3W67A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tocopherol transfer protein
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w67A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w67A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w67A03
4J7QA 3B7QA 4J7PA 1OIPA 3HY5A 1R5LA 3P7ZA 4TLGA 4CIZA 3B7NA 2D4QA 2E2XA 3PG7A 4OMKA 4OMJA 4M8ZA 3Q8GA 3W67A 1OLME 3HX3A 3W68A 1O6UA 3B7ZA 1AUAA 1OIZA 1OLMA 3PEGA 3B74A 4FMMA 4UYBA 4CJ6A
chains in the Genus database with same CATH superfamily
3GPXA 4ASWA 2L09A 4BWNA 1GTWA 2V1CA 4B86A 2H43A 1FJKA 5F3WA 1PZQA 2C0WA 3H1LE 1AVYA 1Q39A 3WU2H 2Y0CA 3CX5I 3GP1A 3WUUA 3RK2B 4U3FG 3PTZA 3E9SA 1JM0A 1K73Q 4XE5B 4DUYM 2FY8A 1L0LD 2BNKA 2P5TA 1TDHA 4IBEA 2WPSA 4DV6M 1YUBA 3RBZA 2BEQD 2F5NA 3CCQP 3FTDA 4OU7A 2H89C 2XH9A 5B66H 1GL2B 1LT9C 3Q5RA 2KI7B 3EQ2A 1QAOA 1L0NK 3KSXA 1ZR4A 1KILD 3SYLA 2G8YA 2YMKA 4BLCA 3B4SA 3U6OA 1L4AA 1D0MA 2LXBA 2XV5A 1IFMA 2JA2A 1WMKA 5AVZB 3PEGA 1SQVJ 3AEBC 2WPRA 1JB0F 3FTCA 1M56D 1XTGB 1T3TA 3VTPC 1EDKA 4X65M 4AKGA 3L28A 2QJYC 2W90A 2Y21A 1MJGM 3MZWB 1H89A 2CHQA 3GW6A 3L70G 1Q7YQ 4NL4H 3L73G 3JCUH 3H1KD 3VMAA 1H0TA 1Q3BA 4M0DA 1RE4A 4WB4A 4N78D 1KYOD 1NU1D 2CHGA 2NZ2A 4KHPM 4KODA 5EQTA 2R6FA 3SHGB 2OYHA 1N7SC 2R46A 2O01N 4GITA 1IFPA 3CF0A 3HD7B 1M1JA 2ZVNB 3L35A 1ZMUA 1GU5A 1VF5C 1S5LH 5EXXA 5AVWB 3UK6A 1XC8A 1JB0J 1FC2C 3A0HH 1VQ1A 1NJFA 1HUCA 4I1LA 3S9OA 1NAYA 3H4JA 2E75B 1NY5A 3E21A 3IR9A 1Y47A 5B5EH 1R7RA 2C9OA 1PGQA 3T1HM 2HL7A 4EOTA 1SQVE 1OFIA 1BSHA 4PV1C 4TLGA 4ANRA 4JI4M 1OTRA 2CV0A 1JY3P 3H1JE 2XZFA 2QVAA 4LZJA 1GABA 1VDDA 2FS1A 2Y0EA 2WWWA 4LRSA 2DWNA 3L75G 4I8OA 1H88A 5AVTB 1I94M 3TGUJ 4ITQA 1SFCD 1BGYE 1RU3A 1SQBD 3AE1C 1N2DC 1GL2A 4C7RA 3H4MA 4DR7M 4DR5M 1LNQA 3PNYA 2O25A 3FE3A 2OQ4A 3HTKB 4LJ9A 4CGYB 1SQQK 3CWBD 1P84I 1QAQA 3NWLA 1IZNB 1VDFA 4L73A 4FMMA 3HKPA 2J5UA 4EIWA 2Q3IA 3KVWA 2BCCG 2FYUK 2LXCB 2HYNA 4ZMDA 1VQ5P 3ILKA 4BRYB 1AIPC 3V6IA 4IBCA 1G1JA 3GG2A 2Y9ZA 4EDFA 4BB9A 4LF9M 4MM3B 4DCKA 2O01F 3U59A 1RF0A 2FFDB 2DW3A 3GRYA 3L72G 2FYUD 1FZEA 2XDJA 1KD1Q 2JZ0A 3D8LA 5ITTA 1N36M 2Q2EB 3TGUE 1DO0A 2W82A 1V92A 2R44A 2UXDM 2YNYA 3HD7A 1IY1A 3U1AA 3SHFA 1IQPA 1QDTA 4FWGA 2XKMA 1YITP 1ZP0C 4DV1M 2RGHA 3F5HA 3VDUA 2WSEF 4YXDC 2ZTDA 4DBGB 4FWHA 4DZOA 1DGBA 4NXMM 1KILB 2YQZA 1K3XA 1EZVG 1JEKA 3HY5A 4LJ7A 5AW7B 1T6OA 1AVOA 3V4WA 1NTZK 4GC9A 1T8ZA 1HVVA 1V34A 1W5CE 2NPSC 2Z5HA 3M6AA 3CC2P 2Z7JA 3BVHA 3JAMS 4JN6A 1LTMA 5AVSB 1KTMA 4R71A 4YY3M 3HHZA 3KP0E 2CEAA 4JPZB 2JO1A 3H6PA 1SXJD 1P3QQ 3H1IE 2A06D 2A5YB 4JI2M 2IYOA 4TLFA 3L2AA 1WHCA 2OTJP 1X8YA 2NPSD 4DT0A 5KAFE 3RK3E 2ZVOB 2WPVB 3FWLA 1HJBA 2I7PA 1M1KQ 4LLHA 5KAIE 2KIKA 4IL6H 2KSEA 1PRBA 3HTKA 2JJLA 3CXHD 3TNUB 1IN8A 2KA6B 5TISH 3H1LD 2E43A 2JNHA 2K0BX 4Y99C 3Q8XA 1L0LJ 2AXCA 2W6AA 3B5NB 1FOSE 2UXBM 3G3ZA 1SQPK 4MGYE 3P7KA 4G4QA 4BRYA 5FLXS 3BOSA 1TH3A 4I5SA 1KORA 3HE4B 1E94E 5IREB 2QBYB 1SLQA 2FFDA 3C9PA 1Q86Q 1SQVG 1VG5A 2NRGA 1MX0A 1E9SA 1JCDA 2D2CC 5APUA 3KP1E 3VYIA 3J81S 3FX0A 2QJPB 4B7GA 5AW9B 3E1RA 1TH4A 3CMAP 4N3YB 3VDPA 1BCCE 1L4AC 2CV2A 2HFED 1ZW0A 4RESB 1KMIZ 1LJ2A 1ZXGA 3W67A 3IHPA 2OGUA 4Z8XA 4GKKM 3H1KJ 3SAUA 3AJIB 1VQOP 3I5CA 2ZYAA 4DOJA 5CCGC 1LTGC 1NU1J 3PP5A 3V76A 2LNHC 1J2JB 1RE4C 4Y28J 3P8CD 1KILA 4WY4C 4DR6M 4H13C 1NHGC 3AOEA 3TE6A 1FZBA 2YO2A 1OFHA 3B71A 1NVMA 4R3DA 2F5SA 2QQ8A 1L1ZA 1D2NA 4F1IA 5KLIB 1OIZA 1M1JC 1FZFA 3VFDA 1KILE 5KAFH 2N9BA 2W27A 1Q82Q 4PD4I 2JR8A 2KRUA 1N77A 3IG8A 1RE3A 3IFMA 4IBDA 4I81A 2Z3XA 3LVVA 5DNYA 1T2KD 2P2UA 1HTLC 4B3SM 2KOGA 1O6UA 4JI7M 1AUAA 1EQ7A 1IFNA 3TNUA 1MV8A 2KYVA 3B7QA 3TGUG 4N78E 1KYOE 3H1JD 2E74B 3M9HA 5CBOA 3B5NA 1R5SA 3NFQA 3L26A 3GRVA 2ZM6M 1SQBJ 1EZVI 1NO4A 1VDLA 3U60B 2ZYGA 2W8ZA 2D7EA 2FFJA 1IC2A 1BGYD 3HE4A 2WTYA 2K9YA 2QBYA 4ZKPA 4O9BA 1VL2A 3CPWO 2WVRA 4LFAM 1GL2C 3RK2D 3HJSA 1XTCC 1VQPP 1BE3E 4QHSA 1ZRTE 2IBZD 3N4XA 1EXJA 2MH8A 3KHUA 2WT7B 3ABVC 3DZDA 3HE5B 1G8PA 1R2YA 1GDTA 3R9XB 2AXTH 3EWKA 2KXPB 1BVSA 3ZH9B 1KQGB 1N73B 1JMBA 4HJGH 1G71A 3GPUA 1QANA 2KNAA 2KUBA 1JQJC 4UB6H 3HZJA 4DV2M 1YQ3C 1RF0C 4HYTB 1VQ9P 4L74A 2EKFA 3VMYA 2FXOA 1SQBE 5FTJA 2KZSA 5C1BA 1WRGA 1VEKA 5KJ7A 2WPQA 3BXWA 3HD7C 1Z56A 3QWOC 1GZLA 1A02F 2DI0A 4EI2A 1X37A 2F5QA 3CWBE 5ITQA 4KJMA 3C3DA 2L7IA 4JI5M 1USEA 1HGZA 4NPDA 2J58A 2HODB 2CE7A 1K04A 2YIUB 2E75C 3BCCJ 3TF5A 4LZZA 4L8RC 5EXPA 1IK7A 3HD7D 1KYOH 2WMMA 4K3AA 2YKPA 1SQQE 3VP8A 1XWIA 2B88A 2DAEA 4HL4A 3GQ4A 4RKUF 2FYUE 2K3RA 2M0BA 3RK3C 2E76B 4XK8F 4KT0F 2QM7A 2MGWA 3FYCA 4MGZE 1GW4A 2EKKA 2ZBKB 1NNUC 4IJFA 2X49A 3U60A 1AQTA 1SQXK 3Q2YA 2AHMA 1HNXM 1NTMK 1EDLA 3GHGB 3CX5D 1EDIA 3LQRA 1ZOYC 1LTJB 1L0LG 4GMQA 5KLVK 3H1LJ 1WGLA 4PDIA 3ITKA 3I01M 4M9XA 2KZJA 1TF0B 1GU4A 4IBFA 1LT1A 3ZQJA 1KFMA 1SQXD 1QVRA 1YI2P 1NTMD 4CPGA 5AW8B 2APLA 3BASA 2WT7A 5BVZA 4JI1M 3CF6E 3HE5A 4PCZA 1PV3A 2QJKB 2R45A 3HU1A 1EXIA 2A45H 5CCHA 1N73A 3VLFB 1PGOA 3KDPB 1OQYA 2LHCA 4RO0A 1HQCA 3MJ5A 3WHKA 2YXQB 5APVA 2XEPA 3RGPA 1R6BX 1SXJE 5A2QS 1NVOA 3MTUE 1NTZE 3E46A 8CATA 2C9LY 1ZQ9A 4UB8E 3GLFB 1OVVA 1J09A 1N32M 2IFMA 1HT2E 3U5ZB 3H1KG 1ZMVA 1LTIC 2Q7CA 5FTKA 4C46A 3E7KA 1EE8A 1NU1G 4B3TM 3NBXX 4M0WA 4OVZB 2B9BA 4Z6YA 1H8AA 2CPBA 1PM5A 3CXHE 2JY8A 3GF3A 3GO8A 4QOZC 4OVNF 1PL5A 1KFNA 5DJUB 3AEFC 1XNQM 1OX3A 1NNJA 2HODA 1XXHB 1KB9I 3V2NA 3QAUA 1QZMA 3M9BA 2H1RA 4ZNCA 1KILC 4H44D 3AOEC 1GVNA 4II7A 2L6OA 1OMIA 5EXTA 3IAOA 1W5TA 3KW6A 1RHZB 1IXZA 4QNMA 2EA0A 5EXSA 1IM2A 3QYEA 4IL6X 3EIEA 5KPTA 2HR3A 2Q1KA 1SQPE 1OZHA 2B3TA 5APWA 3GF7A 2KK7A 3K5BA 1PPJD 4GEWA 3A7OA 5C18A 1Y8AA 1GL7A 4LF5M 2WZJA 1RE3C 1GKIA 1ZAEA 3GHGA 2A45G 1NHLA 1LTJA 3QYBA 1L0ND 4WP2A 3DOAA 1NTKK 3H1JJ 4NRVA 2QM8A 1SQBG 2QIWA 2HHHM 2WZ7A 3P8CE 5E6JA 3GRRA 3J27B 2LVPC 3NMDA 3EFFK 3VMXA 2OYIC 3B5NC 3FUUA 3BRTB 1BGYJ 4X62M 2YKQA 1MFTA 1NTKD 1HR0M 2XNXA 1P84D 5GTIH 4NC6A 2VDBB 1IFIA 2MJ5B 5KKZB 3J80S 1K05A 1VQ8P 3A3YB 1YE9A 1U57A 2E2XA 1T3JA 3B5ND 1G41A 3CCJP 1G3IA 3GLFA 1BE3D 2QJPC 3CXHH 1ZRTD 2FYNC 4DV7M 3U5ZA 2E5LM 3A98B 4RF0A 2R3CA 1NHWC 2FBWC 1Q3CA 4OVZA 4TUWA 2CK3H 2JP7A 3AE6C 1SFCC 1G2CB 3CCVP 1ZV8A 1AA0A 3CC4P 2KNVA 1ORYB 5KO3A 4JV5M 1Y9BA 4KHXA 2JKVA 1M7LA 1QL2A 3MD0A 1E32A 3HU3A 1XXHA 4DR1M 3OAKA 3ZC7B 3SWKA 2QA4P 5DYGA 4PDGA 2XZUA 2O1KA 2Y0TA 3GPYA 1JY2P 4LFCM 2QENA 1EFUB 3A0BE 4NXNM 5KPZA 1QUTA 2JY7A 3V2PA 5KJ7C 1RH5B 2RKOA 5KLIC 3G4SP 3BCCG 1XXHE 2CRUA 3AE7C 1J5EM 3V5BA 2WITA 5GTHE 2P10A 2M5ZA 2IBZE 3CI9A 1WJ7A 3L71D 3H1HD 2IFNA 2FXMA 1NKZB 5KJ7D 3VKGA 3L73D 3I55P 1KQSO 1GK4A 1KYOI 2KZIA 3LCVB 1G4AE 4GIPA 1ZN5A 4JQ0D 3P7ZA 2A06G 3BATA 3TL4X 3TSIA 1FOSF 2LR2A 1SQQD 2EO2A 2R65A 1TH2A 1HT1E 3CCMP 2N1TB 3VKHA 4LRTA 1LWUB 4MGHA 5L8RF 3H1IJ 1EIJA 3L36A 4HKZH 2FOIC 2XGNA 5FTLA 3SFEC 3T97B 3KXEC 2LVAA 1AQ5A 4X66M 4WW0A 2DVWB 2DKLA 5BU5A 3H1LG 2V7QJ 2F4VM 1BDCA 3CCEP 1FE6A 3V4QA 3A46A 3SFDC 4H44B 1L2DA 4R4MA 3GLHB 2I8DA 3IECA 2KS1B 5AW0B 4DV3M 4NSRA 2E74D 4AG6A 3JR4A 1YHQP 1QLED 4LF6M 4D6TE 4UYBA 1J1DC 4GC5A 2R4EA 3U6EA 1ZMEC 1OVRA 4GHLA 2I1JA 5KPRA 1FBMA 1FZCC 2FNAA 4IFDK 1PP9D 4LF7M 1CZQA 1SXJC 2L4FA 3AV0A 1S4XA 2A45I 4H0LD 2DXIA 5L8RJ 4FCTA 5BR8M 3L75D 2C98A 1G2CA 1N73C 2JEEA 5FSWA 1JO5A 2DENA 3A0BH 5JI2E 3U1CA 4LY6A 1HQYE 4AQRD 4S12A 3K92A 4DV0M 4GODA 4XBOA 1IY0A 1NTZD 1GMJA 1BCCJ 2R18A 5CCHD 2W6JH 2RMZA 1XB2B 3CX5E 3VN0A 1RF1B 3CMEP 3GLIB 2GUVA 3I04M 1GD2E 3D6YA 3Q8GA 2D7HA 1QX8A 3HGIA 4LJ8A 4G3OA 1PGYA 4B3MM 1SQXE 3LVWA 4EIJA 1OAOC 4JI3M 1NTME 2R62A 1FS0E 2E5TA 2H5XA 5APQA 3FRIA 4OH8B 1UM8A 1IN6A 2IPPA 2G5GX 3T1YM 2YIUC 1URQD 1K8AQ 2R5DA 5KLVE 2QJYB 3MP7B 4JI0M 5AW1B 4PD4D 2JWAA 1HWTC 2Z4RA 3T6PA 2Y9YA 4Y28F 2N1TA 3D71A 3U61B 1LWUA 4WVZA 1L1TA 1DEEG 2HPCB 3RGUA 2XF3A 3L74D 5APTA 3KQGA 3P32A 1S9KD 1NOHA 2W83C 3SASA 1Q02A 1SQPD 3T97A 3SWFA 1VQ7P 4IFMA 1N7SB 4QNRA 4IFFA 2K9DA 2Z4SA 3G71P 1YJWP 1TTEA 1D0KA 4D80A 2J5YA 3H1JG 1L0NJ 3OW2O 1NY6A 2KRKA 1VF5B 2ERCA 3PG7A 3C9IA 3GHGC 3GLHA 2KS1A 2GA1A 2E76D 5IZ7D 3AL0C 1JR3A 1YBKA 3SATA 3TDKA 2HWJA 4Q7JA 1FJGM 1BGYG 3AE8C 5H37D 3I4YA 3WHLA 1NH4A 2XSZD 3FXEA 2YMYA 1X22A 2OTKE 3LQQA 3NXSA 1KQFB 3M7GA 2LXEA 2L2DA 5EJCA 3Q1MA 3HJQA 4PV1B 2QJKC 1XNRM 2IBZG 1JR3E 2OYHC 1T2KC 1OLMA 1JTHB 1MFZA 1IXRC 3PFIA 4IOIH 4HEOA 3CX5H 1BE3J 2V7QH 2ZTCA 1FZAA 1PPJE 3O6QB 2B87B 5KAIH 1NV8A 4IIWA 1T6AA 2Q6QA 1RF1A 3M9QA 3GLIA 2OYOA 1L0NE 3PRJA 2BJVA 4BXLA 4LJ6A 3L4FA 2FE8A 1QEXA 2XZRA 4NSOB 3PH0A 2OQQA 2ZT9B 1ZMWA 2Z8YM 2PAJA 4L16A 2QCUA 2HKJA 2B89A 2ZAOA 1DD3A 2JY6B 5CJ4A 3RL0B 2E5YA 1ZV1A 3GLGB 3GLIE 4FCWA 4AQYM 4GT1A 3RK2C 1VQMP 2QZ4A 3J7AS 4L78A 3SMSA 1NTKE 2VQFM 1P84E 1IBMM 2UU9M 3SSUA 3U6CA 4WWIA 1DIPA 1KV4A 1GO5A 4H0LB 3U61A 1FDOA 2J59M 2HPCA 2FH0A 2C96A 4GKGA 4PT5A 3CWBJ 5ITRA 1KSFX 4YTPC 1C7YA 3L71J 3H1HJ 4I7ZB 2G8LA 2K6BA 4FW9A 1N7SA 1IJDB 3T15A 3WMM0 4K35A 3U6PA 2Q9IA 1IN7A 2IZ1A 3CC7P 3V2RA 1SQQJ 2L91A 3PNVA 5AVYB 3H1IG 2CWBA 1M57D 2DWLA 2QNJA 3SAVA 2IX7C 2XNDH 1Z5AA 3VK8A 3B9PA 2OARA 1U7JA 2FYUJ 4N6JA 1S5LX 2RRUA 3MHVA 3I56P 1LTSC 2HG5D 2V6ZM 1OW7A 2G3AA 3HRNA 3M91A 2UWJE 2GM4A 4LF8M 4DR3M 4GH9A 2GUSA 3CL3D 1S2EA 1URQB 1Q2NA 2LTUA 1JTHA 2M60A 2VF7A 1YJ9P 4AUWA 5KKZC 2D7GA 2ZYDA 3KXDA 4DR4M 1UIXA 4LCBA 3O6QA 1E9RA 2B87A 3G6EP 3B7NA 3L71E 3IF4A 3H1HE 1PP9J 4D6TD 5BPVA 5AW6B 4NRWA 3L70E 5H2FE 2K37A 2JZ1A 3L73E 3Q3DA 2K1AA 4JYBA 1VEJA 3AE5C 3UIAA 3CCRP 1FAVA 2P67A 3C8VA 4L76A 1YJNP 1YTZT 3KS4A 2DZOB 4ZPXA 1LTBC 4LGMA 2AEMA 3FKEA 4YHHM 3IG5A 4Y99B 1R2ZA 3UJNA 1P84H 1BCCG 1KFVA 1NSFA 1OFCX 1NTZJ 1NAFA 3CTWB 3LW5F 1NYHA 2O1JA 3GLGA 2DAMA 2KSJA 3U6SA 1WXQA 2O5RA 3S1KA 1XMOM 4ZKUA 3C1LA 3CCUP 3L37A 1N34M 5CMZA 5GKNA 2IBZI 3TYYA 2WSFJ 1WR1B 2M8RA 2KLVA 4AKIA 1KB9D 1Z5CA 1QGKB 2D2CB 3HHXA 4IBGA 1JY3O 1BSNA 2NQ8C 4CIZA 5CHXA 5KQ8A 4W7ZA 5B66E 1S1CX 1PP9E 1CSBA 1LTAC 4L4UA 1S3JA 2V4HA 5C39A 4OGQD 1LP1B 3L75E 4J7QA 5KLVD 3LW5J 1SS1A 2OOAA 3AECC 1PPJG 3L74J 2KEBA 1HJ0A 4LC1A 1AV1A 2EJSA 2UUBM 5E79E 1PIXA 2Q3EA 4OX9M 2X8AA 2N1TC 2DWMA 1SQPJ 2FFDC 1IN4A 4WY4B 3R2PA 2FYZA 4G4RA 1L0NG 2R4JA 3S4RA 3W0FA 4B08A 4I2LC 2LVQD 2RGOA 2K88A 3JCUE 3UGJA 2C9NY 4LGDE 1N75A 1URQA 1NO1A 4CISA 3L25A 2JWDA 4GHAA 2N1TD 3GLMA 5BU8B 1JCCA 4IBJA 5H2FH 1OVUA 4H44C 2CV1A 2XFSA 1YIJP 1YSYA 2QP9X 3KS8A 1LTTC 2N9YB 3B8EB 3Q5PA 3KFUG 2DAIA 3CCSP 3MK6A 1N78A 2ZXXA 1J1EB 3VMZA 1F4IA 4HB1A 1C1KA 2C99A 1X9VA 1FJPA 2MROB 4L75A 3HHYA 1HGVA 4PD4E 2PP6A 2KW0A 1S3SA 1L0LK 4QOSA 2RKLA 1BE3G 5B5EE 1JR3D 3JC22 5DJTB 3L74E 3V2QA 2CFOA 1QL1A 5FTNA 3FUVA 1FNNA 1S9KE 4NPEA 4FVMA 1DGFA 4LF4M 3W68A 3G9RA 4L15A 2XSZA 1Q90D 1VQ4P 2CP8A 2E42A 5AVUB 1MU5A 4GRIA 2F5PA 1TU3F 1RF1C 4G6ZA 1R4GA 3R8FA 3PLNA 1G1IA 1EZVE 3M06A 2WQYC 4OW0A 1J7KA 4JI8M 2ITAA 1TR8A 1OJLA 5AVQB 1PJQA 1PJJA 3HHWA 4A7PA 3J2PB 5TJHA 1X0TA 4R7GA 1GJSA 2VF8A 4JBZA 5E79H 5FTMA 1OW8A 1NU1K 4W80A 1LP1A 4IJEA 2KP8A 1QZEA 5AW3B 4BBAA 3CWBG 2QRXA 5CCGA 5APYA 3L71G 2P58A 3H1HG 4UB8H 2GNOA 3KDSE 2KHHA 1DV0A 2ZJSE 3FYDA 5AW2B 4OMKA 4WY4A 4Z1MH 3SC3A 2KLUA 3KYQA 3P8MC 2JP3A 4LJ4A 2WSFH 3THGA 5ITUA 1DO2A 1SQQG 3UMMA 3T38A 4C7NB 5CBNA 2HLOA 3AFHA 1N7LA 2FYUG 4QMAA 3WUVA 3GQ3A 2JWSA 5EP3A 4U3FD 2YKOA 4GOFA 1DGHB 1KQLA 4AG5A 2UXCM 4PD4H 3SYKA 3GLFE 3AEAC 2H88C 3FUWA 1N7SD 3SMPA 1VQNP 3LW5H 3K1JA 3OA7A 1OAIA 4M9SA 1E5WA 1ZLLA 3MHVC 2H8PD 3AOGA 3K2LA 2RH0A 5DYIA 1VF5D 3M0DA 3QWLA 4WBAA 2HCBA 3PHLA 1OWAA 4LJAA 3N7NA 3CCLP 1VQKP 2C9CA 1SG9A 1SQBK 4OGQB 2IZ0A 3RK3B 1PP9G 4LJ5A 1HJPA 1Y8GA 1DH3A 2JXNA 4AYCA 4JF7A 2C5RA 2L5GB 4D6TJ 4F2LA 3TWLA 2KZUA 4FCVA 3SFZA 3I4VA 1VPCA 2WSCF 2AEFA 1L2BA 4DR2M 1E79H 3GMAA 1Z5BA 4UN2B 4PV1D 2F5OA 4B7HA 1OKSA 3LIDA 1K9MQ 3L70D 2ZXEB 3KOZE 2PFXA 3KZIE 1QQWA 1MKMA 4IBBA 4MH0E 5ITYA 3FD9A 2Z5IA 1OXZA 2OOBA 1IFJA 1NTZG 1X79B 3Q5SA 3TQSA 3KPEA 1QVGO 5AVXB 1W2BO 2ZT9C 5EFWB 2E74C 4IL6E 3FRHA 3RL0C 4J7PA 3MUDA 2QPAA 2XLJA 3F92A 3MMPA 4QHTA 5TISE 2Q5UA 3KSJA 2WSCJ 2ZT9D 1NKNA 2H7HA 4H0LC 3ZDMA 3NTNA 4FD2A 4K0KM 3SARA 1SQXJ 2LWXA 3LMMA 3RL0D 1NTMJ 3M0AA 3QH9A 2IYPA 4AI6A 3HUSB 4LG2A 4I7ZC 4C7NA 2DWZB 2VQEM 1CUKA 5LMNM 4M3LA 3SAWA 3GPPA 2Y0QA 3L74G 3AE3C 5KLVJ 4REZA 4JI6M 4OWFA 3BBZA 4PJ0E 3RFWA 1SQPG 1JNMA 2HAKA 2LH0A 3MIWA 2G3QA 5CCHC 3U6DA 2KXEA 2YO3A 2DZNB 1DGHA 2PRRA 1L2PA 3LCUA 3B74A 1QYRA 5E26A 3AEGC 2VRSA 2FKWB 2O01J 4JXJA 3BCCD 1JY3N 3TPZA 2LKMA 4W7YA 1R5LA 5GTHH 1NWQA 3BRVB 3WUTA 1N86A 3TWKA 1KB9E 1M90Q 4KLNA 1LT9B 2YFQA 1URQC 3K9PA 1N8RQ 4I6MC 3RE8A 1JY2N 2BCCD 1Z59A 2J7NA 4R4LA 3KZIH 2BEZF 2CHVA 3I51A 5KTBA 1FU1A 7CATA 1W5SA 1GL6A 2ZANA 3AEEC 3HWSA 3J7BA 2Y0DA 5AW5B 3AE9C 2CUZA 1PJTA 4CHTB 2WSEJ 2OTLP 4B7FA 2MKVA 3FWNA 3A5TA 3VK7A 4LFBM 3E1IA 3L72D 1PJIA 1XHBA 2M3BA 4M9ZA 3AKZA 5ITXA 3EFGA 3CGWA 2JDIH 1CW5A 1CI6B 4AKHA 3GQ5A 3VOPA 3PVSA 2BJWA 4IBIA 3PXGA 1IFDA 5AVVB 3MGNA 2OYIB 3DFZA 2E76C 3UZUA 3R4YA 3HJ8A 4L6V6 1VQLP 1LV7A 5JI3E 5ITXE 1JOCA 1IK9A 1HH0A 2BWEA 1K82A 1RQUA 1G59A 1USDA 2D4QA 2V1UA 1MN3A 4P16A 3A2AA 1IXSB 4KO8A 3KOWE 3JSVC 2OO9A 2BASA 3OTOM 1LTJC 1EZVD 4RF1A 3LIEA 1EC5A 3KOXE 4PJ0H 3HUSA 2FYNB 5CJ0A 3IN6A 1QVFO 2KB7P 1A5TA 4MB7A 1NGMB 2FXPA 4YPCA 3FXDA 2XFTA 1MZ9A 1NTKJ 4GKJM 2K9JB 3AEDC 2EUCA 3HU2A 3GLHE 1SFCB 5LMUM 4W5WA 4JYAM 1JUNA 1RQVA 1D0LA 4AW4A 2D2CD 2POHA 2P7JA 4NPFX 1V33A 3D70A 2ZAEB 2XU6A 1NJIQ 1QDRA 1FZGA 4P17A 1DGGA 2AXTE 1L4AD 4RNAA 3EIHA 2QG4A 1AFOA 1KB9H 3E4RA 1L0LE 2WSCH 1WGNA 4FWDA 3AE4C 1GJTA 3KOYE 3CXHI 1VQ6P 4UB6E 1UIIA 4DV5M 5CCGD 4U3FJ 2DAKA 4OMJA 3F89A 2R3SA 2YXRB 2Z4EA 1OLME 1RY3A 1LT9A 1HNZM 1PGJA 3SBJA 5AW4B 3CLQA 1SQVK 4MGKE 4WY4D 4H13D 4MGIE 2QE7H 4TT3H 3D6ZA 2GQFA 2L4EA 1HF9A 3NBIA 1UFZA 1L2CA 1QUSA 2MJZA 1J1EC 3L27A 4X64M 3H25A 1IO4A 1GK6A 4DJGA 1SQVD 2SPZA 3M0DC 1H6UA 2QSFX 4D6TG 1ZR2A 2LVOC 3JR5A 3RL0g 5IWAM 1K3WA 2O01H 3H1KE 1CI6A 2YNMD 1WIVA 2LBCA 2C0XA 1IBKM 1NU1E 2ZAMA 2OYIA 2P1JA 3VP9A 3FUXA 3TWMA 3L29A 4I4LA 1YQ4C 3L70J 1XMQM 1NV9A 3L73J 4JYCA 5M1BA 3B89A 2DHRA 1KZUB 3USSA 3GRUA 1KYIA 1IXSA 4U3FE 1R8EA 1S72P 1HNWM 3RGSA 2X4AA 2M5AB 4D82A 2IDBA 1BDDA 2WSEH 4GDOA 4YXWH 5K5GB 4LGYA 1DX7A 1OIPA 2RN0A 3A45A 1J1DB 4XA4A 1IFYA 5KQDA 2DNAA 2KNCB 1FZCB 1HBWA 2L7HA 1YTZI 1SXJB 4MN4C 2K9JA 1NJGA 2I1KA 1SFCA 2DZLA 2R5BA 3MUDC 3B7ZA 3W0LB 2NPSB 3CD6P 1I4WA 1VEGA 1GL2D 1SQXG 2CPSA 1GW3A 3O8ZA 2QEXP 4XGIA 3ZCBB 1NTMG 4EYYQ 2M3EA 1SP4A 3CF2A 2DAGA 4GIFA 5APSA 2OPFA 1Q81Q 1KN7A 3PJSK 5KLVG 4U7JA 2WSFF 3RBXA 1FDIA 1PJSA 1U7MA 3FGAD 1AJYA 3H32B 5EP4A 2JY5A 3C3EA 3TGUD 3L75J 1KC8Q 2UUCM 1EDJA 2AEJA 1Z6TA 4CJ6A 4IBKA 3FTEA 1D7MA 1DD4A 4B3RM 1YYCA 5EP2A 5AVRB 2R0IA 3K9OA 1L8QA 4HLQA 3U6QA 2QHOB 1IY2A 2DHYA 1PGPA 1QAMA 1FDMA 2W6BA 1YLAA 3DA1A 3TK1A 4G4OA 3OJAB 4WURA 2KDLA 4NOOB 1W2EA 3WU2E 2I7NA 3FUTA 2BWBA 2BCCJ 1DEBA 2KNZA 3A42A 4AZFA 1TDZA 4OGQC 2E75D 1OW6A 3GLGE 3H1ID 1A02J 1L4AB 2O3JA 1LGHB 2WSSH 3L72J 1MUUA 1JY2O 5DFLA 3AE2C 3RK3D 1GLNA 1T3UA 1WT6A 2JUJA 3U6MA 2QSIA 2M5AA 1PFIA 3M0EA 2Y20A 2VIIA 1M8OB 4RJTA 4GOEA 2ZFCA 1H0TB 1IN5A 2KNCA 4HH2A 1LWUC 1FZCA 2J7OA 2MR9A 4H13B 4DUZM 4G4NA 1SXJA 3BCCE 2N35A 2UUAM 1T43A 1JMMA 2K47A 2PGDA 2LVNC 2R32A 4RKUJ 1N33M 1TGUA 5EP1A 4KT0J 1IBLM 2NPSA 3SWYA 4PD2A 2OYHB 2YR0A 4ASVA 3K8ZA 1M1JB 4D81A 3C58A 3U6LA 1SVFA 3II6A 2BCCE 4A3VB 4DV4M 5IT9S 2A06E 1NTKG 4XFJA 2LHGA 5GTIE 4M8ZA 3H32A 3HX3A 3HUSC 1S5LE 3FTFA 3D8BA 3A0HE 5APXA 1BCCD 3L72E
chains in the Genus database with same CATH topology
4J7QA 3B7QA 4J7PA 1OIPA 3HY5A 1R5LA 3P7ZA 4TLGA 4CIZA 3B7NA 2D4QA 2E2XA 3PG7A 4OMKA 4OMJA 4M8ZA 3Q8GA 3W67A 1OLME 3HX3A 3W68A 1O6UA 3B7ZA 1AUAA 1OIZA 1OLMA 3PEGA 3B74A 4FMMA 4UYBA 4CJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Q A;  3B7Q A;  4J7P A;  1OIP A;  3HY5 A;  1R5L A;  3P7Z A;  4TLG A;  4CIZ A;  3B7N A;  2D4Q A;  2E2X A;  3PG7 A;  4OMK A;  4OMJ A;  4M8Z A;  3Q8G A;  3W67 A;  1OLM E;  3HX3 A;  3W68 A;  1O6U A;  3B7Z A;  1AUA A;  1OIZ A;  1OLM A;  3PEG A;  3B74 A;  4FMM A;  4UYB A;  4CJ6 A; 
#chains in the Genus database with same CATH topology
 3GPX A;  4ASW A;  2L09 A;  4BWN A;  1GTW A;  2V1C A;  4B86 A;  2H43 A;  1FJK A;  5F3W A;  1PZQ A;  2C0W A;  3H1L E;  1AVY A;  1Q39 A;  3WU2 H;  2Y0C A;  3CX5 I;  3GP1 A;  3WUU A;  3RK2 B;  4U3F G;  3PTZ A;  3E9S A;  1JM0 A;  1K73 Q;  4XE5 B;  4DUY M;  2FY8 A;  1L0L D;  2BNK A;  2P5T A;  1TDH A;  4IBE A;  2WPS A;  4DV6 M;  1YUB A;  3RBZ A;  2BEQ D;  2F5N A;  3CCQ P;  3FTD A;  4OU7 A;  2H89 C;  2XH9 A;  5B66 H;  1GL2 B;  1LT9 C;  3Q5R A;  2KI7 B;  3EQ2 A;  1QAO A;  1L0N K;  3KSX A;  1ZR4 A;  1KIL D;  3SYL A;  2G8Y A;  2YMK A;  4BLC A;  3B4S A;  3U6O A;  1L4A A;  1D0M A;  2LXB A;  2XV5 A;  1IFM A;  2JA2 A;  1WMK A;  5AVZ B;  3PEG A;  1SQV J;  3AEB C;  2WPR A;  1JB0 F;  3FTC A;  1M56 D;  1XTG B;  1T3T A;  3VTP C;  1EDK A;  4X65 M;  4AKG A;  3L28 A;  2QJY C;  2W90 A;  2Y21 A;  1MJG M;  3MZW B;  1H89 A;  2CHQ A;  3GW6 A;  3L70 G;  1Q7Y Q;  4NL4 H;  3L73 G;  3JCU H;  3H1K D;  3VMA A;  1H0T A;  1Q3B A;  4M0D A;  1RE4 A;  4WB4 A;  4N78 D;  1KYO D;  1NU1 D;  2CHG A;  2NZ2 A;  4KHP M;  4KOD A;  5EQT A;  2R6F A;  3SHG B;  2OYH A;  1N7S C;  2R46 A;  2O01 N;  4GIT A;  1IFP A;  3CF0 A;  3HD7 B;  1M1J A;  2ZVN B;  3L35 A;  1ZMU A;  1GU5 A;  1VF5 C;  1S5L H;  5EXX A;  5AVW B;  3UK6 A;  1XC8 A;  1JB0 J;  1FC2 C;  3A0H H;  1VQ1 A;  1NJF A;  1HUC A;  4I1L A;  3S9O A;  1NAY A;  3H4J A;  2E75 B;  1NY5 A;  3E21 A;  3IR9 A;  1Y47 A;  5B5E H;  1R7R A;  2C9O A;  1PGQ A;  3T1H M;  2HL7 A;  4EOT A;  1SQV E;  1OFI A;  1BSH A;  4PV1 C;  4TLG A;  4ANR A;  4JI4 M;  1OTR A;  2CV0 A;  1JY3 P;  3H1J E;  2XZF A;  2QVA A;  4LZJ A;  1GAB A;  1VDD A;  2FS1 A;  2Y0E A;  2WWW A;  4LRS A;  2DWN A;  3L75 G;  4I8O A;  1H88 A;  5AVT B;  1I94 M;  3TGU J;  4ITQ A;  1SFC D;  1BGY E;  1RU3 A;  1SQB D;  3AE1 C;  1N2D C;  1GL2 A;  4C7R A;  3H4M A;  4DR7 M;  4DR5 M;  1LNQ A;  3PNY A;  2O25 A;  3FE3 A;  2OQ4 A;  3HTK B;  4LJ9 A;  4CGY B;  1SQQ K;  3CWB D;  1P84 I;  1QAQ A;  3NWL A;  1IZN B;  1VDF A;  4L73 A;  4FMM A;  3HKP A;  2J5U A;  4EIW A;  2Q3I A;  3KVW A;  2BCC G;  2FYU K;  2LXC B;  2HYN A;  4ZMD A;  1VQ5 P;  3ILK A;  4BRY B;  1AIP C;  3V6I A;  4IBC A;  1G1J A;  3GG2 A;  2Y9Z A;  4EDF A;  4BB9 A;  4LF9 M;  4MM3 B;  4DCK A;  2O01 F;  3U59 A;  1RF0 A;  2FFD B;  2DW3 A;  3GRY A;  3L72 G;  2FYU D;  1FZE A;  2XDJ A;  1KD1 Q;  2JZ0 A;  3D8L A;  5ITT A;  1N36 M;  2Q2E B;  3TGU E;  1DO0 A;  2W82 A;  1V92 A;  2R44 A;  2UXD M;  2YNY A;  3HD7 A;  1IY1 A;  3U1A A;  3SHF A;  1IQP A;  1QDT A;  4FWG A;  2XKM A;  1YIT P;  1ZP0 C;  4DV1 M;  2RGH A;  3F5H A;  3VDU A;  2WSE F;  4YXD C;  2ZTD A;  4DBG B;  4FWH A;  4DZO A;  1DGB A;  4NXM M;  1KIL B;  2YQZ A;  1K3X A;  1EZV G;  1JEK A;  3HY5 A;  4LJ7 A;  5AW7 B;  1T6O A;  1AVO A;  3V4W A;  1NTZ K;  4GC9 A;  1T8Z A;  1HVV A;  1V34 A;  1W5C E;  2NPS C;  2Z5H A;  3M6A A;  3CC2 P;  2Z7J A;  3BVH A;  3JAM S;  4JN6 A;  1LTM A;  5AVS B;  1KTM A;  4R71 A;  4YY3 M;  3HHZ A;  3KP0 E;  2CEA A;  4JPZ B;  2JO1 A;  3H6P A;  1SXJ D;  1P3Q Q;  3H1I E;  2A06 D;  2A5Y B;  4JI2 M;  2IYO A;  4TLF A;  3L2A A;  1WHC A;  2OTJ P;  1X8Y A;  2NPS D;  4DT0 A;  5KAF E;  3RK3 E;  2ZVO B;  2WPV B;  3FWL A;  1HJB A;  2I7P A;  1M1K Q;  4LLH A;  5KAI E;  2KIK A;  4IL6 H;  2KSE A;  1PRB A;  3HTK A;  2JJL A;  3CXH D;  3TNU B;  1IN8 A;  2KA6 B;  5TIS H;  3H1L D;  2E43 A;  2JNH A;  2K0B X;  4Y99 C;  3Q8X A;  1L0L J;  2AXC A;  2W6A A;  3B5N B;  1FOS E;  2UXB M;  3G3Z A;  1SQP K;  4MGY E;  3P7K A;  4G4Q A;  4BRY A;  5FLX S;  3BOS A;  1TH3 A;  4I5S A;  1KOR A;  3HE4 B;  1E94 E;  5IRE B;  2QBY B;  1SLQ A;  2FFD A;  3C9P A;  1Q86 Q;  1SQV G;  1VG5 A;  2NRG A;  1MX0 A;  1E9S A;  1JCD A;  2D2C C;  5APU A;  3KP1 E;  3VYI A;  3J81 S;  3FX0 A;  2QJP B;  4B7G A;  5AW9 B;  3E1R A;  1TH4 A;  3CMA P;  4N3Y B;  3VDP A;  1BCC E;  1L4A C;  2CV2 A;  2HFE D;  1ZW0 A;  4RES B;  1KMI Z;  1LJ2 A;  1ZXG A;  3W67 A;  3IHP A;  2OGU A;  4Z8X A;  4GKK M;  3H1K J;  3SAU A;  3AJI B;  1VQO P;  3I5C A;  2ZYA A;  4DOJ A;  5CCG C;  1LTG C;  1NU1 J;  3PP5 A;  3V76 A;  2LNH C;  1J2J B;  1RE4 C;  4Y28 J;  3P8C D;  1KIL A;  4WY4 C;  4DR6 M;  4H13 C;  1NHG C;  3AOE A;  3TE6 A;  1FZB A;  2YO2 A;  1OFH A;  3B71 A;  1NVM A;  4R3D A;  2F5S A;  2QQ8 A;  1L1Z A;  1D2N A;  4F1I A;  5KLI B;  1OIZ A;  1M1J C;  1FZF A;  3VFD A;  1KIL E;  5KAF H;  2N9B A;  2W27 A;  1Q82 Q;  4PD4 I;  2JR8 A;  2KRU A;  1N77 A;  3IG8 A;  1RE3 A;  3IFM A;  4IBD A;  4I81 A;  2Z3X A;  3LVV A;  5DNY A;  1T2K D;  2P2U A;  1HTL C;  4B3S M;  2KOG A;  1O6U A;  4JI7 M;  1AUA A;  1EQ7 A;  1IFN A;  3TNU A;  1MV8 A;  2KYV A;  3B7Q A;  3TGU G;  4N78 E;  1KYO E;  3H1J D;  2E74 B;  3M9H A;  5CBO A;  3B5N A;  1R5S A;  3NFQ A;  3L26 A;  3GRV A;  2ZM6 M;  1SQB J;  1EZV I;  1NO4 A;  1VDL A;  3U60 B;  2ZYG A;  2W8Z A;  2D7E A;  2FFJ A;  1IC2 A;  1BGY D;  3HE4 A;  2WTY A;  2K9Y A;  2QBY A;  4ZKP A;  4O9B A;  1VL2 A;  3CPW O;  2WVR A;  4LFA M;  1GL2 C;  3RK2 D;  3HJS A;  1XTC C;  1VQP P;  1BE3 E;  4QHS A;  1ZRT E;  2IBZ D;  3N4X A;  1EXJ A;  2MH8 A;  3KHU A;  2WT7 B;  3ABV C;  3DZD A;  3HE5 B;  1G8P A;  1R2Y A;  1GDT A;  3R9X B;  2AXT H;  3EWK A;  2KXP B;  1BVS A;  3ZH9 B;  1KQG B;  1N73 B;  1JMB A;  4HJG H;  1G71 A;  3GPU A;  1QAN A;  2KNA A;  2KUB A;  1JQJ C;  4UB6 H;  3HZJ A;  4DV2 M;  1YQ3 C;  1RF0 C;  4HYT B;  1VQ9 P;  4L74 A;  2EKF A;  3VMY A;  2FXO A;  1SQB E;  5FTJ A;  2KZS A;  5C1B A;  1WRG A;  1VEK A;  5KJ7 A;  2WPQ A;  3BXW A;  3HD7 C;  1Z56 A;  3QWO C;  1GZL A;  1A02 F;  2DI0 A;  4EI2 A;  1X37 A;  2F5Q A;  3CWB E;  5ITQ A;  4KJM A;  3C3D A;  2L7I A;  4JI5 M;  1USE A;  1HGZ A;  4NPD A;  2J58 A;  2HOD B;  2CE7 A;  1K04 A;  2YIU B;  2E75 C;  3BCC J;  3TF5 A;  4LZZ A;  4L8R C;  5EXP A;  1IK7 A;  3HD7 D;  1KYO H;  2WMM A;  4K3A A;  2YKP A;  1SQQ E;  3VP8 A;  1XWI A;  2B88 A;  2DAE A;  4HL4 A;  3GQ4 A;  4RKU F;  2FYU E;  2K3R A;  2M0B A;  3RK3 C;  2E76 B;  4XK8 F;  4KT0 F;  2QM7 A;  2MGW A;  3FYC A;  4MGZ E;  1GW4 A;  2EKK A;  2ZBK B;  1NNU C;  4IJF A;  2X49 A;  3U60 A;  1AQT A;  1SQX K;  3Q2Y A;  2AHM A;  1HNX M;  1NTM K;  1EDL A;  3GHG B;  3CX5 D;  1EDI A;  3LQR A;  1ZOY C;  1LTJ B;  1L0L G;  4GMQ A;  5KLV K;  3H1L J;  1WGL A;  4PDI A;  3ITK A;  3I01 M;  4M9X A;  2KZJ A;  1TF0 B;  1GU4 A;  4IBF A;  1LT1 A;  3ZQJ A;  1KFM A;  1SQX D;  1QVR A;  1YI2 P;  1NTM D;  4CPG A;  5AW8 B;  2APL A;  3BAS A;  2WT7 A;  5BVZ A;  4JI1 M;  3CF6 E;  3HE5 A;  4PCZ A;  1PV3 A;  2QJK B;  2R45 A;  3HU1 A;  1EXI A;  2A45 H;  5CCH A;  1N73 A;  3VLF B;  1PGO A;  3KDP B;  1OQY A;  2LHC A;  4RO0 A;  1HQC A;  3MJ5 A;  3WHK A;  2YXQ B;  5APV A;  2XEP A;  3RGP A;  1R6B X;  1SXJ E;  5A2Q S;  1NVO A;  3MTU E;  1NTZ E;  3E46 A;  8CAT A;  2C9L Y;  1ZQ9 A;  4UB8 E;  3GLF B;  1OVV A;  1J09 A;  1N32 M;  2IFM A;  1HT2 E;  3U5Z B;  3H1K G;  1ZMV A;  1LTI C;  2Q7C A;  5FTK A;  4C46 A;  3E7K A;  1EE8 A;  1NU1 G;  4B3T M;  3NBX X;  4M0W A;  4OVZ B;  2B9B A;  4Z6Y A;  1H8A A;  2CPB A;  1PM5 A;  3CXH E;  2JY8 A;  3GF3 A;  3GO8 A;  4QOZ C;  4OVN F;  1PL5 A;  1KFN A;  5DJU B;  3AEF C;  1XNQ M;  1OX3 A;  1NNJ A;  2HOD A;  1XXH B;  1KB9 I;  3V2N A;  3QAU A;  1QZM A;  3M9B A;  2H1R A;  4ZNC A;  1KIL C;  4H44 D;  3AOE C;  1GVN A;  4II7 A;  2L6O A;  1OMI A;  5EXT A;  3IAO A;  1W5T A;  3KW6 A;  1RHZ B;  1IXZ A;  4QNM A;  2EA0 A;  5EXS A;  1IM2 A;  3QYE A;  4IL6 X;  3EIE A;  5KPT A;  2HR3 A;  2Q1K A;  1SQP E;  1OZH A;  2B3T A;  5APW A;  3GF7 A;  2KK7 A;  3K5B A;  1PPJ D;  4GEW A;  3A7O A;  5C18 A;  1Y8A A;  1GL7 A;  4LF5 M;  2WZJ A;  1RE3 C;  1GKI A;  1ZAE A;  3GHG A;  2A45 G;  1NHL A;  1LTJ A;  3QYB A;  1L0N D;  4WP2 A;  3DOA A;  1NTK K;  3H1J J;  4NRV A;  2QM8 A;  1SQB G;  2QIW A;  2HHH M;  2WZ7 A;  3P8C E;  5E6J A;  3GRR A;  3J27 B;  2LVP C;  3NMD A;  3EFF K;  3VMX A;  2OYI C;  3B5N C;  3FUU A;  3BRT B;  1BGY J;  4X62 M;  2YKQ A;  1MFT A;  1NTK D;  1HR0 M;  2XNX A;  1P84 D;  5GTI H;  4NC6 A;  2VDB B;  1IFI A;  2MJ5 B;  5KKZ B;  3J80 S;  1K05 A;  1VQ8 P;  3A3Y B;  1YE9 A;  1U57 A;  2E2X A;  1T3J A;  3B5N D;  1G41 A;  3CCJ P;  1G3I A;  3GLF A;  1BE3 D;  2QJP C;  3CXH H;  1ZRT D;  2FYN C;  4DV7 M;  3U5Z A;  2E5L M;  3A98 B;  4RF0 A;  2R3C A;  1NHW C;  2FBW C;  1Q3C A;  4OVZ A;  4TUW A;  2CK3 H;  2JP7 A;  3AE6 C;  1SFC C;  1G2C B;  3CCV P;  1ZV8 A;  1AA0 A;  3CC4 P;  2KNV A;  1ORY B;  5KO3 A;  4JV5 M;  1Y9B A;  4KHX A;  2JKV A;  1M7L A;  1QL2 A;  3MD0 A;  1E32 A;  3HU3 A;  1XXH A;  4DR1 M;  3OAK A;  3ZC7 B;  3SWK A;  2QA4 P;  5DYG A;  4PDG A;  2XZU A;  2O1K A;  2Y0T A;  3GPY A;  1JY2 P;  4LFC M;  2QEN A;  1EFU B;  3A0B E;  4NXN M;  5KPZ A;  1QUT A;  2JY7 A;  3V2P A;  5KJ7 C;  1RH5 B;  2RKO A;  5KLI C;  3G4S P;  3BCC G;  1XXH E;  2CRU A;  3AE7 C;  1J5E M;  3V5B A;  2WIT A;  5GTH E;  2P10 A;  2M5Z A;  2IBZ E;  3CI9 A;  1WJ7 A;  3L71 D;  3H1H D;  2IFN A;  2FXM A;  1NKZ B;  5KJ7 D;  3VKG A;  3L73 D;  3I55 P;  1KQS O;  1GK4 A;  1KYO I;  2KZI A;  3LCV B;  1G4A E;  4GIP A;  1ZN5 A;  4JQ0 D;  3P7Z A;  2A06 G;  3BAT A;  3TL4 X;  3TSI A;  1FOS F;  2LR2 A;  1SQQ D;  2EO2 A;  2R65 A;  1TH2 A;  1HT1 E;  3CCM P;  2N1T B;  3VKH A;  4LRT A;  1LWU B;  4MGH A;  5L8R F;  3H1I J;  1EIJ A;  3L36 A;  4HKZ H;  2FOI C;  2XGN A;  5FTL A;  3SFE C;  3T97 B;  3KXE C;  2LVA A;  1AQ5 A;  4X66 M;  4WW0 A;  2DVW B;  2DKL A;  5BU5 A;  3H1L G;  2V7Q J;  2F4V M;  1BDC A;  3CCE P;  1FE6 A;  3V4Q A;  3A46 A;  3SFD C;  4H44 B;  1L2D A;  4R4M A;  3GLH B;  2I8D A;  3IEC A;  2KS1 B;  5AW0 B;  4DV3 M;  4NSR A;  2E74 D;  4AG6 A;  3JR4 A;  1YHQ P;  1QLE D;  4LF6 M;  4D6T E;  4UYB A;  1J1D C;  4GC5 A;  2R4E A;  3U6E A;  1ZME C;  1OVR A;  4GHL A;  2I1J A;  5KPR A;  1FBM A;  1FZC C;  2FNA A;  4IFD K;  1PP9 D;  4LF7 M;  1CZQ A;  1SXJ C;  2L4F A;  3AV0 A;  1S4X A;  2A45 I;  4H0L D;  2DXI A;  5L8R J;  4FCT A;  5BR8 M;  3L75 D;  2C98 A;  1G2C A;  1N73 C;  2JEE A;  5FSW A;  1JO5 A;  2DEN A;  3A0B H;  5JI2 E;  3U1C A;  4LY6 A;  1HQY E;  4AQR D;  4S12 A;  3K92 A;  4DV0 M;  4GOD A;  4XBO A;  1IY0 A;  1NTZ D;  1GMJ A;  1BCC J;  2R18 A;  5CCH D;  2W6J H;  2RMZ A;  1XB2 B;  3CX5 E;  3VN0 A;  1RF1 B;  3CME P;  3GLI B;  2GUV A;  3I04 M;  1GD2 E;  3D6Y A;  3Q8G A;  2D7H A;  1QX8 A;  3HGI A;  4LJ8 A;  4G3O A;  1PGY A;  4B3M M;  1SQX E;  3LVW A;  4EIJ A;  1OAO C;  4JI3 M;  1NTM E;  2R62 A;  1FS0 E;  2E5T A;  2H5X A;  5APQ A;  3FRI A;  4OH8 B;  1UM8 A;  1IN6 A;  2IPP A;  2G5G X;  3T1Y M;  2YIU C;  1URQ D;  1K8A Q;  2R5D A;  5KLV E;  2QJY B;  3MP7 B;  4JI0 M;  5AW1 B;  4PD4 D;  2JWA A;  1HWT C;  2Z4R A;  3T6P A;  2Y9Y A;  4Y28 F;  2N1T A;  3D71 A;  3U61 B;  1LWU A;  4WVZ A;  1L1T A;  1DEE G;  2HPC B;  3RGU A;  2XF3 A;  3L74 D;  5APT A;  3KQG A;  3P32 A;  1S9K D;  1NOH A;  2W83 C;  3SAS A;  1Q02 A;  1SQP D;  3T97 A;  3SWF A;  1VQ7 P;  4IFM A;  1N7S B;  4QNR A;  4IFF A;  2K9D A;  2Z4S A;  3G71 P;  1YJW P;  1TTE A;  1D0K A;  4D80 A;  2J5Y A;  3H1J G;  1L0N J;  3OW2 O;  1NY6 A;  2KRK A;  1VF5 B;  2ERC A;  3PG7 A;  3C9I A;  3GHG C;  3GLH A;  2KS1 A;  2GA1 A;  2E76 D;  5IZ7 D;  3AL0 C;  1JR3 A;  1YBK A;  3SAT A;  3TDK A;  2HWJ A;  4Q7J A;  1FJG M;  1BGY G;  3AE8 C;  5H37 D;  3I4Y A;  3WHL A;  1NH4 A;  2XSZ D;  3FXE A;  2YMY A;  1X22 A;  2OTK E;  3LQQ A;  3NXS A;  1KQF B;  3M7G A;  2LXE A;  2L2D A;  5EJC A;  3Q1M A;  3HJQ A;  4PV1 B;  2QJK C;  1XNR M;  2IBZ G;  1JR3 E;  2OYH C;  1T2K C;  1OLM A;  1JTH B;  1MFZ A;  1IXR C;  3PFI A;  4IOI H;  4HEO A;  3CX5 H;  1BE3 J;  2V7Q H;  2ZTC A;  1FZA A;  1PPJ E;  3O6Q B;  2B87 B;  5KAI H;  1NV8 A;  4IIW A;  1T6A A;  2Q6Q A;  1RF1 A;  3M9Q A;  3GLI A;  2OYO A;  1L0N E;  3PRJ A;  2BJV A;  4BXL A;  4LJ6 A;  3L4F A;  2FE8 A;  1QEX A;  2XZR A;  4NSO B;  3PH0 A;  2OQQ A;  2ZT9 B;  1ZMW A;  2Z8Y M;  2PAJ A;  4L16 A;  2QCU A;  2HKJ A;  2B89 A;  2ZAO A;  1DD3 A;  2JY6 B;  5CJ4 A;  3RL0 B;  2E5Y A;  1ZV1 A;  3GLG B;  3GLI E;  4FCW A;  4AQY M;  4GT1 A;  3RK2 C;  1VQM P;  2QZ4 A;  3J7A S;  4L78 A;  3SMS A;  1NTK E;  2VQF M;  1P84 E;  1IBM M;  2UU9 M;  3SSU A;  3U6C A;  4WWI A;  1DIP A;  1KV4 A;  1GO5 A;  4H0L B;  3U61 A;  1FDO A;  2J59 M;  2HPC A;  2FH0 A;  2C96 A;  4GKG A;  4PT5 A;  3CWB J;  5ITR A;  1KSF X;  4YTP C;  1C7Y A;  3L71 J;  3H1H J;  4I7Z B;  2G8L A;  2K6B A;  4FW9 A;  1N7S A;  1IJD B;  3T15 A;  3WMM 0;  4K35 A;  3U6P A;  2Q9I A;  1IN7 A;  2IZ1 A;  3CC7 P;  3V2R A;  1SQQ J;  2L91 A;  3PNV A;  5AVY B;  3H1I G;  2CWB A;  1M57 D;  2DWL A;  2QNJ A;  3SAV A;  2IX7 C;  2XND H;  1Z5A A;  3VK8 A;  3B9P A;  2OAR A;  1U7J A;  2FYU J;  4N6J A;  1S5L X;  2RRU A;  3MHV A;  3I56 P;  1LTS C;  2HG5 D;  2V6Z M;  1OW7 A;  2G3A A;  3HRN A;  3M91 A;  2UWJ E;  2GM4 A;  4LF8 M;  4DR3 M;  4GH9 A;  2GUS A;  3CL3 D;  1S2E A;  1URQ B;  1Q2N A;  2LTU A;  1JTH A;  2M60 A;  2VF7 A;  1YJ9 P;  4AUW A;  5KKZ C;  2D7G A;  2ZYD A;  3KXD A;  4DR4 M;  1UIX A;  4LCB A;  3O6Q A;  1E9R A;  2B87 A;  3G6E P;  3B7N A;  3L71 E;  3IF4 A;  3H1H E;  1PP9 J;  4D6T D;  5BPV A;  5AW6 B;  4NRW A;  3L70 E;  5H2F E;  2K37 A;  2JZ1 A;  3L73 E;  3Q3D A;  2K1A A;  4JYB A;  1VEJ A;  3AE5 C;  3UIA A;  3CCR P;  1FAV A;  2P67 A;  3C8V A;  4L76 A;  1YJN P;  1YTZ T;  3KS4 A;  2DZO B;  4ZPX A;  1LTB C;  4LGM A;  2AEM A;  3FKE A;  4YHH M;  3IG5 A;  4Y99 B;  1R2Z A;  3UJN A;  1P84 H;  1BCC G;  1KFV A;  1NSF A;  1OFC X;  1NTZ J;  1NAF A;  3CTW B;  3LW5 F;  1NYH A;  2O1J A;  3GLG A;  2DAM A;  2KSJ A;  3U6S A;  1WXQ A;  2O5R A;  3S1K A;  1XMO M;  4ZKU A;  3C1L A;  3CCU P;  3L37 A;  1N34 M;  5CMZ A;  5GKN A;  2IBZ I;  3TYY A;  2WSF J;  1WR1 B;  2M8R A;  2KLV A;  4AKI A;  1KB9 D;  1Z5C A;  1QGK B;  2D2C B;  3HHX A;  4IBG A;  1JY3 O;  1BSN A;  2NQ8 C;  4CIZ A;  5CHX A;  5KQ8 A;  4W7Z A;  5B66 E;  1S1C X;  1PP9 E;  1CSB A;  1LTA C;  4L4U A;  1S3J A;  2V4H A;  5C39 A;  4OGQ D;  1LP1 B;  3L75 E;  4J7Q A;  5KLV D;  3LW5 J;  1SS1 A;  2OOA A;  3AEC C;  1PPJ G;  3L74 J;  2KEB A;  1HJ0 A;  4LC1 A;  1AV1 A;  2EJS A;  2UUB M;  5E79 E;  1PIX A;  2Q3E A;  4OX9 M;  2X8A A;  2N1T C;  2DWM A;  1SQP J;  2FFD C;  1IN4 A;  4WY4 B;  3R2P A;  2FYZ A;  4G4R A;  1L0N G;  2R4J A;  3S4R A;  3W0F A;  4B08 A;  4I2L C;  2LVQ D;  2RGO A;  2K88 A;  3JCU E;  3UGJ A;  2C9N Y;  4LGD E;  1N75 A;  1URQ A;  1NO1 A;  4CIS A;  3L25 A;  2JWD A;  4GHA A;  2N1T D;  3GLM A;  5BU8 B;  1JCC A;  4IBJ A;  5H2F H;  1OVU A;  4H44 C;  2CV1 A;  2XFS A;  1YIJ P;  1YSY A;  2QP9 X;  3KS8 A;  1LTT C;  2N9Y B;  3B8E B;  3Q5P A;  3KFU G;  2DAI A;  3CCS P;  3MK6 A;  1N78 A;  2ZXX A;  1J1E B;  3VMZ A;  1F4I A;  4HB1 A;  1C1K A;  2C99 A;  1X9V A;  1FJP A;  2MRO B;  4L75 A;  3HHY A;  1HGV A;  4PD4 E;  2PP6 A;  2KW0 A;  1S3S A;  1L0L K;  4QOS A;  2RKL A;  1BE3 G;  5B5E E;  1JR3 D;  3JC2 2;  5DJT B;  3L74 E;  3V2Q A;  2CFO A;  1QL1 A;  5FTN A;  3FUV A;  1FNN A;  1S9K E;  4NPE A;  4FVM A;  1DGF A;  4LF4 M;  3W68 A;  3G9R A;  4L15 A;  2XSZ A;  1Q90 D;  1VQ4 P;  2CP8 A;  2E42 A;  5AVU B;  1MU5 A;  4GRI A;  2F5P A;  1TU3 F;  1RF1 C;  4G6Z A;  1R4G A;  3R8F A;  3PLN A;  1G1I A;  1EZV E;  3M06 A;  2WQY C;  4OW0 A;  1J7K A;  4JI8 M;  2ITA A;  1TR8 A;  1OJL A;  5AVQ B;  1PJQ A;  1PJJ A;  3HHW A;  4A7P A;  3J2P B;  5TJH A;  1X0T A;  4R7G A;  1GJS A;  2VF8 A;  4JBZ A;  5E79 H;  5FTM A;  1OW8 A;  1NU1 K;  4W80 A;  1LP1 A;  4IJE A;  2KP8 A;  1QZE A;  5AW3 B;  4BBA A;  3CWB G;  2QRX A;  5CCG A;  5APY A;  3L71 G;  2P58 A;  3H1H G;  4UB8 H;  2GNO A;  3KDS E;  2KHH A;  1DV0 A;  2ZJS E;  3FYD A;  5AW2 B;  4OMK A;  4WY4 A;  4Z1M H;  3SC3 A;  2KLU A;  3KYQ A;  3P8M C;  2JP3 A;  4LJ4 A;  2WSF H;  3THG A;  5ITU A;  1DO2 A;  1SQQ G;  3UMM A;  3T38 A;  4C7N B;  5CBN A;  2HLO A;  3AFH A;  1N7L A;  2FYU G;  4QMA A;  3WUV A;  3GQ3 A;  2JWS A;  5EP3 A;  4U3F D;  2YKO A;  4GOF A;  1DGH B;  1KQL A;  4AG5 A;  2UXC M;  4PD4 H;  3SYK A;  3GLF E;  3AEA C;  2H88 C;  3FUW A;  1N7S D;  3SMP A;  1VQN P;  3LW5 H;  3K1J A;  3OA7 A;  1OAI A;  4M9S A;  1E5W A;  1ZLL A;  3MHV C;  2H8P D;  3AOG A;  3K2L A;  2RH0 A;  5DYI A;  1VF5 D;  3M0D A;  3QWL A;  4WBA A;  2HCB A;  3PHL A;  1OWA A;  4LJA A;  3N7N A;  3CCL P;  1VQK P;  2C9C A;  1SG9 A;  1SQB K;  4OGQ B;  2IZ0 A;  3RK3 B;  1PP9 G;  4LJ5 A;  1HJP A;  1Y8G A;  1DH3 A;  2JXN A;  4AYC A;  4JF7 A;  2C5R A;  2L5G B;  4D6T J;  4F2L A;  3TWL A;  2KZU A;  4FCV A;  3SFZ A;  3I4V A;  1VPC A;  2WSC F;  2AEF A;  1L2B A;  4DR2 M;  1E79 H;  3GMA A;  1Z5B A;  4UN2 B;  4PV1 D;  2F5O A;  4B7H A;  1OKS A;  3LID A;  1K9M Q;  3L70 D;  2ZXE B;  3KOZ E;  2PFX A;  3KZI E;  1QQW A;  1MKM A;  4IBB A;  4MH0 E;  5ITY A;  3FD9 A;  2Z5I A;  1OXZ A;  2OOB A;  1IFJ A;  1NTZ G;  1X79 B;  3Q5S A;  3TQS A;  3KPE A;  1QVG O;  5AVX B;  1W2B O;  2ZT9 C;  5EFW B;  2E74 C;  4IL6 E;  3FRH A;  3RL0 C;  4J7P A;  3MUD A;  2QPA A;  2XLJ A;  3F92 A;  3MMP A;  4QHT A;  5TIS E;  2Q5U A;  3KSJ A;  2WSC J;  2ZT9 D;  1NKN A;  2H7H A;  4H0L C;  3ZDM A;  3NTN A;  4FD2 A;  4K0K M;  3SAR A;  1SQX J;  2LWX A;  3LMM A;  3RL0 D;  1NTM J;  3M0A A;  3QH9 A;  2IYP A;  4AI6 A;  3HUS B;  4LG2 A;  4I7Z C;  4C7N A;  2DWZ B;  2VQE M;  1CUK A;  5LMN M;  4M3L A;  3SAW A;  3GPP A;  2Y0Q A;  3L74 G;  3AE3 C;  5KLV J;  4REZ A;  4JI6 M;  4OWF A;  3BBZ A;  4PJ0 E;  3RFW A;  1SQP G;  1JNM A;  2HAK A;  2LH0 A;  3MIW A;  2G3Q A;  5CCH C;  3U6D A;  2KXE A;  2YO3 A;  2DZN B;  1DGH A;  2PRR A;  1L2P A;  3LCU A;  3B74 A;  1QYR A;  5E26 A;  3AEG C;  2VRS A;  2FKW B;  2O01 J;  4JXJ A;  3BCC D;  1JY3 N;  3TPZ A;  2LKM A;  4W7Y A;  1R5L A;  5GTH H;  1NWQ A;  3BRV B;  3WUT A;  1N86 A;  3TWK A;  1KB9 E;  1M90 Q;  4KLN A;  1LT9 B;  2YFQ A;  1URQ C;  3K9P A;  1N8R Q;  4I6M C;  3RE8 A;  1JY2 N;  2BCC D;  1Z59 A;  2J7N A;  4R4L A;  3KZI H;  2BEZ F;  2CHV A;  3I51 A;  5KTB A;  1FU1 A;  7CAT A;  1W5S A;  1GL6 A;  2ZAN A;  3AEE C;  3HWS A;  3J7B A;  2Y0D A;  5AW5 B;  3AE9 C;  2CUZ A;  1PJT A;  4CHT B;  2WSE J;  2OTL P;  4B7F A;  2MKV A;  3FWN A;  3A5T A;  3VK7 A;  4LFB M;  3E1I A;  3L72 D;  1PJI A;  1XHB A;  2M3B A;  4M9Z A;  3AKZ A;  5ITX A;  3EFG A;  3CGW A;  2JDI H;  1CW5 A;  1CI6 B;  4AKH A;  3GQ5 A;  3VOP A;  3PVS A;  2BJW A;  4IBI A;  3PXG A;  1IFD A;  5AVV B;  3MGN A;  2OYI B;  3DFZ A;  2E76 C;  3UZU A;  3R4Y A;  3HJ8 A;  4L6V 6;  1VQL P;  1LV7 A;  5JI3 E;  5ITX E;  1JOC A;  1IK9 A;  1HH0 A;  2BWE A;  1K82 A;  1RQU A;  1G59 A;  1USD A;  2D4Q A;  2V1U A;  1MN3 A;  4P16 A;  3A2A A;  1IXS B;  4KO8 A;  3KOW E;  3JSV C;  2OO9 A;  2BAS A;  3OTO M;  1LTJ C;  1EZV D;  4RF1 A;  3LIE A;  1EC5 A;  3KOX E;  4PJ0 H;  3HUS A;  2FYN B;  5CJ0 A;  3IN6 A;  1QVF O;  2KB7 P;  1A5T A;  4MB7 A;  1NGM B;  2FXP A;  4YPC A;  3FXD A;  2XFT A;  1MZ9 A;  1NTK J;  4GKJ M;  2K9J B;  3AED C;  2EUC A;  3HU2 A;  3GLH E;  1SFC B;  5LMU M;  4W5W A;  4JYA M;  1JUN A;  1RQV A;  1D0L A;  4AW4 A;  2D2C D;  2POH A;  2P7J A;  4NPF X;  1V33 A;  3D70 A;  2ZAE B;  2XU6 A;  1NJI Q;  1QDR A;  1FZG A;  4P17 A;  1DGG A;  2AXT E;  1L4A D;  4RNA A;  3EIH A;  2QG4 A;  1AFO A;  1KB9 H;  3E4R A;  1L0L E;  2WSC H;  1WGN A;  4FWD A;  3AE4 C;  1GJT A;  3KOY E;  3CXH I;  1VQ6 P;  4UB6 E;  1UII A;  4DV5 M;  5CCG D;  4U3F J;  2DAK A;  4OMJ A;  3F89 A;  2R3S A;  2YXR B;  2Z4E A;  1OLM E;  1RY3 A;  1LT9 A;  1HNZ M;  1PGJ A;  3SBJ A;  5AW4 B;  3CLQ A;  1SQV K;  4MGK E;  4WY4 D;  4H13 D;  4MGI E;  2QE7 H;  4TT3 H;  3D6Z A;  2GQF A;  2L4E A;  1HF9 A;  3NBI A;  1UFZ A;  1L2C A;  1QUS A;  2MJZ A;  1J1E C;  3L27 A;  4X64 M;  3H25 A;  1IO4 A;  1GK6 A;  4DJG A;  1SQV D;  2SPZ A;  3M0D C;  1H6U A;  2QSF X;  4D6T G;  1ZR2 A;  2LVO C;  3JR5 A;  3RL0 g;  5IWA M;  1K3W A;  2O01 H;  3H1K E;  1CI6 A;  2YNM D;  1WIV A;  2LBC A;  2C0X A;  1IBK M;  1NU1 E;  2ZAM A;  2OYI A;  2P1J A;  3VP9 A;  3FUX A;  3TWM A;  3L29 A;  4I4L A;  1YQ4 C;  3L70 J;  1XMQ M;  1NV9 A;  3L73 J;  4JYC A;  5M1B A;  3B89 A;  2DHR A;  1KZU B;  3USS A;  3GRU A;  1KYI A;  1IXS A;  4U3F E;  1R8E A;  1S72 P;  1HNW M;  3RGS A;  2X4A A;  2M5A B;  4D82 A;  2IDB A;  1BDD A;  2WSE H;  4GDO A;  4YXW H;  5K5G B;  4LGY A;  1DX7 A;  1OIP A;  2RN0 A;  3A45 A;  1J1D B;  4XA4 A;  1IFY A;  5KQD A;  2DNA A;  2KNC B;  1FZC B;  1HBW A;  2L7H A;  1YTZ I;  1SXJ B;  4MN4 C;  2K9J A;  1NJG A;  2I1K A;  1SFC A;  2DZL A;  2R5B A;  3MUD C;  3B7Z A;  3W0L B;  2NPS B;  3CD6 P;  1I4W A;  1VEG A;  1GL2 D;  1SQX G;  2CPS A;  1GW3 A;  3O8Z A;  2QEX P;  4XGI A;  3ZCB B;  1NTM G;  4EYY Q;  2M3E A;  1SP4 A;  3CF2 A;  2DAG A;  4GIF A;  5APS A;  2OPF A;  1Q81 Q;  1KN7 A;  3PJS K;  5KLV G;  4U7J A;  2WSF F;  3RBX A;  1FDI A;  1PJS A;  1U7M A;  3FGA D;  1AJY A;  3H32 B;  5EP4 A;  2JY5 A;  3C3E A;  3TGU D;  3L75 J;  1KC8 Q;  2UUC M;  1EDJ A;  2AEJ A;  1Z6T A;  4CJ6 A;  4IBK A;  3FTE A;  1D7M A;  1DD4 A;  4B3R M;  1YYC A;  5EP2 A;  5AVR B;  2R0I A;  3K9O A;  1L8Q A;  4HLQ A;  3U6Q A;  2QHO B;  1IY2 A;  2DHY A;  1PGP A;  1QAM A;  1FDM A;  2W6B A;  1YLA A;  3DA1 A;  3TK1 A;  4G4O A;  3OJA B;  4WUR A;  2KDL A;  4NOO B;  1W2E A;  3WU2 E;  2I7N A;  3FUT A;  2BWB A;  2BCC J;  1DEB A;  2KNZ A;  3A42 A;  4AZF A;  1TDZ A;  4OGQ C;  2E75 D;  1OW6 A;  3GLG E;  3H1I D;  1A02 J;  1L4A B;  2O3J A;  1LGH B;  2WSS H;  3L72 J;  1MUU A;  1JY2 O;  5DFL A;  3AE2 C;  3RK3 D;  1GLN A;  1T3U A;  1WT6 A;  2JUJ A;  3U6M A;  2QSI A;  2M5A A;  1PFI A;  3M0E A;  2Y20 A;  2VII A;  1M8O B;  4RJT A;  4GOE A;  2ZFC A;  1H0T B;  1IN5 A;  2KNC A;  4HH2 A;  1LWU C;  1FZC A;  2J7O A;  2MR9 A;  4H13 B;  4DUZ M;  4G4N A;  1SXJ A;  3BCC E;  2N35 A;  2UUA M;  1T43 A;  1JMM A;  2K47 A;  2PGD A;  2LVN C;  2R32 A;  4RKU J;  1N33 M;  1TGU A;  5EP1 A;  4KT0 J;  1IBL M;  2NPS A;  3SWY A;  4PD2 A;  2OYH B;  2YR0 A;  4ASV A;  3K8Z A;  1M1J B;  4D81 A;  3C58 A;  3U6L A;  1SVF A;  3II6 A;  2BCC E;  4A3V B;  4DV4 M;  5IT9 S;  2A06 E;  1NTK G;  4XFJ A;  2LHG A;  5GTI E;  4M8Z A;  3H32 A;  3HX3 A;  3HUS C;  1S5L E;  3FTF A;  3D8B A;  3A0H E;  5APX A;  1BCC D;  3L72 E; 
#chains in the Genus database with same CATH homology
 4J7Q A;  3B7Q A;  4J7P A;  1OIP A;  3HY5 A;  1R5L A;  3P7Z A;  4TLG A;  4CIZ A;  3B7N A;  2D4Q A;  2E2X A;  3PG7 A;  4OMK A;  4OMJ A;  4M8Z A;  3Q8G A;  3W67 A;  1OLM E;  3HX3 A;  3W68 A;  1O6U A;  3B7Z A;  1AUA A;  1OIZ A;  1OLM A;  3PEG A;  3B74 A;  4FMM A;  4UYB A;  4CJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...