2JZ1A

Dsx_long
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLNIYDGGELRNTTRQCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein doublesex
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08828 DSX_dimer Doublesex dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz1A01
1DO0A 2G3QA 2JY7A 5DFLA 1TR8A 1HT2E 1WGLA 1YLAA 1T6OA 4GEWA 2BWBA 1WIVA 1VDLA 4DBGB 2OOAA 2KNZA 2JY6B 2CWBA 2OOBA 4Q7JA 1F4IA 2QNJA 3F92A 3T6PA 1OTRA 2JY8A 1VEGA 2JY5A 3GLFE 2DAEA 1EFUB 3K9PA 1DO2A 1MN3A 2DAMA 1KYIA 1WR1B 2BWEA 2L2DA 1E94E 1ZMWA 2JP7A 1JR3E 3FRIA 2EKKA 2LVOC 2JUJA 1TTEA 1VEKA 1P3QQ 3GLGE 1G41A 3GLIE 3H4JA 1Y8GA 1V92A 2DZLA 1WHCA 3FE3A 2ZTCA 1OQYA 3LCUA 1OAIA 3B89A 2JZ1A 1NV9A 3E21A 1WGNA 1C7YA 1IXSA 1QZEA 2ZTDA 4WP2A 2EKFA 3GLHE 1UFZA 1WJ7A 1GO5A 1DV0A 3MMPA 1AIPC 2DKLA 2KNAA 2EJSA 1ZMUA 2OO9A 2RRUA 2L4EA 2K9DA 3IECA 2LVQD 2WZJA 3K9OA 2DHYA 1Q02A 3BBZA 1T43A 2HAKA 1BVSA 1ZV1A 2MROB 1HT1E 1G4AE 2JZ0A 1VQ1A 4G3OA 1PGYA 2LVPC 1A5TA 1VEJA 3LCVB 2QSFX 3E46A 2K0BX 2L4FA 2DI0A 2KNVA 1IFYA 3IHPA 2DENA 2LVAA 1CUKA 1SG9A 2DAKA 2H5XA 2MGWA 2MR9A 1R4GA 2LBCA 1HJPA 4UN2B 5JI2E 1VG5A 2KHHA 1XXHE 1OKSA 2DAIA 2LTUA 2R0IA 2JNHA 4HEOA 1G3IA 4F1IA 1XB2B 2QHOB 1NV8A 2LVNC 2MJ5B 4F2LA 1IM2A 1ZMVA 2HWJA 2CP8A 2DAGA 4R71A 2DNAA 1HQYE 2B3TA 3FRHA 2O25A
chains in the Genus database with same CATH superfamily
4IBFA 1QQWA 4JI8M 1GJTA 5C18A 2KXEA 1TR8A 1WGLA 1X37A 2QBYB 1T6OA 2F4VM 2Z3XA 2RGOA 4JI0M 3HHWA 3R9XB 2CHGA 2OOAA 2JY6B 3UMMA 2JXNA 3GQ3A 1V34A 1N75A 2QENA 3GPYA 1AUAA 2XZUA 3T6PA 2V1UA 3SHFA 4RF0A 1OTRA 1IN4A 5JI3E 4JI1M 3UK6A 2JY5A 3W0LB 5KPTA 1DO2A 2ERCA 3ZCBB 4B7GA 2J7OA 2V1CA 3CGWA 3E9SA 1GL6A 3FYDA 4FW9A 4GC5A 4CJ6A 4DR4M 1E94E 2JP7A 3T15A 1JR3E 3B7QA 4Y28F 4B7HA 1L2DA 4GKJM 4X65M 3FYCA 4NXMM 5H37D 1P3QQ 3HJSA 3GLGE 3GLIE 3TWMA 4S12A 3M7GA 2ZTCA 1NHGC 1OQYA 2KZUA 1OAIA 2QCUA 3AFHA 3FUXA 3LCUA 4LZJA 3A42A 1GLNA 1PJSA 1C7YA 1QZEA 1YUBA 3LVVA 4NOOB 4D82A 4L6V6 3KXEC 1TH2A 2N35A 3PFIA 5IZ7D 3TL4X 2C98A 1DGGA 1UFZA 4NSRA 3C9PA 3Q8GA 4LJ8A 1MJGM 4CGYB 1NNUC 4LJ7A 3J2PB 4BBAA 5KQDA 4WURA 5KO3A 2JA2A 4G4OA 2EJSA 3GRRA 3KP0E 2OO9A 1K82A 4AI6A 4W5WA 2LVQD 2WZJA 3K9OA 3QWLA 1NNJA 4DR6M 4L8RC 2J7NA 3KOZE 1XNQM 4BB9A 1D0LA 1IY2A 3MHVC 4AKIA 3R8FA 3M6AA 4LJ9A 4DR2M 4L78A 2HAKA 2DVWB 4CHTB 3VKGA 1HT1E 1G4AE 4IJEA 4AG5A 4LF9M 3KP1E 2DZOB 3L2AA 3NWLA 3JAMS 1ORYB 3J27B 2LVPC 5IREB 5FTLA 3L29A 1W5SA 5FTNA 1IN6A 3I4VA 5KPRA 4HLQA 3HX3A 3LCVB 2Y20A 4DV1M 3AOEC 1OIPA 4MM3B 2RGHA 2Z4RA 4LF7M 2CFOA 3J81S 3SASA 1J5EM 3OTOM 4IBCA 2H5XA 2CV0A 2VQFM 2LBCA 3DFZA 3W67A 1JR3D 1D0MA 4QNRA 1XXHE 2KW0A 4PD2A 3HHZA 3J80S 3FUWA 2I7NA 3HHYA 3GRYA 2AHMA 5KPZA 4KO8A 2ZAOA 4X66M 1D0KA 1H6UA 4GIPA 2CUZA 4GH9A 1NJFA 1XB2B 3C3EA 5LMNM 2C9OA 1RU3A 3JR5A 2LVNC 4KT0F 3RGSA 4PT5A 1ZMVA 4CISA 4II7A 1PM5A 3DA1A 2CV1A 1HQYE 4DV0M 4D81A 1UM8A 4QOSA 3UJNA 1OFHA 2VIIA 2HKJA 2WSEF 4FD2A 4REZA 2OPFA 1NO1A 2QQ8A 2LNHC 4GEWA 3WHLA 3PNVA 4AQYM 3LW5F 3GPPA 2LHCA 1D2NA 4DBGB 3GO8A 3VK7A 3GQ5A 4B3SM 3L25A 2A5YB 4K0KM 1N33M 3U6MA 2KDLA 4NXNM 4LF8M 4B3RM 4LG2A 2ZBKB 3D8LA 3BXWA 1OAOC 4JI3M 3SC3A 3GLFE 3CF0A 1N77A 2HCBA 3QYBA 2X4AA 5E6JA 1JR3A 1IN7A 1SXJB 2R6FA 3KOXE 1WR1B 4B3MM 2XSZD 2NQ8C 2C9CA 5EXXA 1GJSA 5EP4A 3SFZA 3E4RA 1JQJC 2XLJA 3FRIA 3GLIA 5BPVA 2EKKA 3FTFA 1IQPA 1QZMA 2UXCM 2JUJA 2ZANA 4GITA 1TTEA 4MGIE 3EIEA 4R3DA 4IBIA 4G4NA 1DGFA 3AOEA 3B89A 2CHVA 2JZ1A 3K8ZA 1V33A 2KEBA 1TH3A 2XGNA 1Z6TA 3B9PA 4AG6A 3ZQJA 5F3WA 3GLIB 1Q3CA 1PJJA 4G4QA 2ZTDA 3HU1A 4NL4H 1IBKM 1L1TA 2YFQA 2BJWA 4FVMA 3SATA 2FS1A 1GO5A 1DV0A 3MMPA 4GRIA 5IWAM 4PDIA 3T1HM 2O5RA 3AKZA 1E9RA 3I01M 1N32M 2DHYA 3VK8A 3NBXX 1GL7A 2R18A 4IBEA 3H4MA 2RKOA 4LF5M 1FJGM 3HU3A 1BVSA 1XNRM 1Z5CA 1VDDA 4OW0A 3THGA 3SYKA 2FH0A 4R7GA 4A3VB 5BR8M 1A5TA 4QOZC 2R46A 4IBJA 3SMSA 2FE8A 7CATA 3E46A 2K0BX 2XSZA 3GLHA 4MH0E 4P16A 1HNWM 1N78A 1DGBA 2DWLA 2R4EA 5FTMA 4QHSA 4EIWA 3SAWA 3IHPA 3LMMA 3EIHA 5ITQA 2LXEA 1R5LA 2MR9A 3DOAA 3U5ZA 1GVNA 3KW6A 3GPUA 2XEPA 4MGYE 5EJCA 1LTMA 1IBLM 1HJPA 2P5TA 3AOGA 3CTWB 4LJAA 4NC6A 1XXHA 2WSCF 3GLHB 4UN2B 3MK6A 2HL7A 5FSWA 1EIJA 1I4WA 2KHHA 1IXRC 3FUVA 3PNYA 4LGMA 3VDPA 2R45A 5ITYA 3KSXA 3SAVA 3GRVA 2UUBM 2LTUA 3U5ZB 1XMQM 2LWXA 2JNHA 4MGKE 3GPXA 1G3IA 1TH4A 4DR7M 1L2BA 1TGUA 3WHKA 2KRKA 1XXHB 3KVWA 1QANA 1DGHA 2QHOB 3DZDA 3ZH9B 3KOWE 1W5TA 4F2LA 1IM2A 1IN8A 2HWJA 3HWSA 3GLFB 4R71A 1N34M 1G71A 4PDGA 2O25A 3TWKA 5EP2A 4FWGA 4NSOB 1PJQA 2K47A 4JI5M 3U6PA 1DGHB 2G3QA 5DFLA 3TE6A 2F5NA 1HR0M 4LFBM 2R62A 2FFJA 3VLFB 1J09A 2QP9X 1Q3BA 2BWBA 2L09A 2UUAM 4ZPXA 5A2QS 1E9SA 4KODA 3FTEA 3SYLA 5EP1A 4YY3M 4ITQA 3SMPA 2OOBA 4IIWA 3HKPA 1E32A 4P17A 1QDRA 3HJQA 3RE8A 3GLFA 5EXSA 4X64M 2F5QA 4WW0A 4I81A 4LJ5A 5FTJA 4JYAM 2DAEA 3K9PA 1NY5A 3C3DA 4XGIA 1MN3A 3HHXA 2DAMA 1KYIA 2C99A 2BWEA 3U60A 1I94M 2L2DA 1L8QA 3B7ZA 3HZJA 4M9ZA 3TQSA 1GKIA 1OFIA 4B08A 4L4UA 2LVOC 3AV0A 4JXJA 4LZZA 5EXPA 1VEKA 2QPAA 2CHQA 4M0DA 4RF1A 1WHCA 3FE3A 5IT9S 4DUYM 3V76A 4GC9A 1PRBA 2KRUA 4FWHA 1NV9A 3E21A 2EO2A 1WGNA 4LJ4A 4DV7M 2L6OA 3AJIB 4KLNA 8CATA 2DHRA 4FCVA 4G6ZA 5FTKA 1NSFA 1TDHA 1NHWC 3IG5A 5DNYA 4JV5M 4WP2A 2EKFA 3KSJA 3FUTA 4XBOA 3U61A 3A98B 1AIPC 2V6ZM 2F5PA 1LV7A 3LQQA 5ITTA 5ITUA 1IY0A 1R2YA 2I7PA 2K9DA 3IECA 3A46A 1ZQ9A 5EXTA 1QAOA 4LF6M 1GABA 3GLGA 1L2CA 3MJ5A 2BJVA 3UGJA 1T43A 2FNAA 4DV6M 3U61B 4IBKA 1QUSA 2ZM6M 3C58A 4NRVA 1PJIA 4TUWA 3L26A 2XH9A 5ITXE 3GQ4A 5DYIA 3SHGB 2XFTA 4B3TM 3PVSA 3GLGB 2QSFX 1N36M 5E26A 4M9SA 1TF0B 2L4FA 2KNVA 4JI4M 2D7HA 1IFYA 2R44A 3SAUA 4ANRA 2DENA 2UU9M 3K92A 4IBBA 1CUKA 4JI2M 2DAKA 2R4JA 4GHAA 2EUCA 1OJLA 3U6CA 1R4GA 4G4RA 2JWSA 2LH0A 2E5LM 4LFCM 4I4LA 2HHHM 5C1BA 3HJ8A 4L16A 5JI2E 3RFWA 3GRUA 1FNNA 4LFAM 1QDTA 3LQRA 1OKSA 2DAIA 1Z5AA 3B7NA 5GKNA 3U6OA 1R2ZA 2R0IA 4HEOA 2CRUA 1SXJE 3QAUA 4KHPM 1C1KA 3W68A 4OVZA 4I8OA 4I5SA 3HGIA 1MX0A 4BLCA 1NV8A 2KZSA 3FKEA 3K2LA 2MJ5B 1G59A 1QUTA 2DAGA 3BOSA 3ILKA 4LRTA 3SARA 1T3TA 4M0WA 3FRHA 2Z8YM 3L28A 2F5SA 1G8PA 1K3WA 4OVZB 1IY1A 2M5ZA 1DO0A 2JY7A 1QVRA 1WXQA 3D8BA 1YLAA 1HT2E 3PXGA 2W82A 2VDBB 2H1RA 1WIVA 2GNOA 3JR4A 1VDLA 2KNZA 2R65A 4Z8XA 2CWBA 4Q7JA 1F4IA 2MH8A 3QYEA 4XK8F 4PCZA 4AKHA 4GMQA 2QNJA 3F92A 3SBJA 1SXJC 4IBGA 2C5RA 1J7KA 1K3XA 3U6QA 2JY8A 1VEGA 4YHHM 3T38A 1R6BX 2YR0A 1EFUB 4DR3M 3KS8A 3CF6E 2YNMD 1OIZA 3TPZA 4X62M 3Q8XA 4IBDA 1ZMWA 3FD9A 1XHBA 1YE9A 4MGHA 2FOIC 1Z5BA 2O01F 1HNZM 1NY6A 2VF7A 3GP1A 1G41A 2APLA 3H4JA 1XMOM 1TDZA 2Z7JA 1Y8GA 1V92A 2DZLA 2EA0A 2UXDM 3VKHA 3I04M 2KA6B 1JB0F 1Q39A 3I51A 3T1YM 2VF8A 2Y0TA 1KFVA 1IXZA 1MU5A 2LHGA 1NVMA 4QNMA 4OX9M 1IXSA 2Q2EB 2YQZA 5L8RF 4AKGA 4L15A 1EE8A 3CF2A 3IG8A 1HNXM 1SXJD 4DV3M 3FTDA 5KQ8A 3W0FA 4FCTA 3GLHE 4AW4A 1WJ7A 3L27A 4RNAA 4OU7A 1YSYA 2DKLA 2KNAA 3J7AS 2D7GA 2DZNB 1ZMUA 2XZFA 2RRUA 2L4EA 3FTCA 5DYGA 3UZUA 4DR5M 2CEAA 1IXSB 2OQ4A 4MB7A 3U6LA 3KDSE 2DXIA 2UUCM 1QAMA 3AL0C 2Y21A 4GHLA 2XFSA 1Q02A 2BNKA 2D7EA 2M60A 1R7RA 2X49A 1KSFX 2Z4SA 3BBZA 3VDUA 4HL4A 4AZFA 1QYRA 2J5YA 4MGZE 5ITXA 5EP3A 1ZV1A 2MROB 4LCBA 4LJ6A 4B7FA 2VQEM 1S3SA 1HQCA 3KOYE 1L1ZA 3TWLA 2JZ0A 1VQ1A 1Z59A 1PGYA 3K1JA 4G3OA 3U60B 4RKUF 2DWZB 3U6EA 1VEJA 4DV4M 1NJGA 2K6BA 2X8AA 4FWDA 4LGYA 3HU2A 2DI0A 4DUZM 3I4YA 3LVWA 1IN5A 2DWMA 2LVAA 1SG9A 2WSFF 4QHTA 2MGWA 3KS4A 2G5GX 5ITRA 4GKKM 2L7IA 3U6SA 4LF4M 4CIZA 2L7HA 1XC8A 1VG5A 2DWNA 5FLXS 2XF3A 3NBIA 4D80A 3A45A 3VFDA 2F5OA 1SXJA 4JI6M 4M9XA 1IBMM 1XWIA 2G8LA 4IJFA 3M0EA 2ZAMA 4LY6A 3HY5A 3RGPA 3KFUG 4DV2M 3B74A 4F1IA 4DV5M 4LRSA 4JI7M 4FCWA 2CV2A 3U6DA 4NRWA 3ZC7B 5EQTA 2QBYA 1PJTA 1ZAEA 2Y0QA 3J7BA 2UXBM 4Z6YA 2QZ4A 2C96A 2CP8A 2GQFA 4JN6A 2DNAA 4DR1M 5LMUM 2B3TA 2CE7A 3FUUA 1QAQA
chains in the Genus database with same CATH topology
1DO0A 2G3QA 2JY7A 5DFLA 1TR8A 1HT2E 1WGLA 1YLAA 1T6OA 4GEWA 2BWBA 1WIVA 1VDLA 4DBGB 2OOAA 2KNZA 2JY6B 2CWBA 2OOBA 4Q7JA 1F4IA 2QNJA 3F92A 3T6PA 1OTRA 2JY8A 1VEGA 2JY5A 3GLFE 2DAEA 1EFUB 3K9PA 1DO2A 1MN3A 2DAMA 1KYIA 1WR1B 2BWEA 2L2DA 1E94E 1ZMWA 2JP7A 1JR3E 3FRIA 2EKKA 2LVOC 2JUJA 1TTEA 1VEKA 1P3QQ 3GLGE 1G41A 3GLIE 3H4JA 1Y8GA 1V92A 2DZLA 1WHCA 3FE3A 2ZTCA 1OQYA 3LCUA 1OAIA 3B89A 2JZ1A 1NV9A 3E21A 1WGNA 1C7YA 1IXSA 1QZEA 2ZTDA 4WP2A 2EKFA 3GLHE 1UFZA 1WJ7A 1GO5A 1DV0A 3MMPA 1AIPC 2DKLA 2KNAA 2EJSA 1ZMUA 2OO9A 2RRUA 2L4EA 2K9DA 3IECA 2LVQD 2WZJA 3K9OA 2DHYA 1Q02A 3BBZA 1T43A 2HAKA 1BVSA 1ZV1A 2MROB 1HT1E 1G4AE 2JZ0A 1VQ1A 4G3OA 1PGYA 2LVPC 1A5TA 1VEJA 3LCVB 2QSFX 3E46A 2K0BX 2L4FA 2DI0A 2KNVA 1IFYA 3IHPA 2DENA 2LVAA 1CUKA 1SG9A 2DAKA 2H5XA 2MGWA 2MR9A 1R4GA 2LBCA 1HJPA 4UN2B 5JI2E 1VG5A 2KHHA 1XXHE 1OKSA 2DAIA 2LTUA 2R0IA 2JNHA 4HEOA 1G3IA 4F1IA 1XB2B 2QHOB 1NV8A 2LVNC 2MJ5B 4F2LA 1IM2A 1ZMVA 2HWJA 2CP8A 2DAGA 4R71A 2DNAA 1HQYE 2B3TA 3FRHA 2O25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO0 A;  2G3Q A;  2JY7 A;  5DFL A;  1TR8 A;  1HT2 E;  1WGL A;  1YLA A;  1T6O A;  4GEW A;  2BWB A;  1WIV A;  1VDL A;  4DBG B;  2OOA A;  2KNZ A;  2JY6 B;  2CWB A;  2OOB A;  4Q7J A;  1F4I A;  2QNJ A;  3F92 A;  3T6P A;  1OTR A;  2JY8 A;  1VEG A;  2JY5 A;  3GLF E;  2DAE A;  1EFU B;  3K9P A;  1DO2 A;  1MN3 A;  2DAM A;  1KYI A;  1WR1 B;  2BWE A;  2L2D A;  1E94 E;  1ZMW A;  2JP7 A;  1JR3 E;  3FRI A;  2EKK A;  2LVO C;  2JUJ A;  1TTE A;  1VEK A;  1P3Q Q;  3GLG E;  1G41 A;  3GLI E;  3H4J A;  1Y8G A;  1V92 A;  2DZL A;  1WHC A;  3FE3 A;  2ZTC A;  1OQY A;  3LCU A;  1OAI A;  3B89 A;  2JZ1 A;  1NV9 A;  3E21 A;  1WGN A;  1C7Y A;  1IXS A;  1QZE A;  2ZTD A;  4WP2 A;  2EKF A;  3GLH E;  1UFZ A;  1WJ7 A;  1GO5 A;  1DV0 A;  3MMP A;  1AIP C;  2DKL A;  2KNA A;  2EJS A;  1ZMU A;  2OO9 A;  2RRU A;  2L4E A;  2K9D A;  3IEC A;  2LVQ D;  2WZJ A;  3K9O A;  2DHY A;  1Q02 A;  3BBZ A;  1T43 A;  2HAK A;  1BVS A;  1ZV1 A;  2MRO B;  1HT1 E;  1G4A E;  2JZ0 A;  1VQ1 A;  4G3O A;  1PGY A;  2LVP C;  1A5T A;  1VEJ A;  3LCV B;  2QSF X;  3E46 A;  2K0B X;  2L4F A;  2DI0 A;  2KNV A;  1IFY A;  3IHP A;  2DEN A;  2LVA A;  1CUK A;  1SG9 A;  2DAK A;  2H5X A;  2MGW A;  2MR9 A;  1R4G A;  2LBC A;  1HJP A;  4UN2 B;  5JI2 E;  1VG5 A;  2KHH A;  1XXH E;  1OKS A;  2DAI A;  2LTU A;  2R0I A;  2JNH A;  4HEO A;  1G3I A;  4F1I A;  1XB2 B;  2QHO B;  1NV8 A;  2LVN C;  2MJ5 B;  4F2L A;  1IM2 A;  1ZMV A;  2HWJ A;  2CP8 A;  2DAG A;  4R71 A;  2DNA A;  1HQY E;  2B3T A;  3FRH A;  2O25 A; 
#chains in the Genus database with same CATH topology
 4IBF A;  1QQW A;  4JI8 M;  1GJT A;  5C18 A;  2KXE A;  1TR8 A;  1WGL A;  1X37 A;  2QBY B;  1T6O A;  2F4V M;  2Z3X A;  2RGO A;  4JI0 M;  3HHW A;  3R9X B;  2CHG A;  2OOA A;  2JY6 B;  3UMM A;  2JXN A;  3GQ3 A;  1V34 A;  1N75 A;  2QEN A;  3GPY A;  1AUA A;  2XZU A;  3T6P A;  2V1U A;  3SHF A;  4RF0 A;  1OTR A;  1IN4 A;  5JI3 E;  4JI1 M;  3UK6 A;  2JY5 A;  3W0L B;  5KPT A;  1DO2 A;  2ERC A;  3ZCB B;  4B7G A;  2J7O A;  2V1C A;  3CGW A;  3E9S A;  1GL6 A;  3FYD A;  4FW9 A;  4GC5 A;  4CJ6 A;  4DR4 M;  1E94 E;  2JP7 A;  3T15 A;  1JR3 E;  3B7Q A;  4Y28 F;  4B7H A;  1L2D A;  4GKJ M;  4X65 M;  3FYC A;  4NXM M;  5H37 D;  1P3Q Q;  3HJS A;  3GLG E;  3GLI E;  3TWM A;  4S12 A;  3M7G A;  2ZTC A;  1NHG C;  1OQY A;  2KZU A;  1OAI A;  2QCU A;  3AFH A;  3FUX A;  3LCU A;  4LZJ A;  3A42 A;  1GLN A;  1PJS A;  1C7Y A;  1QZE A;  1YUB A;  3LVV A;  4NOO B;  4D82 A;  4L6V 6;  3KXE C;  1TH2 A;  2N35 A;  3PFI A;  5IZ7 D;  3TL4 X;  2C98 A;  1DGG A;  1UFZ A;  4NSR A;  3C9P A;  3Q8G A;  4LJ8 A;  1MJG M;  4CGY B;  1NNU C;  4LJ7 A;  3J2P B;  4BBA A;  5KQD A;  4WUR A;  5KO3 A;  2JA2 A;  4G4O A;  2EJS A;  3GRR A;  3KP0 E;  2OO9 A;  1K82 A;  4AI6 A;  4W5W A;  2LVQ D;  2WZJ A;  3K9O A;  3QWL A;  1NNJ A;  4DR6 M;  4L8R C;  2J7N A;  3KOZ E;  1XNQ M;  4BB9 A;  1D0L A;  1IY2 A;  3MHV C;  4AKI A;  3R8F A;  3M6A A;  4LJ9 A;  4DR2 M;  4L78 A;  2HAK A;  2DVW B;  4CHT B;  3VKG A;  1HT1 E;  1G4A E;  4IJE A;  4AG5 A;  4LF9 M;  3KP1 E;  2DZO B;  3L2A A;  3NWL A;  3JAM S;  1ORY B;  3J27 B;  2LVP C;  5IRE B;  5FTL A;  3L29 A;  1W5S A;  5FTN A;  1IN6 A;  3I4V A;  5KPR A;  4HLQ A;  3HX3 A;  3LCV B;  2Y20 A;  4DV1 M;  3AOE C;  1OIP A;  4MM3 B;  2RGH A;  2Z4R A;  4LF7 M;  2CFO A;  3J81 S;  3SAS A;  1J5E M;  3OTO M;  4IBC A;  2H5X A;  2CV0 A;  2VQF M;  2LBC A;  3DFZ A;  3W67 A;  1JR3 D;  1D0M A;  4QNR A;  1XXH E;  2KW0 A;  4PD2 A;  3HHZ A;  3J80 S;  3FUW A;  2I7N A;  3HHY A;  3GRY A;  2AHM A;  5KPZ A;  4KO8 A;  2ZAO A;  4X66 M;  1D0K A;  1H6U A;  4GIP A;  2CUZ A;  4GH9 A;  1NJF A;  1XB2 B;  3C3E A;  5LMN M;  2C9O A;  1RU3 A;  3JR5 A;  2LVN C;  4KT0 F;  3RGS A;  4PT5 A;  1ZMV A;  4CIS A;  4II7 A;  1PM5 A;  3DA1 A;  2CV1 A;  1HQY E;  4DV0 M;  4D81 A;  1UM8 A;  4QOS A;  3UJN A;  1OFH A;  2VII A;  2HKJ A;  2WSE F;  4FD2 A;  4REZ A;  2OPF A;  1NO1 A;  2QQ8 A;  2LNH C;  4GEW A;  3WHL A;  3PNV A;  4AQY M;  3LW5 F;  3GPP A;  2LHC A;  1D2N A;  4DBG B;  3GO8 A;  3VK7 A;  3GQ5 A;  4B3S M;  3L25 A;  2A5Y B;  4K0K M;  1N33 M;  3U6M A;  2KDL A;  4NXN M;  4LF8 M;  4B3R M;  4LG2 A;  2ZBK B;  3D8L A;  3BXW A;  1OAO C;  4JI3 M;  3SC3 A;  3GLF E;  3CF0 A;  1N77 A;  2HCB A;  3QYB A;  2X4A A;  5E6J A;  1JR3 A;  1IN7 A;  1SXJ B;  2R6F A;  3KOX E;  1WR1 B;  4B3M M;  2XSZ D;  2NQ8 C;  2C9C A;  5EXX A;  1GJS A;  5EP4 A;  3SFZ A;  3E4R A;  1JQJ C;  2XLJ A;  3FRI A;  3GLI A;  5BPV A;  2EKK A;  3FTF A;  1IQP A;  1QZM A;  2UXC M;  2JUJ A;  2ZAN A;  4GIT A;  1TTE A;  4MGI E;  3EIE A;  4R3D A;  4IBI A;  4G4N A;  1DGF A;  3AOE A;  3B89 A;  2CHV A;  2JZ1 A;  3K8Z A;  1V33 A;  2KEB A;  1TH3 A;  2XGN A;  1Z6T A;  3B9P A;  4AG6 A;  3ZQJ A;  5F3W A;  3GLI B;  1Q3C A;  1PJJ A;  4G4Q A;  2ZTD A;  3HU1 A;  4NL4 H;  1IBK M;  1L1T A;  2YFQ A;  2BJW A;  4FVM A;  3SAT A;  2FS1 A;  1GO5 A;  1DV0 A;  3MMP A;  4GRI A;  5IWA M;  4PDI A;  3T1H M;  2O5R A;  3AKZ A;  1E9R A;  3I01 M;  1N32 M;  2DHY A;  3VK8 A;  3NBX X;  1GL7 A;  2R18 A;  4IBE A;  3H4M A;  2RKO A;  4LF5 M;  1FJG M;  3HU3 A;  1BVS A;  1XNR M;  1Z5C A;  1VDD A;  4OW0 A;  3THG A;  3SYK A;  2FH0 A;  4R7G A;  4A3V B;  5BR8 M;  1A5T A;  4QOZ C;  2R46 A;  4IBJ A;  3SMS A;  2FE8 A;  7CAT A;  3E46 A;  2K0B X;  2XSZ A;  3GLH A;  4MH0 E;  4P16 A;  1HNW M;  1N78 A;  1DGB A;  2DWL A;  2R4E A;  5FTM A;  4QHS A;  4EIW A;  3SAW A;  3IHP A;  3LMM A;  3EIH A;  5ITQ A;  2LXE A;  1R5L A;  2MR9 A;  3DOA A;  3U5Z A;  1GVN A;  3KW6 A;  3GPU A;  2XEP A;  4MGY E;  5EJC A;  1LTM A;  1IBL M;  1HJP A;  2P5T A;  3AOG A;  3CTW B;  4LJA A;  4NC6 A;  1XXH A;  2WSC F;  3GLH B;  4UN2 B;  3MK6 A;  2HL7 A;  5FSW A;  1EIJ A;  1I4W A;  2KHH A;  1IXR C;  3FUV A;  3PNY A;  4LGM A;  3VDP A;  2R45 A;  5ITY A;  3KSX A;  3SAV A;  3GRV A;  2UUB M;  2LTU A;  3U5Z B;  1XMQ M;  2LWX A;  2JNH A;  4MGK E;  3GPX A;  1G3I A;  1TH4 A;  4DR7 M;  1L2B A;  1TGU A;  3WHK A;  2KRK A;  1XXH B;  3KVW A;  1QAN A;  1DGH A;  2QHO B;  3DZD A;  3ZH9 B;  3KOW E;  1W5T A;  4F2L A;  1IM2 A;  1IN8 A;  2HWJ A;  3HWS A;  3GLF B;  4R71 A;  1N34 M;  1G71 A;  4PDG A;  2O25 A;  3TWK A;  5EP2 A;  4FWG A;  4NSO B;  1PJQ A;  2K47 A;  4JI5 M;  3U6P A;  1DGH B;  2G3Q A;  5DFL A;  3TE6 A;  2F5N A;  1HR0 M;  4LFB M;  2R62 A;  2FFJ A;  3VLF B;  1J09 A;  2QP9 X;  1Q3B A;  2BWB A;  2L09 A;  2UUA M;  4ZPX A;  5A2Q S;  1E9S A;  4KOD A;  3FTE A;  3SYL A;  5EP1 A;  4YY3 M;  4ITQ A;  3SMP A;  2OOB A;  4IIW A;  3HKP A;  1E32 A;  4P17 A;  1QDR A;  3HJQ A;  3RE8 A;  3GLF A;  5EXS A;  4X64 M;  2F5Q A;  4WW0 A;  4I81 A;  4LJ5 A;  5FTJ A;  4JYA M;  2DAE A;  3K9P A;  1NY5 A;  3C3D A;  4XGI A;  1MN3 A;  3HHX A;  2DAM A;  1KYI A;  2C99 A;  2BWE A;  3U60 A;  1I94 M;  2L2D A;  1L8Q A;  3B7Z A;  3HZJ A;  4M9Z A;  3TQS A;  1GKI A;  1OFI A;  4B08 A;  4L4U A;  2LVO C;  3AV0 A;  4JXJ A;  4LZZ A;  5EXP A;  1VEK A;  2QPA A;  2CHQ A;  4M0D A;  4RF1 A;  1WHC A;  3FE3 A;  5IT9 S;  4DUY M;  3V76 A;  4GC9 A;  1PRB A;  2KRU A;  4FWH A;  1NV9 A;  3E21 A;  2EO2 A;  1WGN A;  4LJ4 A;  4DV7 M;  2L6O A;  3AJI B;  4KLN A;  8CAT A;  2DHR A;  4FCV A;  4G6Z A;  5FTK A;  1NSF A;  1TDH A;  1NHW C;  3IG5 A;  5DNY A;  4JV5 M;  4WP2 A;  2EKF A;  3KSJ A;  3FUT A;  4XBO A;  3U61 A;  3A98 B;  1AIP C;  2V6Z M;  2F5P A;  1LV7 A;  3LQQ A;  5ITT A;  5ITU A;  1IY0 A;  1R2Y A;  2I7P A;  2K9D A;  3IEC A;  3A46 A;  1ZQ9 A;  5EXT A;  1QAO A;  4LF6 M;  1GAB A;  3GLG A;  1L2C A;  3MJ5 A;  2BJV A;  3UGJ A;  1T43 A;  2FNA A;  4DV6 M;  3U61 B;  4IBK A;  1QUS A;  2ZM6 M;  3C58 A;  4NRV A;  1PJI A;  4TUW A;  3L26 A;  2XH9 A;  5ITX E;  3GQ4 A;  5DYI A;  3SHG B;  2XFT A;  4B3T M;  3PVS A;  3GLG B;  2QSF X;  1N36 M;  5E26 A;  4M9S A;  1TF0 B;  2L4F A;  2KNV A;  4JI4 M;  2D7H A;  1IFY A;  2R44 A;  3SAU A;  4ANR A;  2DEN A;  2UU9 M;  3K92 A;  4IBB A;  1CUK A;  4JI2 M;  2DAK A;  2R4J A;  4GHA A;  2EUC A;  1OJL A;  3U6C A;  1R4G A;  4G4R A;  2JWS A;  2LH0 A;  2E5L M;  4LFC M;  4I4L A;  2HHH M;  5C1B A;  3HJ8 A;  4L16 A;  5JI2 E;  3RFW A;  3GRU A;  1FNN A;  4LFA M;  1QDT A;  3LQR A;  1OKS A;  2DAI A;  1Z5A A;  3B7N A;  5GKN A;  3U6O A;  1R2Z A;  2R0I A;  4HEO A;  2CRU A;  1SXJ E;  3QAU A;  4KHP M;  1C1K A;  3W68 A;  4OVZ A;  4I8O A;  4I5S A;  3HGI A;  1MX0 A;  4BLC A;  1NV8 A;  2KZS A;  3FKE A;  3K2L A;  2MJ5 B;  1G59 A;  1QUT A;  2DAG A;  3BOS A;  3ILK A;  4LRT A;  3SAR A;  1T3T A;  4M0W A;  3FRH A;  2Z8Y M;  3L28 A;  2F5S A;  1G8P A;  1K3W A;  4OVZ B;  1IY1 A;  2M5Z A;  1DO0 A;  2JY7 A;  1QVR A;  1WXQ A;  3D8B A;  1YLA A;  1HT2 E;  3PXG A;  2W82 A;  2VDB B;  2H1R A;  1WIV A;  2GNO A;  3JR4 A;  1VDL A;  2KNZ A;  2R65 A;  4Z8X A;  2CWB A;  4Q7J A;  1F4I A;  2MH8 A;  3QYE A;  4XK8 F;  4PCZ A;  4AKH A;  4GMQ A;  2QNJ A;  3F92 A;  3SBJ A;  1SXJ C;  4IBG A;  2C5R A;  1J7K A;  1K3X A;  3U6Q A;  2JY8 A;  1VEG A;  4YHH M;  3T38 A;  1R6B X;  2YR0 A;  1EFU B;  4DR3 M;  3KS8 A;  3CF6 E;  2YNM D;  1OIZ A;  3TPZ A;  4X62 M;  3Q8X A;  4IBD A;  1ZMW A;  3FD9 A;  1XHB A;  1YE9 A;  4MGH A;  2FOI C;  1Z5B A;  2O01 F;  1HNZ M;  1NY6 A;  2VF7 A;  3GP1 A;  1G41 A;  2APL A;  3H4J A;  1XMO M;  1TDZ A;  2Z7J A;  1Y8G A;  1V92 A;  2DZL A;  2EA0 A;  2UXD M;  3VKH A;  3I04 M;  2KA6 B;  1JB0 F;  1Q39 A;  3I51 A;  3T1Y M;  2VF8 A;  2Y0T A;  1KFV A;  1IXZ A;  1MU5 A;  2LHG A;  1NVM A;  4QNM A;  4OX9 M;  1IXS A;  2Q2E B;  2YQZ A;  5L8R F;  4AKG A;  4L15 A;  1EE8 A;  3CF2 A;  3IG8 A;  1HNX M;  1SXJ D;  4DV3 M;  3FTD A;  5KQ8 A;  3W0F A;  4FCT A;  3GLH E;  4AW4 A;  1WJ7 A;  3L27 A;  4RNA A;  4OU7 A;  1YSY A;  2DKL A;  2KNA A;  3J7A S;  2D7G A;  2DZN B;  1ZMU A;  2XZF A;  2RRU A;  2L4E A;  3FTC A;  5DYG A;  3UZU A;  4DR5 M;  2CEA A;  1IXS B;  2OQ4 A;  4MB7 A;  3U6L A;  3KDS E;  2DXI A;  2UUC M;  1QAM A;  3AL0 C;  2Y21 A;  4GHL A;  2XFS A;  1Q02 A;  2BNK A;  2D7E A;  2M60 A;  1R7R A;  2X49 A;  1KSF X;  2Z4S A;  3BBZ A;  3VDU A;  4HL4 A;  4AZF A;  1QYR A;  2J5Y A;  4MGZ E;  5ITX A;  5EP3 A;  1ZV1 A;  2MRO B;  4LCB A;  4LJ6 A;  4B7F A;  2VQE M;  1S3S A;  1HQC A;  3KOY E;  1L1Z A;  3TWL A;  2JZ0 A;  1VQ1 A;  1Z59 A;  1PGY A;  3K1J A;  4G3O A;  3U60 B;  4RKU F;  2DWZ B;  3U6E A;  1VEJ A;  4DV4 M;  1NJG A;  2K6B A;  2X8A A;  4FWD A;  4LGY A;  3HU2 A;  2DI0 A;  4DUZ M;  3I4Y A;  3LVW A;  1IN5 A;  2DWM A;  2LVA A;  1SG9 A;  2WSF F;  4QHT A;  2MGW A;  3KS4 A;  2G5G X;  5ITR A;  4GKK M;  2L7I A;  3U6S A;  4LF4 M;  4CIZ A;  2L7H A;  1XC8 A;  1VG5 A;  2DWN A;  5FLX S;  2XF3 A;  3NBI A;  4D80 A;  3A45 A;  3VFD A;  2F5O A;  1SXJ A;  4JI6 M;  4M9X A;  1IBM M;  1XWI A;  2G8L A;  4IJF A;  3M0E A;  2ZAM A;  4LY6 A;  3HY5 A;  3RGP A;  3KFU G;  4DV2 M;  3B74 A;  4F1I A;  4DV5 M;  4LRS A;  4JI7 M;  4FCW A;  2CV2 A;  3U6D A;  4NRW A;  3ZC7 B;  5EQT A;  2QBY A;  1PJT A;  1ZAE A;  2Y0Q A;  3J7B A;  2UXB M;  4Z6Y A;  2QZ4 A;  2C96 A;  2CP8 A;  2GQF A;  4JN6 A;  2DNA A;  4DR1 M;  5LMU M;  2B3T A;  2CE7 A;  3FUU A;  1QAQ A; 
#chains in the Genus database with same CATH homology
 1DO0 A;  2G3Q A;  2JY7 A;  5DFL A;  1TR8 A;  1HT2 E;  1WGL A;  1YLA A;  1T6O A;  4GEW A;  2BWB A;  1WIV A;  1VDL A;  4DBG B;  2OOA A;  2KNZ A;  2JY6 B;  2CWB A;  2OOB A;  4Q7J A;  1F4I A;  2QNJ A;  3F92 A;  3T6P A;  1OTR A;  2JY8 A;  1VEG A;  2JY5 A;  3GLF E;  2DAE A;  1EFU B;  3K9P A;  1DO2 A;  1MN3 A;  2DAM A;  1KYI A;  1WR1 B;  2BWE A;  2L2D A;  1E94 E;  1ZMW A;  2JP7 A;  1JR3 E;  3FRI A;  2EKK A;  2LVO C;  2JUJ A;  1TTE A;  1VEK A;  1P3Q Q;  3GLG E;  1G41 A;  3GLI E;  3H4J A;  1Y8G A;  1V92 A;  2DZL A;  1WHC A;  3FE3 A;  2ZTC A;  1OQY A;  3LCU A;  1OAI A;  3B89 A;  2JZ1 A;  1NV9 A;  3E21 A;  1WGN A;  1C7Y A;  1IXS A;  1QZE A;  2ZTD A;  4WP2 A;  2EKF A;  3GLH E;  1UFZ A;  1WJ7 A;  1GO5 A;  1DV0 A;  3MMP A;  1AIP C;  2DKL A;  2KNA A;  2EJS A;  1ZMU A;  2OO9 A;  2RRU A;  2L4E A;  2K9D A;  3IEC A;  2LVQ D;  2WZJ A;  3K9O A;  2DHY A;  1Q02 A;  3BBZ A;  1T43 A;  2HAK A;  1BVS A;  1ZV1 A;  2MRO B;  1HT1 E;  1G4A E;  2JZ0 A;  1VQ1 A;  4G3O A;  1PGY A;  2LVP C;  1A5T A;  1VEJ A;  3LCV B;  2QSF X;  3E46 A;  2K0B X;  2L4F A;  2DI0 A;  2KNV A;  1IFY A;  3IHP A;  2DEN A;  2LVA A;  1CUK A;  1SG9 A;  2DAK A;  2H5X A;  2MGW A;  2MR9 A;  1R4G A;  2LBC A;  1HJP A;  4UN2 B;  5JI2 E;  1VG5 A;  2KHH A;  1XXH E;  1OKS A;  2DAI A;  2LTU A;  2R0I A;  2JNH A;  4HEO A;  1G3I A;  4F1I A;  1XB2 B;  2QHO B;  1NV8 A;  2LVN C;  2MJ5 B;  4F2L A;  1IM2 A;  1ZMV A;  2HWJ A;  2CP8 A;  2DAG A;  4R71 A;  2DNA A;  1HQY E;  2B3T A;  3FRH A;  2O25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...