1K3WA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
254
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 81
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3wA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3wA01
4NRWA 4JI8M 2UXBM 3W0FA 2XZUA 2UUBM 4PD2A 1EE8A 4LF5M 2F5NA 3A42A 3J80S 5ITQA 4AQYM 4DV5M 1TDHA 3SASA 4JI5M 3GPUA 5LMNM 1IBMM 2UXCM 1Z5AA 4DV3M 4LFAM 3U6LA 1IBKM 2F5PA 3U6MA 4JV5M 4DR2M 4MB7A 1L1TA 4LF9M 5ITYA 4B3SM 1FJGM 4GKJM 3JR5A 4DR7M 4KHPM 5ITXE 3T1YM 1N32M 4PCZA 4X65M 3U6QA 3A45A 1MU5A 4G4RA 2HKJA 2XZFA 1L2BA 5ITTA 4YY3M 3SARA 4DR5M 1PJIA 3SATA 2UUAM 1Q3CA 5ITUA 3GQ3A 4X64M 4LF8M 1N34M 1KFVA 3C58A 3SAVA 4DR4M 3TWKA 1K3WA 5BR8M 2VQFM 4DUZM 4DV7M 2OQ4A 4G4OA 1HNZM 4LFBM 1N33M 1PJJA 1XC8A 4JYAM 3GPXA 3T1HM 1XMOM 3U6EA 4PDGA 3U6DA 1K82A 1L2DA 3GQ5A 4JI7M 3J7AS 4JI6M 3J81S 4G4QA 1MX0A 3DOAA 3SAUA 1XNRM 4ITQA 4PDIA 1HNXM 3GP1A 3VK7A 4DV1M 1PM5A 2UU9M 4LF6M 1XMQM 2HHHM 4DR1M 3SAWA 3A46A 3OTOM 2F5QA 3U6CA 4LF7M 4NXMM 3GPYA 1Q39A 4NXNM 1HR0M 2E5LM 1R2ZA 3U6SA 3VK8A 1I94M 4LF4M 3U6OA 1N36M 1NNJA 5ITXA 4GKKM 4DV4M 1TDZA 1Q3BA 4JI0M 4B3TM 1L1ZA 5FLXS 1XNQM 4DR6M 4DUYM 3SBJA 2F5OA 5ITRA 3GQ4A 1HNWM 4X66M 2ZBKB 5A2QS 4DV6M 2VQEM 4JI3M 2Q2EB 4G4NA 3GO8A 4B3RM 4YHHM 4X62M 3GPPA 1IBLM 4NRVA 5IT9S 3JAMS 4DV2M 2F4VM 1Z5BA 4OX9M 4DV0M 4LFCM 3TWLA 2ZM6M 5IWAM 1Z5CA 4CISA 4JI2M 1K3XA 2OPFA 4JI4M 5LMUM 1Z59A 3U6PA 1J5EM 4K0KM 2UXDM 1R2YA 1L2CA 2F5SA 4JI1M 4B3MM 3TWMA 2UUCM 3JR4A 2EA0A 4DR3M
chains in the Genus database with same CATH superfamily
1DGHA 2O5RA 4NRWA 2QNJA 1DO2A 2XZUA 2JUJA 2UUBM 2UXBM 2H5XA 4PD2A 1WJ7A 2F5NA 4LF5M 5EQTA 4I8OA 1LTMA 4AQYM 3KS8A 4CIZA 2XSZD 2Y0TA 5LMNM 3GLFB 1D0LA 1ZV1A 3U6LA 3SMSA 4LGMA 2LNHC 1IFYA 2KW0A 3DA1A 2CV2A 4MB7A 4B3SM 3LW5F 4IJFA 3GLGA 5EP3A 4IBCA 3T1YM 4PCZA 1F4IA 1OTRA 3RGPA 2EO2A 5FTJA 4R71A 3PVSA 1MU5A 4G6ZA 2Z4SA 3H4JA 3FRHA 4I81A 4QNRA 1EIJA 2KHHA 3W0LB 1A5TA 3HJQA 4HLQA 4LJ7A 1CUKA 1NHWC 3SARA 4CJ6A 4GHAA 3GQ3A 4M0DA 3KP0E 4LF8M 2LVQD 4IBBA 2Y20A 2EKKA 3J2PB 1IN4A 1DO0A 2N35A 5DYGA 4LRTA 2YNMD 4AI6A 3B9PA 2DZOB 4D80A 5BR8M 4DUZM 2LVAA 2XH9A 3B89A 3GLHA 3T15A 4M0WA 4G4OA 1HNZM 2LVPC 2DWMA 2R62A 3HY5A 1N33M 1R7RA 4QOZC 3U5ZA 4LJ9A 1E94E 3B74A 1G8PA 2P5TA 3FTCA 1WXQA 3U6DA 4RNAA 3HHWA 1JR3D 2ZANA 3E21A 1HQYE 3GLHB 3SAUA 4ITQA 2D7EA 2JY8A 1HNXM 1OIZA 4D81A 3FTFA 3VK7A 1PM5A 4M9XA 2UU9M 4L78A 3LVWA 3ZQJA 2HHHM 4AKIA 1IXRC 3AOEC 4LY6A 1IN5A 3ZCBB 3A46A 3E46A 5E6JA 4NXMM 2OOAA 2XEPA 2YQZA 2CHVA 3U6SA 3LQQA 3L25A 4GHLA 4M9SA 3VK8A 4LF4M 1R6BX 3KP1E 3K9PA 5EP4A 2YFQA 5FTKA 3KXEC 5KPRA 4GKKM 3I04M 1NJFA 3J27B 1X37A 1P3QQ 2M5ZA 3FUTA 3SBJA 1OKSA 1QQWA 3HJ8A 3HU1A 4MGKE 3GQ4A 4X66M 1GO5A 2L6OA 1QAOA 2ZBKB 3IECA 3BBZA 2QQ8A 3AOEA 2C5RA 1TR8A 3Q8XA 1PJQA 2CV1A 2GNOA 3E9SA 3L28A 4NRVA 1G3IA 5EXXA 2KRUA 3FRIA 2F4VM 2LHCA 1OIPA 4OX9M 3UGJA 3E4RA 4B7GA 3FE3A 2ZM6M 4ZPXA 1K3XA 4BB9A 2KZUA 4LJ6A 1SG9A 3RGSA 3U6PA 1Z59A 4EIWA 2RRUA 5H37D 2UXDM 1Y8GA 1L2CA 2F5SA 2J5YA 2HCBA 2OO9A 1G59A 5GKNA 2Y21A 2DNAA 2EA0A 1NJGA 1VDLA 1AIPC 3QWLA 4WP2A 4JI8M 1JB0F 3AV0A 3KDSE 4FCTA 4KO8A 3U60A 1NY6A 3SMPA 3J80S 1OFIA 3UK6A 4DV5M 4Z6YA 1WIVA 2L4EA 3EIHA 2WSEF 4MH0E 4P16A 4AG6A 1Q02A 4HEOA 3GPUA 4JI5M 3KOXE 4OU7A 3ZH9B 3KOWE 1R4GA 3UMMA 4FWGA 1ZAEA 1XHBA 1SXJC 3WHLA 2Z8YM 3U6MA 1NY5A 4JV5M 1HQCA 3AL0C 2XFSA 3VDPA 5ITYA 2LWXA 3CF0A 3HJSA 3W67A 2DZNB 3LVVA 3JR5A 2EKFA 1GL6A 5ITXE 4KHPM 1VQ1A 4W5WA 3FKEA 3A45A 1OFHA 4MGHA 4M9ZA 2HKJA 2XZFA 1NV8A 3KSJA 1VEKA 3MJ5A 1Z6TA 3LCUA 4YY3M 5ITTA 2APLA 3GRYA 4LGYA 1DV0A 4QHSA 1N34M 1IN7A 2Z4RA 2R4EA 4GIPA 3C58A 3VKGA 3TE6A 1EFUB 3SHGB 2LBCA 1K3WA 1SXJA 1PJSA 2H1RA 3QYBA 1V92A 1DGHB 4F1IA 2K9DA 3KS4A 1W5TA 2V1UA 1VEGA 2CE7A 3B7QA 1J09A 1PJJA 3MHVC 1TH4A 1TGUA 1XMOM 2R46A 3KSXA 1K82A 2NQ8C 3SC3A 1SXJB 3M6AA 1NV9A 4AW4A 3K2LA 2FFJA 1DGFA 4RF0A 1C1KA 3DOAA 2I7PA 4PDIA 2LH0A 1NHGC 3AOGA 1C7YA 1QANA 1TF0B 3GP1A 4DBGB 4LJ5A 3D8LA 3FD9A 4MM3B 3GLGB 1XMQM 1LV7A 5FSWA 3SAWA 4BBAA 3U6CA 4BLCA 3K8ZA 2FNAA 2WSFF 3IHPA 4NXNM 3PNVA 4GC9A 2E5LM 4FWHA 1N78A 2L09A 1XXHE 2X49A 3EIEA 1ZMWA 1N36M 1NNJA 3GLHE 5DYIA 1IM2A 3CF6E 2C96A 3T6PA 2HAKA 1GLNA 1TDZA 4B3TM 1L1ZA 5FLXS 1XNQM 5E26A 3FYCA 3SYLA 5EXTA 3AJIB 2R6FA 3HU2A 5ITRA 2MH8A 1HT2E 3K1JA 1QUTA 4II7A 1H6UA 2JA2A 3ILKA 4DV6M 2VQEM 3U5ZB 5F3WA 3CTWB 2DZLA 4NC6A 5EP1A 1IY0A 1PRBA 2Q2EB 1NVMA 4NOOB 7CATA 3SASA 1QDRA 2DAGA 1GJSA 2CV0A 2L7IA 3CF2A 2DHRA 2AHMA 2FOIC 2X4AA 1E9RA 1IN8A 3GRUA 1OJLA 3HHZA 1HJPA 3JAMS 4DV2M 2BWEA 1Z5BA 4Y28F 3KW6A 2DAKA 1T3TA 2BWBA 1QUSA 2LXEA 1Z5CA 4GMQA 3HWSA 2RKOA 5LMUM 4R3DA 3QYEA 3FUWA 1R2YA 3K9OA 1E9SA 1SXJD 1UFZA 3I51A 4B3MM 1IY2A 2MR9A 4IJEA 1DGBA 2DI0A 2MROB 2QP9X 2UUAM 3I4VA 3C9PA 5EP2A 1PJTA 3U61A 1EE8A 1GVNA 3A42A 5ITQA 2RGOA 1QAQA 4LCBA 4CGYB 4MGYE 1D2NA 4I5SA 3HU3A 2WZJA 2ZAOA 1IBMM 2KRKA 4IBKA 1HT1E 1Z5AA 4FD2A 4LFAM 4DV3M 3R8FA 3M7GA 1E32A 3D8BA 2C9OA 3U61B 2ERCA 1L8QA 4I4LA 5DNYA 2Z7JA 4IBIA 4DR2M 4FWDA 1S3SA 2ZTDA 1L1TA 1D0MA 3B7NA 4KODA 2I7NA 4GKJM 2VIIA 4REZA 4OVZA 2CHGA 5KQ8A 2LVOC 3M0EA 3GLIE 4X65M 3U6QA 2HL7A 2XF3A 3LCVB 1FNNA 2L7HA 3UZUA 1QZMA 3I01M 2V1CA 4MGIE 2QBYA 4OVZB 1N75A 1PJIA 3SATA 2CFOA 3HKPA 5ITUA 4KLNA 2KEBA 3PXGA 4RKUF 2VF7A 2M60A 3F92A 4X64M 4AKHA 3MMPA 5C1BA 4G3OA 4DR4M 1ORYB 4HL4A 3A98B 3TWKA 3FYDA 1DGGA 2QBYB 1JR3E 2W82A 2LVNC 2VQFM 4LFBM 1T6OA 2D7GA 3U60B 2ZTCA 4NSRA 1BVSA 2YR0A 3LMMA 3GPXA 3J7AS 4RF1A 4PDGA 3GQ5A 4JI7M 3R9XB 2VDBB 4FCVA 4JI6M 1MX0A 1XNRM 2BJWA 1NSFA 1OAOC 1NO1A 1TH2A 1VG5A 1ZMVA 3PNYA 3RFWA 3GLFE 2DWNA 3C3EA 1IY1A 3T38A 4Q7JA 3J7BA 2F5QA 3GRVA 3NWLA 4S12A 3ZC7B 5KQDA 2JZ1A 1Q39A 2MJ5B 3L29A 4XGIA 1HR0M 1R2ZA 4IIWA 2JY7A 4L16A 1I94M 3HHXA 3L2AA 3Q8GA 3U6OA 2CRUA 5ITXA 2D7HA 2JZ0A 1JQJC 3L27A 4DV4M 2JY6B 4JI0M 3HGIA 3GLGE 4L8RC 2K6BA 2R4JA 3V76A 4DUYM 3CGWA 4XK8F 4AKGA 3FTEA 1TTEA 3NBIA 1ZQ9A 2L4FA 5A2QS 2GQFA 4WW0A 4JI3M 3KOYE 3QAUA 1J7KA 2G8LA 1TH3A 4P17A 3THGA 4LZJA 4G4NA 2WSCF 1ZMUA 3W68A 3GO8A 4B3RM 1XB2B 4YHHM 4OW0A 5EXPA 1OQYA 1IN6A 1IBLM 2BNKA 5IT9S 3AKZA 1MN3A 1V33A 1QDTA 3FTDA 2QSFX 3IG8A 3FUXA 1WR1B 2QZ4A 2R0IA 3IG5A 1V34A 4L6V6 2HWJA 1QVRA 1D0KA 4B7FA 5IWAM 4CISA 4QNMA 5KPTA 2OPFA 2XFTA 1GJTA 1IQPA 1R5LA 2BJVA 2J7OA 5EXSA 1WGNA 4JI1M 2Z3XA 1PGYA 4NL4H 3TWMA 3SFZA 4JN6A 2EJSA 2A5YB 2CWBA 1L2DA 2DWZB 3DZDA 2QCUA 4FVMA 3W0FA 2MGWA 3BXWA 3VKHA 1TDHA 1YLAA 4CHTB 2K47A 4GC5A 2UXCM 1KSFX 3UJNA 4GH9A 1XXHA 4GEWA 1IBKM 1I4WA 2F5PA 1GABA 4Z8XA 2DKLA 3VDUA 5JI2E 4IBGA 1KYIA 4LF9M 1FJGM 2G3QA 1YUBA 2XLJA 4IBEA 3NBXX 1YSYA 3VFDA 1XXHB 4QHTA 4PT5A 4DR7M 1N32M 4JXJA 2DWLA 5KPZA 2V6ZM 5BPVA 1N77A 4G4RA 2CP8A 1L2BA 1MJGM 2KDLA 2KNVA 3L26A 2R44A 2R45A 2Y0QA 1UM8A 1IXSA 1G41A 5EJCA 4DR5M 1Q3CA 2CEAA 8CATA 2OOBA 4LJ4A 4NSOB 4QOSA 4AG5A 1KFVA 2DVWB 3SAVA 2EUCA 2C98A 2K0BX 1IXSB 3AFHA 5KO3A 4DV7M 2OQ4A 3TL4X 4IBDA 4A3VB 4UN2B 4IBJA 3GRRA 2L2DA 1XC8A 2KNAA 4JYAM 2CHQA 1YE9A 4ANRA 3T1HM 3B7ZA 3KVWA 3U6EA 3SHFA 3DFZA 2LTUA 3KFUG 2DAEA 3MK6A 2XSZA 3BOSA 3J81S 4G4QA 2VF8A 4FW9A 1NNUC 1XWIA 1GL7A 2JY5A 4F2LA 4GITA 4LJ8A 4MGZE 2R65A 3TPZA 3I4YA 4DV1M 4LF6M 1G71A 2DAIA 1QAMA 2RGHA 4DR1M 5L8RF 1T43A 2DENA 4D82A 3OTOM 1AUAA 2X8AA 4LF7M 3FUUA 2DHYA 4R7GA 3GPYA 2KZSA 3H4MA 3RE8A 4LJAA 2O25A 3HZJA 3KOZE 4B08A 1VDDA 2JWSA 4LZZA 2C99A 2FS1A 1RU3A 3GLIA 1OAIA 1Q3BA 4KT0F 1G4AE 2J7NA 2DAMA 2O01F 3C3DA 4DR6M 1QYRA 2F5OA 1VEJA 5JI3E 3WHKA 1GKIA 1QZEA 2XGNA 2G5GX 1HNWM 1WGLA 2KXEA 4WURA 2ZAMA 1W5SA 3GLIB 2C9CA 5FTLA 4FCWA 2QPAA 2R18A 4GRIA 2JNHA 2FE8A 3HX3A 3HHYA 5FTNA 2LHGA 3LQRA 5IZ7D 4LRSA 4L4UA 3K92A 3PFIA 3TQSA 2JP7A 1JR3A 1WHCA 3VLFB 4X62M 3GPPA 4IBFA 5DFLA 4B7HA 2DXIA 5C18A 1SXJE 2FH0A 4DV0M 4LG2A 4LFCM 5IREB 3TWLA 2JXNA 4JI2M 2KNZA 2QHOB 4JI4M 2CUZA 2KA6B 4AZFA 1J5EM 4K0KM 4L15A 3FUVA 5FTMA 4XBOA 4TUWA 1IXZA 2B3TA 3GLFA 2UUCM 3SYKA 3JR4A 2QENA 4DR3M
chains in the Genus database with same CATH topology
1DGHA 2O5RA 4NRWA 2UXBM 1DO2A 2XZUA 2UUBM 4AKIA 4PD2A 4LF5M 2F5NA 5EQTA 4I8OA 4AQYM 3KS8A 2XSZD 2Y0TA 5LMNM 3GLFB 3U6LA 3SMSA 4LGMA 2LNHC 2KW0A 3DA1A 2CV2A 4MB7A 4B3SM 4IJFA 3GLGA 5EP3A 4IBCA 3T1YM 4PCZA 3RGPA 2EO2A 5FTJA 3PVSA 1MU5A 4G6ZA 2Z4SA 4QNRA 4I81A 3W0LB 3HJQA 4HLQA 4LJ7A 1NHWC 3SARA 4GHAA 3GQ3A 4M0DA 3KP0E 4LF8M 4IBBA 2Y20A 3J2PB 1IN4A 1DO0A 5DYGA 4LRTA 2YNMD 4AI6A 3B9PA 2DZOB 4D80A 5BR8M 4DUZM 4G4OA 2XH9A 1HNZM 3GLHA 3T15A 4M0WA 2DWMA 2R62A 1N33M 1R7RA 4QOZC 3U5ZA 4LJ9A 1E94E 1G8PA 2P5TA 3FTCA 1WXQA 3U6DA 4RNAA 3HHWA 1JR3D 2ZANA 1HQYE 3GLHB 3SAUA 4ITQA 2D7EA 1HNXM 4D81A 3FTFA 3VK7A 1PM5A 4M9XA 2UU9M 4L78A 3LVWA 2HHHM 1IXRC 3AOEC 4LY6A 1IN5A 3ZCBB 3A46A 5E6JA 4NXMM 2XEPA 2YQZA 2CHVA 3U6SA 3LQQA 3L25A 4GHLA 4M9SA 3VK8A 4LF4M 1R6BX 3KP1E 5EP4A 2YFQA 5FTKA 3KXEC 5KPRA 4GKKM 1NJFA 3J27B 1X37A 2M5ZA 3FUTA 3SBJA 3HJ8A 1QQWA 3HU1A 4MGKE 3GQ4A 4X66M 2L6OA 1QAOA 2ZBKB 3AOEA 2C5RA 3Q8XA 2CV1A 3E9SA 3L28A 4NRVA 1G3IA 5EXXA 2KRUA 2F4VM 4OX9M 3UGJA 3E4RA 4B7GA 2ZM6M 4ZPXA 1K3XA 4BB9A 2KZUA 4LJ6A 3RGSA 3U6PA 1Z59A 4EIWA 2UXDM 5H37D 1L2CA 2F5SA 2HCBA 1G59A 5GKNA 2Y21A 2EA0A 1NJGA 3QWLA 4JI8M 3AV0A 3KDSE 4FCTA 4KO8A 3U60A 1NY6A 3SMPA 3J80S 1OFIA 3UK6A 4DV5M 4Z6YA 4AG6A 3EIHA 4MH0E 3SASA 4P16A 3GPUA 4JI5M 3KOXE 4OU7A 3ZH9B 3KOWE 3UMMA 4FWGA 1ZAEA 1XHBA 1SXJC 3WHLA 3U6MA 4JV5M 1NY5A 1HQCA 3AL0C 2XFSA 3VDPA 5ITYA 2LWXA 3CF0A 3HJSA 3JR5A 2DZNB 3LVVA 4KHPM 5ITXE 1GL6A 4W5WA 3FKEA 3A45A 1OFHA 4MGHA 4M9ZA 2HKJA 2XZFA 3KSJA 3MJ5A 1Z6TA 5ITTA 4YY3M 3GRYA 4LGYA 4QHSA 1N34M 1IN7A 2Z4RA 2R4EA 4GIPA 3C58A 3VKGA 3TE6A 3SHGB 1K3WA 1SXJA 2H1RA 1DGHB 3KS4A 1W5TA 2V1UA 2CE7A 1J09A 1PJJA 3MHVC 1TH4A 1TGUA 1XMOM 2R46A 3KSXA 1K82A 2NQ8C 3SC3A 1SXJB 3M6AA 4AW4A 3K2LA 2FFJA 1DGFA 4RF0A 1C1KA 3DOAA 2I7PA 4PDIA 1NHGC 2LH0A 3AOGA 1QANA 3GP1A 4LJ5A 3D8LA 3FD9A 4MM3B 3GLGB 1XMQM 1LV7A 5FSWA 3SAWA 4BBAA 3U6CA 4BLCA 3K8ZA 2FNAA 4NXNM 3PNVA 4GC9A 2E5LM 4FWHA 1N78A 2L09A 2X49A 3EIEA 1N36M 1NNJA 5DYIA 1IM2A 3CF6E 2C96A 1TDZA 1GLNA 4B3TM 1L1ZA 5FLXS 1XNQM 5E26A 3FYCA 3SYLA 5EXTA 3AJIB 3HU2A 5ITRA 1HT2E 3K1JA 4II7A 1H6UA 2JA2A 3ILKA 4DV6M 2VQEM 3U5ZB 5F3WA 3CTWB 5EP1A 1IY0A 2Q2EB 1NVMA 4NOOB 7CATA 2CV0A 2L7IA 3CF2A 2DHRA 2AHMA 2FOIC 2X4AA 1E9RA 1IN8A 3GRUA 1OJLA 3HHZA 3JAMS 4DV2M 1Z5BA 3KW6A 1T3TA 4GMQA 2LXEA 1Z5CA 3HWSA 2RKOA 5LMUM 4R3DA 3FUWA 1R2YA 1E9SA 1SXJD 3I51A 4B3MM 1IY2A 4IJEA 1DGBA 2QP9X 2UUAM 3I4VA 5EP2A 3U61A 1EE8A 1GVNA 3A42A 5ITQA 2RGOA 1QAQA 4LCBA 4CGYB 4MGYE 1D2NA 4I5SA 3HU3A 2ZAOA 1IBMM 2KRKA 4IBKA 1HT1E 1Z5AA 4FD2A 4LFAM 4DV3M 3R8FA 3M7GA 1E32A 3D8BA 2C9OA 3U61B 2ERCA 1L8QA 4I4LA 5DNYA 2Z7JA 4IBIA 4DR2M 4FWDA 1S3SA 1L1TA 4KODA 2I7NA 4GKJM 2VIIA 4REZA 4OVZA 2CHGA 5KQ8A 3M0EA 4X65M 3U6QA 2HL7A 2XF3A 1FNNA 2L7HA 3UZUA 1QZMA 2V1CA 4MGIE 2QBYA 4OVZB 1N75A 1PJIA 3SATA 2CFOA 3HKPA 5ITUA 4KLNA 2KEBA 3PXGA 4X64M 2M60A 4AKHA 5C1BA 4DR4M 1ORYB 4HL4A 3A98B 3TWKA 3FYDA 1DGGA 2QBYB 2W82A 2VQFM 4LFBM 2D7GA 3U60B 4NSRA 2YR0A 3LMMA 3GPXA 3J7AS 4RF1A 4PDGA 3GQ5A 4JI7M 3R9XB 4JI6M 4FCVA 1MX0A 1XNRM 2BJWA 1NSFA 1TH2A 3RFWA 3PNYA 2DWNA 1IY1A 3T38A 3J7BA 2F5QA 3GRVA 3NWLA 4S12A 3ZC7B 5KQDA 1Q39A 3L29A 4XGIA 1HR0M 1R2ZA 4IIWA 4L16A 1I94M 3HHXA 3L2AA 3U6OA 5ITXA 2D7HA 3L27A 1JQJC 4DV4M 4JI0M 3HGIA 4L8RC 4DUYM 2R4JA 4AKGA 3FTEA 3NBIA 1ZQ9A 5A2QS 4WW0A 4JI3M 3KOYE 3QAUA 1J7KA 2G8LA 1TH3A 3THGA 4LZJA 4G4NA 3GO8A 4B3RM 4YHHM 4OW0A 5EXPA 1IN6A 1IBLM 2BNKA 5IT9S 3AKZA 3FTDA 3IG8A 3FUXA 2QZ4A 3IG5A 1QVRA 4B7FA 5IWAM 4CISA 4QNMA 5KPTA 2OPFA 2XFTA 1IQPA 2BJVA 2J7OA 5EXSA 4JI1M 2Z3XA 4NL4H 3TWMA 3SFZA 4JN6A 2A5YB 1L2DA 2DWZB 3DZDA 2QCUA 4FVMA 3W0FA 3VKHA 1TDHA 4CHTB 2K47A 4GC5A 2UXCM 1KSFX 3UJNA 4GH9A 1XXHA 1IBKM 2F5PA 1I4WA 4Z8XA 3VDUA 5JI2E 4IBGA 1KYIA 4LF9M 1FJGM 1YUBA 2XLJA 4IBEA 4DR7M 1YSYA 3VFDA 1XXHB 4QHTA 4PT5A 1N32M 4JXJA 2DWLA 5KPZA 2V6ZM 5BPVA 1N77A 4G4RA 1L2BA 3L26A 2R45A 2Y0QA 1UM8A 1G41A 5EJCA 4DR5M 1Q3CA 2CEAA 8CATA 4LJ4A 4AG5A 4NSOB 4QOSA 1KFVA 2DVWB 3SAVA 2EUCA 2C98A 1IXSB 3AFHA 5KO3A 4DV7M 2OQ4A 3TL4X 4IBDA 4A3VB 4IBJA 3GRRA 1XC8A 4JYAM 2CHQA 1YE9A 3T1HM 3KVWA 3U6EA 3SHFA 3DFZA 3KFUG 3MK6A 2XSZA 3BOSA 3J81S 4G4QA 4FW9A 1NNUC 1XWIA 1GL7A 4GITA 4LJ8A 4MGZE 2R65A 3TPZA 3I4YA 4DV1M 4LF6M 1QAMA 2RGHA 4DR1M 4D82A 3OTOM 4LF7M 2X8AA 3FUUA 4R7GA 3GPYA 2KZSA 3H4MA 3RE8A 4LJAA 3KOZE 4B08A 1VDDA 4LZZA 2C99A 3GLIA 1Q3BA 1G4AE 2J7NA 4DR6M 1QYRA 2F5OA 5JI3E 3WHKA 1GKIA 2XGNA 1HNWM 2G5GX 2KXEA 4WURA 2ZAMA 1W5SA 3GLIB 2C9CA 5FTLA 4FCWA 2QPAA 2R18A 4GRIA 2FE8A 3HHYA 5FTNA 5IZ7D 3LQRA 4LRSA 4L4UA 3K92A 3PFIA 3TQSA 1JR3A 3VLFB 4X62M 3GPPA 4IBFA 4B7HA 2DXIA 5C18A 1SXJE 4DV0M 4LG2A 4LFCM 5IREB 3TWLA 4JI2M 4JI4M 2CUZA 2KA6B 4AZFA 1J5EM 4K0KM 4L15A 3FUVA 5FTMA 4XBOA 4TUWA 1IXZA 3GLFA 2UUCM 3SYKA 3JR4A 2QENA 4DR3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRW A;  4JI8 M;  2UXB M;  3W0F A;  2XZU A;  2UUB M;  4PD2 A;  1EE8 A;  4LF5 M;  2F5N A;  3A42 A;  3J80 S;  5ITQ A;  4AQY M;  4DV5 M;  1TDH A;  3SAS A;  4JI5 M;  3GPU A;  5LMN M;  1IBM M;  2UXC M;  1Z5A A;  4DV3 M;  4LFA M;  3U6L A;  1IBK M;  2F5P A;  3U6M A;  4JV5 M;  4DR2 M;  4MB7 A;  1L1T A;  4LF9 M;  5ITY A;  4B3S M;  1FJG M;  4GKJ M;  3JR5 A;  4DR7 M;  4KHP M;  5ITX E;  3T1Y M;  1N32 M;  4PCZ A;  4X65 M;  3U6Q A;  3A45 A;  1MU5 A;  4G4R A;  2HKJ A;  2XZF A;  1L2B A;  5ITT A;  4YY3 M;  3SAR A;  4DR5 M;  1PJI A;  3SAT A;  2UUA M;  1Q3C A;  5ITU A;  3GQ3 A;  4X64 M;  4LF8 M;  1N34 M;  1KFV A;  3C58 A;  3SAV A;  4DR4 M;  3TWK A;  1K3W A;  5BR8 M;  2VQF M;  4DUZ M;  4DV7 M;  2OQ4 A;  4G4O A;  1HNZ M;  4LFB M;  1N33 M;  1PJJ A;  1XC8 A;  4JYA M;  3GPX A;  3T1H M;  1XMO M;  3U6E A;  4PDG A;  3U6D A;  1K82 A;  1L2D A;  3GQ5 A;  4JI7 M;  3J7A S;  4JI6 M;  3J81 S;  4G4Q A;  1MX0 A;  3DOA A;  3SAU A;  1XNR M;  4ITQ A;  4PDI A;  1HNX M;  3GP1 A;  3VK7 A;  4DV1 M;  1PM5 A;  2UU9 M;  4LF6 M;  1XMQ M;  2HHH M;  4DR1 M;  3SAW A;  3A46 A;  3OTO M;  2F5Q A;  3U6C A;  4LF7 M;  4NXM M;  3GPY A;  1Q39 A;  4NXN M;  1HR0 M;  2E5L M;  1R2Z A;  3U6S A;  3VK8 A;  1I94 M;  4LF4 M;  3U6O A;  1N36 M;  1NNJ A;  5ITX A;  4GKK M;  4DV4 M;  1TDZ A;  1Q3B A;  4JI0 M;  4B3T M;  1L1Z A;  5FLX S;  1XNQ M;  4DR6 M;  4DUY M;  3SBJ A;  2F5O A;  5ITR A;  3GQ4 A;  1HNW M;  4X66 M;  2ZBK B;  5A2Q S;  4DV6 M;  2VQE M;  4JI3 M;  2Q2E B;  4G4N A;  3GO8 A;  4B3R M;  4YHH M;  4X62 M;  3GPP A;  1IBL M;  4NRV A;  5IT9 S;  3JAM S;  4DV2 M;  2F4V M;  1Z5B A;  4OX9 M;  4DV0 M;  4LFC M;  3TWL A;  2ZM6 M;  5IWA M;  1Z5C A;  4CIS A;  4JI2 M;  1K3X A;  2OPF A;  4JI4 M;  5LMU M;  1Z59 A;  3U6P A;  1J5E M;  4K0K M;  2UXD M;  1R2Y A;  1L2C A;  2F5S A;  4JI1 M;  4B3M M;  3TWM A;  2UUC M;  3JR4 A;  2EA0 A;  4DR3 M; 
#chains in the Genus database with same CATH topology
 1DGH A;  2O5R A;  4NRW A;  2QNJ A;  1DO2 A;  2XZU A;  2JUJ A;  2UUB M;  2UXB M;  2H5X A;  4PD2 A;  1WJ7 A;  2F5N A;  4LF5 M;  5EQT A;  4I8O A;  1LTM A;  4AQY M;  3KS8 A;  4CIZ A;  2XSZ D;  2Y0T A;  5LMN M;  3GLF B;  1D0L A;  1ZV1 A;  3U6L A;  3SMS A;  4LGM A;  2LNH C;  1IFY A;  2KW0 A;  3DA1 A;  2CV2 A;  4MB7 A;  4B3S M;  3LW5 F;  4IJF A;  3GLG A;  5EP3 A;  4IBC A;  3T1Y M;  4PCZ A;  1F4I A;  1OTR A;  3RGP A;  2EO2 A;  5FTJ A;  4R71 A;  3PVS A;  1MU5 A;  4G6Z A;  2Z4S A;  3H4J A;  3FRH A;  4I81 A;  4QNR A;  1EIJ A;  2KHH A;  3W0L B;  1A5T A;  3HJQ A;  4HLQ A;  4LJ7 A;  1CUK A;  1NHW C;  3SAR A;  4CJ6 A;  4GHA A;  3GQ3 A;  4M0D A;  3KP0 E;  4LF8 M;  2LVQ D;  4IBB A;  2Y20 A;  2EKK A;  3J2P B;  1IN4 A;  1DO0 A;  2N35 A;  5DYG A;  4LRT A;  2YNM D;  4AI6 A;  3B9P A;  2DZO B;  4D80 A;  5BR8 M;  4DUZ M;  2LVA A;  2XH9 A;  3B89 A;  3GLH A;  3T15 A;  4M0W A;  4G4O A;  1HNZ M;  2LVP C;  2DWM A;  2R62 A;  3HY5 A;  1N33 M;  1R7R A;  4QOZ C;  3U5Z A;  4LJ9 A;  1E94 E;  3B74 A;  1G8P A;  2P5T A;  3FTC A;  1WXQ A;  3U6D A;  4RNA A;  3HHW A;  1JR3 D;  2ZAN A;  3E21 A;  1HQY E;  3GLH B;  3SAU A;  4ITQ A;  2D7E A;  2JY8 A;  1HNX M;  1OIZ A;  4D81 A;  3FTF A;  3VK7 A;  1PM5 A;  4M9X A;  2UU9 M;  4L78 A;  3LVW A;  3ZQJ A;  2HHH M;  4AKI A;  1IXR C;  3AOE C;  4LY6 A;  1IN5 A;  3ZCB B;  3A46 A;  3E46 A;  5E6J A;  4NXM M;  2OOA A;  2XEP A;  2YQZ A;  2CHV A;  3U6S A;  3LQQ A;  3L25 A;  4GHL A;  4M9S A;  3VK8 A;  4LF4 M;  1R6B X;  3KP1 E;  3K9P A;  5EP4 A;  2YFQ A;  5FTK A;  3KXE C;  5KPR A;  4GKK M;  3I04 M;  1NJF A;  3J27 B;  1X37 A;  1P3Q Q;  2M5Z A;  3FUT A;  3SBJ A;  1OKS A;  1QQW A;  3HJ8 A;  3HU1 A;  4MGK E;  3GQ4 A;  4X66 M;  1GO5 A;  2L6O A;  1QAO A;  2ZBK B;  3IEC A;  3BBZ A;  2QQ8 A;  3AOE A;  2C5R A;  1TR8 A;  3Q8X A;  1PJQ A;  2CV1 A;  2GNO A;  3E9S A;  3L28 A;  4NRV A;  1G3I A;  5EXX A;  2KRU A;  3FRI A;  2F4V M;  2LHC A;  1OIP A;  4OX9 M;  3UGJ A;  3E4R A;  4B7G A;  3FE3 A;  2ZM6 M;  4ZPX A;  1K3X A;  4BB9 A;  2KZU A;  4LJ6 A;  1SG9 A;  3RGS A;  3U6P A;  1Z59 A;  4EIW A;  2RRU A;  5H37 D;  2UXD M;  1Y8G A;  1L2C A;  2F5S A;  2J5Y A;  2HCB A;  2OO9 A;  1G59 A;  5GKN A;  2Y21 A;  2DNA A;  2EA0 A;  1NJG A;  1VDL A;  1AIP C;  3QWL A;  4WP2 A;  4JI8 M;  1JB0 F;  3AV0 A;  3KDS E;  4FCT A;  4KO8 A;  3U60 A;  1NY6 A;  3SMP A;  3J80 S;  1OFI A;  3UK6 A;  4DV5 M;  4Z6Y A;  1WIV A;  2L4E A;  3EIH A;  2WSE F;  4MH0 E;  4P16 A;  4AG6 A;  1Q02 A;  4HEO A;  3GPU A;  4JI5 M;  3KOX E;  4OU7 A;  3ZH9 B;  3KOW E;  1R4G A;  3UMM A;  4FWG A;  1ZAE A;  1XHB A;  1SXJ C;  3WHL A;  2Z8Y M;  3U6M A;  1NY5 A;  4JV5 M;  1HQC A;  3AL0 C;  2XFS A;  3VDP A;  5ITY A;  2LWX A;  3CF0 A;  3HJS A;  3W67 A;  2DZN B;  3LVV A;  3JR5 A;  2EKF A;  1GL6 A;  5ITX E;  4KHP M;  1VQ1 A;  4W5W A;  3FKE A;  3A45 A;  1OFH A;  4MGH A;  4M9Z A;  2HKJ A;  2XZF A;  1NV8 A;  3KSJ A;  1VEK A;  3MJ5 A;  1Z6T A;  3LCU A;  4YY3 M;  5ITT A;  2APL A;  3GRY A;  4LGY A;  1DV0 A;  4QHS A;  1N34 M;  1IN7 A;  2Z4R A;  2R4E A;  4GIP A;  3C58 A;  3VKG A;  3TE6 A;  1EFU B;  3SHG B;  2LBC A;  1K3W A;  1SXJ A;  1PJS A;  2H1R A;  3QYB A;  1V92 A;  1DGH B;  4F1I A;  2K9D A;  3KS4 A;  1W5T A;  2V1U A;  1VEG A;  2CE7 A;  3B7Q A;  1J09 A;  1PJJ A;  3MHV C;  1TH4 A;  1TGU A;  1XMO M;  2R46 A;  3KSX A;  1K82 A;  2NQ8 C;  3SC3 A;  1SXJ B;  3M6A A;  1NV9 A;  4AW4 A;  3K2L A;  2FFJ A;  1DGF A;  4RF0 A;  1C1K A;  3DOA A;  2I7P A;  4PDI A;  2LH0 A;  1NHG C;  3AOG A;  1C7Y A;  1QAN A;  1TF0 B;  3GP1 A;  4DBG B;  4LJ5 A;  3D8L A;  3FD9 A;  4MM3 B;  3GLG B;  1XMQ M;  1LV7 A;  5FSW A;  3SAW A;  4BBA A;  3U6C A;  4BLC A;  3K8Z A;  2FNA A;  2WSF F;  3IHP A;  4NXN M;  3PNV A;  4GC9 A;  2E5L M;  4FWH A;  1N78 A;  2L09 A;  1XXH E;  2X49 A;  3EIE A;  1ZMW A;  1N36 M;  1NNJ A;  3GLH E;  5DYI A;  1IM2 A;  3CF6 E;  2C96 A;  3T6P A;  2HAK A;  1GLN A;  1TDZ A;  4B3T M;  1L1Z A;  5FLX S;  1XNQ M;  5E26 A;  3FYC A;  3SYL A;  5EXT A;  3AJI B;  2R6F A;  3HU2 A;  5ITR A;  2MH8 A;  1HT2 E;  3K1J A;  1QUT A;  4II7 A;  1H6U A;  2JA2 A;  3ILK A;  4DV6 M;  2VQE M;  3U5Z B;  5F3W A;  3CTW B;  2DZL A;  4NC6 A;  5EP1 A;  1IY0 A;  1PRB A;  2Q2E B;  1NVM A;  4NOO B;  7CAT A;  3SAS A;  1QDR A;  2DAG A;  1GJS A;  2CV0 A;  2L7I A;  3CF2 A;  2DHR A;  2AHM A;  2FOI C;  2X4A A;  1E9R A;  1IN8 A;  3GRU A;  1OJL A;  3HHZ A;  1HJP A;  3JAM S;  4DV2 M;  2BWE A;  1Z5B A;  4Y28 F;  3KW6 A;  2DAK A;  1T3T A;  2BWB A;  1QUS A;  2LXE A;  1Z5C A;  4GMQ A;  3HWS A;  2RKO A;  5LMU M;  4R3D A;  3QYE A;  3FUW A;  1R2Y A;  3K9O A;  1E9S A;  1SXJ D;  1UFZ A;  3I51 A;  4B3M M;  1IY2 A;  2MR9 A;  4IJE A;  1DGB A;  2DI0 A;  2MRO B;  2QP9 X;  2UUA M;  3I4V A;  3C9P A;  5EP2 A;  1PJT A;  3U61 A;  1EE8 A;  1GVN A;  3A42 A;  5ITQ A;  2RGO A;  1QAQ A;  4LCB A;  4CGY B;  4MGY E;  1D2N A;  4I5S A;  3HU3 A;  2WZJ A;  2ZAO A;  1IBM M;  2KRK A;  4IBK A;  1HT1 E;  1Z5A A;  4FD2 A;  4LFA M;  4DV3 M;  3R8F A;  3M7G A;  1E32 A;  3D8B A;  2C9O A;  3U61 B;  2ERC A;  1L8Q A;  4I4L A;  5DNY A;  2Z7J A;  4IBI A;  4DR2 M;  4FWD A;  1S3S A;  2ZTD A;  1L1T A;  1D0M A;  3B7N A;  4KOD A;  2I7N A;  4GKJ M;  2VII A;  4REZ A;  4OVZ A;  2CHG A;  5KQ8 A;  2LVO C;  3M0E A;  3GLI E;  4X65 M;  3U6Q A;  2HL7 A;  2XF3 A;  3LCV B;  1FNN A;  2L7H A;  3UZU A;  1QZM A;  3I01 M;  2V1C A;  4MGI E;  2QBY A;  4OVZ B;  1N75 A;  1PJI A;  3SAT A;  2CFO A;  3HKP A;  5ITU A;  4KLN A;  2KEB A;  3PXG A;  4RKU F;  2VF7 A;  2M60 A;  3F92 A;  4X64 M;  4AKH A;  3MMP A;  5C1B A;  4G3O A;  4DR4 M;  1ORY B;  4HL4 A;  3A98 B;  3TWK A;  3FYD A;  1DGG A;  2QBY B;  1JR3 E;  2W82 A;  2LVN C;  2VQF M;  4LFB M;  1T6O A;  2D7G A;  3U60 B;  2ZTC A;  4NSR A;  1BVS A;  2YR0 A;  3LMM A;  3GPX A;  3J7A S;  4RF1 A;  4PDG A;  3GQ5 A;  4JI7 M;  3R9X B;  2VDB B;  4FCV A;  4JI6 M;  1MX0 A;  1XNR M;  2BJW A;  1NSF A;  1OAO C;  1NO1 A;  1TH2 A;  1VG5 A;  1ZMV A;  3PNY A;  3RFW A;  3GLF E;  2DWN A;  3C3E A;  1IY1 A;  3T38 A;  4Q7J A;  3J7B A;  2F5Q A;  3GRV A;  3NWL A;  4S12 A;  3ZC7 B;  5KQD A;  2JZ1 A;  1Q39 A;  2MJ5 B;  3L29 A;  4XGI A;  1HR0 M;  1R2Z A;  4IIW A;  2JY7 A;  4L16 A;  1I94 M;  3HHX A;  3L2A A;  3Q8G A;  3U6O A;  2CRU A;  5ITX A;  2D7H A;  2JZ0 A;  1JQJ C;  3L27 A;  4DV4 M;  2JY6 B;  4JI0 M;  3HGI A;  3GLG E;  4L8R C;  2K6B A;  2R4J A;  3V76 A;  4DUY M;  3CGW A;  4XK8 F;  4AKG A;  3FTE A;  1TTE A;  3NBI A;  1ZQ9 A;  2L4F A;  5A2Q S;  2GQF A;  4WW0 A;  4JI3 M;  3KOY E;  3QAU A;  1J7K A;  2G8L A;  1TH3 A;  4P17 A;  3THG A;  4LZJ A;  4G4N A;  2WSC F;  1ZMU A;  3W68 A;  3GO8 A;  4B3R M;  1XB2 B;  4YHH M;  4OW0 A;  5EXP A;  1OQY A;  1IN6 A;  1IBL M;  2BNK A;  5IT9 S;  3AKZ A;  1MN3 A;  1V33 A;  1QDT A;  3FTD A;  2QSF X;  3IG8 A;  3FUX A;  1WR1 B;  2QZ4 A;  2R0I A;  3IG5 A;  1V34 A;  4L6V 6;  2HWJ A;  1QVR A;  1D0K A;  4B7F A;  5IWA M;  4CIS A;  4QNM A;  5KPT A;  2OPF A;  2XFT A;  1GJT A;  1IQP A;  1R5L A;  2BJV A;  2J7O A;  5EXS A;  1WGN A;  4JI1 M;  2Z3X A;  1PGY A;  4NL4 H;  3TWM A;  3SFZ A;  4JN6 A;  2EJS A;  2A5Y B;  2CWB A;  1L2D A;  2DWZ B;  3DZD A;  2QCU A;  4FVM A;  3W0F A;  2MGW A;  3BXW A;  3VKH A;  1TDH A;  1YLA A;  4CHT B;  2K47 A;  4GC5 A;  2UXC M;  1KSF X;  3UJN A;  4GH9 A;  1XXH A;  4GEW A;  1IBK M;  1I4W A;  2F5P A;  1GAB A;  4Z8X A;  2DKL A;  3VDU A;  5JI2 E;  4IBG A;  1KYI A;  4LF9 M;  1FJG M;  2G3Q A;  1YUB A;  2XLJ A;  4IBE A;  3NBX X;  1YSY A;  3VFD A;  1XXH B;  4QHT A;  4PT5 A;  4DR7 M;  1N32 M;  4JXJ A;  2DWL A;  5KPZ A;  2V6Z M;  5BPV A;  1N77 A;  4G4R A;  2CP8 A;  1L2B A;  1MJG M;  2KDL A;  2KNV A;  3L26 A;  2R44 A;  2R45 A;  2Y0Q A;  1UM8 A;  1IXS A;  1G41 A;  5EJC A;  4DR5 M;  1Q3C A;  2CEA A;  8CAT A;  2OOB A;  4LJ4 A;  4NSO B;  4QOS A;  4AG5 A;  1KFV A;  2DVW B;  3SAV A;  2EUC A;  2C98 A;  2K0B X;  1IXS B;  3AFH A;  5KO3 A;  4DV7 M;  2OQ4 A;  3TL4 X;  4IBD A;  4A3V B;  4UN2 B;  4IBJ A;  3GRR A;  2L2D A;  1XC8 A;  2KNA A;  4JYA M;  2CHQ A;  1YE9 A;  4ANR A;  3T1H M;  3B7Z A;  3KVW A;  3U6E A;  3SHF A;  3DFZ A;  2LTU A;  3KFU G;  2DAE A;  3MK6 A;  2XSZ A;  3BOS A;  3J81 S;  4G4Q A;  2VF8 A;  4FW9 A;  1NNU C;  1XWI A;  1GL7 A;  2JY5 A;  4F2L A;  4GIT A;  4LJ8 A;  4MGZ E;  2R65 A;  3TPZ A;  3I4Y A;  4DV1 M;  4LF6 M;  1G71 A;  2DAI A;  1QAM A;  2RGH A;  4DR1 M;  5L8R F;  1T43 A;  2DEN A;  4D82 A;  3OTO M;  1AUA A;  2X8A A;  4LF7 M;  3FUU A;  2DHY A;  4R7G A;  3GPY A;  2KZS A;  3H4M A;  3RE8 A;  4LJA A;  2O25 A;  3HZJ A;  3KOZ E;  4B08 A;  1VDD A;  2JWS A;  4LZZ A;  2C99 A;  2FS1 A;  1RU3 A;  3GLI A;  1OAI A;  1Q3B A;  4KT0 F;  1G4A E;  2J7N A;  2DAM A;  2O01 F;  3C3D A;  4DR6 M;  1QYR A;  2F5O A;  1VEJ A;  5JI3 E;  3WHK A;  1GKI A;  1QZE A;  2XGN A;  2G5G X;  1HNW M;  1WGL A;  2KXE A;  4WUR A;  2ZAM A;  1W5S A;  3GLI B;  2C9C A;  5FTL A;  4FCW A;  2QPA A;  2R18 A;  4GRI A;  2JNH A;  2FE8 A;  3HX3 A;  3HHY A;  5FTN A;  2LHG A;  3LQR A;  5IZ7 D;  4LRS A;  4L4U A;  3K92 A;  3PFI A;  3TQS A;  2JP7 A;  1JR3 A;  1WHC A;  3VLF B;  4X62 M;  3GPP A;  4IBF A;  5DFL A;  4B7H A;  2DXI A;  5C18 A;  1SXJ E;  2FH0 A;  4DV0 M;  4LG2 A;  4LFC M;  5IRE B;  3TWL A;  2JXN A;  4JI2 M;  2KNZ A;  2QHO B;  4JI4 M;  2CUZ A;  2KA6 B;  4AZF A;  1J5E M;  4K0K M;  4L15 A;  3FUV A;  5FTM A;  4XBO A;  4TUW A;  1IXZ A;  2B3T A;  3GLF A;  2UUC M;  3SYK A;  3JR4 A;  2QEN A;  4DR3 M; 
#chains in the Genus database with same CATH homology
 1DGH A;  2O5R A;  4NRW A;  2UXB M;  1DO2 A;  2XZU A;  2UUB M;  4AKI A;  4PD2 A;  4LF5 M;  2F5N A;  5EQT A;  4I8O A;  4AQY M;  3KS8 A;  2XSZ D;  2Y0T A;  5LMN M;  3GLF B;  3U6L A;  3SMS A;  4LGM A;  2LNH C;  2KW0 A;  3DA1 A;  2CV2 A;  4MB7 A;  4B3S M;  4IJF A;  3GLG A;  5EP3 A;  4IBC A;  3T1Y M;  4PCZ A;  3RGP A;  2EO2 A;  5FTJ A;  3PVS A;  1MU5 A;  4G6Z A;  2Z4S A;  4QNR A;  4I81 A;  3W0L B;  3HJQ A;  4HLQ A;  4LJ7 A;  1NHW C;  3SAR A;  4GHA A;  3GQ3 A;  4M0D A;  3KP0 E;  4LF8 M;  4IBB A;  2Y20 A;  3J2P B;  1IN4 A;  1DO0 A;  5DYG A;  4LRT A;  2YNM D;  4AI6 A;  3B9P A;  2DZO B;  4D80 A;  5BR8 M;  4DUZ M;  4G4O A;  2XH9 A;  1HNZ M;  3GLH A;  3T15 A;  4M0W A;  2DWM A;  2R62 A;  1N33 M;  1R7R A;  4QOZ C;  3U5Z A;  4LJ9 A;  1E94 E;  1G8P A;  2P5T A;  3FTC A;  1WXQ A;  3U6D A;  4RNA A;  3HHW A;  1JR3 D;  2ZAN A;  1HQY E;  3GLH B;  3SAU A;  4ITQ A;  2D7E A;  1HNX M;  4D81 A;  3FTF A;  3VK7 A;  1PM5 A;  4M9X A;  2UU9 M;  4L78 A;  3LVW A;  2HHH M;  1IXR C;  3AOE C;  4LY6 A;  1IN5 A;  3ZCB B;  3A46 A;  5E6J A;  4NXM M;  2XEP A;  2YQZ A;  2CHV A;  3U6S A;  3LQQ A;  3L25 A;  4GHL A;  4M9S A;  3VK8 A;  4LF4 M;  1R6B X;  3KP1 E;  5EP4 A;  2YFQ A;  5FTK A;  3KXE C;  5KPR A;  4GKK M;  1NJF A;  3J27 B;  1X37 A;  2M5Z A;  3FUT A;  3SBJ A;  3HJ8 A;  1QQW A;  3HU1 A;  4MGK E;  3GQ4 A;  4X66 M;  2L6O A;  1QAO A;  2ZBK B;  3AOE A;  2C5R A;  3Q8X A;  2CV1 A;  3E9S A;  3L28 A;  4NRV A;  1G3I A;  5EXX A;  2KRU A;  2F4V M;  4OX9 M;  3UGJ A;  3E4R A;  4B7G A;  2ZM6 M;  4ZPX A;  1K3X A;  4BB9 A;  2KZU A;  4LJ6 A;  3RGS A;  3U6P A;  1Z59 A;  4EIW A;  2UXD M;  5H37 D;  1L2C A;  2F5S A;  2HCB A;  1G59 A;  5GKN A;  2Y21 A;  2EA0 A;  1NJG A;  3QWL A;  4JI8 M;  3AV0 A;  3KDS E;  4FCT A;  4KO8 A;  3U60 A;  1NY6 A;  3SMP A;  3J80 S;  1OFI A;  3UK6 A;  4DV5 M;  4Z6Y A;  4AG6 A;  3EIH A;  4MH0 E;  3SAS A;  4P16 A;  3GPU A;  4JI5 M;  3KOX E;  4OU7 A;  3ZH9 B;  3KOW E;  3UMM A;  4FWG A;  1ZAE A;  1XHB A;  1SXJ C;  3WHL A;  3U6M A;  4JV5 M;  1NY5 A;  1HQC A;  3AL0 C;  2XFS A;  3VDP A;  5ITY A;  2LWX A;  3CF0 A;  3HJS A;  3JR5 A;  2DZN B;  3LVV A;  4KHP M;  5ITX E;  1GL6 A;  4W5W A;  3FKE A;  3A45 A;  1OFH A;  4MGH A;  4M9Z A;  2HKJ A;  2XZF A;  3KSJ A;  3MJ5 A;  1Z6T A;  5ITT A;  4YY3 M;  3GRY A;  4LGY A;  4QHS A;  1N34 M;  1IN7 A;  2Z4R A;  2R4E A;  4GIP A;  3C58 A;  3VKG A;  3TE6 A;  3SHG B;  1K3W A;  1SXJ A;  2H1R A;  1DGH B;  3KS4 A;  1W5T A;  2V1U A;  2CE7 A;  1J09 A;  1PJJ A;  3MHV C;  1TH4 A;  1TGU A;  1XMO M;  2R46 A;  3KSX A;  1K82 A;  2NQ8 C;  3SC3 A;  1SXJ B;  3M6A A;  4AW4 A;  3K2L A;  2FFJ A;  1DGF A;  4RF0 A;  1C1K A;  3DOA A;  2I7P A;  4PDI A;  1NHG C;  2LH0 A;  3AOG A;  1QAN A;  3GP1 A;  4LJ5 A;  3D8L A;  3FD9 A;  4MM3 B;  3GLG B;  1XMQ M;  1LV7 A;  5FSW A;  3SAW A;  4BBA A;  3U6C A;  4BLC A;  3K8Z A;  2FNA A;  4NXN M;  3PNV A;  4GC9 A;  2E5L M;  4FWH A;  1N78 A;  2L09 A;  2X49 A;  3EIE A;  1N36 M;  1NNJ A;  5DYI A;  1IM2 A;  3CF6 E;  2C96 A;  1TDZ A;  1GLN A;  4B3T M;  1L1Z A;  5FLX S;  1XNQ M;  5E26 A;  3FYC A;  3SYL A;  5EXT A;  3AJI B;  3HU2 A;  5ITR A;  1HT2 E;  3K1J A;  4II7 A;  1H6U A;  2JA2 A;  3ILK A;  4DV6 M;  2VQE M;  3U5Z B;  5F3W A;  3CTW B;  5EP1 A;  1IY0 A;  2Q2E B;  1NVM A;  4NOO B;  7CAT A;  2CV0 A;  2L7I A;  3CF2 A;  2DHR A;  2AHM A;  2FOI C;  2X4A A;  1E9R A;  1IN8 A;  3GRU A;  1OJL A;  3HHZ A;  3JAM S;  4DV2 M;  1Z5B A;  3KW6 A;  1T3T A;  4GMQ A;  2LXE A;  1Z5C A;  3HWS A;  2RKO A;  5LMU M;  4R3D A;  3FUW A;  1R2Y A;  1E9S A;  1SXJ D;  3I51 A;  4B3M M;  1IY2 A;  4IJE A;  1DGB A;  2QP9 X;  2UUA M;  3I4V A;  5EP2 A;  3U61 A;  1EE8 A;  1GVN A;  3A42 A;  5ITQ A;  2RGO A;  1QAQ A;  4LCB A;  4CGY B;  4MGY E;  1D2N A;  4I5S A;  3HU3 A;  2ZAO A;  1IBM M;  2KRK A;  4IBK A;  1HT1 E;  1Z5A A;  4FD2 A;  4LFA M;  4DV3 M;  3R8F A;  3M7G A;  1E32 A;  3D8B A;  2C9O A;  3U61 B;  2ERC A;  1L8Q A;  4I4L A;  5DNY A;  2Z7J A;  4IBI A;  4DR2 M;  4FWD A;  1S3S A;  1L1T A;  4KOD A;  2I7N A;  4GKJ M;  2VII A;  4REZ A;  4OVZ A;  2CHG A;  5KQ8 A;  3M0E A;  4X65 M;  3U6Q A;  2HL7 A;  2XF3 A;  1FNN A;  2L7H A;  3UZU A;  1QZM A;  2V1C A;  4MGI E;  2QBY A;  4OVZ B;  1N75 A;  1PJI A;  3SAT A;  2CFO A;  3HKP A;  5ITU A;  4KLN A;  2KEB A;  3PXG A;  4X64 M;  2M60 A;  4AKH A;  5C1B A;  4DR4 M;  1ORY B;  4HL4 A;  3A98 B;  3TWK A;  3FYD A;  1DGG A;  2QBY B;  2W82 A;  2VQF M;  4LFB M;  2D7G A;  3U60 B;  4NSR A;  2YR0 A;  3LMM A;  3GPX A;  3J7A S;  4RF1 A;  4PDG A;  3GQ5 A;  4JI7 M;  3R9X B;  4JI6 M;  4FCV A;  1MX0 A;  1XNR M;  2BJW A;  1NSF A;  1TH2 A;  3RFW A;  3PNY A;  2DWN A;  1IY1 A;  3T38 A;  3J7B A;  2F5Q A;  3GRV A;  3NWL A;  4S12 A;  3ZC7 B;  5KQD A;  1Q39 A;  3L29 A;  4XGI A;  1HR0 M;  1R2Z A;  4IIW A;  4L16 A;  1I94 M;  3HHX A;  3L2A A;  3U6O A;  5ITX A;  2D7H A;  3L27 A;  1JQJ C;  4DV4 M;  4JI0 M;  3HGI A;  4L8R C;  4DUY M;  2R4J A;  4AKG A;  3FTE A;  3NBI A;  1ZQ9 A;  5A2Q S;  4WW0 A;  4JI3 M;  3KOY E;  3QAU A;  1J7K A;  2G8L A;  1TH3 A;  3THG A;  4LZJ A;  4G4N A;  3GO8 A;  4B3R M;  4YHH M;  4OW0 A;  5EXP A;  1IN6 A;  1IBL M;  2BNK A;  5IT9 S;  3AKZ A;  3FTD A;  3IG8 A;  3FUX A;  2QZ4 A;  3IG5 A;  1QVR A;  4B7F A;  5IWA M;  4CIS A;  4QNM A;  5KPT A;  2OPF A;  2XFT A;  1IQP A;  2BJV A;  2J7O A;  5EXS A;  4JI1 M;  2Z3X A;  4NL4 H;  3TWM A;  3SFZ A;  4JN6 A;  2A5Y B;  1L2D A;  2DWZ B;  3DZD A;  2QCU A;  4FVM A;  3W0F A;  3VKH A;  1TDH A;  4CHT B;  2K47 A;  4GC5 A;  2UXC M;  1KSF X;  3UJN A;  4GH9 A;  1XXH A;  1IBK M;  2F5P A;  1I4W A;  4Z8X A;  3VDU A;  5JI2 E;  4IBG A;  1KYI A;  4LF9 M;  1FJG M;  1YUB A;  2XLJ A;  4IBE A;  4DR7 M;  1YSY A;  3VFD A;  1XXH B;  4QHT A;  4PT5 A;  1N32 M;  4JXJ A;  2DWL A;  5KPZ A;  2V6Z M;  5BPV A;  1N77 A;  4G4R A;  1L2B A;  3L26 A;  2R45 A;  2Y0Q A;  1UM8 A;  1G41 A;  5EJC A;  4DR5 M;  1Q3C A;  2CEA A;  8CAT A;  4LJ4 A;  4AG5 A;  4NSO B;  4QOS A;  1KFV A;  2DVW B;  3SAV A;  2EUC A;  2C98 A;  1IXS B;  3AFH A;  5KO3 A;  4DV7 M;  2OQ4 A;  3TL4 X;  4IBD A;  4A3V B;  4IBJ A;  3GRR A;  1XC8 A;  4JYA M;  2CHQ A;  1YE9 A;  3T1H M;  3KVW A;  3U6E A;  3SHF A;  3DFZ A;  3KFU G;  3MK6 A;  2XSZ A;  3BOS A;  3J81 S;  4G4Q A;  4FW9 A;  1NNU C;  1XWI A;  1GL7 A;  4GIT A;  4LJ8 A;  4MGZ E;  2R65 A;  3TPZ A;  3I4Y A;  4DV1 M;  4LF6 M;  1QAM A;  2RGH A;  4DR1 M;  4D82 A;  3OTO M;  4LF7 M;  2X8A A;  3FUU A;  4R7G A;  3GPY A;  2KZS A;  3H4M A;  3RE8 A;  4LJA A;  3KOZ E;  4B08 A;  1VDD A;  4LZZ A;  2C99 A;  3GLI A;  1Q3B A;  1G4A E;  2J7N A;  4DR6 M;  1QYR A;  2F5O A;  5JI3 E;  3WHK A;  1GKI A;  2XGN A;  1HNW M;  2G5G X;  2KXE A;  4WUR A;  2ZAM A;  1W5S A;  3GLI B;  2C9C A;  5FTL A;  4FCW A;  2QPA A;  2R18 A;  4GRI A;  2FE8 A;  3HHY A;  5FTN A;  5IZ7 D;  3LQR A;  4LRS A;  4L4U A;  3K92 A;  3PFI A;  3TQS A;  1JR3 A;  3VLF B;  4X62 M;  3GPP A;  4IBF A;  4B7H A;  2DXI A;  5C18 A;  1SXJ E;  4DV0 M;  4LG2 A;  4LFC M;  5IRE B;  3TWL A;  4JI2 M;  4JI4 M;  2CUZ A;  2KA6 B;  4AZF A;  1J5E M;  4K0K M;  4L15 A;  3FUV A;  5FTM A;  4XBO A;  4TUW A;  1IXZ A;  3GLF A;  2UUC M;  3SYK A;  3JR4 A;  2QEN A;  4DR3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...