2KZSA

Daxx helical bundle (dhb) domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-associated protein 6
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzsA00
2KZUA 2KZSA
chains in the Genus database with same CATH superfamily
1V33A 1TH3A 2EO2A 4JXJA 2MROB 4LJ4A 4PDIA 1L2DA 2KXEA 3RGSA 3FUWA 2V1UA 2CHVA 3HY5A 1FJGM 4CJ6A 3GQ4A 4FWGA 1EIJA 1VEKA 3GLHE 2R6FA 2QQ8A 2ZTCA 4HEOA 4AW4A 2L6OA 3KSXA 2CV2A 1GABA 3GLHB 2I7NA 2HL7A 2RGHA 1HQYE 4NSRA 1XXHE 2VIIA 4MM3B 3GQ5A 1XXHB 4IIWA 3U6SA 1T6OA 2Y0TA 2VF8A 4LRTA 3VK8A 3GLFE 4NXNM 3UMMA 3HU2A 1G4AE 2XGNA 3GPXA 2O5RA 1UFZA 3LCUA 4I5SA 2FFJA 8CATA 3GLGA 3GLFB 1N34M 4WP2A 3HHZA 3GPYA 2UU9M 1G8PA 3TQSA 5FLXS 2ZANA 4DUZM 5EP4A 1YUBA 1KFVA 3JAMS 4B3RM 4LF4M 3B89A 1NSFA 1S3SA 3C58A 1G71A 3F92A 2DZNB 1IXSB 1YSYA 4W5WA 4JI3M 2C9OA 3HZJA 3TE6A 2DWNA 4JV5M 3AOGA 1PJTA 2R62A 4DR6M 1MJGM 3LVWA 4IBJA 4ANRA 1VQ1A 3U6QA 3B7QA 2R65A 2ZAMA 3FYCA 1HNXM 7CATA 3MMPA 1QUTA 2Q2EB 4TUWA 3GLIE 2R4EA 1XMOM 2BJWA 3CF2A 3GLIB 3KXEC 1R6BX 4KODA 3TWLA 4CISA 4GHAA 1GL6A 2VQFM 2C98A 1ZMUA 1QVRA 1WGNA 2CRUA 4FW9A 1R5LA 2XSZD 3IG5A 4GC9A 3J7AS 4IJEA 4DV2M 2WSCF 2X49A 1N36M 2R46A 2HCBA 3LW5F 4LZZA 1JR3A 1SXJE 4LFCM 1N78A 1WHCA 4DBGB 1Z5BA 4DR1M 1SXJB 4JI0M 2JY6B 2WZJA 3OTOM 3FKEA 4LZJA 3U5ZA 1R2ZA 2RGOA 1KSFX 1ZMWA 2CV1A 4AKGA 4LJ8A 2FNAA 3AKZA 3B7ZA 1T43A 4KT0F 2K9DA 3GRRA 4R7GA 1XB2B 2JZ0A 4DR5M 2CHGA 3GRUA 2CE7A 2CV0A 3PNYA 3AV0A 3KOXE 2LHCA 4L4UA 3E21A 2Z4SA 3D8BA 3UK6A 2MR9A 5DNYA 1W5TA 2R18A 4JI4M 4FWHA 3EIHA 3MK6A 4CGYB 4HL4A 1DV0A 2R0IA 2XF3A 1HQCA 3HU3A 1J5EM 1E9RA 4KO8A 2LXEA 2KNAA 3T1HM 2CUZA 1QZMA 5E26A 2JA2A 3TWKA 3M6AA 3M0EA 4WURA 1XHBA 2UXBM 3QYBA 2F5PA 2KHHA 2JNHA 1TGUA 3I01M 2HAKA 2K47A 2DAGA 4NOOB 2JY8A 2DHYA 3RGPA 3IG8A 3SAWA 2DWMA 1QYRA 1GVNA 3I51A 1TTEA 3Q8XA 2F4VM 1JR3D 1XNRM 1Z6TA 4NC6A 1L2BA 3PFIA 3A42A 3T6PA 2J7OA 4R71A 1WIVA 1IN7A 2ZAOA 3HKPA 1IN4A 1WJ7A 3ZH9B 2G5GX 2JY7A 2LTUA 3KOYE 3SASA 1F4IA 4L6V6 1OFHA 2UUCM 2C96A 1P3QQ 4LF7M 3J81S 5L8RF 1HR0M 1GLNA 2QP9X 2A5YB 3LVVA 1QAOA 1VG5A 2JP7A 2R44A 3H4JA 3HJ8A 4GEWA 1IXZA 1UM8A 1I4WA 1VEGA 1YLAA 3K2LA 4GC5A 3NWLA 2DAMA 2EKKA 4S12A 2QZ4A 5DYIA 3GPUA 1L1TA 5EXPA 2LWXA 4YHHM 1OQYA 2CHQA 2AHMA 4JI6M 2DWLA 3U6LA 2XFSA 1VDDA 5IT9S 2DZLA 5BR8M 3L26A 1L8QA 1C1KA 3FUVA 3VDPA 1DGBA 4B3MM 1IBLM 4LY6A 4IBKA 4G4OA 4UN2B 4AG5A 1OTRA 2H5XA 3E9SA 3K92A 4GH9A 4II7A 4L16A 3WHKA 3U61B 3VK7A 1ORYB 5GKNA 2XSZA 2LVOC 4YY3M 3AL0C 2DAEA 1X37A 4LJ5A 4G4NA 2ZTDA 1D0LA 3DA1A 1PJSA 4ZPXA 4DV5M 5IWAM 3KSJA 4QOSA 4QNMA 3TPZA 1DGHA 2KRUA 1H6UA 3MHVC 4MGYE 4PT5A 3RE8A 3LCVB 3GLGE 2BWEA 2G3QA 2F5OA 5FTJA 3WHLA 2XLJA 3GLGB 2L2DA 1IXRC 4DV3M 1OAOC 1D2NA 2DAIA 2V6ZM 3HJQA 2BNKA 2LVNC 5KPRA 4B08A 3EIEA 4LGMA 4P17A 1DO2A 3SHGB 3W67A 1HJPA 2YQZA 1OFIA 4JI5M 2KRKA 4BLCA 3GLHA 4GMQA 3DZDA 2UXCM 2XFTA 3SYKA 2HWJA 4L78A 4IBFA 3U6CA 1VDLA 2MH8A 2C5RA 3L27A 3T38A 1J7KA 4PD2A 3A46A 2VF7A 5KQ8A 2QHOB 3NBXX 3GLFA 3W0FA 2BWBA 1Y8GA 4DV4M 2M60A 5EJCA 1GJSA 1OAIA 2JY5A 1NV9A 2KW0A 5LMUM 3U6MA 2DAKA 3W0LB 4LCBA 4JI2M 3AJIB 2UXDM 1IN8A 5EP2A 2EA0A 3C3DA 5ITTA 1NVMA 3LMMA 3FD9A 2JXNA 3L2AA 4NRVA 1IY0A 1PJJA 2QBYB 4FWDA 4NXMM 3U6DA 1N77A 2Z3XA 3U5ZB 4GKKM 3ZC7B 2I7PA 3SHFA 3FUXA 5DFLA 3KFUG 4FVMA 2L7IA 4QOZC 4OX9M 3HGIA 5EXXA 4AZFA 4FCVA 4XGIA 2X4AA 4PDGA 4LJAA 3FUTA 5H37D 3R8FA 3GLIA 1DGFA 1QAMA 2FH0A 2OQ4A 5EXTA 3GO8A 2Z8YM 1PJIA 1G59A 3KS8A 1XWIA 2RRUA 3KP1E 1XMQM 3SC3A 1HNZM 3KOZE 1ZQ9A 1NHGC 2LVAA 4LGYA 3L25A 3HHYA 4RF0A 4AKIA 1T3TA 3PVSA 4XK8F 3KS4A 4B3TM 1V34A 1SXJA 2DHRA 2LBCA 1J09A 3BXWA 3KVWA 4M9ZA 2YNMD 4BB9A 3IECA 5FTLA 3U60A 3K9OA 1SG9A 2OO9A 3D8LA 4IJFA 2LH0A 2YFQA 4IBBA 3B7NA 2CEAA 1E94E 1AIPC 5FTNA 3J80S 5ITXA 3VFDA 4IBIA 4JN6A 5JI3E 1OIZA 4OVZA 3BOSA 4F2LA 3NBIA 1D0KA 2KZSA 4RF1A 1HT1E 5EP3A 1PGYA 2FOIC 1HNWM 3J27B 4AQYM 2F5NA 1E9SA 3J2PB 3FUUA 3I4VA 5ITYA 2P5TA 2XZFA 3SARA 1N33M 1PM5A 1N32M 1BVSA 3V76A 4KLNA 3TWMA 3GQ3A 2J5YA 4M9XA 3KP0E 3FRHA 5EQTA 1MU5A 1MX0A 1QDTA 3FTDA 4LJ9A 1Z59A 4G4RA 3A45A 1N75A 4X62M 4DR3M 4L15A 3GP1A 2RKOA 3T1YM 1ZV1A 3GRYA 2OOBA 4OU7A 1V92A 4AKHA 2LVPC 4LF9M 4DV1M 3W68A 3DOAA 1TDHA 5EP1A 2DZOB 4QNRA 1IFYA 1RU3A 4JI1M 1GKIA 4MGKE 3HJSA 3E4RA 5EXSA 1IY1A 4D81A 2NQ8C 5A2QS 1SXJD 1XC8A 4B3SM 1WXQA 1EE8A 3T15A 3JR4A 2OPFA 4AG6A 4KHPM 1QUSA 3DFZA 4DUYM 1QDRA 2DWZB 4FCTA 1TH2A 4P16A 4Y28F 3FTEA 3A98B 3B74A 4DV0M 1D0MA 2L09A 2M5ZA 2JZ1A 2VQEM 4Q7JA 3KDSE 2CP8A 4IBGA 4LRSA 2KA6B 1VEJA 5IREB 2WSFF 3SYLA 5C1BA 1QZEA 2R4JA 3PXGA 1TF0B 1OJLA 2KEBA 3HHXA 1GO5A 4IBEA 1R7RA 4NSOB 4DR2M 2L7HA 2CWBA 2APLA 1K82A 3AOEC 2V1CA 2KZUA 2O01F 3I04M 1OKSA 2L4EA 4PCZA 1R2YA 4LG2A 2Z4RA 1JB0F 2CFOA 1L1ZA 1IBMM 2E5LM 4HLQA 3HU1A 3U6PA 1JQJC 1IY2A 2LVQD 4AI6A 4MGIE 4Z6YA 3U61A 2HHHM 2DKLA 2QCUA 4LFAM 2QPAA 1NV8A 1NNUC 2JWSA 2Y21A 1NO1A 3HHWA 3VDUA 2UUBM 3FYDA 4WW0A 3SMPA 2D7HA 1XXHA 2DVWB 1NJFA 1NJGA 3AOEA 5C18A 5ITRA 2Y20A 1NY5A 2VDBB 3M7GA 3SATA 1LTMA 2LHGA 3C9PA 1EFUB 2K6BA 4B7GA 4LF5M 4B7HA 2JUJA 1HT2E 4NRWA 1E32A 2X8AA 5KO3A 3IHPA 5FTKA 4MH0E 4LFBM 4CHTB 3CF0A 4FCWA 3THGA 2GQFA 4X64M 3K8ZA 1WR1B 3J7BA 4RKUF 5KPZA 1NY6A 3C3EA 1JR3E 3L29A 4RNAA 2EUCA 3ILKA 3U6EA 1XNQM 4B7FA 3SBJA 1QAQA 3SAUA 1IXSA 2O25A 1GL7A 1K3XA 1QQWA 4R3DA 2UUAM 1NNJA 5KQDA 3L28A 2XH9A 1CUKA 4D80A 2ZBKB 3HX3A 1MN3A 1Z5AA 2C9CA 2KNVA 2B3TA 3LQQA 3E46A 1L2CA 4IBDA 1K3WA 1SXJC 1WGLA 5ITQA 4L8RC 4DV6M 4XBOA 4MB7A 2DENA 5ITUA 3FE3A 2F5SA 3U6OA 4DV7M 3ZCBB 4GKJM 1ZMVA 4M0DA 1Q39A 2BJVA 3JR5A 4LF8M 2D7GA 2C99A 3CF6E 1LV7A 2G8LA 3CGWA 3CTWB 1PJQA 5DYGA 4G4QA 2FE8A 4LF6M 4JYAM 2QBYA 4GHLA 1GJTA 1G3IA 3U60B 5BPVA 2EKFA 3BBZA 3HWSA 3ZQJA 1I94M 3AFHA 5LMNM 1IBKM 2OOAA 4M9SA 3SFZA 5ITXE 4I4LA 2D7EA 4REZA 4X66M 3VKHA 2LNHC 4JI8M 3UJNA 4MGHA 4OVZB 5IZ7D 1G41A 3QYEA 3VLFB 1FNNA 1DO0A 3FRIA 2XZUA 4M0WA 2J7NA 5E6JA 4K0KM 3MJ5A 3QWLA 4QHSA 2K0BX 1Q3BA 1ZAEA 2N35A 1Q3CA 4G6ZA 4A3VB 4ITQA 2MGWA 2GNOA 3GRVA 3Q8GA 2ZM6M 4JI7M 5FSWA 2YR0A 4IBCA 4OW0A 2Z7JA 3FTFA 1NHWC 4LJ7A 4X65M 1C7YA 2WSEF 1YE9A 3GPPA 4F1IA 2MJ5B 4LJ6A 1PRBA 1R4GA 1Z5CA 4DR7M 2DI0A 3LQRA 1AUAA 1TR8A 5FTMA 3UGJA 1IQPA 3FTCA 4GRIA 1TDZA 1KYIA 2W82A 1W5SA 2KDLA 3PNVA 3I4YA 5JI2E 1TH4A 3H4MA 4MGZE 3TL4X 3RFWA 1IM2A 1IN5A 2EJSA 2ERCA 2QSFX 2Y0QA 4NL4H 4D82A 5KPTA 3KOWE 3UZUA 2L4FA 3SMSA 2H1RA 3KW6A 3VKGA 4BBAA 4EIWA 1A5TA 3SAVA 2KNZA 2F5QA 3K9PA 4GITA 2R45A 4DR4M 2HKJA 4Z8XA 2DXIA 4QHTA 5F3WA 1IN6A 1QANA 4FD2A 4G3OA 1DGHB 2DNAA 4I8OA 3B9PA 4CIZA 2XEPA 1Q02A 4GIPA 1DGGA 3K1JA 2QNJA 2QENA 3QAUA 4I81A 2FS1A 3R9XB 1OIPA
chains in the Genus database with same CATH topology
2EO2A 1TH3A 4JXJA 4LJ4A 4PDIA 1L2DA 2KXEA 3RGSA 3FUWA 2V1UA 2CHVA 1FJGM 3GQ4A 4FWGA 2CV2A 4AW4A 2L6OA 3KSXA 3GLHB 2I7NA 2HL7A 2RGHA 1HQYE 4NSRA 2VIIA 4MM3B 3GQ5A 1XXHB 4IIWA 3U6SA 2Y0TA 4LRTA 3VK8A 4NXNM 3UMMA 3HU2A 1G4AE 2XGNA 3GPXA 2O5RA 4I5SA 2FFJA 8CATA 3GLGA 3GLFB 1N34M 3HHZA 3GPYA 2UU9M 1G8PA 3TQSA 5FLXS 2ZANA 4DUZM 5EP4A 1YUBA 1KFVA 3JAMS 4B3RM 4LF4M 1NSFA 1S3SA 3C58A 4W5WA 2DZNB 1IXSB 1YSYA 4JI3M 3TE6A 2C9OA 2DWNA 4JV5M 3AOGA 2R62A 3LVWA 4IBJA 3U6QA 2R65A 2ZAMA 3FYCA 1HNXM 7CATA 2Q2EB 4TUWA 2R4EA 1XMOM 2BJWA 3CF2A 3GLIB 3KXEC 1R6BX 4KODA 3TWLA 4CISA 4GHAA 1GL6A 2VQFM 2C98A 1QVRA 4FW9A 2XSZD 3IG5A 4GC9A 3J7AS 4IJEA 4DV2M 2X49A 1N36M 2R46A 2HCBA 4LZZA 4LFCM 1JR3A 1SXJE 1N78A 1Z5BA 4DR1M 1SXJB 4JI0M 3OTOM 3FKEA 4LZJA 3U5ZA 1R2ZA 2RGOA 1KSFX 2CV1A 4AKGA 4LJ8A 2FNAA 3AKZA 3GRRA 4R7GA 4DR5M 2CHGA 3GRUA 2CE7A 2CV0A 3PNYA 3AV0A 3KOXE 4L4UA 2Z4SA 3D8BA 3UK6A 5DNYA 4JI4M 1W5TA 2R18A 4FWHA 3EIHA 3MK6A 4CGYB 4HL4A 3HU3A 2XF3A 1HQCA 1J5EM 1E9RA 4KO8A 2LXEA 3T1HM 2CUZA 1QZMA 5E26A 2JA2A 3TWKA 3M6AA 3M0EA 4WURA 1XHBA 2UXBM 2F5PA 1TGUA 2K47A 4NOOB 3RGPA 3IG8A 3SAWA 2DWMA 1QYRA 1GVNA 3I51A 3Q8XA 2F4VM 1JR3D 1XNRM 1Z6TA 1L2BA 3PFIA 3A42A 2J7OA 1IN7A 2ZAOA 3HKPA 1IN4A 3ZH9B 2G5GX 3KOYE 3SASA 1OFHA 2UUCM 2C96A 4LF7M 3J81S 1HR0M 1GLNA 2QP9X 2A5YB 3LVVA 1QAOA 3HJ8A 1IXZA 1UM8A 1I4WA 3K2LA 4GC5A 5EP3A 3NWLA 4S12A 3GPUA 5DYIA 2QZ4A 1L1TA 5EXPA 2LWXA 4YHHM 2CHQA 2AHMA 4JI6M 2DWLA 3U6LA 2XFSA 1VDDA 5IT9S 5BR8M 3L26A 1L8QA 1C1KA 3FUVA 3VDPA 1DGBA 4B3MM 1IBLM 4LY6A 4IBKA 4G4OA 4AG5A 4II7A 3E9SA 3K92A 4GH9A 3U61B 4L16A 3WHKA 3VK7A 1ORYB 5GKNA 2XSZA 4YY3M 3AL0C 1X37A 4LJ5A 4G4NA 3DA1A 4DV5M 4ZPXA 5IWAM 3KSJA 4QOSA 4QNMA 3TPZA 1DGHA 2KRUA 1H6UA 3MHVC 4MGYE 4PT5A 3RE8A 2F5OA 5FTJA 3WHLA 2XLJA 3GLGB 1IXRC 4DV3M 2V6ZM 1D2NA 3HJQA 2BNKA 5KPRA 4B08A 3EIEA 4LGMA 1DO2A 3SHGB 2YQZA 1OFIA 4JI5M 2KRKA 4BLCA 3GLHA 4GMQA 3DZDA 2UXCM 2XFTA 3SYKA 4L78A 4IBFA 3U6CA 2C5RA 3L27A 3T38A 1J7KA 4PD2A 3A46A 5KQ8A 3GLFA 3W0FA 4DV4M 2M60A 5EJCA 2KW0A 5LMUM 3U6MA 3W0LB 4LCBA 4JI2M 3AJIB 2UXDM 1IN8A 5EP2A 2EA0A 5ITTA 1NVMA 3LMMA 3FD9A 4NRVA 3L2AA 1PJJA 1IY0A 2QBYB 4NXMM 4FWDA 3U6DA 1N77A 2Z3XA 3U5ZB 4GKKM 3ZC7B 2I7PA 3SHFA 3FUXA 3KFUG 4FVMA 2L7IA 4QOZC 4OX9M 3HGIA 5EXXA 4AZFA 4FCVA 4XGIA 2X4AA 4PDGA 4LJAA 3FUTA 5H37D 3R8FA 3GLIA 1DGFA 1QAMA 2OQ4A 5EXTA 3GO8A 1PJIA 1G59A 3KS8A 1XWIA 3KP1E 1XMQM 3SC3A 1HNZM 3KOZE 1ZQ9A 1NHGC 4LGYA 3L25A 3HHYA 4RF0A 4AKIA 1T3TA 3PVSA 3KS4A 4B3TM 2DHRA 1SXJA 3KVWA 4M9ZA 1J09A 4BB9A 2YNMD 5FTLA 3U60A 3D8LA 4IJFA 2LH0A 2YFQA 4IBBA 2CEAA 1E94E 5FTNA 5ITXA 3J80S 3VFDA 5JI3E 4IBIA 4JN6A 4OVZA 3BOSA 3NBIA 2KZSA 4RF1A 1HT1E 2FOIC 1HNWM 3J27B 4AQYM 2F5NA 1E9SA 3J2PB 3FUUA 3I4VA 5ITYA 2P5TA 2XZFA 3SARA 1N33M 1PM5A 1N32M 4KLNA 3TWMA 3GQ3A 4M9XA 3KP0E 5EQTA 1MU5A 1MX0A 3FTDA 4LJ9A 1Z59A 4G4RA 3A45A 1N75A 4X62M 4DR3M 4L15A 3GP1A 2RKOA 3T1YM 3GRYA 4OU7A 4AKHA 4LF9M 4DV1M 3DOAA 1TDHA 5EP1A 2DZOB 4QNRA 4JI1M 1GKIA 4MGKE 3HJSA 3E4RA 5EXSA 1IY1A 4D81A 2NQ8C 5A2QS 1SXJD 1XC8A 4B3SM 1WXQA 1EE8A 3T15A 3JR4A 2OPFA 4AG6A 4KHPM 3DFZA 4DUYM 2DWZB 4FCTA 1TH2A 4P16A 3FTEA 3A98B 4DV0M 2L09A 2M5ZA 2VQEM 3KDSE 4IBGA 4LRSA 2KA6B 5IREB 3SYLA 5C1BA 2R4JA 3PXGA 1OJLA 2KEBA 3HHXA 4IBEA 1R7RA 4NSOB 4DR2M 2L7HA 1K82A 3AOEC 2V1CA 2KZUA 4PCZA 4LG2A 1R2YA 2Z4RA 1L1ZA 2CFOA 1IBMM 2E5LM 4HLQA 3HU1A 3U6PA 1JQJC 1IY2A 4AI6A 4MGIE 4Z6YA 3U61A 2HHHM 2QCUA 4LFAM 2QPAA 2UUBM 1NNUC 3VDUA 2Y21A 3HHWA 3FYDA 4WW0A 3SMPA 2D7HA 1XXHA 2DVWB 1NJFA 1NJGA 3AOEA 5C18A 5ITRA 2Y20A 1NY5A 3M7GA 3SATA 4B7GA 4LF5M 4B7HA 1HT2E 4NRWA 1E32A 2X8AA 5KO3A 5FTKA 4MH0E 4LFBM 4CHTB 3CF0A 4FCWA 3THGA 4X64M 3K8ZA 3J7BA 5KPZA 1NY6A 3L29A 1XNQM 4RNAA 2EUCA 3ILKA 3U6EA 4B7FA 3SBJA 1QAQA 3SAUA 1K3XA 1GL7A 1QQWA 4R3DA 2UUAM 1NNJA 5KQDA 3L28A 2XH9A 4D80A 2ZBKB 1Z5AA 2C9CA 3LQQA 1L2CA 4IBDA 1K3WA 1SXJC 5ITQA 4L8RC 4DV6M 4XBOA 4MB7A 5ITUA 2F5SA 3U6OA 4DV7M 3ZCBB 4GKJM 4M0DA 1Q39A 2BJVA 3JR5A 4LF8M 2D7GA 2C99A 3CF6E 1LV7A 2G8LA 3CTWB 5DYGA 4G4QA 2FE8A 4LF6M 4JYAM 2QBYA 4GHLA 1G3IA 3U60B 5BPVA 3HWSA 1I94M 3AFHA 5LMNM 1IBKM 4M9SA 3SFZA 5ITXE 4I4LA 2D7EA 4REZA 4X66M 3VKHA 2LNHC 4JI8M 3UJNA 4MGHA 4OVZB 5IZ7D 1G41A 3VLFB 1FNNA 1DO0A 2XZUA 4M0WA 2J7NA 5E6JA 4K0KM 3MJ5A 3QWLA 4QHSA 1Q3BA 1ZAEA 1Q3CA 4G6ZA 4A3VB 4ITQA 3GRVA 2ZM6M 4JI7M 5FSWA 2YR0A 4IBCA 4OW0A 2Z7JA 3FTFA 1NHWC 4LJ7A 4X65M 1YE9A 3GPPA 4LJ6A 1Z5CA 4DR7M 3LQRA 5FTMA 3UGJA 1IQPA 3FTCA 4GRIA 1TDZA 1KYIA 2W82A 1W5SA 3PNVA 3I4YA 5JI2E 1TH4A 3H4MA 4MGZE 3TL4X 3RFWA 1IM2A 1IN5A 2ERCA 4D82A 4NL4H 2Y0QA 5KPTA 4DR6M 3KOWE 3UZUA 3SMSA 2H1RA 3KW6A 3VKGA 4BBAA 4EIWA 3SAVA 2F5QA 4GITA 2R45A 4DR4M 2HKJA 4Z8XA 2DXIA 4QHTA 5F3WA 1IN6A 1QANA 4FD2A 1DGHB 4I8OA 3B9PA 2XEPA 4GIPA 1DGGA 3K1JA 2QENA 3QAUA 4I81A 3R9XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZU A;  2KZS A; 
#chains in the Genus database with same CATH topology
 1V33 A;  1TH3 A;  2EO2 A;  4JXJ A;  2MRO B;  4LJ4 A;  4PDI A;  1L2D A;  2KXE A;  3RGS A;  3FUW A;  2V1U A;  2CHV A;  3HY5 A;  1FJG M;  4CJ6 A;  3GQ4 A;  4FWG A;  1EIJ A;  1VEK A;  3GLH E;  2R6F A;  2QQ8 A;  2ZTC A;  4HEO A;  4AW4 A;  2L6O A;  3KSX A;  2CV2 A;  1GAB A;  3GLH B;  2I7N A;  2HL7 A;  2RGH A;  1HQY E;  4NSR A;  1XXH E;  2VII A;  4MM3 B;  3GQ5 A;  1XXH B;  4IIW A;  3U6S A;  1T6O A;  2Y0T A;  2VF8 A;  4LRT A;  3VK8 A;  3GLF E;  4NXN M;  3UMM A;  3HU2 A;  1G4A E;  2XGN A;  3GPX A;  2O5R A;  1UFZ A;  3LCU A;  4I5S A;  2FFJ A;  8CAT A;  3GLG A;  3GLF B;  1N34 M;  4WP2 A;  3HHZ A;  3GPY A;  2UU9 M;  1G8P A;  3TQS A;  5FLX S;  2ZAN A;  4DUZ M;  5EP4 A;  1YUB A;  1KFV A;  3JAM S;  4B3R M;  4LF4 M;  3B89 A;  1NSF A;  1S3S A;  3C58 A;  1G71 A;  3F92 A;  2DZN B;  1IXS B;  1YSY A;  4W5W A;  4JI3 M;  2C9O A;  3HZJ A;  3TE6 A;  2DWN A;  4JV5 M;  3AOG A;  1PJT A;  2R62 A;  4DR6 M;  1MJG M;  3LVW A;  4IBJ A;  4ANR A;  1VQ1 A;  3U6Q A;  3B7Q A;  2R65 A;  2ZAM A;  3FYC A;  1HNX M;  7CAT A;  3MMP A;  1QUT A;  2Q2E B;  4TUW A;  3GLI E;  2R4E A;  1XMO M;  2BJW A;  3CF2 A;  3GLI B;  3KXE C;  1R6B X;  4KOD A;  3TWL A;  4CIS A;  4GHA A;  1GL6 A;  2VQF M;  2C98 A;  1ZMU A;  1QVR A;  1WGN A;  2CRU A;  4FW9 A;  1R5L A;  2XSZ D;  3IG5 A;  4GC9 A;  3J7A S;  4IJE A;  4DV2 M;  2WSC F;  2X49 A;  1N36 M;  2R46 A;  2HCB A;  3LW5 F;  4LZZ A;  1JR3 A;  1SXJ E;  4LFC M;  1N78 A;  1WHC A;  4DBG B;  1Z5B A;  4DR1 M;  1SXJ B;  4JI0 M;  2JY6 B;  2WZJ A;  3OTO M;  3FKE A;  4LZJ A;  3U5Z A;  1R2Z A;  2RGO A;  1KSF X;  1ZMW A;  2CV1 A;  4AKG A;  4LJ8 A;  2FNA A;  3AKZ A;  3B7Z A;  1T43 A;  4KT0 F;  2K9D A;  3GRR A;  4R7G A;  1XB2 B;  2JZ0 A;  4DR5 M;  2CHG A;  3GRU A;  2CE7 A;  2CV0 A;  3PNY A;  3AV0 A;  3KOX E;  2LHC A;  4L4U A;  3E21 A;  2Z4S A;  3D8B A;  3UK6 A;  2MR9 A;  5DNY A;  1W5T A;  2R18 A;  4JI4 M;  4FWH A;  3EIH A;  3MK6 A;  4CGY B;  4HL4 A;  1DV0 A;  2R0I A;  2XF3 A;  1HQC A;  3HU3 A;  1J5E M;  1E9R A;  4KO8 A;  2LXE A;  2KNA A;  3T1H M;  2CUZ A;  1QZM A;  5E26 A;  2JA2 A;  3TWK A;  3M6A A;  3M0E A;  4WUR A;  1XHB A;  2UXB M;  3QYB A;  2F5P A;  2KHH A;  2JNH A;  1TGU A;  3I01 M;  2HAK A;  2K47 A;  2DAG A;  4NOO B;  2JY8 A;  2DHY A;  3RGP A;  3IG8 A;  3SAW A;  2DWM A;  1QYR A;  1GVN A;  3I51 A;  1TTE A;  3Q8X A;  2F4V M;  1JR3 D;  1XNR M;  1Z6T A;  4NC6 A;  1L2B A;  3PFI A;  3A42 A;  3T6P A;  2J7O A;  4R71 A;  1WIV A;  1IN7 A;  2ZAO A;  3HKP A;  1IN4 A;  1WJ7 A;  3ZH9 B;  2G5G X;  2JY7 A;  2LTU A;  3KOY E;  3SAS A;  1F4I A;  4L6V 6;  1OFH A;  2UUC M;  2C96 A;  1P3Q Q;  4LF7 M;  3J81 S;  5L8R F;  1HR0 M;  1GLN A;  2QP9 X;  2A5Y B;  3LVV A;  1QAO A;  1VG5 A;  2JP7 A;  2R44 A;  3H4J A;  3HJ8 A;  4GEW A;  1IXZ A;  1UM8 A;  1I4W A;  1VEG A;  1YLA A;  3K2L A;  4GC5 A;  3NWL A;  2DAM A;  2EKK A;  4S12 A;  2QZ4 A;  5DYI A;  3GPU A;  1L1T A;  5EXP A;  2LWX A;  4YHH M;  1OQY A;  2CHQ A;  2AHM A;  4JI6 M;  2DWL A;  3U6L A;  2XFS A;  1VDD A;  5IT9 S;  2DZL A;  5BR8 M;  3L26 A;  1L8Q A;  1C1K A;  3FUV A;  3VDP A;  1DGB A;  4B3M M;  1IBL M;  4LY6 A;  4IBK A;  4G4O A;  4UN2 B;  4AG5 A;  1OTR A;  2H5X A;  3E9S A;  3K92 A;  4GH9 A;  4II7 A;  4L16 A;  3WHK A;  3U61 B;  3VK7 A;  1ORY B;  5GKN A;  2XSZ A;  2LVO C;  4YY3 M;  3AL0 C;  2DAE A;  1X37 A;  4LJ5 A;  4G4N A;  2ZTD A;  1D0L A;  3DA1 A;  1PJS A;  4ZPX A;  4DV5 M;  5IWA M;  3KSJ A;  4QOS A;  4QNM A;  3TPZ A;  1DGH A;  2KRU A;  1H6U A;  3MHV C;  4MGY E;  4PT5 A;  3RE8 A;  3LCV B;  3GLG E;  2BWE A;  2G3Q A;  2F5O A;  5FTJ A;  3WHL A;  2XLJ A;  3GLG B;  2L2D A;  1IXR C;  4DV3 M;  1OAO C;  1D2N A;  2DAI A;  2V6Z M;  3HJQ A;  2BNK A;  2LVN C;  5KPR A;  4B08 A;  3EIE A;  4LGM A;  4P17 A;  1DO2 A;  3SHG B;  3W67 A;  1HJP A;  2YQZ A;  1OFI A;  4JI5 M;  2KRK A;  4BLC A;  3GLH A;  4GMQ A;  3DZD A;  2UXC M;  2XFT A;  3SYK A;  2HWJ A;  4L78 A;  4IBF A;  3U6C A;  1VDL A;  2MH8 A;  2C5R A;  3L27 A;  3T38 A;  1J7K A;  4PD2 A;  3A46 A;  2VF7 A;  5KQ8 A;  2QHO B;  3NBX X;  3GLF A;  3W0F A;  2BWB A;  1Y8G A;  4DV4 M;  2M60 A;  5EJC A;  1GJS A;  1OAI A;  2JY5 A;  1NV9 A;  2KW0 A;  5LMU M;  3U6M A;  2DAK A;  3W0L B;  4LCB A;  4JI2 M;  3AJI B;  2UXD M;  1IN8 A;  5EP2 A;  2EA0 A;  3C3D A;  5ITT A;  1NVM A;  3LMM A;  3FD9 A;  2JXN A;  3L2A A;  4NRV A;  1IY0 A;  1PJJ A;  2QBY B;  4FWD A;  4NXM M;  3U6D A;  1N77 A;  2Z3X A;  3U5Z B;  4GKK M;  3ZC7 B;  2I7P A;  3SHF A;  3FUX A;  5DFL A;  3KFU G;  4FVM A;  2L7I A;  4QOZ C;  4OX9 M;  3HGI A;  5EXX A;  4AZF A;  4FCV A;  4XGI A;  2X4A A;  4PDG A;  4LJA A;  3FUT A;  5H37 D;  3R8F A;  3GLI A;  1DGF A;  1QAM A;  2FH0 A;  2OQ4 A;  5EXT A;  3GO8 A;  2Z8Y M;  1PJI A;  1G59 A;  3KS8 A;  1XWI A;  2RRU A;  3KP1 E;  1XMQ M;  3SC3 A;  1HNZ M;  3KOZ E;  1ZQ9 A;  1NHG C;  2LVA A;  4LGY A;  3L25 A;  3HHY A;  4RF0 A;  4AKI A;  1T3T A;  3PVS A;  4XK8 F;  3KS4 A;  4B3T M;  1V34 A;  1SXJ A;  2DHR A;  2LBC A;  1J09 A;  3BXW A;  3KVW A;  4M9Z A;  2YNM D;  4BB9 A;  3IEC A;  5FTL A;  3U60 A;  3K9O A;  1SG9 A;  2OO9 A;  3D8L A;  4IJF A;  2LH0 A;  2YFQ A;  4IBB A;  3B7N A;  2CEA A;  1E94 E;  1AIP C;  5FTN A;  3J80 S;  5ITX A;  3VFD A;  4IBI A;  4JN6 A;  5JI3 E;  1OIZ A;  4OVZ A;  3BOS A;  4F2L A;  3NBI A;  1D0K A;  2KZS A;  4RF1 A;  1HT1 E;  5EP3 A;  1PGY A;  2FOI C;  1HNW M;  3J27 B;  4AQY M;  2F5N A;  1E9S A;  3J2P B;  3FUU A;  3I4V A;  5ITY A;  2P5T A;  2XZF A;  3SAR A;  1N33 M;  1PM5 A;  1N32 M;  1BVS A;  3V76 A;  4KLN A;  3TWM A;  3GQ3 A;  2J5Y A;  4M9X A;  3KP0 E;  3FRH A;  5EQT A;  1MU5 A;  1MX0 A;  1QDT A;  3FTD A;  4LJ9 A;  1Z59 A;  4G4R A;  3A45 A;  1N75 A;  4X62 M;  4DR3 M;  4L15 A;  3GP1 A;  2RKO A;  3T1Y M;  1ZV1 A;  3GRY A;  2OOB A;  4OU7 A;  1V92 A;  4AKH A;  2LVP C;  4LF9 M;  4DV1 M;  3W68 A;  3DOA A;  1TDH A;  5EP1 A;  2DZO B;  4QNR A;  1IFY A;  1RU3 A;  4JI1 M;  1GKI A;  4MGK E;  3HJS A;  3E4R A;  5EXS A;  1IY1 A;  4D81 A;  2NQ8 C;  5A2Q S;  1SXJ D;  1XC8 A;  4B3S M;  1WXQ A;  1EE8 A;  3T15 A;  3JR4 A;  2OPF A;  4AG6 A;  4KHP M;  1QUS A;  3DFZ A;  4DUY M;  1QDR A;  2DWZ B;  4FCT A;  1TH2 A;  4P16 A;  4Y28 F;  3FTE A;  3A98 B;  3B74 A;  4DV0 M;  1D0M A;  2L09 A;  2M5Z A;  2JZ1 A;  2VQE M;  4Q7J A;  3KDS E;  2CP8 A;  4IBG A;  4LRS A;  2KA6 B;  1VEJ A;  5IRE B;  2WSF F;  3SYL A;  5C1B A;  1QZE A;  2R4J A;  3PXG A;  1TF0 B;  1OJL A;  2KEB A;  3HHX A;  1GO5 A;  4IBE A;  1R7R A;  4NSO B;  4DR2 M;  2L7H A;  2CWB A;  2APL A;  1K82 A;  3AOE C;  2V1C A;  2KZU A;  2O01 F;  3I04 M;  1OKS A;  2L4E A;  4PCZ A;  1R2Y A;  4LG2 A;  2Z4R A;  1JB0 F;  2CFO A;  1L1Z A;  1IBM M;  2E5L M;  4HLQ A;  3HU1 A;  3U6P A;  1JQJ C;  1IY2 A;  2LVQ D;  4AI6 A;  4MGI E;  4Z6Y A;  3U61 A;  2HHH M;  2DKL A;  2QCU A;  4LFA M;  2QPA A;  1NV8 A;  1NNU C;  2JWS A;  2Y21 A;  1NO1 A;  3HHW A;  3VDU A;  2UUB M;  3FYD A;  4WW0 A;  3SMP A;  2D7H A;  1XXH A;  2DVW B;  1NJF A;  1NJG A;  3AOE A;  5C18 A;  5ITR A;  2Y20 A;  1NY5 A;  2VDB B;  3M7G A;  3SAT A;  1LTM A;  2LHG A;  3C9P A;  1EFU B;  2K6B A;  4B7G A;  4LF5 M;  4B7H A;  2JUJ A;  1HT2 E;  4NRW A;  1E32 A;  2X8A A;  5KO3 A;  3IHP A;  5FTK A;  4MH0 E;  4LFB M;  4CHT B;  3CF0 A;  4FCW A;  3THG A;  2GQF A;  4X64 M;  3K8Z A;  1WR1 B;  3J7B A;  4RKU F;  5KPZ A;  1NY6 A;  3C3E A;  1JR3 E;  3L29 A;  4RNA A;  2EUC A;  3ILK A;  3U6E A;  1XNQ M;  4B7F A;  3SBJ A;  1QAQ A;  3SAU A;  1IXS A;  2O25 A;  1GL7 A;  1K3X A;  1QQW A;  4R3D A;  2UUA M;  1NNJ A;  5KQD A;  3L28 A;  2XH9 A;  1CUK A;  4D80 A;  2ZBK B;  3HX3 A;  1MN3 A;  1Z5A A;  2C9C A;  2KNV A;  2B3T A;  3LQQ A;  3E46 A;  1L2C A;  4IBD A;  1K3W A;  1SXJ C;  1WGL A;  5ITQ A;  4L8R C;  4DV6 M;  4XBO A;  4MB7 A;  2DEN A;  5ITU A;  3FE3 A;  2F5S A;  3U6O A;  4DV7 M;  3ZCB B;  4GKJ M;  1ZMV A;  4M0D A;  1Q39 A;  2BJV A;  3JR5 A;  4LF8 M;  2D7G A;  2C99 A;  3CF6 E;  1LV7 A;  2G8L A;  3CGW A;  3CTW B;  1PJQ A;  5DYG A;  4G4Q A;  2FE8 A;  4LF6 M;  4JYA M;  2QBY A;  4GHL A;  1GJT A;  1G3I A;  3U60 B;  5BPV A;  2EKF A;  3BBZ A;  3HWS A;  3ZQJ A;  1I94 M;  3AFH A;  5LMN M;  1IBK M;  2OOA A;  4M9S A;  3SFZ A;  5ITX E;  4I4L A;  2D7E A;  4REZ A;  4X66 M;  3VKH A;  2LNH C;  4JI8 M;  3UJN A;  4MGH A;  4OVZ B;  5IZ7 D;  1G41 A;  3QYE A;  3VLF B;  1FNN A;  1DO0 A;  3FRI A;  2XZU A;  4M0W A;  2J7N A;  5E6J A;  4K0K M;  3MJ5 A;  3QWL A;  4QHS A;  2K0B X;  1Q3B A;  1ZAE A;  2N35 A;  1Q3C A;  4G6Z A;  4A3V B;  4ITQ A;  2MGW A;  2GNO A;  3GRV A;  3Q8G A;  2ZM6 M;  4JI7 M;  5FSW A;  2YR0 A;  4IBC A;  4OW0 A;  2Z7J A;  3FTF A;  1NHW C;  4LJ7 A;  4X65 M;  1C7Y A;  2WSE F;  1YE9 A;  3GPP A;  4F1I A;  2MJ5 B;  4LJ6 A;  1PRB A;  1R4G A;  1Z5C A;  4DR7 M;  2DI0 A;  3LQR A;  1AUA A;  1TR8 A;  5FTM A;  3UGJ A;  1IQP A;  3FTC A;  4GRI A;  1TDZ A;  1KYI A;  2W82 A;  1W5S A;  2KDL A;  3PNV A;  3I4Y A;  5JI2 E;  1TH4 A;  3H4M A;  4MGZ E;  3TL4 X;  3RFW A;  1IM2 A;  1IN5 A;  2EJS A;  2ERC A;  2QSF X;  2Y0Q A;  4NL4 H;  4D82 A;  5KPT A;  3KOW E;  3UZU A;  2L4F A;  3SMS A;  2H1R A;  3KW6 A;  3VKG A;  4BBA A;  4EIW A;  1A5T A;  3SAV A;  2KNZ A;  2F5Q A;  3K9P A;  4GIT A;  2R45 A;  4DR4 M;  2HKJ A;  4Z8X A;  2DXI A;  4QHT A;  5F3W A;  1IN6 A;  1QAN A;  4FD2 A;  4G3O A;  1DGH B;  2DNA A;  4I8O A;  3B9P A;  4CIZ A;  2XEP A;  1Q02 A;  4GIP A;  1DGG A;  3K1J A;  2QNJ A;  2QEN A;  3QAU A;  4I81 A;  2FS1 A;  3R9X B;  1OIP A; 
#chains in the Genus database with same CATH homology
 2EO2 A;  1TH3 A;  4JXJ A;  4LJ4 A;  4PDI A;  1L2D A;  2KXE A;  3RGS A;  3FUW A;  2V1U A;  2CHV A;  1FJG M;  3GQ4 A;  4FWG A;  2CV2 A;  4AW4 A;  2L6O A;  3KSX A;  3GLH B;  2I7N A;  2HL7 A;  2RGH A;  1HQY E;  4NSR A;  2VII A;  4MM3 B;  3GQ5 A;  1XXH B;  4IIW A;  3U6S A;  2Y0T A;  4LRT A;  3VK8 A;  4NXN M;  3UMM A;  3HU2 A;  1G4A E;  2XGN A;  3GPX A;  2O5R A;  4I5S A;  2FFJ A;  8CAT A;  3GLG A;  3GLF B;  1N34 M;  3HHZ A;  3GPY A;  2UU9 M;  1G8P A;  3TQS A;  5FLX S;  2ZAN A;  4DUZ M;  5EP4 A;  1YUB A;  1KFV A;  3JAM S;  4B3R M;  4LF4 M;  1NSF A;  1S3S A;  3C58 A;  4W5W A;  2DZN B;  1IXS B;  1YSY A;  4JI3 M;  3TE6 A;  2C9O A;  2DWN A;  4JV5 M;  3AOG A;  2R62 A;  3LVW A;  4IBJ A;  3U6Q A;  2R65 A;  2ZAM A;  3FYC A;  1HNX M;  7CAT A;  2Q2E B;  4TUW A;  2R4E A;  1XMO M;  2BJW A;  3CF2 A;  3GLI B;  3KXE C;  1R6B X;  4KOD A;  3TWL A;  4CIS A;  4GHA A;  1GL6 A;  2VQF M;  2C98 A;  1QVR A;  4FW9 A;  2XSZ D;  3IG5 A;  4GC9 A;  3J7A S;  4IJE A;  4DV2 M;  2X49 A;  1N36 M;  2R46 A;  2HCB A;  4LZZ A;  4LFC M;  1JR3 A;  1SXJ E;  1N78 A;  1Z5B A;  4DR1 M;  1SXJ B;  4JI0 M;  3OTO M;  3FKE A;  4LZJ A;  3U5Z A;  1R2Z A;  2RGO A;  1KSF X;  2CV1 A;  4AKG A;  4LJ8 A;  2FNA A;  3AKZ A;  3GRR A;  4R7G A;  4DR5 M;  2CHG A;  3GRU A;  2CE7 A;  2CV0 A;  3PNY A;  3AV0 A;  3KOX E;  4L4U A;  2Z4S A;  3D8B A;  3UK6 A;  5DNY A;  4JI4 M;  1W5T A;  2R18 A;  4FWH A;  3EIH A;  3MK6 A;  4CGY B;  4HL4 A;  3HU3 A;  2XF3 A;  1HQC A;  1J5E M;  1E9R A;  4KO8 A;  2LXE A;  3T1H M;  2CUZ A;  1QZM A;  5E26 A;  2JA2 A;  3TWK A;  3M6A A;  3M0E A;  4WUR A;  1XHB A;  2UXB M;  2F5P A;  1TGU A;  2K47 A;  4NOO B;  3RGP A;  3IG8 A;  3SAW A;  2DWM A;  1QYR A;  1GVN A;  3I51 A;  3Q8X A;  2F4V M;  1JR3 D;  1XNR M;  1Z6T A;  1L2B A;  3PFI A;  3A42 A;  2J7O A;  1IN7 A;  2ZAO A;  3HKP A;  1IN4 A;  3ZH9 B;  2G5G X;  3KOY E;  3SAS A;  1OFH A;  2UUC M;  2C96 A;  4LF7 M;  3J81 S;  1HR0 M;  1GLN A;  2QP9 X;  2A5Y B;  3LVV A;  1QAO A;  3HJ8 A;  1IXZ A;  1UM8 A;  1I4W A;  3K2L A;  4GC5 A;  5EP3 A;  3NWL A;  4S12 A;  3GPU A;  5DYI A;  2QZ4 A;  1L1T A;  5EXP A;  2LWX A;  4YHH M;  2CHQ A;  2AHM A;  4JI6 M;  2DWL A;  3U6L A;  2XFS A;  1VDD A;  5IT9 S;  5BR8 M;  3L26 A;  1L8Q A;  1C1K A;  3FUV A;  3VDP A;  1DGB A;  4B3M M;  1IBL M;  4LY6 A;  4IBK A;  4G4O A;  4AG5 A;  4II7 A;  3E9S A;  3K92 A;  4GH9 A;  3U61 B;  4L16 A;  3WHK A;  3VK7 A;  1ORY B;  5GKN A;  2XSZ A;  4YY3 M;  3AL0 C;  1X37 A;  4LJ5 A;  4G4N A;  3DA1 A;  4DV5 M;  4ZPX A;  5IWA M;  3KSJ A;  4QOS A;  4QNM A;  3TPZ A;  1DGH A;  2KRU A;  1H6U A;  3MHV C;  4MGY E;  4PT5 A;  3RE8 A;  2F5O A;  5FTJ A;  3WHL A;  2XLJ A;  3GLG B;  1IXR C;  4DV3 M;  2V6Z M;  1D2N A;  3HJQ A;  2BNK A;  5KPR A;  4B08 A;  3EIE A;  4LGM A;  1DO2 A;  3SHG B;  2YQZ A;  1OFI A;  4JI5 M;  2KRK A;  4BLC A;  3GLH A;  4GMQ A;  3DZD A;  2UXC M;  2XFT A;  3SYK A;  4L78 A;  4IBF A;  3U6C A;  2C5R A;  3L27 A;  3T38 A;  1J7K A;  4PD2 A;  3A46 A;  5KQ8 A;  3GLF A;  3W0F A;  4DV4 M;  2M60 A;  5EJC A;  2KW0 A;  5LMU M;  3U6M A;  3W0L B;  4LCB A;  4JI2 M;  3AJI B;  2UXD M;  1IN8 A;  5EP2 A;  2EA0 A;  5ITT A;  1NVM A;  3LMM A;  3FD9 A;  4NRV A;  3L2A A;  1PJJ A;  1IY0 A;  2QBY B;  4NXM M;  4FWD A;  3U6D A;  1N77 A;  2Z3X A;  3U5Z B;  4GKK M;  3ZC7 B;  2I7P A;  3SHF A;  3FUX A;  3KFU G;  4FVM A;  2L7I A;  4QOZ C;  4OX9 M;  3HGI A;  5EXX A;  4AZF A;  4FCV A;  4XGI A;  2X4A A;  4PDG A;  4LJA A;  3FUT A;  5H37 D;  3R8F A;  3GLI A;  1DGF A;  1QAM A;  2OQ4 A;  5EXT A;  3GO8 A;  1PJI A;  1G59 A;  3KS8 A;  1XWI A;  3KP1 E;  1XMQ M;  3SC3 A;  1HNZ M;  3KOZ E;  1ZQ9 A;  1NHG C;  4LGY A;  3L25 A;  3HHY A;  4RF0 A;  4AKI A;  1T3T A;  3PVS A;  3KS4 A;  4B3T M;  2DHR A;  1SXJ A;  3KVW A;  4M9Z A;  1J09 A;  4BB9 A;  2YNM D;  5FTL A;  3U60 A;  3D8L A;  4IJF A;  2LH0 A;  2YFQ A;  4IBB A;  2CEA A;  1E94 E;  5FTN A;  5ITX A;  3J80 S;  3VFD A;  5JI3 E;  4IBI A;  4JN6 A;  4OVZ A;  3BOS A;  3NBI A;  2KZS A;  4RF1 A;  1HT1 E;  2FOI C;  1HNW M;  3J27 B;  4AQY M;  2F5N A;  1E9S A;  3J2P B;  3FUU A;  3I4V A;  5ITY A;  2P5T A;  2XZF A;  3SAR A;  1N33 M;  1PM5 A;  1N32 M;  4KLN A;  3TWM A;  3GQ3 A;  4M9X A;  3KP0 E;  5EQT A;  1MU5 A;  1MX0 A;  3FTD A;  4LJ9 A;  1Z59 A;  4G4R A;  3A45 A;  1N75 A;  4X62 M;  4DR3 M;  4L15 A;  3GP1 A;  2RKO A;  3T1Y M;  3GRY A;  4OU7 A;  4AKH A;  4LF9 M;  4DV1 M;  3DOA A;  1TDH A;  5EP1 A;  2DZO B;  4QNR A;  4JI1 M;  1GKI A;  4MGK E;  3HJS A;  3E4R A;  5EXS A;  1IY1 A;  4D81 A;  2NQ8 C;  5A2Q S;  1SXJ D;  1XC8 A;  4B3S M;  1WXQ A;  1EE8 A;  3T15 A;  3JR4 A;  2OPF A;  4AG6 A;  4KHP M;  3DFZ A;  4DUY M;  2DWZ B;  4FCT A;  1TH2 A;  4P16 A;  3FTE A;  3A98 B;  4DV0 M;  2L09 A;  2M5Z A;  2VQE M;  3KDS E;  4IBG A;  4LRS A;  2KA6 B;  5IRE B;  3SYL A;  5C1B A;  2R4J A;  3PXG A;  1OJL A;  2KEB A;  3HHX A;  4IBE A;  1R7R A;  4NSO B;  4DR2 M;  2L7H A;  1K82 A;  3AOE C;  2V1C A;  2KZU A;  4PCZ A;  4LG2 A;  1R2Y A;  2Z4R A;  1L1Z A;  2CFO A;  1IBM M;  2E5L M;  4HLQ A;  3HU1 A;  3U6P A;  1JQJ C;  1IY2 A;  4AI6 A;  4MGI E;  4Z6Y A;  3U61 A;  2HHH M;  2QCU A;  4LFA M;  2QPA A;  2UUB M;  1NNU C;  3VDU A;  2Y21 A;  3HHW A;  3FYD A;  4WW0 A;  3SMP A;  2D7H A;  1XXH A;  2DVW B;  1NJF A;  1NJG A;  3AOE A;  5C18 A;  5ITR A;  2Y20 A;  1NY5 A;  3M7G A;  3SAT A;  4B7G A;  4LF5 M;  4B7H A;  1HT2 E;  4NRW A;  1E32 A;  2X8A A;  5KO3 A;  5FTK A;  4MH0 E;  4LFB M;  4CHT B;  3CF0 A;  4FCW A;  3THG A;  4X64 M;  3K8Z A;  3J7B A;  5KPZ A;  1NY6 A;  3L29 A;  1XNQ M;  4RNA A;  2EUC A;  3ILK A;  3U6E A;  4B7F A;  3SBJ A;  1QAQ A;  3SAU A;  1K3X A;  1GL7 A;  1QQW A;  4R3D A;  2UUA M;  1NNJ A;  5KQD A;  3L28 A;  2XH9 A;  4D80 A;  2ZBK B;  1Z5A A;  2C9C A;  3LQQ A;  1L2C A;  4IBD A;  1K3W A;  1SXJ C;  5ITQ A;  4L8R C;  4DV6 M;  4XBO A;  4MB7 A;  5ITU A;  2F5S A;  3U6O A;  4DV7 M;  3ZCB B;  4GKJ M;  4M0D A;  1Q39 A;  2BJV A;  3JR5 A;  4LF8 M;  2D7G A;  2C99 A;  3CF6 E;  1LV7 A;  2G8L A;  3CTW B;  5DYG A;  4G4Q A;  2FE8 A;  4LF6 M;  4JYA M;  2QBY A;  4GHL A;  1G3I A;  3U60 B;  5BPV A;  3HWS A;  1I94 M;  3AFH A;  5LMN M;  1IBK M;  4M9S A;  3SFZ A;  5ITX E;  4I4L A;  2D7E A;  4REZ A;  4X66 M;  3VKH A;  2LNH C;  4JI8 M;  3UJN A;  4MGH A;  4OVZ B;  5IZ7 D;  1G41 A;  3VLF B;  1FNN A;  1DO0 A;  2XZU A;  4M0W A;  2J7N A;  5E6J A;  4K0K M;  3MJ5 A;  3QWL A;  4QHS A;  1Q3B A;  1ZAE A;  1Q3C A;  4G6Z A;  4A3V B;  4ITQ A;  3GRV A;  2ZM6 M;  4JI7 M;  5FSW A;  2YR0 A;  4IBC A;  4OW0 A;  2Z7J A;  3FTF A;  1NHW C;  4LJ7 A;  4X65 M;  1YE9 A;  3GPP A;  4LJ6 A;  1Z5C A;  4DR7 M;  3LQR A;  5FTM A;  3UGJ A;  1IQP A;  3FTC A;  4GRI A;  1TDZ A;  1KYI A;  2W82 A;  1W5S A;  3PNV A;  3I4Y A;  5JI2 E;  1TH4 A;  3H4M A;  4MGZ E;  3TL4 X;  3RFW A;  1IM2 A;  1IN5 A;  2ERC A;  4D82 A;  4NL4 H;  2Y0Q A;  5KPT A;  4DR6 M;  3KOW E;  3UZU A;  3SMS A;  2H1R A;  3KW6 A;  3VKG A;  4BBA A;  4EIW A;  3SAV A;  2F5Q A;  4GIT A;  2R45 A;  4DR4 M;  2HKJ A;  4Z8X A;  2DXI A;  4QHT A;  5F3W A;  1IN6 A;  1QAN A;  4FD2 A;  1DGH B;  4I8O A;  3B9P A;  2XEP A;  4GIP A;  1DGG A;  3K1J A;  2QEN A;  3QAU A;  4I81 A;  3R9X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...