2JZ1A

Dsx_long
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLNIYDGGELRNTTRQCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein doublesex
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08828 DSX_dimer Doublesex dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz1A01
1VEJA 2KNVA 2DI0A 2JY6B 2DNAA 3F92A 2JP7A 1HT2E 1ZMUA 1WIVA 2DAEA 1SG9A 1MN3A 3LCVB 1XXHE 1P3QQ 2OOAA 1E94E 2BWEA 2O25A 1TR8A 1BVSA 3B89A 1UFZA 2MJ5B 2JZ1A 1GO5A 2CWBA 1T43A 2HWJA 2JZ0A 4HEOA 5JI2E 1IXSA 2QHOB 1OKSA 1TTEA 2MGWA 1YLAA 1QZEA 1WGNA 2L2DA 2HAKA 4UN2B 2LVOC 2K0BX 2LVNC 1WJ7A 2DZLA 1G4AE 3T6PA 2LTUA 1ZV1A 1F4IA 2CP8A 4WP2A 2DKLA 1VG5A 3BBZA 4F1IA 1PGYA 2G3QA 2EJSA 2LVAA 1EFUB 1HJPA 2ZTCA 2KNZA 2JY5A 3H4JA 1VEKA 1CUKA 1KYIA 2DAKA 2RRUA 3E21A 3LCUA 1G41A 3GLFE 1IM2A 1WR1B 1Y8GA 2LBCA 3FE3A 2OOBA 1HT1E 2L4EA 2QNJA 3IHPA 2JUJA 3E46A 2L4FA 2KHHA 3GLGE 1NV8A 2JY7A 3FRHA 2DENA 2LVPC 2ZTDA 3FRIA 3IECA 2KNAA 4F2LA 1VEGA 2BWBA 2DHYA 5DFLA 3GLHE 2WZJA 4DBGB 2H5XA 4G3OA 2DAIA 3K9OA 1WGLA 1ZMWA 2JNHA 1R4GA 1V92A 1T6OA 3GLIE 1VDLA 1Q02A 1ZMVA 1A5TA 1OAIA 1XB2B 2EKKA 1OTRA 3K9PA 1HQYE 2DAMA 1JR3E 2MR9A 2MROB 2K9DA 4Q7JA 1DO2A 1G3IA 2LVQD 4R71A 1DV0A 1VQ1A 2R0IA 1C7YA 4GEWA 2EKFA 2DAGA 3MMPA 1IFYA 2QSFX 1NV9A 1WHCA 2OO9A 2JY8A 2B3TA 1AIPC 1OQYA 1DO0A
chains in the Genus database with same CATH superfamily
1W5TA 1MX0A 1VEJA 4JN6A 2X4AA 2DNAA 2G5GX 1V34A 4LZZA 1GJTA 2QPAA 3EIHA 2JP7A 3NBXX 1XXHA 2EA0A 4DV7M 1WIVA 4IBGA 4IBEA 4B7HA 5EXTA 3LCVB 1NHWC 2D7GA 1IQPA 1N36M 1ZAEA 3T38A 1QDTA 3KSXA 1QVRA 4M0DA 4LF5M 4LFCM 2C5RA 2BWEA 2O25A 1TR8A 1IBMM 3FUTA 4NOOB 3SYLA 4M0WA 3VK8A 1XNQM 2F4VM 1IN6A 1QAQA 4LF9M 1GO5A 4AI6A 4WW0A 3KP1E 2XH9A 3E4RA 3I4VA 4PDGA 2XLJA 4IBDA 4D81A 4JI4M 5C18A 4G4RA 1JB0F 2XZUA 2UU9M 1YLAA 2XSZD 3U6DA 3ZC7B 4FCTA 1KSFX 2HAKA 2APLA 4UN2B 2LVNC 4FW9A 3VFDA 1WJ7A 2DVWB 3HWSA 4LJ6A 1V33A 4DR2M 3VDPA 3W67A 2KA6B 2O01F 3PVSA 3GPUA 1QQWA 2CUZA 2DHRA 3SAVA 3AV0A 1VG5A 4IBBA 1ZQ9A 1Z5BA 2CV1A 1QZMA 1PGYA 2G3QA 1L2BA 1FJGM 2ZANA 4P16A 3K92A 3U6QA 1HJPA 5FTMA 4DUYM 4JYAM 1UM8A 1PJQA 1CUKA 5DYGA 1KYIA 2DXIA 2FH0A 3E21A 4K0KM 1TH3A 4LJ9A 5ITRA 2FS1A 1IM2A 3GP1A 2LXEA 4QNMA 3FD9A 3HHXA 2CRUA 3SARA 1Y8GA 4B3SM 7CATA 1TF0B 5C1BA 4LJ8A 3SBJA 2HL7A 2L4EA 2VDBB 2CHQA 3PNVA 4CHTB 2JUJA 2Z3XA 4Y28F 1GABA 4I8OA 4L6V6 4OW0A 3D8LA 4NXMM 2FNAA 3B7NA 5EP4A 3RGPA 5E6JA 3K8ZA 5EQTA 4LF8M 1X37A 2KRKA 4IBCA 4B3RM 1VEGA 1YUBA 2L6OA 3AJIB 4IBIA 2ZM6M 2I7NA 2KDLA 4LJAA 5DFLA 4LF4M 5JI3E 4MGYE 3KSJA 3JR5A 4NL4H 1TGUA 4M9SA 2KRUA 3SC3A 4B7FA 3MK6A 2AHMA 2NQ8C 2JNHA 2JA2A 4LJ7A 2DWLA 1G71A 5DNYA 2UUAM 5EXXA 2UXDM 3ZH9B 2N35A 1VDLA 4R7GA 4D82A 5ITTA 4Z8XA 1Q02A 3FTFA 1OIPA 3AKZA 4BLCA 1OAIA 3U60B 1Q3CA 3D8BA 4IBJA 5LMUM 1JR3E 5EXPA 4B3TM 2K9DA 4DV1M 4KLNA 1IY1A 4PD2A 2LVQD 3A45A 4XK8F 1DV0A 4DR7M 3VK7A 2R0IA 1C7YA 3LVVA 2CHGA 4LRTA 4QHSA 2EKFA 2EO2A 3C58A 3RE8A 3A42A 3CTWB 1NV9A 2F5SA 1YE9A 1SXJE 3HHWA 3HKPA 3B7ZA 5IWAM 5A2QS 1I4WA 1EFUB 4AKIA 2G8LA 1N32M 2L09A 3SASA 4M9ZA 4JI0M 3F92A 3SYKA 1HT2E 4IIWA 4CGYB 2DAEA 1SXJC 4GRIA 1SG9A 4KO8A 3DA1A 3SMSA 3TWMA 4LCBA 4EIWA 4ITQA 3ZCBB 5H37D 3FTCA 2F5PA 4DR4M 4OVZB 3HHZA 4GHLA 1P3QQ 3HU1A 3KOYE 3MHVC 2HCBA 2O5RA 1PRBA 1NO1A 2OOAA 4GC5A 4MM3B 4NXNM 1QAMA 4GMQA 4DR5M 5FTJA 1DGHA 4G4NA 3VLFB 3QAUA 1OIZA 4JI8M 1MJGM 1IN5A 4ZPXA 3GQ4A 1T43A 2JZ0A 1IN4A 4JI2M 4HEOA 2DZNB 1TH4A 3THGA 2F5QA 4CJ6A 3HJQA 1IXSA 1HQCA 3KS4A 5EP1A 2QHOB 3H4MA 4RNAA 3CF2A 2MGWA 1QZEA 4BBAA 5ITXE 1WGNA 5EXSA 3L2AA 1K82A 3K1JA 3GLFB 1EE8A 1GL6A 2LVOC 3U6SA 4JI7M 4AQYM 1NNJA 3FTDA 4GKKM 5KQDA 3ZQJA 5FTLA 1W5SA 4DR6M 4L8RC 3T6PA 1GLNA 4HL4A 4X62M 2VQFM 4RKUF 1PJTA 1F4IA 1IY0A 2CP8A 2DZOB 3GLHA 3SMPA 3GLGB 3U61A 1PJSA 1HNZM 4LF6M 3J81S 1QYRA 3I4YA 4IBKA 1HR0M 3KW6A 4L15A 4DR1M 4LFBM 1H6UA 4X65M 4B3MM 2KNZA 3U6MA 2JY5A 1QUTA 4LJ5A 1VEKA 1YSYA 3KP0E 4M9XA 3TWLA 2UXBM 3SHFA 5KPRA 2Z4SA 3CF6E 4I4LA 5KO3A 3K2LA 4LJ4A 2QBYB 3SFZA 2D7HA 2ZAMA 3GLIB 2C96A 3GPXA 3E46A 4JI6M 2KHHA 2FE8A 3LQRA 1NV8A 3FRHA 2Z4RA 3T1HM 2RKOA 3HU3A 2ZTDA 1J7KA 2LVPC 3FRIA 3IECA 2XF3A 4GITA 4OX9M 2BJWA 1J5EM 4NSRA 4NRVA 4L4UA 3SAWA 2V1CA 4KT0F 1N34M 3GQ3A 3M0EA 1NY6A 2BWBA 2DHYA 3GLHE 2WZJA 1N78A 2R45A 4D80A 4DBGB 2BNKA 4G3OA 2R65A 1IN7A 2ZBKB 3BXWA 3HU2A 2UUCM 2J7NA 5IREB 3K9OA 1OFHA 2X49A 4MH0E 3LMMA 3EIEA 1E9RA 5DYIA 2XGNA 4IJFA 1HNWM 3KS8A 1QUSA 1R7RA 1T6OA 3L29A 4JXJA 1IXRC 3TWKA 3U5ZB 1JR3A 3B9PA 1ZMVA 5EP2A 3RGSA 1NVMA 4DUZM 4KODA 1LTMA 4LF7M 4Q7JA 5KQ8A 3I51A 1G59A 2ERCA 2GNOA 3I04M 5BR8M 1XXHB 3M6AA 3NWLA 3AOEC 3GO8A 2DAGA 1QAOA 2BJVA 1SXJA 3GRRA 2YNMD 2QSFX 4I81A 1XC8A 1GJSA 1WHCA 4IJEA 2JY8A 5EP3A 3UGJA 4GHAA 2I7PA 1DO0A 2R46A 3GRUA 2MH8A 2VF7A 1QDRA 2KNVA 2DI0A 1Z59A 2JY6B 3PFIA 4QNRA 1IXZA 3VKGA 2QCUA 3MJ5A 2HKJA 1MN3A 1D0MA 4QOZC 1TH2A 4W5WA 2V1UA 2LHCA 2QZ4A 2HHHM 2LHGA 3IG5A 3L26A 2E5LM 3B7QA 2DWZB 2ZAOA 4GC9A 4G4QA 2Q2EB 1BVSA 2R4EA 2JWSA 2KZSA 3B89A 4JI3M 1UFZA 3U6OA 8CATA 2MJ5B 3HJ8A 4XBOA 2CWBA 3AOGA 2HWJA 3UJNA 3OTOM 2UUBM 2LWXA 4DV4M 5EJCA 1R2ZA 3KOXE 3LW5F 3TL4X 4TUWA 2LNHC 1GKIA 5ITXA 3U6PA 2Y20A 3SAUA 1VDDA 1QANA 3GRYA 5FLXS 4RF0A 2K0BX 3KVWA 3VDUA 3J27B 2LH0A 3C3DA 4GIPA 2V6ZM 4CISA 2J7OA 1R6BX 2DZLA 4FWDA 3SHGB 5BPVA 4DV3M 3L25A 2LTUA 3UMMA 4WP2A 4NRWA 3GQ5A 4F1IA 1L2CA 4REZA 1R2YA 2H1RA 4PT5A 2R4JA 3J80S 1Z5AA 2L7IA 2ZTCA 4XGIA 1PJIA 4I5SA 3UK6A 3H4JA 1IBLM 2RRUA 2XFTA 2P5TA 3LCUA 4S12A 2K6BA 3GLFE 2J5YA 2FOIC 3J7BA 4MGIE 2RGHA 2VIIA 4LGYA 1WR1B 2A5YB 4DV6M 4CIZA 5LMNM 2LBCA 1OJLA 2OOBA 3KXEC 4KHPM 1TDHA 1N33M 1GL7A 2QNJA 3IHPA 4LFAM 4JV5M 3U6LA 3SATA 2CV0A 3GLGE 5GKNA 4AG6A 5L8RF 3E9SA 2DENA 3NBIA 3IG8A 3FUUA 1G8PA 2C98A 2XZFA 1I94M 1NJGA 3J2PB 1XWIA 1NHGC 2Y21A 3M7GA 3KFUG 1E32A 4II7A 4GKJM 4G6ZA 2M60A 4QHTA 2WSCF 4RF1A 3AL0C 2QQ8A 4ANRA 2D7EA 2CFOA 2R18A 1WGLA 3AOEA 1ZMWA 1R4GA 3WHKA 1L2DA 2KZUA 3GLIE 1PM5A 3R9XB 3TE6A 4GH9A 4FCVA 3FKEA 2EUCA 2EKKA 1DGBA 3FUVA 1OTRA 3HGIA 5FTKA 2MR9A 3W68A 3A46A 1T3TA 1E9SA 1G3IA 3QYEA 1IBKM 3FUWA 5KPTA 1R5LA 4LY6A 1OAOC 1VQ1A 1NNUC 3RFWA 5ITYA 4LG2A 2L7HA 4GEWA 3FTEA 3VKHA 2YR0A 3MMPA 5E26A 3HJSA 1Q39A 1XNRM 4QOSA 2Z7JA 2F5NA 5ITUA 3J7AS 2YFQA 3KOZE 2Y0QA 3CF0A 1E94E 1RU3A 3CGWA 2XSZA 3U60A 1DGHB 4DV5M 2JXNA 4X66M 3DFZA 1PJJA 2C9OA 2CEAA 4MB7A 4PDIA 1ZMUA 3HY5A 4LGMA 3T15A 1IXSB 2R44A 2DWNA 3LQQA 1XXHE 2C99A 1D2NA 4YY3M 2X8AA 3UZUA 1JR3D 2KW0A 1JQJC 1OFIA 2KXEA 1D0LA 4AKHA 1IN8A 2KEBA 4JI5M 2CHVA 2YQZA 1DGFA 1XHBA 3FYDA 4AW4A 4B08A 4IBFA 2JZ1A 3BOSA 4YHHM 2R6FA 5JI2E 1SXJD 3GLHB 4A3VB 3U61B 3W0LB 3T1YM 2XEPA 1OKSA 3QYBA 2K47A 2Y0TA 1TTEA 3DZDA 2VQEM 2M5ZA 4OVZA 1XMQM 3TQSA 2UXCM 2L2DA 2W82A 3AFHA 3Q8XA 1K3WA 1Z5CA 3C3EA 3HZJA 4LRSA 4AKGA 4HLQA 1LV7A 3HHYA 4AG5A 4DR3M 4DV2M 1G4AE 2QENA 4WURA 1ZV1A 3C9PA 2DKLA 4FWHA 4NSOB 4MGKE 3KDSE 3I01M 4Z6YA 3BBZA 1HNXM 4MGHA 4B7GA 3L28A 3FYCA 2EJSA 2LVAA 3V76A 2DWMA 2Z8YM 5IZ7D 4JI1M 3GLFA 3PXGA 1Q3BA 2FFJA 2CV2A 4FCWA 3ILKA 2DAKA 3GPYA 1KFVA 3A98B 1IY2A 1G41A 2QP9X 1N77A 3L27A 2R62A 1FNNA 3GRVA 2CE7A 4FWGA 1ORYB 2RGOA 3FE3A 3GLGA 1HT1E 3R8FA 3DOAA 1N75A 2L4FA 3B74A 1S3SA 3TPZA 3LVWA 2JY7A 1MU5A 5KPZA 1D0KA 4LZJA 2KNAA 4F2LA 4X64M 5IT9S 4AZFA 1TDZA 1Z6TA 3HX3A 4G4OA 5ITQA 4FVMA 1L1ZA 2OQ4A 3U6EA 1L8QA 5FTNA 2H5XA 3WHLA 2QBYA 2DAIA 3JAMS 1EIJA 2WSFF 3GLIA 1NY5A 1SXJB 4OU7A 1K3XA 4DV0M 5F3WA 4MGZE 2OPFA 1V92A 2GQFA 2WSEF 3Q8GA 1NJFA 3FUXA 4P17A 4BB9A 3W0FA 1A5TA 1XB2B 4R3DA 3K9PA 1HQYE 3JR4A 2DAMA 2C9CA 2MROB 1DO2A 1NSFA 4L16A 4R71A 3KOWE 3PNYA 4NC6A 2XFSA 5FSWA 1C1KA 4FD2A 1IFYA 4L78A 1AUAA 2OO9A 1L1TA 1DGGA 3GPPA 2VF8A 3QWLA 3U6CA 2B3TA 3U5ZA 1AIPC 1J09A 1GVNA 1OQYA 1XMOM 4PCZA 1WXQA 2F5OA
chains in the Genus database with same CATH topology
1VEJA 2KNVA 2DI0A 2JY6B 2DNAA 3F92A 2JP7A 1HT2E 1ZMUA 1WIVA 2DAEA 1SG9A 1MN3A 3LCVB 1XXHE 1P3QQ 2OOAA 1E94E 2BWEA 2O25A 1TR8A 1BVSA 3B89A 1UFZA 2MJ5B 2JZ1A 1GO5A 2CWBA 1T43A 2HWJA 2JZ0A 4HEOA 5JI2E 1IXSA 2QHOB 1OKSA 1TTEA 2MGWA 1YLAA 1QZEA 1WGNA 2L2DA 2HAKA 4UN2B 2LVOC 2K0BX 2LVNC 1WJ7A 2DZLA 1G4AE 3T6PA 2LTUA 1ZV1A 1F4IA 2CP8A 4WP2A 2DKLA 1VG5A 3BBZA 4F1IA 1PGYA 2G3QA 2EJSA 2LVAA 1EFUB 1HJPA 2ZTCA 2KNZA 2JY5A 3H4JA 1VEKA 1CUKA 1KYIA 2DAKA 2RRUA 3E21A 3LCUA 1G41A 3GLFE 1IM2A 1WR1B 1Y8GA 2LBCA 3FE3A 2OOBA 1HT1E 2L4EA 2QNJA 3IHPA 2JUJA 3E46A 2L4FA 2KHHA 3GLGE 1NV8A 2JY7A 3FRHA 2DENA 2LVPC 2ZTDA 3FRIA 3IECA 2KNAA 4F2LA 1VEGA 2BWBA 2DHYA 5DFLA 3GLHE 2WZJA 4DBGB 2H5XA 4G3OA 2DAIA 3K9OA 1WGLA 1ZMWA 2JNHA 1R4GA 1V92A 1T6OA 3GLIE 1VDLA 1Q02A 1ZMVA 1A5TA 1OAIA 1XB2B 2EKKA 1OTRA 3K9PA 1HQYE 2DAMA 1JR3E 2MR9A 2MROB 2K9DA 4Q7JA 1DO2A 1G3IA 2LVQD 4R71A 1DV0A 1VQ1A 2R0IA 1C7YA 4GEWA 2EKFA 2DAGA 3MMPA 1IFYA 2QSFX 1NV9A 1WHCA 2OO9A 2JY8A 2B3TA 1AIPC 1OQYA 1DO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEJ A;  2KNV A;  2DI0 A;  2JY6 B;  2DNA A;  3F92 A;  2JP7 A;  1HT2 E;  1ZMU A;  1WIV A;  2DAE A;  1SG9 A;  1MN3 A;  3LCV B;  1XXH E;  1P3Q Q;  2OOA A;  1E94 E;  2BWE A;  2O25 A;  1TR8 A;  1BVS A;  3B89 A;  1UFZ A;  2MJ5 B;  2JZ1 A;  1GO5 A;  2CWB A;  1T43 A;  2HWJ A;  2JZ0 A;  4HEO A;  5JI2 E;  1IXS A;  2QHO B;  1OKS A;  1TTE A;  2MGW A;  1YLA A;  1QZE A;  1WGN A;  2L2D A;  2HAK A;  4UN2 B;  2LVO C;  2K0B X;  2LVN C;  1WJ7 A;  2DZL A;  1G4A E;  3T6P A;  2LTU A;  1ZV1 A;  1F4I A;  2CP8 A;  4WP2 A;  2DKL A;  1VG5 A;  3BBZ A;  4F1I A;  1PGY A;  2G3Q A;  2EJS A;  2LVA A;  1EFU B;  1HJP A;  2ZTC A;  2KNZ A;  2JY5 A;  3H4J A;  1VEK A;  1CUK A;  1KYI A;  2DAK A;  2RRU A;  3E21 A;  3LCU A;  1G41 A;  3GLF E;  1IM2 A;  1WR1 B;  1Y8G A;  2LBC A;  3FE3 A;  2OOB A;  1HT1 E;  2L4E A;  2QNJ A;  3IHP A;  2JUJ A;  3E46 A;  2L4F A;  2KHH A;  3GLG E;  1NV8 A;  2JY7 A;  3FRH A;  2DEN A;  2LVP C;  2ZTD A;  3FRI A;  3IEC A;  2KNA A;  4F2L A;  1VEG A;  2BWB A;  2DHY A;  5DFL A;  3GLH E;  2WZJ A;  4DBG B;  2H5X A;  4G3O A;  2DAI A;  3K9O A;  1WGL A;  1ZMW A;  2JNH A;  1R4G A;  1V92 A;  1T6O A;  3GLI E;  1VDL A;  1Q02 A;  1ZMV A;  1A5T A;  1OAI A;  1XB2 B;  2EKK A;  1OTR A;  3K9P A;  1HQY E;  2DAM A;  1JR3 E;  2MR9 A;  2MRO B;  2K9D A;  4Q7J A;  1DO2 A;  1G3I A;  2LVQ D;  4R71 A;  1DV0 A;  1VQ1 A;  2R0I A;  1C7Y A;  4GEW A;  2EKF A;  2DAG A;  3MMP A;  1IFY A;  2QSF X;  1NV9 A;  1WHC A;  2OO9 A;  2JY8 A;  2B3T A;  1AIP C;  1OQY A;  1DO0 A; 
#chains in the Genus database with same CATH topology
 1W5T A;  1MX0 A;  1VEJ A;  4JN6 A;  2X4A A;  2DNA A;  2G5G X;  1V34 A;  4LZZ A;  1GJT A;  2QPA A;  3EIH A;  2JP7 A;  3NBX X;  1XXH A;  2EA0 A;  4DV7 M;  1WIV A;  4IBG A;  4IBE A;  4B7H A;  5EXT A;  3LCV B;  1NHW C;  2D7G A;  1IQP A;  1N36 M;  1ZAE A;  3T38 A;  1QDT A;  3KSX A;  1QVR A;  4M0D A;  4LF5 M;  4LFC M;  2C5R A;  2BWE A;  2O25 A;  1TR8 A;  1IBM M;  3FUT A;  4NOO B;  3SYL A;  4M0W A;  3VK8 A;  1XNQ M;  2F4V M;  1IN6 A;  1QAQ A;  4LF9 M;  1GO5 A;  4AI6 A;  4WW0 A;  3KP1 E;  2XH9 A;  3E4R A;  3I4V A;  4PDG A;  2XLJ A;  4IBD A;  4D81 A;  4JI4 M;  5C18 A;  4G4R A;  1JB0 F;  2XZU A;  2UU9 M;  1YLA A;  2XSZ D;  3U6D A;  3ZC7 B;  4FCT A;  1KSF X;  2HAK A;  2APL A;  4UN2 B;  2LVN C;  4FW9 A;  3VFD A;  1WJ7 A;  2DVW B;  3HWS A;  4LJ6 A;  1V33 A;  4DR2 M;  3VDP A;  3W67 A;  2KA6 B;  2O01 F;  3PVS A;  3GPU A;  1QQW A;  2CUZ A;  2DHR A;  3SAV A;  3AV0 A;  1VG5 A;  4IBB A;  1ZQ9 A;  1Z5B A;  2CV1 A;  1QZM A;  1PGY A;  2G3Q A;  1L2B A;  1FJG M;  2ZAN A;  4P16 A;  3K92 A;  3U6Q A;  1HJP A;  5FTM A;  4DUY M;  4JYA M;  1UM8 A;  1PJQ A;  1CUK A;  5DYG A;  1KYI A;  2DXI A;  2FH0 A;  3E21 A;  4K0K M;  1TH3 A;  4LJ9 A;  5ITR A;  2FS1 A;  1IM2 A;  3GP1 A;  2LXE A;  4QNM A;  3FD9 A;  3HHX A;  2CRU A;  3SAR A;  1Y8G A;  4B3S M;  7CAT A;  1TF0 B;  5C1B A;  4LJ8 A;  3SBJ A;  2HL7 A;  2L4E A;  2VDB B;  2CHQ A;  3PNV A;  4CHT B;  2JUJ A;  2Z3X A;  4Y28 F;  1GAB A;  4I8O A;  4L6V 6;  4OW0 A;  3D8L A;  4NXM M;  2FNA A;  3B7N A;  5EP4 A;  3RGP A;  5E6J A;  3K8Z A;  5EQT A;  4LF8 M;  1X37 A;  2KRK A;  4IBC A;  4B3R M;  1VEG A;  1YUB A;  2L6O A;  3AJI B;  4IBI A;  2ZM6 M;  2I7N A;  2KDL A;  4LJA A;  5DFL A;  4LF4 M;  5JI3 E;  4MGY E;  3KSJ A;  3JR5 A;  4NL4 H;  1TGU A;  4M9S A;  2KRU A;  3SC3 A;  4B7F A;  3MK6 A;  2AHM A;  2NQ8 C;  2JNH A;  2JA2 A;  4LJ7 A;  2DWL A;  1G71 A;  5DNY A;  2UUA M;  5EXX A;  2UXD M;  3ZH9 B;  2N35 A;  1VDL A;  4R7G A;  4D82 A;  5ITT A;  4Z8X A;  1Q02 A;  3FTF A;  1OIP A;  3AKZ A;  4BLC A;  1OAI A;  3U60 B;  1Q3C A;  3D8B A;  4IBJ A;  5LMU M;  1JR3 E;  5EXP A;  4B3T M;  2K9D A;  4DV1 M;  4KLN A;  1IY1 A;  4PD2 A;  2LVQ D;  3A45 A;  4XK8 F;  1DV0 A;  4DR7 M;  3VK7 A;  2R0I A;  1C7Y A;  3LVV A;  2CHG A;  4LRT A;  4QHS A;  2EKF A;  2EO2 A;  3C58 A;  3RE8 A;  3A42 A;  3CTW B;  1NV9 A;  2F5S A;  1YE9 A;  1SXJ E;  3HHW A;  3HKP A;  3B7Z A;  5IWA M;  5A2Q S;  1I4W A;  1EFU B;  4AKI A;  2G8L A;  1N32 M;  2L09 A;  3SAS A;  4M9Z A;  4JI0 M;  3F92 A;  3SYK A;  1HT2 E;  4IIW A;  4CGY B;  2DAE A;  1SXJ C;  4GRI A;  1SG9 A;  4KO8 A;  3DA1 A;  3SMS A;  3TWM A;  4LCB A;  4EIW A;  4ITQ A;  3ZCB B;  5H37 D;  3FTC A;  2F5P A;  4DR4 M;  4OVZ B;  3HHZ A;  4GHL A;  1P3Q Q;  3HU1 A;  3KOY E;  3MHV C;  2HCB A;  2O5R A;  1PRB A;  1NO1 A;  2OOA A;  4GC5 A;  4MM3 B;  4NXN M;  1QAM A;  4GMQ A;  4DR5 M;  5FTJ A;  1DGH A;  4G4N A;  3VLF B;  3QAU A;  1OIZ A;  4JI8 M;  1MJG M;  1IN5 A;  4ZPX A;  3GQ4 A;  1T43 A;  2JZ0 A;  1IN4 A;  4JI2 M;  4HEO A;  2DZN B;  1TH4 A;  3THG A;  2F5Q A;  4CJ6 A;  3HJQ A;  1IXS A;  1HQC A;  3KS4 A;  5EP1 A;  2QHO B;  3H4M A;  4RNA A;  3CF2 A;  2MGW A;  1QZE A;  4BBA A;  5ITX E;  1WGN A;  5EXS A;  3L2A A;  1K82 A;  3K1J A;  3GLF B;  1EE8 A;  1GL6 A;  2LVO C;  3U6S A;  4JI7 M;  4AQY M;  1NNJ A;  3FTD A;  4GKK M;  5KQD A;  3ZQJ A;  5FTL A;  1W5S A;  4DR6 M;  4L8R C;  3T6P A;  1GLN A;  4HL4 A;  4X62 M;  2VQF M;  4RKU F;  1PJT A;  1F4I A;  1IY0 A;  2CP8 A;  2DZO B;  3GLH A;  3SMP A;  3GLG B;  3U61 A;  1PJS A;  1HNZ M;  4LF6 M;  3J81 S;  1QYR A;  3I4Y A;  4IBK A;  1HR0 M;  3KW6 A;  4L15 A;  4DR1 M;  4LFB M;  1H6U A;  4X65 M;  4B3M M;  2KNZ A;  3U6M A;  2JY5 A;  1QUT A;  4LJ5 A;  1VEK A;  1YSY A;  3KP0 E;  4M9X A;  3TWL A;  2UXB M;  3SHF A;  5KPR A;  2Z4S A;  3CF6 E;  4I4L A;  5KO3 A;  3K2L A;  4LJ4 A;  2QBY B;  3SFZ A;  2D7H A;  2ZAM A;  3GLI B;  2C96 A;  3GPX A;  3E46 A;  4JI6 M;  2KHH A;  2FE8 A;  3LQR A;  1NV8 A;  3FRH A;  2Z4R A;  3T1H M;  2RKO A;  3HU3 A;  2ZTD A;  1J7K A;  2LVP C;  3FRI A;  3IEC A;  2XF3 A;  4GIT A;  4OX9 M;  2BJW A;  1J5E M;  4NSR A;  4NRV A;  4L4U A;  3SAW A;  2V1C A;  4KT0 F;  1N34 M;  3GQ3 A;  3M0E A;  1NY6 A;  2BWB A;  2DHY A;  3GLH E;  2WZJ A;  1N78 A;  2R45 A;  4D80 A;  4DBG B;  2BNK A;  4G3O A;  2R65 A;  1IN7 A;  2ZBK B;  3BXW A;  3HU2 A;  2UUC M;  2J7N A;  5IRE B;  3K9O A;  1OFH A;  2X49 A;  4MH0 E;  3LMM A;  3EIE A;  1E9R A;  5DYI A;  2XGN A;  4IJF A;  1HNW M;  3KS8 A;  1QUS A;  1R7R A;  1T6O A;  3L29 A;  4JXJ A;  1IXR C;  3TWK A;  3U5Z B;  1JR3 A;  3B9P A;  1ZMV A;  5EP2 A;  3RGS A;  1NVM A;  4DUZ M;  4KOD A;  1LTM A;  4LF7 M;  4Q7J A;  5KQ8 A;  3I51 A;  1G59 A;  2ERC A;  2GNO A;  3I04 M;  5BR8 M;  1XXH B;  3M6A A;  3NWL A;  3AOE C;  3GO8 A;  2DAG A;  1QAO A;  2BJV A;  1SXJ A;  3GRR A;  2YNM D;  2QSF X;  4I81 A;  1XC8 A;  1GJS A;  1WHC A;  4IJE A;  2JY8 A;  5EP3 A;  3UGJ A;  4GHA A;  2I7P A;  1DO0 A;  2R46 A;  3GRU A;  2MH8 A;  2VF7 A;  1QDR A;  2KNV A;  2DI0 A;  1Z59 A;  2JY6 B;  3PFI A;  4QNR A;  1IXZ A;  3VKG A;  2QCU A;  3MJ5 A;  2HKJ A;  1MN3 A;  1D0M A;  4QOZ C;  1TH2 A;  4W5W A;  2V1U A;  2LHC A;  2QZ4 A;  2HHH M;  2LHG A;  3IG5 A;  3L26 A;  2E5L M;  3B7Q A;  2DWZ B;  2ZAO A;  4GC9 A;  4G4Q A;  2Q2E B;  1BVS A;  2R4E A;  2JWS A;  2KZS A;  3B89 A;  4JI3 M;  1UFZ A;  3U6O A;  8CAT A;  2MJ5 B;  3HJ8 A;  4XBO A;  2CWB A;  3AOG A;  2HWJ A;  3UJN A;  3OTO M;  2UUB M;  2LWX A;  4DV4 M;  5EJC A;  1R2Z A;  3KOX E;  3LW5 F;  3TL4 X;  4TUW A;  2LNH C;  1GKI A;  5ITX A;  3U6P A;  2Y20 A;  3SAU A;  1VDD A;  1QAN A;  3GRY A;  5FLX S;  4RF0 A;  2K0B X;  3KVW A;  3VDU A;  3J27 B;  2LH0 A;  3C3D A;  4GIP A;  2V6Z M;  4CIS A;  2J7O A;  1R6B X;  2DZL A;  4FWD A;  3SHG B;  5BPV A;  4DV3 M;  3L25 A;  2LTU A;  3UMM A;  4WP2 A;  4NRW A;  3GQ5 A;  4F1I A;  1L2C A;  4REZ A;  1R2Y A;  2H1R A;  4PT5 A;  2R4J A;  3J80 S;  1Z5A A;  2L7I A;  2ZTC A;  4XGI A;  1PJI A;  4I5S A;  3UK6 A;  3H4J A;  1IBL M;  2RRU A;  2XFT A;  2P5T A;  3LCU A;  4S12 A;  2K6B A;  3GLF E;  2J5Y A;  2FOI C;  3J7B A;  4MGI E;  2RGH A;  2VII A;  4LGY A;  1WR1 B;  2A5Y B;  4DV6 M;  4CIZ A;  5LMN M;  2LBC A;  1OJL A;  2OOB A;  3KXE C;  4KHP M;  1TDH A;  1N33 M;  1GL7 A;  2QNJ A;  3IHP A;  4LFA M;  4JV5 M;  3U6L A;  3SAT A;  2CV0 A;  3GLG E;  5GKN A;  4AG6 A;  5L8R F;  3E9S A;  2DEN A;  3NBI A;  3IG8 A;  3FUU A;  1G8P A;  2C98 A;  2XZF A;  1I94 M;  1NJG A;  3J2P B;  1XWI A;  1NHG C;  2Y21 A;  3M7G A;  3KFU G;  1E32 A;  4II7 A;  4GKJ M;  4G6Z A;  2M60 A;  4QHT A;  2WSC F;  4RF1 A;  3AL0 C;  2QQ8 A;  4ANR A;  2D7E A;  2CFO A;  2R18 A;  1WGL A;  3AOE A;  1ZMW A;  1R4G A;  3WHK A;  1L2D A;  2KZU A;  3GLI E;  1PM5 A;  3R9X B;  3TE6 A;  4GH9 A;  4FCV A;  3FKE A;  2EUC A;  2EKK A;  1DGB A;  3FUV A;  1OTR A;  3HGI A;  5FTK A;  2MR9 A;  3W68 A;  3A46 A;  1T3T A;  1E9S A;  1G3I A;  3QYE A;  1IBK M;  3FUW A;  5KPT A;  1R5L A;  4LY6 A;  1OAO C;  1VQ1 A;  1NNU C;  3RFW A;  5ITY A;  4LG2 A;  2L7H A;  4GEW A;  3FTE A;  3VKH A;  2YR0 A;  3MMP A;  5E26 A;  3HJS A;  1Q39 A;  1XNR M;  4QOS A;  2Z7J A;  2F5N A;  5ITU A;  3J7A S;  2YFQ A;  3KOZ E;  2Y0Q A;  3CF0 A;  1E94 E;  1RU3 A;  3CGW A;  2XSZ A;  3U60 A;  1DGH B;  4DV5 M;  2JXN A;  4X66 M;  3DFZ A;  1PJJ A;  2C9O A;  2CEA A;  4MB7 A;  4PDI A;  1ZMU A;  3HY5 A;  4LGM A;  3T15 A;  1IXS B;  2R44 A;  2DWN A;  3LQQ A;  1XXH E;  2C99 A;  1D2N A;  4YY3 M;  2X8A A;  3UZU A;  1JR3 D;  2KW0 A;  1JQJ C;  1OFI A;  2KXE A;  1D0L A;  4AKH A;  1IN8 A;  2KEB A;  4JI5 M;  2CHV A;  2YQZ A;  1DGF A;  1XHB A;  3FYD A;  4AW4 A;  4B08 A;  4IBF A;  2JZ1 A;  3BOS A;  4YHH M;  2R6F A;  5JI2 E;  1SXJ D;  3GLH B;  4A3V B;  3U61 B;  3W0L B;  3T1Y M;  2XEP A;  1OKS A;  3QYB A;  2K47 A;  2Y0T A;  1TTE A;  3DZD A;  2VQE M;  2M5Z A;  4OVZ A;  1XMQ M;  3TQS A;  2UXC M;  2L2D A;  2W82 A;  3AFH A;  3Q8X A;  1K3W A;  1Z5C A;  3C3E A;  3HZJ A;  4LRS A;  4AKG A;  4HLQ A;  1LV7 A;  3HHY A;  4AG5 A;  4DR3 M;  4DV2 M;  1G4A E;  2QEN A;  4WUR A;  1ZV1 A;  3C9P A;  2DKL A;  4FWH A;  4NSO B;  4MGK E;  3KDS E;  3I01 M;  4Z6Y A;  3BBZ A;  1HNX M;  4MGH A;  4B7G A;  3L28 A;  3FYC A;  2EJS A;  2LVA A;  3V76 A;  2DWM A;  2Z8Y M;  5IZ7 D;  4JI1 M;  3GLF A;  3PXG A;  1Q3B A;  2FFJ A;  2CV2 A;  4FCW A;  3ILK A;  2DAK A;  3GPY A;  1KFV A;  3A98 B;  1IY2 A;  1G41 A;  2QP9 X;  1N77 A;  3L27 A;  2R62 A;  1FNN A;  3GRV A;  2CE7 A;  4FWG A;  1ORY B;  2RGO A;  3FE3 A;  3GLG A;  1HT1 E;  3R8F A;  3DOA A;  1N75 A;  2L4F A;  3B74 A;  1S3S A;  3TPZ A;  3LVW A;  2JY7 A;  1MU5 A;  5KPZ A;  1D0K A;  4LZJ A;  2KNA A;  4F2L A;  4X64 M;  5IT9 S;  4AZF A;  1TDZ A;  1Z6T A;  3HX3 A;  4G4O A;  5ITQ A;  4FVM A;  1L1Z A;  2OQ4 A;  3U6E A;  1L8Q A;  5FTN A;  2H5X A;  3WHL A;  2QBY A;  2DAI A;  3JAM S;  1EIJ A;  2WSF F;  3GLI A;  1NY5 A;  1SXJ B;  4OU7 A;  1K3X A;  4DV0 M;  5F3W A;  4MGZ E;  2OPF A;  1V92 A;  2GQF A;  2WSE F;  3Q8G A;  1NJF A;  3FUX A;  4P17 A;  4BB9 A;  3W0F A;  1A5T A;  1XB2 B;  4R3D A;  3K9P A;  1HQY E;  3JR4 A;  2DAM A;  2C9C A;  2MRO B;  1DO2 A;  1NSF A;  4L16 A;  4R71 A;  3KOW E;  3PNY A;  4NC6 A;  2XFS A;  5FSW A;  1C1K A;  4FD2 A;  1IFY A;  4L78 A;  1AUA A;  2OO9 A;  1L1T A;  1DGG A;  3GPP A;  2VF8 A;  3QWL A;  3U6C A;  2B3T A;  3U5Z A;  1AIP C;  1J09 A;  1GVN A;  1OQY A;  1XMO M;  4PCZ A;  1WXQ A;  2F5O A; 
#chains in the Genus database with same CATH homology
 1VEJ A;  2KNV A;  2DI0 A;  2JY6 B;  2DNA A;  3F92 A;  2JP7 A;  1HT2 E;  1ZMU A;  1WIV A;  2DAE A;  1SG9 A;  1MN3 A;  3LCV B;  1XXH E;  1P3Q Q;  2OOA A;  1E94 E;  2BWE A;  2O25 A;  1TR8 A;  1BVS A;  3B89 A;  1UFZ A;  2MJ5 B;  2JZ1 A;  1GO5 A;  2CWB A;  1T43 A;  2HWJ A;  2JZ0 A;  4HEO A;  5JI2 E;  1IXS A;  2QHO B;  1OKS A;  1TTE A;  2MGW A;  1YLA A;  1QZE A;  1WGN A;  2L2D A;  2HAK A;  4UN2 B;  2LVO C;  2K0B X;  2LVN C;  1WJ7 A;  2DZL A;  1G4A E;  3T6P A;  2LTU A;  1ZV1 A;  1F4I A;  2CP8 A;  4WP2 A;  2DKL A;  1VG5 A;  3BBZ A;  4F1I A;  1PGY A;  2G3Q A;  2EJS A;  2LVA A;  1EFU B;  1HJP A;  2ZTC A;  2KNZ A;  2JY5 A;  3H4J A;  1VEK A;  1CUK A;  1KYI A;  2DAK A;  2RRU A;  3E21 A;  3LCU A;  1G41 A;  3GLF E;  1IM2 A;  1WR1 B;  1Y8G A;  2LBC A;  3FE3 A;  2OOB A;  1HT1 E;  2L4E A;  2QNJ A;  3IHP A;  2JUJ A;  3E46 A;  2L4F A;  2KHH A;  3GLG E;  1NV8 A;  2JY7 A;  3FRH A;  2DEN A;  2LVP C;  2ZTD A;  3FRI A;  3IEC A;  2KNA A;  4F2L A;  1VEG A;  2BWB A;  2DHY A;  5DFL A;  3GLH E;  2WZJ A;  4DBG B;  2H5X A;  4G3O A;  2DAI A;  3K9O A;  1WGL A;  1ZMW A;  2JNH A;  1R4G A;  1V92 A;  1T6O A;  3GLI E;  1VDL A;  1Q02 A;  1ZMV A;  1A5T A;  1OAI A;  1XB2 B;  2EKK A;  1OTR A;  3K9P A;  1HQY E;  2DAM A;  1JR3 E;  2MR9 A;  2MRO B;  2K9D A;  4Q7J A;  1DO2 A;  1G3I A;  2LVQ D;  4R71 A;  1DV0 A;  1VQ1 A;  2R0I A;  1C7Y A;  4GEW A;  2EKF A;  2DAG A;  3MMP A;  1IFY A;  2QSF X;  1NV9 A;  1WHC A;  2OO9 A;  2JY8 A;  2B3T A;  1AIP C;  1OQY A;  1DO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...