1K3WA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
254
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 81
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3wA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3wA01
3GPPA 1L1ZA 1XMOM 1J5EM 5FLXS 4JYAM 4LFCM 4B3SM 4LF7M 4PDIA 4JV5M 2UUBM 3A42A 3U6LA 1XNRM 4DV6M 3J7AS 4B3RM 3J80S 1HNXM 4LFBM 2F4VM 5A2QS 1HNZM 2XZFA 4LF6M 3T1YM 3VK8A 1PM5A 3W0FA 3OTOM 2F5NA 1L2BA 3U6PA 1Z5BA 4LF4M 5LMNM 4NRWA 3A45A 4PDGA 1KFVA 4X66M 1K3WA 4PCZA 3TWLA 1NNJA 4JI4M 3SASA 1Q39A 5IWAM 4YHHM 1K82A 4DR1M 2VQEM 3U6SA 2F5PA 4DR3M 4DR2M 3U6CA 4GKKM 4G4RA 5ITRA 4GKJM 3GPYA 1FJGM 4KHPM 4B3TM 4JI5M 4DV7M 3JR5A 4LF5M 4NRVA 2UXDM 4DR5M 3U6DA 2UXBM 5ITUA 3T1HM 4DR7M 1R2YA 2ZBKB 1N34M 2Q2EB 4DV3M 2UXCM 4DV0M 1Z59A 4JI2M 1XC8A 5ITXE 2VQFM 5ITXA 4JI8M 1Z5AA 4DR4M 1N32M 3GP1A 3TWKA 1Z5CA 4LF9M 4OX9M 1MX0A 4DV1M 4CISA 3JR4A 1I94M 3A46A 4NXNM 3SAUA 1PJIA 3SARA 4LF8M 3GO8A 5LMUM 3GPXA 3GPUA 4LFAM 1L2CA 1L2DA 4AQYM 4DV5M 2HKJA 2EA0A 3TWMA 5ITYA 3GQ5A 4YY3M 3GQ3A 2OPFA 3U6EA 2UU9M 4JI3M 1R2ZA 2F5QA 4PD2A 5ITTA 4X65M 3SATA 4X64M 4B3MM 1N33M 1IBLM 4DUYM 5IT9S 4DV4M 2OQ4A 1IBMM 4JI0M 4G4OA 3U6MA 4JI7M 3GQ4A 2E5LM 1EE8A 1K3XA 2XZUA 2F5SA 4JI6M 1XNQM 2UUAM 3SAVA 4JI1M 1MU5A 1Q3CA 1PJJA 4G4QA 2F5OA 5ITQA 4G4NA 3SAWA 1TDZA 3U6QA 3JAMS 3SBJA 4NXMM 2ZM6M 3C58A 1HR0M 1TDHA 3VK7A 4MB7A 5BR8M 3U6OA 1XMQM 1IBKM 3J81S 4DUZM 1L1TA 4DR6M 2UUCM 1Q3BA 3DOAA 4ITQA 2HHHM 4K0KM 1HNWM 1N36M 4DV2M 4X62M
chains in the Genus database with same CATH superfamily
3EIEA 5EQTA 4CHTB 1L1ZA 4AKIA 3IG8A 2H1RA 3M0EA 4GHLA 4JYAM 4LFCM 3H4MA 3CTWB 3H4JA 2UUBM 1WXQA 4D80A 4LFBM 1WGNA 2QSFX 5A2QS 2LHCA 3K92A 3M6AA 1MN3A 2HAKA 1TH4A 4AW4A 5EXXA 2J7OA 4FW9A 3FTFA 2C98A 1CUKA 4OVZA 5DYGA 3VFDA 2JNHA 2QCUA 2WSEF 3U5ZB 2BJVA 4MM3B 3GPXA 1Z5BA 4OVZB 1ZMVA 5LMNM 2LNHC 4PDGA 1DGHA 1G59A 5FTJA 2ERCA 2JY6B 3ILKA 4X66M 3TWLA 4LJAA 2WZJA 4UN2B 3V76A 4YHHM 4AKGA 2DAIA 3FTDA 4EIWA 4GKKM 2N35A 1RU3A 2JA2A 4REZA 3GPYA 4KHPM 2XFTA 2UXDM 5C18A 7CATA 4DR5M 3LCVB 3KP0E 2Y20A 5ITUA 4KO8A 1R2YA 3RGSA 1J7KA 1ORYB 4GMQA 4ANRA 1N34M 1V92A 4LCBA 1Z59A 2MROB 3PNVA 4LJ5A 4JI2M 3AL0C 3SMPA 1HQYE 2EO2A 5E6JA 5H37D 1N32M 3GP1A 2OOBA 4AG6A 4FD2A 4LRSA 3GLIA 4IBEA 4CJ6A 1YSYA 2DHRA 1GL7A 1SXJA 4OX9M 3MMPA 2Y0QA 3QYEA 3JR4A 4R71A 3GLIB 4NXNM 1I94M 3IHPA 1QANA 3SAUA 1PJIA 3SARA 3PNYA 3GO8A 3K1JA 3ZC7B 2L7IA 1P3QQ 2Y21A 2JXNA 3VKGA 1L2CA 4CIZA 4AQYM 1VEGA 4LJ9A 3E21A 3HJQA 2EA0A 3I51A 2KZSA 4IBKA 5ITYA 1SXJC 1IN7A 1HT2E 3KS4A 1HQCA 3TE6A 4PD2A 5ITTA 4GHAA 1VG5A 1T6OA 2R46A 2CUZA 4X64M 1IY2A 2R6FA 4HEOA 4QHTA 4D82A 4LJ6A 1WR1B 1EIJA 3FRHA 3M7GA 2Z8YM 4GC9A 3AV0A 3HHXA 4NSOB 1N77A 3HZJA 2C99A 1IBMM 2QBYA 4JI7M 3L29A 4LJ7A 2K9DA 2GNOA 3GQ4A 1F4IA 1H6UA 2X8AA 2QBYB 2D7GA 3D8LA 1G8PA 1XNQM 2JY8A 1G4AE 3FRIA 3MJ5A 3FYDA 4OU7A 3SAVA 3KFUG 1PJTA 4IBJA 3SHGB 4D81A 2FOIC 3U6QA 2BNKA 3SBJA 4BLCA 3KS8A 4MGZE 1OIZA 4LJ8A 1TDHA 2O25A 4IBIA 1OAIA 1OAOC 1IFYA 4RKUF 1GVNA 5BPVA 1E9SA 1V33A 4FWHA 2UUCM 3AOEA 4QHSA 3HHWA 3LVWA 3B9PA 4GRIA 4FCTA 4DV2M 1AUAA 4GITA 2DAKA 4NC6A 3GPPA 3NBIA 1D2NA 1XB2B 2JY5A 3L26A 1LTMA 5FLXS 2W82A 2V1CA 4GC5A 3FUWA 3TQSA 3ZH9B 1TR8A 3U6LA 3J80S 1QAOA 4BBAA 3KP1E 1GJTA 4IBBA 2XZFA 1HNZM 1VEKA 2R0IA 2RGOA 3W0FA 4QOSA 3D8BA 1QDRA 1IXRC 2LVQD 1MJGM 2LBCA 2L6OA 4M9SA 3QWLA 2DZLA 2L09A 1R5LA 1DGGA 2FFJA 3U60A 2CV1A 3T38A 3QAUA 1D0MA 4Q7JA 2CV2A 3TPZA 4PCZA 1QAMA 1VDDA 5KPTA 1NNJA 1ZV1A 2KNAA 3UZUA 5IWAM 3AOGA 2F5PA 3J27B 4FCVA 3SHFA 2EKKA 1S3SA 4G4RA 5ITRA 2VIIA 8CATA 3IECA 1D0KA 4B3TM 1JR3A 4JI5M 2J5YA 3L28A 2NQ8C 2QENA 2ZANA 1V34A 2ZTDA 4LJ4A 5FTMA 3U5ZA 3A98B 2UXBM 4S12A 4M0WA 3UMMA 2ZBKB 1GKIA 2Q2EB 5KPZA 3GRVA 4WURA 1JR3D 1D0LA 1GL6A 3C9PA 5ITXA 3W67A 2VQFM 3GLFB 1FNNA 3GLIE 2DHYA 4CGYB 1SXJE 1Z5CA 4LF9M 3FKEA 3GRYA 3LQQA 3QYBA 4AKHA 3KOYE 1BVSA 1YE9A 5IREB 3A46A 2R18A 1WIVA 2C9CA 1IN4A 4I81A 2K0BX 4FCWA 4LFAM 2EUCA 5EP4A 3GPUA 1G3IA 1NNUC 3PXGA 2JUJA 3FUXA 3I04M 2XF3A 2L4FA 3SYKA 1E32A 4DV5M 2B3TA 2OPFA 2QP9X 2A5YB 3FUTA 4I5SA 2I7NA 2C5RA 1AIPC 3C3DA 2RGHA 4MGKE 1PJSA 4B3MM 1IM2A 1IXSA 3BBZA 3GRUA 3R9XB 1N33M 1WHCA 2QNJA 2LWXA 4WP2A 4PT5A 2H5XA 1NSFA 1QYRA 3HX3A 2X4AA 1IXSB 3NWLA 3WHKA 3C3EA 2GQFA 2LXEA 2OQ4A 1ZAEA 3KXEC 2DWLA 4KODA 2E5LM 2O5RA 1K3XA 3DFZA 2XZUA 2KEBA 4L8RC 2L2DA 4L15A 2VF8A 1IN8A 3I01M 2XLJA 1MU5A 2MR9A 1PJJA 3HU1A 4G4QA 2QHOB 2Z3XA 5ITQA 2F5OA 3SAWA 1ZMWA 2C9OA 2HCBA 4NXMM 4LGYA 3L2AA 1WJ7A 2LVNC 1C1KA 2JZ1A 3KVWA 5KO3A 4DBGB 1C7YA 4LGMA 3U6OA 4DUZM 4JN6A 4F2LA 1A5TA 2FE8A 1Y8GA 2R45A 3UGJA 2G5GX 3E4RA 3FE3A 1N75A 3NBXX 5EXPA 1L1TA 4QOZC 2KW0A 4L16A 2YNMD 2APLA 2FNAA 4IJEA 1NJFA 3ZQJA 4A3VB 1TTEA 3CGWA 2DAGA 3I4VA 4LZZA 2BJWA 1XMOM 3B89A 1J5EM 2DWZB 4M0DA 4B3SM 4LF7M 4PDIA 1R7RA 4JV5M 1ZQ9A 3A42A 3CF0A 4DV6M 5C1BA 4KT0F 1XXHE 4B3RM 1HNXM 1VEJA 4MGYE 2F4VM 4LF6M 2QQ8A 3T1YM 3VK8A 5EP2A 1PM5A 5EP3A 5F3WA 4LG2A 1Z6TA 1IY0A 3HHZA 4GH9A 2P5TA 3Q8GA 1L2BA 1IN5A 1GLNA 1QZMA 3BOSA 3HHYA 2KRKA 2VDBB 3EIHA 3U6PA 4XGIA 3GLGA 4NRWA 2Z4RA 3HWSA 3B74A 3GLGB 4IBGA 3PVSA 2KZUA 1J09A 1PRBA 1Q39A 1W5SA 3WHLA 1K82A 1R4GA 2JZ0A 1SG9A 2LHGA 5KQ8A 2VQEM 4DR3M 4DR2M 4W5WA 3U6SA 3U6CA 1N78A 4RF1A 1FJGM 1X37A 3KW6A 2WSCF 3AOEC 4KLNA 4NSRA 1TH2A 4I8OA 5DNYA 1UM8A 1HT1E 1PJQA 2XEPA 2O01F 1GO5A 3MK6A 4AZFA 2OO9A 2Z7JA 4JXJA 1PGYA 4IBCA 4DV3M 2UXCM 3DA1A 3Q8XA 1WGLA 4FWGA 4FWDA 3T6PA 5ITXE 4JI8M 4DR4M 2CE7A 4M9XA 3HY5A 3FTCA 4TUWA 3VDUA 2DXIA 1MX0A 3R8FA 2KXEA 2M5ZA 3B7ZA 5LMUM 2R44A 2M60A 4XBOA 5FTNA 3SYLA 3MHVC 2G8LA 1L2DA 4WW0A 3IG5A 3LQRA 3VKHA 1YLAA 4FVMA 1NO1A 4P16A 3U6EA 1DV0A 1EFUB 4JI3M 3KOXE 2DWNA 2Y0TA 3SFZA 4X65M 5E26A 3AKZA 4BB9A 3SATA 4XK8F 2LVPC 3VLFB 3GLFA 3CF6E 2KNVA 3SMSA 1IBLM 1OQYA 1GABA 2ZTCA 2CHGA 2QPAA 1QUTA 5EXTA 5IT9S 1YUBA 2R62A 2XSZA 2V6ZM 3W0LB 5FTLA 3FD9A 4JI0M 3CF2A 2CHQA 4LY6A 4G4OA 1QZEA 2DAMA 3UK6A 1NJGA 1EE8A 3TL4X 4JI6M 2LVOC 3LW5F 1OJLA 1VDLA 2XSZD 3HKPA 1DO2A 4NL4H 3T15A 4JI1M 4R7GA 3KSXA 1OFHA 2DZNB 1TDZA 1IN6A 3JAMS 2ZM6M 3HJSA 2X49A 3J7BA 3PFIA 2KNZA 4L78A 4AG5A 3C58A 1HR0M 5GKNA 1XMQM 2DNAA 2K47A 2L4EA 3KOWE 3KSJA 3GLHA 1JQJC 2Z4SA 4LZJA 1Q3BA 4B7FA 3BXWA 3DOAA 4ITQA 1E9RA 4K0KM 1NHGC 3RE8A 1DGHB 3GLHB 2HWJA 1N36M 3LVVA 4MGIE 2J7NA 4X62M 1W5TA 5KPRA 4GEWA 5DYIA 4GIPA 3FYCA 3RFWA 3AFHA 1QVRA 3I4YA 2DENA 2LVAA 4L6V6 4QNMA 2KRUA 5KQDA 1XNRM 3KDSE 3J7AS 1NHWC 2D7HA 2WSFF 2DZOB 1XHBA 2DVWB 4QNRA 2V1UA 5EXSA 3OTOM 3B7QA 2KA6B 2F5NA 3THGA 4RF0A 4LF4M 3HJ8A 3J2PB 1I4WA 2FS1A 2CEAA 3LMMA 4G6ZA 1DO0A 3B7NA 3GLGE 2R4JA 3A45A 2CP8A 1KFVA 2FH0A 1ZMUA 4Y28F 3HGIA 1OKSA 4I4LA 3U61A 3K2LA 1L8QA 1NV8A 1SXJB 2JY7A 2ZAMA 4RNAA 2QZ4A 1DGBA 4Z8XA 1K3WA 3SASA 5FTKA 1Q02A 4JI4M 1R6BX 4DR1M 4ZPXA 3U61B 3LCUA 4G3OA 1SXJD 4OW0A 1TH3A 2LTUA 3FUVA 4II7A 3UJNA 4GKJM 2MH8A 2MJ5B 1G41A 1QQWA 1TGUA 2CRUA 3JR5A 4DV7M 4NRVA 4LF5M 4AI6A 4HLQA 2ZAOA 3W68A 3U6DA 1NV9A 3T1HM 4DR7M 5JI2E 4IBDA 4DV0M 1T3TA 1XC8A 2YFQA 4R3DA 3FTEA 1Z5AA 1G71A 3TWKA 1QUSA 3L25A 1LV7A 2CHVA 1IY1A 2RKOA 1OFIA 2RRUA 2XFSA 1NY5A 4Z6YA 3DZDA 4DV1M 4CISA 3L27A 2XGNA 3F92A 1TF0B 3VDPA 2AHMA 2YQZA 4LF8M 3K8ZA 3FUUA 5FSWA 1GJSA 4LRTA 2KDLA 2BWEA 1JB0F 1DGFA 3E9SA 3HU3A 3ZCBB 5JI3E 1E94E 2HKJA 3HU2A 3TWMA 3GQ5A 2L7HA 4YY3M 1JR3E 3GQ3A 2UU9M 2VF7A 2CFOA 3KOZE 1XWIA 1R2ZA 2F5QA 5EJCA 2BWBA 3GLFE 2HL7A 1KSFX 4HL4A 3E46A 2R65A 4DUYM 2DWMA 4DV4M 1UFZA 2DI0A 5DFLA 1IQPA 3AJIB 1OTRA 2C96A 2DKLA 2OOAA 4L4UA 1QAQA 3U6MA 1T43A 4B7GA 2CWBA 4NOOB 3K9OA 5EP1A 4MH0E 2F5SA 1NVMA 2UUAM 2JWSA 1OIPA 1XXHA 2I7PA 2YR0A 1Q3CA 1VQ1A 4G4NA 2CV0A 2R4EA 2G3QA 5L8RF 4M9ZA 2EKFA 1XXHB 4B7HA 2XH9A 3K9PA 4B08A 2MGWA 3VK7A 4MB7A 2K6BA 5BR8M 2LH0A 4IJFA 1IBKM 3J81S 4MGHA 2DAEA 2JP7A 1IXZA 4IBFA 4DR6M 5IZ7D 3GLHE 2KHHA 4IIWA 4P17A 2EJSA 3GRRA 1KYIA 2HHHM 1NY6A 3SC3A 2D7EA 1QDTA 4F1IA 3RGPA 3U60B 1HNWM 1HJPA
chains in the Genus database with same CATH topology
3EIEA 5EQTA 4CHTB 1L1ZA 4AKIA 3IG8A 2H1RA 3M0EA 4GHLA 4JYAM 4LFCM 3H4MA 3CTWB 2UUBM 1WXQA 4D80A 4LFBM 5A2QS 3M6AA 3K92A 3FTFA 1TH4A 4AW4A 5EXXA 2J7OA 4FW9A 2C98A 5DYGA 4OVZA 3VFDA 2QCUA 3U5ZB 2BJVA 4MM3B 1Z5BA 4OVZB 5LMNM 2LNHC 4PDGA 1DGHA 1G59A 5FTJA 2ERCA 3ILKA 4X66M 3TWLA 4LJAA 4AKGA 4YHHM 3FTDA 4EIWA 4GKKM 2JA2A 4REZA 3GPYA 4KHPM 2XFTA 2UXDM 5C18A 7CATA 4DR5M 3KP0E 2Y20A 5ITUA 4KO8A 1R2YA 3RGSA 1J7KA 1ORYB 4GMQA 1N34M 4LCBA 1Z59A 3PNVA 4JI2M 4LJ5A 3AL0C 3SMPA 1HQYE 2EO2A 5E6JA 5H37D 1N32M 3GP1A 4AG6A 4FD2A 4LRSA 3GLIA 4IBEA 1YSYA 2DHRA 1GL7A 1SXJA 4OX9M 2Y0QA 3JR4A 3GLIB 1I94M 4NXNM 4AI6A 3SAUA 1QANA 1PJIA 3SARA 3PNYA 3GO8A 3K1JA 3ZC7B 2L7IA 2Y21A 3VKGA 1L2CA 4AQYM 4LJ9A 3HJQA 2EA0A 3I51A 2KZSA 4IBKA 5ITYA 1SXJC 1IN7A 1HT2E 3KS4A 1HQCA 3TE6A 4PD2A 5ITTA 2R46A 2CUZA 4X64M 1IY2A 4QHTA 4D82A 4LJ6A 3M7GA 4GC9A 3AV0A 3HHXA 4NSOB 1N77A 1IBMM 2C99A 2QBYA 4JI7M 3L29A 4LJ7A 3GQ4A 1H6UA 2X8AA 2QBYB 2D7GA 3D8LA 1G8PA 1XNQM 1G4AE 4OU7A 3MJ5A 3FYDA 3SAVA 3KFUG 4IBJA 3SHGB 4D81A 2FOIC 3U6QA 2BNKA 3SBJA 4BLCA 3KS8A 4MGZE 4LJ8A 1TDHA 4IBIA 1GVNA 5BPVA 1E9SA 4FWHA 2UUCM 3AOEA 4QHSA 3HHWA 3LVWA 3B9PA 4GRIA 4FCTA 4DV2M 4GITA 3GPPA 3NBIA 1D2NA 3L26A 5FLXS 2W82A 2V1CA 4GC5A 3FUWA 3TQSA 3ZH9B 3U6LA 3J80S 1QAOA 4BBAA 3KP1E 4IBBA 1HNZM 2XZFA 2RGOA 3W0FA 4QOSA 3D8BA 1IXRC 2L6OA 4M9SA 3QWLA 2L09A 2FFJA 1DGGA 3U60A 3T38A 3QAUA 2CV2A 3TPZA 4PCZA 1QAMA 1VDDA 5KPTA 1NNJA 5IWAM 3UZUA 3AOGA 2F5PA 3J27B 4FCVA 3SHFA 1S3SA 4G4RA 5ITRA 2VIIA 8CATA 4B3TM 1JR3A 4JI5M 3L28A 2NQ8C 2QENA 2ZANA 4LJ4A 3U5ZA 5FTMA 2UXBM 3A98B 4S12A 4M0WA 3UMMA 2ZBKB 1GKIA 2Q2EB 5KPZA 3GRVA 4WURA 1JR3D 1GL6A 2VQFM 5ITXA 3GLFB 1FNNA 4CGYB 1SXJE 1Z5CA 4LF9M 3FKEA 3GRYA 3LQQA 4AKHA 3KOYE 3A46A 1YE9A 5IREB 2R18A 2C9CA 1IN4A 4I81A 4LFAM 4FCWA 3GPUA 2EUCA 5EP4A 3GPXA 1G3IA 1NNUC 3PXGA 3FUXA 2XF3A 3SYKA 1E32A 4DV5M 2OPFA 2QP9X 2A5YB 3FUTA 4I5SA 2I7NA 2C5RA 2RGHA 4MGKE 4B3MM 1IM2A 1N33M 3GRUA 3R9XB 2LWXA 4PT5A 1NSFA 1QYRA 2X4AA 1IXSB 3NWLA 3WHKA 2LXEA 2OQ4A 1ZAEA 3KXEC 2DWLA 4KODA 2E5LM 2O5RA 1K3XA 3DFZA 2XZUA 2KEBA 4L8RC 4L15A 1IN8A 2XLJA 1MU5A 1PJJA 3HU1A 4G4QA 2Z3XA 2F5OA 5ITQA 3SAWA 2C9OA 2HCBA 4NXMM 4LGYA 3L2AA 1C1KA 3KVWA 5KO3A 4LGMA 3U6OA 4DUZM 4JN6A 2FE8A 2R45A 3UGJA 1L1TA 2G5GX 3E4RA 5EXPA 1N75A 4QOZC 2KW0A 4L16A 2YNMD 2FNAA 4IJEA 1NJFA 4A3VB 3I4VA 4LZZA 2BJWA 1XMOM 1J5EM 2DWZB 4M0DA 4B3SM 4LF7M 4PDIA 1R7RA 4JV5M 1ZQ9A 3A42A 3CF0A 4DV6M 5C1BA 4B3RM 1HNXM 2F4VM 4MGYE 4LF6M 3T1YM 3VK8A 5EP2A 1PM5A 5EP3A 5F3WA 4LG2A 1Z6TA 1IY0A 3HHZA 4GH9A 2P5TA 1L2BA 1IN5A 1GLNA 1QZMA 3BOSA 3HHYA 2KRKA 3EIHA 3U6PA 4XGIA 3GLGA 4NRWA 2Z4RA 3HWSA 3GLGB 4IBGA 3PVSA 2KZUA 1J09A 1W5SA 1Q39A 3WHLA 1K82A 2CV1A 2VQEM 3U6SA 1N78A 5KQ8A 4DR3M 4DR2M 4W5WA 3U6CA 4RF1A 1FJGM 1X37A 3KW6A 3AOEC 4NSRA 4KLNA 1TH2A 4I8OA 5DNYA 1UM8A 1HT1E 2XEPA 3MK6A 4AZFA 2Z7JA 4JXJA 4IBCA 4DV3M 2UXCM 3DA1A 3Q8XA 4FWGA 4FWDA 5ITXE 4DR4M 4JI8M 2CE7A 4M9XA 3FTCA 4TUWA 3VDUA 2DXIA 1MX0A 3R8FA 2KXEA 2M5ZA 5LMUM 5FTNA 2M60A 4XBOA 3SYLA 3MHVC 2G8LA 1L2DA 4WW0A 3IG5A 3LQRA 3VKHA 4FVMA 4P16A 3U6EA 4JI3M 3KOXE 2DWNA 2Y0TA 3SFZA 4X65M 5E26A 3AKZA 4BB9A 3SATA 3VLFB 3GLFA 3CF6E 3SMSA 1IBLM 2CHGA 2QPAA 5EXTA 5IT9S 1YUBA 2R62A 2XSZA 2V6ZM 3W0LB 5FTLA 3FD9A 4JI0M 3CF2A 2CHQA 4LY6A 4G4OA 3UK6A 1NJGA 1EE8A 3TL4X 4JI6M 1OJLA 2XSZD 4NL4H 3HKPA 1DO2A 3T15A 4JI1M 4R7GA 3KSXA 1OFHA 2DZNB 1TDZA 1IN6A 3JAMS 2ZM6M 3HJSA 2X49A 3J7BA 3PFIA 4L78A 4AG5A 3C58A 1HR0M 4GHAA 5GKNA 1XMQM 2K47A 3KOWE 3KSJA 3GLHA 1JQJC 2Z4SA 4LZJA 1Q3BA 4B7FA 3DOAA 4ITQA 1E9RA 4K0KM 1NHGC 3RE8A 1DGHB 3GLHB 1N36M 3LVVA 4MGIE 2J7NA 4X62M 1W5TA 5KPRA 5DYIA 4GIPA 3FYCA 3RFWA 3AFHA 1QVRA 3I4YA 4QNMA 5KQDA 2KRUA 1XNRM 3KDSE 3J7AS 1NHWC 2D7HA 2DZOB 1XHBA 2DVWB 4QNRA 2V1UA 5EXSA 3OTOM 2KA6B 2F5NA 3THGA 4RF0A 4LF4M 3HJ8A 3J2PB 1I4WA 2CEAA 3LMMA 4G6ZA 1DO0A 2R4JA 3A45A 1KFVA 3HGIA 4I4LA 3U61A 3K2LA 1L8QA 1SXJB 2ZAMA 4RNAA 4Z8XA 1K3WA 2QZ4A 1DGBA 4JI4M 3SASA 5FTKA 1R6BX 4DR1M 4ZPXA 3U61B 4OW0A 1SXJD 1TH3A 3UJNA 3FUVA 4II7A 4GKJM 1G41A 1QQWA 1TGUA 4DV7M 3JR5A 4LF5M 4NRVA 4HLQA 2ZAOA 3U6DA 3T1HM 4DR7M 5JI2E 4IBDA 4DV0M 1T3TA 1XC8A 2YFQA 4R3DA 3FTEA 1Z5AA 3TWKA 3L25A 1LV7A 2CHVA 1IY1A 2RKOA 1OFIA 2XFSA 1NY5A 4Z6YA 3DZDA 4DV1M 4CISA 3L27A 2XGNA 3VDPA 2AHMA 2YQZA 4LF8M 3K8ZA 3FUUA 5FSWA 4LRTA 3E9SA 1DGFA 3HU3A 3ZCBB 5JI3E 1E94E 2HKJA 3HU2A 3TWMA 3GQ5A 2L7HA 4YY3M 3GQ3A 2UU9M 2CFOA 3KOZE 1XWIA 1R2ZA 2F5QA 5EJCA 2HL7A 1KSFX 4HL4A 2R65A 4DUYM 2DWMA 4DV4M 1IQPA 3AJIB 3U6MA 2C96A 4L4UA 1QAQA 4B7GA 4NOOB 5EP1A 4MH0E 2F5SA 1NVMA 2UUAM 1XXHA 2I7PA 2YR0A 1Q3CA 4G4NA 2CV0A 2R4EA 4M9ZA 1XXHB 4B7HA 2XH9A 4B08A 3VK7A 4MB7A 5BR8M 2LH0A 4IJFA 1IBKM 3J81S 4MGHA 1IXZA 4IBFA 4DR6M 5IZ7D 4IIWA 3GRRA 1KYIA 2HHHM 1NY6A 3SC3A 2D7EA 3RGPA 3U60B 1HNWM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPP A;  1L1Z A;  1XMO M;  1J5E M;  5FLX S;  4JYA M;  4LFC M;  4B3S M;  4LF7 M;  4PDI A;  4JV5 M;  2UUB M;  3A42 A;  3U6L A;  1XNR M;  4DV6 M;  3J7A S;  4B3R M;  3J80 S;  1HNX M;  4LFB M;  2F4V M;  5A2Q S;  1HNZ M;  2XZF A;  4LF6 M;  3T1Y M;  3VK8 A;  1PM5 A;  3W0F A;  3OTO M;  2F5N A;  1L2B A;  3U6P A;  1Z5B A;  4LF4 M;  5LMN M;  4NRW A;  3A45 A;  4PDG A;  1KFV A;  4X66 M;  1K3W A;  4PCZ A;  3TWL A;  1NNJ A;  4JI4 M;  3SAS A;  1Q39 A;  5IWA M;  4YHH M;  1K82 A;  4DR1 M;  2VQE M;  3U6S A;  2F5P A;  4DR3 M;  4DR2 M;  3U6C A;  4GKK M;  4G4R A;  5ITR A;  4GKJ M;  3GPY A;  1FJG M;  4KHP M;  4B3T M;  4JI5 M;  4DV7 M;  3JR5 A;  4LF5 M;  4NRV A;  2UXD M;  4DR5 M;  3U6D A;  2UXB M;  5ITU A;  3T1H M;  4DR7 M;  1R2Y A;  2ZBK B;  1N34 M;  2Q2E B;  4DV3 M;  2UXC M;  4DV0 M;  1Z59 A;  4JI2 M;  1XC8 A;  5ITX E;  2VQF M;  5ITX A;  4JI8 M;  1Z5A A;  4DR4 M;  1N32 M;  3GP1 A;  3TWK A;  1Z5C A;  4LF9 M;  4OX9 M;  1MX0 A;  4DV1 M;  4CIS A;  3JR4 A;  1I94 M;  3A46 A;  4NXN M;  3SAU A;  1PJI A;  3SAR A;  4LF8 M;  3GO8 A;  5LMU M;  3GPX A;  3GPU A;  4LFA M;  1L2C A;  1L2D A;  4AQY M;  4DV5 M;  2HKJ A;  2EA0 A;  3TWM A;  5ITY A;  3GQ5 A;  4YY3 M;  3GQ3 A;  2OPF A;  3U6E A;  2UU9 M;  4JI3 M;  1R2Z A;  2F5Q A;  4PD2 A;  5ITT A;  4X65 M;  3SAT A;  4X64 M;  4B3M M;  1N33 M;  1IBL M;  4DUY M;  5IT9 S;  4DV4 M;  2OQ4 A;  1IBM M;  4JI0 M;  4G4O A;  3U6M A;  4JI7 M;  3GQ4 A;  2E5L M;  1EE8 A;  1K3X A;  2XZU A;  2F5S A;  4JI6 M;  1XNQ M;  2UUA M;  3SAV A;  4JI1 M;  1MU5 A;  1Q3C A;  1PJJ A;  4G4Q A;  2F5O A;  5ITQ A;  4G4N A;  3SAW A;  1TDZ A;  3U6Q A;  3JAM S;  3SBJ A;  4NXM M;  2ZM6 M;  3C58 A;  1HR0 M;  1TDH A;  3VK7 A;  4MB7 A;  5BR8 M;  3U6O A;  1XMQ M;  1IBK M;  3J81 S;  4DUZ M;  1L1T A;  4DR6 M;  2UUC M;  1Q3B A;  3DOA A;  4ITQ A;  2HHH M;  4K0K M;  1HNW M;  1N36 M;  4DV2 M;  4X62 M; 
#chains in the Genus database with same CATH topology
 3EIE A;  5EQT A;  4CHT B;  1L1Z A;  4AKI A;  3IG8 A;  2H1R A;  3M0E A;  4GHL A;  4JYA M;  4LFC M;  3H4M A;  3CTW B;  3H4J A;  2UUB M;  1WXQ A;  4D80 A;  4LFB M;  1WGN A;  2QSF X;  5A2Q S;  2LHC A;  3K92 A;  3M6A A;  1MN3 A;  2HAK A;  1TH4 A;  4AW4 A;  5EXX A;  2J7O A;  4FW9 A;  3FTF A;  2C98 A;  1CUK A;  4OVZ A;  5DYG A;  3VFD A;  2JNH A;  2QCU A;  2WSE F;  3U5Z B;  2BJV A;  4MM3 B;  3GPX A;  1Z5B A;  4OVZ B;  1ZMV A;  5LMN M;  2LNH C;  4PDG A;  1DGH A;  1G59 A;  5FTJ A;  2ERC A;  2JY6 B;  3ILK A;  4X66 M;  3TWL A;  4LJA A;  2WZJ A;  4UN2 B;  3V76 A;  4YHH M;  4AKG A;  2DAI A;  3FTD A;  4EIW A;  4GKK M;  2N35 A;  1RU3 A;  2JA2 A;  4REZ A;  3GPY A;  4KHP M;  2XFT A;  2UXD M;  5C18 A;  7CAT A;  4DR5 M;  3LCV B;  3KP0 E;  2Y20 A;  5ITU A;  4KO8 A;  1R2Y A;  3RGS A;  1J7K A;  1ORY B;  4GMQ A;  4ANR A;  1N34 M;  1V92 A;  4LCB A;  1Z59 A;  2MRO B;  3PNV A;  4LJ5 A;  4JI2 M;  3AL0 C;  3SMP A;  1HQY E;  2EO2 A;  5E6J A;  5H37 D;  1N32 M;  3GP1 A;  2OOB A;  4AG6 A;  4FD2 A;  4LRS A;  3GLI A;  4IBE A;  4CJ6 A;  1YSY A;  2DHR A;  1GL7 A;  1SXJ A;  4OX9 M;  3MMP A;  2Y0Q A;  3QYE A;  3JR4 A;  4R71 A;  3GLI B;  4NXN M;  1I94 M;  3IHP A;  1QAN A;  3SAU A;  1PJI A;  3SAR A;  3PNY A;  3GO8 A;  3K1J A;  3ZC7 B;  2L7I A;  1P3Q Q;  2Y21 A;  2JXN A;  3VKG A;  1L2C A;  4CIZ A;  4AQY M;  1VEG A;  4LJ9 A;  3E21 A;  3HJQ A;  2EA0 A;  3I51 A;  2KZS A;  4IBK A;  5ITY A;  1SXJ C;  1IN7 A;  1HT2 E;  3KS4 A;  1HQC A;  3TE6 A;  4PD2 A;  5ITT A;  4GHA A;  1VG5 A;  1T6O A;  2R46 A;  2CUZ A;  4X64 M;  1IY2 A;  2R6F A;  4HEO A;  4QHT A;  4D82 A;  4LJ6 A;  1WR1 B;  1EIJ A;  3FRH A;  3M7G A;  2Z8Y M;  4GC9 A;  3AV0 A;  3HHX A;  4NSO B;  1N77 A;  3HZJ A;  2C99 A;  1IBM M;  2QBY A;  4JI7 M;  3L29 A;  4LJ7 A;  2K9D A;  2GNO A;  3GQ4 A;  1F4I A;  1H6U A;  2X8A A;  2QBY B;  2D7G A;  3D8L A;  1G8P A;  1XNQ M;  2JY8 A;  1G4A E;  3FRI A;  3MJ5 A;  3FYD A;  4OU7 A;  3SAV A;  3KFU G;  1PJT A;  4IBJ A;  3SHG B;  4D81 A;  2FOI C;  3U6Q A;  2BNK A;  3SBJ A;  4BLC A;  3KS8 A;  4MGZ E;  1OIZ A;  4LJ8 A;  1TDH A;  2O25 A;  4IBI A;  1OAI A;  1OAO C;  1IFY A;  4RKU F;  1GVN A;  5BPV A;  1E9S A;  1V33 A;  4FWH A;  2UUC M;  3AOE A;  4QHS A;  3HHW A;  3LVW A;  3B9P A;  4GRI A;  4FCT A;  4DV2 M;  1AUA A;  4GIT A;  2DAK A;  4NC6 A;  3GPP A;  3NBI A;  1D2N A;  1XB2 B;  2JY5 A;  3L26 A;  1LTM A;  5FLX S;  2W82 A;  2V1C A;  4GC5 A;  3FUW A;  3TQS A;  3ZH9 B;  1TR8 A;  3U6L A;  3J80 S;  1QAO A;  4BBA A;  3KP1 E;  1GJT A;  4IBB A;  2XZF A;  1HNZ M;  1VEK A;  2R0I A;  2RGO A;  3W0F A;  4QOS A;  3D8B A;  1QDR A;  1IXR C;  2LVQ D;  1MJG M;  2LBC A;  2L6O A;  4M9S A;  3QWL A;  2DZL A;  2L09 A;  1R5L A;  1DGG A;  2FFJ A;  3U60 A;  2CV1 A;  3T38 A;  3QAU A;  1D0M A;  4Q7J A;  2CV2 A;  3TPZ A;  4PCZ A;  1QAM A;  1VDD A;  5KPT A;  1NNJ A;  1ZV1 A;  2KNA A;  3UZU A;  5IWA M;  3AOG A;  2F5P A;  3J27 B;  4FCV A;  3SHF A;  2EKK A;  1S3S A;  4G4R A;  5ITR A;  2VII A;  8CAT A;  3IEC A;  1D0K A;  4B3T M;  1JR3 A;  4JI5 M;  2J5Y A;  3L28 A;  2NQ8 C;  2QEN A;  2ZAN A;  1V34 A;  2ZTD A;  4LJ4 A;  5FTM A;  3U5Z A;  3A98 B;  2UXB M;  4S12 A;  4M0W A;  3UMM A;  2ZBK B;  1GKI A;  2Q2E B;  5KPZ A;  3GRV A;  4WUR A;  1JR3 D;  1D0L A;  1GL6 A;  3C9P A;  5ITX A;  3W67 A;  2VQF M;  3GLF B;  1FNN A;  3GLI E;  2DHY A;  4CGY B;  1SXJ E;  1Z5C A;  4LF9 M;  3FKE A;  3GRY A;  3LQQ A;  3QYB A;  4AKH A;  3KOY E;  1BVS A;  1YE9 A;  5IRE B;  3A46 A;  2R18 A;  1WIV A;  2C9C A;  1IN4 A;  4I81 A;  2K0B X;  4FCW A;  4LFA M;  2EUC A;  5EP4 A;  3GPU A;  1G3I A;  1NNU C;  3PXG A;  2JUJ A;  3FUX A;  3I04 M;  2XF3 A;  2L4F A;  3SYK A;  1E32 A;  4DV5 M;  2B3T A;  2OPF A;  2QP9 X;  2A5Y B;  3FUT A;  4I5S A;  2I7N A;  2C5R A;  1AIP C;  3C3D A;  2RGH A;  4MGK E;  1PJS A;  4B3M M;  1IM2 A;  1IXS A;  3BBZ A;  3GRU A;  3R9X B;  1N33 M;  1WHC A;  2QNJ A;  2LWX A;  4WP2 A;  4PT5 A;  2H5X A;  1NSF A;  1QYR A;  3HX3 A;  2X4A A;  1IXS B;  3NWL A;  3WHK A;  3C3E A;  2GQF A;  2LXE A;  2OQ4 A;  1ZAE A;  3KXE C;  2DWL A;  4KOD A;  2E5L M;  2O5R A;  1K3X A;  3DFZ A;  2XZU A;  2KEB A;  4L8R C;  2L2D A;  4L15 A;  2VF8 A;  1IN8 A;  3I01 M;  2XLJ A;  1MU5 A;  2MR9 A;  1PJJ A;  3HU1 A;  4G4Q A;  2QHO B;  2Z3X A;  5ITQ A;  2F5O A;  3SAW A;  1ZMW A;  2C9O A;  2HCB A;  4NXM M;  4LGY A;  3L2A A;  1WJ7 A;  2LVN C;  1C1K A;  2JZ1 A;  3KVW A;  5KO3 A;  4DBG B;  1C7Y A;  4LGM A;  3U6O A;  4DUZ M;  4JN6 A;  4F2L A;  1A5T A;  2FE8 A;  1Y8G A;  2R45 A;  3UGJ A;  2G5G X;  3E4R A;  3FE3 A;  1N75 A;  3NBX X;  5EXP A;  1L1T A;  4QOZ C;  2KW0 A;  4L16 A;  2YNM D;  2APL A;  2FNA A;  4IJE A;  1NJF A;  3ZQJ A;  4A3V B;  1TTE A;  3CGW A;  2DAG A;  3I4V A;  4LZZ A;  2BJW A;  1XMO M;  3B89 A;  1J5E M;  2DWZ B;  4M0D A;  4B3S M;  4LF7 M;  4PDI A;  1R7R A;  4JV5 M;  1ZQ9 A;  3A42 A;  3CF0 A;  4DV6 M;  5C1B A;  4KT0 F;  1XXH E;  4B3R M;  1HNX M;  1VEJ A;  4MGY E;  2F4V M;  4LF6 M;  2QQ8 A;  3T1Y M;  3VK8 A;  5EP2 A;  1PM5 A;  5EP3 A;  5F3W A;  4LG2 A;  1Z6T A;  1IY0 A;  3HHZ A;  4GH9 A;  2P5T A;  3Q8G A;  1L2B A;  1IN5 A;  1GLN A;  1QZM A;  3BOS A;  3HHY A;  2KRK A;  2VDB B;  3EIH A;  3U6P A;  4XGI A;  3GLG A;  4NRW A;  2Z4R A;  3HWS A;  3B74 A;  3GLG B;  4IBG A;  3PVS A;  2KZU A;  1J09 A;  1PRB A;  1Q39 A;  1W5S A;  3WHL A;  1K82 A;  1R4G A;  2JZ0 A;  1SG9 A;  2LHG A;  5KQ8 A;  2VQE M;  4DR3 M;  4DR2 M;  4W5W A;  3U6S A;  3U6C A;  1N78 A;  4RF1 A;  1FJG M;  1X37 A;  3KW6 A;  2WSC F;  3AOE C;  4KLN A;  4NSR A;  1TH2 A;  4I8O A;  5DNY A;  1UM8 A;  1HT1 E;  1PJQ A;  2XEP A;  2O01 F;  1GO5 A;  3MK6 A;  4AZF A;  2OO9 A;  2Z7J A;  4JXJ A;  1PGY A;  4IBC A;  4DV3 M;  2UXC M;  3DA1 A;  3Q8X A;  1WGL A;  4FWG A;  4FWD A;  3T6P A;  5ITX E;  4JI8 M;  4DR4 M;  2CE7 A;  4M9X A;  3HY5 A;  3FTC A;  4TUW A;  3VDU A;  2DXI A;  1MX0 A;  3R8F A;  2KXE A;  2M5Z A;  3B7Z A;  5LMU M;  2R44 A;  2M60 A;  4XBO A;  5FTN A;  3SYL A;  3MHV C;  2G8L A;  1L2D A;  4WW0 A;  3IG5 A;  3LQR A;  3VKH A;  1YLA A;  4FVM A;  1NO1 A;  4P16 A;  3U6E A;  1DV0 A;  1EFU B;  4JI3 M;  3KOX E;  2DWN A;  2Y0T A;  3SFZ A;  4X65 M;  5E26 A;  3AKZ A;  4BB9 A;  3SAT A;  4XK8 F;  2LVP C;  3VLF B;  3GLF A;  3CF6 E;  2KNV A;  3SMS A;  1IBL M;  1OQY A;  1GAB A;  2ZTC A;  2CHG A;  2QPA A;  1QUT A;  5EXT A;  5IT9 S;  1YUB A;  2R62 A;  2XSZ A;  2V6Z M;  3W0L B;  5FTL A;  3FD9 A;  4JI0 M;  3CF2 A;  2CHQ A;  4LY6 A;  4G4O A;  1QZE A;  2DAM A;  3UK6 A;  1NJG A;  1EE8 A;  3TL4 X;  4JI6 M;  2LVO C;  3LW5 F;  1OJL A;  1VDL A;  2XSZ D;  3HKP A;  1DO2 A;  4NL4 H;  3T15 A;  4JI1 M;  4R7G A;  3KSX A;  1OFH A;  2DZN B;  1TDZ A;  1IN6 A;  3JAM S;  2ZM6 M;  3HJS A;  2X49 A;  3J7B A;  3PFI A;  2KNZ A;  4L78 A;  4AG5 A;  3C58 A;  1HR0 M;  5GKN A;  1XMQ M;  2DNA A;  2K47 A;  2L4E A;  3KOW E;  3KSJ A;  3GLH A;  1JQJ C;  2Z4S A;  4LZJ A;  1Q3B A;  4B7F A;  3BXW A;  3DOA A;  4ITQ A;  1E9R A;  4K0K M;  1NHG C;  3RE8 A;  1DGH B;  3GLH B;  2HWJ A;  1N36 M;  3LVV A;  4MGI E;  2J7N A;  4X62 M;  1W5T A;  5KPR A;  4GEW A;  5DYI A;  4GIP A;  3FYC A;  3RFW A;  3AFH A;  1QVR A;  3I4Y A;  2DEN A;  2LVA A;  4L6V 6;  4QNM A;  2KRU A;  5KQD A;  1XNR M;  3KDS E;  3J7A S;  1NHW C;  2D7H A;  2WSF F;  2DZO B;  1XHB A;  2DVW B;  4QNR A;  2V1U A;  5EXS A;  3OTO M;  3B7Q A;  2KA6 B;  2F5N A;  3THG A;  4RF0 A;  4LF4 M;  3HJ8 A;  3J2P B;  1I4W A;  2FS1 A;  2CEA A;  3LMM A;  4G6Z A;  1DO0 A;  3B7N A;  3GLG E;  2R4J A;  3A45 A;  2CP8 A;  1KFV A;  2FH0 A;  1ZMU A;  4Y28 F;  3HGI A;  1OKS A;  4I4L A;  3U61 A;  3K2L A;  1L8Q A;  1NV8 A;  1SXJ B;  2JY7 A;  2ZAM A;  4RNA A;  2QZ4 A;  1DGB A;  4Z8X A;  1K3W A;  3SAS A;  5FTK A;  1Q02 A;  4JI4 M;  1R6B X;  4DR1 M;  4ZPX A;  3U61 B;  3LCU A;  4G3O A;  1SXJ D;  4OW0 A;  1TH3 A;  2LTU A;  3FUV A;  4II7 A;  3UJN A;  4GKJ M;  2MH8 A;  2MJ5 B;  1G41 A;  1QQW A;  1TGU A;  2CRU A;  3JR5 A;  4DV7 M;  4NRV A;  4LF5 M;  4AI6 A;  4HLQ A;  2ZAO A;  3W68 A;  3U6D A;  1NV9 A;  3T1H M;  4DR7 M;  5JI2 E;  4IBD A;  4DV0 M;  1T3T A;  1XC8 A;  2YFQ A;  4R3D A;  3FTE A;  1Z5A A;  1G71 A;  3TWK A;  1QUS A;  3L25 A;  1LV7 A;  2CHV A;  1IY1 A;  2RKO A;  1OFI A;  2RRU A;  2XFS A;  1NY5 A;  4Z6Y A;  3DZD A;  4DV1 M;  4CIS A;  3L27 A;  2XGN A;  3F92 A;  1TF0 B;  3VDP A;  2AHM A;  2YQZ A;  4LF8 M;  3K8Z A;  3FUU A;  5FSW A;  1GJS A;  4LRT A;  2KDL A;  2BWE A;  1JB0 F;  1DGF A;  3E9S A;  3HU3 A;  3ZCB B;  5JI3 E;  1E94 E;  2HKJ A;  3HU2 A;  3TWM A;  3GQ5 A;  2L7H A;  4YY3 M;  1JR3 E;  3GQ3 A;  2UU9 M;  2VF7 A;  2CFO A;  3KOZ E;  1XWI A;  1R2Z A;  2F5Q A;  5EJC A;  2BWB A;  3GLF E;  2HL7 A;  1KSF X;  4HL4 A;  3E46 A;  2R65 A;  4DUY M;  2DWM A;  4DV4 M;  1UFZ A;  2DI0 A;  5DFL A;  1IQP A;  3AJI B;  1OTR A;  2C96 A;  2DKL A;  2OOA A;  4L4U A;  1QAQ A;  3U6M A;  1T43 A;  4B7G A;  2CWB A;  4NOO B;  3K9O A;  5EP1 A;  4MH0 E;  2F5S A;  1NVM A;  2UUA M;  2JWS A;  1OIP A;  1XXH A;  2I7P A;  2YR0 A;  1Q3C A;  1VQ1 A;  4G4N A;  2CV0 A;  2R4E A;  2G3Q A;  5L8R F;  4M9Z A;  2EKF A;  1XXH B;  4B7H A;  2XH9 A;  3K9P A;  4B08 A;  2MGW A;  3VK7 A;  4MB7 A;  2K6B A;  5BR8 M;  2LH0 A;  4IJF A;  1IBK M;  3J81 S;  4MGH A;  2DAE A;  2JP7 A;  1IXZ A;  4IBF A;  4DR6 M;  5IZ7 D;  3GLH E;  2KHH A;  4IIW A;  4P17 A;  2EJS A;  3GRR A;  1KYI A;  2HHH M;  1NY6 A;  3SC3 A;  2D7E A;  1QDT A;  4F1I A;  3RGP A;  3U60 B;  1HNW M;  1HJP A; 
#chains in the Genus database with same CATH homology
 3EIE A;  5EQT A;  4CHT B;  1L1Z A;  4AKI A;  3IG8 A;  2H1R A;  3M0E A;  4GHL A;  4JYA M;  4LFC M;  3H4M A;  3CTW B;  2UUB M;  1WXQ A;  4D80 A;  4LFB M;  5A2Q S;  3M6A A;  3K92 A;  3FTF A;  1TH4 A;  4AW4 A;  5EXX A;  2J7O A;  4FW9 A;  2C98 A;  5DYG A;  4OVZ A;  3VFD A;  2QCU A;  3U5Z B;  2BJV A;  4MM3 B;  1Z5B A;  4OVZ B;  5LMN M;  2LNH C;  4PDG A;  1DGH A;  1G59 A;  5FTJ A;  2ERC A;  3ILK A;  4X66 M;  3TWL A;  4LJA A;  4AKG A;  4YHH M;  3FTD A;  4EIW A;  4GKK M;  2JA2 A;  4REZ A;  3GPY A;  4KHP M;  2XFT A;  2UXD M;  5C18 A;  7CAT A;  4DR5 M;  3KP0 E;  2Y20 A;  5ITU A;  4KO8 A;  1R2Y A;  3RGS A;  1J7K A;  1ORY B;  4GMQ A;  1N34 M;  4LCB A;  1Z59 A;  3PNV A;  4JI2 M;  4LJ5 A;  3AL0 C;  3SMP A;  1HQY E;  2EO2 A;  5E6J A;  5H37 D;  1N32 M;  3GP1 A;  4AG6 A;  4FD2 A;  4LRS A;  3GLI A;  4IBE A;  1YSY A;  2DHR A;  1GL7 A;  1SXJ A;  4OX9 M;  2Y0Q A;  3JR4 A;  3GLI B;  1I94 M;  4NXN M;  4AI6 A;  3SAU A;  1QAN A;  1PJI A;  3SAR A;  3PNY A;  3GO8 A;  3K1J A;  3ZC7 B;  2L7I A;  2Y21 A;  3VKG A;  1L2C A;  4AQY M;  4LJ9 A;  3HJQ A;  2EA0 A;  3I51 A;  2KZS A;  4IBK A;  5ITY A;  1SXJ C;  1IN7 A;  1HT2 E;  3KS4 A;  1HQC A;  3TE6 A;  4PD2 A;  5ITT A;  2R46 A;  2CUZ A;  4X64 M;  1IY2 A;  4QHT A;  4D82 A;  4LJ6 A;  3M7G A;  4GC9 A;  3AV0 A;  3HHX A;  4NSO B;  1N77 A;  1IBM M;  2C99 A;  2QBY A;  4JI7 M;  3L29 A;  4LJ7 A;  3GQ4 A;  1H6U A;  2X8A A;  2QBY B;  2D7G A;  3D8L A;  1G8P A;  1XNQ M;  1G4A E;  4OU7 A;  3MJ5 A;  3FYD A;  3SAV A;  3KFU G;  4IBJ A;  3SHG B;  4D81 A;  2FOI C;  3U6Q A;  2BNK A;  3SBJ A;  4BLC A;  3KS8 A;  4MGZ E;  4LJ8 A;  1TDH A;  4IBI A;  1GVN A;  5BPV A;  1E9S A;  4FWH A;  2UUC M;  3AOE A;  4QHS A;  3HHW A;  3LVW A;  3B9P A;  4GRI A;  4FCT A;  4DV2 M;  4GIT A;  3GPP A;  3NBI A;  1D2N A;  3L26 A;  5FLX S;  2W82 A;  2V1C A;  4GC5 A;  3FUW A;  3TQS A;  3ZH9 B;  3U6L A;  3J80 S;  1QAO A;  4BBA A;  3KP1 E;  4IBB A;  1HNZ M;  2XZF A;  2RGO A;  3W0F A;  4QOS A;  3D8B A;  1IXR C;  2L6O A;  4M9S A;  3QWL A;  2L09 A;  2FFJ A;  1DGG A;  3U60 A;  3T38 A;  3QAU A;  2CV2 A;  3TPZ A;  4PCZ A;  1QAM A;  1VDD A;  5KPT A;  1NNJ A;  5IWA M;  3UZU A;  3AOG A;  2F5P A;  3J27 B;  4FCV A;  3SHF A;  1S3S A;  4G4R A;  5ITR A;  2VII A;  8CAT A;  4B3T M;  1JR3 A;  4JI5 M;  3L28 A;  2NQ8 C;  2QEN A;  2ZAN A;  4LJ4 A;  3U5Z A;  5FTM A;  2UXB M;  3A98 B;  4S12 A;  4M0W A;  3UMM A;  2ZBK B;  1GKI A;  2Q2E B;  5KPZ A;  3GRV A;  4WUR A;  1JR3 D;  1GL6 A;  2VQF M;  5ITX A;  3GLF B;  1FNN A;  4CGY B;  1SXJ E;  1Z5C A;  4LF9 M;  3FKE A;  3GRY A;  3LQQ A;  4AKH A;  3KOY E;  3A46 A;  1YE9 A;  5IRE B;  2R18 A;  2C9C A;  1IN4 A;  4I81 A;  4LFA M;  4FCW A;  3GPU A;  2EUC A;  5EP4 A;  3GPX A;  1G3I A;  1NNU C;  3PXG A;  3FUX A;  2XF3 A;  3SYK A;  1E32 A;  4DV5 M;  2OPF A;  2QP9 X;  2A5Y B;  3FUT A;  4I5S A;  2I7N A;  2C5R A;  2RGH A;  4MGK E;  4B3M M;  1IM2 A;  1N33 M;  3GRU A;  3R9X B;  2LWX A;  4PT5 A;  1NSF A;  1QYR A;  2X4A A;  1IXS B;  3NWL A;  3WHK A;  2LXE A;  2OQ4 A;  1ZAE A;  3KXE C;  2DWL A;  4KOD A;  2E5L M;  2O5R A;  1K3X A;  3DFZ A;  2XZU A;  2KEB A;  4L8R C;  4L15 A;  1IN8 A;  2XLJ A;  1MU5 A;  1PJJ A;  3HU1 A;  4G4Q A;  2Z3X A;  2F5O A;  5ITQ A;  3SAW A;  2C9O A;  2HCB A;  4NXM M;  4LGY A;  3L2A A;  1C1K A;  3KVW A;  5KO3 A;  4LGM A;  3U6O A;  4DUZ M;  4JN6 A;  2FE8 A;  2R45 A;  3UGJ A;  1L1T A;  2G5G X;  3E4R A;  5EXP A;  1N75 A;  4QOZ C;  2KW0 A;  4L16 A;  2YNM D;  2FNA A;  4IJE A;  1NJF A;  4A3V B;  3I4V A;  4LZZ A;  2BJW A;  1XMO M;  1J5E M;  2DWZ B;  4M0D A;  4B3S M;  4LF7 M;  4PDI A;  1R7R A;  4JV5 M;  1ZQ9 A;  3A42 A;  3CF0 A;  4DV6 M;  5C1B A;  4B3R M;  1HNX M;  2F4V M;  4MGY E;  4LF6 M;  3T1Y M;  3VK8 A;  5EP2 A;  1PM5 A;  5EP3 A;  5F3W A;  4LG2 A;  1Z6T A;  1IY0 A;  3HHZ A;  4GH9 A;  2P5T A;  1L2B A;  1IN5 A;  1GLN A;  1QZM A;  3BOS A;  3HHY A;  2KRK A;  3EIH A;  3U6P A;  4XGI A;  3GLG A;  4NRW A;  2Z4R A;  3HWS A;  3GLG B;  4IBG A;  3PVS A;  2KZU A;  1J09 A;  1W5S A;  1Q39 A;  3WHL A;  1K82 A;  2CV1 A;  2VQE M;  3U6S A;  1N78 A;  5KQ8 A;  4DR3 M;  4DR2 M;  4W5W A;  3U6C A;  4RF1 A;  1FJG M;  1X37 A;  3KW6 A;  3AOE C;  4NSR A;  4KLN A;  1TH2 A;  4I8O A;  5DNY A;  1UM8 A;  1HT1 E;  2XEP A;  3MK6 A;  4AZF A;  2Z7J A;  4JXJ A;  4IBC A;  4DV3 M;  2UXC M;  3DA1 A;  3Q8X A;  4FWG A;  4FWD A;  5ITX E;  4DR4 M;  4JI8 M;  2CE7 A;  4M9X A;  3FTC A;  4TUW A;  3VDU A;  2DXI A;  1MX0 A;  3R8F A;  2KXE A;  2M5Z A;  5LMU M;  5FTN A;  2M60 A;  4XBO A;  3SYL A;  3MHV C;  2G8L A;  1L2D A;  4WW0 A;  3IG5 A;  3LQR A;  3VKH A;  4FVM A;  4P16 A;  3U6E A;  4JI3 M;  3KOX E;  2DWN A;  2Y0T A;  3SFZ A;  4X65 M;  5E26 A;  3AKZ A;  4BB9 A;  3SAT A;  3VLF B;  3GLF A;  3CF6 E;  3SMS A;  1IBL M;  2CHG A;  2QPA A;  5EXT A;  5IT9 S;  1YUB A;  2R62 A;  2XSZ A;  2V6Z M;  3W0L B;  5FTL A;  3FD9 A;  4JI0 M;  3CF2 A;  2CHQ A;  4LY6 A;  4G4O A;  3UK6 A;  1NJG A;  1EE8 A;  3TL4 X;  4JI6 M;  1OJL A;  2XSZ D;  4NL4 H;  3HKP A;  1DO2 A;  3T15 A;  4JI1 M;  4R7G A;  3KSX A;  1OFH A;  2DZN B;  1TDZ A;  1IN6 A;  3JAM S;  2ZM6 M;  3HJS A;  2X49 A;  3J7B A;  3PFI A;  4L78 A;  4AG5 A;  3C58 A;  1HR0 M;  4GHA A;  5GKN A;  1XMQ M;  2K47 A;  3KOW E;  3KSJ A;  3GLH A;  1JQJ C;  2Z4S A;  4LZJ A;  1Q3B A;  4B7F A;  3DOA A;  4ITQ A;  1E9R A;  4K0K M;  1NHG C;  3RE8 A;  1DGH B;  3GLH B;  1N36 M;  3LVV A;  4MGI E;  2J7N A;  4X62 M;  1W5T A;  5KPR A;  5DYI A;  4GIP A;  3FYC A;  3RFW A;  3AFH A;  1QVR A;  3I4Y A;  4QNM A;  5KQD A;  2KRU A;  1XNR M;  3KDS E;  3J7A S;  1NHW C;  2D7H A;  2DZO B;  1XHB A;  2DVW B;  4QNR A;  2V1U A;  5EXS A;  3OTO M;  2KA6 B;  2F5N A;  3THG A;  4RF0 A;  4LF4 M;  3HJ8 A;  3J2P B;  1I4W A;  2CEA A;  3LMM A;  4G6Z A;  1DO0 A;  2R4J A;  3A45 A;  1KFV A;  3HGI A;  4I4L A;  3U61 A;  3K2L A;  1L8Q A;  1SXJ B;  2ZAM A;  4RNA A;  4Z8X A;  1K3W A;  2QZ4 A;  1DGB A;  4JI4 M;  3SAS A;  5FTK A;  1R6B X;  4DR1 M;  4ZPX A;  3U61 B;  4OW0 A;  1SXJ D;  1TH3 A;  3UJN A;  3FUV A;  4II7 A;  4GKJ M;  1G41 A;  1QQW A;  1TGU A;  4DV7 M;  3JR5 A;  4LF5 M;  4NRV A;  4HLQ A;  2ZAO A;  3U6D A;  3T1H M;  4DR7 M;  5JI2 E;  4IBD A;  4DV0 M;  1T3T A;  1XC8 A;  2YFQ A;  4R3D A;  3FTE A;  1Z5A A;  3TWK A;  3L25 A;  1LV7 A;  2CHV A;  1IY1 A;  2RKO A;  1OFI A;  2XFS A;  1NY5 A;  4Z6Y A;  3DZD A;  4DV1 M;  4CIS A;  3L27 A;  2XGN A;  3VDP A;  2AHM A;  2YQZ A;  4LF8 M;  3K8Z A;  3FUU A;  5FSW A;  4LRT A;  3E9S A;  1DGF A;  3HU3 A;  3ZCB B;  5JI3 E;  1E94 E;  2HKJ A;  3HU2 A;  3TWM A;  3GQ5 A;  2L7H A;  4YY3 M;  3GQ3 A;  2UU9 M;  2CFO A;  3KOZ E;  1XWI A;  1R2Z A;  2F5Q A;  5EJC A;  2HL7 A;  1KSF X;  4HL4 A;  2R65 A;  4DUY M;  2DWM A;  4DV4 M;  1IQP A;  3AJI B;  3U6M A;  2C96 A;  4L4U A;  1QAQ A;  4B7G A;  4NOO B;  5EP1 A;  4MH0 E;  2F5S A;  1NVM A;  2UUA M;  1XXH A;  2I7P A;  2YR0 A;  1Q3C A;  4G4N A;  2CV0 A;  2R4E A;  4M9Z A;  1XXH B;  4B7H A;  2XH9 A;  4B08 A;  3VK7 A;  4MB7 A;  5BR8 M;  2LH0 A;  4IJF A;  1IBK M;  3J81 S;  4MGH A;  1IXZ A;  4IBF A;  4DR6 M;  5IZ7 D;  4IIW A;  3GRR A;  1KYI A;  2HHH M;  1NY6 A;  3SC3 A;  2D7E A;  3RGP A;  3U60 B;  1HNW M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...