3WHK A;  2XGN A;  2CV2 A;  2RKO A;  1TDH A;  4DV2 M;  1E32 A;  4I81 A;  3K1J A;  4OX9 M;  1W5T A;  3L2A A;  1NVM A;  3D8B A;  1TH2 A;  3C58 A;  3UMM A;  4LF6 M;  1IN5 A;  5EQT A;  2A5Y B;  2CHV A;  4LG2 A;  4WUR A;  3KW6 A;  3GQ4 A;  3FTC A;  1HNZ M;  3MHV C;  7CAT A;  2XZU A;  2Q2E B;  4S12 A;  3AFH A;  2KZS A;  3U60 A;  3DFZ A;  4IBE A;  4GHL A;  1XXH B;  1N32 M;  4PDI A;  2F5P A;  3DOA A;  1YE9 A;  4JI3 M;  2E5L M;  4JI2 M;  4JI7 M;  3SYL A;  2LNH C;  3L27 A;  3SHG B;  2R65 A;  2Y0T A;  4DV4 M;  2HCB A;  4GRI A;  1NY5 A;  4DV5 M;  2X8A A;  3GRU A;  3NWL A;  4B7G A;  3KS4 A;  2YNM D;  4QHS A;  4LGY A;  3T1Y M;  1JR3 A;  1IN4 A;  1SXJ A;  2DHR A;  3VLF B;  3WHL A;  2H1R A;  2P5T A;  2CV1 A;  5BR8 M;  3HWS A;  2BNK A;  2XFS A;  3MK6 A;  1IXZ A;  5ITX E;  1HQC A;  2FNA A;  3GLI B;  2F4V M;  1Q39 A;  1G3I A;  3HHX A;  1KFV A;  3HU1 A;  2LH0 A;  4JI0 M;  4X65 M;  3SAR A;  3AL0 C;  4JV5 M;  4OU7 A;  3VDP A;  1NNU C;  4QOZ C;  4I8O A;  2R46 A;  4B3S M;  4DV0 M;  1GL6 A;  5E26 A;  1R2Z A;  4AZF A;  1KYI A;  3SAW A;  1D2N A;  3I51 A;  4ZPX A;  3R9X B;  1L8Q A;  4G4R A;  4X62 M;  3FUW A;  1H6U A;  2I7N A;  5EXT A;  1XMO M;  4OVZ A;  1SXJ E;  2XF3 A;  4LJ6 A;  4R3D A;  2CHG A;  4LF9 M;  4DR4 M;  3DA1 A;  3E9S A;  2XLJ A;  1HQY E;  3Q8X A;  4AW4 A;  2UUA M;  5EP3 A;  4G4O A;  3K8Z A;  4QNM A;  2F5Q A;  4II7 A;  4JN6 A;  5EXP A;  4IBG A;  1IBL M;  1MU5 A;  3NBI A;  3U5Z A;  2C98 A;  3SMP A;  4M9S A;  1J09 A;  4QNR A;  1XXH A;  2FOI C;  1XHB A;  4GIT A;  1GL7 A;  4PDG A;  4W5W A;  2CV0 A;  2EO2 A;  3AOE C;  1DGH A;  3JR5 A;  2QP9 X;  3HHW A;  4OVZ B;  4GKJ M;  4IBD A;  4BB9 A;  3T1H M;  3TWK A;  5DYI A;  4NOO B;  4CHT B;  3VKH A;  3CF6 E;  2CUZ A;  1SXJ C;  1Z59 A;  2CFO A;  1FJG M;  1I94 M;  1EE8 A;  4B3M M;  4RF0 A;  2R18 A;  3M6A A;  1NJG A;  3GRR A;  4AKI A;  4MM3 B;  1IN6 A;  3LVW A;  3ILK A;  1Z5A A;  1GVN A;  1YSY A;  1G4A E;  2DVW B;  2ZBK B;  4KOD A;  1XNQ M;  5H37 D;  1E9R A;  4MGZ E;  4DV6 M;  3FKE A;  2UUB M;  5EP1 A;  4Z8X A;  3FYD A;  3J7A S;  1MX0 A;  2UXB M;  3GRY A;  1DGF A;  2EUC A;  1IXR C;  3I4Y A;  4M0W A;  3JR4 A;  5EXX A;  4NXN M;  4LZZ A;  1R2Y A;  4NXM M;  3KDS E;  3GPP A;  3LQQ A;  3U5Z B;  1N36 M;  4GHA A;  2KRK A;  1IM2 A;  4MB7 A;  1TGU A;  3UK6 A;  2L7H A;  3SHF A;  3AOE A;  4BLC A;  2OQ4 A;  3GQ3 A;  4LF4 M;  1IY0 A;  3FYC A;  1VDD A;  2X49 A;  4B7F A;  1L2C A;  3RGS A;  4KLN A;  3KOX E;  3HJS A;  3VDU A;  2D7E A;  1Q3B A;  4G6Z A;  5C18 A;  2C99 A;  4RF1 A;  4IBF A;  4IBI A;  4YY3 M;  3SYK A;  3K2L A;  4PD2 A;  1N75 A;  3A42 A;  1HT2 E;  3U6P A;  3U6E A;  5F3W A;  4MGY E;  2ZM6 M;  4LJ7 A;  1QAM A;  2K47 A;  2V1C A;  1QQW A;  3U6O A;  1IN7 A;  3UJN A;  1NHG C;  3T38 A;  2D7H A;  3I4V A;  4HLQ A;  5KPR A;  2R4J A;  4M9Z A;  1L2B A;  5E6J A;  4DV7 M;  4AQY M;  5KPT A;  4GC5 A;  2LWX A;  3B9P A;  4KO8 A;  1L1Z A;  4MGK E;  2DWL A;  3TPZ A;  3BOS A;  2L7I A;  3GPY A;  4DR1 M;  5FSW A;  4DR5 M;  4R7G A;  2RGH A;  2QCU A;  5FTK A;  5FTL A;  5EJC A;  1UM8 A;  3U6Q A;  3FUV A;  4DR3 M;  4X64 M;  4KHP M;  4FWD A;  4B7H A;  4XGI A;  3HHZ A;  4AKH A;  5ITX A;  4IBJ A;  5C1B A;  2C5R A;  4DV1 M;  2V1U A;  3OTO M;  3SMS A;  1XC8 A;  3J2P B;  2C9C A;  1ORY B;  4CGY B;  4NL4 H;  4IIW A;  5KO3 A;  3LVV A;  5FTM A;  4JI4 M;  1DO0 A;  2F5O A;  3UGJ A;  4BBA A;  5KPZ A;  4NSR A;  3J27 B;  1PM5 A;  2LXE A;  4DUZ M;  1TH3 A;  4B08 A;  3SAV A;  3LQR A;  5GKN A;  3A45 A;  4IBK A;  1Z5C A;  2XZF A;  4FW9 A;  4JXJ A;  4LRS A;  2EA0 A;  1TH4 A;  1JQJ C;  3GLG B;  2HL7 A;  2FFJ A;  3GPX A;  4JI8 M;  2Y21 A;  2KA6 B;  4GMQ A;  3VK7 A;  5KQD A;  1DGB A;  1HT1 E;  3KFU G;  3VKG A;  1ZAE A;  4IJE A;  2KEB A;  5IWA M;  4LJ5 A;  4LF7 M;  1I4W A;  2DZN B;  3GLH A;  5ITU A;  3R8F A;  4Z6Y A;  3FUX A;  2BJW A;  4LGM A;  3GLF B;  2AHM A;  3L25 A;  3AJI B;  4LJ9 A;  3THG A;  3HGI A;  3MJ5 A;  5JI3 E;  3PNV A;  3GLG A;  1XWI A;  1GLN A;  4MGI E;  1QAN A;  5FTN A;  4B3T M;  3J81 S;  3L29 A;  1OFI A;  1HNX M;  3RFW A;  4B3R M;  3W0L B;  4D80 A;  2KXE A;  4LRT A;  1TDZ A;  2DWM A;  4CIS A;  5FTJ A;  2ZAM A;  1OFH A;  1NJF A;  1R7R A;  2QEN A;  1R6B X;  1Q3C A;  4AG5 A;  3GLH B;  2UXD M;  3EIH A;  1IBK M;  3TE6 A;  1QAQ A;  5FLX S;  3RGP A;  4LJA A;  4HL4 A;  5A2Q S;  3GLF A;  1E94 E;  1W5S A;  3FTE A;  2QPA A;  1NSF A;  3HJ8 A;  1SXJ B;  2F5S A;  1IY1 A;  1G8P A;  1Z6T A;  4REZ A;  4LZJ A;  4ITQ A;  1HNW M;  1NNJ A;  3HJQ A;  4IJF A;  4DR2 M;  3CF2 A;  3SFZ A;  2CE7 A;  3UZU A;  4QHT A;  1C1K A;  2VII A;  1QYR A;  1SXJ D;  5ITY A;  2KRU A;  4L8R C;  2XSZ D;  3L28 A;  2I7P A;  1JR3 D;  3GRV A;  2G8L A;  3T15 A;  2Y0Q A;  4EIW A;  2O5R A;  3FUU A;  3PFI A;  2BJV A;  1YUB A;  3GO8 A;  4AKG A;  2M60 A;  2CEA A;  3U61 A;  2JA2 A;  5EP4 A;  4FCV A;  4PT5 A;  3JAM S;  1J7K A;  4LJ8 A;  1WXQ A;  5BPV A;  3GP1 A;  1DGH B;  4FCW A;  4M0D A;  5EP2 A;  4L15 A;  3HU3 A;  2D7G A;  2HKJ A;  1DO2 A;  5JI2 E;  3KOW E;  2UU9 M;  1N33 M;  4RNA A;  4MGH A;  3K92 A;  2KZU A;  3SAT A;  4JI1 M;  1GKI A;  1HR0 M;  3DZD A;  3AV0 A;  3FD9 A;  5ITT A;  3A98 B;  4WW0 A;  4IBC A;  5DYG A;  2L6O A;  5KQ8 A;  4AG6 A;  1IXS B;  3E4R A;  3ZH9 B;  3L26 A;  2ZAO A;  3KSX A;  4PCZ A;  5DNY A;  3U6C A;  3VFD A;  4LF5 M;  3U60 B;  2V6Z M;  3PVS A;  3GPU A;  1IY2 A;  1IBM M;  4L4U A;  2X4A A;  3IG8 A;  3TWL A;  2QBY B;  1FNN A;  5ITQ A;  2KW0 A;  3U6L A;  3KOZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...