1K3WA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
254
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
total genus 81
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3wA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3wA01
3TWKA 4X65M 4PDIA 2OPFA 2F5NA 1HR0M 3A46A 4DV2M 4JI7M 5ITYA 3J81S 4LFAM 4DV5M 4DR2M 3SBJA 1Z59A 4JI5M 3J7AS 4K0KM 2XZFA 2HHHM 2F5PA 4JI1M 2ZBKB 2UXBM 3U6SA 4LFCM 3OTOM 5ITXA 4DUZM 4MB7A 2F5OA 3SAVA 4LF9M 3U6MA 1K3XA 2E5LM 4OX9M 4LF8M 4DR5M 1NNJA 1N32M 4PCZA 2UXDM 3U6DA 3GPUA 4YHHM 2XZUA 2HKJA 4G4OA 3A45A 1I94M 3VK8A 2F5QA 4KHPM 1Z5CA 3GP1A 2UXCM 4X62M 4CISA 3GO8A 5LMUM 1TDHA 1HNXM 4JV5M 2VQEM 1K82A 3U6LA 4NRWA 4DV7M 4DV3M 3VK7A 2F5SA 1IBLM 3GQ4A 5LMNM 1L2CA 4LF7M 5ITRA 1XNQM 4GKJM 4B3MM 3U6CA 5IT9S 1L1TA 3TWMA 5ITXE 3SARA 1FJGM 1R2YA 3DOAA 1Z5AA 4JI6M 1N36M 4NXMM 1XMOM 1L2BA 3U6EA 1L2DA 1MU5A 1PJJA 4LFBM 3U6QA 3JAMS 2EA0A 4JI2M 4X64M 3T1HM 4JI4M 4JI0M 1HNWM 3J80S 3SAWA 1XNRM 4DR6M 2F4VM 1J5EM 4G4QA 3U6OA 5ITQA 4G4NA 4B3RM 4DR4M 3GPXA 1Q39A 1IBKM 4LF6M 3JR4A 2UUAM 4B3TM 1PM5A 4DV6M 1R2ZA 1TDZA 3A42A 5A2QS 1PJIA 3SASA 3JR5A 1Q3BA 4G4RA 4AQYM 4PD2A 4DR1M 3SAUA 1N34M 1Q3CA 5IWAM 1N33M 4DUYM 4ITQA 4DR3M 1HNZM 4X66M 4JI3M 3TWLA 4B3SM 4PDGA 1EE8A 1XC8A 4DR7M 4LF5M 3GQ5A 1MX0A 5ITUA 2ZM6M 1IBMM 4GKKM 4NXNM 5FLXS 4DV1M 3W0FA 1L1ZA 4YY3M 5BR8M 2VQFM 1Z5BA 2UUBM 4JI8M 3SATA 4JYAM 3GPPA 2OQ4A 3U6PA 3GPYA 2Q2EB 1KFVA 2UUCM 4DV0M 4DV4M 1K3WA 4LF4M 5ITTA 2UU9M 3C58A 3GQ3A 4NRVA 3T1YM 1XMQM
chains in the Genus database with same CATH superfamily
4FVMA 4GC9A 2Z7JA 2QNJA 1E9SA 4RKUF 4XBOA 4PDIA 2F5NA 1HR0M 1IXSA 4JI7M 1IM2A 2ZANA 1N75A 3L27A 2JUJA 1QUTA 4QNMA 2VIIA 3SBJA 1Z59A 1VQ1A 8CATA 1C7YA 3KP1E 2XZFA 2X4AA 2EJSA 2QPAA 3UK6A 2MGWA 4QNRA 7CATA 1VEGA 4IBDA 2F5PA 1GO5A 4FWHA 3V76A 1D0MA 4NSRA 3GLGA 1TGUA 1NV8A 3KS4A 3LMMA 3W68A 2QSFX 3D8BA 4LFCM 2R45A 2YQZA 3OTOM 4XK8F 2QP9X 3GLIE 4DUZM 4MB7A 2KNZA 2F5OA 4AKGA 1DGBA 1QDRA 3FTEA 4I4LA 3KDSE 1BVSA 1F4IA 4TUWA 2XZUA 2CRUA 4G4OA 3J7BA 2JZ0A 2UXCM 4B7HA 1QDTA 3L26A 5LMUM 1HNXM 4JV5M 1NJFA 4LY6A 3CTWB 1Z6TA 4NRWA 3HGIA 4DV7M 1EFUB 1TR8A 3MJ5A 3VK7A 3WHLA 5EQTA 5FTMA 4Z6YA 5LMNM 2Z8YM 3HU3A 1XNQM 4GKJM 5DFLA 4MGZE 3U6CA 5IT9S 4I8OA 2FFJA 2OOAA 2GQFA 3TWMA 1GLNA 2X8AA 3LW5F 3FRIA 2A5YB 2XEPA 4KT0F 1N36M 1TF0B 1G4AE 4LG2A 1XMOM 1L2BA 4M9ZA 3RFWA 3BBZA 3GLHE 4LFBM 1QVRA 3GRRA 3HHXA 4GITA 2LTUA 4JI4M 3VFDA 3DFZA 3SAWA 1G41A 1QYRA 4LCBA 2LVPC 2V1UA 2R4JA 3CF2A 3W67A 5KPTA 4RNAA 4B3RM 2ERCA 3GPXA 2DZLA 1GL7A 3UJNA 3SMPA 4B3TM 2JXNA 2JY7A 1R6BX 2KRKA 5JI2E 1ZV1A 2XFSA 2J5YA 3JR5A 4RF0A 4LJ8A 3C3DA 4G4RA 1KSFX 1QZEA 2G3QA 5IWAM 4AKHA 4LGYA 2R44A 2YR0A 4DUYM 4ITQA 3KSJA 5GKNA 5FTKA 2RKOA 2FOIC 4FCWA 3SFZA 4B3SM 2R18A 1T3TA 3GQ5A 1HQCA 5ITUA 3NWLA 2JY8A 4NXNM 3GLFB 3BOSA 1HQYE 3KOXE 2CHQA 4M0WA 4LRTA 1ORYB 4CGYB 3T15A 3T6PA 4WW0A 1OQYA 5KPZA 1G71A 2AHMA 1J09A 3E21A 2EKFA 2LNHC 3U6PA 2DENA 3ZC7B 1KFVA 2JY6B 3MHVC 2P5TA 1K3WA 1OIPA 2LH0A 4MGIE 2CE7A 4PT5A 2D7HA 3QAUA 4L78A 4R7GA 2UU9M 2DAGA 1OAIA 2MROB 1NNUC 1S3SA 3EIEA 2C98A 2LVAA 2DWZB 2OPFA 3D8LA 3KSXA 3B7QA 2O01F 3LCVB 3KVWA 2YFQA 4KO8A 2XLJA 4LFAM 3AOEA 1FNNA 1QUSA 3J7AS 3MK6A 4K0KM 4WURA 1JR3E 3PFIA 5EP2A 5FSWA 1R4GA 3THGA 1PJQA 1PJTA 1VG5A 2WSEF 2R4EA 2HHHM 4QOZC 4DBGB 3FUTA 1LTMA 3KXEC 4FWDA 1IN5A 2ZBKB 2RRUA 2UXBM 1WR1B 4XGIA 3LQRA 3IG8A 5ITXA 2BJWA 3DA1A 1JQJC 2L4EA 1DV0A 4NC6A 1PJSA 2EO2A 2DWLA 4OX9M 4HL4A 1IN8A 5BPVA 2C9OA 1HT2E 1YLAA 4LF8M 1EIJA 1GJTA 4F1IA 1ZQ9A 1RU3A 3U61A 5H37D 4GH9A 1NNJA 4MGYE 4AI6A 3GLIB 2VF8A 2F5QA 4S12A 2Y0QA 3VK8A 1Z5CA 3GP1A 3QYEA 4CISA 1E9RA 2Z4SA 1TDHA 1IY0A 3FUXA 4IJEA 1T6OA 2VQEM 1OAOC 2HL7A 2LVQD 3SMSA 5KO3A 2QHOB 2F5SA 1ZAEA 2FNAA 3FUUA 3GQ4A 1SXJC 1L2CA 4LF7M 2Y20A 4D82A 3GLGE 3H4JA 3L28A 4QOSA 2Z3XA 2LXEA 2ZTCA 1L1TA 2YNMD 1C1KA 2APLA 4L4UA 2JP7A 2QENA 3F92A 2KNAA 4LJ4A 2EKKA 4HEOA 4LZZA 1Z5AA 4LJAA 1XWIA 2KW0A 4JI6M 4JN6A 4NXMM 3B89A 2DAKA 3K92A 1L2DA 1MU5A 2QZ4A 4F2LA 1SXJD 3JAMS 3SYLA 4JI2M 4IBEA 2KZSA 3K9PA 1G59A 1IN7A 1D2NA 4LJ9A 1QQWA 1XXHA 2DWNA 1J5EM 2F4VM 1DO2A 4GMQA 4QHSA 4G4NA 4CHTB 1IFYA 1ZMUA 2FH0A 1Q39A 2N35A 2BWEA 2JZ1A 2R46A 3K9OA 3PVSA 1IXRC 1TDZA 1VDLA 3A42A 1LV7A 1PJIA 4NSOB 2WSCF 3J27B 4AQYM 2JWSA 4DR1M 4P16A 1GABA 3L2AA 2EUCA 4DR3M 1HNZM 3C9PA 1CUKA 4I5SA 4JI3M 5EP1A 4II7A 3TWLA 4PDGA 2O25A 4MM3B 1QZMA 2ZAOA 1OFIA 4GKKM 2L09A 1IBMM 2J7NA 2HAKA 5FLXS 3HJ8A 4DV1M 3W0FA 1WHCA 2GNOA 4YY3M 1WGLA 2J7OA 5BR8M 1IXZA 2UUBM 2VF7A 3SATA 1DGGA 2O5RA 2JNHA 3GRVA 1PGYA 3VKGA 2M5ZA 4I81A 5EXPA 3GPYA 4MH0E 4G6ZA 3PNYA 4LGMA 1P3QQ 4FWGA 5IREB 2KXEA 5FTLA 3I4VA 3AJIB 5ITTA 2DAIA 3I4YA 3I04M 4LRSA 2MR9A 3HJSA 4IIWA 3C58A 4NRVA 4HLQA 4X65M 1V92A 1AUAA 3K1JA 2I7NA 4DV2M 4GC5A 3E9SA 5ITYA 3HHZA 3IG5A 3GRYA 1NHWC 5C1BA 3B7ZA 4JI5M 1NJGA 1GJSA 1NO1A 3VDUA 2DWMA 2QBYB 3KP0E 2H1RA 2NQ8C 3IECA 5FTNA 4JI1M 2KNVA 5JI3E 4MGKE 1WIVA 4FW9A 3HKPA 3PXGA 1DO0A 2HCBA 2V1CA 5IZ7D 5C18A 2R62A 3B74A 4B7GA 3HHYA 2XSZD 2LVNC 4LF9M 3SAVA 1VEJA 1IN4A 3L29A 2R6FA 1HJPA 3U6MA 1DGHB 1TH4A 1T43A 1Y8GA 3AV0A 4FD2A 4DR5M 2D7GA 4PCZA 5KQ8A 5DYIA 4OW0A 3U6DA 1NVMA 1D0KA 1G3IA 2K9DA 4YHHM 2HKJA 3AKZA 1I94M 3NBIA 4GRIA 1NSFA 4AW4A 1IN6A 2B3TA 4X62M 3K2LA 1SXJB 3UMMA 2Z4RA 3UGJA 1W5TA 3FTFA 1H6UA 4G3OA 3U6LA 4L6V6 4DV3M 4P17A 4REZA 4OU7A 2I7PA 5EXTA 1IBLM 1UFZA 1E32A 4IBIA 4FCVA 2W82A 3ZCBB 2KEBA 3HZJA 4KODA 3GRUA 4LZJA 4B3MM 4L8RC 4L16A 2CV1A 3B9PA 1NHGC 3J2PB 1YSYA 5ITXE 3SARA 3AFHA 1GL6A 3DOAA 2DVWB 5FTJA 1GKIA 3GLGB 2QBYA 3GLFA 3AL0C 1AIPC 2JA2A 2KRUA 3AOEC 4GIPA 3UZUA 2K6BA 1IY2A 3LVVA 1X37A 3FKEA 2BJVA 2EA0A 1TH2A 5EJCA 3T1HM 4GHLA 1WJ7A 3U5ZB 1VDDA 3J80S 2OO9A 4IBBA 1XNRM 2QCUA 1MN3A 1OTRA 2MH8A 3R8FA 3MMPA 4G4QA 1OKSA 3U6OA 4CIZA 4IBJA 4B7FA 4UN2B 5KPRA 1GVNA 2CV0A 4LF6M 3FTCA 1XB2B 1OJLA 2KA6B 4BBAA 4FCTA 4IBCA 2UUAM 1JR3D 1PM5A 4DV6M 1R2ZA 3SC3A 1XHBA 5A2QS 2DXIA 1Q3BA 2MJ5B 5E26A 4PD2A 3SAUA 3HWSA 4AG5A 2C5RA 3KW6A 2RGHA 4NL4H 1VEKA 2C9CA 4M0DA 4GEWA 4X66M 3KS8A 1YE9A 2C96A 1XC8A 3TE6A 4LF5M 2CHVA 2OOBA 5DYGA 1NY6A 2KHHA 5KQDA 1XXHE 4JI8M 3GLHB 2JY5A 2BNKA 2XFTA 3U60B 3WHKA 3LQQA 4JYAM 2LWXA 4LJ7A 1QAOA 2D7EA 2OQ4A 2XH9A 3GLIA 2ZAMA 2Q2EB 2DKLA 2CWBA 2CP8A 4DV0M 4DV4M 4LF4M 3U5ZA 4OVZB 3QYBA 4R3DA 3KOWE 2L2DA 1I4WA 3KFUG 1ZMWA 3ILKA 1XMQM 3KOYE 5EP3A 3TWKA 2CUZA 1N78A 2Y0TA 2L6OA 2H5XA 1DGFA 2ZTDA 3FYCA 3A46A 3J81S 4DV5M 2FS1A 1YUBA 3HU2A 4DR2M 1R5LA 3M0EA 3VDPA 2CFOA 3L25A 1SG9A 1ZMVA 3FE3A 3NBXX 4JXJA 1OFHA 3U6SA 2KDLA 3CF0A 2LHCA 4IJFA 3RE8A 1R7RA 4BLCA 2LVOC 3HHWA 4AZFA 3FUWA 1N77A 2V6ZM 4MGHA 2BWBA 1L8QA 3FYDA 5EP4A 2G8LA 5EXSA 2KZUA 1K3XA 2E5LM 4A3VB 1WGNA 1G8PA 3FUVA 1N32M 3SHFA 2UXDM 3GLHA 1HT1E 3GPUA 4WP2A 4M9SA 4W5WA 1QAMA 3LVWA 3A45A 3VLFB 3U60A 4KHPM 1IQPA 2DHRA 1TH3A 3K8ZA 1WXQA 3GO8A 4IBKA 4KLNA 1E94E 3FD9A 1A5TA 4LJ5A 3HX3A 3TQSA 5DNYA 1K82A 4OVZA 2XSZA 2XF3A 3E4RA 2DI0A 1OIZA 3M7GA 4AKIA 2CHGA 3M6AA 5ITRA 3LCUA 1W5SA 2L4FA 1IY1A 1JB0F 4IBGA 1V33A 1R2YA 1FJGM 1J7KA 2WZJA 3HY5A 2K47A 3IHPA 1V34A 5L8RF 3B7NA 2R65A 2M60A 4B08A 3CGWA 4Z8XA 4IBFA 3U6EA 3HU1A 1QANA 5F3WA 1PJJA 3RGSA 2C99A 3U6QA 3Q8XA 4X64M 2DZNB 2X49A 3A98B 4JI0M 3SYKA 4CJ6A 3Q8GA 4BB9A 1HNWM 4ANRA 4DR6M 3U61B 4AG6A 3KOZE 3C3EA 5ITQA 4DR4M 3BXWA 3ZQJA 1QAQA 1TTEA 3E46A 1IBKM 3I51A 4EIWA 2CV2A 1IXSB 3JR4A 3TPZA 3FTDA 3H4MA 4Q7JA 4D81A 4GHAA 3SASA 4Y28F 5EXXA 2WSFF 4M9XA 3R9XB 1PRBA 3RGPA 1KYIA 3AOGA 1N34M 2DHYA 1NY5A 1Q3CA 1Q02A 2DAEA 2XGNA 2FE8A 2QQ8A 3GLFE 1N33M 1UM8A 2L7IA 1MJGM 2DAMA 4LJ6A 1EE8A 2LHGA 1D0LA 3EIHA 4DR7M 4D80A 1MX0A 2ZM6M 1JR3A 2Y21A 4ZPXA 3ZH9B 3CF6E 1L1ZA 2VQFM 4L15A 1Z5BA 3TL4X 1DGHA 3PNVA 2K0BX 2HWJA 3GPPA 3HJQA 4NOOB 2G5GX 3I01M 3W0LB 2UUCM 3T38A 2DNAA 3FRHA 1XXHB 3VKHA 4QHTA 1SXJE 1SXJA 3QWLA 5E6JA 1NV9A 2LBCA 2CEAA 4RF1A 2DZOB 3GQ3A 2R0IA 2RGOA 4R71A 3SHGB 3T1YM 2L7HA 2VDBB 3DZDA
chains in the Genus database with same CATH topology
4FVMA 4GC9A 2Z7JA 4XBOA 1E9SA 4PDIA 2F5NA 1HR0M 4JI7M 1IM2A 2ZANA 1N75A 3L27A 4QNMA 2VIIA 3SBJA 1Z59A 8CATA 4AKGA 3KP1E 2XZFA 2X4AA 2QPAA 3UK6A 4QNRA 7CATA 4IBDA 2F5PA 4FWHA 4NSRA 3GLGA 1TGUA 3KS4A 3LMMA 3D8BA 4LFCM 2R45A 2YQZA 3OTOM 2QP9X 4DUZM 4MB7A 2F5OA 1DGBA 3FTEA 4I4LA 3KDSE 4TUWA 2XZUA 4G4OA 3J7BA 2UXCM 4B7HA 3L26A 5LMUM 1HNXM 4JV5M 1NJFA 4LY6A 3CTWB 1Z6TA 4NRWA 3HGIA 4DV7M 3MJ5A 3VK7A 3WHLA 5EQTA 5FTMA 4Z6YA 5LMNM 3HU3A 1XNQM 4GKJM 4MGZE 3U6CA 5IT9S 4I8OA 2FFJA 3TWMA 1GLNA 2X8AA 2A5YB 2XEPA 1N36M 1G4AE 4LG2A 1XMOM 1L2BA 4M9ZA 3RFWA 4LFBM 1QVRA 3GRRA 3HHXA 4GITA 4JI4M 3VFDA 3DFZA 3SAWA 1G41A 1QYRA 4LCBA 2V1UA 2R4JA 3CF2A 5KPTA 4RNAA 4B3RM 2ERCA 3GPXA 1GL7A 3UJNA 3SMPA 4B3TM 1R6BX 2KRKA 5JI2E 2XFSA 3JR5A 4RF0A 4LJ8A 4G4RA 1KSFX 5IWAM 4AKHA 4LGYA 2YR0A 4DUYM 4ITQA 3KSJA 5GKNA 5FTKA 2RKOA 2FOIC 4FCWA 3SFZA 4B3SM 2R18A 1T3TA 3GQ5A 1HQCA 5ITUA 3NWLA 4NXNM 3GLFB 3BOSA 1HQYE 3KOXE 2CHQA 4M0WA 4LRTA 1ORYB 4CGYB 3T15A 4WW0A 5KPZA 2AHMA 1J09A 3U6PA 2LNHC 3ZC7B 1KFVA 3MHVC 2P5TA 1K3WA 2LH0A 4MGIE 2CE7A 4PT5A 2D7HA 3QAUA 4L78A 4R7GA 2UU9M 1NNUC 1S3SA 3EIEA 2C98A 2DWZB 2OPFA 3D8LA 3KSXA 3KVWA 2YFQA 4KO8A 2XLJA 4LFAM 3AOEA 1FNNA 3J7AS 3MK6A 4K0KM 4WURA 3PFIA 5FSWA 5EP2A 3THGA 2HHHM 2R4EA 4QOZC 3FUTA 3KXEC 4FWDA 1IN5A 2ZBKB 2UXBM 4XGIA 3LQRA 3IG8A 5ITXA 2BJWA 3DA1A 1JQJC 2EO2A 2DWLA 4OX9M 4HL4A 1IN8A 5BPVA 2C9OA 1HT2E 4LF8M 1NNJA 1ZQ9A 3U61A 4AI6A 5H37D 4GH9A 4MGYE 3GLIB 2F5QA 4S12A 2Y0QA 3VK8A 1Z5CA 3GP1A 4CISA 1E9RA 2Z4SA 1TDHA 1IY0A 3FUXA 4IJEA 2VQEM 2HL7A 3SMSA 5KO3A 2F5SA 1ZAEA 2FNAA 3FUUA 3GQ4A 1SXJC 1L2CA 4LF7M 2Y20A 4D82A 4QOSA 3L28A 2Z3XA 2LXEA 1L1TA 2YNMD 1C1KA 4L4UA 2QENA 4LJ4A 4LZZA 1Z5AA 4LJAA 1XWIA 2KW0A 4JI6M 4JN6A 4NXMM 3K92A 1L2DA 1MU5A 2QZ4A 1SXJD 3JAMS 3SYLA 4JI2M 4IBEA 2KZSA 1G59A 1IN7A 1D2NA 4LJ9A 1QQWA 1XXHA 2DWNA 1J5EM 2F4VM 1DO2A 4GMQA 4QHSA 4G4NA 4CHTB 1Q39A 2R46A 3PVSA 1IXRC 1TDZA 3A42A 1LV7A 1PJIA 4NSOB 3J27B 4AQYM 4DR1M 4P16A 3L2AA 2EUCA 4DR3M 1HNZM 4I5SA 4JI3M 3TWLA 5EP1A 4II7A 4PDGA 4MM3B 1QZMA 2ZAOA 1OFIA 4GKKM 2L09A 1IBMM 2J7NA 5FLXS 3HJ8A 4DV1M 3W0FA 4YY3M 2J7OA 5BR8M 2UUBM 1IXZA 3SATA 1DGGA 2O5RA 3GRVA 3VKGA 2M5ZA 4I81A 5EXPA 3GPYA 4MH0E 4G6ZA 3PNYA 4LGMA 4FWGA 5IREB 2KXEA 5FTLA 3I4VA 3AJIB 5ITTA 3I4YA 4LRSA 3C58A 3HJSA 4IIWA 4NRVA 4HLQA 4X65M 3K1JA 2I7NA 4DV2M 4GC5A 3E9SA 5ITYA 3HHZA 3IG5A 3GRYA 1NHWC 5C1BA 4JI5M 1NJGA 3VDUA 2DWMA 2QBYB 3KP0E 2H1RA 2NQ8C 5FTNA 4JI1M 5JI3E 4MGKE 4FW9A 3HKPA 3PXGA 1DO0A 2HCBA 2V1CA 5IZ7D 5C18A 2R62A 4B7GA 3HHYA 2XSZD 4LF9M 3SAVA 3L29A 1IN4A 3U6MA 1DGHB 1TH4A 3AV0A 4FD2A 4DR5M 2D7GA 4PCZA 5KQ8A 5DYIA 4OW0A 3U6DA 1NVMA 4YHHM 1G3IA 3AKZA 2HKJA 1I94M 3NBIA 4GRIA 1NSFA 4AW4A 1IN6A 4X62M 3K2LA 1SXJB 3UMMA 2Z4RA 3UGJA 1W5TA 3FTFA 1H6UA 3U6LA 4DV3M 4REZA 4OU7A 2I7PA 5EXTA 1IBLM 1E32A 4IBIA 4FCVA 2W82A 3ZCBB 2KEBA 4LZJA 4KODA 3GRUA 4B3MM 4L8RC 4L16A 2CV1A 3B9PA 1NHGC 3J2PB 1YSYA 5ITXE 3SARA 3AFHA 1GL6A 3DOAA 2DVWB 5FTJA 1GKIA 3GLGB 2QBYA 3GLFA 3AL0C 2JA2A 2KRUA 3AOEC 3UZUA 4GIPA 1IY2A 3LVVA 1X37A 3FKEA 2BJVA 2EA0A 1TH2A 5EJCA 3T1HM 4GHLA 3U5ZB 1VDDA 3J80S 4IBBA 1XNRM 2QCUA 3R8FA 4G4QA 3U6OA 4IBJA 4B7FA 5KPRA 1GVNA 2CV0A 4LF6M 3FTCA 1OJLA 2KA6B 4BBAA 4FCTA 4IBCA 2UUAM 1JR3D 1PM5A 4DV6M 1R2ZA 3SC3A 1XHBA 5A2QS 2DXIA 1Q3BA 5E26A 4PD2A 3SAUA 3HWSA 4AG5A 2C5RA 3KW6A 2RGHA 4NL4H 2C9CA 4M0DA 4X66M 3KS8A 1YE9A 2C96A 1XC8A 3TE6A 4LF5M 2CHVA 5DYGA 1NY6A 5KQDA 4JI8M 3GLHB 2BNKA 2XFTA 3U60B 3WHKA 3LQQA 4JYAM 2LWXA 4LJ7A 1QAOA 2D7EA 2OQ4A 2XH9A 3GLIA 2ZAMA 2Q2EB 4DV0M 4DV4M 4LF4M 3U5ZA 4OVZB 4R3DA 3KOWE 1I4WA 3KFUG 3ILKA 1XMQM 3KOYE 5EP3A 3TWKA 2CUZA 1N78A 2Y0TA 2L6OA 1DGFA 3FYCA 3A46A 3J81S 4DV5M 1YUBA 3HU2A 4DR2M 3M0EA 3VDPA 2CFOA 3L25A 4JXJA 1OFHA 3U6SA 3CF0A 4IJFA 3RE8A 1R7RA 4BLCA 3HHWA 4AZFA 3FUWA 1N77A 2V6ZM 4MGHA 1L8QA 3FYDA 5EP4A 5EXSA 2G8LA 1K3XA 2KZUA 2E5LM 4A3VB 3FUVA 1G8PA 1N32M 3SHFA 2UXDM 3GLHA 1HT1E 3GPUA 4M9SA 4W5WA 1QAMA 3LVWA 3A45A 3VLFB 3U60A 4KHPM 1IQPA 2DHRA 1TH3A 3K8ZA 1WXQA 3GO8A 4IBKA 4KLNA 1E94E 3FD9A 4LJ5A 3TQSA 5DNYA 1K82A 4OVZA 2XSZA 2XF3A 3E4RA 3M7GA 4AKIA 2CHGA 3M6AA 5ITRA 1W5SA 1IY1A 4IBGA 1FJGM 1R2YA 1J7KA 2K47A 2R65A 2M60A 4B08A 4Z8XA 4IBFA 3U6EA 3HU1A 1QANA 5F3WA 1PJJA 3RGSA 2C99A 3U6QA 3Q8XA 4X64M 2DZNB 2X49A 3A98B 4JI0M 3SYKA 1HNWM 4BB9A 4DR6M 3U61B 4AG6A 3KOZE 5ITQA 4DR4M 1QAQA 1IBKM 3I51A 4EIWA 2CV2A 1IXSB 3JR4A 3TPZA 3FTDA 3H4MA 4D81A 4GHAA 3SASA 5EXXA 4M9XA 3R9XB 3RGPA 1KYIA 3AOGA 1N34M 1NY5A 1Q3CA 2XGNA 1N33M 2FE8A 1UM8A 2L7IA 4LJ6A 1EE8A 4DR7M 3EIHA 4D80A 1MX0A 2ZM6M 1JR3A 2Y21A 4ZPXA 3ZH9B 3CF6E 1L1ZA 2VQFM 4L15A 1Z5BA 3TL4X 1DGHA 3PNVA 3GPPA 3HJQA 4NOOB 2G5GX 3W0LB 2UUCM 3T38A 1XXHB 3VKHA 4QHTA 1SXJE 1SXJA 3QWLA 5E6JA 2CEAA 4RF1A 2DZOB 3GQ3A 2RGOA 3SHGB 3T1YM 2L7HA 3DZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWK A;  4X65 M;  4PDI A;  2OPF A;  2F5N A;  1HR0 M;  3A46 A;  4DV2 M;  4JI7 M;  5ITY A;  3J81 S;  4LFA M;  4DV5 M;  4DR2 M;  3SBJ A;  1Z59 A;  4JI5 M;  3J7A S;  4K0K M;  2XZF A;  2HHH M;  2F5P A;  4JI1 M;  2ZBK B;  2UXB M;  3U6S A;  4LFC M;  3OTO M;  5ITX A;  4DUZ M;  4MB7 A;  2F5O A;  3SAV A;  4LF9 M;  3U6M A;  1K3X A;  2E5L M;  4OX9 M;  4LF8 M;  4DR5 M;  1NNJ A;  1N32 M;  4PCZ A;  2UXD M;  3U6D A;  3GPU A;  4YHH M;  2XZU A;  2HKJ A;  4G4O A;  3A45 A;  1I94 M;  3VK8 A;  2F5Q A;  4KHP M;  1Z5C A;  3GP1 A;  2UXC M;  4X62 M;  4CIS A;  3GO8 A;  5LMU M;  1TDH A;  1HNX M;  4JV5 M;  2VQE M;  1K82 A;  3U6L A;  4NRW A;  4DV7 M;  4DV3 M;  3VK7 A;  2F5S A;  1IBL M;  3GQ4 A;  5LMN M;  1L2C A;  4LF7 M;  5ITR A;  1XNQ M;  4GKJ M;  4B3M M;  3U6C A;  5IT9 S;  1L1T A;  3TWM A;  5ITX E;  3SAR A;  1FJG M;  1R2Y A;  3DOA A;  1Z5A A;  4JI6 M;  1N36 M;  4NXM M;  1XMO M;  1L2B A;  3U6E A;  1L2D A;  1MU5 A;  1PJJ A;  4LFB M;  3U6Q A;  3JAM S;  2EA0 A;  4JI2 M;  4X64 M;  3T1H M;  4JI4 M;  4JI0 M;  1HNW M;  3J80 S;  3SAW A;  1XNR M;  4DR6 M;  2F4V M;  1J5E M;  4G4Q A;  3U6O A;  5ITQ A;  4G4N A;  4B3R M;  4DR4 M;  3GPX A;  1Q39 A;  1IBK M;  4LF6 M;  3JR4 A;  2UUA M;  4B3T M;  1PM5 A;  4DV6 M;  1R2Z A;  1TDZ A;  3A42 A;  5A2Q S;  1PJI A;  3SAS A;  3JR5 A;  1Q3B A;  4G4R A;  4AQY M;  4PD2 A;  4DR1 M;  3SAU A;  1N34 M;  1Q3C A;  5IWA M;  1N33 M;  4DUY M;  4ITQ A;  4DR3 M;  1HNZ M;  4X66 M;  4JI3 M;  3TWL A;  4B3S M;  4PDG A;  1EE8 A;  1XC8 A;  4DR7 M;  4LF5 M;  3GQ5 A;  1MX0 A;  5ITU A;  2ZM6 M;  1IBM M;  4GKK M;  4NXN M;  5FLX S;  4DV1 M;  3W0F A;  1L1Z A;  4YY3 M;  5BR8 M;  2VQF M;  1Z5B A;  2UUB M;  4JI8 M;  3SAT A;  4JYA M;  3GPP A;  2OQ4 A;  3U6P A;  3GPY A;  2Q2E B;  1KFV A;  2UUC M;  4DV0 M;  4DV4 M;  1K3W A;  4LF4 M;  5ITT A;  2UU9 M;  3C58 A;  3GQ3 A;  4NRV A;  3T1Y M;  1XMQ M; 
#chains in the Genus database with same CATH topology
 4FVM A;  4GC9 A;  2Z7J A;  2QNJ A;  1E9S A;  4RKU F;  4XBO A;  4PDI A;  2F5N A;  1HR0 M;  1IXS A;  4JI7 M;  1IM2 A;  2ZAN A;  1N75 A;  3L27 A;  2JUJ A;  1QUT A;  4QNM A;  2VII A;  3SBJ A;  1Z59 A;  1VQ1 A;  8CAT A;  1C7Y A;  3KP1 E;  2XZF A;  2X4A A;  2EJS A;  2QPA A;  3UK6 A;  2MGW A;  4QNR A;  7CAT A;  1VEG A;  4IBD A;  2F5P A;  1GO5 A;  4FWH A;  3V76 A;  1D0M A;  4NSR A;  3GLG A;  1TGU A;  1NV8 A;  3KS4 A;  3LMM A;  3W68 A;  2QSF X;  3D8B A;  4LFC M;  2R45 A;  2YQZ A;  3OTO M;  4XK8 F;  2QP9 X;  3GLI E;  4DUZ M;  4MB7 A;  2KNZ A;  2F5O A;  4AKG A;  1DGB A;  1QDR A;  3FTE A;  4I4L A;  3KDS E;  1BVS A;  1F4I A;  4TUW A;  2XZU A;  2CRU A;  4G4O A;  3J7B A;  2JZ0 A;  2UXC M;  4B7H A;  1QDT A;  3L26 A;  5LMU M;  1HNX M;  4JV5 M;  1NJF A;  4LY6 A;  3CTW B;  1Z6T A;  4NRW A;  3HGI A;  4DV7 M;  1EFU B;  1TR8 A;  3MJ5 A;  3VK7 A;  3WHL A;  5EQT A;  5FTM A;  4Z6Y A;  5LMN M;  2Z8Y M;  3HU3 A;  1XNQ M;  4GKJ M;  5DFL A;  4MGZ E;  3U6C A;  5IT9 S;  4I8O A;  2FFJ A;  2OOA A;  2GQF A;  3TWM A;  1GLN A;  2X8A A;  3LW5 F;  3FRI A;  2A5Y B;  2XEP A;  4KT0 F;  1N36 M;  1TF0 B;  1G4A E;  4LG2 A;  1XMO M;  1L2B A;  4M9Z A;  3RFW A;  3BBZ A;  3GLH E;  4LFB M;  1QVR A;  3GRR A;  3HHX A;  4GIT A;  2LTU A;  4JI4 M;  3VFD A;  3DFZ A;  3SAW A;  1G41 A;  1QYR A;  4LCB A;  2LVP C;  2V1U A;  2R4J A;  3CF2 A;  3W67 A;  5KPT A;  4RNA A;  4B3R M;  2ERC A;  3GPX A;  2DZL A;  1GL7 A;  3UJN A;  3SMP A;  4B3T M;  2JXN A;  2JY7 A;  1R6B X;  2KRK A;  5JI2 E;  1ZV1 A;  2XFS A;  2J5Y A;  3JR5 A;  4RF0 A;  4LJ8 A;  3C3D A;  4G4R A;  1KSF X;  1QZE A;  2G3Q A;  5IWA M;  4AKH A;  4LGY A;  2R44 A;  2YR0 A;  4DUY M;  4ITQ A;  3KSJ A;  5GKN A;  5FTK A;  2RKO A;  2FOI C;  4FCW A;  3SFZ A;  4B3S M;  2R18 A;  1T3T A;  3GQ5 A;  1HQC A;  5ITU A;  3NWL A;  2JY8 A;  4NXN M;  3GLF B;  3BOS A;  1HQY E;  3KOX E;  2CHQ A;  4M0W A;  4LRT A;  1ORY B;  4CGY B;  3T15 A;  3T6P A;  4WW0 A;  1OQY A;  5KPZ A;  1G71 A;  2AHM A;  1J09 A;  3E21 A;  2EKF A;  2LNH C;  3U6P A;  2DEN A;  3ZC7 B;  1KFV A;  2JY6 B;  3MHV C;  2P5T A;  1K3W A;  1OIP A;  2LH0 A;  4MGI E;  2CE7 A;  4PT5 A;  2D7H A;  3QAU A;  4L78 A;  4R7G A;  2UU9 M;  2DAG A;  1OAI A;  2MRO B;  1NNU C;  1S3S A;  3EIE A;  2C98 A;  2LVA A;  2DWZ B;  2OPF A;  3D8L A;  3KSX A;  3B7Q A;  2O01 F;  3LCV B;  3KVW A;  2YFQ A;  4KO8 A;  2XLJ A;  4LFA M;  3AOE A;  1FNN A;  1QUS A;  3J7A S;  3MK6 A;  4K0K M;  4WUR A;  1JR3 E;  3PFI A;  5EP2 A;  5FSW A;  1R4G A;  3THG A;  1PJQ A;  1PJT A;  1VG5 A;  2WSE F;  2R4E A;  2HHH M;  4QOZ C;  4DBG B;  3FUT A;  1LTM A;  3KXE C;  4FWD A;  1IN5 A;  2ZBK B;  2RRU A;  2UXB M;  1WR1 B;  4XGI A;  3LQR A;  3IG8 A;  5ITX A;  2BJW A;  3DA1 A;  1JQJ C;  2L4E A;  1DV0 A;  4NC6 A;  1PJS A;  2EO2 A;  2DWL A;  4OX9 M;  4HL4 A;  1IN8 A;  5BPV A;  2C9O A;  1HT2 E;  1YLA A;  4LF8 M;  1EIJ A;  1GJT A;  4F1I A;  1ZQ9 A;  1RU3 A;  3U61 A;  5H37 D;  4GH9 A;  1NNJ A;  4MGY E;  4AI6 A;  3GLI B;  2VF8 A;  2F5Q A;  4S12 A;  2Y0Q A;  3VK8 A;  1Z5C A;  3GP1 A;  3QYE A;  4CIS A;  1E9R A;  2Z4S A;  1TDH A;  1IY0 A;  3FUX A;  4IJE A;  1T6O A;  2VQE M;  1OAO C;  2HL7 A;  2LVQ D;  3SMS A;  5KO3 A;  2QHO B;  2F5S A;  1ZAE A;  2FNA A;  3FUU A;  3GQ4 A;  1SXJ C;  1L2C A;  4LF7 M;  2Y20 A;  4D82 A;  3GLG E;  3H4J A;  3L28 A;  4QOS A;  2Z3X A;  2LXE A;  2ZTC A;  1L1T A;  2YNM D;  1C1K A;  2APL A;  4L4U A;  2JP7 A;  2QEN A;  3F92 A;  2KNA A;  4LJ4 A;  2EKK A;  4HEO A;  4LZZ A;  1Z5A A;  4LJA A;  1XWI A;  2KW0 A;  4JI6 M;  4JN6 A;  4NXM M;  3B89 A;  2DAK A;  3K92 A;  1L2D A;  1MU5 A;  2QZ4 A;  4F2L A;  1SXJ D;  3JAM S;  3SYL A;  4JI2 M;  4IBE A;  2KZS A;  3K9P A;  1G59 A;  1IN7 A;  1D2N A;  4LJ9 A;  1QQW A;  1XXH A;  2DWN A;  1J5E M;  2F4V M;  1DO2 A;  4GMQ A;  4QHS A;  4G4N A;  4CHT B;  1IFY A;  1ZMU A;  2FH0 A;  1Q39 A;  2N35 A;  2BWE A;  2JZ1 A;  2R46 A;  3K9O A;  3PVS A;  1IXR C;  1TDZ A;  1VDL A;  3A42 A;  1LV7 A;  1PJI A;  4NSO B;  2WSC F;  3J27 B;  4AQY M;  2JWS A;  4DR1 M;  4P16 A;  1GAB A;  3L2A A;  2EUC A;  4DR3 M;  1HNZ M;  3C9P A;  1CUK A;  4I5S A;  4JI3 M;  5EP1 A;  4II7 A;  3TWL A;  4PDG A;  2O25 A;  4MM3 B;  1QZM A;  2ZAO A;  1OFI A;  4GKK M;  2L09 A;  1IBM M;  2J7N A;  2HAK A;  5FLX S;  3HJ8 A;  4DV1 M;  3W0F A;  1WHC A;  2GNO A;  4YY3 M;  1WGL A;  2J7O A;  5BR8 M;  1IXZ A;  2UUB M;  2VF7 A;  3SAT A;  1DGG A;  2O5R A;  2JNH A;  3GRV A;  1PGY A;  3VKG A;  2M5Z A;  4I81 A;  5EXP A;  3GPY A;  4MH0 E;  4G6Z A;  3PNY A;  4LGM A;  1P3Q Q;  4FWG A;  5IRE B;  2KXE A;  5FTL A;  3I4V A;  3AJI B;  5ITT A;  2DAI A;  3I4Y A;  3I04 M;  4LRS A;  2MR9 A;  3HJS A;  4IIW A;  3C58 A;  4NRV A;  4HLQ A;  4X65 M;  1V92 A;  1AUA A;  3K1J A;  2I7N A;  4DV2 M;  4GC5 A;  3E9S A;  5ITY A;  3HHZ A;  3IG5 A;  3GRY A;  1NHW C;  5C1B A;  3B7Z A;  4JI5 M;  1NJG A;  1GJS A;  1NO1 A;  3VDU A;  2DWM A;  2QBY B;  3KP0 E;  2H1R A;  2NQ8 C;  3IEC A;  5FTN A;  4JI1 M;  2KNV A;  5JI3 E;  4MGK E;  1WIV A;  4FW9 A;  3HKP A;  3PXG A;  1DO0 A;  2HCB A;  2V1C A;  5IZ7 D;  5C18 A;  2R62 A;  3B74 A;  4B7G A;  3HHY A;  2XSZ D;  2LVN C;  4LF9 M;  3SAV A;  1VEJ A;  1IN4 A;  3L29 A;  2R6F A;  1HJP A;  3U6M A;  1DGH B;  1TH4 A;  1T43 A;  1Y8G A;  3AV0 A;  4FD2 A;  4DR5 M;  2D7G A;  4PCZ A;  5KQ8 A;  5DYI A;  4OW0 A;  3U6D A;  1NVM A;  1D0K A;  1G3I A;  2K9D A;  4YHH M;  2HKJ A;  3AKZ A;  1I94 M;  3NBI A;  4GRI A;  1NSF A;  4AW4 A;  1IN6 A;  2B3T A;  4X62 M;  3K2L A;  1SXJ B;  3UMM A;  2Z4R A;  3UGJ A;  1W5T A;  3FTF A;  1H6U A;  4G3O A;  3U6L A;  4L6V 6;  4DV3 M;  4P17 A;  4REZ A;  4OU7 A;  2I7P A;  5EXT A;  1IBL M;  1UFZ A;  1E32 A;  4IBI A;  4FCV A;  2W82 A;  3ZCB B;  2KEB A;  3HZJ A;  4KOD A;  3GRU A;  4LZJ A;  4B3M M;  4L8R C;  4L16 A;  2CV1 A;  3B9P A;  1NHG C;  3J2P B;  1YSY A;  5ITX E;  3SAR A;  3AFH A;  1GL6 A;  3DOA A;  2DVW B;  5FTJ A;  1GKI A;  3GLG B;  2QBY A;  3GLF A;  3AL0 C;  1AIP C;  2JA2 A;  2KRU A;  3AOE C;  4GIP A;  3UZU A;  2K6B A;  1IY2 A;  3LVV A;  1X37 A;  3FKE A;  2BJV A;  2EA0 A;  1TH2 A;  5EJC A;  3T1H M;  4GHL A;  1WJ7 A;  3U5Z B;  1VDD A;  3J80 S;  2OO9 A;  4IBB A;  1XNR M;  2QCU A;  1MN3 A;  1OTR A;  2MH8 A;  3R8F A;  3MMP A;  4G4Q A;  1OKS A;  3U6O A;  4CIZ A;  4IBJ A;  4B7F A;  4UN2 B;  5KPR A;  1GVN A;  2CV0 A;  4LF6 M;  3FTC A;  1XB2 B;  1OJL A;  2KA6 B;  4BBA A;  4FCT A;  4IBC A;  2UUA M;  1JR3 D;  1PM5 A;  4DV6 M;  1R2Z A;  3SC3 A;  1XHB A;  5A2Q S;  2DXI A;  1Q3B A;  2MJ5 B;  5E26 A;  4PD2 A;  3SAU A;  3HWS A;  4AG5 A;  2C5R A;  3KW6 A;  2RGH A;  4NL4 H;  1VEK A;  2C9C A;  4M0D A;  4GEW A;  4X66 M;  3KS8 A;  1YE9 A;  2C96 A;  1XC8 A;  3TE6 A;  4LF5 M;  2CHV A;  2OOB A;  5DYG A;  1NY6 A;  2KHH A;  5KQD A;  1XXH E;  4JI8 M;  3GLH B;  2JY5 A;  2BNK A;  2XFT A;  3U60 B;  3WHK A;  3LQQ A;  4JYA M;  2LWX A;  4LJ7 A;  1QAO A;  2D7E A;  2OQ4 A;  2XH9 A;  3GLI A;  2ZAM A;  2Q2E B;  2DKL A;  2CWB A;  2CP8 A;  4DV0 M;  4DV4 M;  4LF4 M;  3U5Z A;  4OVZ B;  3QYB A;  4R3D A;  3KOW E;  2L2D A;  1I4W A;  3KFU G;  1ZMW A;  3ILK A;  1XMQ M;  3KOY E;  5EP3 A;  3TWK A;  2CUZ A;  1N78 A;  2Y0T A;  2L6O A;  2H5X A;  1DGF A;  2ZTD A;  3FYC A;  3A46 A;  3J81 S;  4DV5 M;  2FS1 A;  1YUB A;  3HU2 A;  4DR2 M;  1R5L A;  3M0E A;  3VDP A;  2CFO A;  3L25 A;  1SG9 A;  1ZMV A;  3FE3 A;  3NBX X;  4JXJ A;  1OFH A;  3U6S A;  2KDL A;  3CF0 A;  2LHC A;  4IJF A;  3RE8 A;  1R7R A;  4BLC A;  2LVO C;  3HHW A;  4AZF A;  3FUW A;  1N77 A;  2V6Z M;  4MGH A;  2BWB A;  1L8Q A;  3FYD A;  5EP4 A;  2G8L A;  5EXS A;  2KZU A;  1K3X A;  2E5L M;  4A3V B;  1WGN A;  1G8P A;  3FUV A;  1N32 M;  3SHF A;  2UXD M;  3GLH A;  1HT1 E;  3GPU A;  4WP2 A;  4M9S A;  4W5W A;  1QAM A;  3LVW A;  3A45 A;  3VLF B;  3U60 A;  4KHP M;  1IQP A;  2DHR A;  1TH3 A;  3K8Z A;  1WXQ A;  3GO8 A;  4IBK A;  4KLN A;  1E94 E;  3FD9 A;  1A5T A;  4LJ5 A;  3HX3 A;  3TQS A;  5DNY A;  1K82 A;  4OVZ A;  2XSZ A;  2XF3 A;  3E4R A;  2DI0 A;  1OIZ A;  3M7G A;  4AKI A;  2CHG A;  3M6A A;  5ITR A;  3LCU A;  1W5S A;  2L4F A;  1IY1 A;  1JB0 F;  4IBG A;  1V33 A;  1R2Y A;  1FJG M;  1J7K A;  2WZJ A;  3HY5 A;  2K47 A;  3IHP A;  1V34 A;  5L8R F;  3B7N A;  2R65 A;  2M60 A;  4B08 A;  3CGW A;  4Z8X A;  4IBF A;  3U6E A;  3HU1 A;  1QAN A;  5F3W A;  1PJJ A;  3RGS A;  2C99 A;  3U6Q A;  3Q8X A;  4X64 M;  2DZN B;  2X49 A;  3A98 B;  4JI0 M;  3SYK A;  4CJ6 A;  3Q8G A;  4BB9 A;  1HNW M;  4ANR A;  4DR6 M;  3U61 B;  4AG6 A;  3KOZ E;  3C3E A;  5ITQ A;  4DR4 M;  3BXW A;  3ZQJ A;  1QAQ A;  1TTE A;  3E46 A;  1IBK M;  3I51 A;  4EIW A;  2CV2 A;  1IXS B;  3JR4 A;  3TPZ A;  3FTD A;  3H4M A;  4Q7J A;  4D81 A;  4GHA A;  3SAS A;  4Y28 F;  5EXX A;  2WSF F;  4M9X A;  3R9X B;  1PRB A;  3RGP A;  1KYI A;  3AOG A;  1N34 M;  2DHY A;  1NY5 A;  1Q3C A;  1Q02 A;  2DAE A;  2XGN A;  2FE8 A;  2QQ8 A;  3GLF E;  1N33 M;  1UM8 A;  2L7I A;  1MJG M;  2DAM A;  4LJ6 A;  1EE8 A;  2LHG A;  1D0L A;  3EIH A;  4DR7 M;  4D80 A;  1MX0 A;  2ZM6 M;  1JR3 A;  2Y21 A;  4ZPX A;  3ZH9 B;  3CF6 E;  1L1Z A;  2VQF M;  4L15 A;  1Z5B A;  3TL4 X;  1DGH A;  3PNV A;  2K0B X;  2HWJ A;  3GPP A;  3HJQ A;  4NOO B;  2G5G X;  3I01 M;  3W0L B;  2UUC M;  3T38 A;  2DNA A;  3FRH A;  1XXH B;  3VKH A;  4QHT A;  1SXJ E;  1SXJ A;  3QWL A;  5E6J A;  1NV9 A;  2LBC A;  2CEA A;  4RF1 A;  2DZO B;  3GQ3 A;  2R0I A;  2RGO A;  4R71 A;  3SHG B;  3T1Y M;  2L7H A;  2VDB B;  3DZD A; 
#chains in the Genus database with same CATH homology
 4FVM A;  4GC9 A;  2Z7J A;  4XBO A;  1E9S A;  4PDI A;  2F5N A;  1HR0 M;  4JI7 M;  1IM2 A;  2ZAN A;  1N75 A;  3L27 A;  4QNM A;  2VII A;  3SBJ A;  1Z59 A;  8CAT A;  4AKG A;  3KP1 E;  2XZF A;  2X4A A;  2QPA A;  3UK6 A;  4QNR A;  7CAT A;  4IBD A;  2F5P A;  4FWH A;  4NSR A;  3GLG A;  1TGU A;  3KS4 A;  3LMM A;  3D8B A;  4LFC M;  2R45 A;  2YQZ A;  3OTO M;  2QP9 X;  4DUZ M;  4MB7 A;  2F5O A;  1DGB A;  3FTE A;  4I4L A;  3KDS E;  4TUW A;  2XZU A;  4G4O A;  3J7B A;  2UXC M;  4B7H A;  3L26 A;  5LMU M;  1HNX M;  4JV5 M;  1NJF A;  4LY6 A;  3CTW B;  1Z6T A;  4NRW A;  3HGI A;  4DV7 M;  3MJ5 A;  3VK7 A;  3WHL A;  5EQT A;  5FTM A;  4Z6Y A;  5LMN M;  3HU3 A;  1XNQ M;  4GKJ M;  4MGZ E;  3U6C A;  5IT9 S;  4I8O A;  2FFJ A;  3TWM A;  1GLN A;  2X8A A;  2A5Y B;  2XEP A;  1N36 M;  1G4A E;  4LG2 A;  1XMO M;  1L2B A;  4M9Z A;  3RFW A;  4LFB M;  1QVR A;  3GRR A;  3HHX A;  4GIT A;  4JI4 M;  3VFD A;  3DFZ A;  3SAW A;  1G41 A;  1QYR A;  4LCB A;  2V1U A;  2R4J A;  3CF2 A;  5KPT A;  4RNA A;  4B3R M;  2ERC A;  3GPX A;  1GL7 A;  3UJN A;  3SMP A;  4B3T M;  1R6B X;  2KRK A;  5JI2 E;  2XFS A;  3JR5 A;  4RF0 A;  4LJ8 A;  4G4R A;  1KSF X;  5IWA M;  4AKH A;  4LGY A;  2YR0 A;  4DUY M;  4ITQ A;  3KSJ A;  5GKN A;  5FTK A;  2RKO A;  2FOI C;  4FCW A;  3SFZ A;  4B3S M;  2R18 A;  1T3T A;  3GQ5 A;  1HQC A;  5ITU A;  3NWL A;  4NXN M;  3GLF B;  3BOS A;  1HQY E;  3KOX E;  2CHQ A;  4M0W A;  4LRT A;  1ORY B;  4CGY B;  3T15 A;  4WW0 A;  5KPZ A;  2AHM A;  1J09 A;  3U6P A;  2LNH C;  3ZC7 B;  1KFV A;  3MHV C;  2P5T A;  1K3W A;  2LH0 A;  4MGI E;  2CE7 A;  4PT5 A;  2D7H A;  3QAU A;  4L78 A;  4R7G A;  2UU9 M;  1NNU C;  1S3S A;  3EIE A;  2C98 A;  2DWZ B;  2OPF A;  3D8L A;  3KSX A;  3KVW A;  2YFQ A;  4KO8 A;  2XLJ A;  4LFA M;  3AOE A;  1FNN A;  3J7A S;  3MK6 A;  4K0K M;  4WUR A;  3PFI A;  5FSW A;  5EP2 A;  3THG A;  2HHH M;  2R4E A;  4QOZ C;  3FUT A;  3KXE C;  4FWD A;  1IN5 A;  2ZBK B;  2UXB M;  4XGI A;  3LQR A;  3IG8 A;  5ITX A;  2BJW A;  3DA1 A;  1JQJ C;  2EO2 A;  2DWL A;  4OX9 M;  4HL4 A;  1IN8 A;  5BPV A;  2C9O A;  1HT2 E;  4LF8 M;  1NNJ A;  1ZQ9 A;  3U61 A;  4AI6 A;  5H37 D;  4GH9 A;  4MGY E;  3GLI B;  2F5Q A;  4S12 A;  2Y0Q A;  3VK8 A;  1Z5C A;  3GP1 A;  4CIS A;  1E9R A;  2Z4S A;  1TDH A;  1IY0 A;  3FUX A;  4IJE A;  2VQE M;  2HL7 A;  3SMS A;  5KO3 A;  2F5S A;  1ZAE A;  2FNA A;  3FUU A;  3GQ4 A;  1SXJ C;  1L2C A;  4LF7 M;  2Y20 A;  4D82 A;  4QOS A;  3L28 A;  2Z3X A;  2LXE A;  1L1T A;  2YNM D;  1C1K A;  4L4U A;  2QEN A;  4LJ4 A;  4LZZ A;  1Z5A A;  4LJA A;  1XWI A;  2KW0 A;  4JI6 M;  4JN6 A;  4NXM M;  3K92 A;  1L2D A;  1MU5 A;  2QZ4 A;  1SXJ D;  3JAM S;  3SYL A;  4JI2 M;  4IBE A;  2KZS A;  1G59 A;  1IN7 A;  1D2N A;  4LJ9 A;  1QQW A;  1XXH A;  2DWN A;  1J5E M;  2F4V M;  1DO2 A;  4GMQ A;  4QHS A;  4G4N A;  4CHT B;  1Q39 A;  2R46 A;  3PVS A;  1IXR C;  1TDZ A;  3A42 A;  1LV7 A;  1PJI A;  4NSO B;  3J27 B;  4AQY M;  4DR1 M;  4P16 A;  3L2A A;  2EUC A;  4DR3 M;  1HNZ M;  4I5S A;  4JI3 M;  3TWL A;  5EP1 A;  4II7 A;  4PDG A;  4MM3 B;  1QZM A;  2ZAO A;  1OFI A;  4GKK M;  2L09 A;  1IBM M;  2J7N A;  5FLX S;  3HJ8 A;  4DV1 M;  3W0F A;  4YY3 M;  2J7O A;  5BR8 M;  2UUB M;  1IXZ A;  3SAT A;  1DGG A;  2O5R A;  3GRV A;  3VKG A;  2M5Z A;  4I81 A;  5EXP A;  3GPY A;  4MH0 E;  4G6Z A;  3PNY A;  4LGM A;  4FWG A;  5IRE B;  2KXE A;  5FTL A;  3I4V A;  3AJI B;  5ITT A;  3I4Y A;  4LRS A;  3C58 A;  3HJS A;  4IIW A;  4NRV A;  4HLQ A;  4X65 M;  3K1J A;  2I7N A;  4DV2 M;  4GC5 A;  3E9S A;  5ITY A;  3HHZ A;  3IG5 A;  3GRY A;  1NHW C;  5C1B A;  4JI5 M;  1NJG A;  3VDU A;  2DWM A;  2QBY B;  3KP0 E;  2H1R A;  2NQ8 C;  5FTN A;  4JI1 M;  5JI3 E;  4MGK E;  4FW9 A;  3HKP A;  3PXG A;  1DO0 A;  2HCB A;  2V1C A;  5IZ7 D;  5C18 A;  2R62 A;  4B7G A;  3HHY A;  2XSZ D;  4LF9 M;  3SAV A;  3L29 A;  1IN4 A;  3U6M A;  1DGH B;  1TH4 A;  3AV0 A;  4FD2 A;  4DR5 M;  2D7G A;  4PCZ A;  5KQ8 A;  5DYI A;  4OW0 A;  3U6D A;  1NVM A;  4YHH M;  1G3I A;  3AKZ A;  2HKJ A;  1I94 M;  3NBI A;  4GRI A;  1NSF A;  4AW4 A;  1IN6 A;  4X62 M;  3K2L A;  1SXJ B;  3UMM A;  2Z4R A;  3UGJ A;  1W5T A;  3FTF A;  1H6U A;  3U6L A;  4DV3 M;  4REZ A;  4OU7 A;  2I7P A;  5EXT A;  1IBL M;  1E32 A;  4IBI A;  4FCV A;  2W82 A;  3ZCB B;  2KEB A;  4LZJ A;  4KOD A;  3GRU A;  4B3M M;  4L8R C;  4L16 A;  2CV1 A;  3B9P A;  1NHG C;  3J2P B;  1YSY A;  5ITX E;  3SAR A;  3AFH A;  1GL6 A;  3DOA A;  2DVW B;  5FTJ A;  1GKI A;  3GLG B;  2QBY A;  3GLF A;  3AL0 C;  2JA2 A;  2KRU A;  3AOE C;  3UZU A;  4GIP A;  1IY2 A;  3LVV A;  1X37 A;  3FKE A;  2BJV A;  2EA0 A;  1TH2 A;  5EJC A;  3T1H M;  4GHL A;  3U5Z B;  1VDD A;  3J80 S;  4IBB A;  1XNR M;  2QCU A;  3R8F A;  4G4Q A;  3U6O A;  4IBJ A;  4B7F A;  5KPR A;  1GVN A;  2CV0 A;  4LF6 M;  3FTC A;  1OJL A;  2KA6 B;  4BBA A;  4FCT A;  4IBC A;  2UUA M;  1JR3 D;  1PM5 A;  4DV6 M;  1R2Z A;  3SC3 A;  1XHB A;  5A2Q S;  2DXI A;  1Q3B A;  5E26 A;  4PD2 A;  3SAU A;  3HWS A;  4AG5 A;  2C5R A;  3KW6 A;  2RGH A;  4NL4 H;  2C9C A;  4M0D A;  4X66 M;  3KS8 A;  1YE9 A;  2C96 A;  1XC8 A;  3TE6 A;  4LF5 M;  2CHV A;  5DYG A;  1NY6 A;  5KQD A;  4JI8 M;  3GLH B;  2BNK A;  2XFT A;  3U60 B;  3WHK A;  3LQQ A;  4JYA M;  2LWX A;  4LJ7 A;  1QAO A;  2D7E A;  2OQ4 A;  2XH9 A;  3GLI A;  2ZAM A;  2Q2E B;  4DV0 M;  4DV4 M;  4LF4 M;  3U5Z A;  4OVZ B;  4R3D A;  3KOW E;  1I4W A;  3KFU G;  3ILK A;  1XMQ M;  3KOY E;  5EP3 A;  3TWK A;  2CUZ A;  1N78 A;  2Y0T A;  2L6O A;  1DGF A;  3FYC A;  3A46 A;  3J81 S;  4DV5 M;  1YUB A;  3HU2 A;  4DR2 M;  3M0E A;  3VDP A;  2CFO A;  3L25 A;  4JXJ A;  1OFH A;  3U6S A;  3CF0 A;  4IJF A;  3RE8 A;  1R7R A;  4BLC A;  3HHW A;  4AZF A;  3FUW A;  1N77 A;  2V6Z M;  4MGH A;  1L8Q A;  3FYD A;  5EP4 A;  5EXS A;  2G8L A;  1K3X A;  2KZU A;  2E5L M;  4A3V B;  3FUV A;  1G8P A;  1N32 M;  3SHF A;  2UXD M;  3GLH A;  1HT1 E;  3GPU A;  4M9S A;  4W5W A;  1QAM A;  3LVW A;  3A45 A;  3VLF B;  3U60 A;  4KHP M;  1IQP A;  2DHR A;  1TH3 A;  3K8Z A;  1WXQ A;  3GO8 A;  4IBK A;  4KLN A;  1E94 E;  3FD9 A;  4LJ5 A;  3TQS A;  5DNY A;  1K82 A;  4OVZ A;  2XSZ A;  2XF3 A;  3E4R A;  3M7G A;  4AKI A;  2CHG A;  3M6A A;  5ITR A;  1W5S A;  1IY1 A;  4IBG A;  1FJG M;  1R2Y A;  1J7K A;  2K47 A;  2R65 A;  2M60 A;  4B08 A;  4Z8X A;  4IBF A;  3U6E A;  3HU1 A;  1QAN A;  5F3W A;  1PJJ A;  3RGS A;  2C99 A;  3U6Q A;  3Q8X A;  4X64 M;  2DZN B;  2X49 A;  3A98 B;  4JI0 M;  3SYK A;  1HNW M;  4BB9 A;  4DR6 M;  3U61 B;  4AG6 A;  3KOZ E;  5ITQ A;  4DR4 M;  1QAQ A;  1IBK M;  3I51 A;  4EIW A;  2CV2 A;  1IXS B;  3JR4 A;  3TPZ A;  3FTD A;  3H4M A;  4D81 A;  4GHA A;  3SAS A;  5EXX A;  4M9X A;  3R9X B;  3RGP A;  1KYI A;  3AOG A;  1N34 M;  1NY5 A;  1Q3C A;  2XGN A;  1N33 M;  2FE8 A;  1UM8 A;  2L7I A;  4LJ6 A;  1EE8 A;  4DR7 M;  3EIH A;  4D80 A;  1MX0 A;  2ZM6 M;  1JR3 A;  2Y21 A;  4ZPX A;  3ZH9 B;  3CF6 E;  1L1Z A;  2VQF M;  4L15 A;  1Z5B A;  3TL4 X;  1DGH A;  3PNV A;  3GPP A;  3HJQ A;  4NOO B;  2G5G X;  3W0L B;  2UUC M;  3T38 A;  1XXH B;  3VKH A;  4QHT A;  1SXJ E;  1SXJ A;  3QWL A;  5E6J A;  2CEA A;  4RF1 A;  2DZO B;  3GQ3 A;  2RGO A;  3SHG B;  3T1Y M;  2L7H A;  3DZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...