1N32M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n32M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n32M02
4MB7A 1MU5A 4DV3M 3VK8A 1XMQM 3DOAA 3TWKA 4X62M 1Z5AA 1Q3CA 3GPYA 4JI2M 4LF8M 4G4NA 1KFVA 5LMNM 1I94M 4NRWA 3W0FA 1IBKM 3A45A 1N32M 4DV5M 4CISA 2UXCM 3SBJA 1N33M 1Q3BA 2HHHM 3GQ3A 5ITUA 3U6OA 2E5LM 3SASA 1NNJA 5IWAM 4DR2M 3GO8A 4DV4M 3TWLA 4JI4M 4LFBM 3SAWA 4B3TM 4X64M 4LF6M 4K0KM 4DV2M 1HNXM 4LF7M 1K3WA 1L1ZA 4JV5M 2UUBM 2F5OA 5LMUM 4JI5M 2F5NA 4DR1M 3GP1A 4G4QA 4JI8M 1K82A 1K3XA 4DV0M 1Z59A 3GPUA 1N36M 3JAMS 4JI3M 1N34M 4OX9M 3C58A 5ITQA 4DR5M 3U6SA 4DR4M 3U6MA 4DV6M 3TWMA 3SATA 3GQ5A 4GKJM 2UXDM 4G4RA 3U6QA 3T1HM 1XC8A 3JR4A 1J5EM 4YY3M 1FJGM 2F4VM 2EA0A 4PCZA 4JYAM 3GQ4A 4B3MM 3J7AS 3SARA 3JR5A 4X66M 4NRVA 1EE8A 5BR8M 3U6CA 4ITQA 4DUYM 4YHHM 2OPFA 4JI0M 4DR7M 3U6DA 2ZBKB 1TDZA 1PJIA 4DUZM 2XZUA 3GPXA 4DR3M 4LFAM 1R2YA 1HR0M 5IT9S 3U6LA 5FLXS 2F5QA 5ITXE 4LF5M 5ITTA 3A42A 3SAVA 4NXMM 1PJJA 3VK7A 4B3RM 1L2CA 3T1YM 1MX0A 2UUCM 2F5SA 3SAUA 4LF9M 2Q2EB 4GKKM 5ITXA 4G4OA 4KHPM 1L2DA 1L1TA 3J80S 2ZM6M 4X65M 1R2ZA 2UXBM 5ITYA 3J81S 4PDIA 4PD2A 2UU9M 3GPPA 2VQEM 1HNWM 2HKJA 2UUAM 4JI7M 1XNQM 1PM5A 2XZFA 4LF4M 4DR6M 4AQYM 4DV7M 4PDGA 1XMOM 1L2BA 1TDHA 1XNRM 2OQ4A 5ITRA 4JI6M 2VQFM 4DV1M 1IBLM 1Z5BA 4JI1M 5A2QS 3A46A 3U6EA 4LFCM 4NXNM 2F5PA 3OTOM 1IBMM 4B3SM 1HNZM 1Q39A 3U6PA 1Z5CA
chains in the Genus database with same CATH superfamily
1ZMVA 2JXNA 2Z7JA 4MB7A 3VK8A 2VIIA 3DOAA 3GLGE 3E46A 2C99A 2DZLA 1WGLA 4XBOA 1XXHA 4G4NA 2KZSA 1PJQA 3A45A 3I01M 4IBEA 2CRUA 1H6UA 3HY5A 3KDSE 2UXCM 1IY1A 2Z8YM 1Q3BA 1DV0A 3E21A 3GLFA 5ITUA 2VDBB 2EO2A 1J7KA 4NSRA 4REZA 3KOWE 2Y21A 1NNJA 2FS1A 4IBGA 4B08A 4DV4M 4LFBM 1CUKA 2JWSA 3SAWA 1G8PA 2XSZD 4GC9A 2QQ8A 3PFIA 1OKSA 2QHOB 1E32A 1QVRA 1YSYA 1L1ZA 4JV5M 3GLIE 2NQ8C 4LJ6A 3FD9A 3VKGA 3GP1A 1C1KA 2R62A 5EXPA 4L15A 4G4QA 4LJ9A 1K3XA 3LVWA 2N35A 1Z59A 3GPUA 2BJVA 3UMMA 1N36M 2K47A 3PNYA 1TH3A 2ZTDA 4OX9M 1DGBA 1DO2A 3RFWA 1OJLA 3VFDA 3ZQJA 2L7IA 3TWMA 4GKJM 4TUWA 2UXDM 1IQPA 2QZ4A 2O25A 3HZJA 1WXQA 2KDLA 2R4JA 2W82A 4KO8A 1GL7A 3SARA 4LZZA 4KT0F 3JR5A 3SYLA 1EE8A 1GL6A 4AW4A 4MGHA 3V76A 1QUSA 4YHHM 4M0WA 4JI0M 2OPFA 2CEAA 4GITA 5BPVA 3LQQA 4M9XA 2L09A 1QAMA 4DBGB 3GPXA 1BVSA 3HKPA 4LFAM 1HJPA 3LVVA 5EP3A 2QP9X 5IT9S 1A5TA 3QAUA 3FTCA 3ZH9B 2F5QA 1GJSA 4LZJA 4LRTA 4QHTA 5EXXA 3FUVA 2DWNA 3UGJA 2DAGA 2MROB 4B3RM 4IBFA 4LJ8A 3T1YM 3IHPA 1KSFX 2MJ5B 2QBYA 1G41A 2JP7A 1VQ1A 1D0KA 3EIEA 2FFJA 4FCWA 5DYGA 4B7GA 4LF9M 2Y20A 2RRUA 1E9RA 2LVQD 5ITXA 4HEOA 3U61A 1ZAEA 2D7EA 2OO9A 4F1IA 1R7RA 2CV1A 2CV0A 3J81S 1XWIA 1VDLA 1QZMA 1IM2A 2C96A 2D7GA 2ZTCA 2R44A 4Q7JA 2UU9M 2DHYA 2HKJA 1PGYA 2UUAM 2YR0A 4ANRA 2XZFA 4DR6M 3BOSA 4R3DA 3VDPA 1YUBA 4PDGA 2EKKA 3IG5A 2LXEA 2CUZA 3CGWA 3FRHA 1NHWC 1G71A 1T3TA 3T38A 5FSWA 5ITRA 1NNUC 4RF1A 2J7NA 2QBYB 4CJ6A 3HU1A 3SMSA 1WGNA 2DAKA 2R18A 5A2QS 4M9SA 3U61B 4BLCA 3L26A 4LFCM 2DWLA 2CP8A 4II7A 2F5PA 4AKIA 4LGYA 2Z4SA 1IBMM 4B3SM 1XXHE 1YLAA 2JA2A 1HNZM 3CF0A 1ZQ9A 1PJTA 2KRKA 2R46A 4ZPXA 3HHZA 4BB9A 3FTEA 3M0EA 3L28A 1Z5AA 1IN6A 1Q3CA 1G59A 3K9OA 3FTFA 3GLFE 2AHMA 2RGOA 2EJSA 3Q8XA 4MGKE 2OOAA 2HWJA 5EP1A 3T6PA 4CGYB 5LMNM 2K9DA 1IBKM 4QNRA 2K6BA 1C7YA 3B9PA 1N32M 1HT2E 1NY6A 1VG5A 4F2LA 1GJTA 1TH2A 1WIVA 4IBJA 3RGPA 3W0LB 3SBJA 3E4RA 3HHWA 3GQ3A 2Z4RA 3IG8A 4RNAA 3U6OA 2MR9A 2E5LM 3KOZE 2XFTA 2C9OA 3KFUG 1FNNA 4DR2M 1E94E 3LMMA 4QHSA 3TWLA 2XSZA 3H4MA 4IBCA 4DV2M 2G5GX 2DXIA 4LF7M 2CV2A 1N78A 4L78A 2UUBM 4IJEA 2R6FA 1LV7A 5LMUM 4JI5M 3FTDA 3W68A 2DHRA 4I8OA 3K8ZA 2LH0A 4Y28F 2FE8A 2Y0TA 4QOSA 2WSEF 4JI3M 3JAMS 1TH4A 2JY6B 3D8BA 3C58A 3GRVA 4GHLA 2O01F 5ITQA 1SXJA 2D7HA 4G3OA 4DV6M 3U6MA 1V34A 4I81A 1X37A 5EXSA 4G4RA 3U60A 4Z6YA 1QANA 5JI2E 5KQDA 1XC8A 1J5EM 4FCTA 1UM8A 4YY3M 1FJGM 2EA0A 4PCZA 5C1BA 4AZFA 5FTJA 5DFLA 5BR8M 3U6CA 3B7NA 4HLQA 5IZ7D 3U6DA 2CWBA 1W5TA 3K92A 1TDZA 2O5RA 1XXHB 1PJIA 4DUZM 1DGFA 3KS8A 3HX3A 2DZNB 4DR3M 3FYCA 3B7QA 2LVPC 1SXJB 1QZEA 2H5XA 3J2PB 4I4LA 3R9XB 2ZANA 3A98B 3FRIA 1N77A 3ZC7B 3GLFB 4D82A 5ITXE 8CATA 3FYDA 2JZ1A 3AKZA 3L25A 3HHXA 4MH0E 5E26A 1SXJD 1VEJA 3BBZA 3SHGB 3PXGA 3SAVA 1EFUB 4OVZA 1P3QQ 1MX0A 1PJJA 2HCBA 3I04M 3Q8GA 4B7FA 3UK6A 1OFHA 2Q2EB 3SHFA 4AG6A 2X8AA 1NSFA 1JQJC 2HL7A 1L1TA 3FUUA 3UZUA 1DGGA 4X65M 1R2ZA 4L16A 2DENA 2MGWA 2WSCF 4LRSA 4FWGA 2YNMD 1UFZA 1IN4A 2CHVA 2VQEM 4A3VB 4M9ZA 5GKNA 4LG2A 2LBCA 3LW5F 4AQYM 5KPZA 3DFZA 3I4YA 1AIPC 3HU2A 3LCUA 4OVZB 3HWSA 3I4VA 4IIWA 2OQ4A 3DA1A 5EP4A 2BNKA 4EIWA 3HJSA 3U6EA 3B89A 2R4EA 4P16A 4MGYE 3OTOM 1QUTA 2QPAA 2C98A 3GRUA 2GQFA 4LY6A 1XMQM 3AOEA 3C9PA 3KSJA 4FCVA 5KQ8A 2XFSA 3GPYA 4LF8M 3WHLA 4BBAA 1TGUA 2CE7A 2M60A 2G8LA 1GKIA 2L6OA 2X49A 1W5SA 3KS4A 2YQZA 4DV5M 4CISA 3NWLA 4MGIE 2DVWB 1IXSA 2P5TA 1N33M 5L8RF 1WHCA 3TPZA 4L6V6 2DKLA 2K0BX 3KP0E 2BJWA 3J7BA 2VF8A 2ZAOA 5IREB 1TF0B 4R71A 5IWAM 3GO8A 3CF2A 2J7OA 5FTLA 4K0KM 4X64M 1DO0A 3C3DA 2C5RA 2FNAA 1HNXM 4MM3B 4D80A 1HQCA 3IECA 3I51A 2QNJA 2F5OA 5EP2A 1NHGC 2V6ZM 2EKFA 1SXJE 3FUXA 1G3IA 3M6AA 3VLFB 2CHGA 4JI8M 1OFIA 1AUAA 4DV0M 1IXSB 4JN6A 2A5YB 2BWBA 2GNOA 2KRUA 3KSXA 3MJ5A 5FTNA 2ERCA 3SYKA 1N34M 3FE3A 1ZMWA 1SXJC 5FTMA 2R0IA 4M0DA 1KYIA 1Q02A 1Y8GA 4R7GA 2FOIC 4DR4M 2EUCA 3SATA 1DGHA 3D8LA 3U6QA 3T1HM 2H1RA 4LGMA 3R8FA 3VKHA 4NOOB 2QENA 2F4VM 1D0LA 1IY2A 1J09A 2DAEA 2DNAA 4XGIA 4RKUF 2JY7A 4B3MM 3J7AS 3U5ZA 7CATA 3QYBA 1GLNA 2WSFF 2BWEA 2KHHA 4X66M 3EIHA 4P17A 4I5SA 4ITQA 1OIZA 3L2AA 4DUYM 1QAOA 4LCBA 4NL4H 1TTEA 2VF7A 3KOYE 4KLNA 4S12A 3AFHA 3RE8A 1YE9A 2X4AA 3CF6E 4WURA 1R2YA 1HR0M 1NY5A 2HAKA 4NSOB 1NJFA 5EXTA 5FLXS 3U6LA 2DWMA 2V1UA 4LF5M 2JY5A 1RU3A 1TR8A 3TQSA 1WJ7A 1OAIA 2B3TA 2G3QA 3A42A 4HL4A 3VK7A 3J27B 2FH0A 2Y0QA 1GVNA 2KA6B 3K2LA 2F5SA 2UUCM 3U5ZB 3SAUA 4OW0A 4GKKM 4G4OA 5KO3A 5DYIA 1L2DA 4GHAA 1OTRA 1PJSA 2ZM6M 5ITYA 3SFZA 4PDIA 2LVNC 2YFQA 4PD2A 1IY0A 4RF0A 3THGA 5FTKA 3GPPA 3QWLA 1HNWM 3GLHA 1T43A 4JXJA 4CHTB 4B7HA 1PM5A 3L29A 1OIPA 1VDDA 4GRIA 4DV7M 4W5WA 2JZ0A 4AKGA 3RGSA 1TDHA 1QYRA 4UN2B 1XNRM 2LVAA 4GMQA 4G6ZA 3HU3A 3U60B 1IBLM 3GRYA 3TE6A 1Z5BA 4JI1M 3A46A 1JR3A 3VDUA 2DAMA 2KNZA 1ZV1A 2KNAA 4NXNM 5KPRA 1XB2B 4KODA 2MH8A 1QDTA 4IBBA 1KFVA 1S3SA 1XHBA 3C3EA 1Q39A 5F3WA 5DNYA 1MU5A 3M7GA 4DV3M 3AOEC 3AL0C 2R45A 3L27A 3TWKA 3GLHB 4X62M 2JUJA 2XEPA 2JNHA 2KNVA 2QSFX 4LJ7A 1WR1B 3SMPA 3T15A 4JI2M 1IFYA 4NRWA 4NC6A 3PVSA 3W0FA 3FUTA 3HJQA 2LWXA 3LQRA 1MN3A 2L4EA 1E9SA 2I7PA 2C9CA 1T6OA 3GLGA 1IXZA 2ZAMA 4QOZC 1PRBA 2HHHM 4QNMA 4WW0A 1N75A 3HHYA 2OOBA 4L4UA 3SASA 2L4FA 2LHCA 2CFOA 3ILKA 1GO5A 1JR3D 3WHKA 2Z3XA 1I4WA 2KXEA 3HGIA 4JI4M 1OQYA 4L8RC 1V33A 4AKHA 4B3TM 2QCUA 3GRRA 4LF6M 3DZDA 3KP1E 3KVWA 1K3WA 2JY8A 1R6BX 5EJCA 3CTWB 1OAOC 2F5NA 1ZMUA 4DR1M 1NO1A 4FD2A 3NBIA 1K82A 3GLGB 3W67A 3KW6A 3ZCBB 2WZJA 3GLIA 1IN8A 2LHGA 1GABA 2L2DA 3K1JA 4OU7A 4DR5M 3U6SA 4GC5A 3GQ5A 4GH9A 3E9SA 1IN5A 3JR4A 4FVMA 1EIJA 2KEBA 1VEGA 4GIPA 3BXWA 1HQYE 4JYAM 3GQ4A 4FWDA 1D0MA 2XF3A 2XLJA 3F92A 4MGZE 2LTUA 4NRVA 1D2NA 1VEKA 1MJGM 1QDRA 1R4GA 5C18A 4DR7M 4FW9A 2CHQA 2ZBKB 2XZUA 3B7ZA 2DWZB 3AJIB 2M5ZA 3NBXX 3GLIB 1IN7A 2V1CA 1IXRC 1I94M 3B74A 3KXEC 1LTMA 2XH9A 3AV0A 4CIZA 2KZUA 3HJ8A 3SC3A 1NJGA 4D81A 4PT5A 5ITTA 4NXMM 3FKEA 2L7HA 4AI6A 1L2CA 4LJ4A 2RKOA 2R65A 1Z6TA 3MHVC 5JI3E 2RGHA 4IBIA 2DZOB 2LVOC 3GLHE 1QAQA 3K9PA 4AG5A 4KHPM 3QYEA 3TL4X 4IJFA 3J80S 2KW0A 1R5LA 2UXBM 1JB0F 4LJAA 3PNVA 1HT1E 1F4IA 1G4AE 4Z8XA 4FWHA 1V92A 4LJ5A 4JI7M 1XNQM 1NV8A 3UJNA 4LF4M 1JR3E 5KPTA 1XMOM 3H4JA 3MK6A 2J5YA 3MMPA 1L2BA 1ORYB 2I7NA 4XK8F 4JI6M 4WP2A 4GEWA 1NVMA 1DGHB 1SG9A 2DAIA 3FUWA 2VQFM 4DV1M 4IBKA 4IBDA 5EQTA 2XGNA 1QQWA 3AOGA 3KOXE 5H37D 3LCVB 2LNHC 2APLA 5E6JA 2DI0A 1L8QA 1NV9A 3U6PA 1Z5CA
chains in the Genus database with same CATH topology
2Z7JA 4MB7A 3VK8A 2VIIA 3DOAA 2C99A 4XBOA 1XXHA 4G4NA 2KZSA 3A45A 4IBEA 1H6UA 3KDSE 2UXCM 1IY1A 1Q3BA 3GLFA 5ITUA 4NSRA 2EO2A 1J7KA 4REZA 3KOWE 2Y21A 1NNJA 4IBGA 4B08A 4DV4M 4LFBM 3SAWA 1G8PA 2XSZD 4GC9A 3PFIA 1E32A 1QVRA 1YSYA 1L1ZA 4JV5M 2NQ8C 4LJ6A 3FD9A 3VKGA 3GP1A 1C1KA 2R62A 5EXPA 4L15A 4G4QA 4LJ9A 1K3XA 3LVWA 1Z59A 3GPUA 2BJVA 3UMMA 1N36M 2K47A 3PNYA 1TH3A 4OX9M 1DGBA 1DO2A 3RFWA 1OJLA 3VFDA 2L7IA 3TWMA 4GKJM 4TUWA 2UXDM 1IQPA 2QZ4A 1WXQA 2R4JA 2W82A 4KO8A 1GL7A 3SARA 4LZZA 3JR5A 3SYLA 1EE8A 1GL6A 4AW4A 4MGHA 4YHHM 4M0WA 4JI0M 2OPFA 2CEAA 4GITA 5BPVA 3LQQA 4M9XA 2L09A 1QAMA 3GPXA 3HKPA 4LFAM 3LVVA 5EP3A 2QP9X 5IT9S 3QAUA 3FTCA 3ZH9B 2F5QA 4LZJA 4LRTA 4QHTA 5EXXA 3FUVA 2DWNA 3UGJA 4B3RM 4IBFA 4LJ8A 3T1YM 1KSFX 2QBYA 1G41A 3EIEA 4FCWA 5DYGA 2FFJA 4B7GA 4LF9M 2Y20A 1E9RA 5ITXA 3U61A 1ZAEA 2D7EA 1R7RA 2CV1A 2CV0A 3J81S 1XWIA 1QZMA 1IM2A 2C96A 2D7GA 2UU9M 2HKJA 2UUAM 2YR0A 2XZFA 4DR6M 3BOSA 4R3DA 3VDPA 1YUBA 4PDGA 3IG5A 2LXEA 2CUZA 5FSWA 1NHWC 3T38A 1T3TA 5ITRA 1NNUC 4RF1A 2J7NA 2QBYB 3HU1A 3SMSA 5A2QS 2R18A 4M9SA 3U61B 4BLCA 3L26A 4LFCM 2DWLA 4II7A 4AKIA 2F5PA 4LGYA 2Z4SA 1IBMM 4B3SM 2JA2A 1HNZM 3CF0A 1ZQ9A 2KRKA 2R46A 4ZPXA 3HHZA 4BB9A 3FTEA 3M0EA 3L28A 1Z5AA 1IN6A 1Q3CA 1G59A 3FTFA 2AHMA 2RGOA 3Q8XA 4MGKE 5EP1A 4CGYB 5LMNM 1KFVA 1I94M 1IBKM 2DWMA 4QNRA 3B9PA 1N32M 1HT2E 1NY6A 3W0LB 1TH2A 4IBJA 3SBJA 3RGPA 3E4RA 3HHWA 3GQ3A 2Z4RA 3IG8A 4RNAA 3U6OA 2E5LM 3KOZE 2XFTA 2C9OA 3KFUG 1FNNA 4DR2M 1E94E 3LMMA 4QHSA 3TWLA 2XSZA 3H4MA 4IBCA 4DV2M 2G5GX 2DXIA 4LF7M 2CV2A 1N78A 4L78A 2UUBM 4IJEA 1LV7A 5LMUM 4JI5M 3FTDA 2DHRA 4I8OA 3K8ZA 2LH0A 2FE8A 2Y0TA 4QOSA 3JAMS 4JI3M 1TH4A 3D8BA 3C58A 3GRVA 4GHLA 5ITQA 1SXJA 2D7HA 3U6MA 4DV6M 4I81A 1X37A 4G4RA 3U60A 1XC8A 4Z6YA 1QANA 5JI2E 5KQDA 1J5EM 4FCTA 1UM8A 4YY3M 1FJGM 2EA0A 4PCZA 5C1BA 4AZFA 5FTJA 5BR8M 3U6CA 4HLQA 5IZ7D 3U6DA 1W5TA 3K92A 1TDZA 2O5RA 1XXHB 1PJIA 4DUZM 1DGFA 3KS8A 2DZNB 4DR3M 3FYCA 1SXJB 3J2PB 4I4LA 3R9XB 2ZANA 3A98B 1N77A 3ZC7B 3GLFB 4D82A 5ITXE 8CATA 3FYDA 3AKZA 3L25A 3HHXA 4MH0E 5E26A 1SXJD 3SHGB 3SAVA 1PJJA 3PXGA 4OVZA 1MX0A 2HCBA 4B7FA 3UK6A 1OFHA 2Q2EB 3SHFA 4AG6A 2X8AA 1NSFA 1JQJC 2HL7A 1L1TA 3FUUA 3UZUA 1DGGA 4X65M 1R2ZA 4L16A 4LRSA 4FWGA 2YNMD 1IN4A 2CHVA 2VQEM 4A3VB 4M9ZA 5GKNA 4LG2A 4AQYM 5KPZA 3DFZA 3I4YA 3HU2A 4OVZB 3HWSA 3I4VA 4IIWA 2OQ4A 3DA1A 5EP4A 2BNKA 4EIWA 3HJSA 3U6EA 2R4EA 4P16A 4MGYE 3OTOM 2QPAA 2C98A 3GRUA 4LY6A 1XMQM 3AOEA 3KSJA 4FCVA 5KQ8A 2XFSA 3GPYA 4LF8M 3WHLA 4BBAA 1TGUA 2CE7A 2M60A 2G8LA 1GKIA 2L6OA 2X49A 1W5SA 3KS4A 2YQZA 4DV5M 4CISA 3NWLA 4MGIE 2DVWB 2P5TA 1N33M 3TPZA 3KP0E 2BJWA 3J7BA 2ZAOA 5IWAM 5IREB 3GO8A 3CF2A 2J7OA 5FTLA 4K0KM 4X64M 1DO0A 2C5RA 1HNXM 2FNAA 4MM3B 4D80A 1HQCA 3I51A 2F5OA 5EP2A 1NHGC 2V6ZM 1SXJE 3FUXA 1G3IA 3M6AA 3VLFB 2CHGA 4JI8M 1OFIA 4DV0M 1IXSB 4JN6A 2A5YB 2KRUA 3KSXA 3MJ5A 3SYKA 5FTNA 2ERCA 1N34M 1SXJC 5FTMA 4M0DA 1KYIA 4R7GA 2FOIC 4DR4M 2EUCA 3SATA 1DGHA 3D8LA 3U6QA 3T1HM 2H1RA 4LGMA 3R8FA 3VKHA 4NOOB 2QENA 2F4VM 1IY2A 1J09A 4XGIA 4B3MM 3J7AS 3U5ZA 7CATA 1GLNA 4X66M 3EIHA 4I5SA 4ITQA 3L2AA 4DUYM 1QAOA 4LCBA 4NL4H 3KOYE 4KLNA 4S12A 3AFHA 3RE8A 1YE9A 2X4AA 3CF6E 4WURA 1R2YA 1HR0M 1NY5A 4NSOB 1NJFA 5EXTA 5FLXS 3U6LA 2V1UA 4LF5M 3TQSA 3A42A 4HL4A 3VK7A 3J27B 2Y0QA 1GVNA 2KA6B 3K2LA 2F5SA 2UUCM 3U5ZB 3SAUA 4OW0A 4GKKM 4G4OA 5KO3A 5DYIA 1L2DA 4GHAA 2ZM6M 5ITYA 3SFZA 4PDIA 2YFQA 4PD2A 1IY0A 4RF0A 3THGA 5FTKA 3GPPA 3QWLA 1HNWM 3GLHA 4JXJA 4CHTB 4B7HA 1PM5A 3L29A 1VDDA 4GRIA 4DV7M 4W5WA 4AKGA 3RGSA 1TDHA 1QYRA 1XNRM 4GMQA 4G6ZA 3HU3A 3U60B 1IBLM 3GRYA 3TE6A 1Z5BA 4JI1M 3A46A 1JR3A 3VDUA 5KPRA 4NXNM 4KODA 4IBBA 1S3SA 1XHBA 1Q39A 5F3WA 5DNYA 1MU5A 3M7GA 4DV3M 3AOEC 3AL0C 2R45A 3L27A 3TWKA 3GLHB 4X62M 2XEPA 4LJ7A 3SMPA 3T15A 4JI2M 4NRWA 3PVSA 3W0FA 3FUTA 3HJQA 2LWXA 3LQRA 1E9SA 2I7PA 2C9CA 3GLGA 1IXZA 2ZAMA 4QOZC 2HHHM 4QNMA 4WW0A 1N75A 3HHYA 4L4UA 3SASA 2CFOA 3ILKA 1JR3D 3WHKA 2Z3XA 1I4WA 2KXEA 3HGIA 4JI4M 4L8RC 4AKHA 4B3TM 2QCUA 3GRRA 4LF6M 3DZDA 3KP1E 3KVWA 1K3WA 1R6BX 5EJCA 3CTWB 2F5NA 4DR1M 4FD2A 3NBIA 1K82A 3GLGB 3KW6A 3ZCBB 3GLIA 1IN8A 3K1JA 4OU7A 4DR5M 3U6SA 4GC5A 3GQ5A 4GH9A 3E9SA 1IN5A 3JR4A 4FVMA 2KEBA 4GIPA 1HQYE 4JYAM 3GQ4A 4FWDA 2XF3A 2XLJA 4MGZE 4NRVA 1D2NA 5C18A 4DR7M 4FW9A 2CHQA 2ZBKB 2XZUA 2DWZB 3AJIB 2M5ZA 3GLIB 1IN7A 2V1CA 1IXRC 3KXEC 2XH9A 3AV0A 2KZUA 3HJ8A 3SC3A 1NJGA 4D81A 4PT5A 5ITTA 4NXMM 3FKEA 2L7HA 4AI6A 1L2CA 4LJ4A 2RKOA 2R65A 1Z6TA 3MHVC 5JI3E 2RGHA 4IBIA 2DZOB 1QAQA 4AG5A 4KHPM 3TL4X 4IJFA 3J80S 2KW0A 2UXBM 4LJAA 3PNVA 1HT1E 1G4AE 4Z8XA 4FWHA 4LJ5A 4JI7M 1XNQM 3UJNA 4LF4M 5KPTA 1XMOM 3MK6A 1L2BA 1ORYB 2I7NA 4JI6M 1NVMA 1DGHB 3FUWA 2VQFM 4DV1M 4IBKA 4IBDA 5EQTA 2XGNA 1QQWA 3AOGA 3KOXE 5H37D 2LNHC 5E6JA 5EXSA 1L8QA 3U6PA 1Z5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MB7 A;  1MU5 A;  4DV3 M;  3VK8 A;  1XMQ M;  3DOA A;  3TWK A;  4X62 M;  1Z5A A;  1Q3C A;  3GPY A;  4JI2 M;  4LF8 M;  4G4N A;  1KFV A;  5LMN M;  1I94 M;  4NRW A;  3W0F A;  1IBK M;  3A45 A;  1N32 M;  4DV5 M;  4CIS A;  2UXC M;  3SBJ A;  1N33 M;  1Q3B A;  2HHH M;  3GQ3 A;  5ITU A;  3U6O A;  2E5L M;  3SAS A;  1NNJ A;  5IWA M;  4DR2 M;  3GO8 A;  4DV4 M;  3TWL A;  4JI4 M;  4LFB M;  3SAW A;  4B3T M;  4X64 M;  4LF6 M;  4K0K M;  4DV2 M;  1HNX M;  4LF7 M;  1K3W A;  1L1Z A;  4JV5 M;  2UUB M;  2F5O A;  5LMU M;  4JI5 M;  2F5N A;  4DR1 M;  3GP1 A;  4G4Q A;  4JI8 M;  1K82 A;  1K3X A;  4DV0 M;  1Z59 A;  3GPU A;  1N36 M;  3JAM S;  4JI3 M;  1N34 M;  4OX9 M;  3C58 A;  5ITQ A;  4DR5 M;  3U6S A;  4DR4 M;  3U6M A;  4DV6 M;  3TWM A;  3SAT A;  3GQ5 A;  4GKJ M;  2UXD M;  4G4R A;  3U6Q A;  3T1H M;  1XC8 A;  3JR4 A;  1J5E M;  4YY3 M;  1FJG M;  2F4V M;  2EA0 A;  4PCZ A;  4JYA M;  3GQ4 A;  4B3M M;  3J7A S;  3SAR A;  3JR5 A;  4X66 M;  4NRV A;  1EE8 A;  5BR8 M;  3U6C A;  4ITQ A;  4DUY M;  4YHH M;  2OPF A;  4JI0 M;  4DR7 M;  3U6D A;  2ZBK B;  1TDZ A;  1PJI A;  4DUZ M;  2XZU A;  3GPX A;  4DR3 M;  4LFA M;  1R2Y A;  1HR0 M;  5IT9 S;  3U6L A;  5FLX S;  2F5Q A;  5ITX E;  4LF5 M;  5ITT A;  3A42 A;  3SAV A;  4NXM M;  1PJJ A;  3VK7 A;  4B3R M;  1L2C A;  3T1Y M;  1MX0 A;  2UUC M;  2F5S A;  3SAU A;  4LF9 M;  2Q2E B;  4GKK M;  5ITX A;  4G4O A;  4KHP M;  1L2D A;  1L1T A;  3J80 S;  2ZM6 M;  4X65 M;  1R2Z A;  2UXB M;  5ITY A;  3J81 S;  4PDI A;  4PD2 A;  2UU9 M;  3GPP A;  2VQE M;  1HNW M;  2HKJ A;  2UUA M;  4JI7 M;  1XNQ M;  1PM5 A;  2XZF A;  4LF4 M;  4DR6 M;  4AQY M;  4DV7 M;  4PDG A;  1XMO M;  1L2B A;  1TDH A;  1XNR M;  2OQ4 A;  5ITR A;  4JI6 M;  2VQF M;  4DV1 M;  1IBL M;  1Z5B A;  4JI1 M;  5A2Q S;  3A46 A;  3U6E A;  4LFC M;  4NXN M;  2F5P A;  3OTO M;  1IBM M;  4B3S M;  1HNZ M;  1Q39 A;  3U6P A;  1Z5C A; 
#chains in the Genus database with same CATH topology
 1ZMV A;  2JXN A;  2Z7J A;  4MB7 A;  3VK8 A;  2VII A;  3DOA A;  3GLG E;  3E46 A;  2C99 A;  2DZL A;  1WGL A;  4XBO A;  1XXH A;  4G4N A;  2KZS A;  1PJQ A;  3A45 A;  3I01 M;  4IBE A;  2CRU A;  1H6U A;  3HY5 A;  3KDS E;  2UXC M;  1IY1 A;  2Z8Y M;  1Q3B A;  1DV0 A;  3E21 A;  3GLF A;  5ITU A;  2VDB B;  2EO2 A;  1J7K A;  4NSR A;  4REZ A;  3KOW E;  2Y21 A;  1NNJ A;  2FS1 A;  4IBG A;  4B08 A;  4DV4 M;  4LFB M;  1CUK A;  2JWS A;  3SAW A;  1G8P A;  2XSZ D;  4GC9 A;  2QQ8 A;  3PFI A;  1OKS A;  2QHO B;  1E32 A;  1QVR A;  1YSY A;  1L1Z A;  4JV5 M;  3GLI E;  2NQ8 C;  4LJ6 A;  3FD9 A;  3VKG A;  3GP1 A;  1C1K A;  2R62 A;  5EXP A;  4L15 A;  4G4Q A;  4LJ9 A;  1K3X A;  3LVW A;  2N35 A;  1Z59 A;  3GPU A;  2BJV A;  3UMM A;  1N36 M;  2K47 A;  3PNY A;  1TH3 A;  2ZTD A;  4OX9 M;  1DGB A;  1DO2 A;  3RFW A;  1OJL A;  3VFD A;  3ZQJ A;  2L7I A;  3TWM A;  4GKJ M;  4TUW A;  2UXD M;  1IQP A;  2QZ4 A;  2O25 A;  3HZJ A;  1WXQ A;  2KDL A;  2R4J A;  2W82 A;  4KO8 A;  1GL7 A;  3SAR A;  4LZZ A;  4KT0 F;  3JR5 A;  3SYL A;  1EE8 A;  1GL6 A;  4AW4 A;  4MGH A;  3V76 A;  1QUS A;  4YHH M;  4M0W A;  4JI0 M;  2OPF A;  2CEA A;  4GIT A;  5BPV A;  3LQQ A;  4M9X A;  2L09 A;  1QAM A;  4DBG B;  3GPX A;  1BVS A;  3HKP A;  4LFA M;  1HJP A;  3LVV A;  5EP3 A;  2QP9 X;  5IT9 S;  1A5T A;  3QAU A;  3FTC A;  3ZH9 B;  2F5Q A;  1GJS A;  4LZJ A;  4LRT A;  4QHT A;  5EXX A;  3FUV A;  2DWN A;  3UGJ A;  2DAG A;  2MRO B;  4B3R M;  4IBF A;  4LJ8 A;  3T1Y M;  3IHP A;  1KSF X;  2MJ5 B;  2QBY A;  1G41 A;  2JP7 A;  1VQ1 A;  1D0K A;  3EIE A;  2FFJ A;  4FCW A;  5DYG A;  4B7G A;  4LF9 M;  2Y20 A;  2RRU A;  1E9R A;  2LVQ D;  5ITX A;  4HEO A;  3U61 A;  1ZAE A;  2D7E A;  2OO9 A;  4F1I A;  1R7R A;  2CV1 A;  2CV0 A;  3J81 S;  1XWI A;  1VDL A;  1QZM A;  1IM2 A;  2C96 A;  2D7G A;  2ZTC A;  2R44 A;  4Q7J A;  2UU9 M;  2DHY A;  2HKJ A;  1PGY A;  2UUA M;  2YR0 A;  4ANR A;  2XZF A;  4DR6 M;  3BOS A;  4R3D A;  3VDP A;  1YUB A;  4PDG A;  2EKK A;  3IG5 A;  2LXE A;  2CUZ A;  3CGW A;  3FRH A;  1NHW C;  1G71 A;  1T3T A;  3T38 A;  5FSW A;  5ITR A;  1NNU C;  4RF1 A;  2J7N A;  2QBY B;  4CJ6 A;  3HU1 A;  3SMS A;  1WGN A;  2DAK A;  2R18 A;  5A2Q S;  4M9S A;  3U61 B;  4BLC A;  3L26 A;  4LFC M;  2DWL A;  2CP8 A;  4II7 A;  2F5P A;  4AKI A;  4LGY A;  2Z4S A;  1IBM M;  4B3S M;  1XXH E;  1YLA A;  2JA2 A;  1HNZ M;  3CF0 A;  1ZQ9 A;  1PJT A;  2KRK A;  2R46 A;  4ZPX A;  3HHZ A;  4BB9 A;  3FTE A;  3M0E A;  3L28 A;  1Z5A A;  1IN6 A;  1Q3C A;  1G59 A;  3K9O A;  3FTF A;  3GLF E;  2AHM A;  2RGO A;  2EJS A;  3Q8X A;  4MGK E;  2OOA A;  2HWJ A;  5EP1 A;  3T6P A;  4CGY B;  5LMN M;  2K9D A;  1IBK M;  4QNR A;  2K6B A;  1C7Y A;  3B9P A;  1N32 M;  1HT2 E;  1NY6 A;  1VG5 A;  4F2L A;  1GJT A;  1TH2 A;  1WIV A;  4IBJ A;  3RGP A;  3W0L B;  3SBJ A;  3E4R A;  3HHW A;  3GQ3 A;  2Z4R A;  3IG8 A;  4RNA A;  3U6O A;  2MR9 A;  2E5L M;  3KOZ E;  2XFT A;  2C9O A;  3KFU G;  1FNN A;  4DR2 M;  1E94 E;  3LMM A;  4QHS A;  3TWL A;  2XSZ A;  3H4M A;  4IBC A;  4DV2 M;  2G5G X;  2DXI A;  4LF7 M;  2CV2 A;  1N78 A;  4L78 A;  2UUB M;  4IJE A;  2R6F A;  1LV7 A;  5LMU M;  4JI5 M;  3FTD A;  3W68 A;  2DHR A;  4I8O A;  3K8Z A;  2LH0 A;  4Y28 F;  2FE8 A;  2Y0T A;  4QOS A;  2WSE F;  4JI3 M;  3JAM S;  1TH4 A;  2JY6 B;  3D8B A;  3C58 A;  3GRV A;  4GHL A;  2O01 F;  5ITQ A;  1SXJ A;  2D7H A;  4G3O A;  4DV6 M;  3U6M A;  1V34 A;  4I81 A;  1X37 A;  5EXS A;  4G4R A;  3U60 A;  4Z6Y A;  1QAN A;  5JI2 E;  5KQD A;  1XC8 A;  1J5E M;  4FCT A;  1UM8 A;  4YY3 M;  1FJG M;  2EA0 A;  4PCZ A;  5C1B A;  4AZF A;  5FTJ A;  5DFL A;  5BR8 M;  3U6C A;  3B7N A;  4HLQ A;  5IZ7 D;  3U6D A;  2CWB A;  1W5T A;  3K92 A;  1TDZ A;  2O5R A;  1XXH B;  1PJI A;  4DUZ M;  1DGF A;  3KS8 A;  3HX3 A;  2DZN B;  4DR3 M;  3FYC A;  3B7Q A;  2LVP C;  1SXJ B;  1QZE A;  2H5X A;  3J2P B;  4I4L A;  3R9X B;  2ZAN A;  3A98 B;  3FRI A;  1N77 A;  3ZC7 B;  3GLF B;  4D82 A;  5ITX E;  8CAT A;  3FYD A;  2JZ1 A;  3AKZ A;  3L25 A;  3HHX A;  4MH0 E;  5E26 A;  1SXJ D;  1VEJ A;  3BBZ A;  3SHG B;  3PXG A;  3SAV A;  1EFU B;  4OVZ A;  1P3Q Q;  1MX0 A;  1PJJ A;  2HCB A;  3I04 M;  3Q8G A;  4B7F A;  3UK6 A;  1OFH A;  2Q2E B;  3SHF A;  4AG6 A;  2X8A A;  1NSF A;  1JQJ C;  2HL7 A;  1L1T A;  3FUU A;  3UZU A;  1DGG A;  4X65 M;  1R2Z A;  4L16 A;  2DEN A;  2MGW A;  2WSC F;  4LRS A;  4FWG A;  2YNM D;  1UFZ A;  1IN4 A;  2CHV A;  2VQE M;  4A3V B;  4M9Z A;  5GKN A;  4LG2 A;  2LBC A;  3LW5 F;  4AQY M;  5KPZ A;  3DFZ A;  3I4Y A;  1AIP C;  3HU2 A;  3LCU A;  4OVZ B;  3HWS A;  3I4V A;  4IIW A;  2OQ4 A;  3DA1 A;  5EP4 A;  2BNK A;  4EIW A;  3HJS A;  3U6E A;  3B89 A;  2R4E A;  4P16 A;  4MGY E;  3OTO M;  1QUT A;  2QPA A;  2C98 A;  3GRU A;  2GQF A;  4LY6 A;  1XMQ M;  3AOE A;  3C9P A;  3KSJ A;  4FCV A;  5KQ8 A;  2XFS A;  3GPY A;  4LF8 M;  3WHL A;  4BBA A;  1TGU A;  2CE7 A;  2M60 A;  2G8L A;  1GKI A;  2L6O A;  2X49 A;  1W5S A;  3KS4 A;  2YQZ A;  4DV5 M;  4CIS A;  3NWL A;  4MGI E;  2DVW B;  1IXS A;  2P5T A;  1N33 M;  5L8R F;  1WHC A;  3TPZ A;  4L6V 6;  2DKL A;  2K0B X;  3KP0 E;  2BJW A;  3J7B A;  2VF8 A;  2ZAO A;  5IRE B;  1TF0 B;  4R71 A;  5IWA M;  3GO8 A;  3CF2 A;  2J7O A;  5FTL A;  4K0K M;  4X64 M;  1DO0 A;  3C3D A;  2C5R A;  2FNA A;  1HNX M;  4MM3 B;  4D80 A;  1HQC A;  3IEC A;  3I51 A;  2QNJ A;  2F5O A;  5EP2 A;  1NHG C;  2V6Z M;  2EKF A;  1SXJ E;  3FUX A;  1G3I A;  3M6A A;  3VLF B;  2CHG A;  4JI8 M;  1OFI A;  1AUA A;  4DV0 M;  1IXS B;  4JN6 A;  2A5Y B;  2BWB A;  2GNO A;  2KRU A;  3KSX A;  3MJ5 A;  5FTN A;  2ERC A;  3SYK A;  1N34 M;  3FE3 A;  1ZMW A;  1SXJ C;  5FTM A;  2R0I A;  4M0D A;  1KYI A;  1Q02 A;  1Y8G A;  4R7G A;  2FOI C;  4DR4 M;  2EUC A;  3SAT A;  1DGH A;  3D8L A;  3U6Q A;  3T1H M;  2H1R A;  4LGM A;  3R8F A;  3VKH A;  4NOO B;  2QEN A;  2F4V M;  1D0L A;  1IY2 A;  1J09 A;  2DAE A;  2DNA A;  4XGI A;  4RKU F;  2JY7 A;  4B3M M;  3J7A S;  3U5Z A;  7CAT A;  3QYB A;  1GLN A;  2WSF F;  2BWE A;  2KHH A;  4X66 M;  3EIH A;  4P17 A;  4I5S A;  4ITQ A;  1OIZ A;  3L2A A;  4DUY M;  1QAO A;  4LCB A;  4NL4 H;  1TTE A;  2VF7 A;  3KOY E;  4KLN A;  4S12 A;  3AFH A;  3RE8 A;  1YE9 A;  2X4A A;  3CF6 E;  4WUR A;  1R2Y A;  1HR0 M;  1NY5 A;  2HAK A;  4NSO B;  1NJF A;  5EXT A;  5FLX S;  3U6L A;  2DWM A;  2V1U A;  4LF5 M;  2JY5 A;  1RU3 A;  1TR8 A;  3TQS A;  1WJ7 A;  1OAI A;  2B3T A;  2G3Q A;  3A42 A;  4HL4 A;  3VK7 A;  3J27 B;  2FH0 A;  2Y0Q A;  1GVN A;  2KA6 B;  3K2L A;  2F5S A;  2UUC M;  3U5Z B;  3SAU A;  4OW0 A;  4GKK M;  4G4O A;  5KO3 A;  5DYI A;  1L2D A;  4GHA A;  1OTR A;  1PJS A;  2ZM6 M;  5ITY A;  3SFZ A;  4PDI A;  2LVN C;  2YFQ A;  4PD2 A;  1IY0 A;  4RF0 A;  3THG A;  5FTK A;  3GPP A;  3QWL A;  1HNW M;  3GLH A;  1T43 A;  4JXJ A;  4CHT B;  4B7H A;  1PM5 A;  3L29 A;  1OIP A;  1VDD A;  4GRI A;  4DV7 M;  4W5W A;  2JZ0 A;  4AKG A;  3RGS A;  1TDH A;  1QYR A;  4UN2 B;  1XNR M;  2LVA A;  4GMQ A;  4G6Z A;  3HU3 A;  3U60 B;  1IBL M;  3GRY A;  3TE6 A;  1Z5B A;  4JI1 M;  3A46 A;  1JR3 A;  3VDU A;  2DAM A;  2KNZ A;  1ZV1 A;  2KNA A;  4NXN M;  5KPR A;  1XB2 B;  4KOD A;  2MH8 A;  1QDT A;  4IBB A;  1KFV A;  1S3S A;  1XHB A;  3C3E A;  1Q39 A;  5F3W A;  5DNY A;  1MU5 A;  3M7G A;  4DV3 M;  3AOE C;  3AL0 C;  2R45 A;  3L27 A;  3TWK A;  3GLH B;  4X62 M;  2JUJ A;  2XEP A;  2JNH A;  2KNV A;  2QSF X;  4LJ7 A;  1WR1 B;  3SMP A;  3T15 A;  4JI2 M;  1IFY A;  4NRW A;  4NC6 A;  3PVS A;  3W0F A;  3FUT A;  3HJQ A;  2LWX A;  3LQR A;  1MN3 A;  2L4E A;  1E9S A;  2I7P A;  2C9C A;  1T6O A;  3GLG A;  1IXZ A;  2ZAM A;  4QOZ C;  1PRB A;  2HHH M;  4QNM A;  4WW0 A;  1N75 A;  3HHY A;  2OOB A;  4L4U A;  3SAS A;  2L4F A;  2LHC A;  2CFO A;  3ILK A;  1GO5 A;  1JR3 D;  3WHK A;  2Z3X A;  1I4W A;  2KXE A;  3HGI A;  4JI4 M;  1OQY A;  4L8R C;  1V33 A;  4AKH A;  4B3T M;  2QCU A;  3GRR A;  4LF6 M;  3DZD A;  3KP1 E;  3KVW A;  1K3W A;  2JY8 A;  1R6B X;  5EJC A;  3CTW B;  1OAO C;  2F5N A;  1ZMU A;  4DR1 M;  1NO1 A;  4FD2 A;  3NBI A;  1K82 A;  3GLG B;  3W67 A;  3KW6 A;  3ZCB B;  2WZJ A;  3GLI A;  1IN8 A;  2LHG A;  1GAB A;  2L2D A;  3K1J A;  4OU7 A;  4DR5 M;  3U6S A;  4GC5 A;  3GQ5 A;  4GH9 A;  3E9S A;  1IN5 A;  3JR4 A;  4FVM A;  1EIJ A;  2KEB A;  1VEG A;  4GIP A;  3BXW A;  1HQY E;  4JYA M;  3GQ4 A;  4FWD A;  1D0M A;  2XF3 A;  2XLJ A;  3F92 A;  4MGZ E;  2LTU A;  4NRV A;  1D2N A;  1VEK A;  1MJG M;  1QDR A;  1R4G A;  5C18 A;  4DR7 M;  4FW9 A;  2CHQ A;  2ZBK B;  2XZU A;  3B7Z A;  2DWZ B;  3AJI B;  2M5Z A;  3NBX X;  3GLI B;  1IN7 A;  2V1C A;  1IXR C;  1I94 M;  3B74 A;  3KXE C;  1LTM A;  2XH9 A;  3AV0 A;  4CIZ A;  2KZU A;  3HJ8 A;  3SC3 A;  1NJG A;  4D81 A;  4PT5 A;  5ITT A;  4NXM M;  3FKE A;  2L7H A;  4AI6 A;  1L2C A;  4LJ4 A;  2RKO A;  2R65 A;  1Z6T A;  3MHV C;  5JI3 E;  2RGH A;  4IBI A;  2DZO B;  2LVO C;  3GLH E;  1QAQ A;  3K9P A;  4AG5 A;  4KHP M;  3QYE A;  3TL4 X;  4IJF A;  3J80 S;  2KW0 A;  1R5L A;  2UXB M;  1JB0 F;  4LJA A;  3PNV A;  1HT1 E;  1F4I A;  1G4A E;  4Z8X A;  4FWH A;  1V92 A;  4LJ5 A;  4JI7 M;  1XNQ M;  1NV8 A;  3UJN A;  4LF4 M;  1JR3 E;  5KPT A;  1XMO M;  3H4J A;  3MK6 A;  2J5Y A;  3MMP A;  1L2B A;  1ORY B;  2I7N A;  4XK8 F;  4JI6 M;  4WP2 A;  4GEW A;  1NVM A;  1DGH B;  1SG9 A;  2DAI A;  3FUW A;  2VQF M;  4DV1 M;  4IBK A;  4IBD A;  5EQT A;  2XGN A;  1QQW A;  3AOG A;  3KOX E;  5H37 D;  3LCV B;  2LNH C;  2APL A;  5E6J A;  2DI0 A;  1L8Q A;  1NV9 A;  3U6P A;  1Z5C A; 
#chains in the Genus database with same CATH homology
 2Z7J A;  4MB7 A;  3VK8 A;  2VII A;  3DOA A;  2C99 A;  4XBO A;  1XXH A;  4G4N A;  2KZS A;  3A45 A;  4IBE A;  1H6U A;  3KDS E;  2UXC M;  1IY1 A;  1Q3B A;  3GLF A;  5ITU A;  4NSR A;  2EO2 A;  1J7K A;  4REZ A;  3KOW E;  2Y21 A;  1NNJ A;  4IBG A;  4B08 A;  4DV4 M;  4LFB M;  3SAW A;  1G8P A;  2XSZ D;  4GC9 A;  3PFI A;  1E32 A;  1QVR A;  1YSY A;  1L1Z A;  4JV5 M;  2NQ8 C;  4LJ6 A;  3FD9 A;  3VKG A;  3GP1 A;  1C1K A;  2R62 A;  5EXP A;  4L15 A;  4G4Q A;  4LJ9 A;  1K3X A;  3LVW A;  1Z59 A;  3GPU A;  2BJV A;  3UMM A;  1N36 M;  2K47 A;  3PNY A;  1TH3 A;  4OX9 M;  1DGB A;  1DO2 A;  3RFW A;  1OJL A;  3VFD A;  2L7I A;  3TWM A;  4GKJ M;  4TUW A;  2UXD M;  1IQP A;  2QZ4 A;  1WXQ A;  2R4J A;  2W82 A;  4KO8 A;  1GL7 A;  3SAR A;  4LZZ A;  3JR5 A;  3SYL A;  1EE8 A;  1GL6 A;  4AW4 A;  4MGH A;  4YHH M;  4M0W A;  4JI0 M;  2OPF A;  2CEA A;  4GIT A;  5BPV A;  3LQQ A;  4M9X A;  2L09 A;  1QAM A;  3GPX A;  3HKP A;  4LFA M;  3LVV A;  5EP3 A;  2QP9 X;  5IT9 S;  3QAU A;  3FTC A;  3ZH9 B;  2F5Q A;  4LZJ A;  4LRT A;  4QHT A;  5EXX A;  3FUV A;  2DWN A;  3UGJ A;  4B3R M;  4IBF A;  4LJ8 A;  3T1Y M;  1KSF X;  2QBY A;  1G41 A;  3EIE A;  4FCW A;  5DYG A;  2FFJ A;  4B7G A;  4LF9 M;  2Y20 A;  1E9R A;  5ITX A;  3U61 A;  1ZAE A;  2D7E A;  1R7R A;  2CV1 A;  2CV0 A;  3J81 S;  1XWI A;  1QZM A;  1IM2 A;  2C96 A;  2D7G A;  2UU9 M;  2HKJ A;  2UUA M;  2YR0 A;  2XZF A;  4DR6 M;  3BOS A;  4R3D A;  3VDP A;  1YUB A;  4PDG A;  3IG5 A;  2LXE A;  2CUZ A;  5FSW A;  1NHW C;  3T38 A;  1T3T A;  5ITR A;  1NNU C;  4RF1 A;  2J7N A;  2QBY B;  3HU1 A;  3SMS A;  5A2Q S;  2R18 A;  4M9S A;  3U61 B;  4BLC A;  3L26 A;  4LFC M;  2DWL A;  4II7 A;  4AKI A;  2F5P A;  4LGY A;  2Z4S A;  1IBM M;  4B3S M;  2JA2 A;  1HNZ M;  3CF0 A;  1ZQ9 A;  2KRK A;  2R46 A;  4ZPX A;  3HHZ A;  4BB9 A;  3FTE A;  3M0E A;  3L28 A;  1Z5A A;  1IN6 A;  1Q3C A;  1G59 A;  3FTF A;  2AHM A;  2RGO A;  3Q8X A;  4MGK E;  5EP1 A;  4CGY B;  5LMN M;  1KFV A;  1I94 M;  1IBK M;  2DWM A;  4QNR A;  3B9P A;  1N32 M;  1HT2 E;  1NY6 A;  3W0L B;  1TH2 A;  4IBJ A;  3SBJ A;  3RGP A;  3E4R A;  3HHW A;  3GQ3 A;  2Z4R A;  3IG8 A;  4RNA A;  3U6O A;  2E5L M;  3KOZ E;  2XFT A;  2C9O A;  3KFU G;  1FNN A;  4DR2 M;  1E94 E;  3LMM A;  4QHS A;  3TWL A;  2XSZ A;  3H4M A;  4IBC A;  4DV2 M;  2G5G X;  2DXI A;  4LF7 M;  2CV2 A;  1N78 A;  4L78 A;  2UUB M;  4IJE A;  1LV7 A;  5LMU M;  4JI5 M;  3FTD A;  2DHR A;  4I8O A;  3K8Z A;  2LH0 A;  2FE8 A;  2Y0T A;  4QOS A;  3JAM S;  4JI3 M;  1TH4 A;  3D8B A;  3C58 A;  3GRV A;  4GHL A;  5ITQ A;  1SXJ A;  2D7H A;  3U6M A;  4DV6 M;  4I81 A;  1X37 A;  4G4R A;  3U60 A;  1XC8 A;  4Z6Y A;  1QAN A;  5JI2 E;  5KQD A;  1J5E M;  4FCT A;  1UM8 A;  4YY3 M;  1FJG M;  2EA0 A;  4PCZ A;  5C1B A;  4AZF A;  5FTJ A;  5BR8 M;  3U6C A;  4HLQ A;  5IZ7 D;  3U6D A;  1W5T A;  3K92 A;  1TDZ A;  2O5R A;  1XXH B;  1PJI A;  4DUZ M;  1DGF A;  3KS8 A;  2DZN B;  4DR3 M;  3FYC A;  1SXJ B;  3J2P B;  4I4L A;  3R9X B;  2ZAN A;  3A98 B;  1N77 A;  3ZC7 B;  3GLF B;  4D82 A;  5ITX E;  8CAT A;  3FYD A;  3AKZ A;  3L25 A;  3HHX A;  4MH0 E;  5E26 A;  1SXJ D;  3SHG B;  3SAV A;  1PJJ A;  3PXG A;  4OVZ A;  1MX0 A;  2HCB A;  4B7F A;  3UK6 A;  1OFH A;  2Q2E B;  3SHF A;  4AG6 A;  2X8A A;  1NSF A;  1JQJ C;  2HL7 A;  1L1T A;  3FUU A;  3UZU A;  1DGG A;  4X65 M;  1R2Z A;  4L16 A;  4LRS A;  4FWG A;  2YNM D;  1IN4 A;  2CHV A;  2VQE M;  4A3V B;  4M9Z A;  5GKN A;  4LG2 A;  4AQY M;  5KPZ A;  3DFZ A;  3I4Y A;  3HU2 A;  4OVZ B;  3HWS A;  3I4V A;  4IIW A;  2OQ4 A;  3DA1 A;  5EP4 A;  2BNK A;  4EIW A;  3HJS A;  3U6E A;  2R4E A;  4P16 A;  4MGY E;  3OTO M;  2QPA A;  2C98 A;  3GRU A;  4LY6 A;  1XMQ M;  3AOE A;  3KSJ A;  4FCV A;  5KQ8 A;  2XFS A;  3GPY A;  4LF8 M;  3WHL A;  4BBA A;  1TGU A;  2CE7 A;  2M60 A;  2G8L A;  1GKI A;  2L6O A;  2X49 A;  1W5S A;  3KS4 A;  2YQZ A;  4DV5 M;  4CIS A;  3NWL A;  4MGI E;  2DVW B;  2P5T A;  1N33 M;  3TPZ A;  3KP0 E;  2BJW A;  3J7B A;  2ZAO A;  5IWA M;  5IRE B;  3GO8 A;  3CF2 A;  2J7O A;  5FTL A;  4K0K M;  4X64 M;  1DO0 A;  2C5R A;  1HNX M;  2FNA A;  4MM3 B;  4D80 A;  1HQC A;  3I51 A;  2F5O A;  5EP2 A;  1NHG C;  2V6Z M;  1SXJ E;  3FUX A;  1G3I A;  3M6A A;  3VLF B;  2CHG A;  4JI8 M;  1OFI A;  4DV0 M;  1IXS B;  4JN6 A;  2A5Y B;  2KRU A;  3KSX A;  3MJ5 A;  3SYK A;  5FTN A;  2ERC A;  1N34 M;  1SXJ C;  5FTM A;  4M0D A;  1KYI A;  4R7G A;  2FOI C;  4DR4 M;  2EUC A;  3SAT A;  1DGH A;  3D8L A;  3U6Q A;  3T1H M;  2H1R A;  4LGM A;  3R8F A;  3VKH A;  4NOO B;  2QEN A;  2F4V M;  1IY2 A;  1J09 A;  4XGI A;  4B3M M;  3J7A S;  3U5Z A;  7CAT A;  1GLN A;  4X66 M;  3EIH A;  4I5S A;  4ITQ A;  3L2A A;  4DUY M;  1QAO A;  4LCB A;  4NL4 H;  3KOY E;  4KLN A;  4S12 A;  3AFH A;  3RE8 A;  1YE9 A;  2X4A A;  3CF6 E;  4WUR A;  1R2Y A;  1HR0 M;  1NY5 A;  4NSO B;  1NJF A;  5EXT A;  5FLX S;  3U6L A;  2V1U A;  4LF5 M;  3TQS A;  3A42 A;  4HL4 A;  3VK7 A;  3J27 B;  2Y0Q A;  1GVN A;  2KA6 B;  3K2L A;  2F5S A;  2UUC M;  3U5Z B;  3SAU A;  4OW0 A;  4GKK M;  4G4O A;  5KO3 A;  5DYI A;  1L2D A;  4GHA A;  2ZM6 M;  5ITY A;  3SFZ A;  4PDI A;  2YFQ A;  4PD2 A;  1IY0 A;  4RF0 A;  3THG A;  5FTK A;  3GPP A;  3QWL A;  1HNW M;  3GLH A;  4JXJ A;  4CHT B;  4B7H A;  1PM5 A;  3L29 A;  1VDD A;  4GRI A;  4DV7 M;  4W5W A;  4AKG A;  3RGS A;  1TDH A;  1QYR A;  1XNR M;  4GMQ A;  4G6Z A;  3HU3 A;  3U60 B;  1IBL M;  3GRY A;  3TE6 A;  1Z5B A;  4JI1 M;  3A46 A;  1JR3 A;  3VDU A;  5KPR A;  4NXN M;  4KOD A;  4IBB A;  1S3S A;  1XHB A;  1Q39 A;  5F3W A;  5DNY A;  1MU5 A;  3M7G A;  4DV3 M;  3AOE C;  3AL0 C;  2R45 A;  3L27 A;  3TWK A;  3GLH B;  4X62 M;  2XEP A;  4LJ7 A;  3SMP A;  3T15 A;  4JI2 M;  4NRW A;  3PVS A;  3W0F A;  3FUT A;  3HJQ A;  2LWX A;  3LQR A;  1E9S A;  2I7P A;  2C9C A;  3GLG A;  1IXZ A;  2ZAM A;  4QOZ C;  2HHH M;  4QNM A;  4WW0 A;  1N75 A;  3HHY A;  4L4U A;  3SAS A;  2CFO A;  3ILK A;  1JR3 D;  3WHK A;  2Z3X A;  1I4W A;  2KXE A;  3HGI A;  4JI4 M;  4L8R C;  4AKH A;  4B3T M;  2QCU A;  3GRR A;  4LF6 M;  3DZD A;  3KP1 E;  3KVW A;  1K3W A;  1R6B X;  5EJC A;  3CTW B;  2F5N A;  4DR1 M;  4FD2 A;  3NBI A;  1K82 A;  3GLG B;  3KW6 A;  3ZCB B;  3GLI A;  1IN8 A;  3K1J A;  4OU7 A;  4DR5 M;  3U6S A;  4GC5 A;  3GQ5 A;  4GH9 A;  3E9S A;  1IN5 A;  3JR4 A;  4FVM A;  2KEB A;  4GIP A;  1HQY E;  4JYA M;  3GQ4 A;  4FWD A;  2XF3 A;  2XLJ A;  4MGZ E;  4NRV A;  1D2N A;  5C18 A;  4DR7 M;  4FW9 A;  2CHQ A;  2ZBK B;  2XZU A;  2DWZ B;  3AJI B;  2M5Z A;  3GLI B;  1IN7 A;  2V1C A;  1IXR C;  3KXE C;  2XH9 A;  3AV0 A;  2KZU A;  3HJ8 A;  3SC3 A;  1NJG A;  4D81 A;  4PT5 A;  5ITT A;  4NXM M;  3FKE A;  2L7H A;  4AI6 A;  1L2C A;  4LJ4 A;  2RKO A;  2R65 A;  1Z6T A;  3MHV C;  5JI3 E;  2RGH A;  4IBI A;  2DZO B;  1QAQ A;  4AG5 A;  4KHP M;  3TL4 X;  4IJF A;  3J80 S;  2KW0 A;  2UXB M;  4LJA A;  3PNV A;  1HT1 E;  1G4A E;  4Z8X A;  4FWH A;  4LJ5 A;  4JI7 M;  1XNQ M;  3UJN A;  4LF4 M;  5KPT A;  1XMO M;  3MK6 A;  1L2B A;  1ORY B;  2I7N A;  4JI6 M;  1NVM A;  1DGH B;  3FUW A;  2VQF M;  4DV1 M;  4IBK A;  4IBD A;  5EQT A;  2XGN A;  1QQW A;  3AOG A;  3KOX E;  5H37 D;  2LNH C;  5E6J A;  5EXS A;  1L8Q A;  3U6P A;  1Z5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...