2JZ1A

Dsx_long
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLNIYDGGELRNTTRQCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein doublesex
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08828 DSX_dimer Doublesex dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz1A01
1DV0A 2JZ0A 4F1IA 2QHOB 1VQ1A 2LVQD 2EKKA 2BWEA 2DAIA 2EJSA 1AIPC 3FE3A 3B89A 2R0IA 1WHCA 2B3TA 3E21A 3MMPA 1IM2A 2DENA 1Y8GA 1V92A 1E94E 2LBCA 4UN2B 1C7YA 1GO5A 3IECA 2JZ1A 5JI2E 2JUJA 2DHYA 2QNJA 2G3QA 1G41A 1F4IA 2BWBA 2JY8A 3E46A 1QZEA 3T6PA 4WP2A 1YLAA 1HJPA 5DFLA 1T6OA 1NV9A 1TR8A 2HWJA 2WZJA 1VEJA 2DAGA 2DAEA 3FRIA 3K9PA 2LTUA 1DO0A 3GLFE 1MN3A 1R4GA 2DKLA 1P3QQ 3LCVB 2KHHA 1NV8A 1OTRA 1VEKA 2JY5A 4G3OA 1HT2E 2LVNC 1TTEA 1BVSA 3H4JA 3IHPA 4HEOA 4DBGB 1OQYA 1XB2B 2MJ5B 1ZMWA 2DNAA 2LVOC 2L4EA 2O25A 3GLGE 2OO9A 1ZMUA 1OKSA 1WIVA 2DAMA 2OOBA 2KNAA 2RRUA 3BBZA 1KYIA 2EKFA 1T43A 4Q7JA 1CUKA 2QSFX 2DZLA 1HQYE 2LVAA 1A5TA 2KNVA 1WGNA 2OOAA 2MR9A 1UFZA 1SG9A 1DO2A 2ZTCA 2DI0A 4GEWA 3F92A 2JY7A 2L2DA 1ZV1A 3K9OA 2MGWA 1PGYA 2H5XA 2CP8A 1VEGA 1WR1B 1G3IA 1VG5A 3LCUA 1OAIA 2JP7A 1IXSA 1WJ7A 2JNHA 2CWBA 3GLHE 3FRHA 2ZTDA 3GLIE 1IFYA 4F2LA 1EFUB 2MROB 1HT1E 4R71A 2LVPC 1WGLA 1XXHE 1ZMVA 1VDLA 2DAKA 2JY6B 2KNZA 2L4FA 2K9DA 2K0BX 1G4AE 1JR3E 1Q02A 2HAKA
chains in the Genus database with same CATH superfamily
4PD2A 1IQPA 1IXZA 1IBLM 2F5PA 3TPZA 4DUYM 4GHLA 5ITXA 3QYBA 2WSEF 2YNMD 2V6ZM 3I4VA 4QNMA 4JI2M 1GL7A 2FFJA 3U61A 2F4VM 3I01M 5KPTA 1XHBA 3PVSA 4IBEA 2AHMA 3T1YM 3MMPA 4MGIE 3GLFB 2M60A 1DGHA 2DENA 5FTJA 5IT9S 4OX9M 1QUSA 4DV2M 4UN2B 1JB0F 1N32M 4LFBM 3ZQJA 4IBKA 3FUWA 5C1BA 3EIHA 3FTCA 3LQRA 4LJ9A 2XZUA 1JR3A 4RF0A 1TH3A 3PNYA 4CISA 3K92A 2G3QA 2QP9X 2BWBA 2E5LM 5EXTA 2JY8A 3E46A 4DR1M 3T6PA 4WP2A 1HJPA 1Q3CA 4AQYM 3U6CA 4R7GA 1TGUA 1IBMM 5H37D 1N33M 1XMOM 1L1TA 4DR3M 2ZAOA 2R46A 4LJ7A 4LF5M 3FTEA 2LNHC 3LVWA 1HQCA 3GRVA 4DR6M 1MN3A 1R4GA 2BNKA 3J2PB 1VEKA 2JXNA 2J7OA 3KS4A 3FUUA 1Z5AA 4B08A 4AG5A 3H4MA 1TF0B 1BVSA 1TTEA 3H4JA 2P5TA 4I8OA 4IBBA 2OQ4A 4I5SA 3MJ5A 2DZOB 3U60A 4M0DA 1VDDA 2MJ5B 3GPYA 3W68A 2ZM6M 2R6FA 3HHYA 2EUCA 1D0KA 4II7A 3GLGA 4DR2M 4CGYB 1L8QA 4MGHA 2O25A 2CEAA 3GRYA 3TE6A 1OJLA 1XWIA 4P17A 2F5NA 4GC9A 4LJAA 4TUWA 3NWLA 3GPPA 4LF9M 3VKGA 1ZMUA 2OOBA 1J7KA 4NSRA 3SATA 1V33A 2QZ4A 3BBZA 3DZDA 4L4UA 4FW9A 2ZAMA 2N35A 4BBAA 4L16A 4DV4M 1IY0A 2XLJA 2C9OA 2FE8A 3KP1E 4L15A 1HQYE 2LVAA 3K1JA 4NL4H 2KNVA 4IBFA 4LY6A 4AKHA 1DGGA 2R65A 4CIZA 2UXBM 2HL7A 1G59A 4FWHA 2DWNA 1SG9A 4M9SA 4FCTA 2X8AA 4B3RM 1L2CA 1E9RA 2VIIA 4L8RC 3HZJA 2FOIC 5LMNM 4GH9A 2H5XA 1GVNA 1IN4A 3VDUA 3LCUA 3A46A 2J7NA 3VKHA 4LFCM 3GRRA 1YSYA 4YY3M 3M6AA 2CWBA 3J80S 3GLHE 3FRHA 3AOEA 3K2LA 5GKNA 3ZCBB 2XEPA 4LF4M 4LF8M 3GRUA 1IFYA 1ZAEA 1GABA 1EFUB 3FD9A 3BXWA 2DWLA 1XXHE 3FUTA 1R6BX 2JY6B 4PDIA 1HR0M 1NHGC 4JYAM 2I7PA 5KPRA 5BPVA 3CF2A 1XNQM 1MJGM 3QAUA 3SASA 2Z3XA 3GQ5A 1IN8A 2QHOB 2R62A 1VQ1A 2KZSA 2LVQD 3UMMA 4MGKE 1PJSA 1IY1A 2YFQA 3V76A 5ITXE 2VQFM 2R4EA 1XMQM 3HJ8A 3KOYE 4DV5M 1W5SA 2KRKA 1GL6A 3FE3A 2CUZA 2R0IA 2R45A 2Z7JA 3E21A 4BLCA 5DYIA 1IM2A 5BR8M 4CJ6A 2LWXA 3GLHA 3J27B 4MM3B 2V1UA 2R18A 4KLNA 1IBKM 4LJ8A 2HHHM 1Y8GA 1KFVA 2YQZA 4JN6A 4YHHM 3I51A 1FNNA 1WXQA 1C7YA 4KT0F 3B7QA 4MGZE 2H1RA 5JI2E 2LXEA 4DV6M 3HU1A 3UGJA 5EP2A 4G4NA 2QNJA 2C96A 4LRSA 4JI7M 2O01F 2CV0A 3U5ZB 4LGMA 2VF8A 3DA1A 3KOZE 4LJ4A 1YUBA 3THGA 1EIJA 3TWKA 1R5LA 4LCBA 5DNYA 2R4JA 3AKZA 4FWDA 2R44A 3C58A 1OIPA 3A42A 1T6OA 3BOSA 4IBCA 1N77A 1GJTA 2HWJA 4RF1A 3GO8A 3GLFA 2LTUA 3LW5F 4FD2A 2L7HA 1SXJC 3Q8GA 1P3QQ 3LCVB 3SAUA 4LZZA 2BJWA 1QUTA 2JY5A 2XGNA 4G3OA 4DR4M 1HNXM 3AJIB 3HKPA 4QOZC 2KXEA 2KEBA 4IIWA 2G5GX 4DBGB 4IBDA 2XF3A 4G4QA 3J81S 1TDZA 1QDRA 3SFZA 4G4RA 2L7IA 3NBXX 1QZMA 1E9SA 2QCUA 1ZMWA 3WHKA 4KO8A 3UZUA 4QHTA 2DHRA 3SAWA 2L4EA 3B7NA 3MHVC 4GRIA 4G4OA 3QYEA 3GLGE 1PJQA 2OO9A 2RGHA 3CGWA 3B7ZA 4JI8M 3SC3A 4LZJA 1OKSA 3U6PA 1K3WA 4D82A 3PNVA 2Q2EB 1KYIA 2CFOA 2M5ZA 1G8PA 4XBOA 3SBJA 3L28A 3T38A 2DXIA 4D81A 1T43A 5EP1A 5FTLA 3UJNA 2VDBB 3TL4X 1A5TA 1YE9A 1C1KA 1Z5CA 1NY6A 3E9SA 4QOSA 4QNRA 4Z8XA 1RU3A 4GKJM 2GNOA 2ZTCA 1JQJC 5E6JA 2Y0QA 2C99A 3PXGA 2L2DA 3K9OA 1ZV1A 3KP0E 5IREB 1ZQ9A 4B3SM 1PGYA 4S12A 4Y28F 3VDPA 1LV7A 2CP8A 1VG5A 4ZPXA 4L6V6 2HKJA 3KFUG 3QWLA 2NQ8C 1X37A 1WJ7A 2O5RA 5E26A 3M7GA 3GLIA 5LMUM 2ZTDA 3GLIB 3FUXA 3TWLA 4F2LA 2MROB 2FH0A 2LVPC 4NXNM 3GQ4A 1IN7A 3E4RA 2JWSA 4MH0E 3SMSA 2K9DA 1PM5A 4X65M 4DV3M 2UUBM 2K0BX 1QAOA 3HU2A 1G4AE 3L27A 2HAKA 3HHXA 4NRVA 4OU7A 1NNJA 3VFDA 4F1IA 1NJGA 1L2BA 4D80A 3TWMA 1Q3BA 3VLFB 1W5TA 5DYGA 2BWEA 4PT5A 1PJJA 2EJSA 3CTWB 4LF6M 2CV1A 5EXXA 2MH8A 3AV0A 4M0WA 3HY5A 1AUAA 3SAVA 2KRUA 3B89A 2B3TA 2K47A 1N34M 2WSFF 3RE8A 3IG5A 2EA0A 3A98B 1PJIA 4OVZB 3KSJA 1PJTA 2QPAA 1E94E 3KVWA 2LBCA 1GJSA 3T15A 1N75A 1GO5A 2J5YA 3PFIA 2JUJA 4IJFA 3HU3A 1QANA 1ORYB 1SXJD 7CATA 4IJEA 5IWAM 2BJVA 2XH9A 1J5EM 2I7NA 4AW4A 2Y21A 1IN5A 4B3TM 2Z4SA 3HHZA 2ERCA 1YLAA 5C18A 3ZC7B 1MU5A 3AL0C 4ITQA 1NNUC 1LTMA 3B74A 1OAOC 2DZNB 3KSXA 3A45A 5IZ7D 4ANRA 5ITRA 1NV9A 4K0KM 3RGPA 4DV7M 3FTDA 1GKIA 4DUZM 2DAGA 4GMQA 2DAEA 4I4LA 3FRIA 2XSZD 3GLFE 4JI4M 4NC6A 5EP3A 2RGOA 3JR5A 4NRWA 3KS8A 1SXJB 4DR5M 1KSFX 3U6QA 3D8BA 1OTRA 3L26A 5A2QS 1R2ZA 2XZFA 2LHGA 4M9XA 2LVNC 3HWSA 3FUVA 3AFHA 1QDTA 3HGIA 3IHPA 4HEOA 2QBYB 4JI3M 1OQYA 1K82A 3NBIA 1G71A 3U5ZA 4GIPA 2WSCF 4LGYA 1D0MA 2YR0A 3C3DA 3LMMA 5FTNA 4AG6A 4CHTB 3L25A 2G8LA 2LVOC 2XSZA 3KOXE 3L29A 4AZFA 4A3VB 3FTFA 2XFTA 3HJQA 4GHAA 3R8FA 4IBJA 1DGFA 1UM8A 4LF7M 2KNAA 1IXSB 4DR7M 1S3SA 2ZANA 4FCVA 5F3WA 1XXHB 2EKFA 1IN6A 3LVVA 4Q7JA 2LH0A 2QSFX 4B3MM 2DZLA 3RGSA 3W67A 2X49A 3MK6A 2X4AA 2APLA 5FSWA 3FYCA 1WGNA 3CF0A 4RKUF 4JI5M 3SYLA 2MR9A 5KQDA 2Y0TA 2XFSA 3SYKA 4DV1M 1DO2A 8CATA 3GQ3A 2QENA 1QAMA 1I4WA 2DI0A 4RNAA 4GEWA 4KODA 3SHFA 1MX0A 3F92A 2JY7A 1JR3D 2D7GA 2KA6B 4QHSA 3DFZA 3C9PA 3U61B 4JV5M 1VEGA 1G3IA 4LRTA 3GPUA 1DGBA 3GPXA 2JA2A 3RFWA 3VK7A 1D2NA 1XNRM 1R7RA 2JP7A 2Z4RA 1OIZA 1N78A 4B7HA 1DGHB 3FYDA 4HL4A 3GLIE 1D0LA 3KDSE 3I4YA 3U6OA 4FCWA 1L1ZA 1HT1E 1NHWC 1TH2A 1TDHA 3FKEA 3OTOM 1WGLA 3CF6E 1ZMVA 1VDLA 1N36M 3SARA 4AKGA 1NY5A 4FWGA 4L78A 4PCZA 3JAMS 1Q02A 2JZ0A 3HX3A 5JI3E 3LQQA 3KW6A 2D7EA 3KXEC 1DV0A 4REZA 2L09A 2A5YB 4XK8F 2EKKA 4DV0M 1L2DA 4LFAM 2DAIA 4IBIA 4XGIA 3ZH9B 2VQEM 2L6OA 3TQSA 3B9PA 1QYRA 1HNZM 1AIPC 1J09A 4LG2A 1WHCA 5FTMA 2F5SA 1TH4A 5FTKA 4LJ5A 2K6BA 3AOGA 4X64M 1Z5BA 3U6MA 2C5RA 1FJGM 5ITYA 3U6EA 1K3XA 4KHPM 1V92A 1V34A 2V1CA 1OFHA 4M9ZA 2CHGA 2FS1A 1NJFA 3IECA 2JZ1A 5FLXS 5KQ8A 5EP4A 1QVRA 3J7BA 3M0EA 2DWMA 2LHCA 2DHYA 4WW0A 2KW0A 4B7GA 3U6SA 1IY2A 2UU9M 3KOWE 2DWZB 3IG8A 1G41A 3U60B 1F4IA 3J7AS 1QZEA 2VF7A 4LJ6A 3HJSA 3W0FA 3SMPA 3GLGB 5DFLA 1XC8A 1TR8A 1NSFA 4GITA 2WZJA 1VEJA 4W5WA 2QQ8A 2KDLA 3VK8A 2F5OA 2C98A 3K9PA 1DO0A 5EXPA 2DKLA 2CHVA 4GC5A 1NO1A 1SXJE 1NV8A 2KHHA 3ILKA 4I81A 4OVZA 4JI1M 1HT2E 3D8LA 3U6DA 5ITQA 1QQWA 1H6UA 4G6ZA 4HLQA 4AKIA 4X66M 1E32A 5KPZA 4NXMM 2C9CA 1HNWM 1XB2B 4GKKM 2OPFA 4JI6M 2CV2A 3WHLA 4AI6A 2DNAA 2HCBA 4OW0A 2FNAA 1NVMA 4PDGA 4B7FA 4JI0M 5KO3A 3K8ZA 2DAMA 1WIVA 2F5QA 2RRUA 2EO2A 4IBGA 1EE8A 3GP1A 4P16A 2ZBKB 5EQTA 1SXJA 1Z6TA 4MGYE 3EIEA 1CUKA 3I04M 4WURA 4NSOB 2UXDM 3C3EA 2UUAM 3DOAA 2UUCM 4BB9A 2CE7A 2KZUA 2OOAA 3SHGB 2QBYA 3R9XB 5EJCA 1UFZA 5L8RF 1GLNA 1OFIA 4JXJA 4R3DA 3Q8XA 2RKOA 2MGWA 3L2AA 3W0LB 2Y20A 1I94M 5ITTA 1WR1B 2DVWB 3U6LA 1IXRC 1OAIA 2UXCM 4MB7A 4Z6YA 3JR4A 1IXSA 2JNHA 1PRBA 2CRUA 3GLHB 2Z8YM 3AOEC 1Z59A 4FVMA 4EIWA 2W82A 1XXHA 4X62M 4R71A 1T3TA 3UK6A 5ITUA 2DAKA 2GQFA 1Q39A 2D7HA 2KNZA 2L4FA 3HHWA 5EXSA 3T1HM 1R2YA 1JR3E 2CHQA 4NOOB 1QAQA
chains in the Genus database with same CATH topology
1DV0A 2JZ0A 4F1IA 2QHOB 1VQ1A 2LVQD 2EKKA 2BWEA 2DAIA 2EJSA 1AIPC 3FE3A 3B89A 2R0IA 1WHCA 2B3TA 3E21A 3MMPA 1IM2A 2DENA 1Y8GA 1V92A 1E94E 2LBCA 4UN2B 1C7YA 1GO5A 3IECA 2JZ1A 5JI2E 2JUJA 2DHYA 2QNJA 2G3QA 1G41A 1F4IA 2BWBA 2JY8A 3E46A 1QZEA 3T6PA 4WP2A 1YLAA 1HJPA 5DFLA 1T6OA 1NV9A 1TR8A 2HWJA 2WZJA 1VEJA 2DAGA 2DAEA 3FRIA 3K9PA 2LTUA 1DO0A 3GLFE 1MN3A 1R4GA 2DKLA 1P3QQ 3LCVB 2KHHA 1NV8A 1OTRA 1VEKA 2JY5A 4G3OA 1HT2E 2LVNC 1TTEA 1BVSA 3H4JA 3IHPA 4HEOA 4DBGB 1OQYA 1XB2B 2MJ5B 1ZMWA 2DNAA 2LVOC 2L4EA 2O25A 3GLGE 2OO9A 1ZMUA 1OKSA 1WIVA 2DAMA 2OOBA 2KNAA 2RRUA 3BBZA 1KYIA 2EKFA 1T43A 4Q7JA 1CUKA 2QSFX 2DZLA 1HQYE 2LVAA 1A5TA 2KNVA 1WGNA 2OOAA 2MR9A 1UFZA 1SG9A 1DO2A 2ZTCA 2DI0A 4GEWA 3F92A 2JY7A 2L2DA 1ZV1A 3K9OA 2MGWA 1PGYA 2H5XA 2CP8A 1VEGA 1WR1B 1G3IA 1VG5A 3LCUA 1OAIA 2JP7A 1IXSA 1WJ7A 2JNHA 2CWBA 3GLHE 3FRHA 2ZTDA 3GLIE 1IFYA 4F2LA 1EFUB 2MROB 1HT1E 4R71A 2LVPC 1WGLA 1XXHE 1ZMVA 1VDLA 2DAKA 2JY6B 2KNZA 2L4FA 2K9DA 2K0BX 1G4AE 1JR3E 1Q02A 2HAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DV0 A;  2JZ0 A;  4F1I A;  2QHO B;  1VQ1 A;  2LVQ D;  2EKK A;  2BWE A;  2DAI A;  2EJS A;  1AIP C;  3FE3 A;  3B89 A;  2R0I A;  1WHC A;  2B3T A;  3E21 A;  3MMP A;  1IM2 A;  2DEN A;  1Y8G A;  1V92 A;  1E94 E;  2LBC A;  4UN2 B;  1C7Y A;  1GO5 A;  3IEC A;  2JZ1 A;  5JI2 E;  2JUJ A;  2DHY A;  2QNJ A;  2G3Q A;  1G41 A;  1F4I A;  2BWB A;  2JY8 A;  3E46 A;  1QZE A;  3T6P A;  4WP2 A;  1YLA A;  1HJP A;  5DFL A;  1T6O A;  1NV9 A;  1TR8 A;  2HWJ A;  2WZJ A;  1VEJ A;  2DAG A;  2DAE A;  3FRI A;  3K9P A;  2LTU A;  1DO0 A;  3GLF E;  1MN3 A;  1R4G A;  2DKL A;  1P3Q Q;  3LCV B;  2KHH A;  1NV8 A;  1OTR A;  1VEK A;  2JY5 A;  4G3O A;  1HT2 E;  2LVN C;  1TTE A;  1BVS A;  3H4J A;  3IHP A;  4HEO A;  4DBG B;  1OQY A;  1XB2 B;  2MJ5 B;  1ZMW A;  2DNA A;  2LVO C;  2L4E A;  2O25 A;  3GLG E;  2OO9 A;  1ZMU A;  1OKS A;  1WIV A;  2DAM A;  2OOB A;  2KNA A;  2RRU A;  3BBZ A;  1KYI A;  2EKF A;  1T43 A;  4Q7J A;  1CUK A;  2QSF X;  2DZL A;  1HQY E;  2LVA A;  1A5T A;  2KNV A;  1WGN A;  2OOA A;  2MR9 A;  1UFZ A;  1SG9 A;  1DO2 A;  2ZTC A;  2DI0 A;  4GEW A;  3F92 A;  2JY7 A;  2L2D A;  1ZV1 A;  3K9O A;  2MGW A;  1PGY A;  2H5X A;  2CP8 A;  1VEG A;  1WR1 B;  1G3I A;  1VG5 A;  3LCU A;  1OAI A;  2JP7 A;  1IXS A;  1WJ7 A;  2JNH A;  2CWB A;  3GLH E;  3FRH A;  2ZTD A;  3GLI E;  1IFY A;  4F2L A;  1EFU B;  2MRO B;  1HT1 E;  4R71 A;  2LVP C;  1WGL A;  1XXH E;  1ZMV A;  1VDL A;  2DAK A;  2JY6 B;  2KNZ A;  2L4F A;  2K9D A;  2K0B X;  1G4A E;  1JR3 E;  1Q02 A;  2HAK A; 
#chains in the Genus database with same CATH topology
 4PD2 A;  1IQP A;  1IXZ A;  1IBL M;  2F5P A;  3TPZ A;  4DUY M;  4GHL A;  5ITX A;  3QYB A;  2WSE F;  2YNM D;  2V6Z M;  3I4V A;  4QNM A;  4JI2 M;  1GL7 A;  2FFJ A;  3U61 A;  2F4V M;  3I01 M;  5KPT A;  1XHB A;  3PVS A;  4IBE A;  2AHM A;  3T1Y M;  3MMP A;  4MGI E;  3GLF B;  2M60 A;  1DGH A;  2DEN A;  5FTJ A;  5IT9 S;  4OX9 M;  1QUS A;  4DV2 M;  4UN2 B;  1JB0 F;  1N32 M;  4LFB M;  3ZQJ A;  4IBK A;  3FUW A;  5C1B A;  3EIH A;  3FTC A;  3LQR A;  4LJ9 A;  2XZU A;  1JR3 A;  4RF0 A;  1TH3 A;  3PNY A;  4CIS A;  3K92 A;  2G3Q A;  2QP9 X;  2BWB A;  2E5L M;  5EXT A;  2JY8 A;  3E46 A;  4DR1 M;  3T6P A;  4WP2 A;  1HJP A;  1Q3C A;  4AQY M;  3U6C A;  4R7G A;  1TGU A;  1IBM M;  5H37 D;  1N33 M;  1XMO M;  1L1T A;  4DR3 M;  2ZAO A;  2R46 A;  4LJ7 A;  4LF5 M;  3FTE A;  2LNH C;  3LVW A;  1HQC A;  3GRV A;  4DR6 M;  1MN3 A;  1R4G A;  2BNK A;  3J2P B;  1VEK A;  2JXN A;  2J7O A;  3KS4 A;  3FUU A;  1Z5A A;  4B08 A;  4AG5 A;  3H4M A;  1TF0 B;  1BVS A;  1TTE A;  3H4J A;  2P5T A;  4I8O A;  4IBB A;  2OQ4 A;  4I5S A;  3MJ5 A;  2DZO B;  3U60 A;  4M0D A;  1VDD A;  2MJ5 B;  3GPY A;  3W68 A;  2ZM6 M;  2R6F A;  3HHY A;  2EUC A;  1D0K A;  4II7 A;  3GLG A;  4DR2 M;  4CGY B;  1L8Q A;  4MGH A;  2O25 A;  2CEA A;  3GRY A;  3TE6 A;  1OJL A;  1XWI A;  4P17 A;  2F5N A;  4GC9 A;  4LJA A;  4TUW A;  3NWL A;  3GPP A;  4LF9 M;  3VKG A;  1ZMU A;  2OOB A;  1J7K A;  4NSR A;  3SAT A;  1V33 A;  2QZ4 A;  3BBZ A;  3DZD A;  4L4U A;  4FW9 A;  2ZAM A;  2N35 A;  4BBA A;  4L16 A;  4DV4 M;  1IY0 A;  2XLJ A;  2C9O A;  2FE8 A;  3KP1 E;  4L15 A;  1HQY E;  2LVA A;  3K1J A;  4NL4 H;  2KNV A;  4IBF A;  4LY6 A;  4AKH A;  1DGG A;  2R65 A;  4CIZ A;  2UXB M;  2HL7 A;  1G59 A;  4FWH A;  2DWN A;  1SG9 A;  4M9S A;  4FCT A;  2X8A A;  4B3R M;  1L2C A;  1E9R A;  2VII A;  4L8R C;  3HZJ A;  2FOI C;  5LMN M;  4GH9 A;  2H5X A;  1GVN A;  1IN4 A;  3VDU A;  3LCU A;  3A46 A;  2J7N A;  3VKH A;  4LFC M;  3GRR A;  1YSY A;  4YY3 M;  3M6A A;  2CWB A;  3J80 S;  3GLH E;  3FRH A;  3AOE A;  3K2L A;  5GKN A;  3ZCB B;  2XEP A;  4LF4 M;  4LF8 M;  3GRU A;  1IFY A;  1ZAE A;  1GAB A;  1EFU B;  3FD9 A;  3BXW A;  2DWL A;  1XXH E;  3FUT A;  1R6B X;  2JY6 B;  4PDI A;  1HR0 M;  1NHG C;  4JYA M;  2I7P A;  5KPR A;  5BPV A;  3CF2 A;  1XNQ M;  1MJG M;  3QAU A;  3SAS A;  2Z3X A;  3GQ5 A;  1IN8 A;  2QHO B;  2R62 A;  1VQ1 A;  2KZS A;  2LVQ D;  3UMM A;  4MGK E;  1PJS A;  1IY1 A;  2YFQ A;  3V76 A;  5ITX E;  2VQF M;  2R4E A;  1XMQ M;  3HJ8 A;  3KOY E;  4DV5 M;  1W5S A;  2KRK A;  1GL6 A;  3FE3 A;  2CUZ A;  2R0I A;  2R45 A;  2Z7J A;  3E21 A;  4BLC A;  5DYI A;  1IM2 A;  5BR8 M;  4CJ6 A;  2LWX A;  3GLH A;  3J27 B;  4MM3 B;  2V1U A;  2R18 A;  4KLN A;  1IBK M;  4LJ8 A;  2HHH M;  1Y8G A;  1KFV A;  2YQZ A;  4JN6 A;  4YHH M;  3I51 A;  1FNN A;  1WXQ A;  1C7Y A;  4KT0 F;  3B7Q A;  4MGZ E;  2H1R A;  5JI2 E;  2LXE A;  4DV6 M;  3HU1 A;  3UGJ A;  5EP2 A;  4G4N A;  2QNJ A;  2C96 A;  4LRS A;  4JI7 M;  2O01 F;  2CV0 A;  3U5Z B;  4LGM A;  2VF8 A;  3DA1 A;  3KOZ E;  4LJ4 A;  1YUB A;  3THG A;  1EIJ A;  3TWK A;  1R5L A;  4LCB A;  5DNY A;  2R4J A;  3AKZ A;  4FWD A;  2R44 A;  3C58 A;  1OIP A;  3A42 A;  1T6O A;  3BOS A;  4IBC A;  1N77 A;  1GJT A;  2HWJ A;  4RF1 A;  3GO8 A;  3GLF A;  2LTU A;  3LW5 F;  4FD2 A;  2L7H A;  1SXJ C;  3Q8G A;  1P3Q Q;  3LCV B;  3SAU A;  4LZZ A;  2BJW A;  1QUT A;  2JY5 A;  2XGN A;  4G3O A;  4DR4 M;  1HNX M;  3AJI B;  3HKP A;  4QOZ C;  2KXE A;  2KEB A;  4IIW A;  2G5G X;  4DBG B;  4IBD A;  2XF3 A;  4G4Q A;  3J81 S;  1TDZ A;  1QDR A;  3SFZ A;  4G4R A;  2L7I A;  3NBX X;  1QZM A;  1E9S A;  2QCU A;  1ZMW A;  3WHK A;  4KO8 A;  3UZU A;  4QHT A;  2DHR A;  3SAW A;  2L4E A;  3B7N A;  3MHV C;  4GRI A;  4G4O A;  3QYE A;  3GLG E;  1PJQ A;  2OO9 A;  2RGH A;  3CGW A;  3B7Z A;  4JI8 M;  3SC3 A;  4LZJ A;  1OKS A;  3U6P A;  1K3W A;  4D82 A;  3PNV A;  2Q2E B;  1KYI A;  2CFO A;  2M5Z A;  1G8P A;  4XBO A;  3SBJ A;  3L28 A;  3T38 A;  2DXI A;  4D81 A;  1T43 A;  5EP1 A;  5FTL A;  3UJN A;  2VDB B;  3TL4 X;  1A5T A;  1YE9 A;  1C1K A;  1Z5C A;  1NY6 A;  3E9S A;  4QOS A;  4QNR A;  4Z8X A;  1RU3 A;  4GKJ M;  2GNO A;  2ZTC A;  1JQJ C;  5E6J A;  2Y0Q A;  2C99 A;  3PXG A;  2L2D A;  3K9O A;  1ZV1 A;  3KP0 E;  5IRE B;  1ZQ9 A;  4B3S M;  1PGY A;  4S12 A;  4Y28 F;  3VDP A;  1LV7 A;  2CP8 A;  1VG5 A;  4ZPX A;  4L6V 6;  2HKJ A;  3KFU G;  3QWL A;  2NQ8 C;  1X37 A;  1WJ7 A;  2O5R A;  5E26 A;  3M7G A;  3GLI A;  5LMU M;  2ZTD A;  3GLI B;  3FUX A;  3TWL A;  4F2L A;  2MRO B;  2FH0 A;  2LVP C;  4NXN M;  3GQ4 A;  1IN7 A;  3E4R A;  2JWS A;  4MH0 E;  3SMS A;  2K9D A;  1PM5 A;  4X65 M;  4DV3 M;  2UUB M;  2K0B X;  1QAO A;  3HU2 A;  1G4A E;  3L27 A;  2HAK A;  3HHX A;  4NRV A;  4OU7 A;  1NNJ A;  3VFD A;  4F1I A;  1NJG A;  1L2B A;  4D80 A;  3TWM A;  1Q3B A;  3VLF B;  1W5T A;  5DYG A;  2BWE A;  4PT5 A;  1PJJ A;  2EJS A;  3CTW B;  4LF6 M;  2CV1 A;  5EXX A;  2MH8 A;  3AV0 A;  4M0W A;  3HY5 A;  1AUA A;  3SAV A;  2KRU A;  3B89 A;  2B3T A;  2K47 A;  1N34 M;  2WSF F;  3RE8 A;  3IG5 A;  2EA0 A;  3A98 B;  1PJI A;  4OVZ B;  3KSJ A;  1PJT A;  2QPA A;  1E94 E;  3KVW A;  2LBC A;  1GJS A;  3T15 A;  1N75 A;  1GO5 A;  2J5Y A;  3PFI A;  2JUJ A;  4IJF A;  3HU3 A;  1QAN A;  1ORY B;  1SXJ D;  7CAT A;  4IJE A;  5IWA M;  2BJV A;  2XH9 A;  1J5E M;  2I7N A;  4AW4 A;  2Y21 A;  1IN5 A;  4B3T M;  2Z4S A;  3HHZ A;  2ERC A;  1YLA A;  5C18 A;  3ZC7 B;  1MU5 A;  3AL0 C;  4ITQ A;  1NNU C;  1LTM A;  3B74 A;  1OAO C;  2DZN B;  3KSX A;  3A45 A;  5IZ7 D;  4ANR A;  5ITR A;  1NV9 A;  4K0K M;  3RGP A;  4DV7 M;  3FTD A;  1GKI A;  4DUZ M;  2DAG A;  4GMQ A;  2DAE A;  4I4L A;  3FRI A;  2XSZ D;  3GLF E;  4JI4 M;  4NC6 A;  5EP3 A;  2RGO A;  3JR5 A;  4NRW A;  3KS8 A;  1SXJ B;  4DR5 M;  1KSF X;  3U6Q A;  3D8B A;  1OTR A;  3L26 A;  5A2Q S;  1R2Z A;  2XZF A;  2LHG A;  4M9X A;  2LVN C;  3HWS A;  3FUV A;  3AFH A;  1QDT A;  3HGI A;  3IHP A;  4HEO A;  2QBY B;  4JI3 M;  1OQY A;  1K82 A;  3NBI A;  1G71 A;  3U5Z A;  4GIP A;  2WSC F;  4LGY A;  1D0M A;  2YR0 A;  3C3D A;  3LMM A;  5FTN A;  4AG6 A;  4CHT B;  3L25 A;  2G8L A;  2LVO C;  2XSZ A;  3KOX E;  3L29 A;  4AZF A;  4A3V B;  3FTF A;  2XFT A;  3HJQ A;  4GHA A;  3R8F A;  4IBJ A;  1DGF A;  1UM8 A;  4LF7 M;  2KNA A;  1IXS B;  4DR7 M;  1S3S A;  2ZAN A;  4FCV A;  5F3W A;  1XXH B;  2EKF A;  1IN6 A;  3LVV A;  4Q7J A;  2LH0 A;  2QSF X;  4B3M M;  2DZL A;  3RGS A;  3W67 A;  2X49 A;  3MK6 A;  2X4A A;  2APL A;  5FSW A;  3FYC A;  1WGN A;  3CF0 A;  4RKU F;  4JI5 M;  3SYL A;  2MR9 A;  5KQD A;  2Y0T A;  2XFS A;  3SYK A;  4DV1 M;  1DO2 A;  8CAT A;  3GQ3 A;  2QEN A;  1QAM A;  1I4W A;  2DI0 A;  4RNA A;  4GEW A;  4KOD A;  3SHF A;  1MX0 A;  3F92 A;  2JY7 A;  1JR3 D;  2D7G A;  2KA6 B;  4QHS A;  3DFZ A;  3C9P A;  3U61 B;  4JV5 M;  1VEG A;  1G3I A;  4LRT A;  3GPU A;  1DGB A;  3GPX A;  2JA2 A;  3RFW A;  3VK7 A;  1D2N A;  1XNR M;  1R7R A;  2JP7 A;  2Z4R A;  1OIZ A;  1N78 A;  4B7H A;  1DGH B;  3FYD A;  4HL4 A;  3GLI E;  1D0L A;  3KDS E;  3I4Y A;  3U6O A;  4FCW A;  1L1Z A;  1HT1 E;  1NHW C;  1TH2 A;  1TDH A;  3FKE A;  3OTO M;  1WGL A;  3CF6 E;  1ZMV A;  1VDL A;  1N36 M;  3SAR A;  4AKG A;  1NY5 A;  4FWG A;  4L78 A;  4PCZ A;  3JAM S;  1Q02 A;  2JZ0 A;  3HX3 A;  5JI3 E;  3LQQ A;  3KW6 A;  2D7E A;  3KXE C;  1DV0 A;  4REZ A;  2L09 A;  2A5Y B;  4XK8 F;  2EKK A;  4DV0 M;  1L2D A;  4LFA M;  2DAI A;  4IBI A;  4XGI A;  3ZH9 B;  2VQE M;  2L6O A;  3TQS A;  3B9P A;  1QYR A;  1HNZ M;  1AIP C;  1J09 A;  4LG2 A;  1WHC A;  5FTM A;  2F5S A;  1TH4 A;  5FTK A;  4LJ5 A;  2K6B A;  3AOG A;  4X64 M;  1Z5B A;  3U6M A;  2C5R A;  1FJG M;  5ITY A;  3U6E A;  1K3X A;  4KHP M;  1V92 A;  1V34 A;  2V1C A;  1OFH A;  4M9Z A;  2CHG A;  2FS1 A;  1NJF A;  3IEC A;  2JZ1 A;  5FLX S;  5KQ8 A;  5EP4 A;  1QVR A;  3J7B A;  3M0E A;  2DWM A;  2LHC A;  2DHY A;  4WW0 A;  2KW0 A;  4B7G A;  3U6S A;  1IY2 A;  2UU9 M;  3KOW E;  2DWZ B;  3IG8 A;  1G41 A;  3U60 B;  1F4I A;  3J7A S;  1QZE A;  2VF7 A;  4LJ6 A;  3HJS A;  3W0F A;  3SMP A;  3GLG B;  5DFL A;  1XC8 A;  1TR8 A;  1NSF A;  4GIT A;  2WZJ A;  1VEJ A;  4W5W A;  2QQ8 A;  2KDL A;  3VK8 A;  2F5O A;  2C98 A;  3K9P A;  1DO0 A;  5EXP A;  2DKL A;  2CHV A;  4GC5 A;  1NO1 A;  1SXJ E;  1NV8 A;  2KHH A;  3ILK A;  4I81 A;  4OVZ A;  4JI1 M;  1HT2 E;  3D8L A;  3U6D A;  5ITQ A;  1QQW A;  1H6U A;  4G6Z A;  4HLQ A;  4AKI A;  4X66 M;  1E32 A;  5KPZ A;  4NXM M;  2C9C A;  1HNW M;  1XB2 B;  4GKK M;  2OPF A;  4JI6 M;  2CV2 A;  3WHL A;  4AI6 A;  2DNA A;  2HCB A;  4OW0 A;  2FNA A;  1NVM A;  4PDG A;  4B7F A;  4JI0 M;  5KO3 A;  3K8Z A;  2DAM A;  1WIV A;  2F5Q A;  2RRU A;  2EO2 A;  4IBG A;  1EE8 A;  3GP1 A;  4P16 A;  2ZBK B;  5EQT A;  1SXJ A;  1Z6T A;  4MGY E;  3EIE A;  1CUK A;  3I04 M;  4WUR A;  4NSO B;  2UXD M;  3C3E A;  2UUA M;  3DOA A;  2UUC M;  4BB9 A;  2CE7 A;  2KZU A;  2OOA A;  3SHG B;  2QBY A;  3R9X B;  5EJC A;  1UFZ A;  5L8R F;  1GLN A;  1OFI A;  4JXJ A;  4R3D A;  3Q8X A;  2RKO A;  2MGW A;  3L2A A;  3W0L B;  2Y20 A;  1I94 M;  5ITT A;  1WR1 B;  2DVW B;  3U6L A;  1IXR C;  1OAI A;  2UXC M;  4MB7 A;  4Z6Y A;  3JR4 A;  1IXS A;  2JNH A;  1PRB A;  2CRU A;  3GLH B;  2Z8Y M;  3AOE C;  1Z59 A;  4FVM A;  4EIW A;  2W82 A;  1XXH A;  4X62 M;  4R71 A;  1T3T A;  3UK6 A;  5ITU A;  2DAK A;  2GQF A;  1Q39 A;  2D7H A;  2KNZ A;  2L4F A;  3HHW A;  5EXS A;  3T1H M;  1R2Y A;  1JR3 E;  2CHQ A;  4NOO B;  1QAQ A; 
#chains in the Genus database with same CATH homology
 1DV0 A;  2JZ0 A;  4F1I A;  2QHO B;  1VQ1 A;  2LVQ D;  2EKK A;  2BWE A;  2DAI A;  2EJS A;  1AIP C;  3FE3 A;  3B89 A;  2R0I A;  1WHC A;  2B3T A;  3E21 A;  3MMP A;  1IM2 A;  2DEN A;  1Y8G A;  1V92 A;  1E94 E;  2LBC A;  4UN2 B;  1C7Y A;  1GO5 A;  3IEC A;  2JZ1 A;  5JI2 E;  2JUJ A;  2DHY A;  2QNJ A;  2G3Q A;  1G41 A;  1F4I A;  2BWB A;  2JY8 A;  3E46 A;  1QZE A;  3T6P A;  4WP2 A;  1YLA A;  1HJP A;  5DFL A;  1T6O A;  1NV9 A;  1TR8 A;  2HWJ A;  2WZJ A;  1VEJ A;  2DAG A;  2DAE A;  3FRI A;  3K9P A;  2LTU A;  1DO0 A;  3GLF E;  1MN3 A;  1R4G A;  2DKL A;  1P3Q Q;  3LCV B;  2KHH A;  1NV8 A;  1OTR A;  1VEK A;  2JY5 A;  4G3O A;  1HT2 E;  2LVN C;  1TTE A;  1BVS A;  3H4J A;  3IHP A;  4HEO A;  4DBG B;  1OQY A;  1XB2 B;  2MJ5 B;  1ZMW A;  2DNA A;  2LVO C;  2L4E A;  2O25 A;  3GLG E;  2OO9 A;  1ZMU A;  1OKS A;  1WIV A;  2DAM A;  2OOB A;  2KNA A;  2RRU A;  3BBZ A;  1KYI A;  2EKF A;  1T43 A;  4Q7J A;  1CUK A;  2QSF X;  2DZL A;  1HQY E;  2LVA A;  1A5T A;  2KNV A;  1WGN A;  2OOA A;  2MR9 A;  1UFZ A;  1SG9 A;  1DO2 A;  2ZTC A;  2DI0 A;  4GEW A;  3F92 A;  2JY7 A;  2L2D A;  1ZV1 A;  3K9O A;  2MGW A;  1PGY A;  2H5X A;  2CP8 A;  1VEG A;  1WR1 B;  1G3I A;  1VG5 A;  3LCU A;  1OAI A;  2JP7 A;  1IXS A;  1WJ7 A;  2JNH A;  2CWB A;  3GLH E;  3FRH A;  2ZTD A;  3GLI E;  1IFY A;  4F2L A;  1EFU B;  2MRO B;  1HT1 E;  4R71 A;  2LVP C;  1WGL A;  1XXH E;  1ZMV A;  1VDL A;  2DAK A;  2JY6 B;  2KNZ A;  2L4F A;  2K9D A;  2K0B X;  1G4A E;  1JR3 E;  1Q02 A;  2HAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...