2KZSA

Daxx helical bundle (dhb) domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-associated protein 6
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzsA00
2KZSA 2KZUA
chains in the Genus database with same CATH superfamily
3GQ3A 4LRTA 4AKGA 1GL6A 3BXWA 3U6OA 1OTRA 4DR1M 5ITRA 2D7GA 1GO5A 1D2NA 2EJSA 3V76A 2UUBM 3U5ZB 4RF0A 2MR9A 1D0LA 3AKZA 4PT5A 4CGYB 2OPFA 2EUCA 3U6SA 4B3MM 2N35A 3FTFA 2L4FA 1G4AE 1Q3CA 1SXJA 4LF4M 1R5LA 4MM3B 1OFIA 1ORYB 1X37A 2F4VM 3T6PA 4D82A 1EE8A 3C3EA 3T38A 4M9SA 4OU7A 5C18A 1N33M 2HAKA 3U61B 1DGFA 3CF2A 2I7PA 1XHBA 2LVOC 1QDRA 3I4VA 3L28A 3RGPA 1KFVA 3KFUG 3AOEC 2MROB 3L29A 3NWLA 4OX9M 3LCUA 1UFZA 3HWSA 2V1CA 3SC3A 1OAIA 1E9RA 3LCVB 4QOZC 3T1HM 1XXHA 1H6UA 5EXSA 3U6CA 4WW0A 2DHRA 2FE8A 1XWIA 4M9XA 5LMNM 2QBYA 2ZM6M 4F2LA 3GP1A 3U60B 4ITQA 4JV5M 2Y20A 3PNVA 2CHQA 2JP7A 4JI0M 5F3WA 1G71A 4G6ZA 1WGNA 2JY6B 4XK8F 3FTDA 2K47A 1L1ZA 2LWXA 4P17A 1C1KA 4DR2M 2K6BA 1QUTA 1QQWA 2WSEF 3HHXA 1SG9A 4NC6A 2O5RA 5IREB 1G8PA 2L4EA 3GO8A 3SYKA 4II7A 5KO3A 2LVNC 1GVNA 1VG5A 3TWMA 4M0DA 4L15A 2DVWB 1NSFA 2DENA 2YNMD 1N77A 3LVVA 1NJGA 1R4GA 3DOAA 2DAGA 4QNMA 4JI2M 3HGIA 4AG6A 3SAWA 1PM5A 1HJPA 4UN2B 3CGWA 3W67A 1HT2E 2FH0A 2BNKA 3FUUA 3NBIA 4L8RC 5EXXA 4AI6A 3U6MA 2DZOB 5EXTA 3K92A 1PRBA 1XMOM 3C9PA 2JZ1A 5EP2A 3A42A 2D7EA 3IECA 3U6QA 1NHWC 4LJ5A 4MGYE 2K9DA 3PFIA 4QHSA 5EP3A 4D81A 4G4QA 3SAUA 3GLGA 4ZPXA 3VFDA 4PCZA 4DUYM 2APLA 3AOEA 2CUZA 5EXPA 1T43A 2KW0A 4LJ4A 1HNWM 1C7YA 3KP0E 2ZTDA 4B7GA 3JR4A 2C5RA 2UU9M 4W5WA 2O01F 3KSXA 2XFSA 1HT1E 2QZ4A 2CEAA 5JI2E 1HR0M 1WXQA 4NXNM 3AJIB 4IBIA 1Q39A 3J2PB 2QNJA 1WR1B 2JZ0A 5JI3E 2DWNA 4PDGA 5IZ7D 4B3RM 1E94E 3ZH9B 1MJGM 1V33A 1HQYE 2KRKA 2P5TA 3HJSA 3FYCA 3GRUA 4M0WA 3AOGA 1QZMA 4DV0M 1NY5A 1VEKA 2LVAA 3PVSA 4QOSA 1IXSA 4XBOA 1T6OA 4F1IA 2CHGA 3KS8A 4D80A 2DWMA 2L7HA 2DAEA 1SXJD 2RKOA 4FD2A 5EP4A 4CIZA 1WIVA 3SHFA 4DV4M 3HHYA 1R2ZA 1EIJA 2KNZA 4LY6A 3KOWE 4IJFA 1NNUC 3U61A 4LCBA 1Y8GA 1XNRM 3A45A 3D8BA 2JA2A 1G59A 2X49A 1Q3BA 1AUAA 3UZUA 1IY0A 4R3DA 3SARA 1G3IA 3M0EA 2G5GX 2XFTA 1L8QA 2LVPC 1K3WA 4LF5M 4KT0F 1MU5A 4Y28F 3SMPA 1YLAA 2KZSA 3CF0A 3I51A 3LVWA 2R4JA 1DGBA 1QUSA 2QENA 4DV1M 2LXEA 3R8FA 5IWAM 1DV0A 1R7RA 4MGHA 1JR3D 4LG2A 4MH0E 3QYBA 3FKEA 2G8LA 4P16A 4X65M 3U60A 2JY7A 4IBEA 3LQQA 1IY1A 2QQ8A 3Q8GA 1OQYA 3IHPA 4Q7JA 3L25A 4GHAA 1F4IA 1IBKM 2G3QA 3J80S 3AV0A 2HWJA 2Y0QA 2WZJA 2QHOB 1QAOA 4LF6M 1K82A 4LFBM 3MJ5A 4A3VB 1N34M 2CRUA 7CATA 3VK8A 3DZDA 1VDDA 4OVZA 4AW4A 4FVMA 4KO8A 4G4NA 4GEWA 4DV6M 3U6DA 1ZAEA 1UM8A 3DFZA 5FLXS 3GQ5A 1OAOC 4CJ6A 2BWEA 4MGIE 5H37D 2LHGA 1GABA 2EO2A 1QANA 1VEGA 4IIWA 5E26A 3MK6A 3B89A 2KDLA 5KPTA 4IBDA 3RGSA 4B3SM 2YQZA 2DAMA 2ZAOA 1I4WA 4KLNA 4LGMA 4B08A 2LBCA 1TTEA 1IN7A 3KXEC 3CF6E 4JXJA 2R65A 4NOOB 4K0KM 4M9ZA 1R2YA 4NRVA 1N36M 3VKHA 2OOBA 1KSFX 4AZFA 1Z59A 1WGLA 1XB2B 2WSFF 4DV2M 1ZQ9A 2R45A 2F5NA 2KA6B 3HU1A 2F5SA 2FFJA 1BVSA 2UXBM 2F5QA 2DAKA 2LVQD 4JYAM 2QP9X 2RRUA 2JY5A 2YR0A 3FYDA 3LW5F 4Z6YA 4GKKM 1HQCA 1N32M 4HLQA 1VQ1A 4OW0A 1DGHB 2VF8A 3Q8XA 3GPYA 2ZBKB 2FS1A 1IFYA 3KOXE 2DAIA 1W5SA 5GKNA 2JXNA 3J27B 4GHLA 2Z7JA 3GPUA 3JAMS 5FTMA 2KHHA 1QAMA 5L8RF 1PJJA 3L27A 2CHVA 4R71A 2MGWA 2L7IA 4I5SA 1FJGM 2C9OA 2BJWA 2OOAA 3U6PA 3GQ4A 3FUXA 8CATA 4BB9A 5KPZA 2NQ8C 3BBZA 3HHWA 2D7HA 2F5PA 5ITTA 1DO0A 1JB0F 4CHTB 4FW9A 1Z5CA 2M5ZA 1PJQA 2XSZA 3C58A 1GLNA 4FWDA 2VQFM 4S12A 1NNJA 1TR8A 1MX0A 2H5XA 1SXJE 2L09A 3FRHA 1WJ7A 1NY6A 1XXHB 3KSJA 3NBXX 4I8OA 5ITXE 3JR5A 1YSYA 3E46A 3HJQA 5EP1A 3GLFB 4LF8M 2EKFA 2EA0A 1XMQM 2DXIA 3GRRA 4GC9A 4PD2A 3THGA 2DI0A 5ITUA 3ZQJA 2UXCM 5FSWA 1NHGC 2B3TA 4JI4M 2FOIC 2CE7A 2GQFA 3E9SA 4L78A 2VQEM 4LJ6A 4WURA 3HY5A 1LTMA 1D0KA 2JY8A 4REZA 1TDHA 4G4OA 3W68A 1TF0B 1V92A 3R9XB 3E4RA 4ANRA 1XXHE 4CISA 1QVRA 3LMMA 3U5ZA 1IBLM 2XLJA 3GLFE 4RF1A 2L2DA 1JR3E 4NXMM 4DR3M 4JN6A 1AIPC 1RU3A 1ZMUA 4Z8XA 5FTLA 3H4MA 4BLCA 1MN3A 1CUKA 1OJLA 3E21A 5DFLA 1OKSA 3GLHB 4IBBA 2JNHA 2R0IA 4B7HA 2DZNB 2W82A 3K8ZA 4RKUF 3RFWA 1K3XA 2HHHM 1IN4A 2LNHC 1FNNA 2C96A 1DO2A 4FCTA 1XNQM 3KP1E 3M6AA 3W0LB 4XGIA 3PXGA 4TUWA 2Z4SA 2RGOA 1G41A 2XH9A 2Y0TA 2CV2A 1J5EM 3PNYA 4DV7M 2LHCA 1J7KA 3J7BA 2DNAA 1TH4A 3EIHA 3K9OA 5KQ8A 2DWLA 4JI7M 4GKJM 1TH2A 3SBJA 3M7GA 3H4JA 2O25A 4LGYA 3UMMA 3GLHE 3J81S 4WP2A 1E32A 1YUBA 1NVMA 4MGKE 2H1RA 2C99A 1IY2A 3F92A 3IG8A 1IN5A 4IBJA 2GNOA 2Z4RA 4X64M 3L26A 1DGGA 1I94M 3D8LA 2CV1A 3FUTA 1N78A 2R4EA 5ITQA 4GC5A 3KS4A 3GLIB 2XF3A 4I81A 5FTJA 1NJFA 4HEOA 3TWLA 5DYGA 1VEJA 2ZAMA 3UJNA 4NRWA 4IBGA 2KNVA 2QSFX 3B9PA 4NSRA 4X62M 1DGHA 1Z6TA 3FTEA 1IN8A 2BJVA 2CP8A 3MHVC 1TGUA 3TPZA 1IXSB 3K9PA 4LJ7A 1R6BX 2WSCF 4DR6M 1OIZA 1V34A 2X4AA 4L4UA 3UK6A 2KRUA 1N75A 2EKKA 2KXEA 2R18A 5ITXA 2F5OA 3AL0C 2LH0A 4LFAM 2L6OA 3RE8A 1Z5AA 2R6FA 3GLIE 1HNXM 3HKPA 4LZJA 4DR5M 4FWGA 2V1UA 1OIPA 4LRSA 2FNAA 2DWZB 1IQPA 2UXDM 3VKGA 4G3OA 4HL4A 1QAQA 4AG5A 2XSZD 1PGYA 3TWKA 4FWHA 3OTOM 2MJ5B 1QDTA 4GITA 1LV7A 2KNAA 4PDIA 1IM2A 5A2QS 3I04M 3KW6A 3SASA 4JI8M 1PJTA 3HJ8A 1GL7A 4YY3M 3GLFA 2C98A 1JR3A 2ERCA 3VDPA 3SFZA 1VDLA 4B3TM 2DHYA 4QNRA 4IBFA 2R62A 4JI6M 2Y21A 2I7NA 2E5LM 3HZJA 1TH3A 1SXJB 1YE9A 2A5YB 2VDBB 1PJIA 4AQYM 3TL4X 4IBCA 5FTNA 4I4LA 1ZMWA 3TQSA 3QYEA 1P3QQ 3MMPA 1D0MA 3L2AA 1JQJC 1QZEA 4FCVA 5KQDA 3KOZE 3LQRA 1TDZA 2RGHA 4OVZB 4DBGB 2UUCM 2Q2EB 1T3TA 4L16A 2AHMA 5C1BA 1GJSA 2J5YA 4QHTA 3GPXA 4AKIA 3GRYA 3J7AS 3EIEA 2DZLA 4KODA 1GJTA 3B7ZA 2K0BX 2R44A 4NSOB 4JI1M 3HHZA 4NL4H 1L2CA 3B74A 4IJEA 4DR4M 4GMQA 3VK7A 2XGNA 2QBYB 4R7GA 2M60A 3GLHA 1ZMVA 2JUJA 3A46A 1IXRC 3FRIA 1W5TA 4KHPM 2LTUA 3K2LA 3ILKA 2KEBA 5EQTA 4LFCM 1NV9A 2C9CA 2XEPA 2Z8YM 1NV8A 4X66M 4GIPA 3SYLA 4MGZE 1WHCA 3I4YA 2KZUA 5EJCA 2X8AA 4LJ8A 3U6EA 1NO1A 1L1TA 3FE3A 3FUWA 3ZCBB 4JI5M 2CFOA 2QCUA 2ZANA 1IBMM 3SHGB 5IT9S 1Z5BA 3W0FA 1GKIA 4BBAA 5KPRA 5LMUM 3WHLA 3SMSA 4DV5M 2VF7A 1E9SA 3CTWB 3VLFB 4B7FA 3QWLA 3SAVA 1L2DA 5FTKA 1A5TA 3SATA 3T15A 1IN6A 1SXJC 4LF7M 2MH8A 3FUVA 2CWBA 5DYIA 5E6JA 1J09A 4JI3M 4EIWA 3HU2A 3BOSA 1S3SA 3T1YM 2HL7A 4LJAA 3GPPA 4LJ9A 3IG5A 4GRIA 3UGJA 4MB7A 5ITYA 2UUAM 5DNYA 1L2BA 3GLIA 4LF9M 3ZC7B 3VDUA 2XZFA 3FD9A 2OQ4A 4RNAA 1HNZM 5BR8M 4GH9A 3WHKA 2J7OA 4YHHM 3K1JA 2R46A 3B7NA 3U6LA 2ZTCA 3FTCA 2CV0A 3QAUA 2BWBA 2HKJA 1Q02A 3A98B 4DUZM 3HX3A 1EFUB 3DA1A 3GLGB 1XC8A 4FCWA 4AKHA 1KYIA 3I01M 2XZUA 4IBKA 2VIIA 1OFHA 3KOYE 5BPVA 1ZV1A 2J7NA 2QPAA 2YFQA 3TE6A 3KDSE 4DV3M 2JWSA 3HU3A 1IXZA 4DR7M 3C3DA 3GRVA 4G4RA 2HCBA 2DKLA 1PJSA 1QYRA 2OO9A 3GLGE 2Z3XA 2V6ZM 4L6V6 3KVWA 4LZZA 3B7QA 3AFHA
chains in the Genus database with same CATH topology
3GQ3A 4LRTA 4AKGA 1GL6A 3U6OA 4DR1M 5ITRA 2D7GA 1D2NA 2UUBM 3U5ZB 4RF0A 3AKZA 4PT5A 4CGYB 2OPFA 2EUCA 3U6SA 4B3MM 3FTFA 1G4AE 1Q3CA 1SXJA 4LF4M 4MM3B 1OFIA 1ORYB 1X37A 2F4VM 4D82A 1EE8A 3T38A 4M9SA 4OU7A 5C18A 3U61B 1DGFA 3CF2A 2I7PA 1XHBA 3I4VA 3RGPA 1KFVA 3L28A 3KFUG 3AOEC 3L29A 3NWLA 4OX9M 3SC3A 3HWSA 2V1CA 1E9RA 4QOZC 3T1HM 1XXHA 1H6UA 5EXSA 3U6CA 4WW0A 2DHRA 2FE8A 1XWIA 4M9XA 5LMNM 2QBYA 2ZM6M 3GP1A 3U60B 4ITQA 4JV5M 2Y20A 3PNVA 2CHQA 4JI0M 5F3WA 4G6ZA 3FTDA 2K47A 1L1ZA 2LWXA 1C1KA 4DR2M 1QQWA 3HHXA 2O5RA 5IREB 1G8PA 3GO8A 3SYKA 4II7A 5KO3A 1GVNA 3TWMA 4M0DA 4L15A 2DVWB 1NSFA 2YNMD 1N77A 3LVVA 1NJGA 3DOAA 4QNMA 4JI2M 3HGIA 4AG6A 3SAWA 1PM5A 1HT2E 4L8RC 2BNKA 3FUUA 3NBIA 4AI6A 5EXXA 3U6MA 2DZOB 5EXTA 3K92A 1XMOM 5EP2A 3A42A 2D7EA 3U6QA 1NHWC 4LJ5A 4MGYE 4QHSA 3PFIA 5EP3A 4G4QA 4D81A 3SAUA 4JI6M 3GLGA 4ZPXA 3VFDA 4PCZA 4DUYM 3AOEA 2CUZA 5EXPA 2KW0A 4LJ4A 3KP0E 3JR4A 2C5RA 2UU9M 4W5WA 3KSXA 2XFSA 1HT1E 2QZ4A 2CEAA 5JI2E 1HR0M 1WXQA 4NXNM 3AJIB 4IBIA 1Q39A 3J2PB 5JI3E 2DWNA 4PDGA 5IZ7D 4B3RM 1E94E 3ZH9B 3ZCBB 2KRKA 1HQYE 2P5TA 3HJSA 4M0WA 3FYCA 3GRUA 4DV0M 3AOGA 1QZMA 1NY5A 3PVSA 4QOSA 4XBOA 3KS8A 2CHGA 4D80A 2DWMA 2L7HA 1SXJD 2RKOA 4FD2A 5EP4A 3SHFA 4DV4M 3HHYA 1R2ZA 4LY6A 3KOWE 4IJFA 1NNUC 3U61A 4LCBA 1XNRM 3A45A 3D8BA 2JA2A 1G59A 2X49A 1Q3BA 3UZUA 1IY0A 4R3DA 3SARA 1G3IA 3M0EA 2G5GX 2XFTA 1L8QA 1K3WA 4LF5M 1MU5A 3SMPA 2KZSA 3CF0A 3I51A 3LVWA 2R4JA 1DGBA 2QENA 4DV1M 2LXEA 3R8FA 5IWAM 1R7RA 4MGHA 1JR3D 4LG2A 4MH0E 3FKEA 2G8LA 4P16A 4X65M 3U60A 4IBEA 3LQQA 1IY1A 3L25A 4GHAA 1IBKM 3J80S 3AV0A 2Y0QA 1QAOA 4LF6M 1K82A 4LFBM 3MJ5A 4A3VB 1N34M 7CATA 3VK8A 3DZDA 1VDDA 4OVZA 4AW4A 4FVMA 4KO8A 4G4NA 4DV6M 3U6DA 1ZAEA 1UM8A 3DFZA 5FLXS 3GQ5A 4MGIE 5H37D 2EO2A 1QANA 4IIWA 5E26A 3MK6A 5KPTA 4IBDA 3RGSA 4B3SM 2YQZA 2ZAOA 1I4WA 4KLNA 4LGMA 4B08A 3KXEC 1IN7A 3CF6E 4JXJA 2R65A 4NOOB 4K0KM 4M9ZA 1R2YA 4NRVA 1N36M 3VKHA 1KSFX 4AZFA 1Z59A 1N33M 2F5NA 4DV2M 1ZQ9A 2R45A 2UXBM 2KA6B 3HU1A 2F5SA 2FFJA 2F5QA 4JYAM 2QP9X 2YR0A 3FYDA 4Z6YA 4GKKM 1HQCA 1N32M 4HLQA 4OW0A 1DGHB 3Q8XA 3GPYA 2ZBKB 3KOXE 1W5SA 5GKNA 3J27B 4GHLA 2Z7JA 3GPUA 3JAMS 5FTMA 1QAMA 1PJJA 3L27A 2CHVA 2L7IA 4I5SA 1FJGM 2C9OA 2BJWA 3U6PA 3GQ4A 3FUXA 8CATA 4BB9A 5KPZA 2NQ8C 3HHWA 2D7HA 2F5PA 5ITTA 1DO0A 4CHTB 4FW9A 1Z5CA 2M5ZA 2XSZA 3C58A 2VQFM 1GLNA 4FWDA 1NNJA 4S12A 1HNWM 1MX0A 4B7GA 1SXJE 2L09A 3KSJA 4I8OA 1NY6A 1XXHB 5ITXE 3JR5A 1YSYA 3HJQA 5EP1A 3GLFB 4LF8M 2EA0A 1XMQM 2DXIA 3GRRA 4GC9A 4PD2A 3THGA 5ITUA 2UXCM 5FSWA 1NHGC 4JI4M 2FOIC 2CE7A 3E9SA 4L78A 2VQEM 4LJ6A 4WURA 3R9XB 4REZA 4G4OA 1TDHA 3E4RA 4CISA 1QVRA 3LMMA 3U5ZA 1IBLM 2XLJA 4RF1A 4NXMM 4DR3M 4JN6A 5FTLA 4Z8XA 3H4MA 4BLCA 1OJLA 3GLHB 4IBBA 4B7HA 2DZNB 2W82A 3K8ZA 3RFWA 1K3XA 2HHHM 1IN4A 2LNHC 1FNNA 2C96A 1DO2A 4FCTA 1XNQM 3KP1E 3M6AA 3W0LB 4XGIA 3PXGA 4TUWA 2Z4SA 2RGOA 1G41A 2XH9A 2Y0TA 2CV2A 1J5EM 3PNYA 4DV7M 1J7KA 3J7BA 1TH4A 3EIHA 5KQ8A 4JI7M 2DWLA 4GKJM 1TH2A 3SBJA 3M7GA 4LGYA 3UMMA 3J81S 1E32A 1YUBA 1NVMA 4MGKE 2H1RA 2C99A 1IY2A 3IG8A 4IBJA 1IN5A 4X64M 2Z4RA 3L26A 1I94M 1DGGA 3D8LA 2CV1A 3FUTA 1N78A 2R4EA 5ITQA 4GC5A 3KS4A 3GLIB 2XF3A 4I81A 5FTJA 1NJFA 3TWLA 5DYGA 2ZAMA 3UJNA 4NRWA 4IBGA 4NSRA 3B9PA 4X62M 1DGHA 1Z6TA 3FTEA 1IN8A 2BJVA 3MHVC 1TGUA 3TPZA 1IXSB 4LJ7A 1R6BX 4DR6M 3UK6A 2X4AA 4L4UA 2KRUA 1N75A 2KXEA 2R18A 5ITXA 2F5OA 3AL0C 2LH0A 4LFAM 2L6OA 3RE8A 1Z5AA 1HNXM 3HKPA 4LZJA 4DR5M 4FWGA 2V1UA 4LRSA 2FNAA 2DWZB 1IQPA 2UXDM 3VKGA 4HL4A 1QAQA 4AG5A 2XSZD 3TWKA 4FWHA 3OTOM 4GITA 1LV7A 4PDIA 5A2QS 1IM2A 3KW6A 3SASA 4JI8M 4YY3M 3HJ8A 1GL7A 3GLFA 2C98A 1JR3A 2ERCA 3VDPA 3SFZA 4B3TM 4QNRA 4IBFA 2R62A 2Y21A 2I7NA 2E5LM 1TH3A 1SXJB 1YE9A 2A5YB 1PJIA 4AQYM 3TL4X 4IBCA 5FTNA 4I4LA 3TQSA 3L2AA 1JQJC 4FCVA 5KQDA 3KOZE 3LQRA 1TDZA 2RGHA 4OVZB 2UUCM 2Q2EB 1T3TA 4L16A 2AHMA 5C1BA 4QHTA 3GPXA 4AKIA 3GRYA 3J7AS 3EIEA 4KODA 4NSOB 4JI1M 3HHZA 4NL4H 1L2CA 4IJEA 4DR4M 4GMQA 3VK7A 2XGNA 2QBYB 4R7GA 2M60A 3GLHA 3A46A 1IXRC 1W5TA 4KHPM 3K2LA 3ILKA 2KEBA 5EQTA 4LFCM 2C9CA 2XEPA 4X66M 4GIPA 3SYLA 4MGZE 3I4YA 2KZUA 5EJCA 2X8AA 4LJ8A 3U6EA 1L1TA 3FUWA 4JI5M 2CFOA 2QCUA 2ZANA 1IBMM 3SHGB 5IT9S 1Z5BA 3W0FA 1GKIA 4BBAA 5KPRA 5LMUM 3WHLA 3SMSA 4DV5M 1E9SA 3CTWB 3VLFB 4B7FA 3QWLA 3SAVA 1L2DA 5FTKA 3SATA 3T15A 1IN6A 1SXJC 4LF7M 5E6JA 3FUVA 5DYIA 1J09A 4JI3M 4EIWA 3HU2A 3BOSA 1S3SA 3T1YM 2HL7A 4LJAA 3GPPA 4LJ9A 3IG5A 4GRIA 3UGJA 4MB7A 5ITYA 2UUAM 5DNYA 1L2BA 3GLIA 4LF9M 3ZC7B 3VDUA 2XZFA 3FD9A 2OQ4A 4RNAA 1HNZM 5BR8M 4GH9A 3WHKA 2J7OA 4YHHM 3K1JA 2R46A 3U6LA 3FTCA 2CV0A 3QAUA 2HKJA 4DUZM 3A98B 3DA1A 4AKHA 3GLGB 1XC8A 4FCWA 1KYIA 2XZUA 4IBKA 2VIIA 1OFHA 3KOYE 5BPVA 2J7NA 2QPAA 2YFQA 3TE6A 3KDSE 4DV3M 3HU3A 1IXZA 4DR7M 3GRVA 4G4RA 2HCBA 2Z3XA 1QYRA 2V6ZM 3KVWA 4LZZA 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZS A;  2KZU A; 
#chains in the Genus database with same CATH topology
 3GQ3 A;  4LRT A;  4AKG A;  1GL6 A;  3BXW A;  3U6O A;  1OTR A;  4DR1 M;  5ITR A;  2D7G A;  1GO5 A;  1D2N A;  2EJS A;  3V76 A;  2UUB M;  3U5Z B;  4RF0 A;  2MR9 A;  1D0L A;  3AKZ A;  4PT5 A;  4CGY B;  2OPF A;  2EUC A;  3U6S A;  4B3M M;  2N35 A;  3FTF A;  2L4F A;  1G4A E;  1Q3C A;  1SXJ A;  4LF4 M;  1R5L A;  4MM3 B;  1OFI A;  1ORY B;  1X37 A;  2F4V M;  3T6P A;  4D82 A;  1EE8 A;  3C3E A;  3T38 A;  4M9S A;  4OU7 A;  5C18 A;  1N33 M;  2HAK A;  3U61 B;  1DGF A;  3CF2 A;  2I7P A;  1XHB A;  2LVO C;  1QDR A;  3I4V A;  3L28 A;  3RGP A;  1KFV A;  3KFU G;  3AOE C;  2MRO B;  3L29 A;  3NWL A;  4OX9 M;  3LCU A;  1UFZ A;  3HWS A;  2V1C A;  3SC3 A;  1OAI A;  1E9R A;  3LCV B;  4QOZ C;  3T1H M;  1XXH A;  1H6U A;  5EXS A;  3U6C A;  4WW0 A;  2DHR A;  2FE8 A;  1XWI A;  4M9X A;  5LMN M;  2QBY A;  2ZM6 M;  4F2L A;  3GP1 A;  3U60 B;  4ITQ A;  4JV5 M;  2Y20 A;  3PNV A;  2CHQ A;  2JP7 A;  4JI0 M;  5F3W A;  1G71 A;  4G6Z A;  1WGN A;  2JY6 B;  4XK8 F;  3FTD A;  2K47 A;  1L1Z A;  2LWX A;  4P17 A;  1C1K A;  4DR2 M;  2K6B A;  1QUT A;  1QQW A;  2WSE F;  3HHX A;  1SG9 A;  4NC6 A;  2O5R A;  5IRE B;  1G8P A;  2L4E A;  3GO8 A;  3SYK A;  4II7 A;  5KO3 A;  2LVN C;  1GVN A;  1VG5 A;  3TWM A;  4M0D A;  4L15 A;  2DVW B;  1NSF A;  2DEN A;  2YNM D;  1N77 A;  3LVV A;  1NJG A;  1R4G A;  3DOA A;  2DAG A;  4QNM A;  4JI2 M;  3HGI A;  4AG6 A;  3SAW A;  1PM5 A;  1HJP A;  4UN2 B;  3CGW A;  3W67 A;  1HT2 E;  2FH0 A;  2BNK A;  3FUU A;  3NBI A;  4L8R C;  5EXX A;  4AI6 A;  3U6M A;  2DZO B;  5EXT A;  3K92 A;  1PRB A;  1XMO M;  3C9P A;  2JZ1 A;  5EP2 A;  3A42 A;  2D7E A;  3IEC A;  3U6Q A;  1NHW C;  4LJ5 A;  4MGY E;  2K9D A;  3PFI A;  4QHS A;  5EP3 A;  4D81 A;  4G4Q A;  3SAU A;  3GLG A;  4ZPX A;  3VFD A;  4PCZ A;  4DUY M;  2APL A;  3AOE A;  2CUZ A;  5EXP A;  1T43 A;  2KW0 A;  4LJ4 A;  1HNW M;  1C7Y A;  3KP0 E;  2ZTD A;  4B7G A;  3JR4 A;  2C5R A;  2UU9 M;  4W5W A;  2O01 F;  3KSX A;  2XFS A;  1HT1 E;  2QZ4 A;  2CEA A;  5JI2 E;  1HR0 M;  1WXQ A;  4NXN M;  3AJI B;  4IBI A;  1Q39 A;  3J2P B;  2QNJ A;  1WR1 B;  2JZ0 A;  5JI3 E;  2DWN A;  4PDG A;  5IZ7 D;  4B3R M;  1E94 E;  3ZH9 B;  1MJG M;  1V33 A;  1HQY E;  2KRK A;  2P5T A;  3HJS A;  3FYC A;  3GRU A;  4M0W A;  3AOG A;  1QZM A;  4DV0 M;  1NY5 A;  1VEK A;  2LVA A;  3PVS A;  4QOS A;  1IXS A;  4XBO A;  1T6O A;  4F1I A;  2CHG A;  3KS8 A;  4D80 A;  2DWM A;  2L7H A;  2DAE A;  1SXJ D;  2RKO A;  4FD2 A;  5EP4 A;  4CIZ A;  1WIV A;  3SHF A;  4DV4 M;  3HHY A;  1R2Z A;  1EIJ A;  2KNZ A;  4LY6 A;  3KOW E;  4IJF A;  1NNU C;  3U61 A;  4LCB A;  1Y8G A;  1XNR M;  3A45 A;  3D8B A;  2JA2 A;  1G59 A;  2X49 A;  1Q3B A;  1AUA A;  3UZU A;  1IY0 A;  4R3D A;  3SAR A;  1G3I A;  3M0E A;  2G5G X;  2XFT A;  1L8Q A;  2LVP C;  1K3W A;  4LF5 M;  4KT0 F;  1MU5 A;  4Y28 F;  3SMP A;  1YLA A;  2KZS A;  3CF0 A;  3I51 A;  3LVW A;  2R4J A;  1DGB A;  1QUS A;  2QEN A;  4DV1 M;  2LXE A;  3R8F A;  5IWA M;  1DV0 A;  1R7R A;  4MGH A;  1JR3 D;  4LG2 A;  4MH0 E;  3QYB A;  3FKE A;  2G8L A;  4P16 A;  4X65 M;  3U60 A;  2JY7 A;  4IBE A;  3LQQ A;  1IY1 A;  2QQ8 A;  3Q8G A;  1OQY A;  3IHP A;  4Q7J A;  3L25 A;  4GHA A;  1F4I A;  1IBK M;  2G3Q A;  3J80 S;  3AV0 A;  2HWJ A;  2Y0Q A;  2WZJ A;  2QHO B;  1QAO A;  4LF6 M;  1K82 A;  4LFB M;  3MJ5 A;  4A3V B;  1N34 M;  2CRU A;  7CAT A;  3VK8 A;  3DZD A;  1VDD A;  4OVZ A;  4AW4 A;  4FVM A;  4KO8 A;  4G4N A;  4GEW A;  4DV6 M;  3U6D A;  1ZAE A;  1UM8 A;  3DFZ A;  5FLX S;  3GQ5 A;  1OAO C;  4CJ6 A;  2BWE A;  4MGI E;  5H37 D;  2LHG A;  1GAB A;  2EO2 A;  1QAN A;  1VEG A;  4IIW A;  5E26 A;  3MK6 A;  3B89 A;  2KDL A;  5KPT A;  4IBD A;  3RGS A;  4B3S M;  2YQZ A;  2DAM A;  2ZAO A;  1I4W A;  4KLN A;  4LGM A;  4B08 A;  2LBC A;  1TTE A;  1IN7 A;  3KXE C;  3CF6 E;  4JXJ A;  2R65 A;  4NOO B;  4K0K M;  4M9Z A;  1R2Y A;  4NRV A;  1N36 M;  3VKH A;  2OOB A;  1KSF X;  4AZF A;  1Z59 A;  1WGL A;  1XB2 B;  2WSF F;  4DV2 M;  1ZQ9 A;  2R45 A;  2F5N A;  2KA6 B;  3HU1 A;  2F5S A;  2FFJ A;  1BVS A;  2UXB M;  2F5Q A;  2DAK A;  2LVQ D;  4JYA M;  2QP9 X;  2RRU A;  2JY5 A;  2YR0 A;  3FYD A;  3LW5 F;  4Z6Y A;  4GKK M;  1HQC A;  1N32 M;  4HLQ A;  1VQ1 A;  4OW0 A;  1DGH B;  2VF8 A;  3Q8X A;  3GPY A;  2ZBK B;  2FS1 A;  1IFY A;  3KOX E;  2DAI A;  1W5S A;  5GKN A;  2JXN A;  3J27 B;  4GHL A;  2Z7J A;  3GPU A;  3JAM S;  5FTM A;  2KHH A;  1QAM A;  5L8R F;  1PJJ A;  3L27 A;  2CHV A;  4R71 A;  2MGW A;  2L7I A;  4I5S A;  1FJG M;  2C9O A;  2BJW A;  2OOA A;  3U6P A;  3GQ4 A;  3FUX A;  8CAT A;  4BB9 A;  5KPZ A;  2NQ8 C;  3BBZ A;  3HHW A;  2D7H A;  2F5P A;  5ITT A;  1DO0 A;  1JB0 F;  4CHT B;  4FW9 A;  1Z5C A;  2M5Z A;  1PJQ A;  2XSZ A;  3C58 A;  1GLN A;  4FWD A;  2VQF M;  4S12 A;  1NNJ A;  1TR8 A;  1MX0 A;  2H5X A;  1SXJ E;  2L09 A;  3FRH A;  1WJ7 A;  1NY6 A;  1XXH B;  3KSJ A;  3NBX X;  4I8O A;  5ITX E;  3JR5 A;  1YSY A;  3E46 A;  3HJQ A;  5EP1 A;  3GLF B;  4LF8 M;  2EKF A;  2EA0 A;  1XMQ M;  2DXI A;  3GRR A;  4GC9 A;  4PD2 A;  3THG A;  2DI0 A;  5ITU A;  3ZQJ A;  2UXC M;  5FSW A;  1NHG C;  2B3T A;  4JI4 M;  2FOI C;  2CE7 A;  2GQF A;  3E9S A;  4L78 A;  2VQE M;  4LJ6 A;  4WUR A;  3HY5 A;  1LTM A;  1D0K A;  2JY8 A;  4REZ A;  1TDH A;  4G4O A;  3W68 A;  1TF0 B;  1V92 A;  3R9X B;  3E4R A;  4ANR A;  1XXH E;  4CIS A;  1QVR A;  3LMM A;  3U5Z A;  1IBL M;  2XLJ A;  3GLF E;  4RF1 A;  2L2D A;  1JR3 E;  4NXM M;  4DR3 M;  4JN6 A;  1AIP C;  1RU3 A;  1ZMU A;  4Z8X A;  5FTL A;  3H4M A;  4BLC A;  1MN3 A;  1CUK A;  1OJL A;  3E21 A;  5DFL A;  1OKS A;  3GLH B;  4IBB A;  2JNH A;  2R0I A;  4B7H A;  2DZN B;  2W82 A;  3K8Z A;  4RKU F;  3RFW A;  1K3X A;  2HHH M;  1IN4 A;  2LNH C;  1FNN A;  2C96 A;  1DO2 A;  4FCT A;  1XNQ M;  3KP1 E;  3M6A A;  3W0L B;  4XGI A;  3PXG A;  4TUW A;  2Z4S A;  2RGO A;  1G41 A;  2XH9 A;  2Y0T A;  2CV2 A;  1J5E M;  3PNY A;  4DV7 M;  2LHC A;  1J7K A;  3J7B A;  2DNA A;  1TH4 A;  3EIH A;  3K9O A;  5KQ8 A;  2DWL A;  4JI7 M;  4GKJ M;  1TH2 A;  3SBJ A;  3M7G A;  3H4J A;  2O25 A;  4LGY A;  3UMM A;  3GLH E;  3J81 S;  4WP2 A;  1E32 A;  1YUB A;  1NVM A;  4MGK E;  2H1R A;  2C99 A;  1IY2 A;  3F92 A;  3IG8 A;  1IN5 A;  4IBJ A;  2GNO A;  2Z4R A;  4X64 M;  3L26 A;  1DGG A;  1I94 M;  3D8L A;  2CV1 A;  3FUT A;  1N78 A;  2R4E A;  5ITQ A;  4GC5 A;  3KS4 A;  3GLI B;  2XF3 A;  4I81 A;  5FTJ A;  1NJF A;  4HEO A;  3TWL A;  5DYG A;  1VEJ A;  2ZAM A;  3UJN A;  4NRW A;  4IBG A;  2KNV A;  2QSF X;  3B9P A;  4NSR A;  4X62 M;  1DGH A;  1Z6T A;  3FTE A;  1IN8 A;  2BJV A;  2CP8 A;  3MHV C;  1TGU A;  3TPZ A;  1IXS B;  3K9P A;  4LJ7 A;  1R6B X;  2WSC F;  4DR6 M;  1OIZ A;  1V34 A;  2X4A A;  4L4U A;  3UK6 A;  2KRU A;  1N75 A;  2EKK A;  2KXE A;  2R18 A;  5ITX A;  2F5O A;  3AL0 C;  2LH0 A;  4LFA M;  2L6O A;  3RE8 A;  1Z5A A;  2R6F A;  3GLI E;  1HNX M;  3HKP A;  4LZJ A;  4DR5 M;  4FWG A;  2V1U A;  1OIP A;  4LRS A;  2FNA A;  2DWZ B;  1IQP A;  2UXD M;  3VKG A;  4G3O A;  4HL4 A;  1QAQ A;  4AG5 A;  2XSZ D;  1PGY A;  3TWK A;  4FWH A;  3OTO M;  2MJ5 B;  1QDT A;  4GIT A;  1LV7 A;  2KNA A;  4PDI A;  1IM2 A;  5A2Q S;  3I04 M;  3KW6 A;  3SAS A;  4JI8 M;  1PJT A;  3HJ8 A;  1GL7 A;  4YY3 M;  3GLF A;  2C98 A;  1JR3 A;  2ERC A;  3VDP A;  3SFZ A;  1VDL A;  4B3T M;  2DHY A;  4QNR A;  4IBF A;  2R62 A;  4JI6 M;  2Y21 A;  2I7N A;  2E5L M;  3HZJ A;  1TH3 A;  1SXJ B;  1YE9 A;  2A5Y B;  2VDB B;  1PJI A;  4AQY M;  3TL4 X;  4IBC A;  5FTN A;  4I4L A;  1ZMW A;  3TQS A;  3QYE A;  1P3Q Q;  3MMP A;  1D0M A;  3L2A A;  1JQJ C;  1QZE A;  4FCV A;  5KQD A;  3KOZ E;  3LQR A;  1TDZ A;  2RGH A;  4OVZ B;  4DBG B;  2UUC M;  2Q2E B;  1T3T A;  4L16 A;  2AHM A;  5C1B A;  1GJS A;  2J5Y A;  4QHT A;  3GPX A;  4AKI A;  3GRY A;  3J7A S;  3EIE A;  2DZL A;  4KOD A;  1GJT A;  3B7Z A;  2K0B X;  2R44 A;  4NSO B;  4JI1 M;  3HHZ A;  4NL4 H;  1L2C A;  3B74 A;  4IJE A;  4DR4 M;  4GMQ A;  3VK7 A;  2XGN A;  2QBY B;  4R7G A;  2M60 A;  3GLH A;  1ZMV A;  2JUJ A;  3A46 A;  1IXR C;  3FRI A;  1W5T A;  4KHP M;  2LTU A;  3K2L A;  3ILK A;  2KEB A;  5EQT A;  4LFC M;  1NV9 A;  2C9C A;  2XEP A;  2Z8Y M;  1NV8 A;  4X66 M;  4GIP A;  3SYL A;  4MGZ E;  1WHC A;  3I4Y A;  2KZU A;  5EJC A;  2X8A A;  4LJ8 A;  3U6E A;  1NO1 A;  1L1T A;  3FE3 A;  3FUW A;  3ZCB B;  4JI5 M;  2CFO A;  2QCU A;  2ZAN A;  1IBM M;  3SHG B;  5IT9 S;  1Z5B A;  3W0F A;  1GKI A;  4BBA A;  5KPR A;  5LMU M;  3WHL A;  3SMS A;  4DV5 M;  2VF7 A;  1E9S A;  3CTW B;  3VLF B;  4B7F A;  3QWL A;  3SAV A;  1L2D A;  5FTK A;  1A5T A;  3SAT A;  3T15 A;  1IN6 A;  1SXJ C;  4LF7 M;  2MH8 A;  3FUV A;  2CWB A;  5DYI A;  5E6J A;  1J09 A;  4JI3 M;  4EIW A;  3HU2 A;  3BOS A;  1S3S A;  3T1Y M;  2HL7 A;  4LJA A;  3GPP A;  4LJ9 A;  3IG5 A;  4GRI A;  3UGJ A;  4MB7 A;  5ITY A;  2UUA M;  5DNY A;  1L2B A;  3GLI A;  4LF9 M;  3ZC7 B;  3VDU A;  2XZF A;  3FD9 A;  2OQ4 A;  4RNA A;  1HNZ M;  5BR8 M;  4GH9 A;  3WHK A;  2J7O A;  4YHH M;  3K1J A;  2R46 A;  3B7N A;  3U6L A;  2ZTC A;  3FTC A;  2CV0 A;  3QAU A;  2BWB A;  2HKJ A;  1Q02 A;  3A98 B;  4DUZ M;  3HX3 A;  1EFU B;  3DA1 A;  3GLG B;  1XC8 A;  4FCW A;  4AKH A;  1KYI A;  3I01 M;  2XZU A;  4IBK A;  2VII A;  1OFH A;  3KOY E;  5BPV A;  1ZV1 A;  2J7N A;  2QPA A;  2YFQ A;  3TE6 A;  3KDS E;  4DV3 M;  2JWS A;  3HU3 A;  1IXZ A;  4DR7 M;  3C3D A;  3GRV A;  4G4R A;  2HCB A;  2DKL A;  1PJS A;  1QYR A;  2OO9 A;  3GLG E;  2Z3X A;  2V6Z M;  4L6V 6;  3KVW A;  4LZZ A;  3B7Q A;  3AFH A; 
#chains in the Genus database with same CATH homology
 3GQ3 A;  4LRT A;  4AKG A;  1GL6 A;  3U6O A;  4DR1 M;  5ITR A;  2D7G A;  1D2N A;  2UUB M;  3U5Z B;  4RF0 A;  3AKZ A;  4PT5 A;  4CGY B;  2OPF A;  2EUC A;  3U6S A;  4B3M M;  3FTF A;  1G4A E;  1Q3C A;  1SXJ A;  4LF4 M;  4MM3 B;  1OFI A;  1ORY B;  1X37 A;  2F4V M;  4D82 A;  1EE8 A;  3T38 A;  4M9S A;  4OU7 A;  5C18 A;  3U61 B;  1DGF A;  3CF2 A;  2I7P A;  1XHB A;  3I4V A;  3RGP A;  1KFV A;  3L28 A;  3KFU G;  3AOE C;  3L29 A;  3NWL A;  4OX9 M;  3SC3 A;  3HWS A;  2V1C A;  1E9R A;  4QOZ C;  3T1H M;  1XXH A;  1H6U A;  5EXS A;  3U6C A;  4WW0 A;  2DHR A;  2FE8 A;  1XWI A;  4M9X A;  5LMN M;  2QBY A;  2ZM6 M;  3GP1 A;  3U60 B;  4ITQ A;  4JV5 M;  2Y20 A;  3PNV A;  2CHQ A;  4JI0 M;  5F3W A;  4G6Z A;  3FTD A;  2K47 A;  1L1Z A;  2LWX A;  1C1K A;  4DR2 M;  1QQW A;  3HHX A;  2O5R A;  5IRE B;  1G8P A;  3GO8 A;  3SYK A;  4II7 A;  5KO3 A;  1GVN A;  3TWM A;  4M0D A;  4L15 A;  2DVW B;  1NSF A;  2YNM D;  1N77 A;  3LVV A;  1NJG A;  3DOA A;  4QNM A;  4JI2 M;  3HGI A;  4AG6 A;  3SAW A;  1PM5 A;  1HT2 E;  4L8R C;  2BNK A;  3FUU A;  3NBI A;  4AI6 A;  5EXX A;  3U6M A;  2DZO B;  5EXT A;  3K92 A;  1XMO M;  5EP2 A;  3A42 A;  2D7E A;  3U6Q A;  1NHW C;  4LJ5 A;  4MGY E;  4QHS A;  3PFI A;  5EP3 A;  4G4Q A;  4D81 A;  3SAU A;  4JI6 M;  3GLG A;  4ZPX A;  3VFD A;  4PCZ A;  4DUY M;  3AOE A;  2CUZ A;  5EXP A;  2KW0 A;  4LJ4 A;  3KP0 E;  3JR4 A;  2C5R A;  2UU9 M;  4W5W A;  3KSX A;  2XFS A;  1HT1 E;  2QZ4 A;  2CEA A;  5JI2 E;  1HR0 M;  1WXQ A;  4NXN M;  3AJI B;  4IBI A;  1Q39 A;  3J2P B;  5JI3 E;  2DWN A;  4PDG A;  5IZ7 D;  4B3R M;  1E94 E;  3ZH9 B;  3ZCB B;  2KRK A;  1HQY E;  2P5T A;  3HJS A;  4M0W A;  3FYC A;  3GRU A;  4DV0 M;  3AOG A;  1QZM A;  1NY5 A;  3PVS A;  4QOS A;  4XBO A;  3KS8 A;  2CHG A;  4D80 A;  2DWM A;  2L7H A;  1SXJ D;  2RKO A;  4FD2 A;  5EP4 A;  3SHF A;  4DV4 M;  3HHY A;  1R2Z A;  4LY6 A;  3KOW E;  4IJF A;  1NNU C;  3U61 A;  4LCB A;  1XNR M;  3A45 A;  3D8B A;  2JA2 A;  1G59 A;  2X49 A;  1Q3B A;  3UZU A;  1IY0 A;  4R3D A;  3SAR A;  1G3I A;  3M0E A;  2G5G X;  2XFT A;  1L8Q A;  1K3W A;  4LF5 M;  1MU5 A;  3SMP A;  2KZS A;  3CF0 A;  3I51 A;  3LVW A;  2R4J A;  1DGB A;  2QEN A;  4DV1 M;  2LXE A;  3R8F A;  5IWA M;  1R7R A;  4MGH A;  1JR3 D;  4LG2 A;  4MH0 E;  3FKE A;  2G8L A;  4P16 A;  4X65 M;  3U60 A;  4IBE A;  3LQQ A;  1IY1 A;  3L25 A;  4GHA A;  1IBK M;  3J80 S;  3AV0 A;  2Y0Q A;  1QAO A;  4LF6 M;  1K82 A;  4LFB M;  3MJ5 A;  4A3V B;  1N34 M;  7CAT A;  3VK8 A;  3DZD A;  1VDD A;  4OVZ A;  4AW4 A;  4FVM A;  4KO8 A;  4G4N A;  4DV6 M;  3U6D A;  1ZAE A;  1UM8 A;  3DFZ A;  5FLX S;  3GQ5 A;  4MGI E;  5H37 D;  2EO2 A;  1QAN A;  4IIW A;  5E26 A;  3MK6 A;  5KPT A;  4IBD A;  3RGS A;  4B3S M;  2YQZ A;  2ZAO A;  1I4W A;  4KLN A;  4LGM A;  4B08 A;  3KXE C;  1IN7 A;  3CF6 E;  4JXJ A;  2R65 A;  4NOO B;  4K0K M;  4M9Z A;  1R2Y A;  4NRV A;  1N36 M;  3VKH A;  1KSF X;  4AZF A;  1Z59 A;  1N33 M;  2F5N A;  4DV2 M;  1ZQ9 A;  2R45 A;  2UXB M;  2KA6 B;  3HU1 A;  2F5S A;  2FFJ A;  2F5Q A;  4JYA M;  2QP9 X;  2YR0 A;  3FYD A;  4Z6Y A;  4GKK M;  1HQC A;  1N32 M;  4HLQ A;  4OW0 A;  1DGH B;  3Q8X A;  3GPY A;  2ZBK B;  3KOX E;  1W5S A;  5GKN A;  3J27 B;  4GHL A;  2Z7J A;  3GPU A;  3JAM S;  5FTM A;  1QAM A;  1PJJ A;  3L27 A;  2CHV A;  2L7I A;  4I5S A;  1FJG M;  2C9O A;  2BJW A;  3U6P A;  3GQ4 A;  3FUX A;  8CAT A;  4BB9 A;  5KPZ A;  2NQ8 C;  3HHW A;  2D7H A;  2F5P A;  5ITT A;  1DO0 A;  4CHT B;  4FW9 A;  1Z5C A;  2M5Z A;  2XSZ A;  3C58 A;  2VQF M;  1GLN A;  4FWD A;  1NNJ A;  4S12 A;  1HNW M;  1MX0 A;  4B7G A;  1SXJ E;  2L09 A;  3KSJ A;  4I8O A;  1NY6 A;  1XXH B;  5ITX E;  3JR5 A;  1YSY A;  3HJQ A;  5EP1 A;  3GLF B;  4LF8 M;  2EA0 A;  1XMQ M;  2DXI A;  3GRR A;  4GC9 A;  4PD2 A;  3THG A;  5ITU A;  2UXC M;  5FSW A;  1NHG C;  4JI4 M;  2FOI C;  2CE7 A;  3E9S A;  4L78 A;  2VQE M;  4LJ6 A;  4WUR A;  3R9X B;  4REZ A;  4G4O A;  1TDH A;  3E4R A;  4CIS A;  1QVR A;  3LMM A;  3U5Z A;  1IBL M;  2XLJ A;  4RF1 A;  4NXM M;  4DR3 M;  4JN6 A;  5FTL A;  4Z8X A;  3H4M A;  4BLC A;  1OJL A;  3GLH B;  4IBB A;  4B7H A;  2DZN B;  2W82 A;  3K8Z A;  3RFW A;  1K3X A;  2HHH M;  1IN4 A;  2LNH C;  1FNN A;  2C96 A;  1DO2 A;  4FCT A;  1XNQ M;  3KP1 E;  3M6A A;  3W0L B;  4XGI A;  3PXG A;  4TUW A;  2Z4S A;  2RGO A;  1G41 A;  2XH9 A;  2Y0T A;  2CV2 A;  1J5E M;  3PNY A;  4DV7 M;  1J7K A;  3J7B A;  1TH4 A;  3EIH A;  5KQ8 A;  4JI7 M;  2DWL A;  4GKJ M;  1TH2 A;  3SBJ A;  3M7G A;  4LGY A;  3UMM A;  3J81 S;  1E32 A;  1YUB A;  1NVM A;  4MGK E;  2H1R A;  2C99 A;  1IY2 A;  3IG8 A;  4IBJ A;  1IN5 A;  4X64 M;  2Z4R A;  3L26 A;  1I94 M;  1DGG A;  3D8L A;  2CV1 A;  3FUT A;  1N78 A;  2R4E A;  5ITQ A;  4GC5 A;  3KS4 A;  3GLI B;  2XF3 A;  4I81 A;  5FTJ A;  1NJF A;  3TWL A;  5DYG A;  2ZAM A;  3UJN A;  4NRW A;  4IBG A;  4NSR A;  3B9P A;  4X62 M;  1DGH A;  1Z6T A;  3FTE A;  1IN8 A;  2BJV A;  3MHV C;  1TGU A;  3TPZ A;  1IXS B;  4LJ7 A;  1R6B X;  4DR6 M;  3UK6 A;  2X4A A;  4L4U A;  2KRU A;  1N75 A;  2KXE A;  2R18 A;  5ITX A;  2F5O A;  3AL0 C;  2LH0 A;  4LFA M;  2L6O A;  3RE8 A;  1Z5A A;  1HNX M;  3HKP A;  4LZJ A;  4DR5 M;  4FWG A;  2V1U A;  4LRS A;  2FNA A;  2DWZ B;  1IQP A;  2UXD M;  3VKG A;  4HL4 A;  1QAQ A;  4AG5 A;  2XSZ D;  3TWK A;  4FWH A;  3OTO M;  4GIT A;  1LV7 A;  4PDI A;  5A2Q S;  1IM2 A;  3KW6 A;  3SAS A;  4JI8 M;  4YY3 M;  3HJ8 A;  1GL7 A;  3GLF A;  2C98 A;  1JR3 A;  2ERC A;  3VDP A;  3SFZ A;  4B3T M;  4QNR A;  4IBF A;  2R62 A;  2Y21 A;  2I7N A;  2E5L M;  1TH3 A;  1SXJ B;  1YE9 A;  2A5Y B;  1PJI A;  4AQY M;  3TL4 X;  4IBC A;  5FTN A;  4I4L A;  3TQS A;  3L2A A;  1JQJ C;  4FCV A;  5KQD A;  3KOZ E;  3LQR A;  1TDZ A;  2RGH A;  4OVZ B;  2UUC M;  2Q2E B;  1T3T A;  4L16 A;  2AHM A;  5C1B A;  4QHT A;  3GPX A;  4AKI A;  3GRY A;  3J7A S;  3EIE A;  4KOD A;  4NSO B;  4JI1 M;  3HHZ A;  4NL4 H;  1L2C A;  4IJE A;  4DR4 M;  4GMQ A;  3VK7 A;  2XGN A;  2QBY B;  4R7G A;  2M60 A;  3GLH A;  3A46 A;  1IXR C;  1W5T A;  4KHP M;  3K2L A;  3ILK A;  2KEB A;  5EQT A;  4LFC M;  2C9C A;  2XEP A;  4X66 M;  4GIP A;  3SYL A;  4MGZ E;  3I4Y A;  2KZU A;  5EJC A;  2X8A A;  4LJ8 A;  3U6E A;  1L1T A;  3FUW A;  4JI5 M;  2CFO A;  2QCU A;  2ZAN A;  1IBM M;  3SHG B;  5IT9 S;  1Z5B A;  3W0F A;  1GKI A;  4BBA A;  5KPR A;  5LMU M;  3WHL A;  3SMS A;  4DV5 M;  1E9S A;  3CTW B;  3VLF B;  4B7F A;  3QWL A;  3SAV A;  1L2D A;  5FTK A;  3SAT A;  3T15 A;  1IN6 A;  1SXJ C;  4LF7 M;  5E6J A;  3FUV A;  5DYI A;  1J09 A;  4JI3 M;  4EIW A;  3HU2 A;  3BOS A;  1S3S A;  3T1Y M;  2HL7 A;  4LJA A;  3GPP A;  4LJ9 A;  3IG5 A;  4GRI A;  3UGJ A;  4MB7 A;  5ITY A;  2UUA M;  5DNY A;  1L2B A;  3GLI A;  4LF9 M;  3ZC7 B;  3VDU A;  2XZF A;  3FD9 A;  2OQ4 A;  4RNA A;  1HNZ M;  5BR8 M;  4GH9 A;  3WHK A;  2J7O A;  4YHH M;  3K1J A;  2R46 A;  3U6L A;  3FTC A;  2CV0 A;  3QAU A;  2HKJ A;  4DUZ M;  3A98 B;  3DA1 A;  4AKH A;  3GLG B;  1XC8 A;  4FCW A;  1KYI A;  2XZU A;  4IBK A;  2VII A;  1OFH A;  3KOY E;  5BPV A;  2J7N A;  2QPA A;  2YFQ A;  3TE6 A;  3KDS E;  4DV3 M;  3HU3 A;  1IXZ A;  4DR7 M;  3GRV A;  4G4R A;  2HCB A;  2Z3X A;  1QYR A;  2V6Z M;  3KVW A;  4LZZ A;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...