3W67A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Alpha-tocopherol transfer protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w67A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w67A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w67A03
3P7ZA 4J7QA 1AUAA 3W68A 4J7PA 1OIZA 3PG7A 4M8ZA 1OLMA 1R5LA 3B7NA 1OLME 4TLGA 4CIZA 2E2XA 2D4QA 4OMKA 3PEGA 4FMMA 3W67A 4OMJA 4UYBA 3B7ZA 1OIPA 3HY5A 3B74A 1O6UA 4CJ6A 3B7QA 3HX3A 3Q8GA
chains in the Genus database with same CATH superfamily
5E26A 2UUCM 2KXEA 1PPJG 3L37A 3T1YM 3FE3A 4LGMA 1YIJP 3H1KD 2QM8A 3AE9C 4P16A 1GO5A 5KLVE 4KODA 1N78A 4L16A 1RHZB 3ZCBB 4M9SA 2G3AA 2H5XA 2VF8A 3GLMA 3RK3C 2DWMA 1SQBJ 1X79B 1N8RQ 4B3RM 2DAIA 1IN5A 2XNDH 2QQ8A 3SFZA 1LTAC 3PJSK 2OQQA 1MU5A 2KHHA 2ZYGA 4K0KM 5CMZA 1IN7A 3NWLA 4ASVA 1H8AA 2XZFA 4PV1D 2MGWA 2E2XA 1ZRTE 3L73G 5GTIE 2KOGA 1WHCA 4NRWA 2APLA 3HJ8A 1SQBK 1IFMA 3G4SP 5FLXS 2IDBA 4PV1C 2OYHA 3KFUG 1SXJE 3QYBA 1ZR4A 3ITKA 3HTKB 2JR8A 2G5GX 5ITTA 4UB6E 4DJGA 3GLFA 4DZOA 1AFOA 1HJPA 3KDPB 2R4EA 2YR0A 3SAWA 3C3EA 3AL0C 1NTZG 1HJBA 4KT0F 4JYCA 1LT9B 3QH9A 1N77A 1NU1K 1JY2P 1GU5A 4MGIE 3AE5C 2Q5UA 4FD2A 2IZ0A 1W2EA 1NSFA 4PD4D 2AXTH 2QJKB 3Q5PA 2J7OA 3K8ZA 1NAFA 4HLQA 3JR4A 2AEMA 1X8YA 2LVOC 4DV2M 3PNVA 3FYDA 1P84H 3TL4X 4WVZA 2P2UA 3R4YA 1I4WA 1N73C 2OTLP 3PHLA 1DGBA 1T2KD 3U1CA 1NH4A 2W90A 3SWYA 1Q3BA 1Z5BA 1NKZB 3IN6A 1GL2A 1Z56A 3CLQA 4L74A 3B7NA 1BE3E 1SQXK 3EQ2A 2A06D 3CXHH 2L7IA 2YKQA 3V2PA 3GF3A 3SHFA 3C8VA 1BSNA 1PIXA 3AEAC 3SAUA 1RQUA 2E43A 3H4MA 1RY3A 3WMM0 5KLVD 3S1KA 2O25A 4FW9A 3H1HG 1OFHA 3ABVC 2VDBB 4J7QA 1S5LH 1C1KA 1NAYA 2X4AA 3H1JG 1OLMA 1VEGA 3SMSA 1R5LA 3TGUJ 1OAIA 2ITAA 3RL0C 2FE8A 3HU2A 1BCCD 1EZVI 4UB6H 3G3ZA 1C7YA 1GW4A 2CHVA 3RL0g 3LW5J 4W7YA 4NL4H 5KLIB 1N7SD 2BCCE 2K37A 2FYUG 2H43A 2FY8A 3AE1C 4YXDC 2K47A 1GD2E 3CXHI 3HE4A 1RF1B 4AKHA 4S12A 2L5GB 1IXSA 1CSBA 1V34A 2O01F 2JP3A 1R2YA 3AEGC 1W2BO 2ZTDA 2WSFF 4H44C 1K73Q 3AEDC 1AV1A 3RL0B 4D80A 4MM3B 2C99A 4RKUJ 3FRIA 3RE8A 1MFTA 5BU8B 1J09A 2R65A 3TWMA 1S1CX 4UB8H 1NKNA 1HNXM 1AQTA 1TF0B 3B5NA 1U7MA 4G4NA 1LTSC 4XE5B 4DR7M 4IIWA 4PD4E 1NNJA 3U5ZA 1KD1Q 1MN3A 2GUVA 3OTOM 4KLNA 2KRUA 3G9RA 5KO3A 4M3LA 2E74B 1NV9A 2Q2EB 2MKVA 2B3TA 1WRGA 1AVYA 2QZ4A 1R6BX 2M5AB 4GOFA 4M8ZA 5IREB 3LIEA 3A7OA 3RL0D 2ZYAA 3HUSC 3H1JJ 4GH9A 1YSYA 4FMMA 3RFWA 3E4RA 3GLGE 3QWOC 3VK8A 2CPSA 1LTBC 1G2CB 2J58A 1IFNA 1FJPA 1QZMA 1LTMA 2FFJA 2WZJA 3U6PA 3H1HE 1GL2D 1XXHB 1D0KA 2Y9YA 3CX5E 2EJSA 3J27B 4LC1A 4B86A 1YITP 1IBLM 1VF5D 2KNCB 4IBDA 3KOZE 1NYHA 3BCCD 4MGYE 1X37A 1KILC 1BE3G 3TGUD 4G4OA 1AA0A 4IBKA 1JY2O 3HD7D 2HLOA 1T3JA 2XSZA 1GTWA 4XBOA 1L4AA 3EFFK 3AEEC 3HY5A 3AEFC 3CGWA 4G3OA 3L75D 3TNUB 1OW6A 2L91A 3FTEA 2JJLA 2JY7A 1PL5A 2FYUE 3II6A 1HWTC 1Q39A 4LZZA 1JTHA 3Q3DA 2ZTCA 1IXZA 2R6FA 1L4AD 1SFCD 2RGHA 4YHHM 1V92A 3HHZA 5AW6B 3H6PA 1F4IA 1NWQA 2C9OA 3B7ZA 2W6AA 1VQNP 4OX9M 3C3DA 2JKVA 3H1KE 3L4FA 1N2DC 3L73E 1SQVJ 1XWIA 3M0EA 4GKKM 3LW5H 5DNYA 3SATA 5C39A 1JY3N 3KHUA 4C7NB 1NTMK 3LMMA 1DGHB 1W5SA 2FS1A 1E94E 3VFDA 4AI6A 5DJTB 3GMAA 3PVSA 4JI5M 2IBZI 3TK1A 3SAVA 3CF0A 1LTJA 4WBAA 4BLCA 3KP0E 1URQC 2YMKA 4NPEA 1NTZD 5CBNA 4DV3M 2HG5D 1FZFA 2W6BA 3SFDC 1CZQA 2EKKA 2FOIC 2RN0A 4O9BA 1NTZK 2OO9A 1QUSA 3GPPA 5EXPA 3AKZA 3HKPA 2QM7A 4ASWA 3P8CE 1G8PA 3UK6A 3K1JA 4GEWA 3C9IA 4DT0A 1NTKD 1IK9A 2XF3A 1SQPG 1VQ4P 4CHTB 5APVA 2ZT9D 2KSEA 2BCCJ 3AE7C 5KJ7C 3I55P 1S9KE 3L70D 1K82A 1N86A 4R4MA 3TSIA 1QAQA 4C46A 3KZIH 3CXHE 3RK2C 3L71E 3H4JA 3A0HH 1NVMA 5DJUB 1SFCC 1DD4A 1L0LD 4TLFA 3H1HD 2CRUA 1IXRC 4JQ0D 2KLVA 2YQZA 3FWNA 1RF0C 2MJZA 3FRHA 4X66M 2XKMA 3CCLP 4GHLA 4JI1M 3SHGB 5BR8M 3GG2A 5IWAM 3RK3B 3D6YA 2M0BA 2UUAM 4WP2A 2KA6B 3M9QA 3VP8A 4DR1M 1KSFX 1Y8GA 1G1JA 4LRSA 2Q6QA 1H0TB 2G3QA 3HHYA 4GRIA 1AQ5A 3KOYE 1OWAA 2WSFJ 1J1DB 1S5LX 1JR3E 1DEBA 4I5SA 4UYBA 3EWKA 2YIUC 5DYGA 3RK3E 3L36A 4OW0A 1BGYG 4PCZA 7CATA 3HHXA 1K05A 3L27A 3THGA 1D0MA 4I7ZB 4N3YB 4JI8M 4AQRD 1K9MQ 1FZGA 2DZNB 4EOTA 2LWXA 2FYZA 5AVUB 2E5TA 1SFCA 3BRTB 2F4VM 3H1LD 2Q7CA 1OXZA 3L73D 2L7HA 1QDRA 2CE7A 3D71A 4I81A 1IY0A 2Z4RA 5ITYA 2MROB 2DXIA 3J81S 1OFIA 4UN2B 4B7HA 2LVQD 1Z6TA 2WSCH 3GO8A 4TT3H 1EZVG 4FWDA 2L4EA 5GTIH 3V4QA 2JWAA 3GLGA 2D7EA 3WU2E 3M6AA 1E79H 1OVRA 4TLGA 2DW3A 1ZXGA 1NNUC 2OOBA 4NSOB 4K35A 3KYQA 1SQXG 1EDLA 4HEOA 5E79H 1G59A 1OVVA 4CPGA 5ITXE 3CF6E 1SQQJ 1SLQA 2K0BX 5E6JA 2O01J 2WVRA 1ZV8A 2HYNA 1WR1B 3V2QA 3P8CD 3VTPC 3I5CA 3KDSE 1YJWP 3GRUA 4WWIA 5K5GB 4D6TJ 1VEKA 1NJFA 2NQ8C 4OH8B 3L70E 2XSZD 1GZLA 2RH0A 1NVOA 1J7KA 4JI6M 3U6MA 1FC2C 2PGDA 1OIPA 3B74A 3BCCG 3U61B 1IN4A 1LT1A 2JWDA 2F5PA 1SQXJ 3K2LA 4CISA 1OQYA 1SQBE 5ITRA 2ZAMA 1MV8A 2LVAA 5AVSB 1A02J 3MUDA 1FAVA 3MTUE 4XFJA 2IPPA 2HPCB 5AVTB 2H7HA 4W5WA 2OYIA 1NU1J 3DA1A 2AEFA 2I7PA 4L4UA 4G4QA 1KQFB 5CBOA 4L78A 3BBZA 2A06G 1RE3A 5DYIA 1FDMA 3I4YA 3CCUP 3E7KA 4HB1A 1P84E 3A0BE 4LGDE 2JNHA 1QX8A 3RGSA 5AVYB 3VK7A 1KFNA 2QA4P 3HX3A 2Y21A 1SQBG 1NU1E 1T8ZA 3I4VA 4DV5M 1QEXA 2WSSH 1LJ2A 3USSA 1RU3A 1YE9A 1CW5A 1R2ZA 1L8QA 1R4GA 3JC22 1IC2A 3MHVC 2FBWC 3RBZA 2OOAA 1L1TA 1HQCA 4L6V6 4NSRA 4LJ8A 4MH0E 1FZCC 3GLHA 4CJ6A 1E5WA 2Q1KA 4D6TD 4RNAA 5B5EH 2QE7H 1FE6A 3PG7A 2QNJA 4EIJA 2BASA 3VOPA 1HNWM 4Y99C 3OW2O 5KPRA 3L75E 2EKFA 2XFTA 3UIAA 3KXEC 1URQD 5APXA 1WGLA 2DAEA 1NTMG 2OYHC 5BU5A 4B08A 2LVNC 3TWLA 1L4AB 2XV5A 2ZJSE 5EXTA 1OJLA 2LBCA 1N73A 4DBGB 3FXDA 1KZUB 2XU6A 3L74J 1PP9G 1L2BA 3PXGA 3RGUA 2BNKA 4DV7M 1ZMEC 3TYYA 2PRRA 3IG8A 4IBJA 1LWUC 2O5RA 4H44D 4JI7M 3A3YB 2PP6A 2K88A 1W5TA 1ZV1A 2L09A 3P7ZA 4RKUF 1RE3C 2GA1A 2YO2A 1JR3A 2WWWA 1GLNA 5C18A 1TDZA 3HUSA 3PNYA 1SQPD 4LJ6A 1HT2E 1PJQA 1FBMA 2R0IA 2V7QJ 2QJYC 5B66H 5LMUM 1SQQD 2SPZA 4Y28F 2ZBKB 2IBZD 2JZ0A 5AVQB 1VQMP 3MZWB 4R4LA 4LJ4A 1SQQK 1PV3A 1VQ8P 2D7HA 4FWGA 2QHOB 4DUZM 5AW2B 1IBMM 1ZW0A 3SBJA 1XB2B 2K9YA 1QYRA 3MJ5A 3B8EB 3D70A 3LQRA 3CCEP 3WHLA 1FOSF 3E1IA 2F5SA 2JZ1A 3QYEA 1P84D 2RKLA 1QDTA 1ZMVA 1QVRA 2IX7C 3CPWO 3M91A 4MB7A 3GQ5A 1JOCA 5AVWB 2KB7P 4H0LB 1VQ7P 1M1KQ 1CI6B 3HWSA 4A3VB 3U6OA 4H13B 5KAFH 5F3WA 5ITXA 1SXJC 2EO2A 3U61A 1L0LE 1M57D 3HRNA 3EIHA 2NZ2A 4OGQD 5AW3B 2V6ZM 5CJ4A 2JY6B 3B5ND 3L71J 4FWHA 3CCJP 4BWNA 4YY3M 4MN4C 1VL2A 2MH8A 4D6TE 4OGQC 1DGGA 5FTMA 5AVZB 3F5HA 4QHTA 2HCBA 1DO0A 1QANA 4WURA 3TQSA 4H13D 4I2LC 3HGIA 1IJDB 4IL6H 2DAGA 1XXHA 3U6QA 2WSEH 3RBXA 4UB8E 3V2RA 1MFZA 3DOAA 1GW3A 3FKEA 3HHWA 2C9NY 3LCUA 3VMZA 4OVNF 4Q7JA 1KTMA 3CX5I 3H1LG 5KJ7D 1IZNB 3CX5D 5TISH 2BWBA 1LV7A 3LIDA 2XEPA 1VQ1A 1QL2A 2JO1A 2Q3EA 4I7ZC 3T15A 4KHPM 1L0NK 3FGAD 3GLHB 4OWFA 2N1TA 5AVVB 1BGYJ 5KLVK 4ZMDA 1PPJD 2LNHC 4TUWA 3U1AA 3E21A 2VIIA 4NPDA 3A42A 2FYUK 1OX3A 1SFCB 1FOSE 4HJGH 2XGNA 3RGPA 2FFDC 3CC4P 2FYUD 3GLHE 3WUUA 2C0WA 3AE8C 3U60A 1NJGA 3Q5RA 5APYA 3KPEA 1YUBA 1PFIA 3J7AS 2E76B 4XK8F 2Q9IA 3JR5A 1JM0A 3Q1MA 3CI9A 2R32A 3BASA 5H2FE 3U59A 1OLME 3BRVB 1QVFO 1L0LG 1CI6A 3UMMA 1NHGC 3K9OA 1IFPA 1TGUA 1EQ7A 2NPSD 1SQVG 2F5QA 1H88A 3U6CA 2MR9A 4LF8M 3L25A 3CD6P 1J2JB 2CP8A 1XTGB 1XHBA 3GPXA 2JXNA 1KV4A 5M1BA 3FUVA 3AOGA 1G1IA 1LTIC 2FH0A 2HHHM 2BCCG 3CF2A 5FSWA 1DO2A 1G3IA 3GRYA 3L26A 1KYOH 3HU3A 4IBBA 2ZVNB 1VPCA 4RO0A 3H32A 1H89A 2L4FA 1L0NE 1AVOA 3MP7B 2XDJA 1MKMA 1SQBD 4ZKUA 3C1LA 3VMYA 1PM5A 2Z3XA 2QRXA 1Q02A 4MGHA 3H1JE 1IN8A 1JNMA 4W80A 1Q3CA 3H1IE 2V1UA 2E74D 3A98B 3HD7C 2AXTE 5GTHH 1FU1A 1LWUB 2N35A 1OZHA 2HFED 1E9RA 1GJTA 1E9SA 4DR5M 5FTLA 1S3JA 4RJTA 2IFNA 1IM2A 1YTZT 2KYVA 1XXHE 2WMMA 3IF4A 3L75G 1SQVK 1S9KD 3L74G 2M3EA 2Y9ZA 1Y9BA 2LVPC 4D6TG 2N1TB 2ZVOB 3L71D 2B87A 2KP8A 3L72G 1M1JC 4EIWA 4R71A 1Q86Q 3V2NA 1UIXA 2C9CA 1U7JA 1ZQ9A 1VQ5P 1H0TA 1SQXE 3P32A 3P7KA 3E46A 3NMDA 2KZSA 4U7JA 1N7SA 2FFDB 3PP5A 1MZ9A 5AW1B 4ZPXA 2OQ4A 4RF0A 3KVWA 1HJ0A 3HU1A 3AEBC 2E42A 4DV1M 1PPJE 3M0DA 2JY5A 1FJGM 3IR9A 5KLVG 3KS4A 5JI2E 4L15A 4QNMA 2H8PD 4EDFA 1YHQP 4GODA 3AE3C 3B89A 4LF4M 1NTKJ 5EFWB 1BDCA 2RGOA 2D4QA 4NRVA 1X22A 1M90Q 4AG5A 3L74D 4IJEA 3F92A 3V6IA 1W5CE 3VYIA 3AOEA 2D7GA 4LRTA 2CV2A 4GC9A 5KPZA 2HPCA 2C96A 3L28A 3VKGA 4PV1B 1KN7A 4PJ0H 4M9XA 1QGKB 2UXBM 3TGUE 2JEEA 3FUWA 3GLGB 3KSJA 2E75D 1PRBA 1LP1A 2R62A 2CPBA 1YJ9P 2HAKA 2FYUJ 3KW6A 3H1IJ 3L70G 1A02F 2R5DA 4BRYA 1WGNA 1NTKK 4NPFX 1PGJA 1T3UA 2ZM6M 5AVXB 1N7SC 2BEQD 2P10A 3GHGB 1SQVE 3AJIB 8CATA 4R3DA 1VQOP 4DV0M 2QIWA 3PRJA 4IOIH 3GLFB 1JCCA 3GLIE 1L0ND 4I4LA 1BGYD 2J7NA 1FZCB 1QAMA 1QZEA 1L0NG 2FNAA 2IBZE 1NO1A 1J1EC 3H1JD 1OKSA 3R9XB 5EP1A 1URQB 2N9BA 4LF6M 3R8FA 2D2CD 3H1HJ 5KLIC 4M9ZA 3UJNA 4OMJA 3HE5A 2D2CC 2LR2A 3AE6C 1OAOC 2RKOA 4PD2A 4LF5M 1VQKP 2Y0QA 2EA0A 4N78D 4KO8A 1KC8Q 1S3SA 2XH9A 3LVWA 2DENA 1JUNA 1OW7A 4XA4A 3S4RA 3OAKA 4DR6M 4DOJA 1EFUB 2DZLA 3A0BH 1LTTC 3QWLA 4LGYA 1NTZE 2P1JA 1VQPP 2CFOA 5APTA 2QPAA 2FKWB 2G8LA 3U6DA 2R44A 4LFCM 1ZAEA 1PGOA 3FUUA 1N75A 4DV6M 1Y47A 3HTKA 1NTKE 3MHVA 4DCKA 4F2LA 3TGUG 3W67A 3Q2YA 2YKOA 2KS1B 3N4XA 3J7BA 1NHLA 1LT9A 2H88C 3CXHD 4YXWH 4C7RA 1WIVA 3SASA 4MGZE 1NY6A 4PJ0E 3B71A 4GC5A 3GPYA 1RE4C 4L73A 3CWBD 3ZQJA 2OGUA 2VF7A 2I7NA 2DNAA 3MMPA 3GQ4A 4IBEA 3CC2P 4PDGA 4AKIA 5FTJA 2IFMA 4B7FA 2UWJE 3HJQA 3TPZA 4D82A 4H0LD 5AVRB 2PFXA 1VDLA 4EYYQ 4JN6A 5CJ0A 2N9YB 2FYNC 3T97A 1EIJA 2IBZG 4PD4I 1O6UA 2CHQA 4WB4A 4LLHA 2DVWB 1GL6A 1Z59A 3UZUA 4PDIA 1FZCA 2YXRB 3W0FA 2HODA 3B9PA 3UGJA 4LF7M 1J1DC 4G4RA 3L73J 4KT0J 2ERCA 2KK7A 4FCWA 1GL2B 1SP4A 4B3SM 1IXSB 1SQVD 2P58A 2RRUA 1HQYE 3MD0A 2I1KA 3QAUA 4M0DA 2IYOA 3B5NC 1YBKA 3D6ZA 3KP1E 1VF5C 3IHPA 3M7GA 4JYAM 1IFJA 1EZVD 2YXQB 1X9VA 2P67A 1NY5A 2R18A 4X62M 2Y0DA 3B7QA 1HBWA 3M0AA 2JP7A 3H1LE 4L75A 1J5EM 3P8MC 5APSA 5KAIH 2OTKE 3L72J 4JF7A 1L0LJ 2Y0EA 1NJIQ 1SS1A 4JYBA 1G71A 1DGFA 3VKHA 2C98A 1OW8A 4DV4M 1VEJA 2E76C 3M9HA 4U3FD 1JMMA 3GHGC 4BB9A 3ZH9B 3LQQA 1SQPE 1IY2A 1WJ7A 3SWKA 2AHMA 4F1IA 2A45G 1D0LA 3GPUA 2DI0A 1S4XA 1DH3A 3MIWA 1KB9D 2KUBA 1KQLA 2HWJA 5KAIE 2LXEA 1G2CA 1KB9I 3H1ID 3PEGA 4BBAA 3K92A 4JI2M 5JI3E 2KI7B 1K04A 2W82A 3U6LA 3GRVA 1QL1A 4YPCA 2KIKA 2DHRA 1YTZI 2NPSC 3FUXA 1KB9H 2W27A 2O1KA 3AV0A 2PAJA 1VF5B 4X65M 1H6UA 5KKZB 2QP9X 3B5NB 1Q7YQ 5H2FH 1R8EA 2N1TC 4WY4D 5B66E 3I51A 3U5ZB 2Z5IA 2X8AA 2R3CA 3CTWB 3TNUA 4IFDK 1T43A 2Z4SA 1PJJA 3K9PA 2WSCJ 1VDFA 3LVVA 5BVZA 4HKZH 2N1TD 4WY4C 1NGMB 3L29A 1P3QQ 4QNRA 1KILB 2ZT9B 2CV1A 3V76A 4AW4A 1TR8A 4DR4M 2WITA 1L2PA 1NU1D 1AIPC 3H1IG 3ILKA 4EI2A 2V1CA 5APQA 1PGQA 3V5BA 2ZYDA 4LJ5A 2R45A 3CC7P 4GHAA 2EUCA 3V4WA 4X64M 3Q8GA 3FD9A 3PH0A 3LCVB 1FDOA 2W83C 1HT1E 4REZA 3L74E 3SSUA 1EE8A 1OIZA 1LGHB 2CEAA 2CK3H 2QCUA 1FZBA 1FJKA 3D8BA 3CCMP 3D8LA 3C9PA 3FUTA 4I6MC 3HD7B 2LHCA 1SG9A 4IFFA 2DWNA 3H25A 1Y8AA 2QJPC 1SXJA 1LTJB 1MUUA 2JUJA 1G41A 1N36M 2KRKA 3KSXA 3PTZA 5CCGD 5C1BA 5AW4B 3M9BA 2WTYA 4GOEA 1QUTA 5B5EE 2HODB 4HH2A 1VG5A 3DFZA 4B7GA 2A45H 4W7ZA 1T2KC 2ZXXA 1SXJD 2B87B 1KILE 1UFZA 1NOHA 3CMEP 2A5YB 1KYOE 3NXSA 3U6EA 3GLIA 4PT5A 1XTCC 1XC8A 3RK2D 2QENA 3L71G 2M8RA 5KPTA 3WUVA 4JPZB 1SQPJ 3GF7A 1VQ9P 1USEA 1M56D 4QMAA 3Q8XA 1L2DA 2BWEA 1NTKG 1YYCA 1KFMA 3A45A 3WHKA 1PP9J 3CX5H 3NBXX 2V4HA 4IBCA 1BDDA 3E1RA 1T6AA 3VP9A 2WT7B 3I01M 3FWLA 3MUDC 3J2PB 4JV5M 1NV8A 5FTNA 4C7NA 2K1AA 1URQA 2YKPA 2XNXA 2YIUB 3L72E 3RK2B 2R46A 2LH0A 1PJTA 2OYHB 4AUWA 1UIIA 1BSHA 3LW5F 1HGZA 1LWUA 3TWKA 3FTCA 1GVNA 1SQQE 3OA7A 4NOOB 2GNOA 4DUYM 2DWLA 1PZQA 2AXCA 1ZMUA 1JY3O 2LXBA 4WY4A 1EC5A 1JY2N 3BOSA 5APUA 1EXIA 2UU9M 1YQ3C 4PD4H 2A06E 1JMBA 1AUAA 2KSJA 1HVVA 5EJCA 3AE4C 3L75J 1N7SB 5EXXA 5KQDA 4HYTB 2FFDA 4LF9M 3J80S 4GIFA 2KW0A 2E5LM 4NXMM 2IYPA 3VN0A 2R3SA 4NXNM 2JA2A 1DIPA 1WXQA 1JB0J 3CWBE 2KZIA 3TDKA 5CHXA 4KJMA 4FCVA 5H37D 1JY3P 3TE6A 1BCCE 4IL6E 1DV0A 4ZNCA 4QHSA 3R2PA 3SFEC 2QSIA 1D7MA 1KILA 5AW5B 1M8OB 2I8DA 2BCCD 1JO5A 4XGIA 1HUCA 1ZMWA 3T6PA 1FS0E 2HR3A 5KJ7A 3O6QA 1BCCG 2QJYB 3U60B 2KNZA 3T97B 1KILD 3IAOA 5KQ8A 3I56P 1PJIA 2OYIC 1NTZJ 1EZVE 4JI3M 4Z8XA 4LJ9A 4OMKA 5IT9S 5GTHE 2H89C 2K9JA 1L1ZA 3GW6A 2Z4EA 5ITQA 1EDIA 1SQQG 2DZOB 1ZRTD 2KZUA 2E74C 4LZJA 4AG6A 3L70J 2H1RA 1BVSA 1FDIA 2HL7A 4NC6A 2VQFM 1LTGC 1T6OA 1RF0A 1GJSA 4U3FE 2CV0A 1TTEA 3HE4B 1RF1A 3K5BA 2LTUA 1QQWA 4ZKPA 2F5OA 4LFBM 1KYOI 1L0LK 1GU4A 2W8ZA 2P7JA 1TU3F 1N7LA 1NTME 2VQEM 4B3TM 3A0HE 1FZAA 1NHWC 2WPVB 1IFDA 2B9BA 1K3WA 3KZIE 4II7A 2IZ1A 1VQ6P 3CCSP 1TDHA 3H1LJ 3SYLA 2I1JA 2UXCM 3BCCJ 5EQTA 1TH3A 3CL3D 1N34M 1J1EB 3A2AA 3VLFB 5CCHA 3SC3A 3VDPA 5DFLA 1RE4A 1GKIA 1KMIZ 2AEJA 2WQYC 1JTHB 1LT9C 3KS8A 2NPSB 2Q3IA 1YLAA 2YO3A 1CUKA 2XZUA 1IY1A 3AOEC 3W68A 2R5BA 1EDKA 3ZC7B 1IN6A 1QAOA 4AQYM 3PFIA 2X49A 2KS1A 3EIEA 3FTDA 1PP9D 2YNMD 4RF1A 2LXCB 3FYCA 1TH4A 2QBYA 3G6EP 3HJSA 1BE3D 2QEXP 2WSEF 4OU7A 3CCQP 2QG4A 3TF5A 4U3FJ 3NBIA 2J59M 1XNRM 2Z8YM 3PLNA 1XNQM 3JAMS 3BATA 4Y99B 1GL7A 2F5NA 1QVGO 2BJWA 2QSFX 1KORA 4JI0M 4GMQA 3H1KJ 2K6BA 2CHGA 1FNNA 4DR3M 2V7QH 2W6JH 3IFMA 3I04M 1SQXD 3B4SA 1XMOM 1PGPA 2DHYA 2UUBM 1GL2C 4IFMA 1Z5AA 4U3FG 1OFCX 3BXWA 1I94M 5AW0B 5CCHD 2WSCF 1YQ4C 1N32M 3E9SA 2GM4A 2KNVA 2ZXEB 2CWBA 2OYOA 4GIPA 1SVFA 3A5TA 1YJNP 3FX0A 2Z7JA 2QJPB 5EXSA 4G6ZA 3HD7A 3VMXA 1L2CA 4GKGA 1N33M 1Z5CA 1GK4A 2WPSA 2WPRA 1HGVA 3O8ZA 4IL6X 5CCGC 1SXJB 5EP3A 1HF9A 5A2QS 2FXMA 2WSEJ 3Q5SA 1ZN5A 3KQGA 2NRGA 3NTNA 5LMNM 1NTMD 4MGKE 1GDTA 2OARA 4OGQB 2BEZF 2FYNB 4D81A 4ITQA 2NPSA 3CWBJ 5EP4A 3DZDA 1AJYA 1T3TA 2GQFA 2KNAA 5E79E 1KFVA 5CCGA 1VDDA 2DWZB 2XFSA 1RH5B 1M1JB 1X0TA 3AE2C 1Q2NA 4YTPC 1YI2P 2E5YA 4LCBA 1IFYA 3GP1A 3HUSB 5GKNA 4H0LC 1ORYB 1LP1B 1NU1G 1EDJA 1OTRA 4Z1MH 4FVMA 2WT7A 4OVZA 1BGYE 5TJHA 3WUTA 2YFQA 4M0WA 4DR2M 1KB9E 4JXJA 1HH0A 1JQJC 2R4JA 2POHA 3GHGA 2OTJP 5TISE 1OMIA 3M06A 1K8AQ 2ZAOA 4K3AA 4L8RC 5L8RJ 4CIZA 3JCUH 2KDLA 3N7NA 3OJAB 1RQVA 2XLJA 2Y20A 4N78E 4LJ7A 3C58A 4QOSA 4WY4B 1IO4A 4P17A 3BCCE 1S2EA 3IG5A 2J5YA 5FTKA 3F89A 2K3RA 4FCTA 2C0XA 1GMJA 4IBFA 3HE5B 1NTMJ 3KOXE 3NFQA 4I1LA 3CCVP 2ZFCA 4LJAA 3HZJA 3CMAP 1USDA 1EXJA 4LY6A 5IZ7D 1IBKM 5KKZC 2L2DA 2Y0CA 1SQPK 3SARA 1G4AE 4H44B 2L6OA 2UXDM 2Z5HA 2C5RA 2KEBA 3T38A 4R7GA 2YMYA 4KHXA 1Q82Q 4JBZA 2FXOA 1IFIA 3M0DC 2O01N 2ZANA 4J7PA 2RMZA 3VDUA 5BPVA 1K3XA 5CCHC 3SYKA 2ZAEB 2QVAA 1HNZM 1WMKA 3S9OA 3GRRA 2A45I 4N6JA 1V33A 3KOWE 2WSFH 2Y0TA 1R7RA 3A46A 4GKJM 3W0LB 1DD3A 2XZRA 1U57A 1WT6A 2DAMA 1M1JA 2JY8A 1PJSA 2WZ7A 3U6SA 3AFHA 3H32B 4IJFA 2HKJA 1Q81Q 1HTLC 5AW9B 4GDOA 1MJGM 1KYIA 4OVZB 1L0NJ 1JB0F 3L2AA 1RF1C 2M3BA 1D2NA 3GLIB 2KNCA 1A5TA 2KLUA 1DX7A 2LKMA 3KXDA 1S72P 4ANRA 1ZP0C 4GT1A 4AZFA 2KXPB 3CWBG 1ZOYC 4AKGA 1KYOD 4Y28J 2YNYA 5ITUA 1NO4A 4JI4M 2E75C 3MGNA 3ZDMA 2M5ZA 3GQ3A 1OVUA 2KZJA 1E32A 1IK7A 1R5SA 1PGYA 1BCCJ 1LTJC 5L8RF 2WPQA 2FXPA 1HR0M 4B3MM 3JCUE 1UM8A 2QJKC 1FZEA 1ZLLA 2M5AA 1LNQA 2J5UA 3IECA 5AW8B 4H13C 2G8YA 3L72D 1JCDA 2OYIB 3O6QB 3WU2H 3SMPA 2LHGA 3L35A 4IBGA 2GUSA 2O01H 5AW7B 4HL4A 1DEEG 1VQLP 3FTFA 1N73B 4Z6YA 4LG2A 1QLED 5KLVJ 3MK6A 4WW0A 4RESB 2VRSA 4QOZC 2BJVA 5EP2A 2JDIH 1JR3D 1DGHA 1MX0A 1PP9E 5KTBA 2K9JB 1BE3J 1M7LA 3RK3D 2E76D 3H1KG 2O1JA 3VMAA 1XMQM 2O3JA 3T1HM 4IBIA 5KAFE 2CUZA 1IQPA 2B88A 1Q90D 2OPFA 2JWSA 3SWFA 2MJ5B 1S5LE 3FXEA 1TH2A 4AYCA 3GLFE 4A7PA 1L4AC 2QBYB 3JSVC 3EFGA 2M60A 2B89A 2E75B 1P84I 4CGYB 3G71P 3BVHA 2DAKA 4BRYB 1ZR2A 2ZT9C 4L76A 2DKLA 3CCRP 2C9LY 2P5TA 3AECC 4LFAM 1GK6A 2D2CB 1KQGB 1KQSO 1GABA 1JEKA 4BXLA 2K9DA 5APWA 4GITA 4I8OA
chains in the Genus database with same CATH topology
3P7ZA 4J7QA 1AUAA 3W68A 4J7PA 1OIZA 3PG7A 4M8ZA 1OLMA 1R5LA 3B7NA 1OLME 4TLGA 4CIZA 2E2XA 2D4QA 4OMKA 3PEGA 4FMMA 3W67A 4OMJA 4UYBA 3B7ZA 1OIPA 3HY5A 3B74A 1O6UA 4CJ6A 3B7QA 3HX3A 3Q8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7Z A;  4J7Q A;  1AUA A;  3W68 A;  4J7P A;  1OIZ A;  3PG7 A;  4M8Z A;  1OLM A;  1R5L A;  3B7N A;  1OLM E;  4TLG A;  4CIZ A;  2E2X A;  2D4Q A;  4OMK A;  3PEG A;  4FMM A;  3W67 A;  4OMJ A;  4UYB A;  3B7Z A;  1OIP A;  3HY5 A;  3B74 A;  1O6U A;  4CJ6 A;  3B7Q A;  3HX3 A;  3Q8G A; 
#chains in the Genus database with same CATH topology
 5E26 A;  2UUC M;  2KXE A;  1PPJ G;  3L37 A;  3T1Y M;  3FE3 A;  4LGM A;  1YIJ P;  3H1K D;  2QM8 A;  3AE9 C;  4P16 A;  1GO5 A;  5KLV E;  4KOD A;  1N78 A;  4L16 A;  1RHZ B;  3ZCB B;  4M9S A;  2G3A A;  2H5X A;  2VF8 A;  3GLM A;  3RK3 C;  2DWM A;  1SQB J;  1X79 B;  1N8R Q;  4B3R M;  2DAI A;  1IN5 A;  2XND H;  2QQ8 A;  3SFZ A;  1LTA C;  3PJS K;  2OQQ A;  1MU5 A;  2KHH A;  2ZYG A;  4K0K M;  5CMZ A;  1IN7 A;  3NWL A;  4ASV A;  1H8A A;  2XZF A;  4PV1 D;  2MGW A;  2E2X A;  1ZRT E;  3L73 G;  5GTI E;  2KOG A;  1WHC A;  4NRW A;  2APL A;  3HJ8 A;  1SQB K;  1IFM A;  3G4S P;  5FLX S;  2IDB A;  4PV1 C;  2OYH A;  3KFU G;  1SXJ E;  3QYB A;  1ZR4 A;  3ITK A;  3HTK B;  2JR8 A;  2G5G X;  5ITT A;  4UB6 E;  4DJG A;  3GLF A;  4DZO A;  1AFO A;  1HJP A;  3KDP B;  2R4E A;  2YR0 A;  3SAW A;  3C3E A;  3AL0 C;  1NTZ G;  1HJB A;  4KT0 F;  4JYC A;  1LT9 B;  3QH9 A;  1N77 A;  1NU1 K;  1JY2 P;  1GU5 A;  4MGI E;  3AE5 C;  2Q5U A;  4FD2 A;  2IZ0 A;  1W2E A;  1NSF A;  4PD4 D;  2AXT H;  2QJK B;  3Q5P A;  2J7O A;  3K8Z A;  1NAF A;  4HLQ A;  3JR4 A;  2AEM A;  1X8Y A;  2LVO C;  4DV2 M;  3PNV A;  3FYD A;  1P84 H;  3TL4 X;  4WVZ A;  2P2U A;  3R4Y A;  1I4W A;  1N73 C;  2OTL P;  3PHL A;  1DGB A;  1T2K D;  3U1C A;  1NH4 A;  2W90 A;  3SWY A;  1Q3B A;  1Z5B A;  1NKZ B;  3IN6 A;  1GL2 A;  1Z56 A;  3CLQ A;  4L74 A;  3B7N A;  1BE3 E;  1SQX K;  3EQ2 A;  2A06 D;  3CXH H;  2L7I A;  2YKQ A;  3V2P A;  3GF3 A;  3SHF A;  3C8V A;  1BSN A;  1PIX A;  3AEA C;  3SAU A;  1RQU A;  2E43 A;  3H4M A;  1RY3 A;  3WMM 0;  5KLV D;  3S1K A;  2O25 A;  4FW9 A;  3H1H G;  1OFH A;  3ABV C;  2VDB B;  4J7Q A;  1S5L H;  1C1K A;  1NAY A;  2X4A A;  3H1J G;  1OLM A;  1VEG A;  3SMS A;  1R5L A;  3TGU J;  1OAI A;  2ITA A;  3RL0 C;  2FE8 A;  3HU2 A;  1BCC D;  1EZV I;  4UB6 H;  3G3Z A;  1C7Y A;  1GW4 A;  2CHV A;  3RL0 g;  3LW5 J;  4W7Y A;  4NL4 H;  5KLI B;  1N7S D;  2BCC E;  2K37 A;  2FYU G;  2H43 A;  2FY8 A;  3AE1 C;  4YXD C;  2K47 A;  1GD2 E;  3CXH I;  3HE4 A;  1RF1 B;  4AKH A;  4S12 A;  2L5G B;  1IXS A;  1CSB A;  1V34 A;  2O01 F;  2JP3 A;  1R2Y A;  3AEG C;  1W2B O;  2ZTD A;  2WSF F;  4H44 C;  1K73 Q;  3AED C;  1AV1 A;  3RL0 B;  4D80 A;  4MM3 B;  2C99 A;  4RKU J;  3FRI A;  3RE8 A;  1MFT A;  5BU8 B;  1J09 A;  2R65 A;  3TWM A;  1S1C X;  4UB8 H;  1NKN A;  1HNX M;  1AQT A;  1TF0 B;  3B5N A;  1U7M A;  4G4N A;  1LTS C;  4XE5 B;  4DR7 M;  4IIW A;  4PD4 E;  1NNJ A;  3U5Z A;  1KD1 Q;  1MN3 A;  2GUV A;  3OTO M;  4KLN A;  2KRU A;  3G9R A;  5KO3 A;  4M3L A;  2E74 B;  1NV9 A;  2Q2E B;  2MKV A;  2B3T A;  1WRG A;  1AVY A;  2QZ4 A;  1R6B X;  2M5A B;  4GOF A;  4M8Z A;  5IRE B;  3LIE A;  3A7O A;  3RL0 D;  2ZYA A;  3HUS C;  3H1J J;  4GH9 A;  1YSY A;  4FMM A;  3RFW A;  3E4R A;  3GLG E;  3QWO C;  3VK8 A;  2CPS A;  1LTB C;  1G2C B;  2J58 A;  1IFN A;  1FJP A;  1QZM A;  1LTM A;  2FFJ A;  2WZJ A;  3U6P A;  3H1H E;  1GL2 D;  1XXH B;  1D0K A;  2Y9Y A;  3CX5 E;  2EJS A;  3J27 B;  4LC1 A;  4B86 A;  1YIT P;  1IBL M;  1VF5 D;  2KNC B;  4IBD A;  3KOZ E;  1NYH A;  3BCC D;  4MGY E;  1X37 A;  1KIL C;  1BE3 G;  3TGU D;  4G4O A;  1AA0 A;  4IBK A;  1JY2 O;  3HD7 D;  2HLO A;  1T3J A;  2XSZ A;  1GTW A;  4XBO A;  1L4A A;  3EFF K;  3AEE C;  3HY5 A;  3AEF C;  3CGW A;  4G3O A;  3L75 D;  3TNU B;  1OW6 A;  2L91 A;  3FTE A;  2JJL A;  2JY7 A;  1PL5 A;  2FYU E;  3II6 A;  1HWT C;  1Q39 A;  4LZZ A;  1JTH A;  3Q3D A;  2ZTC A;  1IXZ A;  2R6F A;  1L4A D;  1SFC D;  2RGH A;  4YHH M;  1V92 A;  3HHZ A;  5AW6 B;  3H6P A;  1F4I A;  1NWQ A;  2C9O A;  3B7Z A;  2W6A A;  1VQN P;  4OX9 M;  3C3D A;  2JKV A;  3H1K E;  3L4F A;  1N2D C;  3L73 E;  1SQV J;  1XWI A;  3M0E A;  4GKK M;  3LW5 H;  5DNY A;  3SAT A;  5C39 A;  1JY3 N;  3KHU A;  4C7N B;  1NTM K;  3LMM A;  1DGH B;  1W5S A;  2FS1 A;  1E94 E;  3VFD A;  4AI6 A;  5DJT B;  3GMA A;  3PVS A;  4JI5 M;  2IBZ I;  3TK1 A;  3SAV A;  3CF0 A;  1LTJ A;  4WBA A;  4BLC A;  3KP0 E;  1URQ C;  2YMK A;  4NPE A;  1NTZ D;  5CBN A;  4DV3 M;  2HG5 D;  1FZF A;  2W6B A;  3SFD C;  1CZQ A;  2EKK A;  2FOI C;  2RN0 A;  4O9B A;  1NTZ K;  2OO9 A;  1QUS A;  3GPP A;  5EXP A;  3AKZ A;  3HKP A;  2QM7 A;  4ASW A;  3P8C E;  1G8P A;  3UK6 A;  3K1J A;  4GEW A;  3C9I A;  4DT0 A;  1NTK D;  1IK9 A;  2XF3 A;  1SQP G;  1VQ4 P;  4CHT B;  5APV A;  2ZT9 D;  2KSE A;  2BCC J;  3AE7 C;  5KJ7 C;  3I55 P;  1S9K E;  3L70 D;  1K82 A;  1N86 A;  4R4M A;  3TSI A;  1QAQ A;  4C46 A;  3KZI H;  3CXH E;  3RK2 C;  3L71 E;  3H4J A;  3A0H H;  1NVM A;  5DJU B;  1SFC C;  1DD4 A;  1L0L D;  4TLF A;  3H1H D;  2CRU A;  1IXR C;  4JQ0 D;  2KLV A;  2YQZ A;  3FWN A;  1RF0 C;  2MJZ A;  3FRH A;  4X66 M;  2XKM A;  3CCL P;  4GHL A;  4JI1 M;  3SHG B;  5BR8 M;  3GG2 A;  5IWA M;  3RK3 B;  3D6Y A;  2M0B A;  2UUA M;  4WP2 A;  2KA6 B;  3M9Q A;  3VP8 A;  4DR1 M;  1KSF X;  1Y8G A;  1G1J A;  4LRS A;  2Q6Q A;  1H0T B;  2G3Q A;  3HHY A;  4GRI A;  1AQ5 A;  3KOY E;  1OWA A;  2WSF J;  1J1D B;  1S5L X;  1JR3 E;  1DEB A;  4I5S A;  4UYB A;  3EWK A;  2YIU C;  5DYG A;  3RK3 E;  3L36 A;  4OW0 A;  1BGY G;  4PCZ A;  7CAT A;  3HHX A;  1K05 A;  3L27 A;  3THG A;  1D0M A;  4I7Z B;  4N3Y B;  4JI8 M;  4AQR D;  1K9M Q;  1FZG A;  2DZN B;  4EOT A;  2LWX A;  2FYZ A;  5AVU B;  2E5T A;  1SFC A;  3BRT B;  2F4V M;  3H1L D;  2Q7C A;  1OXZ A;  3L73 D;  2L7H A;  1QDR A;  2CE7 A;  3D71 A;  4I81 A;  1IY0 A;  2Z4R A;  5ITY A;  2MRO B;  2DXI A;  3J81 S;  1OFI A;  4UN2 B;  4B7H A;  2LVQ D;  1Z6T A;  2WSC H;  3GO8 A;  4TT3 H;  1EZV G;  4FWD A;  2L4E A;  5GTI H;  3V4Q A;  2JWA A;  3GLG A;  2D7E A;  3WU2 E;  3M6A A;  1E79 H;  1OVR A;  4TLG A;  2DW3 A;  1ZXG A;  1NNU C;  2OOB A;  4NSO B;  4K35 A;  3KYQ A;  1SQX G;  1EDL A;  4HEO A;  5E79 H;  1G59 A;  1OVV A;  4CPG A;  5ITX E;  3CF6 E;  1SQQ J;  1SLQ A;  2K0B X;  5E6J A;  2O01 J;  2WVR A;  1ZV8 A;  2HYN A;  1WR1 B;  3V2Q A;  3P8C D;  3VTP C;  3I5C A;  3KDS E;  1YJW P;  3GRU A;  4WWI A;  5K5G B;  4D6T J;  1VEK A;  1NJF A;  2NQ8 C;  4OH8 B;  3L70 E;  2XSZ D;  1GZL A;  2RH0 A;  1NVO A;  1J7K A;  4JI6 M;  3U6M A;  1FC2 C;  2PGD A;  1OIP A;  3B74 A;  3BCC G;  3U61 B;  1IN4 A;  1LT1 A;  2JWD A;  2F5P A;  1SQX J;  3K2L A;  4CIS A;  1OQY A;  1SQB E;  5ITR A;  2ZAM A;  1MV8 A;  2LVA A;  5AVS B;  1A02 J;  3MUD A;  1FAV A;  3MTU E;  4XFJ A;  2IPP A;  2HPC B;  5AVT B;  2H7H A;  4W5W A;  2OYI A;  1NU1 J;  3DA1 A;  2AEF A;  2I7P A;  4L4U A;  4G4Q A;  1KQF B;  5CBO A;  4L78 A;  3BBZ A;  2A06 G;  1RE3 A;  5DYI A;  1FDM A;  3I4Y A;  3CCU P;  3E7K A;  4HB1 A;  1P84 E;  3A0B E;  4LGD E;  2JNH A;  1QX8 A;  3RGS A;  5AVY B;  3VK7 A;  1KFN A;  2QA4 P;  3HX3 A;  2Y21 A;  1SQB G;  1NU1 E;  1T8Z A;  3I4V A;  4DV5 M;  1QEX A;  2WSS H;  1LJ2 A;  3USS A;  1RU3 A;  1YE9 A;  1CW5 A;  1R2Z A;  1L8Q A;  1R4G A;  3JC2 2;  1IC2 A;  3MHV C;  2FBW C;  3RBZ A;  2OOA A;  1L1T A;  1HQC A;  4L6V 6;  4NSR A;  4LJ8 A;  4MH0 E;  1FZC C;  3GLH A;  4CJ6 A;  1E5W A;  2Q1K A;  4D6T D;  4RNA A;  5B5E H;  2QE7 H;  1FE6 A;  3PG7 A;  2QNJ A;  4EIJ A;  2BAS A;  3VOP A;  1HNW M;  4Y99 C;  3OW2 O;  5KPR A;  3L75 E;  2EKF A;  2XFT A;  3UIA A;  3KXE C;  1URQ D;  5APX A;  1WGL A;  2DAE A;  1NTM G;  2OYH C;  5BU5 A;  4B08 A;  2LVN C;  3TWL A;  1L4A B;  2XV5 A;  2ZJS E;  5EXT A;  1OJL A;  2LBC A;  1N73 A;  4DBG B;  3FXD A;  1KZU B;  2XU6 A;  3L74 J;  1PP9 G;  1L2B A;  3PXG A;  3RGU A;  2BNK A;  4DV7 M;  1ZME C;  3TYY A;  2PRR A;  3IG8 A;  4IBJ A;  1LWU C;  2O5R A;  4H44 D;  4JI7 M;  3A3Y B;  2PP6 A;  2K88 A;  1W5T A;  1ZV1 A;  2L09 A;  3P7Z A;  4RKU F;  1RE3 C;  2GA1 A;  2YO2 A;  1JR3 A;  2WWW A;  1GLN A;  5C18 A;  1TDZ A;  3HUS A;  3PNY A;  1SQP D;  4LJ6 A;  1HT2 E;  1PJQ A;  1FBM A;  2R0I A;  2V7Q J;  2QJY C;  5B66 H;  5LMU M;  1SQQ D;  2SPZ A;  4Y28 F;  2ZBK B;  2IBZ D;  2JZ0 A;  5AVQ B;  1VQM P;  3MZW B;  4R4L A;  4LJ4 A;  1SQQ K;  1PV3 A;  1VQ8 P;  2D7H A;  4FWG A;  2QHO B;  4DUZ M;  5AW2 B;  1IBM M;  1ZW0 A;  3SBJ A;  1XB2 B;  2K9Y A;  1QYR A;  3MJ5 A;  3B8E B;  3D70 A;  3LQR A;  3CCE P;  3WHL A;  1FOS F;  3E1I A;  2F5S A;  2JZ1 A;  3QYE A;  1P84 D;  2RKL A;  1QDT A;  1ZMV A;  1QVR A;  2IX7 C;  3CPW O;  3M91 A;  4MB7 A;  3GQ5 A;  1JOC A;  5AVW B;  2KB7 P;  4H0L B;  1VQ7 P;  1M1K Q;  1CI6 B;  3HWS A;  4A3V B;  3U6O A;  4H13 B;  5KAF H;  5F3W A;  5ITX A;  1SXJ C;  2EO2 A;  3U61 A;  1L0L E;  1M57 D;  3HRN A;  3EIH A;  2NZ2 A;  4OGQ D;  5AW3 B;  2V6Z M;  5CJ4 A;  2JY6 B;  3B5N D;  3L71 J;  4FWH A;  3CCJ P;  4BWN A;  4YY3 M;  4MN4 C;  1VL2 A;  2MH8 A;  4D6T E;  4OGQ C;  1DGG A;  5FTM A;  5AVZ B;  3F5H A;  4QHT A;  2HCB A;  1DO0 A;  1QAN A;  4WUR A;  3TQS A;  4H13 D;  4I2L C;  3HGI A;  1IJD B;  4IL6 H;  2DAG A;  1XXH A;  3U6Q A;  2WSE H;  3RBX A;  4UB8 E;  3V2R A;  1MFZ A;  3DOA A;  1GW3 A;  3FKE A;  3HHW A;  2C9N Y;  3LCU A;  3VMZ A;  4OVN F;  4Q7J A;  1KTM A;  3CX5 I;  3H1L G;  5KJ7 D;  1IZN B;  3CX5 D;  5TIS H;  2BWB A;  1LV7 A;  3LID A;  2XEP A;  1VQ1 A;  1QL2 A;  2JO1 A;  2Q3E A;  4I7Z C;  3T15 A;  4KHP M;  1L0N K;  3FGA D;  3GLH B;  4OWF A;  2N1T A;  5AVV B;  1BGY J;  5KLV K;  4ZMD A;  1PPJ D;  2LNH C;  4TUW A;  3U1A A;  3E21 A;  2VII A;  4NPD A;  3A42 A;  2FYU K;  1OX3 A;  1SFC B;  1FOS E;  4HJG H;  2XGN A;  3RGP A;  2FFD C;  3CC4 P;  2FYU D;  3GLH E;  3WUU A;  2C0W A;  3AE8 C;  3U60 A;  1NJG A;  3Q5R A;  5APY A;  3KPE A;  1YUB A;  1PFI A;  3J7A S;  2E76 B;  4XK8 F;  2Q9I A;  3JR5 A;  1JM0 A;  3Q1M A;  3CI9 A;  2R32 A;  3BAS A;  5H2F E;  3U59 A;  1OLM E;  3BRV B;  1QVF O;  1L0L G;  1CI6 A;  3UMM A;  1NHG C;  3K9O A;  1IFP A;  1TGU A;  1EQ7 A;  2NPS D;  1SQV G;  2F5Q A;  1H88 A;  3U6C A;  2MR9 A;  4LF8 M;  3L25 A;  3CD6 P;  1J2J B;  2CP8 A;  1XTG B;  1XHB A;  3GPX A;  2JXN A;  1KV4 A;  5M1B A;  3FUV A;  3AOG A;  1G1I A;  1LTI C;  2FH0 A;  2HHH M;  2BCC G;  3CF2 A;  5FSW A;  1DO2 A;  1G3I A;  3GRY A;  3L26 A;  1KYO H;  3HU3 A;  4IBB A;  2ZVN B;  1VPC A;  4RO0 A;  3H32 A;  1H89 A;  2L4F A;  1L0N E;  1AVO A;  3MP7 B;  2XDJ A;  1MKM A;  1SQB D;  4ZKU A;  3C1L A;  3VMY A;  1PM5 A;  2Z3X A;  2QRX A;  1Q02 A;  4MGH A;  3H1J E;  1IN8 A;  1JNM A;  4W80 A;  1Q3C A;  3H1I E;  2V1U A;  2E74 D;  3A98 B;  3HD7 C;  2AXT E;  5GTH H;  1FU1 A;  1LWU B;  2N35 A;  1OZH A;  2HFE D;  1E9R A;  1GJT A;  1E9S A;  4DR5 M;  5FTL A;  1S3J A;  4RJT A;  2IFN A;  1IM2 A;  1YTZ T;  2KYV A;  1XXH E;  2WMM A;  3IF4 A;  3L75 G;  1SQV K;  1S9K D;  3L74 G;  2M3E A;  2Y9Z A;  1Y9B A;  2LVP C;  4D6T G;  2N1T B;  2ZVO B;  3L71 D;  2B87 A;  2KP8 A;  3L72 G;  1M1J C;  4EIW A;  4R71 A;  1Q86 Q;  3V2N A;  1UIX A;  2C9C A;  1U7J A;  1ZQ9 A;  1VQ5 P;  1H0T A;  1SQX E;  3P32 A;  3P7K A;  3E46 A;  3NMD A;  2KZS A;  4U7J A;  1N7S A;  2FFD B;  3PP5 A;  1MZ9 A;  5AW1 B;  4ZPX A;  2OQ4 A;  4RF0 A;  3KVW A;  1HJ0 A;  3HU1 A;  3AEB C;  2E42 A;  4DV1 M;  1PPJ E;  3M0D A;  2JY5 A;  1FJG M;  3IR9 A;  5KLV G;  3KS4 A;  5JI2 E;  4L15 A;  4QNM A;  2H8P D;  4EDF A;  1YHQ P;  4GOD A;  3AE3 C;  3B89 A;  4LF4 M;  1NTK J;  5EFW B;  1BDC A;  2RGO A;  2D4Q A;  4NRV A;  1X22 A;  1M90 Q;  4AG5 A;  3L74 D;  4IJE A;  3F92 A;  3V6I A;  1W5C E;  3VYI A;  3AOE A;  2D7G A;  4LRT A;  2CV2 A;  4GC9 A;  5KPZ A;  2HPC A;  2C96 A;  3L28 A;  3VKG A;  4PV1 B;  1KN7 A;  4PJ0 H;  4M9X A;  1QGK B;  2UXB M;  3TGU E;  2JEE A;  3FUW A;  3GLG B;  3KSJ A;  2E75 D;  1PRB A;  1LP1 A;  2R62 A;  2CPB A;  1YJ9 P;  2HAK A;  2FYU J;  3KW6 A;  3H1I J;  3L70 G;  1A02 F;  2R5D A;  4BRY A;  1WGN A;  1NTK K;  4NPF X;  1PGJ A;  1T3U A;  2ZM6 M;  5AVX B;  1N7S C;  2BEQ D;  2P10 A;  3GHG B;  1SQV E;  3AJI B;  8CAT A;  4R3D A;  1VQO P;  4DV0 M;  2QIW A;  3PRJ A;  4IOI H;  3GLF B;  1JCC A;  3GLI E;  1L0N D;  4I4L A;  1BGY D;  2J7N A;  1FZC B;  1QAM A;  1QZE A;  1L0N G;  2FNA A;  2IBZ E;  1NO1 A;  1J1E C;  3H1J D;  1OKS A;  3R9X B;  5EP1 A;  1URQ B;  2N9B A;  4LF6 M;  3R8F A;  2D2C D;  3H1H J;  5KLI C;  4M9Z A;  3UJN A;  4OMJ A;  3HE5 A;  2D2C C;  2LR2 A;  3AE6 C;  1OAO C;  2RKO A;  4PD2 A;  4LF5 M;  1VQK P;  2Y0Q A;  2EA0 A;  4N78 D;  4KO8 A;  1KC8 Q;  1S3S A;  2XH9 A;  3LVW A;  2DEN A;  1JUN A;  1OW7 A;  4XA4 A;  3S4R A;  3OAK A;  4DR6 M;  4DOJ A;  1EFU B;  2DZL A;  3A0B H;  1LTT C;  3QWL A;  4LGY A;  1NTZ E;  2P1J A;  1VQP P;  2CFO A;  5APT A;  2QPA A;  2FKW B;  2G8L A;  3U6D A;  2R44 A;  4LFC M;  1ZAE A;  1PGO A;  3FUU A;  1N75 A;  4DV6 M;  1Y47 A;  3HTK A;  1NTK E;  3MHV A;  4DCK A;  4F2L A;  3TGU G;  3W67 A;  3Q2Y A;  2YKO A;  2KS1 B;  3N4X A;  3J7B A;  1NHL A;  1LT9 A;  2H88 C;  3CXH D;  4YXW H;  4C7R A;  1WIV A;  3SAS A;  4MGZ E;  1NY6 A;  4PJ0 E;  3B71 A;  4GC5 A;  3GPY A;  1RE4 C;  4L73 A;  3CWB D;  3ZQJ A;  2OGU A;  2VF7 A;  2I7N A;  2DNA A;  3MMP A;  3GQ4 A;  4IBE A;  3CC2 P;  4PDG A;  4AKI A;  5FTJ A;  2IFM A;  4B7F A;  2UWJ E;  3HJQ A;  3TPZ A;  4D82 A;  4H0L D;  5AVR B;  2PFX A;  1VDL A;  4EYY Q;  4JN6 A;  5CJ0 A;  2N9Y B;  2FYN C;  3T97 A;  1EIJ A;  2IBZ G;  4PD4 I;  1O6U A;  2CHQ A;  4WB4 A;  4LLH A;  2DVW B;  1GL6 A;  1Z59 A;  3UZU A;  4PDI A;  1FZC A;  2YXR B;  3W0F A;  2HOD A;  3B9P A;  3UGJ A;  4LF7 M;  1J1D C;  4G4R A;  3L73 J;  4KT0 J;  2ERC A;  2KK7 A;  4FCW A;  1GL2 B;  1SP4 A;  4B3S M;  1IXS B;  1SQV D;  2P58 A;  2RRU A;  1HQY E;  3MD0 A;  2I1K A;  3QAU A;  4M0D A;  2IYO A;  3B5N C;  1YBK A;  3D6Z A;  3KP1 E;  1VF5 C;  3IHP A;  3M7G A;  4JYA M;  1IFJ A;  1EZV D;  2YXQ B;  1X9V A;  2P67 A;  1NY5 A;  2R18 A;  4X62 M;  2Y0D A;  3B7Q A;  1HBW A;  3M0A A;  2JP7 A;  3H1L E;  4L75 A;  1J5E M;  3P8M C;  5APS A;  5KAI H;  2OTK E;  3L72 J;  4JF7 A;  1L0L J;  2Y0E A;  1NJI Q;  1SS1 A;  4JYB A;  1G71 A;  1DGF A;  3VKH A;  2C98 A;  1OW8 A;  4DV4 M;  1VEJ A;  2E76 C;  3M9H A;  4U3F D;  1JMM A;  3GHG C;  4BB9 A;  3ZH9 B;  3LQQ A;  1SQP E;  1IY2 A;  1WJ7 A;  3SWK A;  2AHM A;  4F1I A;  2A45 G;  1D0L A;  3GPU A;  2DI0 A;  1S4X A;  1DH3 A;  3MIW A;  1KB9 D;  2KUB A;  1KQL A;  2HWJ A;  5KAI E;  2LXE A;  1G2C A;  1KB9 I;  3H1I D;  3PEG A;  4BBA A;  3K92 A;  4JI2 M;  5JI3 E;  2KI7 B;  1K04 A;  2W82 A;  3U6L A;  3GRV A;  1QL1 A;  4YPC A;  2KIK A;  2DHR A;  1YTZ I;  2NPS C;  3FUX A;  1KB9 H;  2W27 A;  2O1K A;  3AV0 A;  2PAJ A;  1VF5 B;  4X65 M;  1H6U A;  5KKZ B;  2QP9 X;  3B5N B;  1Q7Y Q;  5H2F H;  1R8E A;  2N1T C;  4WY4 D;  5B66 E;  3I51 A;  3U5Z B;  2Z5I A;  2X8A A;  2R3C A;  3CTW B;  3TNU A;  4IFD K;  1T43 A;  2Z4S A;  1PJJ A;  3K9P A;  2WSC J;  1VDF A;  3LVV A;  5BVZ A;  4HKZ H;  2N1T D;  4WY4 C;  1NGM B;  3L29 A;  1P3Q Q;  4QNR A;  1KIL B;  2ZT9 B;  2CV1 A;  3V76 A;  4AW4 A;  1TR8 A;  4DR4 M;  2WIT A;  1L2P A;  1NU1 D;  1AIP C;  3H1I G;  3ILK A;  4EI2 A;  2V1C A;  5APQ A;  1PGQ A;  3V5B A;  2ZYD A;  4LJ5 A;  2R45 A;  3CC7 P;  4GHA A;  2EUC A;  3V4W A;  4X64 M;  3Q8G A;  3FD9 A;  3PH0 A;  3LCV B;  1FDO A;  2W83 C;  1HT1 E;  4REZ A;  3L74 E;  3SSU A;  1EE8 A;  1OIZ A;  1LGH B;  2CEA A;  2CK3 H;  2QCU A;  1FZB A;  1FJK A;  3D8B A;  3CCM P;  3D8L A;  3C9P A;  3FUT A;  4I6M C;  3HD7 B;  2LHC A;  1SG9 A;  4IFF A;  2DWN A;  3H25 A;  1Y8A A;  2QJP C;  1SXJ A;  1LTJ B;  1MUU A;  2JUJ A;  1G41 A;  1N36 M;  2KRK A;  3KSX A;  3PTZ A;  5CCG D;  5C1B A;  5AW4 B;  3M9B A;  2WTY A;  4GOE A;  1QUT A;  5B5E E;  2HOD B;  4HH2 A;  1VG5 A;  3DFZ A;  4B7G A;  2A45 H;  4W7Z A;  1T2K C;  2ZXX A;  1SXJ D;  2B87 B;  1KIL E;  1UFZ A;  1NOH A;  3CME P;  2A5Y B;  1KYO E;  3NXS A;  3U6E A;  3GLI A;  4PT5 A;  1XTC C;  1XC8 A;  3RK2 D;  2QEN A;  3L71 G;  2M8R A;  5KPT A;  3WUV A;  4JPZ B;  1SQP J;  3GF7 A;  1VQ9 P;  1USE A;  1M56 D;  4QMA A;  3Q8X A;  1L2D A;  2BWE A;  1NTK G;  1YYC A;  1KFM A;  3A45 A;  3WHK A;  1PP9 J;  3CX5 H;  3NBX X;  2V4H A;  4IBC A;  1BDD A;  3E1R A;  1T6A A;  3VP9 A;  2WT7 B;  3I01 M;  3FWL A;  3MUD C;  3J2P B;  4JV5 M;  1NV8 A;  5FTN A;  4C7N A;  2K1A A;  1URQ A;  2YKP A;  2XNX A;  2YIU B;  3L72 E;  3RK2 B;  2R46 A;  2LH0 A;  1PJT A;  2OYH B;  4AUW A;  1UII A;  1BSH A;  3LW5 F;  1HGZ A;  1LWU A;  3TWK A;  3FTC A;  1GVN A;  1SQQ E;  3OA7 A;  4NOO B;  2GNO A;  4DUY M;  2DWL A;  1PZQ A;  2AXC A;  1ZMU A;  1JY3 O;  2LXB A;  4WY4 A;  1EC5 A;  1JY2 N;  3BOS A;  5APU A;  1EXI A;  2UU9 M;  1YQ3 C;  4PD4 H;  2A06 E;  1JMB A;  1AUA A;  2KSJ A;  1HVV A;  5EJC A;  3AE4 C;  3L75 J;  1N7S B;  5EXX A;  5KQD A;  4HYT B;  2FFD A;  4LF9 M;  3J80 S;  4GIF A;  2KW0 A;  2E5L M;  4NXM M;  2IYP A;  3VN0 A;  2R3S A;  4NXN M;  2JA2 A;  1DIP A;  1WXQ A;  1JB0 J;  3CWB E;  2KZI A;  3TDK A;  5CHX A;  4KJM A;  4FCV A;  5H37 D;  1JY3 P;  3TE6 A;  1BCC E;  4IL6 E;  1DV0 A;  4ZNC A;  4QHS A;  3R2P A;  3SFE C;  2QSI A;  1D7M A;  1KIL A;  5AW5 B;  1M8O B;  2I8D A;  2BCC D;  1JO5 A;  4XGI A;  1HUC A;  1ZMW A;  3T6P A;  1FS0 E;  2HR3 A;  5KJ7 A;  3O6Q A;  1BCC G;  2QJY B;  3U60 B;  2KNZ A;  3T97 B;  1KIL D;  3IAO A;  5KQ8 A;  3I56 P;  1PJI A;  2OYI C;  1NTZ J;  1EZV E;  4JI3 M;  4Z8X A;  4LJ9 A;  4OMK A;  5IT9 S;  5GTH E;  2H89 C;  2K9J A;  1L1Z A;  3GW6 A;  2Z4E A;  5ITQ A;  1EDI A;  1SQQ G;  2DZO B;  1ZRT D;  2KZU A;  2E74 C;  4LZJ A;  4AG6 A;  3L70 J;  2H1R A;  1BVS A;  1FDI A;  2HL7 A;  4NC6 A;  2VQF M;  1LTG C;  1T6O A;  1RF0 A;  1GJS A;  4U3F E;  2CV0 A;  1TTE A;  3HE4 B;  1RF1 A;  3K5B A;  2LTU A;  1QQW A;  4ZKP A;  2F5O A;  4LFB M;  1KYO I;  1L0L K;  1GU4 A;  2W8Z A;  2P7J A;  1TU3 F;  1N7L A;  1NTM E;  2VQE M;  4B3T M;  3A0H E;  1FZA A;  1NHW C;  2WPV B;  1IFD A;  2B9B A;  1K3W A;  3KZI E;  4II7 A;  2IZ1 A;  1VQ6 P;  3CCS P;  1TDH A;  3H1L J;  3SYL A;  2I1J A;  2UXC M;  3BCC J;  5EQT A;  1TH3 A;  3CL3 D;  1N34 M;  1J1E B;  3A2A A;  3VLF B;  5CCH A;  3SC3 A;  3VDP A;  5DFL A;  1RE4 A;  1GKI A;  1KMI Z;  2AEJ A;  2WQY C;  1JTH B;  1LT9 C;  3KS8 A;  2NPS B;  2Q3I A;  1YLA A;  2YO3 A;  1CUK A;  2XZU A;  1IY1 A;  3AOE C;  3W68 A;  2R5B A;  1EDK A;  3ZC7 B;  1IN6 A;  1QAO A;  4AQY M;  3PFI A;  2X49 A;  2KS1 A;  3EIE A;  3FTD A;  1PP9 D;  2YNM D;  4RF1 A;  2LXC B;  3FYC A;  1TH4 A;  2QBY A;  3G6E P;  3HJS A;  1BE3 D;  2QEX P;  2WSE F;  4OU7 A;  3CCQ P;  2QG4 A;  3TF5 A;  4U3F J;  3NBI A;  2J59 M;  1XNR M;  2Z8Y M;  3PLN A;  1XNQ M;  3JAM S;  3BAT A;  4Y99 B;  1GL7 A;  2F5N A;  1QVG O;  2BJW A;  2QSF X;  1KOR A;  4JI0 M;  4GMQ A;  3H1K J;  2K6B A;  2CHG A;  1FNN A;  4DR3 M;  2V7Q H;  2W6J H;  3IFM A;  3I04 M;  1SQX D;  3B4S A;  1XMO M;  1PGP A;  2DHY A;  2UUB M;  1GL2 C;  4IFM A;  1Z5A A;  4U3F G;  1OFC X;  3BXW A;  1I94 M;  5AW0 B;  5CCH D;  2WSC F;  1YQ4 C;  1N32 M;  3E9S A;  2GM4 A;  2KNV A;  2ZXE B;  2CWB A;  2OYO A;  4GIP A;  1SVF A;  3A5T A;  1YJN P;  3FX0 A;  2Z7J A;  2QJP B;  5EXS A;  4G6Z A;  3HD7 A;  3VMX A;  1L2C A;  4GKG A;  1N33 M;  1Z5C A;  1GK4 A;  2WPS A;  2WPR A;  1HGV A;  3O8Z A;  4IL6 X;  5CCG C;  1SXJ B;  5EP3 A;  1HF9 A;  5A2Q S;  2FXM A;  2WSE J;  3Q5S A;  1ZN5 A;  3KQG A;  2NRG A;  3NTN A;  5LMN M;  1NTM D;  4MGK E;  1GDT A;  2OAR A;  4OGQ B;  2BEZ F;  2FYN B;  4D81 A;  4ITQ A;  2NPS A;  3CWB J;  5EP4 A;  3DZD A;  1AJY A;  1T3T A;  2GQF A;  2KNA A;  5E79 E;  1KFV A;  5CCG A;  1VDD A;  2DWZ B;  2XFS A;  1RH5 B;  1M1J B;  1X0T A;  3AE2 C;  1Q2N A;  4YTP C;  1YI2 P;  2E5Y A;  4LCB A;  1IFY A;  3GP1 A;  3HUS B;  5GKN A;  4H0L C;  1ORY B;  1LP1 B;  1NU1 G;  1EDJ A;  1OTR A;  4Z1M H;  4FVM A;  2WT7 A;  4OVZ A;  1BGY E;  5TJH A;  3WUT A;  2YFQ A;  4M0W A;  4DR2 M;  1KB9 E;  4JXJ A;  1HH0 A;  1JQJ C;  2R4J A;  2POH A;  3GHG A;  2OTJ P;  5TIS E;  1OMI A;  3M06 A;  1K8A Q;  2ZAO A;  4K3A A;  4L8R C;  5L8R J;  4CIZ A;  3JCU H;  2KDL A;  3N7N A;  3OJA B;  1RQV A;  2XLJ A;  2Y20 A;  4N78 E;  4LJ7 A;  3C58 A;  4QOS A;  4WY4 B;  1IO4 A;  4P17 A;  3BCC E;  1S2E A;  3IG5 A;  2J5Y A;  5FTK A;  3F89 A;  2K3R A;  4FCT A;  2C0X A;  1GMJ A;  4IBF A;  3HE5 B;  1NTM J;  3KOX E;  3NFQ A;  4I1L A;  3CCV P;  2ZFC A;  4LJA A;  3HZJ A;  3CMA P;  1USD A;  1EXJ A;  4LY6 A;  5IZ7 D;  1IBK M;  5KKZ C;  2L2D A;  2Y0C A;  1SQP K;  3SAR A;  1G4A E;  4H44 B;  2L6O A;  2UXD M;  2Z5H A;  2C5R A;  2KEB A;  3T38 A;  4R7G A;  2YMY A;  4KHX A;  1Q82 Q;  4JBZ A;  2FXO A;  1IFI A;  3M0D C;  2O01 N;  2ZAN A;  4J7P A;  2RMZ A;  3VDU A;  5BPV A;  1K3X A;  5CCH C;  3SYK A;  2ZAE B;  2QVA A;  1HNZ M;  1WMK A;  3S9O A;  3GRR A;  2A45 I;  4N6J A;  1V33 A;  3KOW E;  2WSF H;  2Y0T A;  1R7R A;  3A46 A;  4GKJ M;  3W0L B;  1DD3 A;  2XZR A;  1U57 A;  1WT6 A;  2DAM A;  1M1J A;  2JY8 A;  1PJS A;  2WZ7 A;  3U6S A;  3AFH A;  3H32 B;  4IJF A;  2HKJ A;  1Q81 Q;  1HTL C;  5AW9 B;  4GDO A;  1MJG M;  1KYI A;  4OVZ B;  1L0N J;  1JB0 F;  3L2A A;  1RF1 C;  2M3B A;  1D2N A;  3GLI B;  2KNC A;  1A5T A;  2KLU A;  1DX7 A;  2LKM A;  3KXD A;  1S72 P;  4ANR A;  1ZP0 C;  4GT1 A;  4AZF A;  2KXP B;  3CWB G;  1ZOY C;  4AKG A;  1KYO D;  4Y28 J;  2YNY A;  5ITU A;  1NO4 A;  4JI4 M;  2E75 C;  3MGN A;  3ZDM A;  2M5Z A;  3GQ3 A;  1OVU A;  2KZJ A;  1E32 A;  1IK7 A;  1R5S A;  1PGY A;  1BCC J;  1LTJ C;  5L8R F;  2WPQ A;  2FXP A;  1HR0 M;  4B3M M;  3JCU E;  1UM8 A;  2QJK C;  1FZE A;  1ZLL A;  2M5A A;  1LNQ A;  2J5U A;  3IEC A;  5AW8 B;  4H13 C;  2G8Y A;  3L72 D;  1JCD A;  2OYI B;  3O6Q B;  3WU2 H;  3SMP A;  2LHG A;  3L35 A;  4IBG A;  2GUS A;  2O01 H;  5AW7 B;  4HL4 A;  1DEE G;  1VQL P;  3FTF A;  1N73 B;  4Z6Y A;  4LG2 A;  1QLE D;  5KLV J;  3MK6 A;  4WW0 A;  4RES B;  2VRS A;  4QOZ C;  2BJV A;  5EP2 A;  2JDI H;  1JR3 D;  1DGH A;  1MX0 A;  1PP9 E;  5KTB A;  2K9J B;  1BE3 J;  1M7L A;  3RK3 D;  2E76 D;  3H1K G;  2O1J A;  3VMA A;  1XMQ M;  2O3J A;  3T1H M;  4IBI A;  5KAF E;  2CUZ A;  1IQP A;  2B88 A;  1Q90 D;  2OPF A;  2JWS A;  3SWF A;  2MJ5 B;  1S5L E;  3FXE A;  1TH2 A;  4AYC A;  3GLF E;  4A7P A;  1L4A C;  2QBY B;  3JSV C;  3EFG A;  2M60 A;  2B89 A;  2E75 B;  1P84 I;  4CGY B;  3G71 P;  3BVH A;  2DAK A;  4BRY B;  1ZR2 A;  2ZT9 C;  4L76 A;  2DKL A;  3CCR P;  2C9L Y;  2P5T A;  3AEC C;  4LFA M;  1GK6 A;  2D2C B;  1KQG B;  1KQS O;  1GAB A;  1JEK A;  4BXL A;  2K9D A;  5APW A;  4GIT A;  4I8O A; 
#chains in the Genus database with same CATH homology
 3P7Z A;  4J7Q A;  1AUA A;  3W68 A;  4J7P A;  1OIZ A;  3PG7 A;  4M8Z A;  1OLM A;  1R5L A;  3B7N A;  1OLM E;  4TLG A;  4CIZ A;  2E2X A;  2D4Q A;  4OMK A;  3PEG A;  4FMM A;  3W67 A;  4OMJ A;  4UYB A;  3B7Z A;  1OIP A;  3HY5 A;  3B74 A;  1O6U A;  4CJ6 A;  3B7Q A;  3HX3 A;  3Q8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...