3W67A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Alpha-tocopherol transfer protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w67A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w67A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w67A03
3HX3A 1AUAA 1OIPA 3B7QA 3PEGA 4OMJA 3B7NA 3Q8GA 4TLGA 2E2XA 4CIZA 2D4QA 4J7QA 3W67A 4OMKA 1O6UA 1OIZA 4CJ6A 3HY5A 1OLMA 4J7PA 3B74A 1R5LA 4M8ZA 4UYBA 3PG7A 3W68A 4FMMA 3P7ZA 3B7ZA 1OLME
chains in the Genus database with same CATH superfamily
1S3JA 2QQ8A 3TQSA 4AG5A 3V76A 3OW2O 1LNQA 2KA6B 2AXCA 3B4SA 4AUWA 2N1TC 2WSFH 3HY5A 2IBZG 1L4AB 2K3RA 1MN3A 3FE3A 1EIJA 5CCGA 1S1CX 1XTGB 1IQPA 3CTWB 2FYZA 3H1HG 3SFEC 2VIIA 4PJ0E 4GC5A 3L75G 2I7PA 3BVHA 3RGSA 2R6FA 3LVWA 3CPWO 1LT9B 3BASA 1URQA 2M0BA 3CWBE 4PJ0H 1JY2N 3JR5A 1ZXGA 1YQ4C 4OVZB 4DCKA 5KAIH 1RH5B 1FS0E 2DAMA 3K1JA 3WU2E 1AQ5A 2BWBA 1OZHA 3OJAB 4MGZE 4EOTA 1YE9A 1JUNA 2YQZA 2R4EA 1OW8A 2K1AA 1SQVD 1XXHE 1N7SC 2C96A 3NXSA 2QSFX 3L72E 1SQPD 2PAJA 2WPVB 3H1HD 1NO4A 3FTFA 3KOWE 2D2CD 5EP2A 3LIDA 2IZ0A 4H13C 4WP2A 1LTSC 5EXSA 3VN0A 2F5SA 2YO2A 3M9BA 2KS1A 3FKEA 2CPSA 4BRYA 5EXXA 1AV1A 2XF3A 3B7ZA 4OGQB 1ZW0A 5AVXB 1ZV8A 4W7YA 1AA0A 4EI2A 3U61B 3Q5SA 4QOZC 1TH4A 1KYIA 1CI6B 2E76C 2KI7B 1NKZB 1QVFO 2E5YA 2YMYA 3GHGC 1VQPP 2O5RA 1L4AA 1D2NA 3GG2A 2ZYGA 1ZV1A 2KNZA 1LTGC 4WY4B 3F92A 5EJCA 2R3SA 3GLHE 4FWDA 2P67A 1PJQA 1KB9E 1J1DC 1NY5A 4WWIA 1P3QQ 2XKMA 4LGYA 4FCTA 2FFDA 3FXEA 2IPPA 2Y0TA 3FRIA 3SFZA 3I4YA 1PGPA 2BCCJ 2KNCB 1RQVA 2ZYDA 4MGYE 3T38A 2ZJSE 3L4FA 3B74A 3JR4A 2H43A 2AEMA 1SFCB 2WITA 2G8LA 2LBCA 3M06A 3I5CA 2G3QA 2CWBA 4U3FD 1D7MA 2QSIA 4LF5M 1IK9A 1K8AQ 1D0KA 2DWLA 2GA1A 2ZAEB 1DEBA 1Q90D 3L36A 4DR3M 1SQQG 1KQGB 2IFNA 5B5EE 1SQBG 5KLIB 4JI1M 1J2JB 1DO2A 5ITXA 1KC8Q 2GNOA 1QYRA 3MTUE 5FTKA 2NQ8C 3KP0E 3A0BH 5B66E 2CP8A 3FUVA 1WRGA 1XNRM 2R62A 3K8ZA 1DIPA 3MUDC 2H1RA 3U6QA 1KZUB 1QX8A 4H44D 1NU1K 4U3FJ 2XSZD 4OGQC 1NTKE 3O8ZA 2FFDC 3RK2D 1ZMWA 1IBKM 3L71E 1R4GA 1IC2A 2R44A 4JYAM 2P7JA 4WY4A 3AL0C 5KKZB 1S72P 3CMEP 1T3UA 1RE4C 4JI7M 1ZLLA 3M9HA 1IFMA 2KZJA 4GODA 4PD2A 3AEFC 3AOEC 2RKOA 3KVWA 1PP9E 3BXWA 5F3WA 4AKGA 3HD7D 3H4JA 5APSA 1GL7A 2HKJA 5C1BA 1NKNA 2P2UA 1G59A 2BCCG 1Q7YQ 3D8LA 3QAUA 1M56D 4Z1MH 1RF0C 3H1LJ 5JI2E 5BR8M 4JI2M 1ZAEA 3J27B 1LT1A 2H7HA 2K37A 4LGDE 1OIZA 1QUSA 1QUTA 3L72D 4M8ZA 4KJMA 2OTKE 1SXJD 2WTYA 3T15A 4GIFA 4GOEA 4EDFA 4L15A 1SQBJ 2LH0A 2OOBA 3J80S 3GLHB 3CGWA 3VDUA 2W27A 5CMZA 3L75D 2HAKA 4KLNA 2IFMA 3AE3C 4HEOA 4IIWA 2YNYA 4J7QA 2O01J 1VF5B 2Y20A 1N7SA 2HCBA 2YFQA 2RGOA 1HJ0A 2A06D 4IFFA 4I8OA 2RN0A 3PJSK 3RL0D 1L0NG 1VQ6P 1JB0F 3EIEA 1FE6A 2WSCH 4JI6M 2KB7P 3PP5A 4LFCM 3TYYA 1EDLA 1YIJP 3NMDA 4FVMA 2VF8A 3HD7A 4LF6M 4AKHA 1SQVG 1ZN5A 1FJGM 3Q5PA 2O01H 1VEGA 1JMBA 3D8BA 3GW6A 2AEJA 2M3BA 3U60B 2X8AA 1HNXM 5CJ0A 1VQOP 2JJLA 1W5CE 1L2BA 2KSJA 1M1KQ 4LFBM 2C9NY 2L4EA 3SARA 1FAVA 2LTUA 2CV1A 2QP9X 2V1CA 2ZYAA 3G4SP 4ANRA 2YR0A 1PGJA 2G5GX 5ITTA 1IFYA 1RE3A 1ZMVA 1T3JA 1YI2P 1KV4A 3SATA 3KOYE 4R4LA 3WMM0 1E94E 4DV7M 3AEDC 3H6PA 3ITKA 1XMQM 1QANA 3EQ2A 3E1RA 2WMMA 2QBYB 3KZIE 1AFOA 3L35A 3RGPA 2L7IA 1N7SD 2C9OA 3SAUA 3M9QA 3A7OA 1S9KE 4N6JA 2X4AA 1TTEA 1L0LD 3FXDA 1DGHB 4LJAA 3VKGA 1HBWA 1JQJC 1L2CA 1UIXA 5CBNA 1BCCG 2CHVA 3TGUE 3D70A 2JXNA 2KZIA 1N2DC 2JP3A 2LHGA 3C3EA 4GIPA 4DV3M 1USEA 2I1KA 1GJTA 1SQPE 3P7KA 4I81A 3VP9A 5KKZC 2XZRA 1JOCA 1IJDB 3PH0A 3AEEC 2RRUA 1HF9A 2D7EA 1OWAA 2OARA 1XC8A 4C7RA 3AE7C 4XE5B 1KYOH 4M0DA 3H1JE 3TE6A 3CCUP 1FU1A 5LMUM 5KQ8A 2OOAA 4ZNCA 1L0LG 1C1KA 4G4OA 1NHLA 3GF3A 1BSNA 4ZKUA 3U6OA 3MJ5A 3AECC 3I01M 4F2LA 1SQXD 5AW2B 1YHQP 3TWLA 1N33M 5KJ7C 3CF0A 3ZCBB 1KILC 4L73A 1DX7A 3CD6P 1WGNA 4D6TG 2B89A 3RL0B 1HUCA 2A45H 3B9PA 2XNXA 4Z6YA 4YPCA 4UN2B 1CI6A 5CCHC 1LTJC 3SFDC 4D82A 1EZVE 3L73G 2I1JA 2KLVA 1Q39A 3P32A 3I51A 1GTWA 2O25A 1UFZA 1SQQJ 1Y8AA 2F5PA 4JYBA 2MJ5B 1SQXG 1YJ9P 1IFIA 3WUTA 3PTZA 4L75A 1V92A 2O3JA 2ZFCA 2W83C 2CHGA 5FTNA 4RF0A 1MFZA 4HL4A 3HTKA 3T97A 5BU8B 3CC4P 2C0WA 2XSZA 4DR2M 5AVVB 3GQ5A 1GZLA 3MP7B 4OWFA 1X79B 2JP7A 4QNRA 3SASA 1NVMA 3HU1A 1XNQM 1H0TB 2DAIA 5AVUB 2NPSC 1HQCA 3GLGA 3U6EA 3TK1A 1HWTC 3CC2P 2B87A 4ZPXA 2WPSA 3SSUA 2ZT9D 5H2FE 3JAMS 2APLA 2J7OA 1CZQA 3U6DA 4DR4M 3CWBD 3KQGA 3L29A 3H1LG 1S5LE 4XGIA 3SAWA 4RKUJ 5ITXE 3AE5C 4YHHM 1LT9A 3B7QA 1IFJA 2WZJA 4NSRA 1U7MA 4RKUF 4L74A 1VG5A 3GO8A 2P10A 1SXJA 2OQQA 3U1CA 1L2DA 1FJPA 1R2ZA 3HU2A 1H88A 2WSFF 3TNUB 3V4QA 2LVQD 1FZCC 1QVGO 2QJPC 1Q82Q 4L16A 4QHTA 1L2PA 3TGUD 1K9MQ 4A7PA 3WUUA 4D80A 2WT7A 4REZA 4B08A 3CXHI 3PEGA 1VQKP 5KLVE 1C7YA 1EFUB 3CXHD 5H37D 3U6LA 3HE4B 5AW7B 1N34M 1S4XA 4LCBA 3M0DA 5E6JA 3L26A 4KT0F 2UUAM 4K35A 2AEFA 3KW6A 3QWOC 3HTKB 3N4XA 2C5RA 2XNDH 2OYIA 3T6PA 1SQQK 2FNAA 4KO8A 4WURA 4DV2M 3PG7A 4D6TE 3ZDMA 3H1KE 1NTME 4RJTA 2KNAA 4IJEA 5APXA 3LCVB 1OXZA 2CV2A 2IBZE 1MV8A 1HGVA 4GOFA 2JR8A 1P84E 2BCCE 4IL6H 1K73Q 3AKZA 1NTMK 1OW6A 1WJ7A 3CCMP 1LTIC 4OX9M 1BCCD 3V2RA 4PDIA 2N9BA 3GHGB 1LP1A 3HHYA 2Y21A 3FTCA 2N35A 2AXTE 1LV7A 3IHPA 1HTLC 5TISH 3B89A 1N77A 3U5ZA 2EKFA 2GUVA 2WQYC 1TR8A 2XH9A 1IY1A 1SQPG 5EQTA 3MHVA 3AE2C 4XK8F 3CC7P 1IN6A 2C98A 1KB9I 4H0LB 1EQ7A 4DR1M 5AW8B 3CMAP 2W82A 1HH0A 3SWYA 1W2EA 5FTJA 2ITAA 3MIWA 2KIKA 1BCCJ 2O1KA 2CFOA 3GLHA 3R8FA 1J7KA 4U3FE 1LTJA 2V7QJ 3QYBA 4DV5M 3HKPA 2UWJE 1GU5A 3L71J 5APQA 3V2PA 3U59A 3PXGA 1YJWP 4B3SM 3GRRA 3HHZA 2I8DA 1Q3CA 3GRUA 1PP9J 2R4JA 1ZRTD 1IBMM 3KS8A 1N36M 1XMOM 3CCRP 1IXRC 2QE7H 1PGOA 1K04A 4ASWA 2E5LM 3H1IG 1OW7A 3H1LE 3HUSA 2DAEA 4M0WA 5B5EH 3PRJA 2KXPB 3RK3B 3CXHE 1DGFA 5GTIH 3HE5B 1NVOA 2K9DA 2A5YB 4K0KM 4YTPC 1SQXE 5CHXA 1WHCA 1NTZE 4IFDK 1Q2NA 3IG8A 4H44B 1GW3A 2R65A 1LTBC 1Z5AA 1BE3E 3CL3D 3BRVB 3S1KA 1L0NE 4RESB 2ZM6M 2CV0A 2DWZB 1WT6A 3CLQA 3PFIA 2QZ4A 3ABVC 1P84I 3F5HA 1PJSA 1SQQD 3SC3A 3FRHA 3GLMA 4R3DA 2J58A 2DAGA 2KXEA 4IFMA 1OAIA 2RMZA 4P17A 1YSYA 1E79H 4TUWA 2H8PD 5AVZB 2FS1A 3DFZA 1EZVI 2E42A 4IBBA 1FOSF 1SQPK 4QHSA 2FXPA 1AIPC 1PP9G 1FZGA 1V34A 4NXNM 2JEEA 1OQYA 3AE9C 3FUWA 1R8EA 3MD0A 1QZMA 3RE8A 3L74E 2JZ0A 1GMJA 2FYUD 5KAIE 1JMMA 1EDJA 2JY7A 2YKOA 2Y9ZA 1WXQA 1IO4A 3NBIA 4H13B 1NAYA 3RK2B 2CRUA 1HVVA 2O01N 2FXOA 2Z4EA 4I5SA 2BASA 2BCCD 5CCHD 5ITQA 2K0BX 3LVVA 3RBXA 2BNKA 3JCUE 2YIUB 3FX0A 4WBAA 3W67A 1N7LA 1EDKA 3VOPA 1S5LX 1OLMA 1R5LA 3DOAA 1A02F 3FUTA 1URQC 2F5QA 1OX3A 5APYA 3UGJA 2CK3H 3V2QA 5BU5A 1VPCA 2M60A 1GVNA 3CF6E 2IZ1A 5TISE 1NU1D 5AVYB 4NPEA 3P8MC 1SP4A 4GEWA 5EP4A 2BEQD 2QEXP 4L76A 1DO0A 5LMNM 3TGUJ 4G4RA 2KRKA 3LMMA 2F5OA 2LVNC 2OO9A 2GQFA 2L4FA 1GJSA 1NY6A 3P7ZA 3C1LA 2A06G 1IN5A 4IOIH 2YNMD 2LVAA 1KILB 1KTMA 3H1JJ 2L09A 3SAVA 2DENA 3H1HE 2OYHA 1Y9BA 1QQWA 1JY2O 1K3XA 4UB8E 1TDZA 2EUCA 1Z59A 2PRRA 4I1LA 4OH8B 3VFDA 5IWAM 3GRVA 4ZMDA 4OVNF 2MJZA 1OKSA 3CWBG 2HLOA 1NJFA 2Q7CA 3NWLA 3H1LD 3K9OA 1Z56A 5GKNA 4H0LD 1HT2E 1X22A 4AQYM 2B3TA 4LF8M 4OGQD 3KXDA 5L8RJ 5E79E 1JY3O 5DNYA 2G8YA 4H44C 1OVVA 2YIUC 5AVWB 3CCQP 1NOHA 1KB9H 1G4AE 3S9OA 4J7PA 4YXWH 1IFPA 2JDIH 1X9VA 4X65M 3U6PA 1OFHA 2KOGA 4AQRD 1T6AA 3KOXE 1EZVD 2JY8A 4BBAA 1M1JB 2B9BA 1Q3BA 2OGUA 1H6UA 3AOEA 3H1ID 3A46A 4R4MA 4AG6A 1FDOA 1JCDA 2DKLA 3HJ8A 5KQDA 1YITP 1PV3A 3W68A 3ZC7B 2B88A 1RU3A 2A45G 4HB1A 4B7HA 3RBZA 2N9YB 3U5ZB 5FLXS 4MM3B 2WPRA 3L70D 1ZR4A 1XB2B 3HUSC 1N73B 3HE4A 1CSBA 2FYUE 1IM2A 3AV0A 3H1IJ 3T97B 4MGKE 3TF5A 2FYNC 5EP3A 3V2NA 1X37A 2ZBKB 2K9JB 3GPXA 1PL5A 1IY0A 4C7NB 2Q5UA 3F89A 3FGAD 4LF4M 4RNAA 4O9BA 5ITYA 2R32A 1TF0B 3FUUA 4IBCA 2POHA 2FXMA 1YLAA 1NJGA 1PP9D 1W5SA 2KUBA 1N32M 4NPFX 4G4QA 2QHOB 5TJHA 2N1TB 3H32B 1VL2A 1J1EB 2DW3A 1YQ3C 4DBGB 2ZXXA 5ITUA 1LTAC 3AOGA 4JI4M 1M57D 4UB6E 5L8RF 3L74G 2VF7A 5KLVJ 4FW9A 3HE5A 1NYHA 2VQFM 2ZT9B 2C9CA 5DFLA 3A42A 3RFWA 4HJGH 3THGA 4LFAM 2KS1B 3VKHA 1KQLA 1FZAA 4D6TJ 5KAFH 3JC22 1S9KD 1IBLM 1QAOA 2WWWA 1VQ7P 1FZCB 5KJ7A 5CCGD 1PJTA 2XLJA 4PD4I 2YMKA 1Z5BA 3WHKA 1NTKJ 2FY8A 4NRVA 1RF1B 4UB8H 3UZUA 4ITQA 4LJ7A 3I4VA 2BJVA 5IT9S 2ZXEB 3L74D 3KHUA 2FFJA 2E74D 4XBOA 4QNMA 3AJIB 3FYCA 3TWKA 4B7FA 4NOOB 4PV1D 5KO3A 3A3YB 4KT0J 1G3IA 2OYHC 2HYNA 3BCCE 4JI3M 2Y0QA 4GHAA 2YKQA 2DWNA 1DGHA 1OVUA 2Y0CA 3RK3D 1L0NK 2QPAA 2RKLA 1IN7A 2P58A 1TU3F 4PT5A 2ZTCA 5KPTA 1SXJC 1SQVK 3CI9A 2HFED 3TGUG 3CX5E 3GLIE 1DGGA 1RE3C 1LGHB 4R7GA 1QAQA 2E43A 2JA2A 3B7NA 1HNWM 2MROB 3GPPA 5CJ4A 2E74B 3JCUH 1HJBA 1T3TA 1RE4A 2M5ZA 1SQVE 3AEGC 3C58A 2AXTH 1VQMP 3RL0C 5K5GB 2B87B 1GL2D 5KLVK 1L8QA 2WVRA 3Q5RA 1OFCX 1LTJB 2FYNB 1R5SA 1PGYA 2R46A 1FDIA 1NTZG 2WSEH 2JUJA 3A5TA 4JBZA 2LXBA 3TDKA 3H25A 4IJFA 3U6MA 5KPZA 4M3LA 4WB4A 2P5TA 1GU4A 8CATA 1VQ9P 3W0FA 2NZ2A 2RGHA 2V6ZM 4GKKM 1Q02A 3MMPA 1HT1E 1XHBA 2VDBB 3MGNA 3CCLP 4JXJA 1NTKK 1QDTA 4A3VB 4Y99C 2UXDM 1BE3J 2UU9M 2WSEJ 2C0XA 5EXTA 1TH2A 1NWQA 1NU1G 3B5ND 2R45A 1DD4A 1M7LA 1EDIA 3L75E 2XFSA 2O1JA 5AW9B 2DZLA 2KP8A 3D71A 3KXEC 4GITA 5BVZA 3L27A 1KSFX 2FKWB 3TNUA 2KLUA 2R3CA 2ZT9C 3IAOA 1IN8A 3RK2C 3E46A 2H5XA 2EO2A 3C9PA 3VMZA 2KZUA 1L0LJ 3QWLA 4LG2A 4ASVA 5IZ7D 2FE8A 4PD4H 2KNVA 2DAKA 3WHLA 4X64M 1GL2A 4DZOA 5JI3E 2GUSA 1KMIZ 4MB7A 2I7NA 1FNNA 3L71D 1JB0J 1EE8A 1H0TA 3CCVP 1BSHA 3L70J 1PPJE 1SQPJ 4HH2A 5KAFE 1RF1C 5EFWB 3Q1MA 4JV5M 1K3WA 1URQD 3U61A 2D7HA 2Y0EA 3LW5J 1VDDA 1GK4A 1OFIA 2RH0A 3KFUG 4MH0E 3GMAA 1SFCC 1T2KC 5EXPA 3E7KA 4N78E 2LVOC 5EP1A 3SYLA 2N1TD 2NPSA 3AE1C 3BCCG 4G6ZA 1VF5C 4FCWA 1QGKB 1KYOD 2HG5D 1PJJA 1RHZB 3M0DC 3GP1A 2NPSB 1EZVG 3L73E 1PJIA 3IFMA 4Y28F 1WMKA 2LR2A 1PPJG 2IX7C 2A06E 1PIXA 4CIZA 1BGYE 1KFMA 2JZ1A 2V7QH 4AW4A 2KRUA 3D6ZA 1NTZK 3HHXA 1DH3A 1IN4A 1OAOC 3FWLA 4Z8XA 1KORA 2QJYB 4DT0A 1YJNP 1MU5A 2QIWA 5KLVG 1QLED 5E26A 1JCCA 3FUXA 1QL2A 3U6SA 1N86A 3FTDA 3SWKA 3HX3A 1URQB 3SHGB 4CGYB 1ZOYC 4I2LC 5AW5B 3H1HJ 3L70G 1ZR2A 1W5TA 2QJKB 1Z6TA 4OMKA 1LWUA 2OQ4A 1L4AC 1NO1A 3LCUA 2KZSA 4EIJA 2R0IA 2FYUG 4TLFA 2IDBA 1GL6A 2N1TA 2NPSD 4KHPM 3P8CE 5KLVD 1MX0A 1OIPA 4H0LC 3OTOM 1SXJE 2Z3XA 4D81A 4GDOA 4AYCA 4DV1M 3H1KG 4AZFA 3VMXA 4AI6A 1KILE 2CEAA 3M6AA 1ORYB 3BOSA 1R2YA 2LVPC 3Q8XA 4UYBA 2CHQA 3EWKA 3B71A 1FZCA 3C3DA 3B8EB 3U60A 2XV5A 2J5UA 3NFQA 2QVAA 2K88A 3BRTB 4PD4E 2Z7JA 1VQ4P 4PDGA 1NTZD 2R5BA 2UXCM 3U1AA 3H1KD 1LWUC 4YY3M 1SLQA 2ZANA 1IK7A 1GLNA 2PP6A 1HQYE 1S2EA 3AE4C 1NV9A 4X62M 4LZJA 2LXCB 1E9SA 3DZDA 1RF0A 2V4HA 3KSJA 3JSVC 4DOJA 4XA4A 2FYUJ 2DVWB 3HU3A 1DV0A 3I56P 1RY3A 4UB6H 2UUCM 2HPCB 1PM5A 4IBEA 5GTIE 3GRYA 1KILD 3SYKA 2Y0DA 4LY6A 3H1KJ 2O01F 1NTMJ 5GTHH 1AVYA 4WY4C 1GL2C 1KB9D 3HJQA 3HZJA 1ZQ9A 4LF7M 3G9RA 4BRYB 1J1DB 1G8PA 1SFCD 2KK7A 1T2KD 1L1ZA 3NBXX 3A98B 5KPRA 1T8ZA 1S5LH 2GM4A 2KHHA 4GKGA 1O6UA 1FJKA 2J7NA 2XZFA 1VQ5P 2JO1A 1ZRTE 2Q2EB 3L37A 3H1JG 1NU1J 1JM0A 3L71G 3M91A 3B5NA 2W6BA 4L8RC 3W0LB 1NAFA 1UIIA 1SG9A 1HJPA 4NXMM 2WSFJ 3GLFE 4DR7M 1OTRA 4RF1A 2Z4RA 4WW0A 2Q1KA 3SMPA 1MFTA 2SPZA 4B86A 3CX5I 1F4IA 3NTNA 3II6A 4TT3H 3TSIA 2UXBM 3QYEA 1NV8A 4Q7JA 4GMQA 4NPDA 1JNMA 2QJKC 3CXHH 1NHGC 3MHVC 3PVSA 1G2CA 2KYVA 2G3AA 4B3TM 1H8AA 1KILA 2BWEA 4OU7A 2E74C 4IBKA 2K47A 2LXEA 3KP1E 4BLCA 1G2CB 5KTBA 1VEKA 4S12A 3VP8A 1NTMG 3TWMA 2CUZA 4B7GA 1J09A 5AW6B 1SFCA 1X8YA 1YTZT 2XGNA 1FZBA 1VQ8P 5AW4B 3Q2YA 4OW0A 2JY5A 4U7JA 1P84H 4DV4M 3GLGE 3FTEA 2CPBA 2QJPB 1G41A 3EFFK 4I6MC 1FDMA 2XU6A 3L25A 2DHRA 1KYOI 1IXZA 2LWXA 4R71A 4FD2A 1W2BO 3BCCJ 2QRXA 3V5BA 2WSCJ 4LLHA 1K05A 1T6OA 2E75B 2IBZD 4K3AA 2L91A 3GLGB 3AE8C 2PFXA 2F5NA 2D2CC 1GKIA 2OTLP 4NSOB 3GLFA 1Q86Q 1JY3N 4FMMA 3BATA 4PD4D 3O6QB 4B3RM 1V33A 1LTTC 4W7ZA 4IBDA 2BEZF 2IYOA 2Q3EA 4LJ8A 1HGZA 2K6BA 4XFJA 3SWFA 4NC6A 1JR3D 1YUBA 1L0NJ 2W6JH 4PCZA 2E76D 3MK6A 1DD3A 2W90A 3VK8A 3A0HH 3CCEP 1I4WA 2XDJA 1SQVJ 2LKMA 3SHFA 2W6AA 4W80A 3V6IA 1JTHB 3KPEA 1QZEA 1N73A 4JN6A 5C18A 1AQTA 1U7JA 3VMYA 5FTMA 2ZAMA 2QG4A 3VLFB 1MJGM 3C9IA 1PRBA 3PNVA 1CUKA 4JI8M 1R6BX 3QH9A 1KN7A 1JO5A 4L6V6 2X49A 2JNHA 3I55P 1XXHA 2HHHM 1M1JC 3L74J 1QAMA 2PGDA 3KDSE 3DA1A 4RO0A 3N7NA 3E21A 4GC9A 2Y9YA 3VYIA 2L5GB 1VQNP 3PHLA 1IY2A 1OVRA 3J7AS 3HJSA 3E9SA 3IR9A 4TLGA 4LRSA 3Q3DA 3T1HM 1M8OB 4NRWA 2D4QA 2UUBM 4N78D 1DEEG 2ZTDA 1BDCA 1GO5A 5ITRA 4L4UA 3GF7A 1NTKG 3WU2H 4AKIA 4QOSA 1FZEA 1LP1B 2WSSH 1N73C 1JTHA 3VK7A 7CATA 1E5WA 1PZQA 1L0LE 3BBZA 1PFIA 1BDDA 3G3ZA 2NRGA 1JY3P 1KQSO 1YTZI 3Q8GA 3CWBJ 4Y99B 3G71P 3OA7A 4HLQA 2YKPA 1JR3E 2HWJA 2WPQA 1N78A 2LHCA 3RGUA 1U57A 2W8ZA 3FWNA 4CHTB 3R2PA 1IXSB 2AHMA 2V1UA 2Q3IA 3L70E 1VEJA 3B5NB 1R7RA 1EXJA 1HNZM 1SQQE 3ILKA 3L72J 3H1JD 4LJ9A 1NH4A 2ERCA 3A0HE 3CCSP 3L28A 5E79H 1HR0M 4N3YB 3AFHA 3HGIA 1J1EC 2QNJA 3OAKA 4MN4C 2IYPA 4C46A 3A45A 2M5AA 4FWGA 3KOZE 2M5AB 4OVZA 4IL6E 3GQ3A 2K9YA 4BB9A 1ZMEC 2L2DA 4G4NA 2JKVA 3H32A 3GHGA 4GKJM 1KQFB 3FYDA 4JI5M 1AUAA 1FOSE 2E75D 3L73J 1GDTA 3P8CD 2EJSA 3LIEA 4LRTA 4CISA 1QL1A 2EA0A 4I7ZB 1NHWC 2E2XA 2JY6B 1BGYJ 1YBKA 5AW3B 4DV0M 2HODB 4W5WA 1VQLP 3UIAA 1NTMD 1TDHA 1SVFA 2E5TA 1S3SA 4MGHA 2MR9A 1MKMA 2C9LY 4LZZA 3FD9A 1TH3A 2P1JA 4PV1C 2YXRB 4LC1A 1E9RA 1KFVA 2QM7A 3R4YA 1CW5A 2OPFA 5KLIC 5APTA 2WT7B 3TL4X 4P16A 3HWSA 4OMJA 3LQQA 1GABA 3GLIA 2QM8A 3K9PA 1Y8GA 1XWIA 3GLIB 1MZ9A 1YYCA 2E76B 3HRNA 4HYTB 1G71A 1NGMB 5M1BA 2L7HA 3L72G 4JF7A 1BE3G 1GW4A 2KSEA 2QBYA 1KFNA 1Y47A 2DNAA 5CBOA 1LJ2A 2M3EA 5AVRB 4DR5M 1WGLA 2EKKA 3J81S 1SS1A 1OLME 3IG5A 3B5NC 2XZUA 2QJYC 2Z5IA 3A2AA 2Z4SA 3IECA 2VRSA 2ZVNB 2Q9IA 4DJGA 2LNHC 3MZWB 5GTHE 5DYGA 4M9XA 5APWA 2QA4P 2C99A 5CCHA 4I4LA 1MUUA 1LWUB 4FCVA 3H1IE 2KW0A 3GQ4A 1T43A 4IBIA 1L0ND 2F4VM 5FSWA 3BCCD 3J2PB 4JQ0D 1SQXK 5AW1B 1IFNA 2HPCA 4KODA 1JR3A 3K5BA 3SBJA 4M9ZA 5A2QS 1EXIA 2HL7A 1A5TA 3U6CA 3PNYA 2L6OA 2FOIC 1PPJD 2DZOB 5APUA 2JWAA 5AW0B 4CJ6A 2OYIC 2OYOA 1FBMA 1Z5CA 4DUYM 2D7GA 5DJUB 1GL2B 1QEXA 2YXQB 2KEBA 3AE6C 3C8VA 4QMAA 4NL4H 4LF9M 4HKZH 1VF5D 2DI0A 3GLFB 4GHLA 1ZP0C 4B3MM 2DWMA 3RL0g 1G1IA 2HR3A 4PV1B 3KSXA 1OJLA 1SQBK 1ZMUA 3O6QA 1IFDA 1KYOE 4CPGA 1P84D 3UK6A 1JY2P 2Z5HA 3RK3E 3IN6A 4MGIE 5CCGC 1SXJB 1BVSA 1IZNB 4BXLA 5DYIA 1USDA 1BCCE 1EC5A 1SQBE 3LW5F 1H89A 4JPZB 1NTKD 3KZIH 3LW5H 4DUZM 5B66H 1VQ1A 1NNJA 2KNCA 5C39A 4L78A 2H88C 4G3OA 1VDFA 3UMMA 3E1IA 2FFDB 2A45I 1FC2C 4Y28J 4GH9A 1FZFA 2J5YA 1NJIQ 4DV6M 3G6EP 3PLNA 1N75A 1M90Q 1NU1E 3M0EA 1GK6A 3GPUA 2FBWC 4I7ZC 1AVOA 1L4AD 2Q6QA 2J59M 2BJWA 2Z8YM 3VDPA 5KJ7D 3AEAC 1JEKA 3J7BA 4FWHA 2DHYA 2E75C 2JWDA 5H2FH 3A0BE 3K2LA 3CCJP 3MUDA 1SQXJ 4JYCA 1LT9C 1X0TA 3T1YM 1UM8A 1NTZJ 5FTLA 1N8RQ 3HD7C 3HHWA 4LJ6A 4JI0M 1G1JA 4IBJA 2M8RA 2DXIA 1A02J 4H13D 1M1JA 2DZNB 4LGMA 4D6TD 3ZH9B 2MGWA 3EFGA 1I94M 2MH8A 3GPYA 1KD1Q 3L2AA 4IBGA 4II7A 3L73D 2D2CB 3M7GA 1L1TA 3KYQA 2YO3A 2QCUA 1XTCC 1E32A 1LTMA 2WSEF 4WVZA 4F1IA 3WUVA 2QENA 5IREB 3I04M 4IBFA 1RF1A 1NSFA 2ZAOA 4GRIA 4IL6X 4KHXA 3S4RA 2IBZI 4LJ4A 2JWSA 1AJYA 1D0MA 5BPVA 4U3FG 4EIWA 1XXHB 3R9XB 2XEPA 3KS4A 3V4WA 2R5DA 4WY4D 2VQEM 3E4RA 3ZQJA 1J5EM 3CF2A 1BE3D 3KDPB 1BGYG 1NNUC 2KDLA 2OYIB 4C7NA 3K92A 1SQBD 4BWNA 3H4MA 3VMAA 5AVSB 4LJ5A 1L0LK 2K9JA 2ZVOB 3L75J 2MKVA 4DR6M 2WZ7A 4YXDC 3VTPC 1D0LA 4X66M 2H89C 1GD2E 1VDLA 1QVRA 3UJNA 1Q81Q 5APVA 1N7SB 4GT1A 3D6YA 2FH0A 1K82A 5AVTB 1WIVA 3USSA 3HD7B 2WSCF 3HUSB 3CX5H 3M0AA 4M9SA 5DJTB 1QDRA 1BGYD 2XFTA 4EYYQ 3SMSA 2OTJP 2OYHB 3CX5D 3AEBC 3TPZA 1RQUA 1DGBA 1IXSA 3EIHA 2CE7A 2FYUK 3IF4A 3LQRA 1PGQA 2HODA 3RK3C 1OMIA 1WR1B 4ZKPA 5AVQB 1TGUA 2R18A
chains in the Genus database with same CATH topology
3HX3A 1AUAA 1OIPA 3B7QA 3PEGA 4OMJA 3B7NA 3Q8GA 4TLGA 2E2XA 4CIZA 2D4QA 4J7QA 3W67A 4OMKA 1O6UA 1OIZA 4CJ6A 3HY5A 1OLMA 4J7PA 3B74A 1R5LA 4M8ZA 4UYBA 3PG7A 3W68A 4FMMA 3P7ZA 3B7ZA 1OLME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX3 A;  1AUA A;  1OIP A;  3B7Q A;  3PEG A;  4OMJ A;  3B7N A;  3Q8G A;  4TLG A;  2E2X A;  4CIZ A;  2D4Q A;  4J7Q A;  3W67 A;  4OMK A;  1O6U A;  1OIZ A;  4CJ6 A;  3HY5 A;  1OLM A;  4J7P A;  3B74 A;  1R5L A;  4M8Z A;  4UYB A;  3PG7 A;  3W68 A;  4FMM A;  3P7Z A;  3B7Z A;  1OLM E; 
#chains in the Genus database with same CATH topology
 1S3J A;  2QQ8 A;  3TQS A;  4AG5 A;  3V76 A;  3OW2 O;  1LNQ A;  2KA6 B;  2AXC A;  3B4S A;  4AUW A;  2N1T C;  2WSF H;  3HY5 A;  2IBZ G;  1L4A B;  2K3R A;  1MN3 A;  3FE3 A;  1EIJ A;  5CCG A;  1S1C X;  1XTG B;  1IQP A;  3CTW B;  2FYZ A;  3H1H G;  3SFE C;  2VII A;  4PJ0 E;  4GC5 A;  3L75 G;  2I7P A;  3BVH A;  3RGS A;  2R6F A;  3LVW A;  3CPW O;  1LT9 B;  3BAS A;  1URQ A;  2M0B A;  3CWB E;  4PJ0 H;  1JY2 N;  3JR5 A;  1ZXG A;  1YQ4 C;  4OVZ B;  4DCK A;  5KAI H;  1RH5 B;  1FS0 E;  2DAM A;  3K1J A;  3WU2 E;  1AQ5 A;  2BWB A;  1OZH A;  3OJA B;  4MGZ E;  4EOT A;  1YE9 A;  1JUN A;  2YQZ A;  2R4E A;  1OW8 A;  2K1A A;  1SQV D;  1XXH E;  1N7S C;  2C96 A;  3NXS A;  2QSF X;  3L72 E;  1SQP D;  2PAJ A;  2WPV B;  3H1H D;  1NO4 A;  3FTF A;  3KOW E;  2D2C D;  5EP2 A;  3LID A;  2IZ0 A;  4H13 C;  4WP2 A;  1LTS C;  5EXS A;  3VN0 A;  2F5S A;  2YO2 A;  3M9B A;  2KS1 A;  3FKE A;  2CPS A;  4BRY A;  5EXX A;  1AV1 A;  2XF3 A;  3B7Z A;  4OGQ B;  1ZW0 A;  5AVX B;  1ZV8 A;  4W7Y A;  1AA0 A;  4EI2 A;  3U61 B;  3Q5S A;  4QOZ C;  1TH4 A;  1KYI A;  1CI6 B;  2E76 C;  2KI7 B;  1NKZ B;  1QVF O;  2E5Y A;  2YMY A;  3GHG C;  1VQP P;  2O5R A;  1L4A A;  1D2N A;  3GG2 A;  2ZYG A;  1ZV1 A;  2KNZ A;  1LTG C;  4WY4 B;  3F92 A;  5EJC A;  2R3S A;  3GLH E;  4FWD A;  2P67 A;  1PJQ A;  1KB9 E;  1J1D C;  1NY5 A;  4WWI A;  1P3Q Q;  2XKM A;  4LGY A;  4FCT A;  2FFD A;  3FXE A;  2IPP A;  2Y0T A;  3FRI A;  3SFZ A;  3I4Y A;  1PGP A;  2BCC J;  2KNC B;  1RQV A;  2ZYD A;  4MGY E;  3T38 A;  2ZJS E;  3L4F A;  3B74 A;  3JR4 A;  2H43 A;  2AEM A;  1SFC B;  2WIT A;  2G8L A;  2LBC A;  3M06 A;  3I5C A;  2G3Q A;  2CWB A;  4U3F D;  1D7M A;  2QSI A;  4LF5 M;  1IK9 A;  1K8A Q;  1D0K A;  2DWL A;  2GA1 A;  2ZAE B;  1DEB A;  1Q90 D;  3L36 A;  4DR3 M;  1SQQ G;  1KQG B;  2IFN A;  5B5E E;  1SQB G;  5KLI B;  4JI1 M;  1J2J B;  1DO2 A;  5ITX A;  1KC8 Q;  2GNO A;  1QYR A;  3MTU E;  5FTK A;  2NQ8 C;  3KP0 E;  3A0B H;  5B66 E;  2CP8 A;  3FUV A;  1WRG A;  1XNR M;  2R62 A;  3K8Z A;  1DIP A;  3MUD C;  2H1R A;  3U6Q A;  1KZU B;  1QX8 A;  4H44 D;  1NU1 K;  4U3F J;  2XSZ D;  4OGQ C;  1NTK E;  3O8Z A;  2FFD C;  3RK2 D;  1ZMW A;  1IBK M;  3L71 E;  1R4G A;  1IC2 A;  2R44 A;  4JYA M;  2P7J A;  4WY4 A;  3AL0 C;  5KKZ B;  1S72 P;  3CME P;  1T3U A;  1RE4 C;  4JI7 M;  1ZLL A;  3M9H A;  1IFM A;  2KZJ A;  4GOD A;  4PD2 A;  3AEF C;  3AOE C;  2RKO A;  3KVW A;  1PP9 E;  3BXW A;  5F3W A;  4AKG A;  3HD7 D;  3H4J A;  5APS A;  1GL7 A;  2HKJ A;  5C1B A;  1NKN A;  2P2U A;  1G59 A;  2BCC G;  1Q7Y Q;  3D8L A;  3QAU A;  1M56 D;  4Z1M H;  1RF0 C;  3H1L J;  5JI2 E;  5BR8 M;  4JI2 M;  1ZAE A;  3J27 B;  1LT1 A;  2H7H A;  2K37 A;  4LGD E;  1OIZ A;  1QUS A;  1QUT A;  3L72 D;  4M8Z A;  4KJM A;  2OTK E;  1SXJ D;  2WTY A;  3T15 A;  4GIF A;  4GOE A;  4EDF A;  4L15 A;  1SQB J;  2LH0 A;  2OOB A;  3J80 S;  3GLH B;  3CGW A;  3VDU A;  2W27 A;  5CMZ A;  3L75 D;  2HAK A;  4KLN A;  2IFM A;  3AE3 C;  4HEO A;  4IIW A;  2YNY A;  4J7Q A;  2O01 J;  1VF5 B;  2Y20 A;  1N7S A;  2HCB A;  2YFQ A;  2RGO A;  1HJ0 A;  2A06 D;  4IFF A;  4I8O A;  2RN0 A;  3PJS K;  3RL0 D;  1L0N G;  1VQ6 P;  1JB0 F;  3EIE A;  1FE6 A;  2WSC H;  4JI6 M;  2KB7 P;  3PP5 A;  4LFC M;  3TYY A;  1EDL A;  1YIJ P;  3NMD A;  4FVM A;  2VF8 A;  3HD7 A;  4LF6 M;  4AKH A;  1SQV G;  1ZN5 A;  1FJG M;  3Q5P A;  2O01 H;  1VEG A;  1JMB A;  3D8B A;  3GW6 A;  2AEJ A;  2M3B A;  3U60 B;  2X8A A;  1HNX M;  5CJ0 A;  1VQO P;  2JJL A;  1W5C E;  1L2B A;  2KSJ A;  1M1K Q;  4LFB M;  2C9N Y;  2L4E A;  3SAR A;  1FAV A;  2LTU A;  2CV1 A;  2QP9 X;  2V1C A;  2ZYA A;  3G4S P;  4ANR A;  2YR0 A;  1PGJ A;  2G5G X;  5ITT A;  1IFY A;  1RE3 A;  1ZMV A;  1T3J A;  1YI2 P;  1KV4 A;  3SAT A;  3KOY E;  4R4L A;  3WMM 0;  1E94 E;  4DV7 M;  3AED C;  3H6P A;  3ITK A;  1XMQ M;  1QAN A;  3EQ2 A;  3E1R A;  2WMM A;  2QBY B;  3KZI E;  1AFO A;  3L35 A;  3RGP A;  2L7I A;  1N7S D;  2C9O A;  3SAU A;  3M9Q A;  3A7O A;  1S9K E;  4N6J A;  2X4A A;  1TTE A;  1L0L D;  3FXD A;  1DGH B;  4LJA A;  3VKG A;  1HBW A;  1JQJ C;  1L2C A;  1UIX A;  5CBN A;  1BCC G;  2CHV A;  3TGU E;  3D70 A;  2JXN A;  2KZI A;  1N2D C;  2JP3 A;  2LHG A;  3C3E A;  4GIP A;  4DV3 M;  1USE A;  2I1K A;  1GJT A;  1SQP E;  3P7K A;  4I81 A;  3VP9 A;  5KKZ C;  2XZR A;  1JOC A;  1IJD B;  3PH0 A;  3AEE C;  2RRU A;  1HF9 A;  2D7E A;  1OWA A;  2OAR A;  1XC8 A;  4C7R A;  3AE7 C;  4XE5 B;  1KYO H;  4M0D A;  3H1J E;  3TE6 A;  3CCU P;  1FU1 A;  5LMU M;  5KQ8 A;  2OOA A;  4ZNC A;  1L0L G;  1C1K A;  4G4O A;  1NHL A;  3GF3 A;  1BSN A;  4ZKU A;  3U6O A;  3MJ5 A;  3AEC C;  3I01 M;  4F2L A;  1SQX D;  5AW2 B;  1YHQ P;  3TWL A;  1N33 M;  5KJ7 C;  3CF0 A;  3ZCB B;  1KIL C;  4L73 A;  1DX7 A;  3CD6 P;  1WGN A;  4D6T G;  2B89 A;  3RL0 B;  1HUC A;  2A45 H;  3B9P A;  2XNX A;  4Z6Y A;  4YPC A;  4UN2 B;  1CI6 A;  5CCH C;  1LTJ C;  3SFD C;  4D82 A;  1EZV E;  3L73 G;  2I1J A;  2KLV A;  1Q39 A;  3P32 A;  3I51 A;  1GTW A;  2O25 A;  1UFZ A;  1SQQ J;  1Y8A A;  2F5P A;  4JYB A;  2MJ5 B;  1SQX G;  1YJ9 P;  1IFI A;  3WUT A;  3PTZ A;  4L75 A;  1V92 A;  2O3J A;  2ZFC A;  2W83 C;  2CHG A;  5FTN A;  4RF0 A;  1MFZ A;  4HL4 A;  3HTK A;  3T97 A;  5BU8 B;  3CC4 P;  2C0W A;  2XSZ A;  4DR2 M;  5AVV B;  3GQ5 A;  1GZL A;  3MP7 B;  4OWF A;  1X79 B;  2JP7 A;  4QNR A;  3SAS A;  1NVM A;  3HU1 A;  1XNQ M;  1H0T B;  2DAI A;  5AVU B;  2NPS C;  1HQC A;  3GLG A;  3U6E A;  3TK1 A;  1HWT C;  3CC2 P;  2B87 A;  4ZPX A;  2WPS A;  3SSU A;  2ZT9 D;  5H2F E;  3JAM S;  2APL A;  2J7O A;  1CZQ A;  3U6D A;  4DR4 M;  3CWB D;  3KQG A;  3L29 A;  3H1L G;  1S5L E;  4XGI A;  3SAW A;  4RKU J;  5ITX E;  3AE5 C;  4YHH M;  1LT9 A;  3B7Q A;  1IFJ A;  2WZJ A;  4NSR A;  1U7M A;  4RKU F;  4L74 A;  1VG5 A;  3GO8 A;  2P10 A;  1SXJ A;  2OQQ A;  3U1C A;  1L2D A;  1FJP A;  1R2Z A;  3HU2 A;  1H88 A;  2WSF F;  3TNU B;  3V4Q A;  2LVQ D;  1FZC C;  1QVG O;  2QJP C;  1Q82 Q;  4L16 A;  4QHT A;  1L2P A;  3TGU D;  1K9M Q;  4A7P A;  3WUU A;  4D80 A;  2WT7 A;  4REZ A;  4B08 A;  3CXH I;  3PEG A;  1VQK P;  5KLV E;  1C7Y A;  1EFU B;  3CXH D;  5H37 D;  3U6L A;  3HE4 B;  5AW7 B;  1N34 M;  1S4X A;  4LCB A;  3M0D A;  5E6J A;  3L26 A;  4KT0 F;  2UUA M;  4K35 A;  2AEF A;  3KW6 A;  3QWO C;  3HTK B;  3N4X A;  2C5R A;  2XND H;  2OYI A;  3T6P A;  1SQQ K;  2FNA A;  4KO8 A;  4WUR A;  4DV2 M;  3PG7 A;  4D6T E;  3ZDM A;  3H1K E;  1NTM E;  4RJT A;  2KNA A;  4IJE A;  5APX A;  3LCV B;  1OXZ A;  2CV2 A;  2IBZ E;  1MV8 A;  1HGV A;  4GOF A;  2JR8 A;  1P84 E;  2BCC E;  4IL6 H;  1K73 Q;  3AKZ A;  1NTM K;  1OW6 A;  1WJ7 A;  3CCM P;  1LTI C;  4OX9 M;  1BCC D;  3V2R A;  4PDI A;  2N9B A;  3GHG B;  1LP1 A;  3HHY A;  2Y21 A;  3FTC A;  2N35 A;  2AXT E;  1LV7 A;  3IHP A;  1HTL C;  5TIS H;  3B89 A;  1N77 A;  3U5Z A;  2EKF A;  2GUV A;  2WQY C;  1TR8 A;  2XH9 A;  1IY1 A;  1SQP G;  5EQT A;  3MHV A;  3AE2 C;  4XK8 F;  3CC7 P;  1IN6 A;  2C98 A;  1KB9 I;  4H0L B;  1EQ7 A;  4DR1 M;  5AW8 B;  3CMA P;  2W82 A;  1HH0 A;  3SWY A;  1W2E A;  5FTJ A;  2ITA A;  3MIW A;  2KIK A;  1BCC J;  2O1K A;  2CFO A;  3GLH A;  3R8F A;  1J7K A;  4U3F E;  1LTJ A;  2V7Q J;  3QYB A;  4DV5 M;  3HKP A;  2UWJ E;  1GU5 A;  3L71 J;  5APQ A;  3V2P A;  3U59 A;  3PXG A;  1YJW P;  4B3S M;  3GRR A;  3HHZ A;  2I8D A;  1Q3C A;  3GRU A;  1PP9 J;  2R4J A;  1ZRT D;  1IBM M;  3KS8 A;  1N36 M;  1XMO M;  3CCR P;  1IXR C;  2QE7 H;  1PGO A;  1K04 A;  4ASW A;  2E5L M;  3H1I G;  1OW7 A;  3H1L E;  3HUS A;  2DAE A;  4M0W A;  5B5E H;  3PRJ A;  2KXP B;  3RK3 B;  3CXH E;  1DGF A;  5GTI H;  3HE5 B;  1NVO A;  2K9D A;  2A5Y B;  4K0K M;  4YTP C;  1SQX E;  5CHX A;  1WHC A;  1NTZ E;  4IFD K;  1Q2N A;  3IG8 A;  4H44 B;  1GW3 A;  2R65 A;  1LTB C;  1Z5A A;  1BE3 E;  3CL3 D;  3BRV B;  3S1K A;  1L0N E;  4RES B;  2ZM6 M;  2CV0 A;  2DWZ B;  1WT6 A;  3CLQ A;  3PFI A;  2QZ4 A;  3ABV C;  1P84 I;  3F5H A;  1PJS A;  1SQQ D;  3SC3 A;  3FRH A;  3GLM A;  4R3D A;  2J58 A;  2DAG A;  2KXE A;  4IFM A;  1OAI A;  2RMZ A;  4P17 A;  1YSY A;  1E79 H;  4TUW A;  2H8P D;  5AVZ B;  2FS1 A;  3DFZ A;  1EZV I;  2E42 A;  4IBB A;  1FOS F;  1SQP K;  4QHS A;  2FXP A;  1AIP C;  1PP9 G;  1FZG A;  1V34 A;  4NXN M;  2JEE A;  1OQY A;  3AE9 C;  3FUW A;  1R8E A;  3MD0 A;  1QZM A;  3RE8 A;  3L74 E;  2JZ0 A;  1GMJ A;  2FYU D;  5KAI E;  1JMM A;  1EDJ A;  2JY7 A;  2YKO A;  2Y9Z A;  1WXQ A;  1IO4 A;  3NBI A;  4H13 B;  1NAY A;  3RK2 B;  2CRU A;  1HVV A;  2O01 N;  2FXO A;  2Z4E A;  4I5S A;  2BAS A;  2BCC D;  5CCH D;  5ITQ A;  2K0B X;  3LVV A;  3RBX A;  2BNK A;  3JCU E;  2YIU B;  3FX0 A;  4WBA A;  3W67 A;  1N7L A;  1EDK A;  3VOP A;  1S5L X;  1OLM A;  1R5L A;  3DOA A;  1A02 F;  3FUT A;  1URQ C;  2F5Q A;  1OX3 A;  5APY A;  3UGJ A;  2CK3 H;  3V2Q A;  5BU5 A;  1VPC A;  2M60 A;  1GVN A;  3CF6 E;  2IZ1 A;  5TIS E;  1NU1 D;  5AVY B;  4NPE A;  3P8M C;  1SP4 A;  4GEW A;  5EP4 A;  2BEQ D;  2QEX P;  4L76 A;  1DO0 A;  5LMN M;  3TGU J;  4G4R A;  2KRK A;  3LMM A;  2F5O A;  2LVN C;  2OO9 A;  2GQF A;  2L4F A;  1GJS A;  1NY6 A;  3P7Z A;  3C1L A;  2A06 G;  1IN5 A;  4IOI H;  2YNM D;  2LVA A;  1KIL B;  1KTM A;  3H1J J;  2L09 A;  3SAV A;  2DEN A;  3H1H E;  2OYH A;  1Y9B A;  1QQW A;  1JY2 O;  1K3X A;  4UB8 E;  1TDZ A;  2EUC A;  1Z59 A;  2PRR A;  4I1L A;  4OH8 B;  3VFD A;  5IWA M;  3GRV A;  4ZMD A;  4OVN F;  2MJZ A;  1OKS A;  3CWB G;  2HLO A;  1NJF A;  2Q7C A;  3NWL A;  3H1L D;  3K9O A;  1Z56 A;  5GKN A;  4H0L D;  1HT2 E;  1X22 A;  4AQY M;  2B3T A;  4LF8 M;  4OGQ D;  3KXD A;  5L8R J;  5E79 E;  1JY3 O;  5DNY A;  2G8Y A;  4H44 C;  1OVV A;  2YIU C;  5AVW B;  3CCQ P;  1NOH A;  1KB9 H;  1G4A E;  3S9O A;  4J7P A;  4YXW H;  1IFP A;  2JDI H;  1X9V A;  4X65 M;  3U6P A;  1OFH A;  2KOG A;  4AQR D;  1T6A A;  3KOX E;  1EZV D;  2JY8 A;  4BBA A;  1M1J B;  2B9B A;  1Q3B A;  2OGU A;  1H6U A;  3AOE A;  3H1I D;  3A46 A;  4R4M A;  4AG6 A;  1FDO A;  1JCD A;  2DKL A;  3HJ8 A;  5KQD A;  1YIT P;  1PV3 A;  3W68 A;  3ZC7 B;  2B88 A;  1RU3 A;  2A45 G;  4HB1 A;  4B7H A;  3RBZ A;  2N9Y B;  3U5Z B;  5FLX S;  4MM3 B;  2WPR A;  3L70 D;  1ZR4 A;  1XB2 B;  3HUS C;  1N73 B;  3HE4 A;  1CSB A;  2FYU E;  1IM2 A;  3AV0 A;  3H1I J;  3T97 B;  4MGK E;  3TF5 A;  2FYN C;  5EP3 A;  3V2N A;  1X37 A;  2ZBK B;  2K9J B;  3GPX A;  1PL5 A;  1IY0 A;  4C7N B;  2Q5U A;  3F89 A;  3FGA D;  4LF4 M;  4RNA A;  4O9B A;  5ITY A;  2R32 A;  1TF0 B;  3FUU A;  4IBC A;  2POH A;  2FXM A;  1YLA A;  1NJG A;  1PP9 D;  1W5S A;  2KUB A;  1N32 M;  4NPF X;  4G4Q A;  2QHO B;  5TJH A;  2N1T B;  3H32 B;  1VL2 A;  1J1E B;  2DW3 A;  1YQ3 C;  4DBG B;  2ZXX A;  5ITU A;  1LTA C;  3AOG A;  4JI4 M;  1M57 D;  4UB6 E;  5L8R F;  3L74 G;  2VF7 A;  5KLV J;  4FW9 A;  3HE5 A;  1NYH A;  2VQF M;  2ZT9 B;  2C9C A;  5DFL A;  3A42 A;  3RFW A;  4HJG H;  3THG A;  4LFA M;  2KS1 B;  3VKH A;  1KQL A;  1FZA A;  4D6T J;  5KAF H;  3JC2 2;  1S9K D;  1IBL M;  1QAO A;  2WWW A;  1VQ7 P;  1FZC B;  5KJ7 A;  5CCG D;  1PJT A;  2XLJ A;  4PD4 I;  2YMK A;  1Z5B A;  3WHK A;  1NTK J;  2FY8 A;  4NRV A;  1RF1 B;  4UB8 H;  3UZU A;  4ITQ A;  4LJ7 A;  3I4V A;  2BJV A;  5IT9 S;  2ZXE B;  3L74 D;  3KHU A;  2FFJ A;  2E74 D;  4XBO A;  4QNM A;  3AJI B;  3FYC A;  3TWK A;  4B7F A;  4NOO B;  4PV1 D;  5KO3 A;  3A3Y B;  4KT0 J;  1G3I A;  2OYH C;  2HYN A;  3BCC E;  4JI3 M;  2Y0Q A;  4GHA A;  2YKQ A;  2DWN A;  1DGH A;  1OVU A;  2Y0C A;  3RK3 D;  1L0N K;  2QPA A;  2RKL A;  1IN7 A;  2P58 A;  1TU3 F;  4PT5 A;  2ZTC A;  5KPT A;  1SXJ C;  1SQV K;  3CI9 A;  2HFE D;  3TGU G;  3CX5 E;  3GLI E;  1DGG A;  1RE3 C;  1LGH B;  4R7G A;  1QAQ A;  2E43 A;  2JA2 A;  3B7N A;  1HNW M;  2MRO B;  3GPP A;  5CJ4 A;  2E74 B;  3JCU H;  1HJB A;  1T3T A;  1RE4 A;  2M5Z A;  1SQV E;  3AEG C;  3C58 A;  2AXT H;  1VQM P;  3RL0 C;  5K5G B;  2B87 B;  1GL2 D;  5KLV K;  1L8Q A;  2WVR A;  3Q5R A;  1OFC X;  1LTJ B;  2FYN B;  1R5S A;  1PGY A;  2R46 A;  1FDI A;  1NTZ G;  2WSE H;  2JUJ A;  3A5T A;  4JBZ A;  2LXB A;  3TDK A;  3H25 A;  4IJF A;  3U6M A;  5KPZ A;  4M3L A;  4WB4 A;  2P5T A;  1GU4 A;  8CAT A;  1VQ9 P;  3W0F A;  2NZ2 A;  2RGH A;  2V6Z M;  4GKK M;  1Q02 A;  3MMP A;  1HT1 E;  1XHB A;  2VDB B;  3MGN A;  3CCL P;  4JXJ A;  1NTK K;  1QDT A;  4A3V B;  4Y99 C;  2UXD M;  1BE3 J;  2UU9 M;  2WSE J;  2C0X A;  5EXT A;  1TH2 A;  1NWQ A;  1NU1 G;  3B5N D;  2R45 A;  1DD4 A;  1M7L A;  1EDI A;  3L75 E;  2XFS A;  2O1J A;  5AW9 B;  2DZL A;  2KP8 A;  3D71 A;  3KXE C;  4GIT A;  5BVZ A;  3L27 A;  1KSF X;  2FKW B;  3TNU A;  2KLU A;  2R3C A;  2ZT9 C;  3IAO A;  1IN8 A;  3RK2 C;  3E46 A;  2H5X A;  2EO2 A;  3C9P A;  3VMZ A;  2KZU A;  1L0L J;  3QWL A;  4LG2 A;  4ASV A;  5IZ7 D;  2FE8 A;  4PD4 H;  2KNV A;  2DAK A;  3WHL A;  4X64 M;  1GL2 A;  4DZO A;  5JI3 E;  2GUS A;  1KMI Z;  4MB7 A;  2I7N A;  1FNN A;  3L71 D;  1JB0 J;  1EE8 A;  1H0T A;  3CCV P;  1BSH A;  3L70 J;  1PPJ E;  1SQP J;  4HH2 A;  5KAF E;  1RF1 C;  5EFW B;  3Q1M A;  4JV5 M;  1K3W A;  1URQ D;  3U61 A;  2D7H A;  2Y0E A;  3LW5 J;  1VDD A;  1GK4 A;  1OFI A;  2RH0 A;  3KFU G;  4MH0 E;  3GMA A;  1SFC C;  1T2K C;  5EXP A;  3E7K A;  4N78 E;  2LVO C;  5EP1 A;  3SYL A;  2N1T D;  2NPS A;  3AE1 C;  3BCC G;  4G6Z A;  1VF5 C;  4FCW A;  1QGK B;  1KYO D;  2HG5 D;  1PJJ A;  1RHZ B;  3M0D C;  3GP1 A;  2NPS B;  1EZV G;  3L73 E;  1PJI A;  3IFM A;  4Y28 F;  1WMK A;  2LR2 A;  1PPJ G;  2IX7 C;  2A06 E;  1PIX A;  4CIZ A;  1BGY E;  1KFM A;  2JZ1 A;  2V7Q H;  4AW4 A;  2KRU A;  3D6Z A;  1NTZ K;  3HHX A;  1DH3 A;  1IN4 A;  1OAO C;  3FWL A;  4Z8X A;  1KOR A;  2QJY B;  4DT0 A;  1YJN P;  1MU5 A;  2QIW A;  5KLV G;  1QLE D;  5E26 A;  1JCC A;  3FUX A;  1QL2 A;  3U6S A;  1N86 A;  3FTD A;  3SWK A;  3HX3 A;  1URQ B;  3SHG B;  4CGY B;  1ZOY C;  4I2L C;  5AW5 B;  3H1H J;  3L70 G;  1ZR2 A;  1W5T A;  2QJK B;  1Z6T A;  4OMK A;  1LWU A;  2OQ4 A;  1L4A C;  1NO1 A;  3LCU A;  2KZS A;  4EIJ A;  2R0I A;  2FYU G;  4TLF A;  2IDB A;  1GL6 A;  2N1T A;  2NPS D;  4KHP M;  3P8C E;  5KLV D;  1MX0 A;  1OIP A;  4H0L C;  3OTO M;  1SXJ E;  2Z3X A;  4D81 A;  4GDO A;  4AYC A;  4DV1 M;  3H1K G;  4AZF A;  3VMX A;  4AI6 A;  1KIL E;  2CEA A;  3M6A A;  1ORY B;  3BOS A;  1R2Y A;  2LVP C;  3Q8X A;  4UYB A;  2CHQ A;  3EWK A;  3B71 A;  1FZC A;  3C3D A;  3B8E B;  3U60 A;  2XV5 A;  2J5U A;  3NFQ A;  2QVA A;  2K88 A;  3BRT B;  4PD4 E;  2Z7J A;  1VQ4 P;  4PDG A;  1NTZ D;  2R5B A;  2UXC M;  3U1A A;  3H1K D;  1LWU C;  4YY3 M;  1SLQ A;  2ZAN A;  1IK7 A;  1GLN A;  2PP6 A;  1HQY E;  1S2E A;  3AE4 C;  1NV9 A;  4X62 M;  4LZJ A;  2LXC B;  1E9S A;  3DZD A;  1RF0 A;  2V4H A;  3KSJ A;  3JSV C;  4DOJ A;  4XA4 A;  2FYU J;  2DVW B;  3HU3 A;  1DV0 A;  3I56 P;  1RY3 A;  4UB6 H;  2UUC M;  2HPC B;  1PM5 A;  4IBE A;  5GTI E;  3GRY A;  1KIL D;  3SYK A;  2Y0D A;  4LY6 A;  3H1K J;  2O01 F;  1NTM J;  5GTH H;  1AVY A;  4WY4 C;  1GL2 C;  1KB9 D;  3HJQ A;  3HZJ A;  1ZQ9 A;  4LF7 M;  3G9R A;  4BRY B;  1J1D B;  1G8P A;  1SFC D;  2KK7 A;  1T2K D;  1L1Z A;  3NBX X;  3A98 B;  5KPR A;  1T8Z A;  1S5L H;  2GM4 A;  2KHH A;  4GKG A;  1O6U A;  1FJK A;  2J7N A;  2XZF A;  1VQ5 P;  2JO1 A;  1ZRT E;  2Q2E B;  3L37 A;  3H1J G;  1NU1 J;  1JM0 A;  3L71 G;  3M91 A;  3B5N A;  2W6B A;  4L8R C;  3W0L B;  1NAF A;  1UII A;  1SG9 A;  1HJP A;  4NXM M;  2WSF J;  3GLF E;  4DR7 M;  1OTR A;  4RF1 A;  2Z4R A;  4WW0 A;  2Q1K A;  3SMP A;  1MFT A;  2SPZ A;  4B86 A;  3CX5 I;  1F4I A;  3NTN A;  3II6 A;  4TT3 H;  3TSI A;  2UXB M;  3QYE A;  1NV8 A;  4Q7J A;  4GMQ A;  4NPD A;  1JNM A;  2QJK C;  3CXH H;  1NHG C;  3MHV C;  3PVS A;  1G2C A;  2KYV A;  2G3A A;  4B3T M;  1H8A A;  1KIL A;  2BWE A;  4OU7 A;  2E74 C;  4IBK A;  2K47 A;  2LXE A;  3KP1 E;  4BLC A;  1G2C B;  5KTB A;  1VEK A;  4S12 A;  3VP8 A;  1NTM G;  3TWM A;  2CUZ A;  4B7G A;  1J09 A;  5AW6 B;  1SFC A;  1X8Y A;  1YTZ T;  2XGN A;  1FZB A;  1VQ8 P;  5AW4 B;  3Q2Y A;  4OW0 A;  2JY5 A;  4U7J A;  1P84 H;  4DV4 M;  3GLG E;  3FTE A;  2CPB A;  2QJP B;  1G41 A;  3EFF K;  4I6M C;  1FDM A;  2XU6 A;  3L25 A;  2DHR A;  1KYO I;  1IXZ A;  2LWX A;  4R71 A;  4FD2 A;  1W2B O;  3BCC J;  2QRX A;  3V5B A;  2WSC J;  4LLH A;  1K05 A;  1T6O A;  2E75 B;  2IBZ D;  4K3A A;  2L91 A;  3GLG B;  3AE8 C;  2PFX A;  2F5N A;  2D2C C;  1GKI A;  2OTL P;  4NSO B;  3GLF A;  1Q86 Q;  1JY3 N;  4FMM A;  3BAT A;  4PD4 D;  3O6Q B;  4B3R M;  1V33 A;  1LTT C;  4W7Z A;  4IBD A;  2BEZ F;  2IYO A;  2Q3E A;  4LJ8 A;  1HGZ A;  2K6B A;  4XFJ A;  3SWF A;  4NC6 A;  1JR3 D;  1YUB A;  1L0N J;  2W6J H;  4PCZ A;  2E76 D;  3MK6 A;  1DD3 A;  2W90 A;  3VK8 A;  3A0H H;  3CCE P;  1I4W A;  2XDJ A;  1SQV J;  2LKM A;  3SHF A;  2W6A A;  4W80 A;  3V6I A;  1JTH B;  3KPE A;  1QZE A;  1N73 A;  4JN6 A;  5C18 A;  1AQT A;  1U7J A;  3VMY A;  5FTM A;  2ZAM A;  2QG4 A;  3VLF B;  1MJG M;  3C9I A;  1PRB A;  3PNV A;  1CUK A;  4JI8 M;  1R6B X;  3QH9 A;  1KN7 A;  1JO5 A;  4L6V 6;  2X49 A;  2JNH A;  3I55 P;  1XXH A;  2HHH M;  1M1J C;  3L74 J;  1QAM A;  2PGD A;  3KDS E;  3DA1 A;  4RO0 A;  3N7N A;  3E21 A;  4GC9 A;  2Y9Y A;  3VYI A;  2L5G B;  1VQN P;  3PHL A;  1IY2 A;  1OVR A;  3J7A S;  3HJS A;  3E9S A;  3IR9 A;  4TLG A;  4LRS A;  3Q3D A;  3T1H M;  1M8O B;  4NRW A;  2D4Q A;  2UUB M;  4N78 D;  1DEE G;  2ZTD A;  1BDC A;  1GO5 A;  5ITR A;  4L4U A;  3GF7 A;  1NTK G;  3WU2 H;  4AKI A;  4QOS A;  1FZE A;  1LP1 B;  2WSS H;  1N73 C;  1JTH A;  3VK7 A;  7CAT A;  1E5W A;  1PZQ A;  1L0L E;  3BBZ A;  1PFI A;  1BDD A;  3G3Z A;  2NRG A;  1JY3 P;  1KQS O;  1YTZ I;  3Q8G A;  3CWB J;  4Y99 B;  3G71 P;  3OA7 A;  4HLQ A;  2YKP A;  1JR3 E;  2HWJ A;  2WPQ A;  1N78 A;  2LHC A;  3RGU A;  1U57 A;  2W8Z A;  3FWN A;  4CHT B;  3R2P A;  1IXS B;  2AHM A;  2V1U A;  2Q3I A;  3L70 E;  1VEJ A;  3B5N B;  1R7R A;  1EXJ A;  1HNZ M;  1SQQ E;  3ILK A;  3L72 J;  3H1J D;  4LJ9 A;  1NH4 A;  2ERC A;  3A0H E;  3CCS P;  3L28 A;  5E79 H;  1HR0 M;  4N3Y B;  3AFH A;  3HGI A;  1J1E C;  2QNJ A;  3OAK A;  4MN4 C;  2IYP A;  4C46 A;  3A45 A;  2M5A A;  4FWG A;  3KOZ E;  2M5A B;  4OVZ A;  4IL6 E;  3GQ3 A;  2K9Y A;  4BB9 A;  1ZME C;  2L2D A;  4G4N A;  2JKV A;  3H32 A;  3GHG A;  4GKJ M;  1KQF B;  3FYD A;  4JI5 M;  1AUA A;  1FOS E;  2E75 D;  3L73 J;  1GDT A;  3P8C D;  2EJS A;  3LIE A;  4LRT A;  4CIS A;  1QL1 A;  2EA0 A;  4I7Z B;  1NHW C;  2E2X A;  2JY6 B;  1BGY J;  1YBK A;  5AW3 B;  4DV0 M;  2HOD B;  4W5W A;  1VQL P;  3UIA A;  1NTM D;  1TDH A;  1SVF A;  2E5T A;  1S3S A;  4MGH A;  2MR9 A;  1MKM A;  2C9L Y;  4LZZ A;  3FD9 A;  1TH3 A;  2P1J A;  4PV1 C;  2YXR B;  4LC1 A;  1E9R A;  1KFV A;  2QM7 A;  3R4Y A;  1CW5 A;  2OPF A;  5KLI C;  5APT A;  2WT7 B;  3TL4 X;  4P16 A;  3HWS A;  4OMJ A;  3LQQ A;  1GAB A;  3GLI A;  2QM8 A;  3K9P A;  1Y8G A;  1XWI A;  3GLI B;  1MZ9 A;  1YYC A;  2E76 B;  3HRN A;  4HYT B;  1G71 A;  1NGM B;  5M1B A;  2L7H A;  3L72 G;  4JF7 A;  1BE3 G;  1GW4 A;  2KSE A;  2QBY A;  1KFN A;  1Y47 A;  2DNA A;  5CBO A;  1LJ2 A;  2M3E A;  5AVR B;  4DR5 M;  1WGL A;  2EKK A;  3J81 S;  1SS1 A;  1OLM E;  3IG5 A;  3B5N C;  2XZU A;  2QJY C;  2Z5I A;  3A2A A;  2Z4S A;  3IEC A;  2VRS A;  2ZVN B;  2Q9I A;  4DJG A;  2LNH C;  3MZW B;  5GTH E;  5DYG A;  4M9X A;  5APW A;  2QA4 P;  2C99 A;  5CCH A;  4I4L A;  1MUU A;  1LWU B;  4FCV A;  3H1I E;  2KW0 A;  3GQ4 A;  1T43 A;  4IBI A;  1L0N D;  2F4V M;  5FSW A;  3BCC D;  3J2P B;  4JQ0 D;  1SQX K;  5AW1 B;  1IFN A;  2HPC A;  4KOD A;  1JR3 A;  3K5B A;  3SBJ A;  4M9Z A;  5A2Q S;  1EXI A;  2HL7 A;  1A5T A;  3U6C A;  3PNY A;  2L6O A;  2FOI C;  1PPJ D;  2DZO B;  5APU A;  2JWA A;  5AW0 B;  4CJ6 A;  2OYI C;  2OYO A;  1FBM A;  1Z5C A;  4DUY M;  2D7G A;  5DJU B;  1GL2 B;  1QEX A;  2YXQ B;  2KEB A;  3AE6 C;  3C8V A;  4QMA A;  4NL4 H;  4LF9 M;  4HKZ H;  1VF5 D;  2DI0 A;  3GLF B;  4GHL A;  1ZP0 C;  4B3M M;  2DWM A;  3RL0 g;  1G1I A;  2HR3 A;  4PV1 B;  3KSX A;  1OJL A;  1SQB K;  1ZMU A;  3O6Q A;  1IFD A;  1KYO E;  4CPG A;  1P84 D;  3UK6 A;  1JY2 P;  2Z5H A;  3RK3 E;  3IN6 A;  4MGI E;  5CCG C;  1SXJ B;  1BVS A;  1IZN B;  4BXL A;  5DYI A;  1USD A;  1BCC E;  1EC5 A;  1SQB E;  3LW5 F;  1H89 A;  4JPZ B;  1NTK D;  3KZI H;  3LW5 H;  4DUZ M;  5B66 H;  1VQ1 A;  1NNJ A;  2KNC A;  5C39 A;  4L78 A;  2H88 C;  4G3O A;  1VDF A;  3UMM A;  3E1I A;  2FFD B;  2A45 I;  1FC2 C;  4Y28 J;  4GH9 A;  1FZF A;  2J5Y A;  1NJI Q;  4DV6 M;  3G6E P;  3PLN A;  1N75 A;  1M90 Q;  1NU1 E;  3M0E A;  1GK6 A;  3GPU A;  2FBW C;  4I7Z C;  1AVO A;  1L4A D;  2Q6Q A;  2J59 M;  2BJW A;  2Z8Y M;  3VDP A;  5KJ7 D;  3AEA C;  1JEK A;  3J7B A;  4FWH A;  2DHY A;  2E75 C;  2JWD A;  5H2F H;  3A0B E;  3K2L A;  3CCJ P;  3MUD A;  1SQX J;  4JYC A;  1LT9 C;  1X0T A;  3T1Y M;  1UM8 A;  1NTZ J;  5FTL A;  1N8R Q;  3HD7 C;  3HHW A;  4LJ6 A;  4JI0 M;  1G1J A;  4IBJ A;  2M8R A;  2DXI A;  1A02 J;  4H13 D;  1M1J A;  2DZN B;  4LGM A;  4D6T D;  3ZH9 B;  2MGW A;  3EFG A;  1I94 M;  2MH8 A;  3GPY A;  1KD1 Q;  3L2A A;  4IBG A;  4II7 A;  3L73 D;  2D2C B;  3M7G A;  1L1T A;  3KYQ A;  2YO3 A;  2QCU A;  1XTC C;  1E32 A;  1LTM A;  2WSE F;  4WVZ A;  4F1I A;  3WUV A;  2QEN A;  5IRE B;  3I04 M;  4IBF A;  1RF1 A;  1NSF A;  2ZAO A;  4GRI A;  4IL6 X;  4KHX A;  3S4R A;  2IBZ I;  4LJ4 A;  2JWS A;  1AJY A;  1D0M A;  5BPV A;  4U3F G;  4EIW A;  1XXH B;  3R9X B;  2XEP A;  3KS4 A;  3V4W A;  2R5D A;  4WY4 D;  2VQE M;  3E4R A;  3ZQJ A;  1J5E M;  3CF2 A;  1BE3 D;  3KDP B;  1BGY G;  1NNU C;  2KDL A;  2OYI B;  4C7N A;  3K92 A;  1SQB D;  4BWN A;  3H4M A;  3VMA A;  5AVS B;  4LJ5 A;  1L0L K;  2K9J A;  2ZVO B;  3L75 J;  2MKV A;  4DR6 M;  2WZ7 A;  4YXD C;  3VTP C;  1D0L A;  4X66 M;  2H89 C;  1GD2 E;  1VDL A;  1QVR A;  3UJN A;  1Q81 Q;  5APV A;  1N7S B;  4GT1 A;  3D6Y A;  2FH0 A;  1K82 A;  5AVT B;  1WIV A;  3USS A;  3HD7 B;  2WSC F;  3HUS B;  3CX5 H;  3M0A A;  4M9S A;  5DJT B;  1QDR A;  1BGY D;  2XFT A;  4EYY Q;  3SMS A;  2OTJ P;  2OYH B;  3CX5 D;  3AEB C;  3TPZ A;  1RQU A;  1DGB A;  1IXS A;  3EIH A;  2CE7 A;  2FYU K;  3IF4 A;  3LQR A;  1PGQ A;  2HOD A;  3RK3 C;  1OMI A;  1WR1 B;  4ZKP A;  5AVQ B;  1TGU A;  2R18 A; 
#chains in the Genus database with same CATH homology
 3HX3 A;  1AUA A;  1OIP A;  3B7Q A;  3PEG A;  4OMJ A;  3B7N A;  3Q8G A;  4TLG A;  2E2X A;  4CIZ A;  2D4Q A;  4J7Q A;  3W67 A;  4OMK A;  1O6U A;  1OIZ A;  4CJ6 A;  3HY5 A;  1OLM A;  4J7P A;  3B74 A;  1R5L A;  4M8Z A;  4UYB A;  3PG7 A;  3W68 A;  4FMM A;  3P7Z A;  3B7Z A;  1OLM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...