1K3WA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
254
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
molecule tags Hydrolase/dna
source organism Escherichia coli
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
total genus 81
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3wA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3wA01
3W0FA 4B3SM 1EE8A 4G4RA 5ITTA 1N34M 3SAVA 4JI7M 5IT9S 2VQFM 3TWKA 4JI5M 1PJJA 4JI4M 3DOAA 4NRVA 4G4OA 1MU5A 2UXBM 4DR6M 4KHPM 4GKKM 4OX9M 1TDHA 1NNJA 1Z59A 3A45A 5IWAM 2F5OA 4NXMM 5LMUM 3VK8A 4JV5M 5ITRA 3JR5A 4DV4M 1K82A 1R2YA 2HHHM 3GPYA 4JI8M 4LF8M 1L1ZA 4DR1M 2UXDM 3U6MA 2OPFA 3U6LA 3U6QA 1J5EM 1MX0A 3U6SA 4G4NA 3A42A 1IBKM 1XC8A 5ITYA 4X64M 4DR2M 1XNQM 1Q39A 2E5LM 1N36M 4DV6M 4YHHM 3U6EA 4JI6M 1N33M 4PCZA 3T1YM 1XNRM 3J80S 1Z5CA 4LF7M 4DR7M 4DR4M 3SAWA 4X66M 4YY3M 3T1HM 2EA0A 3VK7A 1IBMM 1L2DA 3GPUA 4DUZM 2VQEM 4LFBM 2ZBKB 3OTOM 2HKJA 3SATA 4JYAM 4DV7M 1KFVA 2F5SA 4MB7A 4CISA 1Z5BA 1HR0M 4B3MM 3GQ4A 3GP1A 4AQYM 3GPPA 4DV0M 3J7AS 1HNWM 4DR3M 4LF5M 3JAMS 1PJIA 4LF4M 4B3TM 1HNZM 1XMOM 3U6DA 3GPXA 1PM5A 2Q2EB 2F5NA 1L2CA 1Q3CA 3SARA 3JR4A 3SBJA 1TDZA 3TWLA 4X62M 3A46A 4LFAM 2F4VM 1IBLM 2UUAM 2UUCM 4PDIA 4DV3M 1HNXM 4JI1M 2F5QA 3C58A 5FLXS 2OQ4A 4LF6M 2ZM6M 3TWMA 2F5PA 4K0KM 2UXCM 1N32M 3GO8A 1Z5AA 5A2QS 1I94M 1Q3BA 5ITXA 1K3XA 5BR8M 3U6OA 5ITXE 4JI3M 3SAUA 4DV5M 2XZUA 4ITQA 4JI2M 3GQ3A 4B3RM 3J81S 4DUYM 1R2ZA 4NRWA 4DV2M 4GKJM 1L2BA 4PDGA 3U6CA 4PD2A 4G4QA 4LFCM 1FJGM 4NXNM 1K3WA 4X65M 3SASA 2UUBM 4LF9M 4DR5M 1L1TA 5ITUA 5ITQA 1XMQM 2UU9M 2XZFA 3U6PA 4DV1M 3GQ5A 4JI0M 5LMNM
chains in the Genus database with same CATH superfamily
1DGHA 1DO0A 4GC5A 4L8RC 2R4JA 4D82A 5ITTA 1N34M 1DGFA 3HHXA 3SAVA 3ZQJA 4FWHA 5IT9S 4AKIA 1WXQA 1PJJA 2DZNB 2NQ8C 3DOAA 3GQ5A 4JI4M 4LG2A 3DA1A 3RFWA 3HJSA 4GHAA 3BOSA 2UXBM 3FRIA 1OIZA 4GKKM 3IG8A 1TDHA 2J7OA 1T6OA 4LJ4A 1HQYE 4L4UA 3TQSA 1C7YA 2Z7JA 4JV5M 5ITRA 3IECA 2XH9A 2QCUA 1K82A 1QYRA 3HU2A 2FOIC 3E9SA 4LY6A 1WJ7A 3GPYA 5C1BA 4GHLA 4QNRA 2UXDM 4RF1A 1TH3A 2BWEA 1MX0A 3U6SA 1QAMA 4G4NA 3A42A 4KODA 3FTFA 2KEBA 2R45A 3ZH9B 1QZEA 3B89A 2L7HA 4WP2A 1WGLA 1Q39A 4NSOB 1PJQA 1NY6A 2ZTCA 3SHGB 2L2DA 4R3DA 4LJAA 1I4WA 4PCZA 5E6JA 1XNRM 5DYIA 4IBJA 4LF7M 2ZTDA 4DR4M 3QYBA 1MJGM 3HHWA 5L8RF 4M0DA 2MGWA 2HAKA 1YE9A 1UFZA 3EIEA 3B7ZA 4I4LA 3PXGA 2FNAA 5E26A 1IY2A 3GLGE 3UZUA 2VQEM 4XGIA 3KXEC 1WHCA 3TL4X 3OTOM 2Z8YM 2CHQA 3HX3A 4MGZE 3VDPA 3I51A 3HHYA 3GLHA 2LTUA 3D8BA 1IQPA 2DWZB 3PVSA 4AG5A 3L27A 3KDSE 3QWLA 2D7HA 1JR3D 1IXRC 2JY6B 3VDUA 2Y20A 3LW5F 1X37A 2EKFA 3KFUG 1OTRA 3JAMS 4KT0F 1R5LA 1PJIA 1IY0A 4WW0A 3SFZA 4HEOA 1AIPC 3CF2A 1BVSA 3UJNA 2BWBA 3VKHA 2A5YB 1G41A 1UM8A 3C9PA 1PM5A 3AJIB 2L4EA 4XK8F 3JR4A 4L15A 1VG5A 4MGHA 3A46A 1OKSA 2XFTA 2UUAM 1HJPA 5JI2E 4PDIA 2EUCA 4A3VB 5FLXS 4FWDA 2L4FA 4LF6M 3AL0C 5KPTA 3GLFA 4AI6A 1G8PA 2UXCM 1N32M 3D8LA 4D80A 3W67A 3GO8A 1Q3BA 3U6OA 3FUVA 3M7GA 3PNYA 3U5ZA 4JI3M 2QBYA 4AKGA 1NJGA 1QUTA 2XZUA 4ITQA 5FTLA 3B74A 2LVNC 3GQ3A 1V92A 3J81S 1R2ZA 1XXHA 2VF7A 4NC6A 2KZSA 4LJ8A 3U6CA 1GL6A 4NXNM 2C96A 4X65M 1GKIA 2UUBM 4DR5M 2APLA 5EXTA 2M60A 3K92A 3KSJA 1XMQM 1V34A 4BB9A 2UU9M 2CP8A 3FTEA 1IFYA 3LCUA 4NSRA 4JI0M 4I81A 4LJ6A 1GVNA 3W0FA 4ZPXA 2C99A 1IN7A 1E9RA 1JR3E 3L26A 3KP1E 2O25A 1E94E 1ZAEA 2OO9A 4NRVA 3FTCA 2G8LA 4G6ZA 2FH0A 3FE3A 2CV1A 4DR6M 1VEGA 3WHKA 2JP7A 4BLCA 4OU7A 4B08A 2CWBA 3U61B 2F5OA 4GC9A 1SXJD 4NXMM 4F1IA 4M0WA 3E4RA 1OFHA 1DGBA 1OIPA 3FUUA 3I4VA 4HL4A 4R7GA 3GRYA 1OFIA 1R2YA 1AUAA 2LH0A 5DYGA 1V33A 1D0LA 3FD9A 3W0LB 4LF8M 4GRIA 2D7GA 2CEAA 3U60A 4DR1M 2C9OA 1LTMA 4LJ5A 1TH4A 1HQCA 2JWSA 1OQYA 1IM2A 1VEJA 2JXNA 2Y21A 1OAOC 2K0BX 5ITYA 1JQJC 3ZC7B 3L25A 1IN8A 5FSWA 2FFJA 4JN6A 2E5LM 4LZZA 2VDBB 1QZMA 3AV0A 4I8OA 4IBEA 1G4AE 4M9ZA 2DAGA 2XSZD 3QAUA 2VIIA 3J80S 1Z5CA 2QZ4A 3LCVB 2KRUA 3MK6A 2EA0A 2CV2A 2XSZA 3GPUA 2LVOC 2KNVA 2N35A 5DNYA 3KS8A 1KSFX 3CF6E 3TPZA 3SC3A 3KP0E 5IREB 2RGHA 5EP1A 3SATA 4JYAM 5FTKA 4DV7M 2DAEA 1VEKA 1IXSA 2DNAA 2V1UA 1SXJA 2V1CA 3GLIA 2EJSA 2R0IA 4MH0E 3H4MA 4B3MM 4LRSA 2X49A 3GQ4A 3KOWE 2LVAA 3FRHA 3SHFA 4AQYM 2DZOB 3GPPA 2CV0A 4ANRA 3UGJA 1LV7A 1S3SA 1NV8A 4LF5M 3GLHB 5EXSA 4CHTB 5JI3E 1ZMUA 2DKLA 4JXJA 4KLNA 3K9OA 1HNZM 3FUWA 1NO1A 4QHTA 2DAIA 4R71A 2CE7A 3RGPA 4PT5A 1Q3CA 4IBBA 3SARA 3SBJA 1E9SA 1W5SA 2WSFF 3I4YA 3H4JA 2WZJA 3K8ZA 4DV3M 1HNXM 1DGGA 1QANA 1QDTA 1NNUC 2R6FA 3NBIA 2BJWA 1GJSA 4CJ6A 2EKKA 3CGWA 3PNVA 3T6PA 2CFOA 3KOYE 2CUZA 2K47A 2XEPA 3L2AA 3KS4A 1R7RA 2X4AA 3C3DA 1QQWA 3J2PB 3DFZA 4AG6A 5KQ8A 2RKOA 2KXEA 4LFCM 1FJGM 1W5TA 1K3WA 5IZ7D 1J7KA 4WURA 2KDLA 2M5ZA 2ZAMA 3FUTA 3V76A 4LF9M 5BPVA 4MGKE 5ITUA 2KA6B 1N78A 2KRKA 4QNMA 1IXSB 4RKUF 3T38A 1PRBA 3HU3A 4DV1M 4GEWA 2DXIA 2DAKA 1TGUA 4B3SM 4G4RA 2C5RA 2YQZA 3GLHE 3E21A 4IBCA 3MHVC 3HHZA 2VQFM 3TWKA 1A5TA 4FWGA 4JI5M 3I01M 4OVZB 1TTEA 3VKGA 2V6ZM 3GLGB 4G4OA 2BNKA 5EP4A 3HJQA 2DAMA 2J5YA 2DHYA 4B7GA 1NNJA 5IWAM 1VDDA 1YLAA 1ZMWA 2XFSA 4D81A 3THGA 3JR5A 1QDRA 3WHLA 1C1KA 5KPRA 1WR1B 1QAOA 2JZ1A 1IY1A 2JY7A 3QYEA 2OPFA 3U6LA 1J5EM 4MGIE 2Z4SA 2HWJA 1T3TA 1IBKM 2K9DA 2ZANA 2HCBA 3BBZA 7CATA 4X64M 2DHRA 4DR2M 1TH2A 2G3QA 1XHBA 1ORYB 4YHHM 3U6EA 3HU1A 4GH9A 1N33M 1DO2A 2BJVA 1EIJA 1D0MA 4IBFA 4MM3B 4OW0A 4GMQA 3SAWA 4YY3M 4FW9A 2QP9X 5KO3A 3VK7A 1IBMM 3CTWB 3W68A 1HT2E 5EP3A 3HZJA 3AOGA 3HKPA 1L2DA 1NHWC 1WGNA 2R46A 1IXZA 3SYKA 3K2LA 4LFBM 1TF0B 4IBGA 1WIVA 2ZBKB 1IN5A 2HKJA 3M6AA 2D7EA 1GLNA 1J09A 1XWIA 1T43A 2I7NA 2YR0A 4LJ9A 2KNZA 4MB7A 4GIPA 1HR0M 2YNMD 4MGYE 2XLJA 5FTMA 3AOEC 1Y8GA 1VDLA 3U61A 4DV0M 3J7AS 1H6UA 4P16A 1ZV1A 2LHCA 2LWXA 2JY5A 3I04M 3GLGA 1SXJB 3GLIB 1HT1E 4B3TM 3SMSA 2LVQD 3GRRA 4IJFA 3UK6A 1FNNA 1IN4A 3DZDA 1XMOM 3U6DA 2MH8A 2CHVA 2P5TA 1QVRA 4RF0A 2F5NA 5H37D 3J27B 3LVWA 1TDZA 5GKNA 3TWLA 2RGOA 2QQ8A 2FS1A 2R4EA 1IBLM 2F4VM 2DWNA 2UUCM 1EFUB 4B7FA 1PJTA 4IIWA 3AKZA 3C58A 4JI1M 3TWMA 3GLFB 3BXWA 3Q8XA 4FCVA 2WSCF 4K0KM 1DV0A 3A98B 2C98A 2RRUA 4L16A 1QUSA 5A2QS 1I94M 4QOSA 5EP2A 3KVWA 2I7PA 2L6OA 3B9PA 5KQDA 1ZQ9A 4L78A 4M9SA 3K1JA 4LCBA 3SAUA 3LQQA 1E32A 2H1RA 3ZCBB 3U5ZB 2QBYB 3L29A 4JI2M 4B3RM 3GLFE 2OOAA 1XXHB 2ZAOA 4EIWA 1PGYA 3KOZE 4DUYM 1QAQA 4GKJM 2WSEF 4Z6YA 4PDGA 4PD2A 1DGHB 4G4QA 1L2BA 2GNOA 3HGIA 4CGYB 3AOEA 4QOZC 2H5XA 5FTNA 3KW6A 1XB2B 3SASA 2JZ0A 2ERCA 3FKEA 2K6BA 3ILKA 3J7BA 3LQRA 3NWLA 5EXPA 2XZFA 3PFIA 2JA2A 3FTDA 1SG9A 1Q02A 2QHOB 1Z6TA 3GRVA 1SXJE 1EE8A 4REZA 4Z8XA 3C3EA 3GLIE 3NBXX 2LBCA 1D0KA 4JI7M 2DWMA 4Q7JA 3RGSA 1NHGC 4BBAA 4L6V6 2KNAA 1MU5A 1SXJC 4KHPM 4B7HA 1OAIA 2Y0QA 4OX9M 3KSXA 1Z59A 3A45A 4FVMA 4NL4H 5LMUM 3VK8A 1TR8A 4OVZA 4DV4M 4LGYA 3F92A 3MMPA 3B7NA 4AZFA 1N77A 2Y0TA 4F2LA 5KPZA 1JR3A 4IBDA 2HHHM 4JI8M 5EXXA 3U60B 4II7A 1L1ZA 5DFLA 2MROB 4FCTA 3U6QA 2LVPC 4M9XA 2QSFX 1GABA 1GL7A 1R4GA 4LZJA 1XC8A 3SMPA 3FUXA 2AHMA 2O01F 2HL7A 2MJ5B 1XNQM 2OOBA 2XF3A 2W82A 4LJ7A 5F3WA 1N36M 4DV6M 4LGMA 4JI6M 4NOOB 1G71A 3T1YM 3VLFB 1D2NA 4DR7M 2O5RA 2CHGA 1F4IA 3RE8A 4X66M 3T1HM 3HWSA 1CUKA 2DZLA 3R8FA 1NVMA 4DUZM 4FCWA 5EJCA 2XGNA 2YFQA 5FTJA 3LMMA 2R44A 4CIZA 2QENA 3L28A 1N75A 1P3QQ 1IN6A 1PJSA 2KW0A 2B3TA 1L8QA 2QNJA 2Z4RA 4P17A 3K9PA 4FD2A 1KFVA 2F5SA 4CISA 1Z5BA 1VQ1A 3GP1A 2VF8A 2Z3XA 2L09A 3LVVA 2R62A 4GITA 8CATA 2J7NA 5C18A 3TE6A 2MR9A 4DR3M 4RNAA 4S12A 1ZMVA 1HNWM 2GQFA 4IBIA 2L7IA 3IG5A 4LF4M 2KHHA 1OJLA 4DBGB 1KYIA 3M0EA 2LHGA 2LXEA 4IBKA 3HJ8A 4G3OA 3GPXA 3AFHA 3UMMA 2Q2EB 2DI0A 4KO8A 2DENA 3HY5A 2KZUA 1L2CA 2CRUA 3B7QA 1G59A 4X62M 4LFAM 4UN2B 2DVWB 2FE8A 1RU3A 4W5WA 2F5QA 2R18A 2OQ4A 2ZM6M 2F5PA 4TUWA 4AKHA 2EO2A 3FYDA 1YSYA 3CF0A 2R65A 1NSFA 1Z5AA 3IHPA 1K3XA 5ITXA 1R6BX 5BR8M 3T15A 5ITXE 4XBOA 3VFDA 3MJ5A 1GO5A 4QHSA 5EQTA 2C9CA 4IJEA 3FYCA 4DV5M 1G3IA 2G5GX 1GJTA 2QPAA 2JY8A 2DWLA 3R9XB 4NRWA 4I5SA 1NY5A 1JB0F 1YUBA 4LRTA 4DV2M 4HLQA 2JNHA 3E46A 3Q8GA 1NV9A 4Y28F 3GRUA 4AW4A 3EIHA 2LNHC 3SYLA 1L1TA 5ITQA 2JUJA 2X8AA 1MN3A 3U6PA 3KOXE 1XXHE 1NJFA 3U6MA 5LMNM
chains in the Genus database with same CATH topology
1DGHA 1DO0A 4GC5A 4L8RC 2R4JA 4D82A 5ITTA 1N34M 1DGFA 3HHXA 3SAVA 5IT9S 4FWHA 4AKIA 1WXQA 1PJJA 2DZNB 2NQ8C 3DOAA 3GQ5A 4JI4M 4LG2A 3DA1A 3RFWA 3HJSA 4GHAA 3BOSA 2UXBM 4GKKM 3IG8A 1TDHA 2J7OA 4LJ4A 1HQYE 4L4UA 3TQSA 4JV5M 2Z7JA 5ITRA 2XH9A 2QCUA 1K82A 1QYRA 3HU2A 2FOIC 3E9SA 4LY6A 4GHLA 3GPYA 5C1BA 4QNRA 2UXDM 4RF1A 1TH3A 1MX0A 3U6SA 1QAMA 4G4NA 3A42A 4KODA 3FTFA 2KEBA 2R45A 3ZH9B 2L7HA 4NSOB 1Q39A 1NY6A 3SHGB 4R3DA 4LJAA 1I4WA 4PCZA 5E6JA 1XNRM 5DYIA 4IBJA 4LF7M 4DR4M 3HHWA 4M0DA 1YE9A 3EIEA 4I4LA 3PXGA 2FNAA 5E26A 1IY2A 3UZUA 2VQEM 4XGIA 3KXEC 3TL4X 3OTOM 3VDPA 2CHQA 4MGZE 3I51A 3HHYA 3GLHA 3D8BA 1IQPA 2DWZB 3PVSA 4AG5A 3L27A 3KDSE 3QWLA 2D7HA 1JR3D 1IXRC 3VDUA 2Y20A 1X37A 3KFUG 3JAMS 1PJIA 1IY0A 4WW0A 3SFZA 3CF2A 3UJNA 3VKHA 2A5YB 1G41A 1UM8A 1PM5A 3AJIB 3JR4A 4L15A 3A46A 4MGHA 2XFTA 2UUAM 5JI2E 4PDIA 2EUCA 4A3VB 5FLXS 4FWDA 4LF6M 3AL0C 5KPTA 3GLFA 4AI6A 1G8PA 2UXCM 1N32M 3D8LA 4D80A 3GO8A 1Q3BA 3U6OA 3FUVA 3M7GA 3PNYA 3U5ZA 4JI3M 2QBYA 4AKGA 1NJGA 2XZUA 4ITQA 5FTLA 3GQ3A 3J81S 1R2ZA 1XXHA 2KZSA 4LJ8A 3U6CA 1GL6A 4NXNM 2C96A 4X65M 1GKIA 2UUBM 4DR5M 5EXTA 2M60A 3K92A 3KSJA 1XMQM 2UU9M 4BB9A 3FTEA 4NSRA 4JI0M 4I81A 4LJ6A 1GVNA 3W0FA 4ZPXA 2C99A 1IN7A 1E9RA 3L26A 3KP1E 1E94E 1ZAEA 4NRVA 3FTCA 2G8LA 4G6ZA 2CV1A 4DR6M 3WHKA 4BLCA 4OU7A 4B08A 3U61B 2F5OA 4GC9A 1SXJD 4NXMM 4M0WA 3E4RA 1OFHA 1DGBA 3FUUA 3I4VA 4HL4A 4R7GA 3GRYA 1OFIA 1R2YA 5DYGA 2LH0A 3FD9A 3W0LB 4LF8M 4GRIA 2D7GA 2CEAA 3U60A 4DR1M 2C9OA 4LJ5A 1TH4A 1HQCA 1IM2A 2Y21A 5ITYA 3ZC7B 3L25A 1JQJC 1IN8A 5FSWA 2FFJA 4JN6A 2E5LM 4LZZA 4I8OA 1QZMA 3AV0A 4IBEA 4M9ZA 1G4AE 2XSZD 3QAUA 2VIIA 3J80S 1Z5CA 2QZ4A 2KRUA 3MK6A 2EA0A 2CV2A 2XSZA 3GPUA 5DNYA 3KS8A 1KSFX 3CF6E 3TPZA 3SC3A 3KP0E 5IREB 2RGHA 5EP1A 3SATA 4JYAM 5FTKA 4DV7M 2V1UA 1SXJA 2V1CA 3GLIA 4MH0E 3H4MA 4B3MM 4LRSA 2X49A 3GQ4A 3KOWE 2CV0A 3SHFA 4AQYM 2DZOB 3GPPA 3UGJA 1LV7A 1S3SA 4LF5M 3GLHB 5EXSA 4CHTB 5JI3E 4JXJA 4KLNA 1HNZM 3FUWA 4QHTA 2CE7A 3RGPA 4PT5A 1Q3CA 4IBBA 3SARA 3SBJA 1E9SA 1W5SA 3I4YA 3K8ZA 4DV3M 1HNXM 1DGGA 1QANA 1NNUC 3NBIA 2BJWA 3PNVA 2CFOA 3KOYE 2CUZA 2K47A 3L2AA 2XEPA 3KS4A 1R7RA 2X4AA 1QQWA 3J2PB 3DFZA 4AG6A 5KQ8A 2RKOA 2KXEA 4LFCM 1FJGM 1W5TA 1K3WA 5IZ7D 1J7KA 4WURA 2M5ZA 2ZAMA 3FUTA 4LF9M 5BPVA 4MGKE 5ITUA 2KA6B 1N78A 2KRKA 4QNMA 1IXSB 3T38A 3HU3A 4DV1M 2DXIA 1TGUA 4B3SM 4G4RA 2C5RA 2YQZA 4IBCA 3MHVC 3HHZA 2VQFM 3TWKA 4JI5M 4FWGA 4OVZB 3VKGA 2V6ZM 3GLGB 4G4OA 2BNKA 5EP4A 3HJQA 4B7GA 1NNJA 5IWAM 1VDDA 2XFSA 4D81A 3THGA 3JR5A 3WHLA 1C1KA 5KPRA 1QAOA 1IY1A 2OPFA 3U6LA 1J5EM 4MGIE 2Z4SA 1T3TA 1IBKM 2ZANA 2HCBA 7CATA 4X64M 2DHRA 4DR2M 1TH2A 1XHBA 1ORYB 4YHHM 3U6EA 3HU1A 4GH9A 1N33M 1DO2A 2BJVA 4IBFA 4MM3B 4OW0A 4GMQA 3SAWA 4YY3M 4FW9A 2QP9X 5KO3A 3VK7A 1IBMM 3CTWB 1HT2E 5EP3A 1L2DA 3AOGA 3HKPA 1NHWC 2R46A 1IXZA 3SYKA 3K2LA 4LFBM 4IBGA 2ZBKB 1IN5A 2HKJA 3M6AA 2D7EA 1GLNA 1J09A 1XWIA 2I7NA 2YR0A 4LJ9A 4MB7A 4GIPA 1HR0M 2YNMD 4MGYE 2XLJA 5FTMA 3AOEC 3U61A 4DV0M 3J7AS 1H6UA 4P16A 2LWXA 3GLGA 1SXJB 3GLIB 1HT1E 4B3TM 3SMSA 3GRRA 4IJFA 3UK6A 1FNNA 1IN4A 3DZDA 1XMOM 3U6DA 2CHVA 2P5TA 1QVRA 4RF0A 2F5NA 5H37D 3J27B 3LVWA 1TDZA 5GKNA 3TWLA 2RGOA 2R4EA 1IBLM 2F4VM 2DWNA 2UUCM 4B7FA 4IIWA 3AKZA 3C58A 4JI1M 3TWMA 3GLFB 3Q8XA 4FCVA 4K0KM 3A98B 2C98A 4L16A 5A2QS 1I94M 4QOSA 5EP2A 3KVWA 2I7PA 2L6OA 3B9PA 5KQDA 1ZQ9A 4L78A 4M9SA 3K1JA 4LCBA 3SAUA 3LQQA 1E32A 2H1RA 3ZCBB 3U5ZB 2QBYB 3L29A 4JI2M 4B3RM 1XXHB 2ZAOA 4EIWA 4DUYM 3KOZE 1QAQA 4GKJM 1L2BA 4Z6YA 4PDGA 4PD2A 1DGHB 4G4QA 3HGIA 4CGYB 3AOEA 4QOZC 5FTNA 3KW6A 3SASA 3NWLA 3LQRA 2ERCA 3FKEA 3ILKA 3J7BA 5EXPA 2XZFA 3PFIA 2JA2A 3FTDA 1Z6TA 3GRVA 1SXJE 1EE8A 4REZA 4Z8XA 4JI7M 2DWMA 3RGSA 1NHGC 4BBAA 1MU5A 1SXJC 4KHPM 4B7HA 2Y0QA 4OX9M 3KSXA 1Z59A 3A45A 4FVMA 4NL4H 5LMUM 3VK8A 4OVZA 4DV4M 4LGYA 4AZFA 1N77A 2Y0TA 5KPZA 1JR3A 4IBDA 2HHHM 4JI8M 5EXXA 3U60B 4II7A 1L1ZA 4FCTA 3U6QA 4M9XA 1GL7A 4LZJA 1XC8A 3SMPA 3FUXA 2AHMA 2HL7A 1XNQM 4LJ7A 2XF3A 2W82A 5F3WA 1N36M 4DV6M 4LGMA 4JI6M 4NOOB 3T1YM 3VLFB 1D2NA 4DR7M 2O5RA 2CHGA 3RE8A 4X66M 3T1HM 3HWSA 3R8FA 1NVMA 4DUZM 4FCWA 5EJCA 2XGNA 2YFQA 5FTJA 3LMMA 2QENA 3L28A 1N75A 1IN6A 2KW0A 1L8QA 2Z4RA 4FD2A 1KFVA 2F5SA 4CISA 1Z5BA 3GP1A 2Z3XA 2L09A 3LVVA 2R62A 4GITA 8CATA 2J7NA 5C18A 3TE6A 4DR3M 1HNWM 4RNAA 4S12A 4IBIA 2L7IA 3IG5A 4LF4M 1OJLA 1KYIA 3M0EA 2LXEA 4IBKA 3HJ8A 3GPXA 3AFHA 3UMMA 2Q2EB 4KO8A 2KZUA 1L2CA 1G59A 4X62M 4LFAM 2DVWB 2FE8A 4W5WA 2F5QA 2R18A 2OQ4A 2ZM6M 2F5PA 4TUWA 4AKHA 2EO2A 3FYDA 1YSYA 3CF0A 2R65A 1NSFA 1Z5AA 1K3XA 5ITXA 1R6BX 5BR8M 3T15A 5ITXE 4XBOA 3VFDA 3MJ5A 4QHSA 5EQTA 2C9CA 4IJEA 3FYCA 4DV5M 1G3IA 2G5GX 2QPAA 2DWLA 3R9XB 4NRWA 4I5SA 1NY5A 4LRTA 1YUBA 4DV2M 4HLQA 4AW4A 3GRUA 3EIHA 2LNHC 3SYLA 1L1TA 5ITQA 2X8AA 3U6PA 3KOXE 1NJFA 3U6MA 5LMNM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W0F A;  4B3S M;  1EE8 A;  4G4R A;  5ITT A;  1N34 M;  3SAV A;  4JI7 M;  5IT9 S;  2VQF M;  3TWK A;  4JI5 M;  1PJJ A;  4JI4 M;  3DOA A;  4NRV A;  4G4O A;  1MU5 A;  2UXB M;  4DR6 M;  4KHP M;  4GKK M;  4OX9 M;  1TDH A;  1NNJ A;  1Z59 A;  3A45 A;  5IWA M;  2F5O A;  4NXM M;  5LMU M;  3VK8 A;  4JV5 M;  5ITR A;  3JR5 A;  4DV4 M;  1K82 A;  1R2Y A;  2HHH M;  3GPY A;  4JI8 M;  4LF8 M;  1L1Z A;  4DR1 M;  2UXD M;  3U6M A;  2OPF A;  3U6L A;  3U6Q A;  1J5E M;  1MX0 A;  3U6S A;  4G4N A;  3A42 A;  1IBK M;  1XC8 A;  5ITY A;  4X64 M;  4DR2 M;  1XNQ M;  1Q39 A;  2E5L M;  1N36 M;  4DV6 M;  4YHH M;  3U6E A;  4JI6 M;  1N33 M;  4PCZ A;  3T1Y M;  1XNR M;  3J80 S;  1Z5C A;  4LF7 M;  4DR7 M;  4DR4 M;  3SAW A;  4X66 M;  4YY3 M;  3T1H M;  2EA0 A;  3VK7 A;  1IBM M;  1L2D A;  3GPU A;  4DUZ M;  2VQE M;  4LFB M;  2ZBK B;  3OTO M;  2HKJ A;  3SAT A;  4JYA M;  4DV7 M;  1KFV A;  2F5S A;  4MB7 A;  4CIS A;  1Z5B A;  1HR0 M;  4B3M M;  3GQ4 A;  3GP1 A;  4AQY M;  3GPP A;  4DV0 M;  3J7A S;  1HNW M;  4DR3 M;  4LF5 M;  3JAM S;  1PJI A;  4LF4 M;  4B3T M;  1HNZ M;  1XMO M;  3U6D A;  3GPX A;  1PM5 A;  2Q2E B;  2F5N A;  1L2C A;  1Q3C A;  3SAR A;  3JR4 A;  3SBJ A;  1TDZ A;  3TWL A;  4X62 M;  3A46 A;  4LFA M;  2F4V M;  1IBL M;  2UUA M;  2UUC M;  4PDI A;  4DV3 M;  1HNX M;  4JI1 M;  2F5Q A;  3C58 A;  5FLX S;  2OQ4 A;  4LF6 M;  2ZM6 M;  3TWM A;  2F5P A;  4K0K M;  2UXC M;  1N32 M;  3GO8 A;  1Z5A A;  5A2Q S;  1I94 M;  1Q3B A;  5ITX A;  1K3X A;  5BR8 M;  3U6O A;  5ITX E;  4JI3 M;  3SAU A;  4DV5 M;  2XZU A;  4ITQ A;  4JI2 M;  3GQ3 A;  4B3R M;  3J81 S;  4DUY M;  1R2Z A;  4NRW A;  4DV2 M;  4GKJ M;  1L2B A;  4PDG A;  3U6C A;  4PD2 A;  4G4Q A;  4LFC M;  1FJG M;  4NXN M;  1K3W A;  4X65 M;  3SAS A;  2UUB M;  4LF9 M;  4DR5 M;  1L1T A;  5ITU A;  5ITQ A;  1XMQ M;  2UU9 M;  2XZF A;  3U6P A;  4DV1 M;  3GQ5 A;  4JI0 M;  5LMN M; 
#chains in the Genus database with same CATH topology
 1DGH A;  1DO0 A;  4GC5 A;  4L8R C;  2R4J A;  4D82 A;  5ITT A;  1N34 M;  1DGF A;  3HHX A;  3SAV A;  3ZQJ A;  4FWH A;  5IT9 S;  4AKI A;  1WXQ A;  1PJJ A;  2DZN B;  2NQ8 C;  3DOA A;  3GQ5 A;  4JI4 M;  4LG2 A;  3DA1 A;  3RFW A;  3HJS A;  4GHA A;  3BOS A;  2UXB M;  3FRI A;  1OIZ A;  4GKK M;  3IG8 A;  1TDH A;  2J7O A;  1T6O A;  4LJ4 A;  1HQY E;  4L4U A;  3TQS A;  1C7Y A;  2Z7J A;  4JV5 M;  5ITR A;  3IEC A;  2XH9 A;  2QCU A;  1K82 A;  1QYR A;  3HU2 A;  2FOI C;  3E9S A;  4LY6 A;  1WJ7 A;  3GPY A;  5C1B A;  4GHL A;  4QNR A;  2UXD M;  4RF1 A;  1TH3 A;  2BWE A;  1MX0 A;  3U6S A;  1QAM A;  4G4N A;  3A42 A;  4KOD A;  3FTF A;  2KEB A;  2R45 A;  3ZH9 B;  1QZE A;  3B89 A;  2L7H A;  4WP2 A;  1WGL A;  1Q39 A;  4NSO B;  1PJQ A;  1NY6 A;  2ZTC A;  3SHG B;  2L2D A;  4R3D A;  4LJA A;  1I4W A;  4PCZ A;  5E6J A;  1XNR M;  5DYI A;  4IBJ A;  4LF7 M;  2ZTD A;  4DR4 M;  3QYB A;  1MJG M;  3HHW A;  5L8R F;  4M0D A;  2MGW A;  2HAK A;  1YE9 A;  1UFZ A;  3EIE A;  3B7Z A;  4I4L A;  3PXG A;  2FNA A;  5E26 A;  1IY2 A;  3GLG E;  3UZU A;  2VQE M;  4XGI A;  3KXE C;  1WHC A;  3TL4 X;  3OTO M;  2Z8Y M;  2CHQ A;  3HX3 A;  4MGZ E;  3VDP A;  3I51 A;  3HHY A;  3GLH A;  2LTU A;  3D8B A;  1IQP A;  2DWZ B;  3PVS A;  4AG5 A;  3L27 A;  3KDS E;  3QWL A;  2D7H A;  1JR3 D;  1IXR C;  2JY6 B;  3VDU A;  2Y20 A;  3LW5 F;  1X37 A;  2EKF A;  3KFU G;  1OTR A;  3JAM S;  4KT0 F;  1R5L A;  1PJI A;  1IY0 A;  4WW0 A;  3SFZ A;  4HEO A;  1AIP C;  3CF2 A;  1BVS A;  3UJN A;  2BWB A;  3VKH A;  2A5Y B;  1G41 A;  1UM8 A;  3C9P A;  1PM5 A;  3AJI B;  2L4E A;  4XK8 F;  3JR4 A;  4L15 A;  1VG5 A;  4MGH A;  3A46 A;  1OKS A;  2XFT A;  2UUA M;  1HJP A;  5JI2 E;  4PDI A;  2EUC A;  4A3V B;  5FLX S;  4FWD A;  2L4F A;  4LF6 M;  3AL0 C;  5KPT A;  3GLF A;  4AI6 A;  1G8P A;  2UXC M;  1N32 M;  3D8L A;  4D80 A;  3W67 A;  3GO8 A;  1Q3B A;  3U6O A;  3FUV A;  3M7G A;  3PNY A;  3U5Z A;  4JI3 M;  2QBY A;  4AKG A;  1NJG A;  1QUT A;  2XZU A;  4ITQ A;  5FTL A;  3B74 A;  2LVN C;  3GQ3 A;  1V92 A;  3J81 S;  1R2Z A;  1XXH A;  2VF7 A;  4NC6 A;  2KZS A;  4LJ8 A;  3U6C A;  1GL6 A;  4NXN M;  2C96 A;  4X65 M;  1GKI A;  2UUB M;  4DR5 M;  2APL A;  5EXT A;  2M60 A;  3K92 A;  3KSJ A;  1XMQ M;  1V34 A;  4BB9 A;  2UU9 M;  2CP8 A;  3FTE A;  1IFY A;  3LCU A;  4NSR A;  4JI0 M;  4I81 A;  4LJ6 A;  1GVN A;  3W0F A;  4ZPX A;  2C99 A;  1IN7 A;  1E9R A;  1JR3 E;  3L26 A;  3KP1 E;  2O25 A;  1E94 E;  1ZAE A;  2OO9 A;  4NRV A;  3FTC A;  2G8L A;  4G6Z A;  2FH0 A;  3FE3 A;  2CV1 A;  4DR6 M;  1VEG A;  3WHK A;  2JP7 A;  4BLC A;  4OU7 A;  4B08 A;  2CWB A;  3U61 B;  2F5O A;  4GC9 A;  1SXJ D;  4NXM M;  4F1I A;  4M0W A;  3E4R A;  1OFH A;  1DGB A;  1OIP A;  3FUU A;  3I4V A;  4HL4 A;  4R7G A;  3GRY A;  1OFI A;  1R2Y A;  1AUA A;  2LH0 A;  5DYG A;  1V33 A;  1D0L A;  3FD9 A;  3W0L B;  4LF8 M;  4GRI A;  2D7G A;  2CEA A;  3U60 A;  4DR1 M;  2C9O A;  1LTM A;  4LJ5 A;  1TH4 A;  1HQC A;  2JWS A;  1OQY A;  1IM2 A;  1VEJ A;  2JXN A;  2Y21 A;  1OAO C;  2K0B X;  5ITY A;  1JQJ C;  3ZC7 B;  3L25 A;  1IN8 A;  5FSW A;  2FFJ A;  4JN6 A;  2E5L M;  4LZZ A;  2VDB B;  1QZM A;  3AV0 A;  4I8O A;  4IBE A;  1G4A E;  4M9Z A;  2DAG A;  2XSZ D;  3QAU A;  2VII A;  3J80 S;  1Z5C A;  2QZ4 A;  3LCV B;  2KRU A;  3MK6 A;  2EA0 A;  2CV2 A;  2XSZ A;  3GPU A;  2LVO C;  2KNV A;  2N35 A;  5DNY A;  3KS8 A;  1KSF X;  3CF6 E;  3TPZ A;  3SC3 A;  3KP0 E;  5IRE B;  2RGH A;  5EP1 A;  3SAT A;  4JYA M;  5FTK A;  4DV7 M;  2DAE A;  1VEK A;  1IXS A;  2DNA A;  2V1U A;  1SXJ A;  2V1C A;  3GLI A;  2EJS A;  2R0I A;  4MH0 E;  3H4M A;  4B3M M;  4LRS A;  2X49 A;  3GQ4 A;  3KOW E;  2LVA A;  3FRH A;  3SHF A;  4AQY M;  2DZO B;  3GPP A;  2CV0 A;  4ANR A;  3UGJ A;  1LV7 A;  1S3S A;  1NV8 A;  4LF5 M;  3GLH B;  5EXS A;  4CHT B;  5JI3 E;  1ZMU A;  2DKL A;  4JXJ A;  4KLN A;  3K9O A;  1HNZ M;  3FUW A;  1NO1 A;  4QHT A;  2DAI A;  4R71 A;  2CE7 A;  3RGP A;  4PT5 A;  1Q3C A;  4IBB A;  3SAR A;  3SBJ A;  1E9S A;  1W5S A;  2WSF F;  3I4Y A;  3H4J A;  2WZJ A;  3K8Z A;  4DV3 M;  1HNX M;  1DGG A;  1QAN A;  1QDT A;  1NNU C;  2R6F A;  3NBI A;  2BJW A;  1GJS A;  4CJ6 A;  2EKK A;  3CGW A;  3PNV A;  3T6P A;  2CFO A;  3KOY E;  2CUZ A;  2K47 A;  2XEP A;  3L2A A;  3KS4 A;  1R7R A;  2X4A A;  3C3D A;  1QQW A;  3J2P B;  3DFZ A;  4AG6 A;  5KQ8 A;  2RKO A;  2KXE A;  4LFC M;  1FJG M;  1W5T A;  1K3W A;  5IZ7 D;  1J7K A;  4WUR A;  2KDL A;  2M5Z A;  2ZAM A;  3FUT A;  3V76 A;  4LF9 M;  5BPV A;  4MGK E;  5ITU A;  2KA6 B;  1N78 A;  2KRK A;  4QNM A;  1IXS B;  4RKU F;  3T38 A;  1PRB A;  3HU3 A;  4DV1 M;  4GEW A;  2DXI A;  2DAK A;  1TGU A;  4B3S M;  4G4R A;  2C5R A;  2YQZ A;  3GLH E;  3E21 A;  4IBC A;  3MHV C;  3HHZ A;  2VQF M;  3TWK A;  1A5T A;  4FWG A;  4JI5 M;  3I01 M;  4OVZ B;  1TTE A;  3VKG A;  2V6Z M;  3GLG B;  4G4O A;  2BNK A;  5EP4 A;  3HJQ A;  2DAM A;  2J5Y A;  2DHY A;  4B7G A;  1NNJ A;  5IWA M;  1VDD A;  1YLA A;  1ZMW A;  2XFS A;  4D81 A;  3THG A;  3JR5 A;  1QDR A;  3WHL A;  1C1K A;  5KPR A;  1WR1 B;  1QAO A;  2JZ1 A;  1IY1 A;  2JY7 A;  3QYE A;  2OPF A;  3U6L A;  1J5E M;  4MGI E;  2Z4S A;  2HWJ A;  1T3T A;  1IBK M;  2K9D A;  2ZAN A;  2HCB A;  3BBZ A;  7CAT A;  4X64 M;  2DHR A;  4DR2 M;  1TH2 A;  2G3Q A;  1XHB A;  1ORY B;  4YHH M;  3U6E A;  3HU1 A;  4GH9 A;  1N33 M;  1DO2 A;  2BJV A;  1EIJ A;  1D0M A;  4IBF A;  4MM3 B;  4OW0 A;  4GMQ A;  3SAW A;  4YY3 M;  4FW9 A;  2QP9 X;  5KO3 A;  3VK7 A;  1IBM M;  3CTW B;  3W68 A;  1HT2 E;  5EP3 A;  3HZJ A;  3AOG A;  3HKP A;  1L2D A;  1NHW C;  1WGN A;  2R46 A;  1IXZ A;  3SYK A;  3K2L A;  4LFB M;  1TF0 B;  4IBG A;  1WIV A;  2ZBK B;  1IN5 A;  2HKJ A;  3M6A A;  2D7E A;  1GLN A;  1J09 A;  1XWI A;  1T43 A;  2I7N A;  2YR0 A;  4LJ9 A;  2KNZ A;  4MB7 A;  4GIP A;  1HR0 M;  2YNM D;  4MGY E;  2XLJ A;  5FTM A;  3AOE C;  1Y8G A;  1VDL A;  3U61 A;  4DV0 M;  3J7A S;  1H6U A;  4P16 A;  1ZV1 A;  2LHC A;  2LWX A;  2JY5 A;  3I04 M;  3GLG A;  1SXJ B;  3GLI B;  1HT1 E;  4B3T M;  3SMS A;  2LVQ D;  3GRR A;  4IJF A;  3UK6 A;  1FNN A;  1IN4 A;  3DZD A;  1XMO M;  3U6D A;  2MH8 A;  2CHV A;  2P5T A;  1QVR A;  4RF0 A;  2F5N A;  5H37 D;  3J27 B;  3LVW A;  1TDZ A;  5GKN A;  3TWL A;  2RGO A;  2QQ8 A;  2FS1 A;  2R4E A;  1IBL M;  2F4V M;  2DWN A;  2UUC M;  1EFU B;  4B7F A;  1PJT A;  4IIW A;  3AKZ A;  3C58 A;  4JI1 M;  3TWM A;  3GLF B;  3BXW A;  3Q8X A;  4FCV A;  2WSC F;  4K0K M;  1DV0 A;  3A98 B;  2C98 A;  2RRU A;  4L16 A;  1QUS A;  5A2Q S;  1I94 M;  4QOS A;  5EP2 A;  3KVW A;  2I7P A;  2L6O A;  3B9P A;  5KQD A;  1ZQ9 A;  4L78 A;  4M9S A;  3K1J A;  4LCB A;  3SAU A;  3LQQ A;  1E32 A;  2H1R A;  3ZCB B;  3U5Z B;  2QBY B;  3L29 A;  4JI2 M;  4B3R M;  3GLF E;  2OOA A;  1XXH B;  2ZAO A;  4EIW A;  1PGY A;  3KOZ E;  4DUY M;  1QAQ A;  4GKJ M;  2WSE F;  4Z6Y A;  4PDG A;  4PD2 A;  1DGH B;  4G4Q A;  1L2B A;  2GNO A;  3HGI A;  4CGY B;  3AOE A;  4QOZ C;  2H5X A;  5FTN A;  3KW6 A;  1XB2 B;  3SAS A;  2JZ0 A;  2ERC A;  3FKE A;  2K6B A;  3ILK A;  3J7B A;  3LQR A;  3NWL A;  5EXP A;  2XZF A;  3PFI A;  2JA2 A;  3FTD A;  1SG9 A;  1Q02 A;  2QHO B;  1Z6T A;  3GRV A;  1SXJ E;  1EE8 A;  4REZ A;  4Z8X A;  3C3E A;  3GLI E;  3NBX X;  2LBC A;  1D0K A;  4JI7 M;  2DWM A;  4Q7J A;  3RGS A;  1NHG C;  4BBA A;  4L6V 6;  2KNA A;  1MU5 A;  1SXJ C;  4KHP M;  4B7H A;  1OAI A;  2Y0Q A;  4OX9 M;  3KSX A;  1Z59 A;  3A45 A;  4FVM A;  4NL4 H;  5LMU M;  3VK8 A;  1TR8 A;  4OVZ A;  4DV4 M;  4LGY A;  3F92 A;  3MMP A;  3B7N A;  4AZF A;  1N77 A;  2Y0T A;  4F2L A;  5KPZ A;  1JR3 A;  4IBD A;  2HHH M;  4JI8 M;  5EXX A;  3U60 B;  4II7 A;  1L1Z A;  5DFL A;  2MRO B;  4FCT A;  3U6Q A;  2LVP C;  4M9X A;  2QSF X;  1GAB A;  1GL7 A;  1R4G A;  4LZJ A;  1XC8 A;  3SMP A;  3FUX A;  2AHM A;  2O01 F;  2HL7 A;  2MJ5 B;  1XNQ M;  2OOB A;  2XF3 A;  2W82 A;  4LJ7 A;  5F3W A;  1N36 M;  4DV6 M;  4LGM A;  4JI6 M;  4NOO B;  1G71 A;  3T1Y M;  3VLF B;  1D2N A;  4DR7 M;  2O5R A;  2CHG A;  1F4I A;  3RE8 A;  4X66 M;  3T1H M;  3HWS A;  1CUK A;  2DZL A;  3R8F A;  1NVM A;  4DUZ M;  4FCW A;  5EJC A;  2XGN A;  2YFQ A;  5FTJ A;  3LMM A;  2R44 A;  4CIZ A;  2QEN A;  3L28 A;  1N75 A;  1P3Q Q;  1IN6 A;  1PJS A;  2KW0 A;  2B3T A;  1L8Q A;  2QNJ A;  2Z4R A;  4P17 A;  3K9P A;  4FD2 A;  1KFV A;  2F5S A;  4CIS A;  1Z5B A;  1VQ1 A;  3GP1 A;  2VF8 A;  2Z3X A;  2L09 A;  3LVV A;  2R62 A;  4GIT A;  8CAT A;  2J7N A;  5C18 A;  3TE6 A;  2MR9 A;  4DR3 M;  4RNA A;  4S12 A;  1ZMV A;  1HNW M;  2GQF A;  4IBI A;  2L7I A;  3IG5 A;  4LF4 M;  2KHH A;  1OJL A;  4DBG B;  1KYI A;  3M0E A;  2LHG A;  2LXE A;  4IBK A;  3HJ8 A;  4G3O A;  3GPX A;  3AFH A;  3UMM A;  2Q2E B;  2DI0 A;  4KO8 A;  2DEN A;  3HY5 A;  2KZU A;  1L2C A;  2CRU A;  3B7Q A;  1G59 A;  4X62 M;  4LFA M;  4UN2 B;  2DVW B;  2FE8 A;  1RU3 A;  4W5W A;  2F5Q A;  2R18 A;  2OQ4 A;  2ZM6 M;  2F5P A;  4TUW A;  4AKH A;  2EO2 A;  3FYD A;  1YSY A;  3CF0 A;  2R65 A;  1NSF A;  1Z5A A;  3IHP A;  1K3X A;  5ITX A;  1R6B X;  5BR8 M;  3T15 A;  5ITX E;  4XBO A;  3VFD A;  3MJ5 A;  1GO5 A;  4QHS A;  5EQT A;  2C9C A;  4IJE A;  3FYC A;  4DV5 M;  1G3I A;  2G5G X;  1GJT A;  2QPA A;  2JY8 A;  2DWL A;  3R9X B;  4NRW A;  4I5S A;  1NY5 A;  1JB0 F;  1YUB A;  4LRT A;  4DV2 M;  4HLQ A;  2JNH A;  3E46 A;  3Q8G A;  1NV9 A;  4Y28 F;  3GRU A;  4AW4 A;  3EIH A;  2LNH C;  3SYL A;  1L1T A;  5ITQ A;  2JUJ A;  2X8A A;  1MN3 A;  3U6P A;  3KOX E;  1XXH E;  1NJF A;  3U6M A;  5LMN M; 
#chains in the Genus database with same CATH homology
 1DGH A;  1DO0 A;  4GC5 A;  4L8R C;  2R4J A;  4D82 A;  5ITT A;  1N34 M;  1DGF A;  3HHX A;  3SAV A;  5IT9 S;  4FWH A;  4AKI A;  1WXQ A;  1PJJ A;  2DZN B;  2NQ8 C;  3DOA A;  3GQ5 A;  4JI4 M;  4LG2 A;  3DA1 A;  3RFW A;  3HJS A;  4GHA A;  3BOS A;  2UXB M;  4GKK M;  3IG8 A;  1TDH A;  2J7O A;  4LJ4 A;  1HQY E;  4L4U A;  3TQS A;  4JV5 M;  2Z7J A;  5ITR A;  2XH9 A;  2QCU A;  1K82 A;  1QYR A;  3HU2 A;  2FOI C;  3E9S A;  4LY6 A;  4GHL A;  3GPY A;  5C1B A;  4QNR A;  2UXD M;  4RF1 A;  1TH3 A;  1MX0 A;  3U6S A;  1QAM A;  4G4N A;  3A42 A;  4KOD A;  3FTF A;  2KEB A;  2R45 A;  3ZH9 B;  2L7H A;  4NSO B;  1Q39 A;  1NY6 A;  3SHG B;  4R3D A;  4LJA A;  1I4W A;  4PCZ A;  5E6J A;  1XNR M;  5DYI A;  4IBJ A;  4LF7 M;  4DR4 M;  3HHW A;  4M0D A;  1YE9 A;  3EIE A;  4I4L A;  3PXG A;  2FNA A;  5E26 A;  1IY2 A;  3UZU A;  2VQE M;  4XGI A;  3KXE C;  3TL4 X;  3OTO M;  3VDP A;  2CHQ A;  4MGZ E;  3I51 A;  3HHY A;  3GLH A;  3D8B A;  1IQP A;  2DWZ B;  3PVS A;  4AG5 A;  3L27 A;  3KDS E;  3QWL A;  2D7H A;  1JR3 D;  1IXR C;  3VDU A;  2Y20 A;  1X37 A;  3KFU G;  3JAM S;  1PJI A;  1IY0 A;  4WW0 A;  3SFZ A;  3CF2 A;  3UJN A;  3VKH A;  2A5Y B;  1G41 A;  1UM8 A;  1PM5 A;  3AJI B;  3JR4 A;  4L15 A;  3A46 A;  4MGH A;  2XFT A;  2UUA M;  5JI2 E;  4PDI A;  2EUC A;  4A3V B;  5FLX S;  4FWD A;  4LF6 M;  3AL0 C;  5KPT A;  3GLF A;  4AI6 A;  1G8P A;  2UXC M;  1N32 M;  3D8L A;  4D80 A;  3GO8 A;  1Q3B A;  3U6O A;  3FUV A;  3M7G A;  3PNY A;  3U5Z A;  4JI3 M;  2QBY A;  4AKG A;  1NJG A;  2XZU A;  4ITQ A;  5FTL A;  3GQ3 A;  3J81 S;  1R2Z A;  1XXH A;  2KZS A;  4LJ8 A;  3U6C A;  1GL6 A;  4NXN M;  2C96 A;  4X65 M;  1GKI A;  2UUB M;  4DR5 M;  5EXT A;  2M60 A;  3K92 A;  3KSJ A;  1XMQ M;  2UU9 M;  4BB9 A;  3FTE A;  4NSR A;  4JI0 M;  4I81 A;  4LJ6 A;  1GVN A;  3W0F A;  4ZPX A;  2C99 A;  1IN7 A;  1E9R A;  3L26 A;  3KP1 E;  1E94 E;  1ZAE A;  4NRV A;  3FTC A;  2G8L A;  4G6Z A;  2CV1 A;  4DR6 M;  3WHK A;  4BLC A;  4OU7 A;  4B08 A;  3U61 B;  2F5O A;  4GC9 A;  1SXJ D;  4NXM M;  4M0W A;  3E4R A;  1OFH A;  1DGB A;  3FUU A;  3I4V A;  4HL4 A;  4R7G A;  3GRY A;  1OFI A;  1R2Y A;  5DYG A;  2LH0 A;  3FD9 A;  3W0L B;  4LF8 M;  4GRI A;  2D7G A;  2CEA A;  3U60 A;  4DR1 M;  2C9O A;  4LJ5 A;  1TH4 A;  1HQC A;  1IM2 A;  2Y21 A;  5ITY A;  3ZC7 B;  3L25 A;  1JQJ C;  1IN8 A;  5FSW A;  2FFJ A;  4JN6 A;  2E5L M;  4LZZ A;  4I8O A;  1QZM A;  3AV0 A;  4IBE A;  4M9Z A;  1G4A E;  2XSZ D;  3QAU A;  2VII A;  3J80 S;  1Z5C A;  2QZ4 A;  2KRU A;  3MK6 A;  2EA0 A;  2CV2 A;  2XSZ A;  3GPU A;  5DNY A;  3KS8 A;  1KSF X;  3CF6 E;  3TPZ A;  3SC3 A;  3KP0 E;  5IRE B;  2RGH A;  5EP1 A;  3SAT A;  4JYA M;  5FTK A;  4DV7 M;  2V1U A;  1SXJ A;  2V1C A;  3GLI A;  4MH0 E;  3H4M A;  4B3M M;  4LRS A;  2X49 A;  3GQ4 A;  3KOW E;  2CV0 A;  3SHF A;  4AQY M;  2DZO B;  3GPP A;  3UGJ A;  1LV7 A;  1S3S A;  4LF5 M;  3GLH B;  5EXS A;  4CHT B;  5JI3 E;  4JXJ A;  4KLN A;  1HNZ M;  3FUW A;  4QHT A;  2CE7 A;  3RGP A;  4PT5 A;  1Q3C A;  4IBB A;  3SAR A;  3SBJ A;  1E9S A;  1W5S A;  3I4Y A;  3K8Z A;  4DV3 M;  1HNX M;  1DGG A;  1QAN A;  1NNU C;  3NBI A;  2BJW A;  3PNV A;  2CFO A;  3KOY E;  2CUZ A;  2K47 A;  3L2A A;  2XEP A;  3KS4 A;  1R7R A;  2X4A A;  1QQW A;  3J2P B;  3DFZ A;  4AG6 A;  5KQ8 A;  2RKO A;  2KXE A;  4LFC M;  1FJG M;  1W5T A;  1K3W A;  5IZ7 D;  1J7K A;  4WUR A;  2M5Z A;  2ZAM A;  3FUT A;  4LF9 M;  5BPV A;  4MGK E;  5ITU A;  2KA6 B;  1N78 A;  2KRK A;  4QNM A;  1IXS B;  3T38 A;  3HU3 A;  4DV1 M;  2DXI A;  1TGU A;  4B3S M;  4G4R A;  2C5R A;  2YQZ A;  4IBC A;  3MHV C;  3HHZ A;  2VQF M;  3TWK A;  4JI5 M;  4FWG A;  4OVZ B;  3VKG A;  2V6Z M;  3GLG B;  4G4O A;  2BNK A;  5EP4 A;  3HJQ A;  4B7G A;  1NNJ A;  5IWA M;  1VDD A;  2XFS A;  4D81 A;  3THG A;  3JR5 A;  3WHL A;  1C1K A;  5KPR A;  1QAO A;  1IY1 A;  2OPF A;  3U6L A;  1J5E M;  4MGI E;  2Z4S A;  1T3T A;  1IBK M;  2ZAN A;  2HCB A;  7CAT A;  4X64 M;  2DHR A;  4DR2 M;  1TH2 A;  1XHB A;  1ORY B;  4YHH M;  3U6E A;  3HU1 A;  4GH9 A;  1N33 M;  1DO2 A;  2BJV A;  4IBF A;  4MM3 B;  4OW0 A;  4GMQ A;  3SAW A;  4YY3 M;  4FW9 A;  2QP9 X;  5KO3 A;  3VK7 A;  1IBM M;  3CTW B;  1HT2 E;  5EP3 A;  1L2D A;  3AOG A;  3HKP A;  1NHW C;  2R46 A;  1IXZ A;  3SYK A;  3K2L A;  4LFB M;  4IBG A;  2ZBK B;  1IN5 A;  2HKJ A;  3M6A A;  2D7E A;  1GLN A;  1J09 A;  1XWI A;  2I7N A;  2YR0 A;  4LJ9 A;  4MB7 A;  4GIP A;  1HR0 M;  2YNM D;  4MGY E;  2XLJ A;  5FTM A;  3AOE C;  3U61 A;  4DV0 M;  3J7A S;  1H6U A;  4P16 A;  2LWX A;  3GLG A;  1SXJ B;  3GLI B;  1HT1 E;  4B3T M;  3SMS A;  3GRR A;  4IJF A;  3UK6 A;  1FNN A;  1IN4 A;  3DZD A;  1XMO M;  3U6D A;  2CHV A;  2P5T A;  1QVR A;  4RF0 A;  2F5N A;  5H37 D;  3J27 B;  3LVW A;  1TDZ A;  5GKN A;  3TWL A;  2RGO A;  2R4E A;  1IBL M;  2F4V M;  2DWN A;  2UUC M;  4B7F A;  4IIW A;  3AKZ A;  3C58 A;  4JI1 M;  3TWM A;  3GLF B;  3Q8X A;  4FCV A;  4K0K M;  3A98 B;  2C98 A;  4L16 A;  5A2Q S;  1I94 M;  4QOS A;  5EP2 A;  3KVW A;  2I7P A;  2L6O A;  3B9P A;  5KQD A;  1ZQ9 A;  4L78 A;  4M9S A;  3K1J A;  4LCB A;  3SAU A;  3LQQ A;  1E32 A;  2H1R A;  3ZCB B;  3U5Z B;  2QBY B;  3L29 A;  4JI2 M;  4B3R M;  1XXH B;  2ZAO A;  4EIW A;  4DUY M;  3KOZ E;  1QAQ A;  4GKJ M;  1L2B A;  4Z6Y A;  4PDG A;  4PD2 A;  1DGH B;  4G4Q A;  3HGI A;  4CGY B;  3AOE A;  4QOZ C;  5FTN A;  3KW6 A;  3SAS A;  3NWL A;  3LQR A;  2ERC A;  3FKE A;  3ILK A;  3J7B A;  5EXP A;  2XZF A;  3PFI A;  2JA2 A;  3FTD A;  1Z6T A;  3GRV A;  1SXJ E;  1EE8 A;  4REZ A;  4Z8X A;  4JI7 M;  2DWM A;  3RGS A;  1NHG C;  4BBA A;  1MU5 A;  1SXJ C;  4KHP M;  4B7H A;  2Y0Q A;  4OX9 M;  3KSX A;  1Z59 A;  3A45 A;  4FVM A;  4NL4 H;  5LMU M;  3VK8 A;  4OVZ A;  4DV4 M;  4LGY A;  4AZF A;  1N77 A;  2Y0T A;  5KPZ A;  1JR3 A;  4IBD A;  2HHH M;  4JI8 M;  5EXX A;  3U60 B;  4II7 A;  1L1Z A;  4FCT A;  3U6Q A;  4M9X A;  1GL7 A;  4LZJ A;  1XC8 A;  3SMP A;  3FUX A;  2AHM A;  2HL7 A;  1XNQ M;  4LJ7 A;  2XF3 A;  2W82 A;  5F3W A;  1N36 M;  4DV6 M;  4LGM A;  4JI6 M;  4NOO B;  3T1Y M;  3VLF B;  1D2N A;  4DR7 M;  2O5R A;  2CHG A;  3RE8 A;  4X66 M;  3T1H M;  3HWS A;  3R8F A;  1NVM A;  4DUZ M;  4FCW A;  5EJC A;  2XGN A;  2YFQ A;  5FTJ A;  3LMM A;  2QEN A;  3L28 A;  1N75 A;  1IN6 A;  2KW0 A;  1L8Q A;  2Z4R A;  4FD2 A;  1KFV A;  2F5S A;  4CIS A;  1Z5B A;  3GP1 A;  2Z3X A;  2L09 A;  3LVV A;  2R62 A;  4GIT A;  8CAT A;  2J7N A;  5C18 A;  3TE6 A;  4DR3 M;  1HNW M;  4RNA A;  4S12 A;  4IBI A;  2L7I A;  3IG5 A;  4LF4 M;  1OJL A;  1KYI A;  3M0E A;  2LXE A;  4IBK A;  3HJ8 A;  3GPX A;  3AFH A;  3UMM A;  2Q2E B;  4KO8 A;  2KZU A;  1L2C A;  1G59 A;  4X62 M;  4LFA M;  2DVW B;  2FE8 A;  4W5W A;  2F5Q A;  2R18 A;  2OQ4 A;  2ZM6 M;  2F5P A;  4TUW A;  4AKH A;  2EO2 A;  3FYD A;  1YSY A;  3CF0 A;  2R65 A;  1NSF A;  1Z5A A;  1K3X A;  5ITX A;  1R6B X;  5BR8 M;  3T15 A;  5ITX E;  4XBO A;  3VFD A;  3MJ5 A;  4QHS A;  5EQT A;  2C9C A;  4IJE A;  3FYC A;  4DV5 M;  1G3I A;  2G5G X;  2QPA A;  2DWL A;  3R9X B;  4NRW A;  4I5S A;  1NY5 A;  4LRT A;  1YUB A;  4DV2 M;  4HLQ A;  4AW4 A;  3GRU A;  3EIH A;  2LNH C;  3SYL A;  1L1T A;  5ITQ A;  2X8A A;  3U6P A;  3KOX E;  1NJF A;  3U6M A;  5LMN M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...