1N32M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n32M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n32M02
4MB7A 3U6EA 2ZBKB 1Q3BA 1KFVA 4GKKM 4G4RA 5LMNM 4PDIA 4DR2M 1PJJA 4K0KM 3GQ3A 1K3XA 3GPUA 3SAUA 2ZM6M 1XNRM 4NXNM 3J7AS 4JI1M 2F5OA 2XZFA 3JAMS 1PJIA 3SAWA 1NNJA 2UXBM 4JI8M 4DV7M 1I94M 3T1YM 2F5SA 5ITUA 1HNXM 4DR4M 4JI4M 4PDGA 1L1TA 4X62M 4LF7M 3SBJA 2UXDM 1Z5AA 4X66M 5ITYA 3SARA 2UUAM 1Q39A 3C58A 1L2BA 5A2QS 3VK7A 3SASA 2VQFM 1N32M 2F5NA 4ITQA 4DUZM 3JR5A 4GKJM 3GP1A 2VQEM 4LF6M 2UUBM 4G4OA 4G4QA 4AQYM 2F5PA 3OTOM 2F4VM 4JI3M 5LMUM 1N36M 4X65M 4DV1M 5FLXS 4PD2A 1L2DA 1Z5BA 4YHHM 3GQ4A 4DV6M 3GPXA 4JI6M 3A46A 4DR7M 4NRWA 4JI0M 4DR3M 5ITRA 4B3RM 3U6LA 3U6SA 3U6CA 1HNZM 1MU5A 2HKJA 4JI7M 4DR6M 1EE8A 5ITQA 4G4NA 4LF8M 4JV5M 1J5EM 1MX0A 1R2YA 3SATA 4LF4M 3GO8A 1IBLM 3JR4A 3W0FA 4LF9M 3TWLA 1K82A 2UUCM 2OPFA 4JI2M 4B3SM 1PM5A 1L2CA 4DV3M 3U6OA 4DR1M 4CISA 3U6DA 1L1ZA 5IWAM 3A45A 5ITTA 3T1HM 1R2ZA 5BR8M 2Q2EB 1IBMM 2XZUA 3U6PA 3GPYA 3VK8A 4X64M 4LFBM 3U6MA 4DR5M 4NXMM 4B3TM 1XMQM 1N34M 4DV4M 4LFAM 2HHHM 3A42A 3SAVA 4KHPM 4DV2M 4OX9M 4B3MM 1TDZA 4DV5M 2F5QA 1N33M 2OQ4A 1FJGM 4PCZA 4DUYM 1IBKM 2E5LM 4JI5M 1HNWM 3TWKA 3GPPA 2UXCM 3DOAA 4JYAM 1Z59A 3J80S 2UU9M 3J81S 4LF5M 5ITXA 5IT9S 4NRVA 5ITXE 1TDHA 3TWMA 4YY3M 2EA0A 3U6QA 1XMOM 1Z5CA 1XNQM 1XC8A 1K3WA 4DV0M 4LFCM 1Q3CA 3GQ5A 1HR0M
chains in the Genus database with same CATH superfamily
4MB7A 3U6EA 2ZBKB 1Q3BA 1KFVA 2JZ0A 4GKKM 2VF8A 1PJJA 2LWXA 4IBCA 3UK6A 4IBKA 4LRSA 3KS8A 3HHZA 1D0LA 1QUTA 4Z8XA 1R7RA 2DAIA 2DKLA 3GPUA 3GRYA 3SAUA 1X37A 4AI6A 3QYBA 4QHTA 5BPVA 2LVNC 2P5TA 4LY6A 4Y28F 5KPRA 2KZSA 3E9SA 1OAOC 1R6BX 2XZFA 3HJSA 4GEWA 3KP1E 8CATA 4B08A 2UXBM 1QANA 4DV7M 3T38A 2XSZD 1AUAA 1WHCA 4FD2A 5FTNA 2R6FA 2QCUA 4ANRA 1L1TA 4X62M 2Z8YM 1JR3D 1OQYA 4KODA 2LVAA 4MH0E 4REZA 2DXIA 4FCTA 2O25A 2XEPA 4LJ4A 1TH3A 2JY7A 3SMPA 3FD9A 1IXZA 2J5YA 3W68A 2KEBA 1QAMA 5DYIA 2KZUA 2F5PA 3VKHA 5LMUM 1N36M 2EUCA 1GKIA 1IXSA 4G6ZA 5FLXS 2CV0A 2BNKA 1Y8GA 1QZEA 2DHYA 3GQ4A 3FUUA 4LZJA 1IM2A 4R7GA 3THGA 3GPXA 4JI6M 2DHRA 3HY5A 4MGKE 4B3RM 1ZMUA 3U6LA 4AG5A 1NHGC 5EXTA 1D2NA 1HNZM 1H6UA 1MU5A 2CHQA 2L4FA 2X8AA 4JI7M 2Y21A 1EE8A 1NV8A 3DFZA 1W5TA 2CUZA 4LGMA 5FTMA 1YE9A 2LVPC 1R2YA 3GO8A 2EKKA 3IG5A 3DZDA 2QENA 1K82A 2G5GX 4JI2M 3FTFA 3KOYE 3RGPA 1PM5A 1L2CA 4DV3M 2FS1A 4DR1M 4DBGB 2G3QA 3CF0A 2J7OA 3HHXA 2QQ8A 5BR8M 2Q2EB 1A5TA 1JR3A 1SXJD 2C99A 3KXEC 3HJ8A 4M9XA 4IBBA 5KPTA 1IXRC 2CV2A 4FCVA 4XBOA 1XWIA 3A42A 2JY6B 3GRUA 3HKPA 1E9SA 3HZJA 5EP4A 1ZAEA 4L78A 1S3SA 4M0WA 2XLJA 1N33M 3GRRA 3HHWA 2OQ4A 1HQCA 3HX3A 2JY8A 3U61B 3GLGA 1IBKM 2JWSA 2K6BA 4JI5M 2Z4SA 3GPPA 3U60B 4NL4H 1D0MA 2N35A 3D8LA 4LF5M 5IT9S 3NWLA 2A5YB 4NRVA 4W5WA 4FWHA 4NSRA 4D80A 3L26A 1JR3E 3NBIA 1GL7A 3VLFB 2MR9A 3EIEA 2QBYB 2L2DA 4AW4A 3SFZA 1NNUC 5LMNM 4PDIA 4G4RA 2DI0A 4K0KM 3GQ3A 3BXWA 3J7BA 3K9PA 3GLHA 2JA2A 2QPAA 4MGHA 2DZOB 3B89A 4F2LA 4I81A 4NC6A 2CHGA 2KW0A 2ZM6M 1XNRM 3FTDA 4IBFA 3L2AA 3J7AS 3D8BA 1F4IA 1J7KA 1SXJA 4JI1M 4GH9A 2C5RA 2F5OA 3GLGE 1OAIA 1OJLA 2JXNA 1EFUB 1IFYA 1DGBA 3KSJA 3L27A 1DGGA 1IQPA 1PJTA 3SAWA 4GC5A 3I4YA 2CV1A 5DFLA 3CGWA 5KQDA 2AHMA 3BBZA 3AL0C 3PVSA 2CFOA 1WR1B 4DR4M 2R4JA 4II7A 4PDGA 2FFJA 1DGHB 2UXDM 3HU3A 2R44A 5L8RF 4KT0F 4GIPA 4KLNA 4B7GA 1E9RA 4NSOB 2GNOA 2Z3XA 1LTMA 4HL4A 3VDUA 2HCBA 2KDLA 3E46A 5A2QS 1QUSA 4MGYE 3TL4X 1I4WA 4NOOB 3LQRA 2VQFM 1N32M 4ITQA 3GLHE 4ZPXA 3SYKA 4CIZA 4DUZM 4R71A 2UUBM 4G4OA 4JXJA 1TTEA 2F4VM 4OVZA 5H37D 1ZV1A 2HAKA 1SXJE 3AOGA 1FNNA 4CGYB 4IJFA 2MGWA 1OFIA 4AKIA 3ZQJA 2YQZA 3QYEA 4YHHM 1T6OA 3HJQA 2R18A 4DV6M 2M5ZA 3KOZE 4WP2A 3A46A 4DR7M 2CHVA 3VKGA 4JI0M 5FTLA 3L29A 4DR3M 1DV0A 3U6SA 4MGZE 5DNYA 2VF7A 1HT2E 3AOEC 2L6OA 1CUKA 1QAOA 4G3OA 3UGJA 1OIZA 4LJAA 4CHTB 5ITQA 3J2PB 4P17A 4RNAA 4G4NA 1NJFA 4LF8M 1WGNA 4WW0A 2KNAA 3H4MA 1IBLM 2GQFA 2LXEA 2ZTDA 3M7GA 5E26A 1YUBA 1XB2B 3W0FA 3TWLA 1P3QQ 3GRVA 3K1JA 2UUCM 1QDTA 4LGYA 1VG5A 3FUXA 4RF0A 2L7HA 2O01F 3VDPA 3B7QA 5DYGA 3GLIA 2LHGA 5IWAM 3A45A 3KOWE 1IN8A 5ITTA 4GRIA 1R2ZA 3GLFB 1TF0B 3PXGA 3AJIB 3U6PA 4M0DA 5EP1A 2O5RA 1NY6A 1VEGA 4LJ8A 5KPZA 3VK8A 2R45A 3KFUG 4I4LA 1IN7A 1WXQA 1YLAA 4B3TM 2JP7A 2QZ4A 3Q8GA 1N34M 1DO0A 3SAVA 5C18A 2YR0A 4JN6A 4L4UA 1IN6A 3HU1A 4OX9M 3B7NA 3T15A 1TDZA 4AKGA 1PGYA 1RU3A 1FJGM 2Y20A 2W82A 3B74A 4M9SA 3SYLA 1V34A 2BJVA 3HGIA 2CE7A 2K47A 3LMMA 3DOAA 2D7EA 4LZZA 1QAQA 4OU7A 2XSZA 2XH9A 3KDSE 3Q8XA 1T3TA 2QSFX 3B9PA 2NQ8C 2KRKA 3GLIE 5IREB 2EA0A 2K0BX 3U6QA 2DENA 2FNAA 3SC3A 1XC8A 1QDRA 2R62A 1V33A 1MN3A 1NO1A 1KYIA 2CRUA 3C3EA 1XHBA 4IJEA 4FVMA 4XGIA 5EJCA 3LVWA 4JV5M 3KSXA 3AV0A 4DR2M 3FE3A 2K9DA 1K3XA 2MH8A 2OOBA 3TPZA 2QBYA 2KRUA 4LRTA 4CJ6A 1C7YA 1GL6A 1IXSB 3FTCA 3W0LB 2Y0TA 1NVMA 3UJNA 2JUJA 4XK8F 4GC9A 5F3WA 3K8ZA 2ZAMA 3F92A 2VDBB 3I04M 1PJIA 3NBXX 3U5ZA 3IECA 3K9OA 1GJTA 4R3DA 1VDDA 4JI8M 1I94M 3T1YM 3QWLA 1G59A 3SHGB 1Z6TA 1HNXM 3R9XB 4TUWA 3KVWA 1EIJA 1VEJA 7CATA 4JI4M 4LF7M 3SBJA 4BB9A 2EO2A 3PNVA 3LW5F 5ITYA 3SARA 2UUAM 1GJSA 1KSFX 2H5XA 3VK7A 3SASA 2DWZB 3LQQA 1UM8A 2F5NA 1NHWC 2RKOA 4Z6YA 4LF6M 4D82A 2KNVA 2Z4RA 1N78A 4GMQA 4JI3M 1V92A 2HL7A 4MGIE 3ZC7B 4X65M 1DO2A 4PT5A 4IBIA 3A98B 5GKNA 3W67A 4PD2A 1Z5BA 4F1IA 2I7NA 4WURA 3PNYA 4IBEA 4QNMA 2QP9X 4RF1A 2L09A 3LCUA 3E21A 1E94E 3U6CA 2C98A 2M60A 3H4JA 2OO9A 4LJ9A 1G71A 3QAUA 4DR6M 1XXHB 3LVVA 2LVOC 5IZ7D 4LF4M 4LG2A 2QNJA 3JR4A 4P16A 4AKHA 1GABA 1PJQA 5EXSA 4B3SM 3FYDA 5EP3A 3SHFA 3MK6A 2X49A 3LCVB 2B3TA 4OW0A 1IY2A 3U6DA 4L8RC 4FCWA 4LCBA 4QOZC 3IG8A 2DZLA 3IHPA 1IBMM 1OTRA 2ERCA 1R4GA 4LFBM 3U6MA 4IIWA 4DR5M 3GLFA 1JQJC 3ZH9B 2BWEA 2DAEA 1N75A 2CP8A 4DV2M 1JB0F 2EKFA 1SXJB 4B3MM 4HLQA 1SXJC 2APLA 2RRUA 2VIIA 3AKZA 4Q7JA 1Q02A 2R46A 4FWGA 4DUYM 1OFHA 2V6ZM 4IBJA 2E5LM 2OOAA 4GHAA 2WZJA 4L16A 3R8FA 2UXCM 3B7ZA 3J80S 3DA1A 4BLCA 2UU9M 1WIVA 3FKEA 2RGOA 1QYRA 1TDHA 2FOIC 4IBGA 4KO8A 5ITXE 2DNAA 2I7PA 4M9ZA 3TWMA 2DWLA 2XGNA 1Z5CA 2Z7JA 3I4VA 1K3WA 4LFCM 3WHLA 5KO3A 1TR8A 2MJ5B 2YNMD 4QOSA 2DWNA 1Q3CA 1SG9A 2DAKA 4I5SA 3GQ5A 1NSFA 2YFQA 1TH2A 1TGUA 3GLFE 1N77A 2EJSA 2QHOB 3L25A 1VQ1A 2J7NA 1ORYB 1MJGM 1GO5A 3FRHA 4HEOA 4UN2B 2CWBA 1G8PA 2BJWA 4OVZB 1ZQ9A 1GVNA 2JY5A 4LJ7A 4NXNM 1HT1E 2R4EA 1IY0A 3KW6A 1G4AE 3FRIA 5JI2E 4GHLA 3JAMS 3U61A 1QQWA 2ZAOA 3EIHA 2KA6B 1NNJA 1YSYA 3J27B 2LNHC 4GITA 1NY5A 3U60A 2DAMA 2WSCF 5ITUA 2RGHA 3M0EA 4RKUF 3HU2A 2F5SA 3AFHA 1UFZA 1R5LA 3MMPA 2XFSA 3VFDA 4B7FA 3M6AA 2JZ1A 5E6JA 1Z5AA 4AG6A 4L6V6 4X66M 3FUWA 1NJGA 2DWMA 3K92A 2Y0QA 4A3VB 1Q39A 3C58A 5FTJA 1W5SA 5FTKA 1L2BA 3GLIB 1IY1A 3RE8A 1QVRA 4BBAA 2KNZA 1G41A 2WSEF 4FW9A 2KXEA 2XF3A 3JR5A 2LVQD 3GP1A 2VQEM 4B7HA 1OKSA 4GKJM 4G4QA 3MJ5A 4AQYM 3OTOM 2L7IA 1T43A 1D0KA 3KP0E 1HJPA 1L8QA 4DV1M 3BOSA 1TH4A 1OIPA 2JNHA 2R65A 3FUVA 4IBDA 1L2DA 3SMSA 1ZMVA 4LJ6A 2C9OA 3ZCBB 4FWDA 1BVSA 4NRWA 1VDLA 1NV9A 5ITRA 3V76A 5C1BA 2HKJA 5EP2A 1WJ7A 1J5EM 3FYCA 1IN5A 1MX0A 2L4EA 2WSFF 5EXXA 3SATA 2C9CA 1WGLA 2DVWB 2LTUA 1DGHA 4LF9M 1J09A 2FH0A 4AZFA 1XXHA 2ZTCA 2OPFA 4QNRA 3C9PA 3U6OA 1C1KA 2X4AA 4CISA 3UZUA 1L1ZA 3WHKA 3T1HM 2D7HA 2H1RA 1PRBA 3E4RA 3MHVC 2XZUA 2BWBA 3GPYA 3FTEA 4D81A 3HHYA 2V1CA 2D7GA 4X64M 4NXMM 2R0IA 3CF6E 1E32A 2LHCA 2ZANA 4S12A 2CEAA 3T6PA 1XMQM 4LJ5A 4LFAM 4DV4M 2HHHM 3K2LA 4EIWA 3KS4A 4KHPM 2XFTA 5EQTA 3GLGB 1G3IA 4I8OA 4DV5M 2F5QA 3KOXE 3UMMA 1ZMWA 4PCZA 3AOEA 1LV7A 2C96A 2KHHA 5EXPA 3CF2A 1HQYE 3C3DA 1AIPC 1DGFA 1GLNA 1HNWM 3U5ZB 3TE6A 3TWKA 2MROB 1XXHE 4JYAM 1Z59A 3PFIA 5FSWA 1QZMA 2DAGA 1VEKA 3TQSA 2LBCA 4MM3B 2DZNB 3I51A 5ITXA 3J81S 3FUTA 3ILKA 5JI3E 3L28A 1IN4A 3RFWA 4YY3M 1XMOM 2G8LA 3RGSA 1XNQM 2FE8A 2HWJA 2LH0A 1PJSA 3CTWB 4DV0M 3I01M 3HWSA 4QHSA 2V1UA 4L15A 5KQ8A 1HR0M 3GLHB
chains in the Genus database with same CATH topology
4MB7A 3U6EA 2ZBKB 1Q3BA 1KFVA 4GKKM 1PJJA 2LWXA 4IBCA 3UK6A 4IBKA 4LRSA 3KS8A 3HHZA 4Z8XA 1R7RA 3GPUA 3GRYA 3SAUA 1X37A 4AI6A 4QHTA 5BPVA 2P5TA 4LY6A 5KPRA 2KZSA 3E9SA 1R6BX 2XZFA 3HJSA 3KP1E 8CATA 4B08A 2UXBM 1QANA 4DV7M 3T38A 2XSZD 4FD2A 5FTNA 2QCUA 1L1TA 4X62M 1JR3D 4KODA 4MH0E 4REZA 2DXIA 4FCTA 2XEPA 4LJ4A 1TH3A 3SMPA 3FD9A 1IXZA 2KEBA 1QAMA 5DYIA 2KZUA 2F5PA 3VKHA 5LMUM 1N36M 2EUCA 1GKIA 4G6ZA 5FLXS 2CV0A 2BNKA 3GQ4A 3FUUA 4LZJA 1IM2A 4R7GA 3THGA 3GPXA 4JI6M 2DHRA 4MGKE 4B3RM 3U6LA 4AG5A 1NHGC 5EXTA 1D2NA 1HNZM 1H6UA 1MU5A 2CHQA 2X8AA 4JI7M 2Y21A 1EE8A 3DFZA 1W5TA 2CUZA 4LGMA 5FTMA 1YE9A 1R2YA 3GO8A 3IG5A 3DZDA 2QENA 1K82A 2G5GX 4JI2M 3FTFA 3KOYE 3RGPA 1PM5A 1L2CA 4DV3M 4DR1M 3CF0A 2J7OA 3HHXA 5BR8M 2Q2EB 1JR3A 1SXJD 2C99A 3KXEC 3HJ8A 4M9XA 4IBBA 5KPTA 1IXRC 2CV2A 4FCVA 4XBOA 1XWIA 3A42A 3GRUA 3HKPA 1E9SA 5EP4A 1ZAEA 4L78A 1S3SA 4M0WA 2XLJA 1N33M 3GRRA 3HHWA 2OQ4A 1HQCA 3U61B 3GLGA 1IBKM 4JI5M 2Z4SA 3GPPA 3U60B 4NL4H 4LF5M 3D8LA 5IT9S 3NWLA 2A5YB 4NRVA 4W5WA 4FWHA 4NSRA 4D80A 3L26A 3NBIA 3VLFB 1GL7A 3EIEA 2QBYB 4AW4A 3SFZA 1NNUC 5LMNM 4PDIA 4G4RA 4K0KM 3GQ3A 3J7BA 3GLHA 2JA2A 2QPAA 4MGHA 2DZOB 4I81A 2CHGA 2KW0A 2ZM6M 1XNRM 3FTDA 4IBFA 3L2AA 3J7AS 3D8BA 1J7KA 1SXJA 4JI1M 4GH9A 2C5RA 2F5OA 1OJLA 1DGBA 3KSJA 3L27A 1DGGA 1IQPA 3SAWA 4GC5A 3I4YA 2CV1A 5KQDA 2AHMA 3AL0C 3PVSA 2CFOA 4DR4M 2R4JA 4II7A 4PDGA 2FFJA 1DGHB 2UXDM 3HU3A 4GIPA 4KLNA 4B7GA 1E9RA 4NSOB 2Z3XA 3VDUA 4HL4A 2HCBA 5A2QS 4MGYE 3TL4X 1I4WA 4NOOB 3LQRA 2VQFM 1N32M 4ITQA 4ZPXA 3SYKA 4DUZM 2UUBM 4G4OA 4JXJA 2F4VM 4OVZA 5H37D 3AOGA 1SXJE 1FNNA 4CGYB 4IJFA 1OFIA 4AKIA 2YQZA 4YHHM 3HJQA 2R18A 4DV6M 2M5ZA 3KOZE 3A46A 4DR7M 2CHVA 3VKGA 4JI0M 5FTLA 3L29A 4DR3M 3U6SA 4MGZE 5DNYA 1HT2E 3AOEC 2L6OA 1QAOA 3UGJA 4LJAA 4CHTB 5ITQA 3J2PB 4RNAA 4G4NA 4LF8M 1NJFA 4WW0A 3H4MA 1IBLM 2LXEA 5E26A 3M7GA 3W0FA 1YUBA 3TWLA 3K1JA 3GRVA 2UUCM 4LGYA 3FUXA 4RF0A 2L7HA 3VDPA 5DYGA 3GLIA 5IWAM 3A45A 3KOWE 1IN8A 5ITTA 4GRIA 1R2ZA 3GLFB 3PXGA 3AJIB 3U6PA 4M0DA 5EP1A 2O5RA 1NY6A 3VK8A 4LJ8A 5KPZA 3KFUG 2R45A 4I4LA 1IN7A 1WXQA 4B3TM 2QZ4A 1N34M 1DO0A 3SAVA 5C18A 2YR0A 4JN6A 4L4UA 1IN6A 3HU1A 4OX9M 3T15A 1TDZA 4AKGA 1FJGM 2Y20A 2W82A 4M9SA 3SYLA 2BJVA 3HGIA 2CE7A 2K47A 3LMMA 3DOAA 2D7EA 4LZZA 1QAQA 4OU7A 2XSZA 2XH9A 3KDSE 3Q8XA 1T3TA 3B9PA 2NQ8C 2KRKA 5IREB 2EA0A 3U6QA 2FNAA 3SC3A 1XC8A 2R62A 1KYIA 1XHBA 4IJEA 4FVMA 4XGIA 5EJCA 3LVWA 4JV5M 3KSXA 3AV0A 4DR2M 1K3XA 3TPZA 2QBYA 2KRUA 4LRTA 1GL6A 1IXSB 3FTCA 3W0LB 2Y0TA 1NVMA 3UJNA 5F3WA 4GC9A 3K8ZA 2ZAMA 1PJIA 3U5ZA 4R3DA 1VDDA 4JI8M 1I94M 3T1YM 3QWLA 1G59A 3SHGB 1Z6TA 1HNXM 3R9XB 4TUWA 3KVWA 7CATA 4JI4M 4LF7M 3SBJA 4BB9A 2EO2A 3PNVA 5ITYA 3SARA 2UUAM 1KSFX 3VK7A 3SASA 2DWZB 3LQQA 1UM8A 2F5NA 1NHWC 2RKOA 4Z6YA 4LF6M 4D82A 2Z4RA 1N78A 4GMQA 4JI3M 3ZC7B 2HL7A 4MGIE 4X65M 1DO2A 4PT5A 4IBIA 3A98B 5GKNA 4PD2A 1Z5BA 2I7NA 4WURA 3PNYA 4IBEA 4QNMA 2QP9X 4RF1A 2L09A 1E94E 3U6CA 2C98A 2M60A 4LJ9A 4DR6M 3QAUA 1XXHB 3LVVA 5IZ7D 4LF4M 4LG2A 3JR4A 4P16A 4AKHA 5EXSA 4B3SM 3FYDA 5EP3A 3SHFA 3MK6A 2X49A 4OW0A 1IY2A 3U6DA 4L8RC 4FCWA 4LCBA 4QOZC 3IG8A 1IBMM 2ERCA 4LFBM 3U6MA 4IIWA 4DR5M 3GLFA 1JQJC 3ZH9B 1N75A 4DV2M 1SXJB 4B3MM 4HLQA 1SXJC 2VIIA 3AKZA 2R46A 4FWGA 4DUYM 1OFHA 2V6ZM 4IBJA 2E5LM 4GHAA 4L16A 3R8FA 2UXCM 3J80S 3DA1A 4BLCA 2UU9M 3FKEA 2RGOA 1QYRA 1TDHA 2FOIC 4IBGA 4KO8A 5ITXE 4M9ZA 2I7PA 3TWMA 2DWLA 2XGNA 1Z5CA 2Z7JA 3I4VA 1K3WA 4LFCM 3WHLA 5KO3A 2YNMD 4QOSA 2DWNA 1Q3CA 3GQ5A 4I5SA 1NSFA 2YFQA 1TH2A 1TGUA 1N77A 3L25A 2J7NA 1ORYB 1G8PA 2BJWA 4OVZB 1ZQ9A 1GVNA 4LJ7A 4NXNM 1HT1E 2R4EA 1IY0A 3KW6A 1G4AE 5JI2E 4GHLA 3JAMS 3U61A 1QQWA 2ZAOA 3EIHA 2KA6B 1NNJA 1YSYA 3J27B 2LNHC 4GITA 1NY5A 3U60A 2F5SA 5ITUA 2RGHA 3M0EA 3HU2A 3AFHA 2XFSA 3VFDA 4B7FA 3M6AA 5E6JA 1Z5AA 4AG6A 4X66M 3FUWA 1NJGA 2DWMA 3K92A 2Y0QA 4A3VB 1Q39A 3C58A 5FTJA 1W5SA 5FTKA 1L2BA 3GLIB 1IY1A 3RE8A 1QVRA 4BBAA 1G41A 4FW9A 2KXEA 2XF3A 3JR5A 4GKJM 3GP1A 2VQEM 4B7HA 4G4QA 3MJ5A 4AQYM 3OTOM 2L7IA 3KP0E 1L8QA 4DV1M 3BOSA 1TH4A 2R65A 3FUVA 1L2DA 4IBDA 3SMSA 4LJ6A 2C9OA 3ZCBB 4FWDA 4NRWA 5ITRA 5C1BA 2HKJA 5EP2A 1J5EM 3FYCA 1IN5A 1MX0A 5EXXA 3SATA 2C9CA 2DVWB 1DGHA 4LF9M 1J09A 2OPFA 4AZFA 1XXHA 4QNRA 3U6OA 1C1KA 2X4AA 4CISA 3UZUA 1L1ZA 3WHKA 3T1HM 2D7HA 2H1RA 3E4RA 3MHVC 2XZUA 3GPYA 3FTEA 4D81A 3HHYA 2V1CA 2D7GA 4X64M 4NXMM 3CF6E 1E32A 2ZANA 4S12A 2CEAA 1XMQM 4LJ5A 4LFAM 4DV4M 2HHHM 3K2LA 4EIWA 3KS4A 4KHPM 2XFTA 5EQTA 3GLGB 1G3IA 4I8OA 4DV5M 2F5QA 3KOXE 3UMMA 4PCZA 3AOEA 1LV7A 2C96A 5EXPA 3CF2A 1HQYE 1DGFA 1GLNA 1HNWM 3U5ZB 3TE6A 3TWKA 4JYAM 1Z59A 3PFIA 5FSWA 1QZMA 3TQSA 3J81S 4MM3B 5ITXA 2DZNB 3I51A 3FUTA 3ILKA 5JI3E 3L28A 1IN4A 3RFWA 4YY3M 1XMOM 2G8LA 3RGSA 1XNQM 2FE8A 2LH0A 4DV0M 3CTWB 3HWSA 4QHSA 2V1UA 4L15A 5KQ8A 1HR0M 3GLHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MB7 A;  3U6E A;  2ZBK B;  1Q3B A;  1KFV A;  4GKK M;  4G4R A;  5LMN M;  4PDI A;  4DR2 M;  1PJJ A;  4K0K M;  3GQ3 A;  1K3X A;  3GPU A;  3SAU A;  2ZM6 M;  1XNR M;  4NXN M;  3J7A S;  4JI1 M;  2F5O A;  2XZF A;  3JAM S;  1PJI A;  3SAW A;  1NNJ A;  2UXB M;  4JI8 M;  4DV7 M;  1I94 M;  3T1Y M;  2F5S A;  5ITU A;  1HNX M;  4DR4 M;  4JI4 M;  4PDG A;  1L1T A;  4X62 M;  4LF7 M;  3SBJ A;  2UXD M;  1Z5A A;  4X66 M;  5ITY A;  3SAR A;  2UUA M;  1Q39 A;  3C58 A;  1L2B A;  5A2Q S;  3VK7 A;  3SAS A;  2VQF M;  1N32 M;  2F5N A;  4ITQ A;  4DUZ M;  3JR5 A;  4GKJ M;  3GP1 A;  2VQE M;  4LF6 M;  2UUB M;  4G4O A;  4G4Q A;  4AQY M;  2F5P A;  3OTO M;  2F4V M;  4JI3 M;  5LMU M;  1N36 M;  4X65 M;  4DV1 M;  5FLX S;  4PD2 A;  1L2D A;  1Z5B A;  4YHH M;  3GQ4 A;  4DV6 M;  3GPX A;  4JI6 M;  3A46 A;  4DR7 M;  4NRW A;  4JI0 M;  4DR3 M;  5ITR A;  4B3R M;  3U6L A;  3U6S A;  3U6C A;  1HNZ M;  1MU5 A;  2HKJ A;  4JI7 M;  4DR6 M;  1EE8 A;  5ITQ A;  4G4N A;  4LF8 M;  4JV5 M;  1J5E M;  1MX0 A;  1R2Y A;  3SAT A;  4LF4 M;  3GO8 A;  1IBL M;  3JR4 A;  3W0F A;  4LF9 M;  3TWL A;  1K82 A;  2UUC M;  2OPF A;  4JI2 M;  4B3S M;  1PM5 A;  1L2C A;  4DV3 M;  3U6O A;  4DR1 M;  4CIS A;  3U6D A;  1L1Z A;  5IWA M;  3A45 A;  5ITT A;  3T1H M;  1R2Z A;  5BR8 M;  2Q2E B;  1IBM M;  2XZU A;  3U6P A;  3GPY A;  3VK8 A;  4X64 M;  4LFB M;  3U6M A;  4DR5 M;  4NXM M;  4B3T M;  1XMQ M;  1N34 M;  4DV4 M;  4LFA M;  2HHH M;  3A42 A;  3SAV A;  4KHP M;  4DV2 M;  4OX9 M;  4B3M M;  1TDZ A;  4DV5 M;  2F5Q A;  1N33 M;  2OQ4 A;  1FJG M;  4PCZ A;  4DUY M;  1IBK M;  2E5L M;  4JI5 M;  1HNW M;  3TWK A;  3GPP A;  2UXC M;  3DOA A;  4JYA M;  1Z59 A;  3J80 S;  2UU9 M;  3J81 S;  4LF5 M;  5ITX A;  5IT9 S;  4NRV A;  5ITX E;  1TDH A;  3TWM A;  4YY3 M;  2EA0 A;  3U6Q A;  1XMO M;  1Z5C A;  1XNQ M;  1XC8 A;  1K3W A;  4DV0 M;  4LFC M;  1Q3C A;  3GQ5 A;  1HR0 M; 
#chains in the Genus database with same CATH topology
 4MB7 A;  3U6E A;  2ZBK B;  1Q3B A;  1KFV A;  2JZ0 A;  4GKK M;  2VF8 A;  1PJJ A;  2LWX A;  4IBC A;  3UK6 A;  4IBK A;  4LRS A;  3KS8 A;  3HHZ A;  1D0L A;  1QUT A;  4Z8X A;  1R7R A;  2DAI A;  2DKL A;  3GPU A;  3GRY A;  3SAU A;  1X37 A;  4AI6 A;  3QYB A;  4QHT A;  5BPV A;  2LVN C;  2P5T A;  4LY6 A;  4Y28 F;  5KPR A;  2KZS A;  3E9S A;  1OAO C;  1R6B X;  2XZF A;  3HJS A;  4GEW A;  3KP1 E;  8CAT A;  4B08 A;  2UXB M;  1QAN A;  4DV7 M;  3T38 A;  2XSZ D;  1AUA A;  1WHC A;  4FD2 A;  5FTN A;  2R6F A;  2QCU A;  4ANR A;  1L1T A;  4X62 M;  2Z8Y M;  1JR3 D;  1OQY A;  4KOD A;  2LVA A;  4MH0 E;  4REZ A;  2DXI A;  4FCT A;  2O25 A;  2XEP A;  4LJ4 A;  1TH3 A;  2JY7 A;  3SMP A;  3FD9 A;  1IXZ A;  2J5Y A;  3W68 A;  2KEB A;  1QAM A;  5DYI A;  2KZU A;  2F5P A;  3VKH A;  5LMU M;  1N36 M;  2EUC A;  1GKI A;  1IXS A;  4G6Z A;  5FLX S;  2CV0 A;  2BNK A;  1Y8G A;  1QZE A;  2DHY A;  3GQ4 A;  3FUU A;  4LZJ A;  1IM2 A;  4R7G A;  3THG A;  3GPX A;  4JI6 M;  2DHR A;  3HY5 A;  4MGK E;  4B3R M;  1ZMU A;  3U6L A;  4AG5 A;  1NHG C;  5EXT A;  1D2N A;  1HNZ M;  1H6U A;  1MU5 A;  2CHQ A;  2L4F A;  2X8A A;  4JI7 M;  2Y21 A;  1EE8 A;  1NV8 A;  3DFZ A;  1W5T A;  2CUZ A;  4LGM A;  5FTM A;  1YE9 A;  2LVP C;  1R2Y A;  3GO8 A;  2EKK A;  3IG5 A;  3DZD A;  2QEN A;  1K82 A;  2G5G X;  4JI2 M;  3FTF A;  3KOY E;  3RGP A;  1PM5 A;  1L2C A;  4DV3 M;  2FS1 A;  4DR1 M;  4DBG B;  2G3Q A;  3CF0 A;  2J7O A;  3HHX A;  2QQ8 A;  5BR8 M;  2Q2E B;  1A5T A;  1JR3 A;  1SXJ D;  2C99 A;  3KXE C;  3HJ8 A;  4M9X A;  4IBB A;  5KPT A;  1IXR C;  2CV2 A;  4FCV A;  4XBO A;  1XWI A;  3A42 A;  2JY6 B;  3GRU A;  3HKP A;  1E9S A;  3HZJ A;  5EP4 A;  1ZAE A;  4L78 A;  1S3S A;  4M0W A;  2XLJ A;  1N33 M;  3GRR A;  3HHW A;  2OQ4 A;  1HQC A;  3HX3 A;  2JY8 A;  3U61 B;  3GLG A;  1IBK M;  2JWS A;  2K6B A;  4JI5 M;  2Z4S A;  3GPP A;  3U60 B;  4NL4 H;  1D0M A;  2N35 A;  3D8L A;  4LF5 M;  5IT9 S;  3NWL A;  2A5Y B;  4NRV A;  4W5W A;  4FWH A;  4NSR A;  4D80 A;  3L26 A;  1JR3 E;  3NBI A;  1GL7 A;  3VLF B;  2MR9 A;  3EIE A;  2QBY B;  2L2D A;  4AW4 A;  3SFZ A;  1NNU C;  5LMN M;  4PDI A;  4G4R A;  2DI0 A;  4K0K M;  3GQ3 A;  3BXW A;  3J7B A;  3K9P A;  3GLH A;  2JA2 A;  2QPA A;  4MGH A;  2DZO B;  3B89 A;  4F2L A;  4I81 A;  4NC6 A;  2CHG A;  2KW0 A;  2ZM6 M;  1XNR M;  3FTD A;  4IBF A;  3L2A A;  3J7A S;  3D8B A;  1F4I A;  1J7K A;  1SXJ A;  4JI1 M;  4GH9 A;  2C5R A;  2F5O A;  3GLG E;  1OAI A;  1OJL A;  2JXN A;  1EFU B;  1IFY A;  1DGB A;  3KSJ A;  3L27 A;  1DGG A;  1IQP A;  1PJT A;  3SAW A;  4GC5 A;  3I4Y A;  2CV1 A;  5DFL A;  3CGW A;  5KQD A;  2AHM A;  3BBZ A;  3AL0 C;  3PVS A;  2CFO A;  1WR1 B;  4DR4 M;  2R4J A;  4II7 A;  4PDG A;  2FFJ A;  1DGH B;  2UXD M;  3HU3 A;  2R44 A;  5L8R F;  4KT0 F;  4GIP A;  4KLN A;  4B7G A;  1E9R A;  4NSO B;  2GNO A;  2Z3X A;  1LTM A;  4HL4 A;  3VDU A;  2HCB A;  2KDL A;  3E46 A;  5A2Q S;  1QUS A;  4MGY E;  3TL4 X;  1I4W A;  4NOO B;  3LQR A;  2VQF M;  1N32 M;  4ITQ A;  3GLH E;  4ZPX A;  3SYK A;  4CIZ A;  4DUZ M;  4R71 A;  2UUB M;  4G4O A;  4JXJ A;  1TTE A;  2F4V M;  4OVZ A;  5H37 D;  1ZV1 A;  2HAK A;  1SXJ E;  3AOG A;  1FNN A;  4CGY B;  4IJF A;  2MGW A;  1OFI A;  4AKI A;  3ZQJ A;  2YQZ A;  3QYE A;  4YHH M;  1T6O A;  3HJQ A;  2R18 A;  4DV6 M;  2M5Z A;  3KOZ E;  4WP2 A;  3A46 A;  4DR7 M;  2CHV A;  3VKG A;  4JI0 M;  5FTL A;  3L29 A;  4DR3 M;  1DV0 A;  3U6S A;  4MGZ E;  5DNY A;  2VF7 A;  1HT2 E;  3AOE C;  2L6O A;  1CUK A;  1QAO A;  4G3O A;  3UGJ A;  1OIZ A;  4LJA A;  4CHT B;  5ITQ A;  3J2P B;  4P17 A;  4RNA A;  4G4N A;  1NJF A;  4LF8 M;  1WGN A;  4WW0 A;  2KNA A;  3H4M A;  1IBL M;  2GQF A;  2LXE A;  2ZTD A;  3M7G A;  5E26 A;  1YUB A;  1XB2 B;  3W0F A;  3TWL A;  1P3Q Q;  3GRV A;  3K1J A;  2UUC M;  1QDT A;  4LGY A;  1VG5 A;  3FUX A;  4RF0 A;  2L7H A;  2O01 F;  3VDP A;  3B7Q A;  5DYG A;  3GLI A;  2LHG A;  5IWA M;  3A45 A;  3KOW E;  1IN8 A;  5ITT A;  4GRI A;  1R2Z A;  3GLF B;  1TF0 B;  3PXG A;  3AJI B;  3U6P A;  4M0D A;  5EP1 A;  2O5R A;  1NY6 A;  1VEG A;  4LJ8 A;  5KPZ A;  3VK8 A;  2R45 A;  3KFU G;  4I4L A;  1IN7 A;  1WXQ A;  1YLA A;  4B3T M;  2JP7 A;  2QZ4 A;  3Q8G A;  1N34 M;  1DO0 A;  3SAV A;  5C18 A;  2YR0 A;  4JN6 A;  4L4U A;  1IN6 A;  3HU1 A;  4OX9 M;  3B7N A;  3T15 A;  1TDZ A;  4AKG A;  1PGY A;  1RU3 A;  1FJG M;  2Y20 A;  2W82 A;  3B74 A;  4M9S A;  3SYL A;  1V34 A;  2BJV A;  3HGI A;  2CE7 A;  2K47 A;  3LMM A;  3DOA A;  2D7E A;  4LZZ A;  1QAQ A;  4OU7 A;  2XSZ A;  2XH9 A;  3KDS E;  3Q8X A;  1T3T A;  2QSF X;  3B9P A;  2NQ8 C;  2KRK A;  3GLI E;  5IRE B;  2EA0 A;  2K0B X;  3U6Q A;  2DEN A;  2FNA A;  3SC3 A;  1XC8 A;  1QDR A;  2R62 A;  1V33 A;  1MN3 A;  1NO1 A;  1KYI A;  2CRU A;  3C3E A;  1XHB A;  4IJE A;  4FVM A;  4XGI A;  5EJC A;  3LVW A;  4JV5 M;  3KSX A;  3AV0 A;  4DR2 M;  3FE3 A;  2K9D A;  1K3X A;  2MH8 A;  2OOB A;  3TPZ A;  2QBY A;  2KRU A;  4LRT A;  4CJ6 A;  1C7Y A;  1GL6 A;  1IXS B;  3FTC A;  3W0L B;  2Y0T A;  1NVM A;  3UJN A;  2JUJ A;  4XK8 F;  4GC9 A;  5F3W A;  3K8Z A;  2ZAM A;  3F92 A;  2VDB B;  3I04 M;  1PJI A;  3NBX X;  3U5Z A;  3IEC A;  3K9O A;  1GJT A;  4R3D A;  1VDD A;  4JI8 M;  1I94 M;  3T1Y M;  3QWL A;  1G59 A;  3SHG B;  1Z6T A;  1HNX M;  3R9X B;  4TUW A;  3KVW A;  1EIJ A;  1VEJ A;  7CAT A;  4JI4 M;  4LF7 M;  3SBJ A;  4BB9 A;  2EO2 A;  3PNV A;  3LW5 F;  5ITY A;  3SAR A;  2UUA M;  1GJS A;  1KSF X;  2H5X A;  3VK7 A;  3SAS A;  2DWZ B;  3LQQ A;  1UM8 A;  2F5N A;  1NHW C;  2RKO A;  4Z6Y A;  4LF6 M;  4D82 A;  2KNV A;  2Z4R A;  1N78 A;  4GMQ A;  4JI3 M;  1V92 A;  2HL7 A;  4MGI E;  3ZC7 B;  4X65 M;  1DO2 A;  4PT5 A;  4IBI A;  3A98 B;  5GKN A;  3W67 A;  4PD2 A;  1Z5B A;  4F1I A;  2I7N A;  4WUR A;  3PNY A;  4IBE A;  4QNM A;  2QP9 X;  4RF1 A;  2L09 A;  3LCU A;  3E21 A;  1E94 E;  3U6C A;  2C98 A;  2M60 A;  3H4J A;  2OO9 A;  4LJ9 A;  1G71 A;  3QAU A;  4DR6 M;  1XXH B;  3LVV A;  2LVO C;  5IZ7 D;  4LF4 M;  4LG2 A;  2QNJ A;  3JR4 A;  4P16 A;  4AKH A;  1GAB A;  1PJQ A;  5EXS A;  4B3S M;  3FYD A;  5EP3 A;  3SHF A;  3MK6 A;  2X49 A;  3LCV B;  2B3T A;  4OW0 A;  1IY2 A;  3U6D A;  4L8R C;  4FCW A;  4LCB A;  4QOZ C;  3IG8 A;  2DZL A;  3IHP A;  1IBM M;  1OTR A;  2ERC A;  1R4G A;  4LFB M;  3U6M A;  4IIW A;  4DR5 M;  3GLF A;  1JQJ C;  3ZH9 B;  2BWE A;  2DAE A;  1N75 A;  2CP8 A;  4DV2 M;  1JB0 F;  2EKF A;  1SXJ B;  4B3M M;  4HLQ A;  1SXJ C;  2APL A;  2RRU A;  2VII A;  3AKZ A;  4Q7J A;  1Q02 A;  2R46 A;  4FWG A;  4DUY M;  1OFH A;  2V6Z M;  4IBJ A;  2E5L M;  2OOA A;  4GHA A;  2WZJ A;  4L16 A;  3R8F A;  2UXC M;  3B7Z A;  3J80 S;  3DA1 A;  4BLC A;  2UU9 M;  1WIV A;  3FKE A;  2RGO A;  1QYR A;  1TDH A;  2FOI C;  4IBG A;  4KO8 A;  5ITX E;  2DNA A;  2I7P A;  4M9Z A;  3TWM A;  2DWL A;  2XGN A;  1Z5C A;  2Z7J A;  3I4V A;  1K3W A;  4LFC M;  3WHL A;  5KO3 A;  1TR8 A;  2MJ5 B;  2YNM D;  4QOS A;  2DWN A;  1Q3C A;  1SG9 A;  2DAK A;  4I5S A;  3GQ5 A;  1NSF A;  2YFQ A;  1TH2 A;  1TGU A;  3GLF E;  1N77 A;  2EJS A;  2QHO B;  3L25 A;  1VQ1 A;  2J7N A;  1ORY B;  1MJG M;  1GO5 A;  3FRH A;  4HEO A;  4UN2 B;  2CWB A;  1G8P A;  2BJW A;  4OVZ B;  1ZQ9 A;  1GVN A;  2JY5 A;  4LJ7 A;  4NXN M;  1HT1 E;  2R4E A;  1IY0 A;  3KW6 A;  1G4A E;  3FRI A;  5JI2 E;  4GHL A;  3JAM S;  3U61 A;  1QQW A;  2ZAO A;  3EIH A;  2KA6 B;  1NNJ A;  1YSY A;  3J27 B;  2LNH C;  4GIT A;  1NY5 A;  3U60 A;  2DAM A;  2WSC F;  5ITU A;  2RGH A;  3M0E A;  4RKU F;  3HU2 A;  2F5S A;  3AFH A;  1UFZ A;  1R5L A;  3MMP A;  2XFS A;  3VFD A;  4B7F A;  3M6A A;  2JZ1 A;  5E6J A;  1Z5A A;  4AG6 A;  4L6V 6;  4X66 M;  3FUW A;  1NJG A;  2DWM A;  3K92 A;  2Y0Q A;  4A3V B;  1Q39 A;  3C58 A;  5FTJ A;  1W5S A;  5FTK A;  1L2B A;  3GLI B;  1IY1 A;  3RE8 A;  1QVR A;  4BBA A;  2KNZ A;  1G41 A;  2WSE F;  4FW9 A;  2KXE A;  2XF3 A;  3JR5 A;  2LVQ D;  3GP1 A;  2VQE M;  4B7H A;  1OKS A;  4GKJ M;  4G4Q A;  3MJ5 A;  4AQY M;  3OTO M;  2L7I A;  1T43 A;  1D0K A;  3KP0 E;  1HJP A;  1L8Q A;  4DV1 M;  3BOS A;  1TH4 A;  1OIP A;  2JNH A;  2R65 A;  3FUV A;  4IBD A;  1L2D A;  3SMS A;  1ZMV A;  4LJ6 A;  2C9O A;  3ZCB B;  4FWD A;  1BVS A;  4NRW A;  1VDL A;  1NV9 A;  5ITR A;  3V76 A;  5C1B A;  2HKJ A;  5EP2 A;  1WJ7 A;  1J5E M;  3FYC A;  1IN5 A;  1MX0 A;  2L4E A;  2WSF F;  5EXX A;  3SAT A;  2C9C A;  1WGL A;  2DVW B;  2LTU A;  1DGH A;  4LF9 M;  1J09 A;  2FH0 A;  4AZF A;  1XXH A;  2ZTC A;  2OPF A;  4QNR A;  3C9P A;  3U6O A;  1C1K A;  2X4A A;  4CIS A;  3UZU A;  1L1Z A;  3WHK A;  3T1H M;  2D7H A;  2H1R A;  1PRB A;  3E4R A;  3MHV C;  2XZU A;  2BWB A;  3GPY A;  3FTE A;  4D81 A;  3HHY A;  2V1C A;  2D7G A;  4X64 M;  4NXM M;  2R0I A;  3CF6 E;  1E32 A;  2LHC A;  2ZAN A;  4S12 A;  2CEA A;  3T6P A;  1XMQ M;  4LJ5 A;  4LFA M;  4DV4 M;  2HHH M;  3K2L A;  4EIW A;  3KS4 A;  4KHP M;  2XFT A;  5EQT A;  3GLG B;  1G3I A;  4I8O A;  4DV5 M;  2F5Q A;  3KOX E;  3UMM A;  1ZMW A;  4PCZ A;  3AOE A;  1LV7 A;  2C96 A;  2KHH A;  5EXP A;  3CF2 A;  1HQY E;  3C3D A;  1AIP C;  1DGF A;  1GLN A;  1HNW M;  3U5Z B;  3TE6 A;  3TWK A;  2MRO B;  1XXH E;  4JYA M;  1Z59 A;  3PFI A;  5FSW A;  1QZM A;  2DAG A;  1VEK A;  3TQS A;  2LBC A;  4MM3 B;  2DZN B;  3I51 A;  5ITX A;  3J81 S;  3FUT A;  3ILK A;  5JI3 E;  3L28 A;  1IN4 A;  3RFW A;  4YY3 M;  1XMO M;  2G8L A;  3RGS A;  1XNQ M;  2FE8 A;  2HWJ A;  2LH0 A;  1PJS A;  3CTW B;  4DV0 M;  3I01 M;  3HWS A;  4QHS A;  2V1U A;  4L15 A;  5KQ8 A;  1HR0 M;  3GLH B; 
#chains in the Genus database with same CATH homology
 4MB7 A;  3U6E A;  2ZBK B;  1Q3B A;  1KFV A;  4GKK M;  1PJJ A;  2LWX A;  4IBC A;  3UK6 A;  4IBK A;  4LRS A;  3KS8 A;  3HHZ A;  4Z8X A;  1R7R A;  3GPU A;  3GRY A;  3SAU A;  1X37 A;  4AI6 A;  4QHT A;  5BPV A;  2P5T A;  4LY6 A;  5KPR A;  2KZS A;  3E9S A;  1R6B X;  2XZF A;  3HJS A;  3KP1 E;  8CAT A;  4B08 A;  2UXB M;  1QAN A;  4DV7 M;  3T38 A;  2XSZ D;  4FD2 A;  5FTN A;  2QCU A;  1L1T A;  4X62 M;  1JR3 D;  4KOD A;  4MH0 E;  4REZ A;  2DXI A;  4FCT A;  2XEP A;  4LJ4 A;  1TH3 A;  3SMP A;  3FD9 A;  1IXZ A;  2KEB A;  1QAM A;  5DYI A;  2KZU A;  2F5P A;  3VKH A;  5LMU M;  1N36 M;  2EUC A;  1GKI A;  4G6Z A;  5FLX S;  2CV0 A;  2BNK A;  3GQ4 A;  3FUU A;  4LZJ A;  1IM2 A;  4R7G A;  3THG A;  3GPX A;  4JI6 M;  2DHR A;  4MGK E;  4B3R M;  3U6L A;  4AG5 A;  1NHG C;  5EXT A;  1D2N A;  1HNZ M;  1H6U A;  1MU5 A;  2CHQ A;  2X8A A;  4JI7 M;  2Y21 A;  1EE8 A;  3DFZ A;  1W5T A;  2CUZ A;  4LGM A;  5FTM A;  1YE9 A;  1R2Y A;  3GO8 A;  3IG5 A;  3DZD A;  2QEN A;  1K82 A;  2G5G X;  4JI2 M;  3FTF A;  3KOY E;  3RGP A;  1PM5 A;  1L2C A;  4DV3 M;  4DR1 M;  3CF0 A;  2J7O A;  3HHX A;  5BR8 M;  2Q2E B;  1JR3 A;  1SXJ D;  2C99 A;  3KXE C;  3HJ8 A;  4M9X A;  4IBB A;  5KPT A;  1IXR C;  2CV2 A;  4FCV A;  4XBO A;  1XWI A;  3A42 A;  3GRU A;  3HKP A;  1E9S A;  5EP4 A;  1ZAE A;  4L78 A;  1S3S A;  4M0W A;  2XLJ A;  1N33 M;  3GRR A;  3HHW A;  2OQ4 A;  1HQC A;  3U61 B;  3GLG A;  1IBK M;  4JI5 M;  2Z4S A;  3GPP A;  3U60 B;  4NL4 H;  4LF5 M;  3D8L A;  5IT9 S;  3NWL A;  2A5Y B;  4NRV A;  4W5W A;  4FWH A;  4NSR A;  4D80 A;  3L26 A;  3NBI A;  3VLF B;  1GL7 A;  3EIE A;  2QBY B;  4AW4 A;  3SFZ A;  1NNU C;  5LMN M;  4PDI A;  4G4R A;  4K0K M;  3GQ3 A;  3J7B A;  3GLH A;  2JA2 A;  2QPA A;  4MGH A;  2DZO B;  4I81 A;  2CHG A;  2KW0 A;  2ZM6 M;  1XNR M;  3FTD A;  4IBF A;  3L2A A;  3J7A S;  3D8B A;  1J7K A;  1SXJ A;  4JI1 M;  4GH9 A;  2C5R A;  2F5O A;  1OJL A;  1DGB A;  3KSJ A;  3L27 A;  1DGG A;  1IQP A;  3SAW A;  4GC5 A;  3I4Y A;  2CV1 A;  5KQD A;  2AHM A;  3AL0 C;  3PVS A;  2CFO A;  4DR4 M;  2R4J A;  4II7 A;  4PDG A;  2FFJ A;  1DGH B;  2UXD M;  3HU3 A;  4GIP A;  4KLN A;  4B7G A;  1E9R A;  4NSO B;  2Z3X A;  3VDU A;  4HL4 A;  2HCB A;  5A2Q S;  4MGY E;  3TL4 X;  1I4W A;  4NOO B;  3LQR A;  2VQF M;  1N32 M;  4ITQ A;  4ZPX A;  3SYK A;  4DUZ M;  2UUB M;  4G4O A;  4JXJ A;  2F4V M;  4OVZ A;  5H37 D;  3AOG A;  1SXJ E;  1FNN A;  4CGY B;  4IJF A;  1OFI A;  4AKI A;  2YQZ A;  4YHH M;  3HJQ A;  2R18 A;  4DV6 M;  2M5Z A;  3KOZ E;  3A46 A;  4DR7 M;  2CHV A;  3VKG A;  4JI0 M;  5FTL A;  3L29 A;  4DR3 M;  3U6S A;  4MGZ E;  5DNY A;  1HT2 E;  3AOE C;  2L6O A;  1QAO A;  3UGJ A;  4LJA A;  4CHT B;  5ITQ A;  3J2P B;  4RNA A;  4G4N A;  4LF8 M;  1NJF A;  4WW0 A;  3H4M A;  1IBL M;  2LXE A;  5E26 A;  3M7G A;  3W0F A;  1YUB A;  3TWL A;  3K1J A;  3GRV A;  2UUC M;  4LGY A;  3FUX A;  4RF0 A;  2L7H A;  3VDP A;  5DYG A;  3GLI A;  5IWA M;  3A45 A;  3KOW E;  1IN8 A;  5ITT A;  4GRI A;  1R2Z A;  3GLF B;  3PXG A;  3AJI B;  3U6P A;  4M0D A;  5EP1 A;  2O5R A;  1NY6 A;  3VK8 A;  4LJ8 A;  5KPZ A;  3KFU G;  2R45 A;  4I4L A;  1IN7 A;  1WXQ A;  4B3T M;  2QZ4 A;  1N34 M;  1DO0 A;  3SAV A;  5C18 A;  2YR0 A;  4JN6 A;  4L4U A;  1IN6 A;  3HU1 A;  4OX9 M;  3T15 A;  1TDZ A;  4AKG A;  1FJG M;  2Y20 A;  2W82 A;  4M9S A;  3SYL A;  2BJV A;  3HGI A;  2CE7 A;  2K47 A;  3LMM A;  3DOA A;  2D7E A;  4LZZ A;  1QAQ A;  4OU7 A;  2XSZ A;  2XH9 A;  3KDS E;  3Q8X A;  1T3T A;  3B9P A;  2NQ8 C;  2KRK A;  5IRE B;  2EA0 A;  3U6Q A;  2FNA A;  3SC3 A;  1XC8 A;  2R62 A;  1KYI A;  1XHB A;  4IJE A;  4FVM A;  4XGI A;  5EJC A;  3LVW A;  4JV5 M;  3KSX A;  3AV0 A;  4DR2 M;  1K3X A;  3TPZ A;  2QBY A;  2KRU A;  4LRT A;  1GL6 A;  1IXS B;  3FTC A;  3W0L B;  2Y0T A;  1NVM A;  3UJN A;  5F3W A;  4GC9 A;  3K8Z A;  2ZAM A;  1PJI A;  3U5Z A;  4R3D A;  1VDD A;  4JI8 M;  1I94 M;  3T1Y M;  3QWL A;  1G59 A;  3SHG B;  1Z6T A;  1HNX M;  3R9X B;  4TUW A;  3KVW A;  7CAT A;  4JI4 M;  4LF7 M;  3SBJ A;  4BB9 A;  2EO2 A;  3PNV A;  5ITY A;  3SAR A;  2UUA M;  1KSF X;  3VK7 A;  3SAS A;  2DWZ B;  3LQQ A;  1UM8 A;  2F5N A;  1NHW C;  2RKO A;  4Z6Y A;  4LF6 M;  4D82 A;  2Z4R A;  1N78 A;  4GMQ A;  4JI3 M;  3ZC7 B;  2HL7 A;  4MGI E;  4X65 M;  1DO2 A;  4PT5 A;  4IBI A;  3A98 B;  5GKN A;  4PD2 A;  1Z5B A;  2I7N A;  4WUR A;  3PNY A;  4IBE A;  4QNM A;  2QP9 X;  4RF1 A;  2L09 A;  1E94 E;  3U6C A;  2C98 A;  2M60 A;  4LJ9 A;  4DR6 M;  3QAU A;  1XXH B;  3LVV A;  5IZ7 D;  4LF4 M;  4LG2 A;  3JR4 A;  4P16 A;  4AKH A;  5EXS A;  4B3S M;  3FYD A;  5EP3 A;  3SHF A;  3MK6 A;  2X49 A;  4OW0 A;  1IY2 A;  3U6D A;  4L8R C;  4FCW A;  4LCB A;  4QOZ C;  3IG8 A;  1IBM M;  2ERC A;  4LFB M;  3U6M A;  4IIW A;  4DR5 M;  3GLF A;  1JQJ C;  3ZH9 B;  1N75 A;  4DV2 M;  1SXJ B;  4B3M M;  4HLQ A;  1SXJ C;  2VII A;  3AKZ A;  2R46 A;  4FWG A;  4DUY M;  1OFH A;  2V6Z M;  4IBJ A;  2E5L M;  4GHA A;  4L16 A;  3R8F A;  2UXC M;  3J80 S;  3DA1 A;  4BLC A;  2UU9 M;  3FKE A;  2RGO A;  1QYR A;  1TDH A;  2FOI C;  4IBG A;  4KO8 A;  5ITX E;  4M9Z A;  2I7P A;  3TWM A;  2DWL A;  2XGN A;  1Z5C A;  2Z7J A;  3I4V A;  1K3W A;  4LFC M;  3WHL A;  5KO3 A;  2YNM D;  4QOS A;  2DWN A;  1Q3C A;  3GQ5 A;  4I5S A;  1NSF A;  2YFQ A;  1TH2 A;  1TGU A;  1N77 A;  3L25 A;  2J7N A;  1ORY B;  1G8P A;  2BJW A;  4OVZ B;  1ZQ9 A;  1GVN A;  4LJ7 A;  4NXN M;  1HT1 E;  2R4E A;  1IY0 A;  3KW6 A;  1G4A E;  5JI2 E;  4GHL A;  3JAM S;  3U61 A;  1QQW A;  2ZAO A;  3EIH A;  2KA6 B;  1NNJ A;  1YSY A;  3J27 B;  2LNH C;  4GIT A;  1NY5 A;  3U60 A;  2F5S A;  5ITU A;  2RGH A;  3M0E A;  3HU2 A;  3AFH A;  2XFS A;  3VFD A;  4B7F A;  3M6A A;  5E6J A;  1Z5A A;  4AG6 A;  4X66 M;  3FUW A;  1NJG A;  2DWM A;  3K92 A;  2Y0Q A;  4A3V B;  1Q39 A;  3C58 A;  5FTJ A;  1W5S A;  5FTK A;  1L2B A;  3GLI B;  1IY1 A;  3RE8 A;  1QVR A;  4BBA A;  1G41 A;  4FW9 A;  2KXE A;  2XF3 A;  3JR5 A;  4GKJ M;  3GP1 A;  2VQE M;  4B7H A;  4G4Q A;  3MJ5 A;  4AQY M;  3OTO M;  2L7I A;  3KP0 E;  1L8Q A;  4DV1 M;  3BOS A;  1TH4 A;  2R65 A;  3FUV A;  1L2D A;  4IBD A;  3SMS A;  4LJ6 A;  2C9O A;  3ZCB B;  4FWD A;  4NRW A;  5ITR A;  5C1B A;  2HKJ A;  5EP2 A;  1J5E M;  3FYC A;  1IN5 A;  1MX0 A;  5EXX A;  3SAT A;  2C9C A;  2DVW B;  1DGH A;  4LF9 M;  1J09 A;  2OPF A;  4AZF A;  1XXH A;  4QNR A;  3U6O A;  1C1K A;  2X4A A;  4CIS A;  3UZU A;  1L1Z A;  3WHK A;  3T1H M;  2D7H A;  2H1R A;  3E4R A;  3MHV C;  2XZU A;  3GPY A;  3FTE A;  4D81 A;  3HHY A;  2V1C A;  2D7G A;  4X64 M;  4NXM M;  3CF6 E;  1E32 A;  2ZAN A;  4S12 A;  2CEA A;  1XMQ M;  4LJ5 A;  4LFA M;  4DV4 M;  2HHH M;  3K2L A;  4EIW A;  3KS4 A;  4KHP M;  2XFT A;  5EQT A;  3GLG B;  1G3I A;  4I8O A;  4DV5 M;  2F5Q A;  3KOX E;  3UMM A;  4PCZ A;  3AOE A;  1LV7 A;  2C96 A;  5EXP A;  3CF2 A;  1HQY E;  1DGF A;  1GLN A;  1HNW M;  3U5Z B;  3TE6 A;  3TWK A;  4JYA M;  1Z59 A;  3PFI A;  5FSW A;  1QZM A;  3TQS A;  3J81 S;  4MM3 B;  5ITX A;  2DZN B;  3I51 A;  3FUT A;  3ILK A;  5JI3 E;  3L28 A;  1IN4 A;  3RFW A;  4YY3 M;  1XMO M;  2G8L A;  3RGS A;  1XNQ M;  2FE8 A;  2LH0 A;  4DV0 M;  3CTW B;  3HWS A;  4QHS A;  2V1U A;  4L15 A;  5KQ8 A;  1HR0 M;  3GLH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...