3W67A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tocopherol transfer protein
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w67A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w67A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w67A03
3B7QA 4OMJA 4CIZA 1OIZA 4J7QA 4CJ6A 3W68A 4TLGA 4M8ZA 3W67A 3HY5A 4UYBA 3B7NA 3P7ZA 4OMKA 3B7ZA 3PG7A 2D4QA 3PEGA 3Q8GA 1OLMA 1R5LA 4FMMA 1O6UA 2E2XA 3HX3A 1OLME 1OIPA 3B74A 4J7PA 1AUAA
chains in the Genus database with same CATH superfamily
3OW2O 2C0XA 1Q86Q 5FTKA 1KQLA 2AXTH 1G1JA 3AE3C 2QJKB 4BRYB 3CX5E 2JR8A 2NRGA 1QLED 4NC6A 1NHGC 4IFMA 1V34A 5FSWA 4PDIA 1X22A 2ZAMA 4D81A 1FDOA 3ZDMA 4LJAA 2DNAA 2ZAEB 2KYVA 4B86A 2CPSA 3GPPA 1BVSA 1YQ4C 2I1KA 3ITKA 1OFHA 4L76A 3J81S 1XMOM 3B7QA 1YE9A 1P84D 2J5UA 4KHXA 3GLGA 3H1LE 4GHAA 5ITXE 5FTMA 1N73C 1FS0E 3H1IJ 1VQ5P 1ZMWA 1SQQG 2K9JB 2JA2A 4NXMM 4LZJA 2CPBA 5KKZC 1PP9E 4DR4M 1W2EA 1LTJB 2LBCA 5TJHA 2R5DA 1N34M 4XBOA 3H4MA 3EFFK 2JWDA 3B74A 4LF7M 2M8RA 2Z5IA 3IG8A 3H1LJ 4FWGA 2K9JA 5AW3B 1SQXK 3D6YA 1EXIA 4H44C 3K8ZA 1NO4A 1JMMA 5AVWB 3AOGA 4D6TD 1R8EA 1OVUA 2PP6A 4MB7A 1LTJA 2FS1A 1EDIA 2R45A 1TH4A 1QDTA 2LTUA 2A45I 1OKSA 2KZJA 3KP1E 2W82A 3UJNA 2E75B 2RH0A 3VMYA 1LTSC 3L29A 5C39A 2JWSA 3KDPB 1JY3O 3PRJA 2D2CB 3CCSP 4AQYM 3VOPA 4JXJA 1LGHB 4AZFA 3FX0A 2OO9A 3HZJA 1Y8AA 5KTBA 5TISH 1HF9A 2DAIA 3C58A 3A5TA 1T43A 1KTMA 2R62A 2WSCH 5AW8B 1BE3J 2R5BA 4ZNCA 5CCGA 2LVPC 3VP8A 4LF5M 2ERCA 2BJWA 3E9SA 2QBYB 2QM7A 4WWIA 3VMZA 1NKNA 2RGOA 2ZT9D 1K3WA 2K0BX 1NNJA 5KAFE 3M0DA 5KO3A 1QAMA 2PFXA 3HTKB 4N78D 3WUTA 2CP8A 3VP9A 4QOSA 5K5GB 1HT2E 1YIJP 1VQKP 1VPCA 5DJUB 1VQNP 3CF0A 1IC2A 2FXOA 2BEQD 1ZAEA 2W6AA 4D6TG 1OFIA 4CIZA 3HTKA 1GK4A 4RKUF 4F1IA 2P10A 1KQGB 1MN3A 3J7BA 2KP8A 3SHGB 1RE4C 3RL0B 1GU4A 3AFHA 1QEXA 2QSIA 3RE8A 4D80A 2DI0A 3B5NC 2QJYB 2KS1A 1PZQA 1ZR4A 2KK7A 4IBKA 3HJSA 2EO2A 3FWNA 2LHGA 1E32A 3M9HA 1KD1Q 3ABVC 3I04M 1PJQA 1QANA 1DV0A 5IREB 2IPPA 1UM8A 4DR7M 1T2KC 1PGJA 4ZPXA 3LVVA 4OW0A 2LR2A 2CHVA 2CEAA 3E21A 4X66M 4H44D 1WIVA 1YJWP 2IBZI 3BCCG 1PGPA 2FKWB 3D70A 1QZEA 3NFQA 2EA0A 5KAIH 2ZANA 3HHXA 3L71E 4LFCM 2I7PA 1CI6B 3MUDC 3T97B 2B89A 3I5CA 1ZR2A 3M7GA 3I4VA 1PL5A 1S4XA 2H43A 4JN6A 2DAKA 2YFQA 1GL2B 1DX7A 1AV1A 2YIUB 1YJ9P 3R4YA 4GIPA 2XEPA 3CCVP 4LJ7A 1JR3D 1SXJC 3T97A 2CRUA 4B7FA 1L2PA 4U3FG 3L71J 1OIPA 3ZC7B 1KB9D 1KYOE 5CCHA 1VEGA 4JI7M 1GL2A 2J7OA 4NL4H 1ZXGA 2IFNA 2R4JA 5AW5B 4G4NA 2VF7A 4FD2A 2HAKA 1JTHB 3EWKA 1VF5C 1N8RQ 2H5XA 1NTME 4LJ4A 1FC2C 2OGUA 1AVOA 4R71A 5APVA 1IFJA 1O6UA 1S5LH 1LP1B 3EIEA 3GLHB 2ZXXA 1IBKM 1KV4A 3FTCA 3G9RA 4FCTA 2ZVNB 5EFWB 3TF5A 1GW4A 2JY5A 1JTHA 1N36M 2CHGA 1RF1C 4ZKUA 3FTEA 1VDDA 1GK6A 2KLVA 2KZSA 1R7RA 1LP1A 2W83C 4OGQC 3GLHA 3V76A 2QENA 2IDBA 1MV8A 3J80S 5EXTA 2JKVA 1Y8GA 2M0BA 1KMIZ 3B5ND 1S1CX 3QWOC 1KZUB 5FTNA 5ITUA 1VQ6P 3KDSE 2OTKE 4QHTA 1Q39A 4HL4A 1NTMK 2QHOB 3A3YB 3GPYA 2HWJA 4L15A 4AW4A 4DR3M 3U6OA 3GRYA 2HFED 3GW6A 4LLHA 1CW5A 3RBXA 1HNWM 3C9IA 5C18A 1M90Q 3SAWA 5KLVE 2G5GX 1T2KD 1MUUA 2RGHA 3TNUB 5FTJA 3H1HD 4H13B 4I7ZB 1ZQ9A 1TR8A 3U6PA 3A42A 4RJTA 1IXSA 1PJIA 4J7PA 1M1JB 3H6PA 3KOXE 2LVQD 3SATA 1PPJD 3U61B 1OW6A 2C9OA 5KPTA 2N9YB 1NTKG 3AE7C 3EIHA 4YHHM 2C0WA 3PP5A 1KORA 4GEWA 2YMYA 1XTCC 3OA7A 3TNUA 1P84I 2FXPA 2CE7A 4YPCA 1Q3CA 2JY7A 3D71A 4R7GA 5B66E 1DEEG 1LT9A 1T3UA 2HODB 3U61A 3GQ5A 3SARA 1SXJD 1IXZA 1BSHA 5LMUM 8CATA 1D0LA 3CPWO 2CV1A 2L91A 2Q6QA 4DV4M 3KW6A 1BGYD 2XV5A 3GQ3A 1D7MA 3CC2P 3M6AA 1NU1D 3AEDC 1E9SA 1OAOC 3LCUA 5EP2A 4CHTB 4OMKA 3A7OA 2H7HA 2CWBA 2F5NA 5KLVK 3U60A 4PD4D 1V33A 1VF5D 3B71A 5DYGA 2Q5UA 3MJ5A 4FVMA 2Y0CA 5H2FE 3U5ZB 3CCQP 4G3OA 1G2CA 1J1EB 3R9XB 2VRSA 2DAMA 1IXRC 2WSCJ 2HKJA 1OW8A 2JY8A 2QG4A 1HNXM 4OX9M 3B8EB 3H1HG 3TSIA 2W27A 4PDGA 4KHPM 1T6AA 1GJTA 1HJPA 3U5ZA 2B88A 2GUSA 1QZMA 3CX5H 3RK2C 3L35A 1SQPE 1BCCG 2KLUA 3GPXA 2XNDH 4OGQD 2DWMA 2E74C 3O6QA 3LQQA 2Z4EA 1PPJG 4K3AA 4G4QA 1LV7A 1PJSA 3HHZA 4B3SM 3KVWA 4WY4A 3FE3A 5EXPA 1QL2A 2JP3A 2FYUG 2W6JH 3GLFB 2O5RA 1SS1A 3CF2A 3K9PA 4LRSA 2LXEA 1K8AQ 4O9BA 1SQPJ 2KIKA 1VG5A 3CMEP 3II6A 1BGYG 1L0LD 1OVVA 2Z4RA 5ITXA 2L6OA 3GLFA 3I4YA 2XGNA 3U6QA 1L4AB 4DR1M 2N1TC 5E79H 1VQ4P 3GRRA 5AVSB 2QJPC 2K6BA 3IFMA 1D2NA 1N7SC 2EKKA 5KJ7A 2V6ZM 2BCCD 2L5GB 4JQ0D 3CC4P 1WJ7A 2IYPA 4JPZB 3GG2A 2FFDB 2J5YA 1ZOYC 3H1KD 1JCDA 1XC8A 1G41A 2E76C 1RE3A 3W0LB 1FZCB 4QNMA 1UIIA 1WGLA 1BGYJ 2M60A 4HJGH 4KT0F 4IL6H 2LWXA 4F2LA 1N78A 2FFDA 1PJTA 2KZUA 3TGUD 1SG9A 2N35A 1NU1J 1JY2P 1SQVG 1J2JB 2Z5HA 4DUZM 5BVZA 2RKLA 3M9QA 3CC7P 2KA6B 3K5BA 3AE2C 5FLXS 4OH8B 3THGA 3WU2E 4PV1C 1OX3A 3CF6E 1FDMA 4AKHA 1SQBE 2ZTCA 2XZUA 2AEFA 3OJAB 5CJ0A 4B3RM 5GKNA 4NOOB 1HR0M 4LF8M 2B87A 1QUTA 3GQ4A 4AG5A 2N9BA 1L0LG 2OPFA 2KNCA 5DFLA 2FFJA 2BASA 3B4SA 3NBXX 2C99A 3HUSB 2QZ4A 3L37A 4W7ZA 3HJQA 2R3CA 3RK2D 1NTZG 2OARA 4GOFA 2R4EA 3Q2YA 3C3EA 3LW5J 1TDHA 2E74D 3FYCA 4NXNM 4GC5A 1IN4A 2SPZA 3A98B 4YTPC 4EOTA 1KB9I 2V4HA 3HUSA 4IBGA 4IBEA 4AUWA 3TQSA 1NYHA 4Z6YA 1EXJA 2Y21A 3PG7A 1PRBA 1J7KA 1JB0J 1OXZA 2OYIC 1KFVA 3SAVA 1USEA 1SQBK 4PJ0H 3ZCBB 1DO0A 2M5AB 2BCCE 2Q3EA 3SSUA 4YXWH 4FW9A 1HBWA 1X0TA 1Z5BA 5EP1A 2EUCA 2XFSA 3LIEA 1L0NE 3TGUG 2HCBA 1LWUB 2ZYAA 2WWWA 3LQRA 1R2YA 3FUVA 1K04A 3J2PB 2N1TD 3LVWA 1Z56A 1FBMA 3CCMP 3HHWA 1N7SD 1AVYA 3B89A 1XWIA 3CCRP 1DGHB 1SLQA 2DAEA 5ITTA 2BCCJ 5B5EE 2ZFCA 2LXCB 4LCBA 5BU5A 2GNOA 3L73E 3SYKA 4H0LC 4LJ6A 4JI3M 1NH4A 4LF4M 4AKIA 4TLGA 2NPSA 1L8QA 2L7IA 2OOAA 5KLIC 1ZMEC 2B9BA 4Y99B 4CPGA 4DV3M 1HT1E 2O1JA 1YBKA 3H1KJ 2CK3H 5L8RF 2E76D 4UB6H 2I1JA 3FTDA 1SVFA 1HWTC 1IN7A 3L74G 2RKOA 5JI2E 3DFZA 1VDLA 1HH0A 2IBZE 4N6JA 2ZT9B 5ITQA 3UIAA 2DKLA 4YXDC 2O3JA 1JUNA 4II7A 2A06E 1L0NK 4A3VB 1C7YA 1EZVG 4PV1D 2POHA 1KYOH 1SQXG 2YR0A 3H1IE 3H32A 4XGIA 1URQA 3E1IA 3H1JG 2KNZA 4ASWA 1GU5A 3SFEC 5CBOA 1G8PA 3DOAA 3HU1A 5AVRB 2Q9IA 1ZW0A 1YITP 3AE9C 5APSA 1V92A 2O01F 1Q90D 1IZNB 4GHLA 2K1AA 2YKOA 5APXA 1GLNA 4BRYA 1QGKB 2HG5D 1RH5B 4BB9A 2WSEF 1N73B 1E9RA 5CMZA 3TK1A 1EE8A 3GLFE 1X9VA 2WVRA 5GTHE 2XNXA 4P16A 2KI7B 3GF7A 3I56P 1M1KQ 5H37D 1DH3A 1GL7A 1IBLM 2HR3A 2P58A 1TF0B 1HQCA 4MM3B 2IFMA 2QE7H 1N73A 1NJGA 1OZHA 4M3LA 3VKHA 1JEKA 1N32M 3RGUA 2Y0QA 4PD4I 1SFCD 5AW2B 3PLNA 4H44B 2ZBKB 4HKZH 3UZUA 1SQQE 2KDLA 3K92A 1A5TA 3KZIE 4MGKE 1VQ1A 4NRWA 4L16A 2YXRB 2UXBM 2QCUA 3P7KA 3TWMA 4Z1MH 4ANRA 2CV2A 1LTJC 4DUYM 1HJ0A 1RF0A 1BE3E 2H8PD 4FCWA 1WXQA 2KRUA 1SQQJ 2BWBA 3HD7B 1YI2P 2DZLA 4NRVA 3FTFA 4H0LD 1USDA 2G8LA 3NMDA 4UB8H 3D8LA 3TDKA 5GTIE 3LMMA 2Y0TA 2F4VM 3BBZA 2ZVOB 1JR3A 4DV2M 3HD7A 2E75C 1RHZB 1L1ZA 3FRIA 3BCCD 3PVSA 3BVHA 2W8ZA 1Q7YQ 1FOSE 1KQSO 2JO1A 2WZJA 3UK6A 5CCGC 5E6JA 1GABA 1QUSA 3LW5F 2KXPB 2V7QH 4TLFA 1EIJA 1P84E 2PGDA 2M5ZA 3M0DC 3O8ZA 1S72P 2QBYA 2WPQA 3F89A 1EDKA 3SWFA 5IT9S 3JR4A 4U7JA 2K3RA 3A46A 3V2RA 4U3FD 2R6FA 5H2FH 2D7GA 1QYRA 1TU3F 3A45A 3B5NB 4DV6M 2VDBB 3E4RA 1NSFA 3RK3C 2OOBA 5DYIA 4HLQA 4CISA 3NXSA 1KILC 2FE8A 1QAOA 1FJGM 2JEEA 2X4AA 4D6TE 2C9NY 1RE4A 2O01H 3AL0C 4C7RA 1UFZA 1L1TA 2GQFA 3CCJP 1IY1A 3BATA 3PNVA 3B5NA 3GPUA 2WSEH 1XXHB 3KS4A 1MZ9A 5AVYB 3V2PA 1G1IA 3G6EP 3AV0A 1VQLP 1TTEA 2W90A 2MH8A 1YTZI 3SMSA 3U6EA 4D6TJ 2I7NA 1KN7A 2FYZA 4IL6X 3AKZA 2WSFF 5EP4A 4BBAA 4D82A 4JBZA 2P1JA 4JF7A 1IO4A 3KOZE 1JY2O 3BCCE 2KHHA 3I55P 1IN8A 2YO3A 1CI6A 2AEJA 2YKPA 4XFJA 2KNVA 2FY8A 4N78E 1Q82Q 3N7NA 4NSRA 4DR6M 3PTZA 1I4WA 3SWKA 4ASVA 3U6CA 3AEFC 3A0HE 3W68A 1VF5B 2E75D 1GMJA 3CL3D 2LVNC 1S9KD 2WPSA 3BCCJ 3VK8A 5CCHC 1GL2C 2XFTA 3HKPA 4U3FE 2R3SA 3HE5B 4RO0A 5CCGD 1NTKD 4NSOB 4QHSA 1GO5A 3MGNA 5APWA 1VQMP 1RF1B 3CCEP 4NPFX 2WITA 2XSZA 3RGPA 3Q5SA 4JI6M 3KHUA 4DV0M 2A45H 1NWQA 4M8ZA 4OGQB 5APTA 3CXHH 3P8CD 3DA1A 2KB7P 4W5WA 2P7JA 4U3FJ 3HRNA 2WTYA 2QA4P 1NY6A 4I2LC 3RK3D 3V4WA 1NVOA 3PFIA 4BLCA 4EIJA 1QVGO 1IN5A 1KILD 3SFDC 1AUAA 3L70D 1QVRA 3G3ZA 3E7KA 3AJIB 4B08A 2R65A 3MHVA 1OW7A 1IK7A 3L28A 3OTOM 2NZ2A 3KSXA 5AW4B 3EQ2A 3BASA 4M0DA 5KLVG 1IFYA 3AOEA 2WT7B 4RF1A 3PXGA 4G4RA 3HE4B 1Z5CA 3SC3A 1MU5A 1BCCD 1A02J 1JR3E 3QH9A 3T38A 3U59A 4LJ9A 3VMAA 2F5OA 4MGIE 3C8VA 4MGZE 1KB9E 2HL7A 2LVOC 2YNYA 4OVNF 2CUZA 2W6BA 1FNNA 3TPZA 2IYOA 4JYBA 2WT7A 1VQPP 2FYUD 1JCCA 2KZIA 1AQTA 1M1JA 3D8BA 2OYOA 4P17A 4B7HA 3RBZA 1MFTA 3U1AA 2CFOA 3SASA 3VFDA 4TT3H 4JI0M 2JZ1A 3M0EA 1LT9C 3AEAC 2WSFH 1H0TB 4PT5A 4PD2A 3PHLA 1IY0A 2JXNA 5B5EH 3CWBD 1H6UA 2F5SA 3R8FA 1FOSF 4GT1A 3TL4X 1VQ8P 2HODA 1T8ZA 3V6IA 1IFPA 3FUTA 3L70G 3MP7B 5CCHD 2DZNB 4IBBA 1GL2D 1N2DC 4OU7A 1IBMM 1IY2A 1H0TA 2E42A 4GDOA 1IK9A 1NTKJ 1HJBA 1YYCA 3BOSA 2GA1A 4IFDK 1LTBC 3RK3E 5C1BA 1HTLC 4Z8XA 2J7NA 1OFCX 2DWZB 1KILE 3RK2B 1RU3A 5JI3E 5AW9B 3SHFA 4GH9A 1T6OA 1WMKA 2OYHB 1J1DC 3BRVB 1AIPC 1GKIA 1KYIA 1N7LA 2A5YB 1JM0A 3UGJA 2Z3XA 1SQVD 1VQOP 1QVFO 2LH0A 2FYNC 1XXHE 5AW0B 4EIWA 3H1HE 3AE1C 3T1HM 5BU8B 1LNQA 1FJPA 1S3SA 3AEBC 1FZEA 3CXHD 2OYHA 4WY4C 4M9SA 1BCCE 1OTRA 1GTWA 1PPJE 3GRVA 2B3TA 5GTHH 1N86A 1EQ7A 4ZMDA 2EJSA 1JY3N 1RY3A 4X64M 1F4IA 2R46A 3CWBG 4DOJA 4WB4A 1R2ZA 2N1TB 3G71P 4S12A 1SP4A 3H1HJ 4M9ZA 3KOYE 2QJPB 2YQZA 1PV3A 2WZ7A 3I51A 5EJCA 1NTZD 3AE8C 5KAIE 1BCCJ 1SXJE 4AQRD 2WQYC 1HGZA 4HB1A 2D4QA 1SQPK 1BGYE 5KPZA 1OLMA 3Q1MA 1QL1A 4LGDE 3KZIH 1NU1E 3K9OA 1L4AA 5ITYA 2UWJE 2FYUJ 2E76B 3L72G 4L74A 4LGMA 4PD4E 4M0WA 1Y9BA 2R32A 2E43A 3SFZA 3QYEA 2K37A 4JYCA 3V4QA 2G3AA 5CJ4A 1Q02A 2P67A 3PJSK 3L4FA 3PEGA 3FGAD 2YXQB 3CWBJ 4NPEA 4PV1B 3FXDA 4GC9A 1LT1A 2JJLA 2A45G 1BSNA 2FXMA 3FYDA 1FZCA 4DR2M 3L75D 1HVVA 1NJIQ 4M9XA 3L36A 5AVUB 3FD9A 3HY5A 4DV7M 4IBCA 2Z4SA 3I01M 4G4OA 1VL2A 4GRIA 1FDIA 3C1LA 1NU1K 2LKMA 1ZLLA 4L73A 2Q7CA 1U57A 3M06A 2BNKA 5KAFH 3MTUE 2QP9X 4LGYA 1P84H 3QWLA 3L74D 1NY5A 2Q3IA 3WUVA 3L25A 3JCUE 1L0LE 1SQVJ 4I6MC 4MH0E 2DVWB 2OYIB 3VN0A 1EZVD 1SFCB 2WPRA 3AE4C 1S2EA 3PH0A 2EKFA 3JSVC 4RF0A 1NTZE 3CX5D 3HUSC 4WY4D 3KOWE 1SQXD 4QOZC 1NNUC 3H1JD 4JYAM 2LXBA 3IF4A 2XZRA 4J7QA 4LFBM 1SFCA 4FWHA 1L0LJ 4Y28J 5CBNA 1OWAA 1L0NG 2JDIH 1VQ9P 4OVZB 3LIDA 3H1KE 2HYNA 4WP2A 4IBJA 1CSBA 1NO1A 1NTZJ 3L75G 4RKUJ 2M5AA 5E26A 4H0LB 2L4EA 2OTLP 4I8OA 3TGUE 3L73G 1LWUA 3A2AA 3K1JA 1PP9D 1K82A 3CCUP 2IX7C 1S5LX 3B7NA 3Q8XA 2KSJA 3IR9A 1GDTA 2DAGA 1PGQA 1BDCA 1DD4A 1DGHA 1PM5A 2WSCF 4IBIA 2NPSC 1IQPA 1VEKA 1ORYB 1ZV8A 3KFUG 2R44A 1NAYA 2DW3A 3TGUJ 1YLAA 7CATA 1GD2E 3GHGC 3BRTB 3U1CA 1NKZB 2A06G 2PAJA 3VDUA 2MKVA 1DEBA 4GODA 5A2QS 3SYLA 1S3JA 3KP0E 2IZ0A 1AFOA 3FUUA 2KEBA 3WMM0 4LFAM 3A0HH 3H1IG 2YNMD 4NPDA 4DZOA 2XH9A 3VK7A 3QAUA 3MIWA 3HHYA 1URQC 3GLIE 1EZVE 1XNRM 3CTWB 4XK8F 5BPVA 3F5HA 5APUA 1SQXE 1E79H 4QNRA 1KQFB 3GF3A 3H1LG 2QJKC 3H1JE 3L74J 1WR1B 2LNHC 3GLGB 2MROB 1TDZA 2O1KA 5DJTB 5KKZB 2PRRA 2Q1KA 3GO8A 1DO2A 4L78A 2X8AA 4JI5M 1NV8A 4JI1M 4RESB 1VDFA 1PP9G 4MGHA 1OLME 2AHMA 1GL6A 2MR9A 4KLNA 2NQ8C 3AEGC 1GZLA 1P3QQ 4WVZA 3R2PA 4JI2M 2OQ4A 4WW0A 1SQXJ 5KQDA 5EP3A 1MFZA 2P2UA 2YMKA 1KFNA 4KJMA 4W80A 1H8AA 3H1JJ 2L09A 2DXIA 3CD6P 2G8YA 1LTTC 2K88A 3KXDA 2KOGA 1MX0A 3CI9A 4LF9M 2Z7JA 5E79E 1Z5AA 4IIWA 1BE3G 3KS8A 3RL0g 2V1CA 2LHCA 4UYBA 1RF0C 2K47A 4IJEA 4LJ8A 1PP9J 3ILKA 3HJ8A 2UU9M 3VLFB 5AW7B 1KB9H 3CXHI 3GRUA 1J09A 1OQYA 3AECC 2C9LY 3WHKA 2NPSD 1IM2A 2XF3A 1GVNA 1KFMA 1SQQK 4IL6E 5AVZB 5B66H 5KPRA 2D2CC 4L6V6 4CJ6A 1WHCA 4XE5B 3HD7C 4IJFA 1YSYA 4LZZA 4I1LA 4DCKA 1ZP0C 3L71D 3U6LA 3IN6A 4HH2A 4JI4M 4HYTB 2WMMA 5DNYA 1IJDB 1R5LA 3KQGA 5AVXB 1U7MA 1R6BX 3T6PA 2UUBM 2QRXA 2AXCA 3GP1A 2OTJP 3U6SA 3IAOA 4Q7JA 3T15A 1DD3A 4IFFA 1WT6A 2MJ5B 3V5BA 1FAVA 1JB0F 1ZV1A 1XTGB 1URQD 2HLOA 3RK3B 2HHHM 4GKJM 2XDJA 1D0MA 5AW1B 1KILB 1KYOD 3AE6C 2QIWA 3SWYA 1PGOA 4Y28F 1L2CA 2O01N 3GMAA 3FXEA 1EFUB 1X8YA 3IHPA 2KS1B 1NTMD 3GLMA 4EYYQ 2KNAA 1R4GA 2QM8A 3FKEA 2VF8A 1KILA 4IOIH 1W2BO 3VYIA 3Q5RA 4PJ0E 1K05A 2XZFA 1NAFA 2D7EA 2O25A 1JQJC 3RL0C 1N77A 3UMMA 1K9MQ 4YY3M 2QJYC 2JP7A 3J27B 3FRHA 1M56D 1XXHA 4OMJA 2I8DA 3L71G 3TWKA 1FJKA 4AKGA 1NVMA 4BWNA 3QYBA 2WSSH 1MJGM 3MUDA 1SXJB 3T1YM 2HPCB 1WRGA 3NWLA 2Y0DA 1OMIA 1PJJA 2Y0EA 1EZVI 2ZAOA 3AEEC 2R0IA 4UB6E 2QNJA 3PNYA 4TUWA 1EDJA 3CX5I 1OIZA 3A0BE 1JNMA 1SXJA 2UUCM 5KLVD 2DWLA 1YQ3C 3W67A 2HPCA 1IFMA 4B3TM 3MZWB 4PD4H 5KQ8A 2D2CD 4R4MA 2JY6B 3Q8GA 3DZDA 1NTMG 2YIUC 3HD7D 4LY6A 2AXTE 1ZN5A 3HX3A 3VDPA 1QQWA 3LCVB 2LVAA 4REZA 3RFWA 1DIPA 4WURA 1G4AE 2M3BA 5IWAM 3WU2H 5CHXA 3GLGE 1UIXA 3HE5A 2AEMA 3M91A 1KSFX 1FZBA 3LW5H 2DENA 2ZXEB 1HUCA 3JC22 1RF1A 2XLJA 1IFNA 3HU3A 1T3TA 2Y9YA 3W0FA 3CLQA 1HQYE 5ITRA 4AI6A 2FBWC 3S9OA 4KT0J 1ZMVA 4DV5M 1KC8Q 4IBDA 2DHRA 1FU1A 3MK6A 1Q2NA 3USSA 1NTMJ 2J59M 3HU2A 3JR5A 5EXXA 1GW3A 2E5TA 1TGUA 4KODA 4L75A 3JCUH 1JOCA 5LMNM 3MHVC 4L4UA 1Z6TA 3RL0D 1AQ5A 3U6DA 4ZKPA 4GIFA 3C3DA 1U7JA 5BR8M 3OAKA 2C9CA 1SQPD 1IXSB 3VTPC 4A7PA 1LTGC 3AOEC 2KW0A 2C98A 3E46A 3KXEC 2ZJSE 1XNQM 3N4XA 1Y47A 3BXWA 3HE4A 2ZYDA 1S9KE 2VQFM 1NV9A 3KYQA 2F5QA 4H13C 4I7ZC 1LT9B 5TISE 2E5YA 4UB8E 1NTKE 2JUJA 1M1JC 3P8MC 4DBGB 1FZGA 1JO5A 1OAIA 5APYA 2JWAA 2X49A 1G3IA 1HGVA 2VIIA 2XKMA 5KLVJ 2DHYA 2Z8YM 4JV5M 1PIXA 2MJZA 1NHWC 1NOHA 4MN4C 4CGYB 4LG2A 1Z59A 2UXCM 5AVQB 1Q81Q 1EDLA 3U60B 3P8CE 3Q5PA 3SAUA 4C46A 4X62M 3M0AA 2L2DA 3G4SP 3ZH9B 2MGWA 1JY3P 1LTIC 2OQQA 1K73Q 1G2CB 1VQ7P 4LRTA 4JI8M 1G71A 4OWFA 4MGYE 3L72D 2CV0A 3L70E 3FUXA 3KPEA 1J1DB 2QSFX 4I4LA 2E74B 5EXSA 2XSZD 2FH0A 1I94M 1SQPG 3E1RA 5AW6B 2QPAA 1M57D 5EQTA 1NTKK 5L8RJ 3H4JA 1BDDA 2FYNB 3GLIB 2V7QJ 3O6QB 4DV1M 4UN2B 1J1EC 3SBJA 1R5SA 4WY4B 4IBFA 4G6ZA 3L70J 3WUUA 1SQBD 3M9BA 4GKGA 2XU6A 4FMMA 4GMQA 3GLIA 4AG6A 2E2XA 2OYHC 2ZYGA 2GM4A 1N33M 3B9PA 3S4RA 2FYUE 3H25A 1ZMUA 3IG5A 1AA0A 5M1BA 4RNAA 3CCLP 1N7SB 3WHLA 2O01J 4WBAA 1N75A 4C7NB 2E5LM 4K0KM 2WSEJ 1JMBA 2CHQA 1LTAC 2VQEM 4EDFA 1C1KA 2FNAA 4HEOA 2N1TA 3CWBE 1KYOI 2H1RA 1NU1G 5KJ7C 1N7SA 1W5TA 3F92A 4LC1A 1FE6A 4C7NA 1L4AC 4H13D 2DWNA 1IFIA 1DGBA 1QX8A 5F3WA 1RQUA 1DGFA 4ITQA 4FCVA 1TH3A 2F5PA 1XHBA 1H89A 2JZ0A 2Y20A 4DR5M 2ZM6M 3TYYA 2KXEA 3P32A 1RE3C 2KSEA 1L0ND 1NHLA 2QEXP 1NJFA 2RN0A 3L72E 1ZRTD 1LTMA 2C5RA 1FZAA 2FYUK 1W5CE 4X65M 2FFDC 1XB2B 3KSJA 2BWEA 5FTLA 4B3MM 1SQBG 4PCZA 5GTIH 1PFIA 4GKKM 4L8RC 1S5LE 4R4LA 1FZCC 3S1KA 1L2DA 3EFGA 3L73D 1SQVE 2B87B 3Q3DA 3GLHE 3MMPA 3L72J 1CUKA 2KNCB 2FOIC 3CXHE 4N3YB 3K2LA 3L26A 1EC5A 3L2AA 4DT0A 4GITA 1OVRA 1YHQP 3FUWA 3VKGA 3ZQJA 3AE5C 5AVTB 2IBZD 3J7AS 4BXLA 1DGGA 3B7ZA 2V1UA 1A02F 2A06D 2Y9ZA 1X37A 1OJLA 1VEJA 3RGSA 2H88C 1IFDA 1SQBJ 1E94E 3SMPA 4AYCA 2R18A 2QQ8A 3C9PA 4LF6M 3H1ID 2APLA 1D0KA 2BJVA 3NBIA 2M3EA 2UXDM 2BCCG 1FZFA 3MD0A 1YUBA 1IN6A 2OYIA 1JY2N 1G59A 1M8OB 1SQVK 1W5SA 3L27A 3P7ZA 1YTZT 5APQA 2IZ1A 1NGMB 2ITAA 2QVAA 4KO8A 4LJ5A 3JAMS 1SFCC 3H1KG 2K9DA 2WPVB 3CMAP 4GOEA 3H1LD 2RRUA 1CZQA 3NTNA 2H89C 4I81A 4R3DA 2J58A 3VMXA 1K3XA 2JNHA 1YJNP 1H88A 5KLIB 4OVZA 1MKMA 3HWSA 3V2QA 3HGIA 1L0LK 2G3QA 1ZRTE 3V2NA 5KJ7D 4QMAA 1XMQM 4XA4A 5AVVB 4K35A 3FWLA 4W7YA 1M7LA 2NPSB 1TH2A 3L75E 5IZ7D 2L4FA 1LWUC 1L4AD 2P5TA 1NTZK 2DZOB 3U6MA 1L2BA 3D6ZA 1AJYA 1SQQD 2YKQA 1GJSA 4FWDA 4DJGA 3GHGB 2IBZG 3CGWA 1WGNA 1L0NJ 1LJ2A 2C96A 2UUAM 2BEZF 2ZTDA 3TWLA 2K9YA 1T3JA 2KUBA 4B7GA 3L75J 1RQVA 1PGYA 2GUVA 4EI2A 2Q2EB 3TE6A 4Y99C 2L7HA 1BE3D 1HNZM 3A0BH 3L74E 3GHGA 2WSFJ 4I5SA 3H32B 1URQB 2KRKA 2YO2A 1J5EM 3L73J 3IECA 2D7HA 1QDRA 1Q3BA 1X79B 2ZT9C 2RMZA 1QAQA 1E5WA
chains in the Genus database with same CATH topology
3B7QA 4OMJA 4CIZA 1OIZA 4J7QA 4CJ6A 3W68A 4TLGA 4M8ZA 3W67A 3HY5A 4UYBA 3B7NA 3P7ZA 4OMKA 3B7ZA 3PG7A 2D4QA 3PEGA 3Q8GA 1OLMA 1R5LA 4FMMA 1O6UA 2E2XA 3HX3A 1OLME 1OIPA 3B74A 4J7PA 1AUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7Q A;  4OMJ A;  4CIZ A;  1OIZ A;  4J7Q A;  4CJ6 A;  3W68 A;  4TLG A;  4M8Z A;  3W67 A;  3HY5 A;  4UYB A;  3B7N A;  3P7Z A;  4OMK A;  3B7Z A;  3PG7 A;  2D4Q A;  3PEG A;  3Q8G A;  1OLM A;  1R5L A;  4FMM A;  1O6U A;  2E2X A;  3HX3 A;  1OLM E;  1OIP A;  3B74 A;  4J7P A;  1AUA A; 
#chains in the Genus database with same CATH topology
 3OW2 O;  2C0X A;  1Q86 Q;  5FTK A;  1KQL A;  2AXT H;  1G1J A;  3AE3 C;  2QJK B;  4BRY B;  3CX5 E;  2JR8 A;  2NRG A;  1QLE D;  4NC6 A;  1NHG C;  4IFM A;  1V34 A;  5FSW A;  4PDI A;  1X22 A;  2ZAM A;  4D81 A;  1FDO A;  3ZDM A;  4LJA A;  2DNA A;  2ZAE B;  2KYV A;  4B86 A;  2CPS A;  3GPP A;  1BVS A;  1YQ4 C;  2I1K A;  3ITK A;  1OFH A;  4L76 A;  3J81 S;  1XMO M;  3B7Q A;  1YE9 A;  1P84 D;  2J5U A;  4KHX A;  3GLG A;  3H1L E;  4GHA A;  5ITX E;  5FTM A;  1N73 C;  1FS0 E;  3H1I J;  1VQ5 P;  1ZMW A;  1SQQ G;  2K9J B;  2JA2 A;  4NXM M;  4LZJ A;  2CPB A;  5KKZ C;  1PP9 E;  4DR4 M;  1W2E A;  1LTJ B;  2LBC A;  5TJH A;  2R5D A;  1N34 M;  4XBO A;  3H4M A;  3EFF K;  2JWD A;  3B74 A;  4LF7 M;  2M8R A;  2Z5I A;  3IG8 A;  3H1L J;  4FWG A;  2K9J A;  5AW3 B;  1SQX K;  3D6Y A;  1EXI A;  4H44 C;  3K8Z A;  1NO4 A;  1JMM A;  5AVW B;  3AOG A;  4D6T D;  1R8E A;  1OVU A;  2PP6 A;  4MB7 A;  1LTJ A;  2FS1 A;  1EDI A;  2R45 A;  1TH4 A;  1QDT A;  2LTU A;  2A45 I;  1OKS A;  2KZJ A;  3KP1 E;  2W82 A;  3UJN A;  2E75 B;  2RH0 A;  3VMY A;  1LTS C;  3L29 A;  5C39 A;  2JWS A;  3KDP B;  1JY3 O;  3PRJ A;  2D2C B;  3CCS P;  4AQY M;  3VOP A;  4JXJ A;  1LGH B;  4AZF A;  3FX0 A;  2OO9 A;  3HZJ A;  1Y8A A;  5KTB A;  5TIS H;  1HF9 A;  2DAI A;  3C58 A;  3A5T A;  1T43 A;  1KTM A;  2R62 A;  2WSC H;  5AW8 B;  1BE3 J;  2R5B A;  4ZNC A;  5CCG A;  2LVP C;  3VP8 A;  4LF5 M;  2ERC A;  2BJW A;  3E9S A;  2QBY B;  2QM7 A;  4WWI A;  3VMZ A;  1NKN A;  2RGO A;  2ZT9 D;  1K3W A;  2K0B X;  1NNJ A;  5KAF E;  3M0D A;  5KO3 A;  1QAM A;  2PFX A;  3HTK B;  4N78 D;  3WUT A;  2CP8 A;  3VP9 A;  4QOS A;  5K5G B;  1HT2 E;  1YIJ P;  1VQK P;  1VPC A;  5DJU B;  1VQN P;  3CF0 A;  1IC2 A;  2FXO A;  2BEQ D;  1ZAE A;  2W6A A;  4D6T G;  1OFI A;  4CIZ A;  3HTK A;  1GK4 A;  4RKU F;  4F1I A;  2P10 A;  1KQG B;  1MN3 A;  3J7B A;  2KP8 A;  3SHG B;  1RE4 C;  3RL0 B;  1GU4 A;  3AFH A;  1QEX A;  2QSI A;  3RE8 A;  4D80 A;  2DI0 A;  3B5N C;  2QJY B;  2KS1 A;  1PZQ A;  1ZR4 A;  2KK7 A;  4IBK A;  3HJS A;  2EO2 A;  3FWN A;  2LHG A;  1E32 A;  3M9H A;  1KD1 Q;  3ABV C;  3I04 M;  1PJQ A;  1QAN A;  1DV0 A;  5IRE B;  2IPP A;  1UM8 A;  4DR7 M;  1T2K C;  1PGJ A;  4ZPX A;  3LVV A;  4OW0 A;  2LR2 A;  2CHV A;  2CEA A;  3E21 A;  4X66 M;  4H44 D;  1WIV A;  1YJW P;  2IBZ I;  3BCC G;  1PGP A;  2FKW B;  3D70 A;  1QZE A;  3NFQ A;  2EA0 A;  5KAI H;  2ZAN A;  3HHX A;  3L71 E;  4LFC M;  2I7P A;  1CI6 B;  3MUD C;  3T97 B;  2B89 A;  3I5C A;  1ZR2 A;  3M7G A;  3I4V A;  1PL5 A;  1S4X A;  2H43 A;  4JN6 A;  2DAK A;  2YFQ A;  1GL2 B;  1DX7 A;  1AV1 A;  2YIU B;  1YJ9 P;  3R4Y A;  4GIP A;  2XEP A;  3CCV P;  4LJ7 A;  1JR3 D;  1SXJ C;  3T97 A;  2CRU A;  4B7F A;  1L2P A;  4U3F G;  3L71 J;  1OIP A;  3ZC7 B;  1KB9 D;  1KYO E;  5CCH A;  1VEG A;  4JI7 M;  1GL2 A;  2J7O A;  4NL4 H;  1ZXG A;  2IFN A;  2R4J A;  5AW5 B;  4G4N A;  2VF7 A;  4FD2 A;  2HAK A;  1JTH B;  3EWK A;  1VF5 C;  1N8R Q;  2H5X A;  1NTM E;  4LJ4 A;  1FC2 C;  2OGU A;  1AVO A;  4R71 A;  5APV A;  1IFJ A;  1O6U A;  1S5L H;  1LP1 B;  3EIE A;  3GLH B;  2ZXX A;  1IBK M;  1KV4 A;  3FTC A;  3G9R A;  4FCT A;  2ZVN B;  5EFW B;  3TF5 A;  1GW4 A;  2JY5 A;  1JTH A;  1N36 M;  2CHG A;  1RF1 C;  4ZKU A;  3FTE A;  1VDD A;  1GK6 A;  2KLV A;  2KZS A;  1R7R A;  1LP1 A;  2W83 C;  4OGQ C;  3GLH A;  3V76 A;  2QEN A;  2IDB A;  1MV8 A;  3J80 S;  5EXT A;  2JKV A;  1Y8G A;  2M0B A;  1KMI Z;  3B5N D;  1S1C X;  3QWO C;  1KZU B;  5FTN A;  5ITU A;  1VQ6 P;  3KDS E;  2OTK E;  4QHT A;  1Q39 A;  4HL4 A;  1NTM K;  2QHO B;  3A3Y B;  3GPY A;  2HWJ A;  4L15 A;  4AW4 A;  4DR3 M;  3U6O A;  3GRY A;  2HFE D;  3GW6 A;  4LLH A;  1CW5 A;  3RBX A;  1HNW M;  3C9I A;  5C18 A;  1M90 Q;  3SAW A;  5KLV E;  2G5G X;  1T2K D;  1MUU A;  2RGH A;  3TNU B;  5FTJ A;  3H1H D;  4H13 B;  4I7Z B;  1ZQ9 A;  1TR8 A;  3U6P A;  3A42 A;  4RJT A;  1IXS A;  1PJI A;  4J7P A;  1M1J B;  3H6P A;  3KOX E;  2LVQ D;  3SAT A;  1PPJ D;  3U61 B;  1OW6 A;  2C9O A;  5KPT A;  2N9Y B;  1NTK G;  3AE7 C;  3EIH A;  4YHH M;  2C0W A;  3PP5 A;  1KOR A;  4GEW A;  2YMY A;  1XTC C;  3OA7 A;  3TNU A;  1P84 I;  2FXP A;  2CE7 A;  4YPC A;  1Q3C A;  2JY7 A;  3D71 A;  4R7G A;  5B66 E;  1DEE G;  1LT9 A;  1T3U A;  2HOD B;  3U61 A;  3GQ5 A;  3SAR A;  1SXJ D;  1IXZ A;  1BSH A;  5LMU M;  8CAT A;  1D0L A;  3CPW O;  2CV1 A;  2L91 A;  2Q6Q A;  4DV4 M;  3KW6 A;  1BGY D;  2XV5 A;  3GQ3 A;  1D7M A;  3CC2 P;  3M6A A;  1NU1 D;  3AED C;  1E9S A;  1OAO C;  3LCU A;  5EP2 A;  4CHT B;  4OMK A;  3A7O A;  2H7H A;  2CWB A;  2F5N A;  5KLV K;  3U60 A;  4PD4 D;  1V33 A;  1VF5 D;  3B71 A;  5DYG A;  2Q5U A;  3MJ5 A;  4FVM A;  2Y0C A;  5H2F E;  3U5Z B;  3CCQ P;  4G3O A;  1G2C A;  1J1E B;  3R9X B;  2VRS A;  2DAM A;  1IXR C;  2WSC J;  2HKJ A;  1OW8 A;  2JY8 A;  2QG4 A;  1HNX M;  4OX9 M;  3B8E B;  3H1H G;  3TSI A;  2W27 A;  4PDG A;  4KHP M;  1T6A A;  1GJT A;  1HJP A;  3U5Z A;  2B88 A;  2GUS A;  1QZM A;  3CX5 H;  3RK2 C;  3L35 A;  1SQP E;  1BCC G;  2KLU A;  3GPX A;  2XND H;  4OGQ D;  2DWM A;  2E74 C;  3O6Q A;  3LQQ A;  2Z4E A;  1PPJ G;  4K3A A;  4G4Q A;  1LV7 A;  1PJS A;  3HHZ A;  4B3S M;  3KVW A;  4WY4 A;  3FE3 A;  5EXP A;  1QL2 A;  2JP3 A;  2FYU G;  2W6J H;  3GLF B;  2O5R A;  1SS1 A;  3CF2 A;  3K9P A;  4LRS A;  2LXE A;  1K8A Q;  4O9B A;  1SQP J;  2KIK A;  1VG5 A;  3CME P;  3II6 A;  1BGY G;  1L0L D;  1OVV A;  2Z4R A;  5ITX A;  2L6O A;  3GLF A;  3I4Y A;  2XGN A;  3U6Q A;  1L4A B;  4DR1 M;  2N1T C;  5E79 H;  1VQ4 P;  3GRR A;  5AVS B;  2QJP C;  2K6B A;  3IFM A;  1D2N A;  1N7S C;  2EKK A;  5KJ7 A;  2V6Z M;  2BCC D;  2L5G B;  4JQ0 D;  3CC4 P;  1WJ7 A;  2IYP A;  4JPZ B;  3GG2 A;  2FFD B;  2J5Y A;  1ZOY C;  3H1K D;  1JCD A;  1XC8 A;  1G41 A;  2E76 C;  1RE3 A;  3W0L B;  1FZC B;  4QNM A;  1UII A;  1WGL A;  1BGY J;  2M60 A;  4HJG H;  4KT0 F;  4IL6 H;  2LWX A;  4F2L A;  1N78 A;  2FFD A;  1PJT A;  2KZU A;  3TGU D;  1SG9 A;  2N35 A;  1NU1 J;  1JY2 P;  1SQV G;  1J2J B;  2Z5H A;  4DUZ M;  5BVZ A;  2RKL A;  3M9Q A;  3CC7 P;  2KA6 B;  3K5B A;  3AE2 C;  5FLX S;  4OH8 B;  3THG A;  3WU2 E;  4PV1 C;  1OX3 A;  3CF6 E;  1FDM A;  4AKH A;  1SQB E;  2ZTC A;  2XZU A;  2AEF A;  3OJA B;  5CJ0 A;  4B3R M;  5GKN A;  4NOO B;  1HR0 M;  4LF8 M;  2B87 A;  1QUT A;  3GQ4 A;  4AG5 A;  2N9B A;  1L0L G;  2OPF A;  2KNC A;  5DFL A;  2FFJ A;  2BAS A;  3B4S A;  3NBX X;  2C99 A;  3HUS B;  2QZ4 A;  3L37 A;  4W7Z A;  3HJQ A;  2R3C A;  3RK2 D;  1NTZ G;  2OAR A;  4GOF A;  2R4E A;  3Q2Y A;  3C3E A;  3LW5 J;  1TDH A;  2E74 D;  3FYC A;  4NXN M;  4GC5 A;  1IN4 A;  2SPZ A;  3A98 B;  4YTP C;  4EOT A;  1KB9 I;  2V4H A;  3HUS A;  4IBG A;  4IBE A;  4AUW A;  3TQS A;  1NYH A;  4Z6Y A;  1EXJ A;  2Y21 A;  3PG7 A;  1PRB A;  1J7K A;  1JB0 J;  1OXZ A;  2OYI C;  1KFV A;  3SAV A;  1USE A;  1SQB K;  4PJ0 H;  3ZCB B;  1DO0 A;  2M5A B;  2BCC E;  2Q3E A;  3SSU A;  4YXW H;  4FW9 A;  1HBW A;  1X0T A;  1Z5B A;  5EP1 A;  2EUC A;  2XFS A;  3LIE A;  1L0N E;  3TGU G;  2HCB A;  1LWU B;  2ZYA A;  2WWW A;  3LQR A;  1R2Y A;  3FUV A;  1K04 A;  3J2P B;  2N1T D;  3LVW A;  1Z56 A;  1FBM A;  3CCM P;  3HHW A;  1N7S D;  1AVY A;  3B89 A;  1XWI A;  3CCR P;  1DGH B;  1SLQ A;  2DAE A;  5ITT A;  2BCC J;  5B5E E;  2ZFC A;  2LXC B;  4LCB A;  5BU5 A;  2GNO A;  3L73 E;  3SYK A;  4H0L C;  4LJ6 A;  4JI3 M;  1NH4 A;  4LF4 M;  4AKI A;  4TLG A;  2NPS A;  1L8Q A;  2L7I A;  2OOA A;  5KLI C;  1ZME C;  2B9B A;  4Y99 B;  4CPG A;  4DV3 M;  1HT1 E;  2O1J A;  1YBK A;  3H1K J;  2CK3 H;  5L8R F;  2E76 D;  4UB6 H;  2I1J A;  3FTD A;  1SVF A;  1HWT C;  1IN7 A;  3L74 G;  2RKO A;  5JI2 E;  3DFZ A;  1VDL A;  1HH0 A;  2IBZ E;  4N6J A;  2ZT9 B;  5ITQ A;  3UIA A;  2DKL A;  4YXD C;  2O3J A;  1JUN A;  4II7 A;  2A06 E;  1L0N K;  4A3V B;  1C7Y A;  1EZV G;  4PV1 D;  2POH A;  1KYO H;  1SQX G;  2YR0 A;  3H1I E;  3H32 A;  4XGI A;  1URQ A;  3E1I A;  3H1J G;  2KNZ A;  4ASW A;  1GU5 A;  3SFE C;  5CBO A;  1G8P A;  3DOA A;  3HU1 A;  5AVR B;  2Q9I A;  1ZW0 A;  1YIT P;  3AE9 C;  5APS A;  1V92 A;  2O01 F;  1Q90 D;  1IZN B;  4GHL A;  2K1A A;  2YKO A;  5APX A;  1GLN A;  4BRY A;  1QGK B;  2HG5 D;  1RH5 B;  4BB9 A;  2WSE F;  1N73 B;  1E9R A;  5CMZ A;  3TK1 A;  1EE8 A;  3GLF E;  1X9V A;  2WVR A;  5GTH E;  2XNX A;  4P16 A;  2KI7 B;  3GF7 A;  3I56 P;  1M1K Q;  5H37 D;  1DH3 A;  1GL7 A;  1IBL M;  2HR3 A;  2P58 A;  1TF0 B;  1HQC A;  4MM3 B;  2IFM A;  2QE7 H;  1N73 A;  1NJG A;  1OZH A;  4M3L A;  3VKH A;  1JEK A;  1N32 M;  3RGU A;  2Y0Q A;  4PD4 I;  1SFC D;  5AW2 B;  3PLN A;  4H44 B;  2ZBK B;  4HKZ H;  3UZU A;  1SQQ E;  2KDL A;  3K92 A;  1A5T A;  3KZI E;  4MGK E;  1VQ1 A;  4NRW A;  4L16 A;  2YXR B;  2UXB M;  2QCU A;  3P7K A;  3TWM A;  4Z1M H;  4ANR A;  2CV2 A;  1LTJ C;  4DUY M;  1HJ0 A;  1RF0 A;  1BE3 E;  2H8P D;  4FCW A;  1WXQ A;  2KRU A;  1SQQ J;  2BWB A;  3HD7 B;  1YI2 P;  2DZL A;  4NRV A;  3FTF A;  4H0L D;  1USD A;  2G8L A;  3NMD A;  4UB8 H;  3D8L A;  3TDK A;  5GTI E;  3LMM A;  2Y0T A;  2F4V M;  3BBZ A;  2ZVO B;  1JR3 A;  4DV2 M;  3HD7 A;  2E75 C;  1RHZ B;  1L1Z A;  3FRI A;  3BCC D;  3PVS A;  3BVH A;  2W8Z A;  1Q7Y Q;  1FOS E;  1KQS O;  2JO1 A;  2WZJ A;  3UK6 A;  5CCG C;  5E6J A;  1GAB A;  1QUS A;  3LW5 F;  2KXP B;  2V7Q H;  4TLF A;  1EIJ A;  1P84 E;  2PGD A;  2M5Z A;  3M0D C;  3O8Z A;  1S72 P;  2QBY A;  2WPQ A;  3F89 A;  1EDK A;  3SWF A;  5IT9 S;  3JR4 A;  4U7J A;  2K3R A;  3A46 A;  3V2R A;  4U3F D;  2R6F A;  5H2F H;  2D7G A;  1QYR A;  1TU3 F;  3A45 A;  3B5N B;  4DV6 M;  2VDB B;  3E4R A;  1NSF A;  3RK3 C;  2OOB A;  5DYI A;  4HLQ A;  4CIS A;  3NXS A;  1KIL C;  2FE8 A;  1QAO A;  1FJG M;  2JEE A;  2X4A A;  4D6T E;  2C9N Y;  1RE4 A;  2O01 H;  3AL0 C;  4C7R A;  1UFZ A;  1L1T A;  2GQF A;  3CCJ P;  1IY1 A;  3BAT A;  3PNV A;  3B5N A;  3GPU A;  2WSE H;  1XXH B;  3KS4 A;  1MZ9 A;  5AVY B;  3V2P A;  1G1I A;  3G6E P;  3AV0 A;  1VQL P;  1TTE A;  2W90 A;  2MH8 A;  1YTZ I;  3SMS A;  3U6E A;  4D6T J;  2I7N A;  1KN7 A;  2FYZ A;  4IL6 X;  3AKZ A;  2WSF F;  5EP4 A;  4BBA A;  4D82 A;  4JBZ A;  2P1J A;  4JF7 A;  1IO4 A;  3KOZ E;  1JY2 O;  3BCC E;  2KHH A;  3I55 P;  1IN8 A;  2YO3 A;  1CI6 A;  2AEJ A;  2YKP A;  4XFJ A;  2KNV A;  2FY8 A;  4N78 E;  1Q82 Q;  3N7N A;  4NSR A;  4DR6 M;  3PTZ A;  1I4W A;  3SWK A;  4ASV A;  3U6C A;  3AEF C;  3A0H E;  3W68 A;  1VF5 B;  2E75 D;  1GMJ A;  3CL3 D;  2LVN C;  1S9K D;  2WPS A;  3BCC J;  3VK8 A;  5CCH C;  1GL2 C;  2XFT A;  3HKP A;  4U3F E;  2R3S A;  3HE5 B;  4RO0 A;  5CCG D;  1NTK D;  4NSO B;  4QHS A;  1GO5 A;  3MGN A;  5APW A;  1VQM P;  1RF1 B;  3CCE P;  4NPF X;  2WIT A;  2XSZ A;  3RGP A;  3Q5S A;  4JI6 M;  3KHU A;  4DV0 M;  2A45 H;  1NWQ A;  4M8Z A;  4OGQ B;  5APT A;  3CXH H;  3P8C D;  3DA1 A;  2KB7 P;  4W5W A;  2P7J A;  4U3F J;  3HRN A;  2WTY A;  2QA4 P;  1NY6 A;  4I2L C;  3RK3 D;  3V4W A;  1NVO A;  3PFI A;  4BLC A;  4EIJ A;  1QVG O;  1IN5 A;  1KIL D;  3SFD C;  1AUA A;  3L70 D;  1QVR A;  3G3Z A;  3E7K A;  3AJI B;  4B08 A;  2R65 A;  3MHV A;  1OW7 A;  1IK7 A;  3L28 A;  3OTO M;  2NZ2 A;  3KSX A;  5AW4 B;  3EQ2 A;  3BAS A;  4M0D A;  5KLV G;  1IFY A;  3AOE A;  2WT7 B;  4RF1 A;  3PXG A;  4G4R A;  3HE4 B;  1Z5C A;  3SC3 A;  1MU5 A;  1BCC D;  1A02 J;  1JR3 E;  3QH9 A;  3T38 A;  3U59 A;  4LJ9 A;  3VMA A;  2F5O A;  4MGI E;  3C8V A;  4MGZ E;  1KB9 E;  2HL7 A;  2LVO C;  2YNY A;  4OVN F;  2CUZ A;  2W6B A;  1FNN A;  3TPZ A;  2IYO A;  4JYB A;  2WT7 A;  1VQP P;  2FYU D;  1JCC A;  2KZI A;  1AQT A;  1M1J A;  3D8B A;  2OYO A;  4P17 A;  4B7H A;  3RBZ A;  1MFT A;  3U1A A;  2CFO A;  3SAS A;  3VFD A;  4TT3 H;  4JI0 M;  2JZ1 A;  3M0E A;  1LT9 C;  3AEA C;  2WSF H;  1H0T B;  4PT5 A;  4PD2 A;  3PHL A;  1IY0 A;  2JXN A;  5B5E H;  3CWB D;  1H6U A;  2F5S A;  3R8F A;  1FOS F;  4GT1 A;  3TL4 X;  1VQ8 P;  2HOD A;  1T8Z A;  3V6I A;  1IFP A;  3FUT A;  3L70 G;  3MP7 B;  5CCH D;  2DZN B;  4IBB A;  1GL2 D;  1N2D C;  4OU7 A;  1IBM M;  1IY2 A;  1H0T A;  2E42 A;  4GDO A;  1IK9 A;  1NTK J;  1HJB A;  1YYC A;  3BOS A;  2GA1 A;  4IFD K;  1LTB C;  3RK3 E;  5C1B A;  1HTL C;  4Z8X A;  2J7N A;  1OFC X;  2DWZ B;  1KIL E;  3RK2 B;  1RU3 A;  5JI3 E;  5AW9 B;  3SHF A;  4GH9 A;  1T6O A;  1WMK A;  2OYH B;  1J1D C;  3BRV B;  1AIP C;  1GKI A;  1KYI A;  1N7L A;  2A5Y B;  1JM0 A;  3UGJ A;  2Z3X A;  1SQV D;  1VQO P;  1QVF O;  2LH0 A;  2FYN C;  1XXH E;  5AW0 B;  4EIW A;  3H1H E;  3AE1 C;  3T1H M;  5BU8 B;  1LNQ A;  1FJP A;  1S3S A;  3AEB C;  1FZE A;  3CXH D;  2OYH A;  4WY4 C;  4M9S A;  1BCC E;  1OTR A;  1GTW A;  1PPJ E;  3GRV A;  2B3T A;  5GTH H;  1N86 A;  1EQ7 A;  4ZMD A;  2EJS A;  1JY3 N;  1RY3 A;  4X64 M;  1F4I A;  2R46 A;  3CWB G;  4DOJ A;  4WB4 A;  1R2Z A;  2N1T B;  3G71 P;  4S12 A;  1SP4 A;  3H1H J;  4M9Z A;  3KOY E;  2QJP B;  2YQZ A;  1PV3 A;  2WZ7 A;  3I51 A;  5EJC A;  1NTZ D;  3AE8 C;  5KAI E;  1BCC J;  1SXJ E;  4AQR D;  2WQY C;  1HGZ A;  4HB1 A;  2D4Q A;  1SQP K;  1BGY E;  5KPZ A;  1OLM A;  3Q1M A;  1QL1 A;  4LGD E;  3KZI H;  1NU1 E;  3K9O A;  1L4A A;  5ITY A;  2UWJ E;  2FYU J;  2E76 B;  3L72 G;  4L74 A;  4LGM A;  4PD4 E;  4M0W A;  1Y9B A;  2R32 A;  2E43 A;  3SFZ A;  3QYE A;  2K37 A;  4JYC A;  3V4Q A;  2G3A A;  5CJ4 A;  1Q02 A;  2P67 A;  3PJS K;  3L4F A;  3PEG A;  3FGA D;  2YXQ B;  3CWB J;  4NPE A;  4PV1 B;  3FXD A;  4GC9 A;  1LT1 A;  2JJL A;  2A45 G;  1BSN A;  2FXM A;  3FYD A;  1FZC A;  4DR2 M;  3L75 D;  1HVV A;  1NJI Q;  4M9X A;  3L36 A;  5AVU B;  3FD9 A;  3HY5 A;  4DV7 M;  4IBC A;  2Z4S A;  3I01 M;  4G4O A;  1VL2 A;  4GRI A;  1FDI A;  3C1L A;  1NU1 K;  2LKM A;  1ZLL A;  4L73 A;  2Q7C A;  1U57 A;  3M06 A;  2BNK A;  5KAF H;  3MTU E;  2QP9 X;  4LGY A;  1P84 H;  3QWL A;  3L74 D;  1NY5 A;  2Q3I A;  3WUV A;  3L25 A;  3JCU E;  1L0L E;  1SQV J;  4I6M C;  4MH0 E;  2DVW B;  2OYI B;  3VN0 A;  1EZV D;  1SFC B;  2WPR A;  3AE4 C;  1S2E A;  3PH0 A;  2EKF A;  3JSV C;  4RF0 A;  1NTZ E;  3CX5 D;  3HUS C;  4WY4 D;  3KOW E;  1SQX D;  4QOZ C;  1NNU C;  3H1J D;  4JYA M;  2LXB A;  3IF4 A;  2XZR A;  4J7Q A;  4LFB M;  1SFC A;  4FWH A;  1L0L J;  4Y28 J;  5CBN A;  1OWA A;  1L0N G;  2JDI H;  1VQ9 P;  4OVZ B;  3LID A;  3H1K E;  2HYN A;  4WP2 A;  4IBJ A;  1CSB A;  1NO1 A;  1NTZ J;  3L75 G;  4RKU J;  2M5A A;  5E26 A;  4H0L B;  2L4E A;  2OTL P;  4I8O A;  3TGU E;  3L73 G;  1LWU A;  3A2A A;  3K1J A;  1PP9 D;  1K82 A;  3CCU P;  2IX7 C;  1S5L X;  3B7N A;  3Q8X A;  2KSJ A;  3IR9 A;  1GDT A;  2DAG A;  1PGQ A;  1BDC A;  1DD4 A;  1DGH A;  1PM5 A;  2WSC F;  4IBI A;  2NPS C;  1IQP A;  1VEK A;  1ORY B;  1ZV8 A;  3KFU G;  2R44 A;  1NAY A;  2DW3 A;  3TGU J;  1YLA A;  7CAT A;  1GD2 E;  3GHG C;  3BRT B;  3U1C A;  1NKZ B;  2A06 G;  2PAJ A;  3VDU A;  2MKV A;  1DEB A;  4GOD A;  5A2Q S;  3SYL A;  1S3J A;  3KP0 E;  2IZ0 A;  1AFO A;  3FUU A;  2KEB A;  3WMM 0;  4LFA M;  3A0H H;  3H1I G;  2YNM D;  4NPD A;  4DZO A;  2XH9 A;  3VK7 A;  3QAU A;  3MIW A;  3HHY A;  1URQ C;  3GLI E;  1EZV E;  1XNR M;  3CTW B;  4XK8 F;  5BPV A;  3F5H A;  5APU A;  1SQX E;  1E79 H;  4QNR A;  1KQF B;  3GF3 A;  3H1L G;  2QJK C;  3H1J E;  3L74 J;  1WR1 B;  2LNH C;  3GLG B;  2MRO B;  1TDZ A;  2O1K A;  5DJT B;  5KKZ B;  2PRR A;  2Q1K A;  3GO8 A;  1DO2 A;  4L78 A;  2X8A A;  4JI5 M;  1NV8 A;  4JI1 M;  4RES B;  1VDF A;  1PP9 G;  4MGH A;  1OLM E;  2AHM A;  1GL6 A;  2MR9 A;  4KLN A;  2NQ8 C;  3AEG C;  1GZL A;  1P3Q Q;  4WVZ A;  3R2P A;  4JI2 M;  2OQ4 A;  4WW0 A;  1SQX J;  5KQD A;  5EP3 A;  1MFZ A;  2P2U A;  2YMK A;  1KFN A;  4KJM A;  4W80 A;  1H8A A;  3H1J J;  2L09 A;  2DXI A;  3CD6 P;  2G8Y A;  1LTT C;  2K88 A;  3KXD A;  2KOG A;  1MX0 A;  3CI9 A;  4LF9 M;  2Z7J A;  5E79 E;  1Z5A A;  4IIW A;  1BE3 G;  3KS8 A;  3RL0 g;  2V1C A;  2LHC A;  4UYB A;  1RF0 C;  2K47 A;  4IJE A;  4LJ8 A;  1PP9 J;  3ILK A;  3HJ8 A;  2UU9 M;  3VLF B;  5AW7 B;  1KB9 H;  3CXH I;  3GRU A;  1J09 A;  1OQY A;  3AEC C;  2C9L Y;  3WHK A;  2NPS D;  1IM2 A;  2XF3 A;  1GVN A;  1KFM A;  1SQQ K;  4IL6 E;  5AVZ B;  5B66 H;  5KPR A;  2D2C C;  4L6V 6;  4CJ6 A;  1WHC A;  4XE5 B;  3HD7 C;  4IJF A;  1YSY A;  4LZZ A;  4I1L A;  4DCK A;  1ZP0 C;  3L71 D;  3U6L A;  3IN6 A;  4HH2 A;  4JI4 M;  4HYT B;  2WMM A;  5DNY A;  1IJD B;  1R5L A;  3KQG A;  5AVX B;  1U7M A;  1R6B X;  3T6P A;  2UUB M;  2QRX A;  2AXC A;  3GP1 A;  2OTJ P;  3U6S A;  3IAO A;  4Q7J A;  3T15 A;  1DD3 A;  4IFF A;  1WT6 A;  2MJ5 B;  3V5B A;  1FAV A;  1JB0 F;  1ZV1 A;  1XTG B;  1URQ D;  2HLO A;  3RK3 B;  2HHH M;  4GKJ M;  2XDJ A;  1D0M A;  5AW1 B;  1KIL B;  1KYO D;  3AE6 C;  2QIW A;  3SWY A;  1PGO A;  4Y28 F;  1L2C A;  2O01 N;  3GMA A;  3FXE A;  1EFU B;  1X8Y A;  3IHP A;  2KS1 B;  1NTM D;  3GLM A;  4EYY Q;  2KNA A;  1R4G A;  2QM8 A;  3FKE A;  2VF8 A;  1KIL A;  4IOI H;  1W2B O;  3VYI A;  3Q5R A;  4PJ0 E;  1K05 A;  2XZF A;  1NAF A;  2D7E A;  2O25 A;  1JQJ C;  3RL0 C;  1N77 A;  3UMM A;  1K9M Q;  4YY3 M;  2QJY C;  2JP7 A;  3J27 B;  3FRH A;  1M56 D;  1XXH A;  4OMJ A;  2I8D A;  3L71 G;  3TWK A;  1FJK A;  4AKG A;  1NVM A;  4BWN A;  3QYB A;  2WSS H;  1MJG M;  3MUD A;  1SXJ B;  3T1Y M;  2HPC B;  1WRG A;  3NWL A;  2Y0D A;  1OMI A;  1PJJ A;  2Y0E A;  1EZV I;  2ZAO A;  3AEE C;  2R0I A;  4UB6 E;  2QNJ A;  3PNY A;  4TUW A;  1EDJ A;  3CX5 I;  1OIZ A;  3A0B E;  1JNM A;  1SXJ A;  2UUC M;  5KLV D;  2DWL A;  1YQ3 C;  3W67 A;  2HPC A;  1IFM A;  4B3T M;  3MZW B;  4PD4 H;  5KQ8 A;  2D2C D;  4R4M A;  2JY6 B;  3Q8G A;  3DZD A;  1NTM G;  2YIU C;  3HD7 D;  4LY6 A;  2AXT E;  1ZN5 A;  3HX3 A;  3VDP A;  1QQW A;  3LCV B;  2LVA A;  4REZ A;  3RFW A;  1DIP A;  4WUR A;  1G4A E;  2M3B A;  5IWA M;  3WU2 H;  5CHX A;  3GLG E;  1UIX A;  3HE5 A;  2AEM A;  3M91 A;  1KSF X;  1FZB A;  3LW5 H;  2DEN A;  2ZXE B;  1HUC A;  3JC2 2;  1RF1 A;  2XLJ A;  1IFN A;  3HU3 A;  1T3T A;  2Y9Y A;  3W0F A;  3CLQ A;  1HQY E;  5ITR A;  4AI6 A;  2FBW C;  3S9O A;  4KT0 J;  1ZMV A;  4DV5 M;  1KC8 Q;  4IBD A;  2DHR A;  1FU1 A;  3MK6 A;  1Q2N A;  3USS A;  1NTM J;  2J59 M;  3HU2 A;  3JR5 A;  5EXX A;  1GW3 A;  2E5T A;  1TGU A;  4KOD A;  4L75 A;  3JCU H;  1JOC A;  5LMN M;  3MHV C;  4L4U A;  1Z6T A;  3RL0 D;  1AQ5 A;  3U6D A;  4ZKP A;  4GIF A;  3C3D A;  1U7J A;  5BR8 M;  3OAK A;  2C9C A;  1SQP D;  1IXS B;  3VTP C;  4A7P A;  1LTG C;  3AOE C;  2KW0 A;  2C98 A;  3E46 A;  3KXE C;  2ZJS E;  1XNQ M;  3N4X A;  1Y47 A;  3BXW A;  3HE4 A;  2ZYD A;  1S9K E;  2VQF M;  1NV9 A;  3KYQ A;  2F5Q A;  4H13 C;  4I7Z C;  1LT9 B;  5TIS E;  2E5Y A;  4UB8 E;  1NTK E;  2JUJ A;  1M1J C;  3P8M C;  4DBG B;  1FZG A;  1JO5 A;  1OAI A;  5APY A;  2JWA A;  2X49 A;  1G3I A;  1HGV A;  2VII A;  2XKM A;  5KLV J;  2DHY A;  2Z8Y M;  4JV5 M;  1PIX A;  2MJZ A;  1NHW C;  1NOH A;  4MN4 C;  4CGY B;  4LG2 A;  1Z59 A;  2UXC M;  5AVQ B;  1Q81 Q;  1EDL A;  3U60 B;  3P8C E;  3Q5P A;  3SAU A;  4C46 A;  4X62 M;  3M0A A;  2L2D A;  3G4S P;  3ZH9 B;  2MGW A;  1JY3 P;  1LTI C;  2OQQ A;  1K73 Q;  1G2C B;  1VQ7 P;  4LRT A;  4JI8 M;  1G71 A;  4OWF A;  4MGY E;  3L72 D;  2CV0 A;  3L70 E;  3FUX A;  3KPE A;  1J1D B;  2QSF X;  4I4L A;  2E74 B;  5EXS A;  2XSZ D;  2FH0 A;  1I94 M;  1SQP G;  3E1R A;  5AW6 B;  2QPA A;  1M57 D;  5EQT A;  1NTK K;  5L8R J;  3H4J A;  1BDD A;  2FYN B;  3GLI B;  2V7Q J;  3O6Q B;  4DV1 M;  4UN2 B;  1J1E C;  3SBJ A;  1R5S A;  4WY4 B;  4IBF A;  4G6Z A;  3L70 J;  3WUU A;  1SQB D;  3M9B A;  4GKG A;  2XU6 A;  4FMM A;  4GMQ A;  3GLI A;  4AG6 A;  2E2X A;  2OYH C;  2ZYG A;  2GM4 A;  1N33 M;  3B9P A;  3S4R A;  2FYU E;  3H25 A;  1ZMU A;  3IG5 A;  1AA0 A;  5M1B A;  4RNA A;  3CCL P;  1N7S B;  3WHL A;  2O01 J;  4WBA A;  1N75 A;  4C7N B;  2E5L M;  4K0K M;  2WSE J;  1JMB A;  2CHQ A;  1LTA C;  2VQE M;  4EDF A;  1C1K A;  2FNA A;  4HEO A;  2N1T A;  3CWB E;  1KYO I;  2H1R A;  1NU1 G;  5KJ7 C;  1N7S A;  1W5T A;  3F92 A;  4LC1 A;  1FE6 A;  4C7N A;  1L4A C;  4H13 D;  2DWN A;  1IFI A;  1DGB A;  1QX8 A;  5F3W A;  1RQU A;  1DGF A;  4ITQ A;  4FCV A;  1TH3 A;  2F5P A;  1XHB A;  1H89 A;  2JZ0 A;  2Y20 A;  4DR5 M;  2ZM6 M;  3TYY A;  2KXE A;  3P32 A;  1RE3 C;  2KSE A;  1L0N D;  1NHL A;  2QEX P;  1NJF A;  2RN0 A;  3L72 E;  1ZRT D;  1LTM A;  2C5R A;  1FZA A;  2FYU K;  1W5C E;  4X65 M;  2FFD C;  1XB2 B;  3KSJ A;  2BWE A;  5FTL A;  4B3M M;  1SQB G;  4PCZ A;  5GTI H;  1PFI A;  4GKK M;  4L8R C;  1S5L E;  4R4L A;  1FZC C;  3S1K A;  1L2D A;  3EFG A;  3L73 D;  1SQV E;  2B87 B;  3Q3D A;  3GLH E;  3MMP A;  3L72 J;  1CUK A;  2KNC B;  2FOI C;  3CXH E;  4N3Y B;  3K2L A;  3L26 A;  1EC5 A;  3L2A A;  4DT0 A;  4GIT A;  1OVR A;  1YHQ P;  3FUW A;  3VKG A;  3ZQJ A;  3AE5 C;  5AVT B;  2IBZ D;  3J7A S;  4BXL A;  1DGG A;  3B7Z A;  2V1U A;  1A02 F;  2A06 D;  2Y9Z A;  1X37 A;  1OJL A;  1VEJ A;  3RGS A;  2H88 C;  1IFD A;  1SQB J;  1E94 E;  3SMP A;  4AYC A;  2R18 A;  2QQ8 A;  3C9P A;  4LF6 M;  3H1I D;  2APL A;  1D0K A;  2BJV A;  3NBI A;  2M3E A;  2UXD M;  2BCC G;  1FZF A;  3MD0 A;  1YUB A;  1IN6 A;  2OYI A;  1JY2 N;  1G59 A;  1M8O B;  1SQV K;  1W5S A;  3L27 A;  3P7Z A;  1YTZ T;  5APQ A;  2IZ1 A;  1NGM B;  2ITA A;  2QVA A;  4KO8 A;  4LJ5 A;  3JAM S;  1SFC C;  3H1K G;  2K9D A;  2WPV B;  3CMA P;  4GOE A;  3H1L D;  2RRU A;  1CZQ A;  3NTN A;  2H89 C;  4I81 A;  4R3D A;  2J58 A;  3VMX A;  1K3X A;  2JNH A;  1YJN P;  1H88 A;  5KLI B;  4OVZ A;  1MKM A;  3HWS A;  3V2Q A;  3HGI A;  1L0L K;  2G3Q A;  1ZRT E;  3V2N A;  5KJ7 D;  4QMA A;  1XMQ M;  4XA4 A;  5AVV B;  4K35 A;  3FWL A;  4W7Y A;  1M7L A;  2NPS B;  1TH2 A;  3L75 E;  5IZ7 D;  2L4F A;  1LWU C;  1L4A D;  2P5T A;  1NTZ K;  2DZO B;  3U6M A;  1L2B A;  3D6Z A;  1AJY A;  1SQQ D;  2YKQ A;  1GJS A;  4FWD A;  4DJG A;  3GHG B;  2IBZ G;  3CGW A;  1WGN A;  1L0N J;  1LJ2 A;  2C96 A;  2UUA M;  2BEZ F;  2ZTD A;  3TWL A;  2K9Y A;  1T3J A;  2KUB A;  4B7G A;  3L75 J;  1RQV A;  1PGY A;  2GUV A;  4EI2 A;  2Q2E B;  3TE6 A;  4Y99 C;  2L7H A;  1BE3 D;  1HNZ M;  3A0B H;  3L74 E;  3GHG A;  2WSF J;  4I5S A;  3H32 B;  1URQ B;  2KRK A;  2YO2 A;  1J5E M;  3L73 J;  3IEC A;  2D7H A;  1QDR A;  1Q3B A;  1X79 B;  2ZT9 C;  2RMZ A;  1QAQ A;  1E5W A; 
#chains in the Genus database with same CATH homology
 3B7Q A;  4OMJ A;  4CIZ A;  1OIZ A;  4J7Q A;  4CJ6 A;  3W68 A;  4TLG A;  4M8Z A;  3W67 A;  3HY5 A;  4UYB A;  3B7N A;  3P7Z A;  4OMK A;  3B7Z A;  3PG7 A;  2D4Q A;  3PEG A;  3Q8G A;  1OLM A;  1R5L A;  4FMM A;  1O6U A;  2E2X A;  3HX3 A;  1OLM E;  1OIP A;  3B74 A;  4J7P A;  1AUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...