3W67A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
b'QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tocopherol transfer protein
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w67A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w67A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w67A03
4OMJA 1OLME 3W68A 2E2XA 4J7QA 4UYBA 4TLGA 3PG7A 3HX3A 1R5LA 3B7QA 3B74A 1AUAA 3B7NA 1O6UA 3W67A 4CIZA 3B7ZA 4M8ZA 1OIPA 4CJ6A 3P7ZA 3Q8GA 4OMKA 1OLMA 3HY5A 4J7PA 2D4QA 3PEGA 1OIZA 4FMMA
chains in the Genus database with same CATH superfamily
1YIJP 1SXJE 2QPAA 3EIEA 3GRRA 3RGUA 1JCCA 3H1IE 2CPSA 4OW0A 3CTWB 1N7SB 1RY3A 2WSEF 3CWBD 1QZEA 2H89C 2A5YB 2RGHA 2D2CB 3L35A 2JR8A 1WXQA 2CV2A 4RF0A 1XXHB 4IOIH 2HODB 3P8CE 4QMAA 3TWMA 2FFJA 1SQXG 3FUTA 3PEGA 2H1RA 1SQQD 1K3WA 3RK3D 3H1KG 3O6QA 3VMXA 2WZ7A 3B9PA 4P17A 4IBDA 2O01F 3L72G 3D8BA 3WUUA 1HQCA 3CXHE 2UWJE 1T43A 5L8RJ 4WB4A 3HU3A 1IJDB 4MN4C 3HUSC 1JB0F 1AA0A 1TH3A 2V7QJ 3ITKA 5FTMA 2JY6B 2XLJA 4O9BA 4OGQB 4JI4M 1GTWA 1NVMA 3HU1A 2UUAM 1YQ4C 3DFZA 1KILC 1JCDA 4D82A 2WPRA 2DHRA 2O25A 3KW6A 3FWNA 2OYIA 1FZBA 2R3SA 4GH9A 3KOYE 3QYEA 1D2NA 4UB8H 1KYIA 2PGDA 1QQWA 3VN0A 1OIPA 1MFTA 3PHLA 3SFEC 4RKUF 3A42A 1YJNP 3SHGB 1L1ZA 2L7IA 2AEJA 1G41A 2B9BA 3U61A 4PJ0H 3SWFA 1IY1A 3KXEC 4FW9A 4L4UA 3HE5B 3CX5D 3GLIA 3H1HJ 4F2LA 3R4YA 1T3UA 2WSFF 1C1KA 4AQRD 2RMZA 3AOGA 1FNNA 2JY5A 2ZJSE 2DWLA 1G3IA 4IIWA 4JBZA 1LTJC 2E74B 1N73A 1W5CE 4IBFA 2WWWA 1QANA 1QDTA 4DV7M 4KLNA 2P1JA 2P67A 3ZDMA 4Z1MH 4JQ0D 1IFJA 3EFGA 1OLME 1IXZA 1SQPD 1LNQA 3L36A 1Q90D 3D71A 5ITXA 5APSA 3BCCG 1KILE 1AUAA 1N86A 2M5AB 1GW4A 1SFCB 1T3TA 3SSUA 2KEBA 4JI0M 1R5SA 5EQTA 5APQA 1WHCA 2KDLA 1Y47A 1PPJG 4GIPA 2W6JH 2L5GB 4GKJM 2X4AA 5EP3A 3JCUH 4QNMA 4TT3H 4LJAA 2XH9A 3RL0D 3L74D 3IG5A 1XC8A 4FWDA 4FD2A 2CFOA 4LG2A 4C7NA 2E5LM 1G59A 4DR2M 1NTKG 4LRSA 4AG5A 1Y8AA 2DNAA 3UJNA 2XSZD 2WVRA 1XHBA 1IQPA 3CPWO 2HCBA 4UB8E 1N8RQ 4DR5M 2M5ZA 1BE3J 1XMQM 4PV1C 4L8RC 2J7OA 1URQB 2DENA 3LQQA 5AW1B 4PD2A 1SQBD 1S9KE 1R4GA 2WPSA 1ZXGA 1X22A 1L4AA 5KPRA 4G4QA 3VYIA 1OX3A 2A45H 3WU2E 4MGKE 4Y28F 3GLGE 2OTJP 5EXSA 5LMNM 1M90Q 4N78D 5EXTA 5KAIH 4XA4A 1IFYA 4AKIA 4Y99B 5KLVD 3Q8XA 1QUSA 3U6PA 4DJGA 4GC5A 3HY5A 2DZNB 3JR4A 1GL2B 3SYKA 3KFUG 3KP1E 2QJKB 1V92A 2HPCB 2QJYC 5AVVB 2C0WA 4LF9M 1SQVG 3GLHE 4R4LA 3RGPA 1KYOE 2GUSA 5CHXA 2WTYA 1X37A 1RF1A 1CW5A 1NY6A 2E42A 1LT9A 2LXCB 3L70E 1S3JA 2IPPA 2L09A 1WT6A 4DUYM 4LJ5A 4YHHM 4BRYB 5APXA 3K2LA 4D81A 2R3CA 3K9OA 2XF3A 2EJSA 3M0DC 1NTMK 1KORA 2Z7JA 1ZR4A 3K9PA 1M1JC 1NTMJ 3I5CA 3GLFB 3VMAA 2JJLA 3IF4A 1M56D 4L73A 3CCEP 3L37A 1GO5A 2JY8A 1HNXM 2ZVNB 1OIZA 2I7PA 1QX8A 1NU1K 4XE5B 2MROB 3T97B 2OTKE 3U60B 3CF6E 3L71J 1BCCJ 4HB1A 4LY6A 1NU1J 3FGAD 2UUCM 4HJGH 4II7A 4LF8M 4H0LD 3I56P 2W6AA 3H1LD 4DT0A 5GTIH 3TYYA 3CMAP 2LH0A 1PGJA 4H44D 3SAWA 2FXMA 2QG4A 2B87A 4D6TE 4NSRA 1YE9A 4DV6M 5BU8B 5E79H 1L1TA 4DR6M 2R44A 1KFVA 4RJTA 1NV8A 3CC2P 4R3DA 5AW8B 3SC3A 3U1AA 3UGJA 2V7QH 2A45I 1NGMB 1DH3A 5AVZB 1H6UA 4NPDA 1JR3E 2RKOA 4MGIE 2D7EA 1Q39A 1PL5A 1S5LH 3TSIA 1ZAEA 3GRUA 2I1KA 4I7ZC 3S1KA 2OYHC 3KSXA 3FUUA 4PDIA 1NHWC 3II6A 3BOSA 1H0TA 4OMKA 3JR5A 3R9XB 3AOEA 1KQSO 5EFWB 1AV1A 1VEKA 4NXMM 2N1TC 3PG7A 4C7RA 3IAOA 5B66E 1N78A 3MK6A 3E1IA 3GF7A 3A45A 3FYCA 1QUTA 2KUBA 3U6LA 3B5NC 3M9HA 2A06E 3E46A 2LVNC 3G4SP 2XFTA 2ZYDA 4LFBM 3L70G 2G8LA 1SQQK 2KHHA 1HWTC 4RO0A 3KZIE 1SQQJ 4U3FE 1QVRA 5TJHA 1IM2A 1JUNA 1NTZG 2B89A 2AXCA 2EKKA 2IZ0A 5KPTA 1Q7YQ 1FS0E 3K1JA 4REZA 5KJ7A 2J5YA 1OQYA 4YY3M 1L0ND 3RK2B 3GRYA 1NYHA 3KHUA 3DOAA 2YXRB 1FDIA 2KW0A 1M8OB 3U5ZB 3UMMA 1SLQA 1D0LA 5ITTA 1IFDA 3EWKA 1ZV8A 2NPSB 3GMAA 2G8YA 4FWGA 1PP9J 3FKEA 3H1JG 1GZLA 1EDLA 1I94M 4HEOA 4JPZB 3BATA 3CC7P 1DD3A 4WWIA 2WT7B 3PFIA 1VPCA 3V2NA 1OMIA 1BSNA 5TISH 3B7ZA 2ZYAA 1CUKA 4NOOB 4D6TG 5B5EH 2KOGA 2YO3A 3VDUA 1QVFO 4B7FA 3HE4A 4KT0J 4PV1B 1WR1B 3V2PA 1LWUA 3AEAC 4DUZM 3MTUE 3M7GA 1P84E 2FY8A 3ZC7B 4GODA 1Z5CA 4XK8F 1NKNA 4GDOA 3BXWA 2KLUA 3CCRP 1N7SD 4LZJA 3C1LA 3HHXA 2WSCJ 5DYGA 3G3ZA 2D2CD 2ZXXA 1WRGA 2FYUD 3J2PB 2V6ZM 1KB9D 3P7ZA 4FCTA 4JYCA 5KQDA 5E26A 2CHGA 2CK3H 1T3JA 4WP2A 1U57A 3SFDC 2GNOA 4PT5A 3H1HE 2ZVOB 4DV4M 3FXEA 3HHWA 1D0KA 2QJPB 1VQPP 3HJSA 1YJWP 1IN5A 1O6UA 3MHVA 3GQ4A 2LVQD 4M8ZA 1U7JA 2FNAA 2DAEA 4WY4D 2HAKA 4DV1M 1KQLA 1ZP0C 2F5NA 1RQUA 3UIAA 4JI7M 3KPEA 3RE8A 1FOSE 2LTUA 2Y0TA 3O6QB 4OGQD 3V76A 2R5BA 1NSFA 1XXHE 3TGUE 3SBJA 2IBZE 2EKFA 4U3FG 1E94E 2FKWB 4PCZA 1IY0A 3L74J 4AG6A 3K5BA 3J80S 3L73E 3E7KA 1KD1Q 4OX9M 4NSOB 4N6JA 3I04M 2M0BA 2KP8A 3HUSA 4DOJA 3AV0A 1NKZB 3HJ8A 4K35A 4ZNCA 4WBAA 4JV5M 1SQXD 1Q81Q 1OLMA 3H1KD 1HUCA 1G2CA 5AVXB 3Q5PA 2JP7A 1OXZA 3OW2O 2OGUA 1SQBK 1IN4A 5AVWB 4MGZE 2FYNB 5C39A 5CCGC 1Y8GA 1SQBJ 2Z5IA 2FFDA 2Z8YM 2R18A 1LTMA 4IBGA 4NL4H 1SFCC 3SATA 3NTNA 2XZRA 2K1AA 1UIIA 3GG2A 4PD4D 1GL7A 1BE3E 3U61B 2WSEJ 2E75B 1NH4A 3IR9A 2V4HA 1YYCA 2E74D 5KLVJ 2R6FA 2KZJA 2YKOA 4FMMA 5C18A 3LCVB 3GLIB 3H1KE 2Y9ZA 5GTHH 4IBEA 1M1KQ 4TLGA 3VKHA 2UU9M 4LF5M 3A2AA 1NJIQ 2G5GX 2Y0CA 1J1DB 1W5TA 3L72E 4L74A 2YXQB 4AZFA 5APUA 4DV5M 2O01J 2Q5UA 5CCHD 4KHXA 4I7ZB 1X8YA 1N73B 2M60A 3D70A 4K0KM 3TDKA 1ZMWA 3VOPA 1ZRTD 1G1JA 1S5LX 3PNYA 1JB0J 1VF5B 8CATA 3LQRA 1URQC 3H1HG 1PJIA 1FJGM 3GLGA 2N1TB 2QHOB 2HKJA 1RE3C 4EDFA 4GOEA 5IT9S 2QNJA 1QZMA 3EQ2A 1TU3F 1L0LE 3KSJA 2J58A 3HTKA 1JY3N 3U59A 3LW5F 3A0BE 3LCUA 4HL4A 3B5NB 2XSZA 1H89A 1GJTA 2CE7A 1EZVI 3FD9A 4EYYQ 4B86A 1OFHA 3NMDA 1SXJD 2FE8A 3KDSE 4RKUJ 2LR2A 3A0HH 3PVSA 3H1ID 3CCJP 3TGUG 2IBZG 4C7NB 1K9MQ 3FRIA 2QJKC 3L73G 3H4JA 1Q82Q 2FXPA 1T8ZA 3W67A 1J1EB 2IZ1A 3C3EA 2O1KA 2JUJA 3H1LJ 4H13D 1EFUB 3OA7A 3P8CD 5APYA 1LTBC 1JM0A 2DXIA 3AL0C 3H32A 2YR0A 3SAUA 3GPXA 1USEA 1L4AB 3FYDA 1GL2D 3IN6A 4L75A 2HWJA 3CXHD 1L8QA 4HLQA 2R0IA 1S72P 2HR3A 3CGWA 3BCCE 3SARA 1EE8A 2Y20A 3G6EP 3AE2C 4JXJA 4C46A 4KO8A 1LTAC 1YHQP 1FDMA 2K9JB 1BE3G 1YTZT 2Y0DA 3CF0A 1PPJE 3A46A 5AW6B 2P10A 2L6OA 1EDJA 5CJ0A 2WQYC 2BJWA 2FH0A 1N34M 1NV9A 5DYIA 4GMQA 5AVUB 2H7HA 5CBNA 1FZAA 1IK7A 3KQGA 2KXEA 1VQNP 3M0AA 1NTKE 2YMKA 1X9VA 4LGYA 2P5TA 1RF1B 1EC5A 2CPBA 3HD7C 1OW7A 1I4WA 1N32M 1K8AQ 1ZW0A 2UXBM 1RH5B 3HU2A 1LT9B 3CMEP 4IBCA 3NFQA 3CX5H 3VFDA 3L75J 1EZVG 1QAQA 3PP5A 3L29A 3TE6A 3GHGA 4RESB 2KS1B 2WSCH 5AVYB 2E76B 4WW0A 3AE4C 1L0LG 4IBJA 3HGIA 4MGHA 4M3LA 4ZPXA 1L0NK 4Y28J 2KRKA 4M0WA 1DGBA 3E21A 1LTSC 1L0NJ 2Z3XA 3GLFE 2GA1A 2WMMA 4I5SA 1KTMA 2VIIA 3HZJA 4LGMA 1KILD 1TGUA 3QYBA 1G4AE 1RE4C 1VQ5P 2XEPA 2P58A 5AVRB 5M1BA 1W2EA 1SQVE 1NTMG 3CC4P 4AUWA 1QEXA 2ZYGA 4BLCA 5DJUB 1DGGA 3AKZA 3USSA 1YTZI 3RL0g 2XKMA 4LF4M 5E6JA 1V33A 1PP9E 1VQLP 3A7OA 3SWYA 2C5RA 4R71A 1NU1G 1X0TA 3JAMS 2OO9A 2UXDM 1R2ZA 1Z5BA 1HBWA 2JEEA 1HJ0A 1L2DA 1PV3A 2EUCA 5C1BA 3GF3A 1LP1B 1HR0M 1IBKM 4GKKM 4EIWA 2C9NY 4A3VB 3RK2C 1H88A 2FYUK 3VDPA 1E5WA 2R5DA 1HNZM 1S9KD 2FYUJ 3CI9A 3SWKA 2NPSC 2FBWC 1YQ3C 1SS1A 3GO8A 3Q1MA 2WSEH 4DV3M 1L2BA 4GKGA 2AXTH 4F1IA 1MKMA 1G8PA 1PJJA 1UIXA 2LVAA 4IL6H 1KV4A 2MJ5B 1GW3A 2LHGA 1LJ2A 2E5YA 3RFWA 2F5QA 5H2FH 3S4RA 1ZN5A 2QM7A 1AJYA 2O01H 1MV8A 2C9OA 1QGKB 1GLNA 4LJ6A 2O5RA 1KYOD 4PJ0E 4QOZC 2BEQD 1IN6A 2IDBA 1FZCA 1QL2A 2D7HA 1JY3P 5AW3B 3Q5RA 1FU1A 3L70D 3AE8C 4LJ9A 4QHSA 3GW6A 3V2QA 4PV1D 1A5TA 3VK8A 2PRRA 2XV5A 1QLED 2E5TA 3L27A 1EDIA 2ZTCA 3F5HA 3B8EB 1SQQG 1PJQA 2QIWA 2F4VM 3FXDA 5AW2B 4X64M 3T15A 3JSVC 1N7SA 2QJPC 3F92A 4IBKA 1S2EA 1BGYE 4GT1A 3KYQA 1QAOA 2JWDA 3B71A 2CP8A 3M9BA 1XNRM 4ZKPA 3H1JD 1PP9G 1N77A 2PFXA 3C8VA 1NY5A 3Q5SA 1NO4A 1TH2A 2QSFX 4UB6H 4Z6YA 1DD4A 2WSFH 4JI3M 3JCUE 1GJSA 3I55P 1MU5A 1NTZE 1FBMA 4D6TD 2H8PD 1FOSF 1RF0A 4WY4A 3S9OA 4CGYB 2QEXP 3WHLA 2BCCJ 3RK3B 1S3SA 1LGHB 1JY2N 5KAFH 2Y0EA 3H1JE 4XFJA 1D7MA 5KLIB 3TNUA 2QBYB 2FYNC 3SYLA 3A5TA 1JR3D 2BEZF 4OH8B 1VQ8P 1Q3BA 3P7KA 3T1YM 5BVZA 5CJ4A 3HD7B 3QWOC 1ZMUA 4X66M 3TL4X 5JI3E 3EFFK 2E75C 3MD0A 1WGNA 5KAIE 3ILKA 4PDGA 2JO1A 3CCQP 4RNAA 2Q3IA 2KSEA 3V5BA 3H1IJ 3HX3A 3AFHA 4TLFA 4NXNM 4QOSA 1J1DC 4NPFX 2YKQA 1HVVA 1IXSA 5BPVA 1FJPA 2A06D 2IX7C 3U6MA 1J5EM 1N73C 3ZH9B 2W6BA 1G2CB 4LC1A 1RQVA 4OVNF 4U3FD 3CD6P 5H37D 1VF5C 2FFDB 2ZFCA 3L74G 2QVAA 3OJAB 4CPGA 1F4IA 2CHVA 2QSIA 4GC9A 3C9IA 2M5AA 1PRBA 4ITQA 2KK7A 5CCHA 1NHGC 1BGYG 4JI2M 4CISA 4AI6A 4R4MA 3HKPA 4QNRA 3VP9A 3CWBJ 4DV2M 3O8ZA 3VKGA 3FTDA 2KYVA 1HH0A 1KC8Q 2YIUC 1KZUB 4NRWA 1VQOP 1QDRA 4FVMA 1LV7A 4FCVA 3TWLA 2N1TD 1CI6A 2MKVA 2O01N 1BVSA 2R32A 1DX7A 4MM3B 3GLIE 3JC22 3MGNA 5EP4A 3MUDA 1M7LA 1IXRC 1J1EC 5AW5B 4NPEA 2YQZA 4LJ4A 2K9YA 3QWLA 4M9XA 1G71A 2IYOA 5GTIE 1SXJA 4L76A 1SVFA 1P84D 3RL0B 1GABA 4W7ZA 2JZ0A 1KFNA 3BVHA 3P32A 1KN7A 1OAOC 1GD2E 4J7QA 1L4AC 5E79E 2KIKA 2M3EA 2QE7H 2WPVB 3HTKB 2KLVA 1Z59A 1J2JB 4B3TM 5ITXE 1IY2A 1KB9H 4JYBA 1NJGA 2A45G 3W0FA 3CL3D 3VMZA 4DR4M 4LLHA 2C9CA 1T2KC 2JDIH 3L75E 2OQ4A 3GQ3A 1S5LE 2J59M 3GP1A 3A3YB 3H1HD 1GL2A 3LIDA 2J7NA 4OVZA 4IL6X 4UYBA 1MZ9A 2ZAEB 4IBIA 3KOZE 2JA2A 1OFCX 3NBXX 5FTLA 1WIVA 1ZMEC 1GL6A 1IBMM 4QHTA 2W27A 1RF1C 5KKZB 1NHLA 4YXDC 2KNZA 2KB7P 1LT9C 3L28A 1PJSA 3H32B 3BRVB 4I2LC 2YMYA 3TGUD 3GPPA 1HNWM 2IBZD 1NVOA 2I1JA 1YITP 1OFIA 2CRUA 3WUTA 4BRYA 5IREB 3N7NA 1GU5A 4YTPC 2LKMA 2CV1A 3L73D 5KO3A 1SQPK 1YBKA 2E76C 3MZWB 1NNUC 1SQPJ 3FUXA 3L26A 3PRJA 1HJBA 1WGLA 3LIEA 2UXCM 4LJ8A 3K8ZA 3LW5J 4AYCA 3I51A 2MJZA 2W8ZA 2C96A 2VDBB 3U6EA 2E2XA 4B3MM 1FDOA 1C7YA 2RKLA 1JNMA 4G4RA 3BASA 2RN0A 3KXDA 1MN3A 2DWMA 4PD4H 3FUWA 1Q2NA 2JKVA 4A7PA 2EO2A 1BE3D 3AE9C 1VQ1A 2Z4SA 2Z4RA 4DR7M 2LBCA 2ZT9C 2ZM6M 5AVSB 5TISE 2GQFA 1KQFB 1IZNB 2Q2EB 3AE7C 3AECC 2L4EA 3ZCBB 2OTLP 5B5EE 5DJTB 1KILA 1JY2P 3L72D 2DVWB 4JYAM 2OYIB 1PZQA 1AIPC 4H44B 3THGA 2YO2A 2KI7B 1KB9I 2CV0A 3J7BA 1IC2A 5KLVK 2XGNA 3N4XA 3D6YA 2K37A 3L75G 1YI2P 3L70J 3AOEC 3MIWA 4G4OA 1A02F 1NO1A 4IJFA 3SHFA 2EA0A 3DZDA 1L0LD 3GRVA 5CCGD 2L2DA 5EP2A 2R4EA 2VF7A 1IFNA 3CLQA 4KT0F 1Q3CA 4CIZA 3CF2A 1SFCD 4IJEA 3NXSA 1ZOYC 3TQSA 1NNJA 3HHZA 2DKLA 3LMMA 1LTJA 3IG8A 3QAUA 1JMMA 4M0DA 1Y9BA 2BWEA 1VDDA 2JZ1A 1EZVE 3SFZA 2DAGA 3GPUA 2L7HA 5K5GB 4B3RM 1NTMD 1R5LA 5FTKA 4GRIA 3B7NA 2XZUA 1Q86Q 2VRSA 3RGSA 2AEFA 5KJ7C 4YPCA 1R7RA 1YLAA 1W2BO 2BNKA 3U5ZA 2Y21A 2LXEA 2IFNA 5KPZA 2YIUB 4LJ7A 1NU1D 2F5PA 3CXHH 1AVOA 3MP7B 4OMJA 2CHQA 3SMPA 2NRGA 1URQD 3GLHA 3BCCD 2KZSA 2O1JA 2WT7A 4AW4A 2KXPB 1K82A 4L78A 4PD4I 3M0EA 1NTME 3D8LA 4XGIA 2E43A 1FJKA 1IFIA 4ZMDA 1JY3O 1EQ7A 1PPJD 2WSFJ 3J7AS 4G3OA 2BCCE 2HG5D 1JTHA 1OVUA 1T6AA 2BASA 1LWUC 2DAKA 3ZQJA 2JXNA 1TDZA 3L71E 1BCCE 1MX0A 3E4RA 3LVVA 1NU1E 1EXIA 1G1IA 1NTKD 3AEEC 1NOHA 3SASA 1FZCB 2ZTDA 1SP4A 2FOIC 2JY7A 3AJIB 3KS8A 1N7LA 2MR9A 3AE3C 5GTHE 1NAFA 4W80A 4CJ6A 1VDFA 2NZ2A 1K05A 4DBGB 2WPQA 3G71P 3RK3C 2F5OA 4HH2A 1QYRA 2BJVA 4U3FJ 5KLIC 4BB9A 1T6OA 2CWBA 3B74A 2D7GA 3MHVC 1MFZA 2AHMA 2RRUA 2QQ8A 1DGHA 4DV0M 1R6BX 1QAMA 2ITAA 3PXGA 5APVA 5EXXA 4X62M 2YKPA 3AEBC 3E1RA 3BBZA 1L2PA 3OAKA 1PIXA 3V4QA 5AW0B 1SQVD 3C9PA 1JR3A 2KNCA 1USDA 3M0DA 3A0HE 3PTZA 3KDPB 1PGOA 3U6DA 2M3BA 3PNVA 3TK1A 4LCBA 1M1JA 4WY4B 1QL1A 3CWBE 3HD7D 2XFSA 3UK6A 1PP9D 1DV0A 5A2QS 4X65M 4HYTB 3V4WA 3CXHI 2K3RA 4KHPM 3AE6C 2V1UA 3TNUB 1HJPA 3R8FA 1SQQE 3RK3E 3M91A 3C3DA 3H4MA 2FFDC 1N36M 3LW5H 4JI1M 3U1CA 2I8DA 4G6ZA 1ZMVA 1QVGO 1FAVA 1U7MA 2B87B 2ZT9B 2BCCG 2PP6A 1XNQM 3QH9A 3WU2H 1L2CA 3FTFA 1HF9A 3L4FA 3L71G 1BCCG 1K73Q 2J5UA 2Q3EA 2H88C 4B7GA 1PFIA 3GLMA 5ITRA 1XTCC 1IXSB 2KRUA 2QRXA 3F89A 2C98A 3IECA 2WSSH 5EJCA 5GKNA 3V6IA 2OYHA 4JI5M 1ZV1A 1CZQA 1H0TB 3H25A 2GUVA 1TDHA 4IFDK 2CUZA 4EOTA 3U6CA 1CSBA 1K04A 2D4QA 4FWHA 2OPFA 1KQGB 3CCMP 3RL0C 2NQ8C 1TTEA 3KP0E 1KYOH 3H1IG 3TGUJ 2N1TA 2QENA 2F5SA 2JP3A 3WMM0 3CX5E 3J27B 3KVWA 4L15A 2RGOA 3L73J 2K6BA 2Y9YA 2DWZB 2QCUA 1VQKP 3B5NA 4FCWA 3UZUA 4EIJA 2OOBA 3RK2D 1OTRA 3WHKA 1J09A 5FTNA 2B88A 3CX5I 2RH0A 2H5XA 1EDKA 5LMUM 4L6V6 2R62A 2NPSD 1CI6B 5L8RF 3P8MC 1PGPA 3VMYA 2ZXEB 3I01M 3FTCA 1JEKA 1PGYA 1SQPE 1JQJC 1BGYD 3FUVA 5FLXS 1OJLA 3CWBG 4M9ZA 3AE5C 1IFMA 1SXJB 2G3QA 3M06A 1OW6A 5KKZC 2BWBA 2VQFM 1SQXK 1SQXJ 5AVTB 3H1KJ 2ZAMA 4LFCM 3L74E 1NTZD 3TWKA 3B7QA 2AEMA 2M8RA 3L72J 4ZKUA 4H13B 3FWLA 4UN2B 2HYNA 3M9QA 2KSJA 1ZQ9A 2YNYA 2LXBA 2N9BA 3KS4A 2K9JA 1EXJA 2LWXA 1HQYE 3D6ZA 3HE4B 2R46A 2Q1KA 1XXHA 2DAMA 1LWUB 2HODA 4I8OA 4OVZB 2HHHM 4R7GA 2X8AA 4KJMA 3T1HM 1SQBE 1L0LK 4MH0E 1OKSA 1L0LJ 1AQTA 1OZHA 2WZJA 4N78E 3RBZA 1P3QQ 5KTBA 1VQ9P 1HTLC 4I81A 2AXTE 5KLVE 5B66H 1N33M 2WITA 2R65A 4Z8XA 1W5SA 2L4FA 4IL6E 1KYOI 1LTIC 2W82A 4JN6A 2P7JA 3GHGC 2YFQA 4GHLA 2ZANA 2KS1A 4LFAM 2Z5HA 1RHZB 3HHYA 4H0LC 4LF6M 5H2FE 2OYIC 5IWAM 3VK7A 3Q2YA 2DZOB 1AFOA 2O3JA 1XB2B 4H44C 3PH0A 1DEEG 1LTTC 1BDDA 3FE3A 4ANRA 1TF0B 2LVOC 3CCSP 3KZIH 1Z5AA 1LTGC 4M9SA 2QZ4A 3GQ5A 2HFED 3HJQA 3I4YA 2IYPA 1GK6A 4LZZA 4OU7A 1JY2O 3HE5A 3U6OA 1VQ4P 3L25A 1FE6A 1SQPG 3CCLP 1HGZA 3BCCJ 1SG9A 4NRVA 1HT1E 3T6PA 3HUSB 2K47A 1VQ6P 2R4JA 5AVQB 4ASWA 2ZAOA 4GHAA 1VG5A 2E75D 1N2DC 3KOXE 1OWAA 4BXLA 5BR8M 1KILB 3VLFB 4L16A 1VQ7P 2CEAA 4RF1A 3CCVP 5CCGA 1JMBA 1DIPA 1NTKK 1E9RA 4I4LA 1X79B 1NTKJ 1IN7A 1SFCA 4DR3M 3MMPA 1LP1A 3H1LE 1IBLM 4UB6E 1IO4A 3V2RA 1WMKA 4P16A 1OAIA 1P84H 2XU6A 3IFMA 1VDLA 2OOAA 3I4VA 3B89A 5FSWA 1MJGM 5F3WA 3FX0A 7CATA 2L91A 2VQEM 1XWIA 4GOFA 1IFPA 2MGWA 2DHYA 1VF5D 1BSHA 1SQBG 2H43A 1Q02A 4KODA 2N9YB 5KAFE 4MGYE 4DZOA 4IBBA 2KA6B 4WURA 5AW7B 3KOWE 2XDJA 5CBOA 2QA4P 4MB7A 1LTJB 3L75D 3B5ND 3SAVA 1RU3A 5KLVG 2JWAA 1URQA 2R45A 3GLGB 2Q6QA 1RE3A 4IFMA 2FS1A 1ZLLA 2Y0QA 1SQVK 4W7YA 2XZFA 2APLA 3GPYA 1SQVJ 1HT2E 2W83C 2LVPC 1FZCC 4JI6M 3FRHA 3W0LB 1GKIA 2DZLA 3DA1A 3WUVA 3AEGC 5APWA 2LHCA 1HGVA 4HKZH 1LT1A 4NC6A 1M57D 3GLHB 2I7NA 4AKGA 3AEDC 5FTJA 3HRNA 1NJFA 1YJ9P 1OW8A 1L4AD 4BWNA 1XTGB 2KNVA 2HPCA 3FTEA 1A02J 1JOCA 2K9DA 1N7SC 2G3AA 4K3AA 2N35A 3G9RA 4YXWH 2K0BX 4EI2A 4DR1M 2C9LY 2D2CC 1ZR2A 5JI2E 4G4NA 1D0MA 1WJ7A 4LGDE 1DGFA 1JTHB 1L0NE 1KFMA 1GMJA 5CMZA 5KQ8A 4GIFA 2KNAA 1T2KD 2GM4A 2Q7CA 2UUBM 1YSYA 5APTA 2PAJA 5DFLA 2HLOA 4XBOA 5ITYA 4AKHA 4OWFA 5DNYA 1ORYB 4U7JA 1S1CX 4W5WA 1BDCA 3H1LG 2FXOA 1RF0C 4WY4C 3GLFA 4JF7A 3AEFC 1P84I 1GK4A 4BBAA 1DEBA 1AQ5A 2V1CA 1OVRA 4OGQC 2QJYB 3T38A 4JI8M 2LNHC 1GDTA 3C58A 3T97A 4S12A 3L2AA 3HWSA 3EIHA 3U60A 2DAIA 3NBIA 2QBYA 1EIJA 3E9SA 1GVNA 1MUUA 2E76D 4IFFA 4N3YB 1DGHB 3MJ5A 1IK9A 1R8EA 3HD7A 2A06G 4B7HA 4GEWA 1GU4A 2FYUE 2QP9X 1DO0A 1KB9E 2DW3A 3U6QA 3GHGB 3A0BH 1PM5A 5ITUA 5ITQA 2KNCB 4H0LB 1PJTA 2DWNA 4TUWA 3LVWA 2YNMD 5EXPA 4GITA 1M1JB 2ERCA 3H6PA 4CHTB 3OTOM 2X49A 1BGYJ 3J81S 2IFMA 1J7KA 3Q8GA 2IBZI 2ZT9D 1PGQA 2E74C 1VQMP 1EZVD 1E79H 3VTPC 3IHPA 2OARA 2K88A 4DCKA 3B4SA 1RE4A 1DO2A 3M6AA 1NTZK 5EP1A 3SMSA 2W90A 4I6MC 3Q3DA 1NTZJ 5CCHC 1V34A 2Q9IA 2OYOA 2XNXA 1NWQA 2KZUA 4I1LA 1VEGA 1KMIZ 2C99A 1OVVA 1L0NG 3NWLA 1YUBA 1R2YA 1Z6TA 4Q7JA 1UFZA 3CCUP 1FZFA 4J7PA 1SQXE 2POHA 1NAYA 2B3TA 2SPZA 3PLNA 3H1JJ 2JWSA 3RBXA 2WSCF 3AE1C 3MUDC 1JO5A 4LRTA 1VL2A 1S4XA 2OYHB 4B3SM 1E9SA 2BCCD 5AW9B 2DI0A 3BRTB 4D6TJ 2KZIA 4PD4E 1SXJC 4ASVA 3TF5A 1FZGA 3L71D 1BCCD 2C0XA 1TR8A 2NPSA 3K92A 1N75A 1TH4A 3TPZA 2XNDH 4WVZA 5IZ7D 4H13C 5KJ7D 2Z4EA 4LF7M 5AW4B 1IN8A 4D80A 4Y99C 1VEJA 4AQYM 2FYUG 2FYZA 1KSFX 3U6SA 3ABVC 1E32A 2MH8A 1GL2C 2HL7A 1ZRTE 3W68A 1XMOM 3VP8A 1UM8A 2VF8A 3R2PA 1H8AA 1K3XA 1FC2C 1FZEA 2P2UA 1Z56A 4B08A 2ZBKB 3A98B 2QM8A 2JNHA 1AVYA 3PJSK 5BU5A 2OQQA
chains in the Genus database with same CATH topology
4OMJA 1OLME 3W68A 2E2XA 4J7QA 4UYBA 4TLGA 3PG7A 3HX3A 1R5LA 3B7QA 3B74A 1AUAA 3B7NA 1O6UA 3W67A 4CIZA 3B7ZA 4M8ZA 1OIPA 4CJ6A 3P7ZA 3Q8GA 4OMKA 1OLMA 3HY5A 4J7PA 2D4QA 3PEGA 1OIZA 4FMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMJ A;  1OLM E;  3W68 A;  2E2X A;  4J7Q A;  4UYB A;  4TLG A;  3PG7 A;  3HX3 A;  1R5L A;  3B7Q A;  3B74 A;  1AUA A;  3B7N A;  1O6U A;  3W67 A;  4CIZ A;  3B7Z A;  4M8Z A;  1OIP A;  4CJ6 A;  3P7Z A;  3Q8G A;  4OMK A;  1OLM A;  3HY5 A;  4J7P A;  2D4Q A;  3PEG A;  1OIZ A;  4FMM A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  1SXJ E;  2QPA A;  3EIE A;  3GRR A;  3RGU A;  1JCC A;  3H1I E;  2CPS A;  4OW0 A;  3CTW B;  1N7S B;  1RY3 A;  2WSE F;  3CWB D;  1QZE A;  2H89 C;  2A5Y B;  2RGH A;  2D2C B;  3L35 A;  2JR8 A;  1WXQ A;  2CV2 A;  4RF0 A;  1XXH B;  4IOI H;  2HOD B;  3P8C E;  4QMA A;  3TWM A;  2FFJ A;  1SQX G;  3FUT A;  3PEG A;  2H1R A;  1SQQ D;  1K3W A;  3RK3 D;  3H1K G;  3O6Q A;  3VMX A;  2WZ7 A;  3B9P A;  4P17 A;  4IBD A;  2O01 F;  3L72 G;  3D8B A;  3WUU A;  1HQC A;  3CXH E;  2UWJ E;  1T43 A;  5L8R J;  4WB4 A;  3HU3 A;  1IJD B;  4MN4 C;  3HUS C;  1JB0 F;  1AA0 A;  1TH3 A;  2V7Q J;  3ITK A;  5FTM A;  2JY6 B;  2XLJ A;  4O9B A;  4OGQ B;  4JI4 M;  1GTW A;  1NVM A;  3HU1 A;  2UUA M;  1YQ4 C;  3DFZ A;  1KIL C;  1JCD A;  4D82 A;  2WPR A;  2DHR A;  2O25 A;  3KW6 A;  3FWN A;  2OYI A;  1FZB A;  2R3S A;  4GH9 A;  3KOY E;  3QYE A;  1D2N A;  4UB8 H;  1KYI A;  2PGD A;  1QQW A;  3VN0 A;  1OIP A;  1MFT A;  3PHL A;  3SFE C;  4RKU F;  3A42 A;  1YJN P;  3SHG B;  1L1Z A;  2L7I A;  2AEJ A;  1G41 A;  2B9B A;  3U61 A;  4PJ0 H;  3SWF A;  1IY1 A;  3KXE C;  4FW9 A;  4L4U A;  3HE5 B;  3CX5 D;  3GLI A;  3H1H J;  4F2L A;  3R4Y A;  1T3U A;  2WSF F;  1C1K A;  4AQR D;  2RMZ A;  3AOG A;  1FNN A;  2JY5 A;  2ZJS E;  2DWL A;  1G3I A;  4IIW A;  4JBZ A;  1LTJ C;  2E74 B;  1N73 A;  1W5C E;  4IBF A;  2WWW A;  1QAN A;  1QDT A;  4DV7 M;  4KLN A;  2P1J A;  2P67 A;  3ZDM A;  4Z1M H;  4JQ0 D;  1IFJ A;  3EFG A;  1OLM E;  1IXZ A;  1SQP D;  1LNQ A;  3L36 A;  1Q90 D;  3D71 A;  5ITX A;  5APS A;  3BCC G;  1KIL E;  1AUA A;  1N86 A;  2M5A B;  1GW4 A;  1SFC B;  1T3T A;  3SSU A;  2KEB A;  4JI0 M;  1R5S A;  5EQT A;  5APQ A;  1WHC A;  2KDL A;  1Y47 A;  1PPJ G;  4GIP A;  2W6J H;  2L5G B;  4GKJ M;  2X4A A;  5EP3 A;  3JCU H;  4QNM A;  4TT3 H;  4LJA A;  2XH9 A;  3RL0 D;  3L74 D;  3IG5 A;  1XC8 A;  4FWD A;  4FD2 A;  2CFO A;  4LG2 A;  4C7N A;  2E5L M;  1G59 A;  4DR2 M;  1NTK G;  4LRS A;  4AG5 A;  1Y8A A;  2DNA A;  3UJN A;  2XSZ D;  2WVR A;  1XHB A;  1IQP A;  3CPW O;  2HCB A;  4UB8 E;  1N8R Q;  4DR5 M;  2M5Z A;  1BE3 J;  1XMQ M;  4PV1 C;  4L8R C;  2J7O A;  1URQ B;  2DEN A;  3LQQ A;  5AW1 B;  4PD2 A;  1SQB D;  1S9K E;  1R4G A;  2WPS A;  1ZXG A;  1X22 A;  1L4A A;  5KPR A;  4G4Q A;  3VYI A;  1OX3 A;  2A45 H;  3WU2 E;  4MGK E;  4Y28 F;  3GLG E;  2OTJ P;  5EXS A;  5LMN M;  1M90 Q;  4N78 D;  5EXT A;  5KAI H;  4XA4 A;  1IFY A;  4AKI A;  4Y99 B;  5KLV D;  3Q8X A;  1QUS A;  3U6P A;  4DJG A;  4GC5 A;  3HY5 A;  2DZN B;  3JR4 A;  1GL2 B;  3SYK A;  3KFU G;  3KP1 E;  2QJK B;  1V92 A;  2HPC B;  2QJY C;  5AVV B;  2C0W A;  4LF9 M;  1SQV G;  3GLH E;  4R4L A;  3RGP A;  1KYO E;  2GUS A;  5CHX A;  2WTY A;  1X37 A;  1RF1 A;  1CW5 A;  1NY6 A;  2E42 A;  1LT9 A;  2LXC B;  3L70 E;  1S3J A;  2IPP A;  2L09 A;  1WT6 A;  4DUY M;  4LJ5 A;  4YHH M;  4BRY B;  5APX A;  3K2L A;  4D81 A;  2R3C A;  3K9O A;  2XF3 A;  2EJS A;  3M0D C;  1NTM K;  1KOR A;  2Z7J A;  1ZR4 A;  3K9P A;  1M1J C;  1NTM J;  3I5C A;  3GLF B;  3VMA A;  2JJL A;  3IF4 A;  1M56 D;  4L73 A;  3CCE P;  3L37 A;  1GO5 A;  2JY8 A;  1HNX M;  2ZVN B;  1OIZ A;  2I7P A;  1QX8 A;  1NU1 K;  4XE5 B;  2MRO B;  3T97 B;  2OTK E;  3U60 B;  3CF6 E;  3L71 J;  1BCC J;  4HB1 A;  4LY6 A;  1NU1 J;  3FGA D;  2UUC M;  4HJG H;  4II7 A;  4LF8 M;  4H0L D;  3I56 P;  2W6A A;  3H1L D;  4DT0 A;  5GTI H;  3TYY A;  3CMA P;  2LH0 A;  1PGJ A;  4H44 D;  3SAW A;  2FXM A;  2QG4 A;  2B87 A;  4D6T E;  4NSR A;  1YE9 A;  4DV6 M;  5BU8 B;  5E79 H;  1L1T A;  4DR6 M;  2R44 A;  1KFV A;  4RJT A;  1NV8 A;  3CC2 P;  4R3D A;  5AW8 B;  3SC3 A;  3U1A A;  3UGJ A;  2V7Q H;  2A45 I;  1NGM B;  1DH3 A;  5AVZ B;  1H6U A;  4NPD A;  1JR3 E;  2RKO A;  4MGI E;  2D7E A;  1Q39 A;  1PL5 A;  1S5L H;  3TSI A;  1ZAE A;  3GRU A;  2I1K A;  4I7Z C;  3S1K A;  2OYH C;  3KSX A;  3FUU A;  4PDI A;  1NHW C;  3II6 A;  3BOS A;  1H0T A;  4OMK A;  3JR5 A;  3R9X B;  3AOE A;  1KQS O;  5EFW B;  1AV1 A;  1VEK A;  4NXM M;  2N1T C;  3PG7 A;  4C7R A;  3IAO A;  5B66 E;  1N78 A;  3MK6 A;  3E1I A;  3GF7 A;  3A45 A;  3FYC A;  1QUT A;  2KUB A;  3U6L A;  3B5N C;  3M9H A;  2A06 E;  3E46 A;  2LVN C;  3G4S P;  2XFT A;  2ZYD A;  4LFB M;  3L70 G;  2G8L A;  1SQQ K;  2KHH A;  1HWT C;  4RO0 A;  3KZI E;  1SQQ J;  4U3F E;  1QVR A;  5TJH A;  1IM2 A;  1JUN A;  1NTZ G;  2B89 A;  2AXC A;  2EKK A;  2IZ0 A;  5KPT A;  1Q7Y Q;  1FS0 E;  3K1J A;  4REZ A;  5KJ7 A;  2J5Y A;  1OQY A;  4YY3 M;  1L0N D;  3RK2 B;  3GRY A;  1NYH A;  3KHU A;  3DOA A;  2YXR B;  1FDI A;  2KW0 A;  1M8O B;  3U5Z B;  3UMM A;  1SLQ A;  1D0L A;  5ITT A;  1IFD A;  3EWK A;  1ZV8 A;  2NPS B;  3GMA A;  2G8Y A;  4FWG A;  1PP9 J;  3FKE A;  3H1J G;  1GZL A;  1EDL A;  1I94 M;  4HEO A;  4JPZ B;  3BAT A;  3CC7 P;  1DD3 A;  4WWI A;  2WT7 B;  3PFI A;  1VPC A;  3V2N A;  1OMI A;  1BSN A;  5TIS H;  3B7Z A;  2ZYA A;  1CUK A;  4NOO B;  4D6T G;  5B5E H;  2KOG A;  2YO3 A;  3VDU A;  1QVF O;  4B7F A;  3HE4 A;  4KT0 J;  4PV1 B;  1WR1 B;  3V2P A;  1LWU A;  3AEA C;  4DUZ M;  3MTU E;  3M7G A;  1P84 E;  2FY8 A;  3ZC7 B;  4GOD A;  1Z5C A;  4XK8 F;  1NKN A;  4GDO A;  3BXW A;  2KLU A;  3CCR P;  1N7S D;  4LZJ A;  3C1L A;  3HHX A;  2WSC J;  5DYG A;  3G3Z A;  2D2C D;  2ZXX A;  1WRG A;  2FYU D;  3J2P B;  2V6Z M;  1KB9 D;  3P7Z A;  4FCT A;  4JYC A;  5KQD A;  5E26 A;  2CHG A;  2CK3 H;  1T3J A;  4WP2 A;  1U57 A;  3SFD C;  2GNO A;  4PT5 A;  3H1H E;  2ZVO B;  4DV4 M;  3FXE A;  3HHW A;  1D0K A;  2QJP B;  1VQP P;  3HJS A;  1YJW P;  1IN5 A;  1O6U A;  3MHV A;  3GQ4 A;  2LVQ D;  4M8Z A;  1U7J A;  2FNA A;  2DAE A;  4WY4 D;  2HAK A;  4DV1 M;  1KQL A;  1ZP0 C;  2F5N A;  1RQU A;  3UIA A;  4JI7 M;  3KPE A;  3RE8 A;  1FOS E;  2LTU A;  2Y0T A;  3O6Q B;  4OGQ D;  3V76 A;  2R5B A;  1NSF A;  1XXH E;  3TGU E;  3SBJ A;  2IBZ E;  2EKF A;  4U3F G;  1E94 E;  2FKW B;  4PCZ A;  1IY0 A;  3L74 J;  4AG6 A;  3K5B A;  3J80 S;  3L73 E;  3E7K A;  1KD1 Q;  4OX9 M;  4NSO B;  4N6J A;  3I04 M;  2M0B A;  2KP8 A;  3HUS A;  4DOJ A;  3AV0 A;  1NKZ B;  3HJ8 A;  4K35 A;  4ZNC A;  4WBA A;  4JV5 M;  1SQX D;  1Q81 Q;  1OLM A;  3H1K D;  1HUC A;  1G2C A;  5AVX B;  3Q5P A;  2JP7 A;  1OXZ A;  3OW2 O;  2OGU A;  1SQB K;  1IN4 A;  5AVW B;  4MGZ E;  2FYN B;  5C39 A;  5CCG C;  1Y8G A;  1SQB J;  2Z5I A;  2FFD A;  2Z8Y M;  2R18 A;  1LTM A;  4IBG A;  4NL4 H;  1SFC C;  3SAT A;  3NTN A;  2XZR A;  2K1A A;  1UII A;  3GG2 A;  4PD4 D;  1GL7 A;  1BE3 E;  3U61 B;  2WSE J;  2E75 B;  1NH4 A;  3IR9 A;  2V4H A;  1YYC A;  2E74 D;  5KLV J;  2R6F A;  2KZJ A;  2YKO A;  4FMM A;  5C18 A;  3LCV B;  3GLI B;  3H1K E;  2Y9Z A;  5GTH H;  4IBE A;  1M1K Q;  4TLG A;  3VKH A;  2UU9 M;  4LF5 M;  3A2A A;  1NJI Q;  2G5G X;  2Y0C A;  1J1D B;  1W5T A;  3L72 E;  4L74 A;  2YXQ B;  4AZF A;  5APU A;  4DV5 M;  2O01 J;  2Q5U A;  5CCH D;  4KHX A;  4I7Z B;  1X8Y A;  1N73 B;  2M60 A;  3D70 A;  4K0K M;  3TDK A;  1ZMW A;  3VOP A;  1ZRT D;  1G1J A;  1S5L X;  3PNY A;  1JB0 J;  1VF5 B;  8CAT A;  3LQR A;  1URQ C;  3H1H G;  1PJI A;  1FJG M;  3GLG A;  2N1T B;  2QHO B;  2HKJ A;  1RE3 C;  4EDF A;  4GOE A;  5IT9 S;  2QNJ A;  1QZM A;  3EQ2 A;  1TU3 F;  1L0L E;  3KSJ A;  2J58 A;  3HTK A;  1JY3 N;  3U59 A;  3LW5 F;  3A0B E;  3LCU A;  4HL4 A;  3B5N B;  2XSZ A;  1H89 A;  1GJT A;  2CE7 A;  1EZV I;  3FD9 A;  4EYY Q;  4B86 A;  1OFH A;  3NMD A;  1SXJ D;  2FE8 A;  3KDS E;  4RKU J;  2LR2 A;  3A0H H;  3PVS A;  3H1I D;  3CCJ P;  3TGU G;  2IBZ G;  4C7N B;  1K9M Q;  3FRI A;  2QJK C;  3L73 G;  3H4J A;  1Q82 Q;  2FXP A;  1T8Z A;  3W67 A;  1J1E B;  2IZ1 A;  3C3E A;  2O1K A;  2JUJ A;  3H1L J;  4H13 D;  1EFU B;  3OA7 A;  3P8C D;  5APY A;  1LTB C;  1JM0 A;  2DXI A;  3AL0 C;  3H32 A;  2YR0 A;  3SAU A;  3GPX A;  1USE A;  1L4A B;  3FYD A;  1GL2 D;  3IN6 A;  4L75 A;  2HWJ A;  3CXH D;  1L8Q A;  4HLQ A;  2R0I A;  1S72 P;  2HR3 A;  3CGW A;  3BCC E;  3SAR A;  1EE8 A;  2Y20 A;  3G6E P;  3AE2 C;  4JXJ A;  4C46 A;  4KO8 A;  1LTA C;  1YHQ P;  1FDM A;  2K9J B;  1BE3 G;  1YTZ T;  2Y0D A;  3CF0 A;  1PPJ E;  3A46 A;  5AW6 B;  2P10 A;  2L6O A;  1EDJ A;  5CJ0 A;  2WQY C;  2BJW A;  2FH0 A;  1N34 M;  1NV9 A;  5DYI A;  4GMQ A;  5AVU B;  2H7H A;  5CBN A;  1FZA A;  1IK7 A;  3KQG A;  2KXE A;  1VQN P;  3M0A A;  1NTK E;  2YMK A;  1X9V A;  4LGY A;  2P5T A;  1RF1 B;  1EC5 A;  2CPB A;  3HD7 C;  1OW7 A;  1I4W A;  1N32 M;  1K8A Q;  1ZW0 A;  2UXB M;  1RH5 B;  3HU2 A;  1LT9 B;  3CME P;  4IBC A;  3NFQ A;  3CX5 H;  3VFD A;  3L75 J;  1EZV G;  1QAQ A;  3PP5 A;  3L29 A;  3TE6 A;  3GHG A;  4RES B;  2KS1 B;  2WSC H;  5AVY B;  2E76 B;  4WW0 A;  3AE4 C;  1L0L G;  4IBJ A;  3HGI A;  4MGH A;  4M3L A;  4ZPX A;  1L0N K;  4Y28 J;  2KRK A;  4M0W A;  1DGB A;  3E21 A;  1LTS C;  1L0N J;  2Z3X A;  3GLF E;  2GA1 A;  2WMM A;  4I5S A;  1KTM A;  2VII A;  3HZJ A;  4LGM A;  1KIL D;  1TGU A;  3QYB A;  1G4A E;  1RE4 C;  1VQ5 P;  2XEP A;  2P58 A;  5AVR B;  5M1B A;  1W2E A;  1SQV E;  1NTM G;  3CC4 P;  4AUW A;  1QEX A;  2ZYG A;  4BLC A;  5DJU B;  1DGG A;  3AKZ A;  3USS A;  1YTZ I;  3RL0 g;  2XKM A;  4LF4 M;  5E6J A;  1V33 A;  1PP9 E;  1VQL P;  3A7O A;  3SWY A;  2C5R A;  4R71 A;  1NU1 G;  1X0T A;  3JAM S;  2OO9 A;  2UXD M;  1R2Z A;  1Z5B A;  1HBW A;  2JEE A;  1HJ0 A;  1L2D A;  1PV3 A;  2EUC A;  5C1B A;  3GF3 A;  1LP1 B;  1HR0 M;  1IBK M;  4GKK M;  4EIW A;  2C9N Y;  4A3V B;  3RK2 C;  1H88 A;  2FYU K;  3VDP A;  1E5W A;  2R5D A;  1HNZ M;  1S9K D;  2FYU J;  3CI9 A;  3SWK A;  2NPS C;  2FBW C;  1YQ3 C;  1SS1 A;  3GO8 A;  3Q1M A;  2WSE H;  4DV3 M;  1L2B A;  4GKG A;  2AXT H;  4F1I A;  1MKM A;  1G8P A;  1PJJ A;  1UIX A;  2LVA A;  4IL6 H;  1KV4 A;  2MJ5 B;  1GW3 A;  2LHG A;  1LJ2 A;  2E5Y A;  3RFW A;  2F5Q A;  5H2F H;  3S4R A;  1ZN5 A;  2QM7 A;  1AJY A;  2O01 H;  1MV8 A;  2C9O A;  1QGK B;  1GLN A;  4LJ6 A;  2O5R A;  1KYO D;  4PJ0 E;  4QOZ C;  2BEQ D;  1IN6 A;  2IDB A;  1FZC A;  1QL2 A;  2D7H A;  1JY3 P;  5AW3 B;  3Q5R A;  1FU1 A;  3L70 D;  3AE8 C;  4LJ9 A;  4QHS A;  3GW6 A;  3V2Q A;  4PV1 D;  1A5T A;  3VK8 A;  2PRR A;  2XV5 A;  1QLE D;  2E5T A;  3L27 A;  1EDI A;  2ZTC A;  3F5H A;  3B8E B;  1SQQ G;  1PJQ A;  2QIW A;  2F4V M;  3FXD A;  5AW2 B;  4X64 M;  3T15 A;  3JSV C;  1N7S A;  2QJP C;  3F92 A;  4IBK A;  1S2E A;  1BGY E;  4GT1 A;  3KYQ A;  1QAO A;  2JWD A;  3B71 A;  2CP8 A;  3M9B A;  1XNR M;  4ZKP A;  3H1J D;  1PP9 G;  1N77 A;  2PFX A;  3C8V A;  1NY5 A;  3Q5S A;  1NO4 A;  1TH2 A;  2QSF X;  4UB6 H;  4Z6Y A;  1DD4 A;  2WSF H;  4JI3 M;  3JCU E;  1GJS A;  3I55 P;  1MU5 A;  1NTZ E;  1FBM A;  4D6T D;  2H8P D;  1FOS F;  1RF0 A;  4WY4 A;  3S9O A;  4CGY B;  2QEX P;  3WHL A;  2BCC J;  3RK3 B;  1S3S A;  1LGH B;  1JY2 N;  5KAF H;  2Y0E A;  3H1J E;  4XFJ A;  1D7M A;  5KLI B;  3TNU A;  2QBY B;  2FYN C;  3SYL A;  3A5T A;  1JR3 D;  2BEZ F;  4OH8 B;  1VQ8 P;  1Q3B A;  3P7K A;  3T1Y M;  5BVZ A;  5CJ4 A;  3HD7 B;  3QWO C;  1ZMU A;  4X66 M;  3TL4 X;  5JI3 E;  3EFF K;  2E75 C;  3MD0 A;  1WGN A;  5KAI E;  3ILK A;  4PDG A;  2JO1 A;  3CCQ P;  4RNA A;  2Q3I A;  2KSE A;  3V5B A;  3H1I J;  3HX3 A;  3AFH A;  4TLF A;  4NXN M;  4QOS A;  1J1D C;  4NPF X;  2YKQ A;  1HVV A;  1IXS A;  5BPV A;  1FJP A;  2A06 D;  2IX7 C;  3U6M A;  1J5E M;  1N73 C;  3ZH9 B;  2W6B A;  1G2C B;  4LC1 A;  1RQV A;  4OVN F;  4U3F D;  3CD6 P;  5H37 D;  1VF5 C;  2FFD B;  2ZFC A;  3L74 G;  2QVA A;  3OJA B;  4CPG A;  1F4I A;  2CHV A;  2QSI A;  4GC9 A;  3C9I A;  2M5A A;  1PRB A;  4ITQ A;  2KK7 A;  5CCH A;  1NHG C;  1BGY G;  4JI2 M;  4CIS A;  4AI6 A;  4R4M A;  3HKP A;  4QNR A;  3VP9 A;  3CWB J;  4DV2 M;  3O8Z A;  3VKG A;  3FTD A;  2KYV A;  1HH0 A;  1KC8 Q;  2YIU C;  1KZU B;  4NRW A;  1VQO P;  1QDR A;  4FVM A;  1LV7 A;  4FCV A;  3TWL A;  2N1T D;  1CI6 A;  2MKV A;  2O01 N;  1BVS A;  2R32 A;  1DX7 A;  4MM3 B;  3GLI E;  3JC2 2;  3MGN A;  5EP4 A;  3MUD A;  1M7L A;  1IXR C;  1J1E C;  5AW5 B;  4NPE A;  2YQZ A;  4LJ4 A;  2K9Y A;  3QWL A;  4M9X A;  1G71 A;  2IYO A;  5GTI E;  1SXJ A;  4L76 A;  1SVF A;  1P84 D;  3RL0 B;  1GAB A;  4W7Z A;  2JZ0 A;  1KFN A;  3BVH A;  3P32 A;  1KN7 A;  1OAO C;  1GD2 E;  4J7Q A;  1L4A C;  5E79 E;  2KIK A;  2M3E A;  2QE7 H;  2WPV B;  3HTK B;  2KLV A;  1Z59 A;  1J2J B;  4B3T M;  5ITX E;  1IY2 A;  1KB9 H;  4JYB A;  1NJG A;  2A45 G;  3W0F A;  3CL3 D;  3VMZ A;  4DR4 M;  4LLH A;  2C9C A;  1T2K C;  2JDI H;  3L75 E;  2OQ4 A;  3GQ3 A;  1S5L E;  2J59 M;  3GP1 A;  3A3Y B;  3H1H D;  1GL2 A;  3LID A;  2J7N A;  4OVZ A;  4IL6 X;  4UYB A;  1MZ9 A;  2ZAE B;  4IBI A;  3KOZ E;  2JA2 A;  1OFC X;  3NBX X;  5FTL A;  1WIV A;  1ZME C;  1GL6 A;  1IBM M;  4QHT A;  2W27 A;  1RF1 C;  5KKZ B;  1NHL A;  4YXD C;  2KNZ A;  2KB7 P;  1LT9 C;  3L28 A;  1PJS A;  3H32 B;  3BRV B;  4I2L C;  2YMY A;  3TGU D;  3GPP A;  1HNW M;  2IBZ D;  1NVO A;  2I1J A;  1YIT P;  1OFI A;  2CRU A;  3WUT A;  4BRY A;  5IRE B;  3N7N A;  1GU5 A;  4YTP C;  2LKM A;  2CV1 A;  3L73 D;  5KO3 A;  1SQP K;  1YBK A;  2E76 C;  3MZW B;  1NNU C;  1SQP J;  3FUX A;  3L26 A;  3PRJ A;  1HJB A;  1WGL A;  3LIE A;  2UXC M;  4LJ8 A;  3K8Z A;  3LW5 J;  4AYC A;  3I51 A;  2MJZ A;  2W8Z A;  2C96 A;  2VDB B;  3U6E A;  2E2X A;  4B3M M;  1FDO A;  1C7Y A;  2RKL A;  1JNM A;  4G4R A;  3BAS A;  2RN0 A;  3KXD A;  1MN3 A;  2DWM A;  4PD4 H;  3FUW A;  1Q2N A;  2JKV A;  4A7P A;  2EO2 A;  1BE3 D;  3AE9 C;  1VQ1 A;  2Z4S A;  2Z4R A;  4DR7 M;  2LBC A;  2ZT9 C;  2ZM6 M;  5AVS B;  5TIS E;  2GQF A;  1KQF B;  1IZN B;  2Q2E B;  3AE7 C;  3AEC C;  2L4E A;  3ZCB B;  2OTL P;  5B5E E;  5DJT B;  1KIL A;  1JY2 P;  3L72 D;  2DVW B;  4JYA M;  2OYI B;  1PZQ A;  1AIP C;  4H44 B;  3THG A;  2YO2 A;  2KI7 B;  1KB9 I;  2CV0 A;  3J7B A;  1IC2 A;  5KLV K;  2XGN A;  3N4X A;  3D6Y A;  2K37 A;  3L75 G;  1YI2 P;  3L70 J;  3AOE C;  3MIW A;  4G4O A;  1A02 F;  1NO1 A;  4IJF A;  3SHF A;  2EA0 A;  3DZD A;  1L0L D;  3GRV A;  5CCG D;  2L2D A;  5EP2 A;  2R4E A;  2VF7 A;  1IFN A;  3CLQ A;  4KT0 F;  1Q3C A;  4CIZ A;  3CF2 A;  1SFC D;  4IJE A;  3NXS A;  1ZOY C;  3TQS A;  1NNJ A;  3HHZ A;  2DKL A;  3LMM A;  1LTJ A;  3IG8 A;  3QAU A;  1JMM A;  4M0D A;  1Y9B A;  2BWE A;  1VDD A;  2JZ1 A;  1EZV E;  3SFZ A;  2DAG A;  3GPU A;  2L7H A;  5K5G B;  4B3R M;  1NTM D;  1R5L A;  5FTK A;  4GRI A;  3B7N A;  2XZU A;  1Q86 Q;  2VRS A;  3RGS A;  2AEF A;  5KJ7 C;  4YPC A;  1R7R A;  1YLA A;  1W2B O;  2BNK A;  3U5Z A;  2Y21 A;  2LXE A;  2IFN A;  5KPZ A;  2YIU B;  4LJ7 A;  1NU1 D;  2F5P A;  3CXH H;  1AVO A;  3MP7 B;  4OMJ A;  2CHQ A;  3SMP A;  2NRG A;  1URQ D;  3GLH A;  3BCC D;  2KZS A;  2O1J A;  2WT7 A;  4AW4 A;  2KXP B;  1K82 A;  4L78 A;  4PD4 I;  3M0E A;  1NTM E;  3D8L A;  4XGI A;  2E43 A;  1FJK A;  1IFI A;  4ZMD A;  1JY3 O;  1EQ7 A;  1PPJ D;  2WSF J;  3J7A S;  4G3O A;  2BCC E;  2HG5 D;  1JTH A;  1OVU A;  1T6A A;  2BAS A;  1LWU C;  2DAK A;  3ZQJ A;  2JXN A;  1TDZ A;  3L71 E;  1BCC E;  1MX0 A;  3E4R A;  3LVV A;  1NU1 E;  1EXI A;  1G1I A;  1NTK D;  3AEE C;  1NOH A;  3SAS A;  1FZC B;  2ZTD A;  1SP4 A;  2FOI C;  2JY7 A;  3AJI B;  3KS8 A;  1N7L A;  2MR9 A;  3AE3 C;  5GTH E;  1NAF A;  4W80 A;  4CJ6 A;  1VDF A;  2NZ2 A;  1K05 A;  4DBG B;  2WPQ A;  3G71 P;  3RK3 C;  2F5O A;  4HH2 A;  1QYR A;  2BJV A;  4U3F J;  5KLI C;  4BB9 A;  1T6O A;  2CWB A;  3B74 A;  2D7G A;  3MHV C;  1MFZ A;  2AHM A;  2RRU A;  2QQ8 A;  1DGH A;  4DV0 M;  1R6B X;  1QAM A;  2ITA A;  3PXG A;  5APV A;  5EXX A;  4X62 M;  2YKP A;  3AEB C;  3E1R A;  3BBZ A;  1L2P A;  3OAK A;  1PIX A;  3V4Q A;  5AW0 B;  1SQV D;  3C9P A;  1JR3 A;  2KNC A;  1USD A;  3M0D A;  3A0H E;  3PTZ A;  3KDP B;  1PGO A;  3U6D A;  2M3B A;  3PNV A;  3TK1 A;  4LCB A;  1M1J A;  4WY4 B;  1QL1 A;  3CWB E;  3HD7 D;  2XFS A;  3UK6 A;  1PP9 D;  1DV0 A;  5A2Q S;  4X65 M;  4HYT B;  3V4W A;  3CXH I;  2K3R A;  4KHP M;  3AE6 C;  2V1U A;  3TNU B;  1HJP A;  3R8F A;  1SQQ E;  3RK3 E;  3M91 A;  3C3D A;  3H4M A;  2FFD C;  1N36 M;  3LW5 H;  4JI1 M;  3U1C A;  2I8D A;  4G6Z A;  1ZMV A;  1QVG O;  1FAV A;  1U7M A;  2B87 B;  2ZT9 B;  2BCC G;  2PP6 A;  1XNQ M;  3QH9 A;  3WU2 H;  1L2C A;  3FTF A;  1HF9 A;  3L4F A;  3L71 G;  1BCC G;  1K73 Q;  2J5U A;  2Q3E A;  2H88 C;  4B7G A;  1PFI A;  3GLM A;  5ITR A;  1XTC C;  1IXS B;  2KRU A;  2QRX A;  3F89 A;  2C98 A;  3IEC A;  2WSS H;  5EJC A;  5GKN A;  3V6I A;  2OYH A;  4JI5 M;  1ZV1 A;  1CZQ A;  1H0T B;  3H25 A;  2GUV A;  1TDH A;  4IFD K;  2CUZ A;  4EOT A;  3U6C A;  1CSB A;  1K04 A;  2D4Q A;  4FWH A;  2OPF A;  1KQG B;  3CCM P;  3RL0 C;  2NQ8 C;  1TTE A;  3KP0 E;  1KYO H;  3H1I G;  3TGU J;  2N1T A;  2QEN A;  2F5S A;  2JP3 A;  3WMM 0;  3CX5 E;  3J27 B;  3KVW A;  4L15 A;  2RGO A;  3L73 J;  2K6B A;  2Y9Y A;  2DWZ B;  2QCU A;  1VQK P;  3B5N A;  4FCW A;  3UZU A;  4EIJ A;  2OOB A;  3RK2 D;  1OTR A;  3WHK A;  1J09 A;  5FTN A;  2B88 A;  3CX5 I;  2RH0 A;  2H5X A;  1EDK A;  5LMU M;  4L6V 6;  2R62 A;  2NPS D;  1CI6 B;  5L8R F;  3P8M C;  1PGP A;  3VMY A;  2ZXE B;  3I01 M;  3FTC A;  1JEK A;  1PGY A;  1SQP E;  1JQJ C;  1BGY D;  3FUV A;  5FLX S;  1OJL A;  3CWB G;  4M9Z A;  3AE5 C;  1IFM A;  1SXJ B;  2G3Q A;  3M06 A;  1OW6 A;  5KKZ C;  2BWB A;  2VQF M;  1SQX K;  1SQX J;  5AVT B;  3H1K J;  2ZAM A;  4LFC M;  3L74 E;  1NTZ D;  3TWK A;  3B7Q A;  2AEM A;  2M8R A;  3L72 J;  4ZKU A;  4H13 B;  3FWL A;  4UN2 B;  2HYN A;  3M9Q A;  2KSJ A;  1ZQ9 A;  2YNY A;  2LXB A;  2N9B A;  3KS4 A;  2K9J A;  1EXJ A;  2LWX A;  1HQY E;  3D6Z A;  3HE4 B;  2R46 A;  2Q1K A;  1XXH A;  2DAM A;  1LWU B;  2HOD A;  4I8O A;  4OVZ B;  2HHH M;  4R7G A;  2X8A A;  4KJM A;  3T1H M;  1SQB E;  1L0L K;  4MH0 E;  1OKS A;  1L0L J;  1AQT A;  1OZH A;  2WZJ A;  4N78 E;  3RBZ A;  1P3Q Q;  5KTB A;  1VQ9 P;  1HTL C;  4I81 A;  2AXT E;  5KLV E;  5B66 H;  1N33 M;  2WIT A;  2R65 A;  4Z8X A;  1W5S A;  2L4F A;  4IL6 E;  1KYO I;  1LTI C;  2W82 A;  4JN6 A;  2P7J A;  3GHG C;  2YFQ A;  4GHL A;  2ZAN A;  2KS1 A;  4LFA M;  2Z5H A;  1RHZ B;  3HHY A;  4H0L C;  4LF6 M;  5H2F E;  2OYI C;  5IWA M;  3VK7 A;  3Q2Y A;  2DZO B;  1AFO A;  2O3J A;  1XB2 B;  4H44 C;  3PH0 A;  1DEE G;  1LTT C;  1BDD A;  3FE3 A;  4ANR A;  1TF0 B;  2LVO C;  3CCS P;  3KZI H;  1Z5A A;  1LTG C;  4M9S A;  2QZ4 A;  3GQ5 A;  2HFE D;  3HJQ A;  3I4Y A;  2IYP A;  1GK6 A;  4LZZ A;  4OU7 A;  1JY2 O;  3HE5 A;  3U6O A;  1VQ4 P;  3L25 A;  1FE6 A;  1SQP G;  3CCL P;  1HGZ A;  3BCC J;  1SG9 A;  4NRV A;  1HT1 E;  3T6P A;  3HUS B;  2K47 A;  1VQ6 P;  2R4J A;  5AVQ B;  4ASW A;  2ZAO A;  4GHA A;  1VG5 A;  2E75 D;  1N2D C;  3KOX E;  1OWA A;  4BXL A;  5BR8 M;  1KIL B;  3VLF B;  4L16 A;  1VQ7 P;  2CEA A;  4RF1 A;  3CCV P;  5CCG A;  1JMB A;  1DIP A;  1NTK K;  1E9R A;  4I4L A;  1X79 B;  1NTK J;  1IN7 A;  1SFC A;  4DR3 M;  3MMP A;  1LP1 A;  3H1L E;  1IBL M;  4UB6 E;  1IO4 A;  3V2R A;  1WMK A;  4P16 A;  1OAI A;  1P84 H;  2XU6 A;  3IFM A;  1VDL A;  2OOA A;  3I4V A;  3B89 A;  5FSW A;  1MJG M;  5F3W A;  3FX0 A;  7CAT A;  2L91 A;  2VQE M;  1XWI A;  4GOF A;  1IFP A;  2MGW A;  2DHY A;  1VF5 D;  1BSH A;  1SQB G;  2H43 A;  1Q02 A;  4KOD A;  2N9Y B;  5KAF E;  4MGY E;  4DZO A;  4IBB A;  2KA6 B;  4WUR A;  5AW7 B;  3KOW E;  2XDJ A;  5CBO A;  2QA4 P;  4MB7 A;  1LTJ B;  3L75 D;  3B5N D;  3SAV A;  1RU3 A;  5KLV G;  2JWA A;  1URQ A;  2R45 A;  3GLG B;  2Q6Q A;  1RE3 A;  4IFM A;  2FS1 A;  1ZLL A;  2Y0Q A;  1SQV K;  4W7Y A;  2XZF A;  2APL A;  3GPY A;  1SQV J;  1HT2 E;  2W83 C;  2LVP C;  1FZC C;  4JI6 M;  3FRH A;  3W0L B;  1GKI A;  2DZL A;  3DA1 A;  3WUV A;  3AEG C;  5APW A;  2LHC A;  1HGV A;  4HKZ H;  1LT1 A;  4NC6 A;  1M57 D;  3GLH B;  2I7N A;  4AKG A;  3AED C;  5FTJ A;  3HRN A;  1NJF A;  1YJ9 P;  1OW8 A;  1L4A D;  4BWN A;  1XTG B;  2KNV A;  2HPC A;  3FTE A;  1A02 J;  1JOC A;  2K9D A;  1N7S C;  2G3A A;  4K3A A;  2N35 A;  3G9R A;  4YXW H;  2K0B X;  4EI2 A;  4DR1 M;  2C9L Y;  2D2C C;  1ZR2 A;  5JI2 E;  4G4N A;  1D0M A;  1WJ7 A;  4LGD E;  1DGF A;  1JTH B;  1L0N E;  1KFM A;  1GMJ A;  5CMZ A;  5KQ8 A;  4GIF A;  2KNA A;  1T2K D;  2GM4 A;  2Q7C A;  2UUB M;  1YSY A;  5APT A;  2PAJ A;  5DFL A;  2HLO A;  4XBO A;  5ITY A;  4AKH A;  4OWF A;  5DNY A;  1ORY B;  4U7J A;  1S1C X;  4W5W A;  1BDC A;  3H1L G;  2FXO A;  1RF0 C;  4WY4 C;  3GLF A;  4JF7 A;  3AEF C;  1P84 I;  1GK4 A;  4BBA A;  1DEB A;  1AQ5 A;  2V1C A;  1OVR A;  4OGQ C;  2QJY B;  3T38 A;  4JI8 M;  2LNH C;  1GDT A;  3C58 A;  3T97 A;  4S12 A;  3L2A A;  3HWS A;  3EIH A;  3U60 A;  2DAI A;  3NBI A;  2QBY A;  1EIJ A;  3E9S A;  1GVN A;  1MUU A;  2E76 D;  4IFF A;  4N3Y B;  1DGH B;  3MJ5 A;  1IK9 A;  1R8E A;  3HD7 A;  2A06 G;  4B7H A;  4GEW A;  1GU4 A;  2FYU E;  2QP9 X;  1DO0 A;  1KB9 E;  2DW3 A;  3U6Q A;  3GHG B;  3A0B H;  1PM5 A;  5ITU A;  5ITQ A;  2KNC B;  4H0L B;  1PJT A;  2DWN A;  4TUW A;  3LVW A;  2YNM D;  5EXP A;  4GIT A;  1M1J B;  2ERC A;  3H6P A;  4CHT B;  3OTO M;  2X49 A;  1BGY J;  3J81 S;  2IFM A;  1J7K A;  3Q8G A;  2IBZ I;  2ZT9 D;  1PGQ A;  2E74 C;  1VQM P;  1EZV D;  1E79 H;  3VTP C;  3IHP A;  2OAR A;  2K88 A;  4DCK A;  3B4S A;  1RE4 A;  1DO2 A;  3M6A A;  1NTZ K;  5EP1 A;  3SMS A;  2W90 A;  4I6M C;  3Q3D A;  1NTZ J;  5CCH C;  1V34 A;  2Q9I A;  2OYO A;  2XNX A;  1NWQ A;  2KZU A;  4I1L A;  1VEG A;  1KMI Z;  2C99 A;  1OVV A;  1L0N G;  3NWL A;  1YUB A;  1R2Y A;  1Z6T A;  4Q7J A;  1UFZ A;  3CCU P;  1FZF A;  4J7P A;  1SQX E;  2POH A;  1NAY A;  2B3T A;  2SPZ A;  3PLN A;  3H1J J;  2JWS A;  3RBX A;  2WSC F;  3AE1 C;  3MUD C;  1JO5 A;  4LRT A;  1VL2 A;  1S4X A;  2OYH B;  4B3S M;  1E9S A;  2BCC D;  5AW9 B;  2DI0 A;  3BRT B;  4D6T J;  2KZI A;  4PD4 E;  1SXJ C;  4ASV A;  3TF5 A;  1FZG A;  3L71 D;  1BCC D;  2C0X A;  1TR8 A;  2NPS A;  3K92 A;  1N75 A;  1TH4 A;  3TPZ A;  2XND H;  4WVZ A;  5IZ7 D;  4H13 C;  5KJ7 D;  2Z4E A;  4LF7 M;  5AW4 B;  1IN8 A;  4D80 A;  4Y99 C;  1VEJ A;  4AQY M;  2FYU G;  2FYZ A;  1KSF X;  3U6S A;  3ABV C;  1E32 A;  2MH8 A;  1GL2 C;  2HL7 A;  1ZRT E;  3W68 A;  1XMO M;  3VP8 A;  1UM8 A;  2VF8 A;  3R2P A;  1H8A A;  1K3X A;  1FC2 C;  1FZE A;  2P2U A;  1Z56 A;  4B08 A;  2ZBK B;  3A98 B;  2QM8 A;  2JNH A;  1AVY A;  3PJS K;  5BU5 A;  2OQQ A; 
#chains in the Genus database with same CATH homology
 4OMJ A;  1OLM E;  3W68 A;  2E2X A;  4J7Q A;  4UYB A;  4TLG A;  3PG7 A;  3HX3 A;  1R5L A;  3B7Q A;  3B74 A;  1AUA A;  3B7N A;  1O6U A;  3W67 A;  4CIZ A;  3B7Z A;  4M8Z A;  1OIP A;  4CJ6 A;  3P7Z A;  3Q8G A;  4OMK A;  1OLM A;  3HY5 A;  4J7P A;  2D4Q A;  3PEG A;  1OIZ A;  4FMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...