1N32M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n32M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n32M02
4DV3M 2EA0A 5ITXE 1I94M 5ITTA 1Z5CA 4X65M 5ITQA 1PJIA 4DR6M 4JYAM 2F4VM 4JI1M 1XMQM 4B3RM 3J7AS 5ITXA 5IWAM 4JI8M 2XZUA 4PCZA 3U6QA 1Q3BA 4K0KM 3J80S 2XZFA 1R2ZA 1N33M 1IBKM 1L2DA 4JV5M 3T1HM 4ITQA 3GQ4A 4LF4M 2VQEM 1L1ZA 4G4NA 1KFVA 3U6SA 3A45A 4KHPM 1L1TA 2E5LM 4DR7M 3A46A 4DV6M 3U6CA 1HNWM 4DV0M 4B3SM 4GKKM 2HHHM 4YHHM 3U6EA 4DUYM 4MB7A 4NRWA 4LF8M 1Z5BA 4LF6M 4LFAM 3C58A 1XC8A 1N32M 2UXDM 4JI2M 1TDHA 3VK7A 2F5OA 3SATA 4DR5M 1L2BA 4JI7M 3J81S 3JR5A 2UU9M 4DR2M 2OQ4A 3SARA 5LMUM 3VK8A 5ITYA 5ITUA 2UUAM 4X66M 2F5QA 4B3MM 4G4QA 3U6OA 1Q3CA 4LF7M 3JR4A 3U6DA 3OTOM 1Q39A 1XMOM 4CISA 1IBLM 4JI3M 5ITRA 3TWKA 4B3TM 3SASA 4LF5M 4DV2M 2UXCM 3SAVA 4DV4M 4NXMM 4G4RA 3U6LA 1K82A 5A2QS 4DR1M 1L2CA 4GKJM 4X64M 4PDIA 4LFCM 4DR4M 2F5SA 2VQFM 3TWMA 3GPUA 2Q2EB 5FLXS 4G4OA 1Z59A 3U6MA 4X62M 1N34M 1J5EM 4AQYM 5IT9S 3GQ5A 3GP1A 1XNQM 4DV5M 5BR8M 3GPXA 2F5PA 4JI4M 1MX0A 4JI0M 1HNXM 3GQ3A 3TWLA 1MU5A 1N36M 4JI6M 2ZM6M 2UXBM 4DR3M 2UUBM 3W0FA 3SBJA 4PD2A 2HKJA 3GPPA 3U6PA 1IBMM 4LF9M 2ZBKB 2OPFA 4NRVA 4LFBM 1EE8A 1R2YA 1XNRM 3GO8A 4DUZM 1K3WA 3T1YM 4OX9M 4PDGA 1PM5A 3GPYA 4DV7M 1HNZM 5LMNM 4YY3M 3A42A 4DV1M 1HR0M 1NNJA 3SAUA 2F5NA 3SAWA 1TDZA 4JI5M 3JAMS 1PJJA 1Z5AA 2UUCM 4NXNM 1K3XA 1FJGM 3DOAA
chains in the Genus database with same CATH superfamily
4B7HA 4DV3M 2EA0A 1QZMA 4X65M 1JR3D 5ITQA 4DUZM 4G6ZA 1GABA 4JI1M 3AOEA 1T6OA 1XHBA 2XF3A 3NWLA 3HJ8A 3LW5F 1QZEA 2R44A 4LCBA 5IWAM 2ZAMA 3SMSA 2P5TA 1OFHA 3HU1A 2K6BA 3J7BA 2OOAA 1XWIA 1G71A 4CGYB 3E9SA 1L2DA 1IBKM 3CF0A 2DWLA 3T1HM 3Q8GA 4CHTB 3HHYA 3GQ4A 2EKKA 4R7GA 4CIZA 4LF4M 2WSFF 2XGNA 3T6PA 1L1ZA 2QENA 2GQFA 3LVVA 3A45A 4KHPM 4DR7M 3CGWA 2BWBA 3U60B 2KA6B 4NC6A 4F2LA 2CV0A 3FTFA 3KOYE 4D82A 3FYCA 4QNRA 5EJCA 2LNHC 4LY6A 2R45A 2XSZD 2H1RA 4B3SM 3LMMA 2G5GX 4FD2A 3U6EA 1PRBA 4LZJA 3FUTA 4EIWA 1OAOC 1HT1E 3HJSA 4IJFA 4LF6M 1XC8A 1GVNA 2JNHA 1TDHA 5DYGA 4IIWA 1RU3A 2C96A 3M7GA 1H6UA 1XXHB 1AIPC 4MGHA 3C3DA 2FH0A 4P16A 3PXGA 4B7GA 3U5ZB 3W67A 2DAMA 2C99A 3JR5A 1ZMUA 4MGKE 3L2AA 1GJTA 2OQ4A 1GL7A 1IN7A 1S3SA 3J2PB 3LVWA 4R3DA 3MHVC 4X66M 1HT2E 3THGA 5KPZA 3U61B 4B3MM 4AKGA 3KFUG 4M9ZA 4LF7M 3VDUA 2XFTA 2B3TA 1I4WA 1IXZA 2DAIA 4GRIA 3RGPA 3TWKA 1DGHA 3M6AA 3SASA 4G3OA 4NL4H 3D8BA 1NVMA 4NXMM 4IBKA 1D0LA 3U6LA 1K82A 1JQJC 3FKEA 3E4RA 4X64M 4DR4M 2KW0A 3VLFB 2VQFM 1QVRA 2Q2EB 2V1UA 3ZC7B 3GLFB 1W5TA 4AQYM 3DA1A 3IHPA 2LBCA 3FRIA 4RKUF 3GQ5A 1XNQM 2LVAA 4II7A 2YQZA 4JI4M 1MX0A 4I5SA 3EIEA 4JI0M 4KLNA 3MJ5A 4WW0A 3ZCBB 2LVNC 3TWLA 3FRHA 4UN2B 2HL7A 4JI6M 1SXJD 2FNAA 4OW0A 4GHLA 4LJAA 4Q7JA 1Q02A 3IG8A 4ZPXA 1E9SA 2DHYA 4IBGA 5EP1A 4PD2A 1ZAEA 5EQTA 3U6PA 4LF9M 4XBOA 2EO2A 4GC5A 2HCBA 3E46A 3RGSA 2OPFA 3VKGA 3UJNA 3FUWA 1IM2A 3PNVA 3FD9A 4LJ9A 4RF1A 4HEOA 3TQSA 1SXJC 4MM3B 4LRTA 1G59A 3FTDA 4MH0E 3KXEC 4KODA 3A42A 2O25A 4AKIA 5EXSA 4GEWA 5EP4A 1TDZA 4JI5M 1AUAA 1XXHE 3CF6E 2Z3XA 2QSFX 3BXWA 1WXQA 2DAKA 4NXNM 2KXEA 1FJGM 3KP1E 2KNZA 1XXHA 2J7NA 1NJGA 4DR6M 4NSOB 3GRRA 3FUUA 2H5XA 2LTUA 1UM8A 2ZAOA 2JP7A 2QZ4A 3DFZA 1XB2B 5GKNA 4JI8M 5DYIA 2XZUA 2WZJA 5EP3A 5FTKA 1NY5A 2CWBA 1Q3BA 3SYLA 4K0KM 3J80S 4AZFA 1OIPA 2XZFA 1C1KA 2MGWA 3MMPA 4JV5M 4ITQA 1ZMWA 4IBEA 5C18A 5EXXA 5KPTA 2VQEM 1C7YA 2K0BX 3FE3A 4LJ4A 3T15A 2L2DA 1E9RA 3A46A 2Y0QA 5F3WA 4IBIA 3AOGA 3W0LB 3E21A 4L4UA 4RNAA 1JR3E 3C3EA 3R9XB 1HQCA 1OJLA 1W5SA 2L4FA 2X8AA 3KDSE 3KSJA 3GLFA 1JR3A 3K2LA 3GLIB 4JXJA 5FSWA 2CHQA 2CP8A 1Z5BA 2R18A 4LFAM 1IN5A 3C58A 1ZMVA 1R6BX 1N32M 2W82A 1N75A 3FUVA 1Y8GA 3SATA 2MR9A 4BBAA 1NV9A 3RE8A 1SXJB 4AKHA 3J81S 4DR2M 2LVQD 1V33A 2ZTDA 3BBZA 4PT5A 3SARA 1QDTA 4GMQA 5ITYA 2F5QA 2KNAA 4L15A 1TR8A 4MGZE 2DAEA 3B7ZA 1CUKA 4R71A 5FTLA 1PJQA 2G3QA 3JR4A 3U6DA 3OTOM 4MGYE 3L25A 3KOXE 1QANA 2KRKA 1XMOM 3CTWB 5EXTA 4CISA 1GO5A 5ITRA 4DR1M 3RFWA 2XSZA 4DV2M 2UXCM 4Z6YA 4DV4M 2XLJA 2MROB 2JUJA 4FCTA 4M0WA 1LV7A 1G4AE 1ZQ9A 5A2QS 1L2CA 1QAMA 5IZ7D 3TWMA 4NSRA 2R46A 4Y28F 3UMMA 1UFZA 1Z59A 3U6MA 3T38A 3L26A 3AOEC 1D0KA 5IT9S 1J5EM 2LVPC 3GP1A 4F1IA 2CHVA 2FS1A 1DV0A 1DGBA 2QQ8A 4LG2A 1IN8A 1QYRA 3GPXA 4GKJM 2F5PA 2BJWA 5JI3E 3LCVB 4L8RC 1NNUC 4L16A 2R65A 1KYIA 1R5LA 2M60A 1MN3A 1YUBA 4HL4A 3I51A 2UUBM 3KS8A 4I4LA 4LJ6A 3W0FA 3SBJA 2CV1A 2J7OA 3ZQJA 2EKFA 2DKLA 1IBMM 1R7RA 2OOBA 2Z4RA 2BJVA 2C9CA 3B9PA 2CV2A 1BVSA 2ZBKB 3I4VA 1NO1A 2R4EA 3TPZA 1EE8A 3MK6A 3HHZA 8CATA 2QBYA 3NBXX 2KHHA 2AHMA 2K47A 2L6OA 4L78A 1YLAA 1IXRC 1DO0A 2Z8YM 3HWSA 1WGNA 4PDGA 2KRUA 1IQPA 2QNJA 1A5TA 1HR0M 4WP2A 5LMNM 1NJFA 3KW6A 1DO2A 3SAUA 3GRVA 5EP2A 3JAMS 1PJJA 2G8LA 2LH0A 3QYEA 2LWXA 3HU3A 1K3XA 3DOAA 3KSXA 1I94M 1OFIA 5DFLA 1X37A 5ITTA 1PJIA 4JYAM 1WJ7A 2YFQA 3FTEA 1XMQM 1GJSA 4S12A 1DGFA 2KEBA 5KQ8A 1OTRA 2LHCA 3Q8XA 2NQ8C 5JI2E 5FTJA 4PCZA 4FWGA 3U6QA 5EXPA 1IY0A 1PJTA 2RGOA 1J09A 4JN6A 1R2ZA 3GLHB 2M5ZA 4AG6A 2QPAA 3U60A 2RGHA 3UZUA 2C5RA 3UGJA 3GRUA 3FTCA 2JY6B 3HU2A 3K92A 3AL0C 2VF8A 2ERCA 3I01M 1KFVA 1L1TA 2E5LM 4DV6M 4QHTA 3U6CA 2QHOB 1YE9A 3KOWE 1JB0F 3ILKA 2VF7A 1VDLA 4GIPA 3VFDA 3VDPA 4GKKM 2HHHM 1OQYA 4LJ8A 3L28A 4YHHM 2XH9A 1TH2A 4LJ5A 3U5ZA 4LF8M 4NRWA 1DGGA 2QP9X 2EUCA 4FW9A 2CFOA 3WHKA 1KSFX 2D7EA 3ZH9B 4IBFA 2UXDM 2X49A 7CATA 4JI2M 1F4IA 1GL6A 1R4GA 1EFUB 3KOZE 4NOOB 3VK7A 2F5OA 3U61A 4OVZB 2DZOB 4XGIA 4FWHA 1L2BA 2I7NA 2DZLA 4JI7M 3SHFA 2R62A 2UU9M 4QHSA 1NHWC 4AW4A 1D2NA 2FFJA 5DNYA 5LMUM 5ITUA 4FVMA 2JY8A 3UK6A 1IFYA 1IXSB 1Q39A 1QAQA 3GLFE 4M9SA 5KPRA 4OU7A 2Y0TA 2Z7JA 2D7HA 2KZUA 2JXNA 4BLCA 3GLGB 4AG5A 3R8FA 4G4RA 3HHXA 3HY5A 1QUSA 1QDRA 1E32A 2DZNB 2LVOC 1P3QQ 1TH3A 4M9XA 2DXIA 1XNRM 3IECA 1NV8A 4L6V6 3WHLA 4X62M 3K1JA 2K9DA 4W5WA 3GRYA 4Z8XA 2EJSA 4QOZC 5BR8M 4QOSA 1IY1A 3K9PA 3A98B 3AKZA 2O5RA 2WSEF 2J5YA 1QAOA 1HNXM 3GLHE 2DENA 2VIIA 2L4EA 3K8ZA 2L7IA 3HKPA 2ZM6M 1HQYE 3GLHA 3H4MA 2LXEA 4I8OA 3SFZA 5H37D 1G8PA 2HKJA 3GPPA 1TF0B 1PJSA 1IN6A 3LQRA 2KZSA 2RRUA 4QNMA 5L8RF 2LHGA 1T3TA 2APLA 3L27A 2R0IA 1K3WA 3HHWA 3T1YM 3TL4X 1PM5A 2YNMD 3GPYA 1T43A 4DV7M 1HNZM 2CE7A 1GLNA 3QWLA 2FE8A 2F5NA 3SAWA 2RKOA 1VQ1A 1ORYB 2YR0A 4ANRA 3AJIB 3U6OA 1NY6A 5ITXE 1Z5CA 3I04M 3F92A 4BB9A 1ZV1A 4OVZA 2OO9A 2F4VM 4B3RM 3J7AS 4HLQA 5ITXA 3D8LA 3H4JA 3I4YA 3B74A 1LTMA 2DWNA 3HJQA 4B08A 4D81A 2QCUA 2R6FA 1G3IA 3B89A 1N33M 2WSCF 5KO3A 2JWSA 2V6ZM 3QYBA 2DAGA 4CJ6A 2XEPA 1IXSA 5FTMA 4REZA 3GLIE 1YSYA 4LJ7A 3GLGE 4FWDA 2ZANA 3FUXA 4G4NA 3U6SA 3NBIA 1NHGC 2Y20A 3M0EA 3PNYA 3GLIA 1VEKA 3GLGA 1HNWM 2R4JA 4D80A 3C9PA 1SXJE 1N78A 4B7FA 4DV0M 2DWMA 1TTEA 4DUYM 4MB7A 2DVWB 1VG5A 2D7GA 1SXJA 3AFHA 3EIHA 3SHGB 3KP0E 4GITA 3PVSA 1L8QA 2C9OA 2DWZB 1SG9A 4I81A 1OAIA 4GHAA 5BPVA 4DR5M 1WIVA 4TUWA 2JA2A 4IBDA 2Z4SA 4DBGB 3VK8A 3B7QA 3BOSA 2UUAM 3KVWA 4G4QA 3SC3A 1Q3CA 2N35A 3HGIA 4XK8F 3SMPA 1GKIA 4P17A 1IN4A 2XFSA 4JI3M 1IBLM 2VDBB 4B3TM 3LQQA 1J7KA 2JY5A 4LF5M 3SAVA 1QUTA 4FCWA 5FTNA 4LRSA 2ZTCA 2I7PA 2FOIC 2KDLA 1D0MA 3DZDA 2MH8A 3HX3A 1WR1B 3K9OA 4KT0F 4PDIA 2F5SA 4LFCM 3GPUA 5FLXS 3CF2A 1VDDA 3QAUA 4G4OA 2BWEA 3AV0A 2CEAA 1N34M 1MJGM 2BNKA 3W68A 5C1BA 1VEJA 4DV5M 2MJ5B 3IG5A 3VKHA 4IJEA 1PGYA 1TH4A 2CUZA 3HZJA 4IBJA 4RF0A 3KS4A 4A3VB 5E26A 2DHRA 3B7NA 2C98A 1OIZA 1MU5A 1V34A 2O01F 2X4AA 4LGMA 3GQ3A 1N36M 2UXBM 2CHGA 4DR3M 1HJPA 1G41A 3PFIA 4AI6A 2HWJA 3FYDA 1Z6TA 2GNOA 4LZZA 2JY7A 2V1CA 4NRVA 3SYKA 4IBBA 1NSFA 4LFBM 2Y21A 2CRUA 4WURA 3L29A 1WGLA 1R2YA 1DGHB 1OKSA 4GH9A 2A5YB 1FNNA 4KO8A 4M0DA 4GC9A 2JZ1A 2HAKA 3V76A 3GO8A 4OX9M 1WHCA 1E94E 1VEGA 1TGUA 2DNAA 3LCUA 3TE6A 1V92A 2JZ0A 4YY3M 4DV1M 1EIJA 1NNJA 1QQWA 5KQDA 2QBYB 2L09A 4MGIE 1IY2A 2L7HA 3J27B 4FCVA 5E6JA 5IREB 1N77A 1Z5AA 2KNVA 4LGYA 2UUCM 2DI0A 4IBCA
chains in the Genus database with same CATH topology
4B7HA 4DV3M 2EA0A 1QZMA 4X65M 1JR3D 5ITQA 4G6ZA 4JI1M 3AOEA 1XHBA 2XF3A 3NWLA 3HJ8A 5IWAM 4LCBA 2ZAMA 3SMSA 2P5TA 1OFHA 3HU1A 3J7BA 1XWIA 2DWLA 4CGYB 3E9SA 1L2DA 1IBKM 3CF0A 3T1HM 4CHTB 3HHYA 3GQ4A 4R7GA 4LF4M 2XGNA 1L1ZA 2QENA 3LVVA 3A45A 4KHPM 4DR7M 3U60B 2KA6B 2CV0A 3FTFA 3KOYE 4D82A 3FYCA 4QNRA 5EJCA 2LNHC 4LY6A 2R45A 2XSZD 2H1RA 4B3SM 3LMMA 2G5GX 4FD2A 3U6EA 4LZJA 3FUTA 4EIWA 1HT1E 3HJSA 4IJFA 4LF6M 1XC8A 1GVNA 1TDHA 5DYGA 4IIWA 2C96A 3M7GA 1H6UA 1XXHB 4MGHA 4P16A 3PXGA 4B7GA 3U5ZB 2C99A 3JR5A 4MGKE 3L2AA 2OQ4A 1GL7A 1IN7A 1S3SA 3J2PB 3LVWA 4R3DA 3MHVC 4X66M 1HT2E 3THGA 5KPZA 3U61B 4B3MM 4AKGA 3KFUG 4M9ZA 4LF7M 3VDUA 2XFTA 1I4WA 1IXZA 4GRIA 3RGPA 3TWKA 1DGHA 3M6AA 3SASA 4NL4H 3D8BA 1NVMA 4NXMM 4IBKA 3U6LA 1K82A 1JQJC 3FKEA 3E4RA 4X64M 4DR4M 2KW0A 3VLFB 2VQFM 1QVRA 2Q2EB 2V1UA 3ZC7B 3GLFB 1W5TA 4AQYM 3DA1A 3GQ5A 1XNQM 4II7A 2YQZA 4JI4M 1MX0A 4I5SA 3EIEA 4JI0M 4KLNA 3MJ5A 4WW0A 3ZCBB 3TWLA 4JI6M 2HL7A 1SXJD 2FNAA 4OW0A 4GHLA 4LJAA 3IG8A 4ZPXA 1E9SA 4IBGA 5EP1A 4PD2A 1ZAEA 5EQTA 3U6PA 4LF9M 4XBOA 2EO2A 4GC5A 2HCBA 3RGSA 2OPFA 3VKGA 3UJNA 3FUWA 1IM2A 3PNVA 3FD9A 4LJ9A 4RF1A 3TQSA 1SXJC 4MM3B 4LRTA 1G59A 3FTDA 4MH0E 3KXEC 4KODA 3A42A 4AKIA 5EXSA 5EP4A 1TDZA 4JI5M 2Z3XA 3CF6E 1WXQA 4NXNM 2KXEA 1FJGM 3KP1E 4DR6M 1XXHA 2J7NA 1NJGA 4NSOB 3GRRA 3FUUA 1UM8A 2ZAOA 2QZ4A 3DFZA 5GKNA 4JI8M 5DYIA 2XZUA 5EP3A 5FTKA 1NY5A 3SYLA 1Q3BA 4K0KM 3J80S 4AZFA 2XZFA 1C1KA 4JV5M 4ITQA 4IBEA 5C18A 5EXXA 5KPTA 2VQEM 4LJ4A 3T15A 3A46A 1E9RA 2Y0QA 5F3WA 4IBIA 3AOGA 3W0LB 4L4UA 4RNAA 3R9XB 1HQCA 1OJLA 1W5SA 2X8AA 3KDSE 3KSJA 3GLFA 1JR3A 3K2LA 3GLIB 4JXJA 5FSWA 2CHQA 2R18A 1Z5BA 4LFAM 1IN5A 3C58A 1R6BX 1N32M 2W82A 1N75A 3FUVA 3SATA 4BBAA 3RE8A 1SXJB 4AKHA 3J81S 4DR2M 3SARA 4PT5A 4GMQA 5ITYA 2F5QA 4L15A 4MGZE 5FTLA 3JR4A 3U6DA 3OTOM 4MGYE 3L25A 3KOXE 1QANA 2KRKA 1XMOM 3CTWB 5EXTA 4CISA 5ITRA 3RFWA 2XSZA 4DV2M 2UXCM 4Z6YA 4DV4M 2XLJA 4FCTA 4M0WA 1LV7A 1G4AE 1ZQ9A 5A2QS 1L2CA 1QAMA 5IZ7D 3TWMA 4NSRA 2R46A 3UMMA 1Z59A 3U6MA 3T38A 3L26A 3AOEC 5IT9S 1J5EM 3GP1A 2CHVA 1DGBA 4LG2A 1IN8A 1QYRA 3GPXA 2F5PA 2BJWA 5JI3E 4L8RC 1NNUC 4L16A 2R65A 1KYIA 2M60A 1YUBA 4HL4A 3I51A 2UUBM 3KS8A 4I4LA 4LJ6A 3W0FA 3SBJA 2CV1A 2J7OA 1IBMM 1R7RA 2Z4RA 2BJVA 2C9CA 3B9PA 2CV2A 3I4VA 2ZBKB 3HHZA 2R4EA 3TPZA 1EE8A 3MK6A 8CATA 2QBYA 2AHMA 2K47A 2L6OA 4L78A 1IXRC 1DO0A 3HWSA 4PDGA 2KRUA 1IQPA 1HR0M 5LMNM 1NJFA 3KW6A 1DO2A 3SAUA 3GRVA 5EP2A 3JAMS 1PJJA 2G8LA 2LH0A 2LWXA 3HU3A 1K3XA 3DOAA 3KSXA 1I94M 1OFIA 5ITTA 1X37A 1PJIA 4JYAM 2YFQA 3FTEA 1XMQM 4S12A 1DGFA 2KEBA 5KQ8A 3Q8XA 2NQ8C 5JI2E 5FTJA 4PCZA 4FWGA 3U6QA 5EXPA 1IY0A 2RGOA 4JN6A 1J09A 1R2ZA 3GLHB 2M5ZA 4AG6A 2QPAA 3U60A 2RGHA 3UZUA 2C5RA 3UGJA 3GRUA 3FTCA 3HU2A 3K92A 3AL0C 2ERCA 1KFVA 1L1TA 2E5LM 4DV6M 4QHTA 3U6CA 1YE9A 3KOWE 3ILKA 4GIPA 3VFDA 3VDPA 4GKKM 2HHHM 4LJ8A 4YHHM 3L28A 2XH9A 1TH2A 4LJ5A 3U5ZA 4LF8M 4NRWA 1DGGA 2QP9X 2EUCA 4FW9A 2CFOA 3WHKA 1KSFX 2D7EA 3ZH9B 4IBFA 2UXDM 2X49A 7CATA 4JI2M 1GL6A 3KOZE 4NOOB 3VK7A 2F5OA 3U61A 4OVZB 2DZOB 4XGIA 4FWHA 1L2BA 2I7NA 4JI7M 3SHFA 2R62A 2UU9M 4QHSA 1NHWC 4AW4A 1D2NA 2FFJA 5DNYA 5LMUM 5ITUA 4FVMA 3UK6A 1QAQA 1Q39A 1IXSB 4M9SA 5KPRA 4OU7A 2Y0TA 2Z7JA 2D7HA 2KZUA 4BLCA 3GLGB 4AG5A 3R8FA 4G4RA 3HHXA 2DZNB 1E32A 1TH3A 4M9XA 2DXIA 3WHLA 4X62M 3K1JA 4W5WA 3GRYA 4Z8XA 4QOZC 5BR8M 4QOSA 1IY1A 3AKZA 3A98B 2O5RA 1QAOA 1HNXM 2VIIA 3K8ZA 2L7IA 3HKPA 2ZM6M 1HQYE 3GLHA 3H4MA 2LXEA 4I8OA 3SFZA 5H37D 1G8PA 2HKJA 3GPPA 1IN6A 3LQRA 2KZSA 4QNMA 1T3TA 3L27A 1K3WA 3HHWA 3T1YM 3TL4X 1PM5A 2YNMD 3GPYA 4DV7M 1HNZM 2CE7A 1GLNA 3QWLA 2FE8A 2F5NA 3SAWA 2RKOA 1ORYB 2YR0A 3AJIB 3U6OA 1NY6A 5ITXE 1Z5CA 4BB9A 4OVZA 2F4VM 4B3RM 3J7AS 4HLQA 5ITXA 3D8LA 3I4YA 2DWNA 3HJQA 4B08A 4D81A 2QCUA 1G3IA 1N33M 5KO3A 2V6ZM 2XEPA 5FTMA 4REZA 1YSYA 4LJ7A 4FWDA 2ZANA 3FUXA 4G4NA 3U6SA 3NBIA 1NHGC 2Y20A 3M0EA 3PNYA 3GLIA 3GLGA 1HNWM 2R4JA 4D80A 1SXJE 1N78A 4B7FA 4DV0M 2DWMA 4DUYM 4MB7A 2DVWB 2D7GA 1SXJA 3AFHA 3EIHA 3SHGB 3KP0E 4GITA 3PVSA 1L8QA 2C9OA 2DWZB 4I81A 4GHAA 5BPVA 4DR5M 4TUWA 2JA2A 4IBDA 2Z4SA 3VK8A 3BOSA 2UUAM 3KVWA 4G4QA 3SC3A 1Q3CA 3HGIA 3SMPA 1GKIA 1IBLM 1IN4A 2XFSA 4JI3M 4B3TM 3LQQA 1J7KA 4LF5M 3SAVA 4FCWA 5FTNA 4LRSA 2I7PA 2FOIC 3DZDA 4DR1M 4GKJM 4PDIA 4LFCM 2F5SA 3GPUA 5FLXS 3CF2A 1VDDA 3QAUA 4G4OA 3AV0A 2CEAA 1N34M 2BNKA 5C1BA 4DV5M 3IG5A 3VKHA 4IJEA 1TH4A 2CUZA 4IBJA 4RF0A 3KS4A 4A3VB 5E26A 2DHRA 4LGMA 2C98A 3GQ3A 1MU5A 1N36M 2X4AA 2UXBM 2CHGA 4DR3M 1G41A 3PFIA 4AI6A 3FYDA 1Z6TA 4LZZA 2V1CA 4NRVA 3SYKA 4IBBA 1NSFA 4LFBM 2Y21A 4WURA 3L29A 1R2YA 1DGHB 4GH9A 4M0DA 2A5YB 1FNNA 4KO8A 3GO8A 4GC9A 4DUZM 1XNRM 4OX9M 1E94E 3TE6A 1TGUA 4DV1M 4YY3M 1NNJA 1QQWA 5KQDA 2QBYB 2L09A 4MGIE 1IY2A 2L7HA 3J27B 4FCVA 5E6JA 5IREB 1N77A 1Z5AA 2UUCM 4LGYA 4IBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 M;  2EA0 A;  5ITX E;  1I94 M;  5ITT A;  1Z5C A;  4X65 M;  5ITQ A;  1PJI A;  4DR6 M;  4JYA M;  2F4V M;  4JI1 M;  1XMQ M;  4B3R M;  3J7A S;  5ITX A;  5IWA M;  4JI8 M;  2XZU A;  4PCZ A;  3U6Q A;  1Q3B A;  4K0K M;  3J80 S;  2XZF A;  1R2Z A;  1N33 M;  1IBK M;  1L2D A;  4JV5 M;  3T1H M;  4ITQ A;  3GQ4 A;  4LF4 M;  2VQE M;  1L1Z A;  4G4N A;  1KFV A;  3U6S A;  3A45 A;  4KHP M;  1L1T A;  2E5L M;  4DR7 M;  3A46 A;  4DV6 M;  3U6C A;  1HNW M;  4DV0 M;  4B3S M;  4GKK M;  2HHH M;  4YHH M;  3U6E A;  4DUY M;  4MB7 A;  4NRW A;  4LF8 M;  1Z5B A;  4LF6 M;  4LFA M;  3C58 A;  1XC8 A;  1N32 M;  2UXD M;  4JI2 M;  1TDH A;  3VK7 A;  2F5O A;  3SAT A;  4DR5 M;  1L2B A;  4JI7 M;  3J81 S;  3JR5 A;  2UU9 M;  4DR2 M;  2OQ4 A;  3SAR A;  5LMU M;  3VK8 A;  5ITY A;  5ITU A;  2UUA M;  4X66 M;  2F5Q A;  4B3M M;  4G4Q A;  3U6O A;  1Q3C A;  4LF7 M;  3JR4 A;  3U6D A;  3OTO M;  1Q39 A;  1XMO M;  4CIS A;  1IBL M;  4JI3 M;  5ITR A;  3TWK A;  4B3T M;  3SAS A;  4LF5 M;  4DV2 M;  2UXC M;  3SAV A;  4DV4 M;  4NXM M;  4G4R A;  3U6L A;  1K82 A;  5A2Q S;  4DR1 M;  1L2C A;  4GKJ M;  4X64 M;  4PDI A;  4LFC M;  4DR4 M;  2F5S A;  2VQF M;  3TWM A;  3GPU A;  2Q2E B;  5FLX S;  4G4O A;  1Z59 A;  3U6M A;  4X62 M;  1N34 M;  1J5E M;  4AQY M;  5IT9 S;  3GQ5 A;  3GP1 A;  1XNQ M;  4DV5 M;  5BR8 M;  3GPX A;  2F5P A;  4JI4 M;  1MX0 A;  4JI0 M;  1HNX M;  3GQ3 A;  3TWL A;  1MU5 A;  1N36 M;  4JI6 M;  2ZM6 M;  2UXB M;  4DR3 M;  2UUB M;  3W0F A;  3SBJ A;  4PD2 A;  2HKJ A;  3GPP A;  3U6P A;  1IBM M;  4LF9 M;  2ZBK B;  2OPF A;  4NRV A;  4LFB M;  1EE8 A;  1R2Y A;  1XNR M;  3GO8 A;  4DUZ M;  1K3W A;  3T1Y M;  4OX9 M;  4PDG A;  1PM5 A;  3GPY A;  4DV7 M;  1HNZ M;  5LMN M;  4YY3 M;  3A42 A;  4DV1 M;  1HR0 M;  1NNJ A;  3SAU A;  2F5N A;  3SAW A;  1TDZ A;  4JI5 M;  3JAM S;  1PJJ A;  1Z5A A;  2UUC M;  4NXN M;  1K3X A;  1FJG M;  3DOA A; 
#chains in the Genus database with same CATH topology
 4B7H A;  4DV3 M;  2EA0 A;  1QZM A;  4X65 M;  1JR3 D;  5ITQ A;  4DUZ M;  4G6Z A;  1GAB A;  4JI1 M;  3AOE A;  1T6O A;  1XHB A;  2XF3 A;  3NWL A;  3HJ8 A;  3LW5 F;  1QZE A;  2R44 A;  4LCB A;  5IWA M;  2ZAM A;  3SMS A;  2P5T A;  1OFH A;  3HU1 A;  2K6B A;  3J7B A;  2OOA A;  1XWI A;  1G71 A;  4CGY B;  3E9S A;  1L2D A;  1IBK M;  3CF0 A;  2DWL A;  3T1H M;  3Q8G A;  4CHT B;  3HHY A;  3GQ4 A;  2EKK A;  4R7G A;  4CIZ A;  4LF4 M;  2WSF F;  2XGN A;  3T6P A;  1L1Z A;  2QEN A;  2GQF A;  3LVV A;  3A45 A;  4KHP M;  4DR7 M;  3CGW A;  2BWB A;  3U60 B;  2KA6 B;  4NC6 A;  4F2L A;  2CV0 A;  3FTF A;  3KOY E;  4D82 A;  3FYC A;  4QNR A;  5EJC A;  2LNH C;  4LY6 A;  2R45 A;  2XSZ D;  2H1R A;  4B3S M;  3LMM A;  2G5G X;  4FD2 A;  3U6E A;  1PRB A;  4LZJ A;  3FUT A;  4EIW A;  1OAO C;  1HT1 E;  3HJS A;  4IJF A;  4LF6 M;  1XC8 A;  1GVN A;  2JNH A;  1TDH A;  5DYG A;  4IIW A;  1RU3 A;  2C96 A;  3M7G A;  1H6U A;  1XXH B;  1AIP C;  4MGH A;  3C3D A;  2FH0 A;  4P16 A;  3PXG A;  4B7G A;  3U5Z B;  3W67 A;  2DAM A;  2C99 A;  3JR5 A;  1ZMU A;  4MGK E;  3L2A A;  1GJT A;  2OQ4 A;  1GL7 A;  1IN7 A;  1S3S A;  3J2P B;  3LVW A;  4R3D A;  3MHV C;  4X66 M;  1HT2 E;  3THG A;  5KPZ A;  3U61 B;  4B3M M;  4AKG A;  3KFU G;  4M9Z A;  4LF7 M;  3VDU A;  2XFT A;  2B3T A;  1I4W A;  1IXZ A;  2DAI A;  4GRI A;  3RGP A;  3TWK A;  1DGH A;  3M6A A;  3SAS A;  4G3O A;  4NL4 H;  3D8B A;  1NVM A;  4NXM M;  4IBK A;  1D0L A;  3U6L A;  1K82 A;  1JQJ C;  3FKE A;  3E4R A;  4X64 M;  4DR4 M;  2KW0 A;  3VLF B;  2VQF M;  1QVR A;  2Q2E B;  2V1U A;  3ZC7 B;  3GLF B;  1W5T A;  4AQY M;  3DA1 A;  3IHP A;  2LBC A;  3FRI A;  4RKU F;  3GQ5 A;  1XNQ M;  2LVA A;  4II7 A;  2YQZ A;  4JI4 M;  1MX0 A;  4I5S A;  3EIE A;  4JI0 M;  4KLN A;  3MJ5 A;  4WW0 A;  3ZCB B;  2LVN C;  3TWL A;  3FRH A;  4UN2 B;  2HL7 A;  4JI6 M;  1SXJ D;  2FNA A;  4OW0 A;  4GHL A;  4LJA A;  4Q7J A;  1Q02 A;  3IG8 A;  4ZPX A;  1E9S A;  2DHY A;  4IBG A;  5EP1 A;  4PD2 A;  1ZAE A;  5EQT A;  3U6P A;  4LF9 M;  4XBO A;  2EO2 A;  4GC5 A;  2HCB A;  3E46 A;  3RGS A;  2OPF A;  3VKG A;  3UJN A;  3FUW A;  1IM2 A;  3PNV A;  3FD9 A;  4LJ9 A;  4RF1 A;  4HEO A;  3TQS A;  1SXJ C;  4MM3 B;  4LRT A;  1G59 A;  3FTD A;  4MH0 E;  3KXE C;  4KOD A;  3A42 A;  2O25 A;  4AKI A;  5EXS A;  4GEW A;  5EP4 A;  1TDZ A;  4JI5 M;  1AUA A;  1XXH E;  3CF6 E;  2Z3X A;  2QSF X;  3BXW A;  1WXQ A;  2DAK A;  4NXN M;  2KXE A;  1FJG M;  3KP1 E;  2KNZ A;  1XXH A;  2J7N A;  1NJG A;  4DR6 M;  4NSO B;  3GRR A;  3FUU A;  2H5X A;  2LTU A;  1UM8 A;  2ZAO A;  2JP7 A;  2QZ4 A;  3DFZ A;  1XB2 B;  5GKN A;  4JI8 M;  5DYI A;  2XZU A;  2WZJ A;  5EP3 A;  5FTK A;  1NY5 A;  2CWB A;  1Q3B A;  3SYL A;  4K0K M;  3J80 S;  4AZF A;  1OIP A;  2XZF A;  1C1K A;  2MGW A;  3MMP A;  4JV5 M;  4ITQ A;  1ZMW A;  4IBE A;  5C18 A;  5EXX A;  5KPT A;  2VQE M;  1C7Y A;  2K0B X;  3FE3 A;  4LJ4 A;  3T15 A;  2L2D A;  1E9R A;  3A46 A;  2Y0Q A;  5F3W A;  4IBI A;  3AOG A;  3W0L B;  3E21 A;  4L4U A;  4RNA A;  1JR3 E;  3C3E A;  3R9X B;  1HQC A;  1OJL A;  1W5S A;  2L4F A;  2X8A A;  3KDS E;  3KSJ A;  3GLF A;  1JR3 A;  3K2L A;  3GLI B;  4JXJ A;  5FSW A;  2CHQ A;  2CP8 A;  1Z5B A;  2R18 A;  4LFA M;  1IN5 A;  3C58 A;  1ZMV A;  1R6B X;  1N32 M;  2W82 A;  1N75 A;  3FUV A;  1Y8G A;  3SAT A;  2MR9 A;  4BBA A;  1NV9 A;  3RE8 A;  1SXJ B;  4AKH A;  3J81 S;  4DR2 M;  2LVQ D;  1V33 A;  2ZTD A;  3BBZ A;  4PT5 A;  3SAR A;  1QDT A;  4GMQ A;  5ITY A;  2F5Q A;  2KNA A;  4L15 A;  1TR8 A;  4MGZ E;  2DAE A;  3B7Z A;  1CUK A;  4R71 A;  5FTL A;  1PJQ A;  2G3Q A;  3JR4 A;  3U6D A;  3OTO M;  4MGY E;  3L25 A;  3KOX E;  1QAN A;  2KRK A;  1XMO M;  3CTW B;  5EXT A;  4CIS A;  1GO5 A;  5ITR A;  4DR1 M;  3RFW A;  2XSZ A;  4DV2 M;  2UXC M;  4Z6Y A;  4DV4 M;  2XLJ A;  2MRO B;  2JUJ A;  4FCT A;  4M0W A;  1LV7 A;  1G4A E;  1ZQ9 A;  5A2Q S;  1L2C A;  1QAM A;  5IZ7 D;  3TWM A;  4NSR A;  2R46 A;  4Y28 F;  3UMM A;  1UFZ A;  1Z59 A;  3U6M A;  3T38 A;  3L26 A;  3AOE C;  1D0K A;  5IT9 S;  1J5E M;  2LVP C;  3GP1 A;  4F1I A;  2CHV A;  2FS1 A;  1DV0 A;  1DGB A;  2QQ8 A;  4LG2 A;  1IN8 A;  1QYR A;  3GPX A;  4GKJ M;  2F5P A;  2BJW A;  5JI3 E;  3LCV B;  4L8R C;  1NNU C;  4L16 A;  2R65 A;  1KYI A;  1R5L A;  2M60 A;  1MN3 A;  1YUB A;  4HL4 A;  3I51 A;  2UUB M;  3KS8 A;  4I4L A;  4LJ6 A;  3W0F A;  3SBJ A;  2CV1 A;  2J7O A;  3ZQJ A;  2EKF A;  2DKL A;  1IBM M;  1R7R A;  2OOB A;  2Z4R A;  2BJV A;  2C9C A;  3B9P A;  2CV2 A;  1BVS A;  2ZBK B;  3I4V A;  1NO1 A;  2R4E A;  3TPZ A;  1EE8 A;  3MK6 A;  3HHZ A;  8CAT A;  2QBY A;  3NBX X;  2KHH A;  2AHM A;  2K47 A;  2L6O A;  4L78 A;  1YLA A;  1IXR C;  1DO0 A;  2Z8Y M;  3HWS A;  1WGN A;  4PDG A;  2KRU A;  1IQP A;  2QNJ A;  1A5T A;  1HR0 M;  4WP2 A;  5LMN M;  1NJF A;  3KW6 A;  1DO2 A;  3SAU A;  3GRV A;  5EP2 A;  3JAM S;  1PJJ A;  2G8L A;  2LH0 A;  3QYE A;  2LWX A;  3HU3 A;  1K3X A;  3DOA A;  3KSX A;  1I94 M;  1OFI A;  5DFL A;  1X37 A;  5ITT A;  1PJI A;  4JYA M;  1WJ7 A;  2YFQ A;  3FTE A;  1XMQ M;  1GJS A;  4S12 A;  1DGF A;  2KEB A;  5KQ8 A;  1OTR A;  2LHC A;  3Q8X A;  2NQ8 C;  5JI2 E;  5FTJ A;  4PCZ A;  4FWG A;  3U6Q A;  5EXP A;  1IY0 A;  1PJT A;  2RGO A;  1J09 A;  4JN6 A;  1R2Z A;  3GLH B;  2M5Z A;  4AG6 A;  2QPA A;  3U60 A;  2RGH A;  3UZU A;  2C5R A;  3UGJ A;  3GRU A;  3FTC A;  2JY6 B;  3HU2 A;  3K92 A;  3AL0 C;  2VF8 A;  2ERC A;  3I01 M;  1KFV A;  1L1T A;  2E5L M;  4DV6 M;  4QHT A;  3U6C A;  2QHO B;  1YE9 A;  3KOW E;  1JB0 F;  3ILK A;  2VF7 A;  1VDL A;  4GIP A;  3VFD A;  3VDP A;  4GKK M;  2HHH M;  1OQY A;  4LJ8 A;  3L28 A;  4YHH M;  2XH9 A;  1TH2 A;  4LJ5 A;  3U5Z A;  4LF8 M;  4NRW A;  1DGG A;  2QP9 X;  2EUC A;  4FW9 A;  2CFO A;  3WHK A;  1KSF X;  2D7E A;  3ZH9 B;  4IBF A;  2UXD M;  2X49 A;  7CAT A;  4JI2 M;  1F4I A;  1GL6 A;  1R4G A;  1EFU B;  3KOZ E;  4NOO B;  3VK7 A;  2F5O A;  3U61 A;  4OVZ B;  2DZO B;  4XGI A;  4FWH A;  1L2B A;  2I7N A;  2DZL A;  4JI7 M;  3SHF A;  2R62 A;  2UU9 M;  4QHS A;  1NHW C;  4AW4 A;  1D2N A;  2FFJ A;  5DNY A;  5LMU M;  5ITU A;  4FVM A;  2JY8 A;  3UK6 A;  1IFY A;  1IXS B;  1Q39 A;  1QAQ A;  3GLF E;  4M9S A;  5KPR A;  4OU7 A;  2Y0T A;  2Z7J A;  2D7H A;  2KZU A;  2JXN A;  4BLC A;  3GLG B;  4AG5 A;  3R8F A;  4G4R A;  3HHX A;  3HY5 A;  1QUS A;  1QDR A;  1E32 A;  2DZN B;  2LVO C;  1P3Q Q;  1TH3 A;  4M9X A;  2DXI A;  1XNR M;  3IEC A;  1NV8 A;  4L6V 6;  3WHL A;  4X62 M;  3K1J A;  2K9D A;  4W5W A;  3GRY A;  4Z8X A;  2EJS A;  4QOZ C;  5BR8 M;  4QOS A;  1IY1 A;  3K9P A;  3A98 B;  3AKZ A;  2O5R A;  2WSE F;  2J5Y A;  1QAO A;  1HNX M;  3GLH E;  2DEN A;  2VII A;  2L4E A;  3K8Z A;  2L7I A;  3HKP A;  2ZM6 M;  1HQY E;  3GLH A;  3H4M A;  2LXE A;  4I8O A;  3SFZ A;  5H37 D;  1G8P A;  2HKJ A;  3GPP A;  1TF0 B;  1PJS A;  1IN6 A;  3LQR A;  2KZS A;  2RRU A;  4QNM A;  5L8R F;  2LHG A;  1T3T A;  2APL A;  3L27 A;  2R0I A;  1K3W A;  3HHW A;  3T1Y M;  3TL4 X;  1PM5 A;  2YNM D;  3GPY A;  1T43 A;  4DV7 M;  1HNZ M;  2CE7 A;  1GLN A;  3QWL A;  2FE8 A;  2F5N A;  3SAW A;  2RKO A;  1VQ1 A;  1ORY B;  2YR0 A;  4ANR A;  3AJI B;  3U6O A;  1NY6 A;  5ITX E;  1Z5C A;  3I04 M;  3F92 A;  4BB9 A;  1ZV1 A;  4OVZ A;  2OO9 A;  2F4V M;  4B3R M;  3J7A S;  4HLQ A;  5ITX A;  3D8L A;  3H4J A;  3I4Y A;  3B74 A;  1LTM A;  2DWN A;  3HJQ A;  4B08 A;  4D81 A;  2QCU A;  2R6F A;  1G3I A;  3B89 A;  1N33 M;  2WSC F;  5KO3 A;  2JWS A;  2V6Z M;  3QYB A;  2DAG A;  4CJ6 A;  2XEP A;  1IXS A;  5FTM A;  4REZ A;  3GLI E;  1YSY A;  4LJ7 A;  3GLG E;  4FWD A;  2ZAN A;  3FUX A;  4G4N A;  3U6S A;  3NBI A;  1NHG C;  2Y20 A;  3M0E A;  3PNY A;  3GLI A;  1VEK A;  3GLG A;  1HNW M;  2R4J A;  4D80 A;  3C9P A;  1SXJ E;  1N78 A;  4B7F A;  4DV0 M;  2DWM A;  1TTE A;  4DUY M;  4MB7 A;  2DVW B;  1VG5 A;  2D7G A;  1SXJ A;  3AFH A;  3EIH A;  3SHG B;  3KP0 E;  4GIT A;  3PVS A;  1L8Q A;  2C9O A;  2DWZ B;  1SG9 A;  4I81 A;  1OAI A;  4GHA A;  5BPV A;  4DR5 M;  1WIV A;  4TUW A;  2JA2 A;  4IBD A;  2Z4S A;  4DBG B;  3VK8 A;  3B7Q A;  3BOS A;  2UUA M;  3KVW A;  4G4Q A;  3SC3 A;  1Q3C A;  2N35 A;  3HGI A;  4XK8 F;  3SMP A;  1GKI A;  4P17 A;  1IN4 A;  2XFS A;  4JI3 M;  1IBL M;  2VDB B;  4B3T M;  3LQQ A;  1J7K A;  2JY5 A;  4LF5 M;  3SAV A;  1QUT A;  4FCW A;  5FTN A;  4LRS A;  2ZTC A;  2I7P A;  2FOI C;  2KDL A;  1D0M A;  3DZD A;  2MH8 A;  3HX3 A;  1WR1 B;  3K9O A;  4KT0 F;  4PDI A;  2F5S A;  4LFC M;  3GPU A;  5FLX S;  3CF2 A;  1VDD A;  3QAU A;  4G4O A;  2BWE A;  3AV0 A;  2CEA A;  1N34 M;  1MJG M;  2BNK A;  3W68 A;  5C1B A;  1VEJ A;  4DV5 M;  2MJ5 B;  3IG5 A;  3VKH A;  4IJE A;  1PGY A;  1TH4 A;  2CUZ A;  3HZJ A;  4IBJ A;  4RF0 A;  3KS4 A;  4A3V B;  5E26 A;  2DHR A;  3B7N A;  2C98 A;  1OIZ A;  1MU5 A;  1V34 A;  2O01 F;  2X4A A;  4LGM A;  3GQ3 A;  1N36 M;  2UXB M;  2CHG A;  4DR3 M;  1HJP A;  1G41 A;  3PFI A;  4AI6 A;  2HWJ A;  3FYD A;  1Z6T A;  2GNO A;  4LZZ A;  2JY7 A;  2V1C A;  4NRV A;  3SYK A;  4IBB A;  1NSF A;  4LFB M;  2Y21 A;  2CRU A;  4WUR A;  3L29 A;  1WGL A;  1R2Y A;  1DGH B;  1OKS A;  4GH9 A;  2A5Y B;  1FNN A;  4KO8 A;  4M0D A;  4GC9 A;  2JZ1 A;  2HAK A;  3V76 A;  3GO8 A;  4OX9 M;  1WHC A;  1E94 E;  1VEG A;  1TGU A;  2DNA A;  3LCU A;  3TE6 A;  1V92 A;  2JZ0 A;  4YY3 M;  4DV1 M;  1EIJ A;  1NNJ A;  1QQW A;  5KQD A;  2QBY B;  2L09 A;  4MGI E;  1IY2 A;  2L7H A;  3J27 B;  4FCV A;  5E6J A;  5IRE B;  1N77 A;  1Z5A A;  2KNV A;  4LGY A;  2UUC M;  2DI0 A;  4IBC A; 
#chains in the Genus database with same CATH homology
 4B7H A;  4DV3 M;  2EA0 A;  1QZM A;  4X65 M;  1JR3 D;  5ITQ A;  4G6Z A;  4JI1 M;  3AOE A;  1XHB A;  2XF3 A;  3NWL A;  3HJ8 A;  5IWA M;  4LCB A;  2ZAM A;  3SMS A;  2P5T A;  1OFH A;  3HU1 A;  3J7B A;  1XWI A;  2DWL A;  4CGY B;  3E9S A;  1L2D A;  1IBK M;  3CF0 A;  3T1H M;  4CHT B;  3HHY A;  3GQ4 A;  4R7G A;  4LF4 M;  2XGN A;  1L1Z A;  2QEN A;  3LVV A;  3A45 A;  4KHP M;  4DR7 M;  3U60 B;  2KA6 B;  2CV0 A;  3FTF A;  3KOY E;  4D82 A;  3FYC A;  4QNR A;  5EJC A;  2LNH C;  4LY6 A;  2R45 A;  2XSZ D;  2H1R A;  4B3S M;  3LMM A;  2G5G X;  4FD2 A;  3U6E A;  4LZJ A;  3FUT A;  4EIW A;  1HT1 E;  3HJS A;  4IJF A;  4LF6 M;  1XC8 A;  1GVN A;  1TDH A;  5DYG A;  4IIW A;  2C96 A;  3M7G A;  1H6U A;  1XXH B;  4MGH A;  4P16 A;  3PXG A;  4B7G A;  3U5Z B;  2C99 A;  3JR5 A;  4MGK E;  3L2A A;  2OQ4 A;  1GL7 A;  1IN7 A;  1S3S A;  3J2P B;  3LVW A;  4R3D A;  3MHV C;  4X66 M;  1HT2 E;  3THG A;  5KPZ A;  3U61 B;  4B3M M;  4AKG A;  3KFU G;  4M9Z A;  4LF7 M;  3VDU A;  2XFT A;  1I4W A;  1IXZ A;  4GRI A;  3RGP A;  3TWK A;  1DGH A;  3M6A A;  3SAS A;  4NL4 H;  3D8B A;  1NVM A;  4NXM M;  4IBK A;  3U6L A;  1K82 A;  1JQJ C;  3FKE A;  3E4R A;  4X64 M;  4DR4 M;  2KW0 A;  3VLF B;  2VQF M;  1QVR A;  2Q2E B;  2V1U A;  3ZC7 B;  3GLF B;  1W5T A;  4AQY M;  3DA1 A;  3GQ5 A;  1XNQ M;  4II7 A;  2YQZ A;  4JI4 M;  1MX0 A;  4I5S A;  3EIE A;  4JI0 M;  4KLN A;  3MJ5 A;  4WW0 A;  3ZCB B;  3TWL A;  4JI6 M;  2HL7 A;  1SXJ D;  2FNA A;  4OW0 A;  4GHL A;  4LJA A;  3IG8 A;  4ZPX A;  1E9S A;  4IBG A;  5EP1 A;  4PD2 A;  1ZAE A;  5EQT A;  3U6P A;  4LF9 M;  4XBO A;  2EO2 A;  4GC5 A;  2HCB A;  3RGS A;  2OPF A;  3VKG A;  3UJN A;  3FUW A;  1IM2 A;  3PNV A;  3FD9 A;  4LJ9 A;  4RF1 A;  3TQS A;  1SXJ C;  4MM3 B;  4LRT A;  1G59 A;  3FTD A;  4MH0 E;  3KXE C;  4KOD A;  3A42 A;  4AKI A;  5EXS A;  5EP4 A;  1TDZ A;  4JI5 M;  2Z3X A;  3CF6 E;  1WXQ A;  4NXN M;  2KXE A;  1FJG M;  3KP1 E;  4DR6 M;  1XXH A;  2J7N A;  1NJG A;  4NSO B;  3GRR A;  3FUU A;  1UM8 A;  2ZAO A;  2QZ4 A;  3DFZ A;  5GKN A;  4JI8 M;  5DYI A;  2XZU A;  5EP3 A;  5FTK A;  1NY5 A;  3SYL A;  1Q3B A;  4K0K M;  3J80 S;  4AZF A;  2XZF A;  1C1K A;  4JV5 M;  4ITQ A;  4IBE A;  5C18 A;  5EXX A;  5KPT A;  2VQE M;  4LJ4 A;  3T15 A;  3A46 A;  1E9R A;  2Y0Q A;  5F3W A;  4IBI A;  3AOG A;  3W0L B;  4L4U A;  4RNA A;  3R9X B;  1HQC A;  1OJL A;  1W5S A;  2X8A A;  3KDS E;  3KSJ A;  3GLF A;  1JR3 A;  3K2L A;  3GLI B;  4JXJ A;  5FSW A;  2CHQ A;  2R18 A;  1Z5B A;  4LFA M;  1IN5 A;  3C58 A;  1R6B X;  1N32 M;  2W82 A;  1N75 A;  3FUV A;  3SAT A;  4BBA A;  3RE8 A;  1SXJ B;  4AKH A;  3J81 S;  4DR2 M;  3SAR A;  4PT5 A;  4GMQ A;  5ITY A;  2F5Q A;  4L15 A;  4MGZ E;  5FTL A;  3JR4 A;  3U6D A;  3OTO M;  4MGY E;  3L25 A;  3KOX E;  1QAN A;  2KRK A;  1XMO M;  3CTW B;  5EXT A;  4CIS A;  5ITR A;  3RFW A;  2XSZ A;  4DV2 M;  2UXC M;  4Z6Y A;  4DV4 M;  2XLJ A;  4FCT A;  4M0W A;  1LV7 A;  1G4A E;  1ZQ9 A;  5A2Q S;  1L2C A;  1QAM A;  5IZ7 D;  3TWM A;  4NSR A;  2R46 A;  3UMM A;  1Z59 A;  3U6M A;  3T38 A;  3L26 A;  3AOE C;  5IT9 S;  1J5E M;  3GP1 A;  2CHV A;  1DGB A;  4LG2 A;  1IN8 A;  1QYR A;  3GPX A;  2F5P A;  2BJW A;  5JI3 E;  4L8R C;  1NNU C;  4L16 A;  2R65 A;  1KYI A;  2M60 A;  1YUB A;  4HL4 A;  3I51 A;  2UUB M;  3KS8 A;  4I4L A;  4LJ6 A;  3W0F A;  3SBJ A;  2CV1 A;  2J7O A;  1IBM M;  1R7R A;  2Z4R A;  2BJV A;  2C9C A;  3B9P A;  2CV2 A;  3I4V A;  2ZBK B;  3HHZ A;  2R4E A;  3TPZ A;  1EE8 A;  3MK6 A;  8CAT A;  2QBY A;  2AHM A;  2K47 A;  2L6O A;  4L78 A;  1IXR C;  1DO0 A;  3HWS A;  4PDG A;  2KRU A;  1IQP A;  1HR0 M;  5LMN M;  1NJF A;  3KW6 A;  1DO2 A;  3SAU A;  3GRV A;  5EP2 A;  3JAM S;  1PJJ A;  2G8L A;  2LH0 A;  2LWX A;  3HU3 A;  1K3X A;  3DOA A;  3KSX A;  1I94 M;  1OFI A;  5ITT A;  1X37 A;  1PJI A;  4JYA M;  2YFQ A;  3FTE A;  1XMQ M;  4S12 A;  1DGF A;  2KEB A;  5KQ8 A;  3Q8X A;  2NQ8 C;  5JI2 E;  5FTJ A;  4PCZ A;  4FWG A;  3U6Q A;  5EXP A;  1IY0 A;  2RGO A;  4JN6 A;  1J09 A;  1R2Z A;  3GLH B;  2M5Z A;  4AG6 A;  2QPA A;  3U60 A;  2RGH A;  3UZU A;  2C5R A;  3UGJ A;  3GRU A;  3FTC A;  3HU2 A;  3K92 A;  3AL0 C;  2ERC A;  1KFV A;  1L1T A;  2E5L M;  4DV6 M;  4QHT A;  3U6C A;  1YE9 A;  3KOW E;  3ILK A;  4GIP A;  3VFD A;  3VDP A;  4GKK M;  2HHH M;  4LJ8 A;  4YHH M;  3L28 A;  2XH9 A;  1TH2 A;  4LJ5 A;  3U5Z A;  4LF8 M;  4NRW A;  1DGG A;  2QP9 X;  2EUC A;  4FW9 A;  2CFO A;  3WHK A;  1KSF X;  2D7E A;  3ZH9 B;  4IBF A;  2UXD M;  2X49 A;  7CAT A;  4JI2 M;  1GL6 A;  3KOZ E;  4NOO B;  3VK7 A;  2F5O A;  3U61 A;  4OVZ B;  2DZO B;  4XGI A;  4FWH A;  1L2B A;  2I7N A;  4JI7 M;  3SHF A;  2R62 A;  2UU9 M;  4QHS A;  1NHW C;  4AW4 A;  1D2N A;  2FFJ A;  5DNY A;  5LMU M;  5ITU A;  4FVM A;  3UK6 A;  1QAQ A;  1Q39 A;  1IXS B;  4M9S A;  5KPR A;  4OU7 A;  2Y0T A;  2Z7J A;  2D7H A;  2KZU A;  4BLC A;  3GLG B;  4AG5 A;  3R8F A;  4G4R A;  3HHX A;  2DZN B;  1E32 A;  1TH3 A;  4M9X A;  2DXI A;  3WHL A;  4X62 M;  3K1J A;  4W5W A;  3GRY A;  4Z8X A;  4QOZ C;  5BR8 M;  4QOS A;  1IY1 A;  3AKZ A;  3A98 B;  2O5R A;  1QAO A;  1HNX M;  2VII A;  3K8Z A;  2L7I A;  3HKP A;  2ZM6 M;  1HQY E;  3GLH A;  3H4M A;  2LXE A;  4I8O A;  3SFZ A;  5H37 D;  1G8P A;  2HKJ A;  3GPP A;  1IN6 A;  3LQR A;  2KZS A;  4QNM A;  1T3T A;  3L27 A;  1K3W A;  3HHW A;  3T1Y M;  3TL4 X;  1PM5 A;  2YNM D;  3GPY A;  4DV7 M;  1HNZ M;  2CE7 A;  1GLN A;  3QWL A;  2FE8 A;  2F5N A;  3SAW A;  2RKO A;  1ORY B;  2YR0 A;  3AJI B;  3U6O A;  1NY6 A;  5ITX E;  1Z5C A;  4BB9 A;  4OVZ A;  2F4V M;  4B3R M;  3J7A S;  4HLQ A;  5ITX A;  3D8L A;  3I4Y A;  2DWN A;  3HJQ A;  4B08 A;  4D81 A;  2QCU A;  1G3I A;  1N33 M;  5KO3 A;  2V6Z M;  2XEP A;  5FTM A;  4REZ A;  1YSY A;  4LJ7 A;  4FWD A;  2ZAN A;  3FUX A;  4G4N A;  3U6S A;  3NBI A;  1NHG C;  2Y20 A;  3M0E A;  3PNY A;  3GLI A;  3GLG A;  1HNW M;  2R4J A;  4D80 A;  1SXJ E;  1N78 A;  4B7F A;  4DV0 M;  2DWM A;  4DUY M;  4MB7 A;  2DVW B;  2D7G A;  1SXJ A;  3AFH A;  3EIH A;  3SHG B;  3KP0 E;  4GIT A;  3PVS A;  1L8Q A;  2C9O A;  2DWZ B;  4I81 A;  4GHA A;  5BPV A;  4DR5 M;  4TUW A;  2JA2 A;  4IBD A;  2Z4S A;  3VK8 A;  3BOS A;  2UUA M;  3KVW A;  4G4Q A;  3SC3 A;  1Q3C A;  3HGI A;  3SMP A;  1GKI A;  1IBL M;  1IN4 A;  2XFS A;  4JI3 M;  4B3T M;  3LQQ A;  1J7K A;  4LF5 M;  3SAV A;  4FCW A;  5FTN A;  4LRS A;  2I7P A;  2FOI C;  3DZD A;  4DR1 M;  4GKJ M;  4PDI A;  4LFC M;  2F5S A;  3GPU A;  5FLX S;  3CF2 A;  1VDD A;  3QAU A;  4G4O A;  3AV0 A;  2CEA A;  1N34 M;  2BNK A;  5C1B A;  4DV5 M;  3IG5 A;  3VKH A;  4IJE A;  1TH4 A;  2CUZ A;  4IBJ A;  4RF0 A;  3KS4 A;  4A3V B;  5E26 A;  2DHR A;  4LGM A;  2C98 A;  3GQ3 A;  1MU5 A;  1N36 M;  2X4A A;  2UXB M;  2CHG A;  4DR3 M;  1G41 A;  3PFI A;  4AI6 A;  3FYD A;  1Z6T A;  4LZZ A;  2V1C A;  4NRV A;  3SYK A;  4IBB A;  1NSF A;  4LFB M;  2Y21 A;  4WUR A;  3L29 A;  1R2Y A;  1DGH B;  4GH9 A;  4M0D A;  2A5Y B;  1FNN A;  4KO8 A;  3GO8 A;  4GC9 A;  4DUZ M;  1XNR M;  4OX9 M;  1E94 E;  3TE6 A;  1TGU A;  4DV1 M;  4YY3 M;  1NNJ A;  1QQW A;  5KQD A;  2QBY B;  2L09 A;  4MGI E;  1IY2 A;  2L7H A;  3J27 B;  4FCV A;  5E6J A;  5IRE B;  1N77 A;  1Z5A A;  2UUC M;  4LGY A;  4IBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...