3W67A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Alpha-tocopherol transfer protein
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w67A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w67A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w67A03
1OLMA 3PEGA 4CIZA 3B7NA 2E2XA 1AUAA 3B74A 1O6UA 4J7PA 2D4QA 3W68A 1OIPA 4OMKA 3HY5A 3HX3A 3B7QA 1OIZA 4FMMA 1R5LA 4OMJA 4UYBA 4TLGA 3PG7A 3P7ZA 3W67A 4M8ZA 3Q8GA 1OLME 3B7ZA 4J7QA 4CJ6A
chains in the Genus database with same CATH superfamily
3J7AS 1S5LX 4X64M 1SQXG 3L72J 3RL0C 4LC1A 3E7KA 3IG8A 3MTUE 4N6JA 2AXTE 4D80A 2D4QA 3S1KA 3L74D 1IY1A 1LNQA 2W6JH 2V1CA 5KAFE 4II7A 1L0NK 3WHKA 4ANRA 2HAKA 2H88C 2OYIA 1LT9A 2W27A 3TPZA 2V7QJ 5APXA 1KD1Q 4JI0M 2PAJA 2F4VM 1RE4C 4M3LA 5APTA 3A0HH 1HNZM 5AW1B 1TDZA 1PP9D 4G4OA 1PL5A 4WY4A 5EP4A 1SQXK 3BOSA 2DI0A 1GL2C 1ZMVA 2FOIC 3AOGA 2IFNA 1KILC 1SQBJ 1XC8A 2VF8A 4H0LC 1FC2C 1NU1D 3SASA 3PG7A 1U7JA 2UWJE 1SQPJ 2PRRA 3D71A 4B3TM 2WSSH 1PP9G 1OLME 1Q82Q 1KYOE 2RGHA 2C0XA 3D8BA 1L4AB 2LXEA 1WGNA 3HKPA 4IOIH 1NU1G 2FYUJ 1FAVA 2OYOA 1M90Q 4FD2A 5AW9B 1HT1E 3GPUA 1SQVG 3H1JE 2GQFA 5KJ7A 1Z56A 3M0DC 2HYNA 2K6BA 2KP8A 2YQZA 3EIEA 1VPCA 2YMYA 1RF1C 1RE3A 4GHAA 1W5TA 3IN6A 2ZFCA 2E43A 1SFCC 5EJCA 3EFFK 1N33M 1KB9I 2JY5A 2K88A 2Q3EA 1D0LA 2PGDA 4UB8E 2J5UA 5BVZA 1UFZA 1NY6A 1KORA 1Z6TA 2FXOA 2DAIA 4DV5M 1R8EA 3GLGE 3KP1E 3GRRA 4CGYB 4XFJA 2ZYGA 1HT2E 5KQ8A 4GC5A 3AE8C 5AW4B 4D6TE 1IO4A 4I1LA 4FCWA 3AOEC 2Z4RA 2XSZA 1X79B 2KZUA 1XXHE 1NTKK 4IBBA 2DNAA 1TDHA 1YSYA 2LHCA 3RFWA 3CXHE 1JY2P 7CATA 1QZMA 4L16A 2XH9A 4HLQA 2H1RA 4D82A 1MN3A 5LMNM 2XFTA 1GU4A 2R44A 4KHXA 1PPJE 1OFIA 2G3QA 1UIIA 5CHXA 1GW4A 2IBZI 1M1JB 2W82A 1LP1A 3VYIA 3KHUA 1IN4A 2RKLA 2M5AB 4PD4H 5AVTB 4KODA 3HE5A 3GRUA 2FYNB 4HB1A 4L8RC 1J1EB 1G1JA 2BCCJ 4R4LA 3CMEP 1NKNA 4IJEA 1DGGA 5DYIA 2IZ1A 3KZIH 1X22A 4F1IA 3JC22 3HRNA 1LTSC 3OJAB 1VQ4P 2P1JA 2HLOA 2XZUA 1R2YA 5GTIH 3NBIA 5B5EH 3ZCBB 4GHLA 4WWIA 3U6PA 1IFDA 3G6EP 2R62A 5E6JA 2B87B 3SFDC 1DD3A 2OYHC 4QOZC 4JQ0D 4LRTA 2QENA 2CE7A 3GLHB 4LF9M 3S4RA 5EXXA 1EXJA 3SHFA 1Z5CA 2UU9M 4LF7M 1RF0C 1A02F 1Y8AA 2UUAM 3VKGA 1NVOA 4Y28J 3RGUA 5FTNA 2DXIA 2GUVA 2JP3A 2NPSC 1VQ7P 1URQA 3U1AA 2KUBA 1Q86Q 2I1JA 3T38A 3BCCJ 2ZXXA 4RNAA 4G4RA 1WR1B 2NRGA 4OVNF 1K73Q 4KHPM 3AE4C 3IG5A 4IL6X 1Y9BA 2C9LY 1TGUA 5KLIB 3LIDA 1W2BO 2BJVA 2CPBA 5CCHC 2HL7A 2OTLP 4M9ZA 1ORYB 3A98B 2KZJA 3T97A 3CX5H 3U6MA 3TE6A 1HQYE 2HR3A 2CV1A 2JA2A 3ZQJA 3E9SA 2DWMA 3C1LA 3T15A 3RL0D 2L4FA 4AKIA 1L4AC 1MU5A 4C7NB 2WSFJ 5KPRA 5KKZB 1EDJA 3H1JJ 1PIXA 3RK3D 1SQQD 5EXPA 3LQQA 3L25A 1T3UA 1VQ6P 3KOZE 3L70E 4FMMA 3V4QA 2CEAA 3II6A 1VQLP 3H25A 3WMM0 3H1LJ 1EZVE 3M0EA 2CHVA 3J27B 1IN8A 2ZM6M 1KILD 4H0LD 3QWLA 3HWSA 1KSFX 2C9CA 2ZT9D 4N78E 1QL2A 4AW4A 1EE8A 2G3AA 4LJ5A 2V7QH 3RK2D 4B86A 1AFOA 3CPWO 2YXQB 3J2PB 3FTCA 2KZIA 1T6AA 3HGIA 1IBMM 4GC9A 4IL6E 5KLVD 4YY3M 2EO2A 2K9JA 5AVRB 5ITQA 3GPXA 1XTGB 3CWBD 2BWBA 3I51A 1SFCD 2H5XA 3HX3A 2C96A 3TWMA 2R6FA 1EC5A 2EJSA 5GTIE 1IK9A 3GLMA 3R9XB 1BGYD 1LTGC 1N7SC 5EP3A 3GLHE 2MJZA 3CWBG 1FOSE 2DHYA 2I1KA 5AW8B 2K37A 1BCCD 2KLUA 2W8ZA 3O6QB 1PP9E 3BATA 3I4VA 5ITXA 5GKNA 1L2CA 4JI1M 1QYRA 2H8PD 4WBAA 4GKJM 3TGUJ 3L75D 3MJ5A 1GO5A 2XZFA 1PZQA 1JQJC 1MZ9A 3ZC7B 2HODA 4K35A 3ZH9B 3AE5C 1BGYG 1NTMJ 1NU1E 2KW0A 4EOTA 1LWUA 2YXRB 2WSCJ 1VEGA 1SS1A 4FWGA 1BCCG 2KRUA 1SQVE 2M0BA 1L8QA 2ERCA 1VF5C 4EIJA 4GOFA 3L75G 4LJ8A 4DCKA 1EDIA 4PJ0E 2VF7A 1H6UA 2HODB 3M06A 1N73A 1FBMA 1IJDB 4IBJA 5EXTA 3C58A 2DWLA 1D2NA 3SWFA 3PLNA 3VDPA 4M9SA 1X0TA 5A2QS 1CI6A 4TLGA 3OTOM 1FOSF 3HHZA 2Y21A 4KT0F 3MHVC 2Z5IA 3AE9C 1NOHA 2WITA 1RH5B 1KZUB 1BSNA 1HNXM 2EKKA 2KS1A 2N1TA 1OAIA 2K9DA 2O1JA 2HKJA 3FKEA 1YI2P 1Q90D 2R3SA 3Q5SA 2C9OA 2KB7P 2KI7B 4XGIA 3HY5A 3JCUH 3RL0B 2DAGA 1NGMB 1FZGA 4B7HA 3SHGB 1NNJA 2ZTDA 3GF3A 3IHPA 2KS1B 1GL2A 3GLFA 3RK3B 5AVWB 3KP0E 4LF5M 2B88A 2VRSA 4WP2A 4I5SA 2QNJA 1Q02A 2KDLA 4FCTA 1R5SA 1PJSA 1J1DC 4S12A 2JO1A 4LG2A 2NPSD 2C99A 2LH0A 3NWLA 4YTPC 3JR4A 1JR3D 1HNWM 1KILB 1G59A 2RMZA 5KQDA 4H0LB 4OH8B 1NTZD 4EDFA 3M0DA 2ZT9B 2OO9A 1GJSA 1VQPP 1BE3G 3GRYA 1RF1A 1L0NJ 3RK2B 3EIHA 1IFMA 2K9YA 2FFDC 1DGFA 1BVSA 5CCHD 2BWEA 2EA0A 1HVVA 1NTZG 1CUKA 3TWKA 4HJGH 2L7IA 1HH0A 2A5YB 5TJHA 1IBKM 3P8CD 1NHWC 1SQXJ 2G5GX 1M8OB 2QCUA 2JWDA 3FXDA 1OLMA 3FTFA 1YUBA 4H13D 4DJGA 1LTIC 1SFCB 3TF5A 3V2NA 3AOEA 5CCGD 3CCMP 3L71D 1PGOA 1K05A 4DV7M 1KB9H 1R5LA 2ZYAA 1AA0A 2V4HA 1WJ7A 1DD4A 3LCUA 4LJ7A 3CGWA 3RBXA 4HKZH 3GMAA 1YTZI 2DWZB 1L2BA 3CD6P 1U57A 3H1HD 2LHGA 4NOOB 4MGYE 2QJKC 2LR2A 5ITXE 4IBDA 1QVRA 4AG6A 3HUSA 2OTJP 1PM5A 1YJWP 3SYLA 1FZEA 3GLGA 2WZ7A 1D0KA 3H1IG 1JMMA 1WRGA 4OMJA 2QM7A 2L5GB 3AJIB 3P7ZA 1FDMA 1IFYA 3KDPB 2E42A 3HHWA 1OW8A 1XXHA 2R4JA 1SXJC 2C0WA 3FD9A 1H8AA 1M57D 5APUA 2ZANA 3PTZA 4JI4M 3FWLA 2LXCB 1SQVJ 3FUTA 4DT0A 2K47A 3Q2YA 1S5LH 3GPPA 2WPVB 1L0LD 5ITTA 1IN5A 1Z5BA 2B9BA 4DV1M 4U3FD 1NTKJ 3GLIB 4M9XA 4ZKUA 1FS0E 2W83C 3B5ND 4JI8M 1TTEA 1MUUA 1P84H 3FRHA 2R0IA 3Q5RA 4CIZA 1MFTA 2CFOA 1NJIQ 2OYHA 1ZQ9A 1NV8A 2Y0EA 3RK3E 1SQQE 1JY3O 3U5ZA 2CHQA 3SAUA 1N7SD 3K92A 1G2CB 3E1IA 2YIUC 2NPSA 2POHA 4PD4D 1EZVG 1T43A 1JCDA 1N34M 1KILE 3GHGC 4NXNM 5L8RJ 2QHOB 2RH0A 3PP5A 2QBYB 2SPZA 4CISA 3KOWE 4IBGA 1VF5D 3M9HA 1GJTA 2NPSB 3FE3A 3C8VA 4GIFA 1JO5A 4NRWA 3RK3C 4I8OA 1J5EM 4JI6M 2QJYC 2DZLA 3AE6C 3PJSK 2H89C 1RU3A 1NHLA 3L74G 3G71P 1T6OA 3CWBE 4X66M 5AVYB 3GQ3A 2WSCH 1AQ5A 3SYKA 2E76C 2WT7A 1L4AA 3A0BH 1KN7A 4UB6H 2LTUA 1PJTA 1N32M 3LW5F 3SARA 1BGYE 4PDGA 2ZT9C 4H13B 4ZMDA 3DFZA 3WHLA 3SBJA 2FY8A 1BCCE 3RK2C 4LF8M 1FDOA 2P7JA 1Q39A 3HTKB 2WT7B 4QMAA 3L75E 4DR2M 2CV2A 2AXCA 1GZLA 5EXSA 1RQVA 1YTZT 3L35A 1N8RQ 2MGWA 2E75C 4GH9A 1ZXGA 4JBZA 4MGIE 1IQPA 1JB0J 2FXMA 1PJQA 1K3XA 2L09A 3H1KD 2QQ8A 1OFCX 1KV4A 4IBFA 1TH3A 2RN0A 3CX5D 3QYBA 5B66H 1KQSO 1LTJB 1AV1A 4IFMA 2KIKA 2QIWA 3L36A 4A7PA 2KLVA 3AEFC 3EFGA 4A3VB 4NPDA 5GTHH 2XZRA 4MGKE 2XFSA 1HJBA 1NU1K 4R7GA 2XU6A 3TL4X 1E5WA 4IBIA 1I4WA 1KYOI 1OKSA 1SQVK 5C39A 3GLIE 1JCCA 2A06D 3L73D 2A45H 3CCSP 3M91A 2R46A 2MJ5B 3NFQA 1M1JA 1KQFB 3Q1MA 3R4YA 1P3QQ 1ZP0C 2KZSA 2M5AA 3L72D 3U6DA 1QUSA 3CC7P 3L73G 2A06G 3B5NB 3AEEC 3RBZA 1WGLA 4JYCA 2CV0A 4LJ4A 1RY3A 5KAIH 4JYAM 1PGYA 1NHGC 3NMDA 5FTLA 5AVZB 3D6YA 3L72G 1N7SB 1VQ1A 1QDTA 3W68A 2O3JA 3KSXA 3CCLP 3K5BA 3VOPA 1BE3E 3FUUA 3RGSA 2K0BX 2XNDH 1AIPC 3U6EA 1IFIA 3HU1A 1MFZA 4LFBM 5DYGA 3N4XA 3JSVC 3U6CA 5H2FH 2QEXP 2B87A 5FTMA 3A2AA 4QNMA 1JR3E 3BASA 1NTZE 3CXHI 1SQBD 1S4XA 3AE1C 3GLHA 1PGQA 4L73A 5AVQB 3Q5PA 1XWIA 1SQPD 4NPFX 1WIVA 1VF5B 3V2RA 2DAKA 3AE2C 2YFQA 5K5GB 3GO8A 3A5TA 1AJYA 3SWKA 3CF6E 3I5CA 2FBWC 2AEJA 2ZXEB 4HH2A 3SAVA 5KO3A 3MHVA 3HJQA 2OQQA 2UXCM 3VKHA 3KQGA 1SQBG 2L7HA 3FTEA 2FYUD 3TK1A 1SXJD 3J80S 3A0HE 5FTJA 1SQPG 2YO3A 2LVQD 1TU3F 3P8CE 2EKFA 5AW0B 1JOCA 1IFJA 4LJ6A 1GD2E 2KK7A 3V5BA 2QVAA 2P10A 4RESB 4JPZB 4Z1MH 2IPPA 1LTMA 4M0DA 4N3YB 2O01H 5BPVA 4RO0A 1G8PA 4RF0A 2WSEH 3TSIA 5APSA 2Z4EA 1ZAEA 2CK3H 4MN4C 3H1IE 2BJWA 2JEEA 2XV5A 2PP6A 3H1HE 3OW2O 4W5WA 2FH0A 3F89A 2FKWB 3QAUA 4W80A 2NZ2A 3CLQA 3AL0C 4NC6A 1DO2A 3U60A 3HE4B 3ZDMA 2Q7CA 4C7NA 1XNQM 3KFUG 3MD0A 4DOJA 1JY3N 2Q6QA 4JI7M 2BASA 3CCQP 4H13C 2VQEM 2RRUA 1GDTA 5E79H 1LTBC 3H6PA 4M0WA 5CCGC 1MX0A 1J1DB 3VP8A 3FTDA 3LVVA 3JR5A 3U60B 4DR7M 1QAOA 1Q7YQ 1ZV8A 1IXSA 4DR4M 1QGKB 2LVNC 2Q2EB 4OU7A 1IBLM 3UMMA 1L0LE 2CPSA 4OVZB 3V4WA 1LTJC 3KPEA 1W2EA 3OAKA 2OGUA 5AVUB 2BCCD 1IXSB 2XEPA 4GDOA 2FFDB 1ZMEC 1USEA 2KNVA 2E76D 5FLXS 2JY8A 1SQQG 2J59M 1IK7A 2L4EA 4BRYB 1WMKA 3HHYA 3BRTB 1Q3CA 5C18A 2JY6B 4D6TJ 2KXPB 4RKUF 4Z6YA 2OQ4A 2OOAA 4FVMA 3SC3A 1DEEG 4NSOB 1S9KD 2P2UA 4PD4E 1GTWA 3FRIA 1U7MA 4ZPXA 3MIWA 3V2QA 3FYDA 1GK4A 2O1KA 1RE3C 5DFLA 2E75D 1G71A 4UN2B 2QJPC 2CP8A 1SQQK 3L74E 3B5NC 5H2FE 5C1BA 3O6QA 1KQGB 2QJKB 3KZIE 4H44D 3C3DA 5KLVG 3NTNA 1SP4A 1SXJA 3BCCD 3BVHA 3FYCA 2J5YA 1EZVI 1USDA 5B5EE 4JN6A 2QP9X 4BWNA 4K0KM 4FCVA 3Q8XA 1GK6A 2N9BA 3CL3D 3HJSA 4G4QA 1ZW0A 1BE3J 3VMYA 2QA4P 1KB9D 4IJFA 2PFXA 1NY5A 1SXJB 4PD4I 1OW6A 4REZA 3KVWA 2FS1A 2Y0TA 4F2LA 2YKQA 1NVMA 3A46A 3HD7D 3I4YA 4Y99C 1IN7A 2Z5HA 4B7GA 4XK8F 1HUCA 1FJGM 1KFMA 3T1HM 1NJGA 3MP7B 4GEWA 4JI2M 1PFIA 1VEJA 2D2CD 3M9BA 1L2PA 1YYCA 2B3TA 2HHHM 2WPQA 3H1JD 2D7GA 1EFUB 4W7ZA 4ITQA 2KYVA 3GHGA 3G4SP 1QLED 1NJFA 3U1CA 4I81A 3CX5E 3P32A 2R5BA 4FWDA 3Q3DA 2Y9ZA 4LLHA 3PRJA 3VDUA 2YIUB 1OVVA 2IBZD 5EP1A 2R3CA 4QNRA 3ITKA 1CW5A 4G3OA 1MKMA 5EP2A 3H1LD 3H1IJ 3GHGB 3C3EA 1N78A 1RE4A 2O01F 1P84D 4KLNA 1GW3A 1L1TA 1JTHA 2CWBA 2AHMA 4DUYM 2IBZG 2WSEF 4LCBA 3L73E 2A06E 3U6QA 3AFHA 3MUDC 2HWJA 3L37A 3H1LG 4QHTA 4OGQC 3U61B 1KILA 1S2EA 2QJYB 2E74C 3D6ZA 3KXDA 3PHLA 3L72E 3DOAA 3IR9A 1JTHB 2ZAMA 1N86A 3KW6A 5APWA 2F5OA 1KYIA 4XA4A 2E76B 2Y20A 4EI2A 4P16A 3N7NA 4KO8A 4QHSA 4AKGA 3A42A 1TH2A 1ZRTD 3L70J 4YPCA 1BDDA 2W6AA 1SFCA 4L78A 3DZDA 3TGUD 3LCVB 4AZFA 2AXTH 3KSJA 1FJKA 1VDLA 3K2LA 2C9NY 2E75B 3CTWB 1SQBE 1NTMD 3B4SA 3SSUA 4WB4A 1SQPE 2Y0QA 5AW6B 5CBOA 4Z8XA 4H44B 2LBCA 2R65A 3TGUG 2Y9YA 1NO4A 4CPGA 4EYYQ 2BEQD 1NTMG 2FYUE 3V2PA 1QVGO 8CATA 2OOBA 1SXJE 4R4MA 5APYA 2YR0A 3KDSE 3AE7C 2RKOA 4MGHA 4HYTB 1FZFA 3IFMA 1M1KQ 2DZOB 3CCEP 1NTZK 3L74J 1M56D 1KFVA 1E9SA 4IFFA 5FTKA 2D7EA 1AUAA 3L71G 2CHGA 2WZJA 1EIJA 4AYCA 1R4GA 4WY4D 3UIAA 2ZTCA 1OMIA 2B89A 1FJPA 5AW3B 1WHCA 2GUSA 1I94M 3HD7B 3H1HG 2IYPA 4I6MC 1J2JB 1NSFA 1EDLA 2VQFM 4M8ZA 1XMQM 2ZJSE 2WSFH 4KT0J 1PP9J 1HQCA 3THGA 3GLIA 3G9RA 3E21A 3B74A 1ZMWA 2X49A 4L75A 3CMAP 2EUCA 1NU1J 1DV0A 3VLFB 4KJMA 3GPYA 1F4IA 1VL2A 1YIJP 4BBAA 1KMIZ 1L2DA 2HG5D 4UB8H 3A7OA 4JXJA 3A45A 1MV8A 3E1RA 5AVVB 4GODA 4B7FA 2P58A 1G2CA 2JKVA 5APQA 2GNOA 4LRSA 3JCUE 3CCUP 1IXRC 1XHBA 4LJAA 1D7MA 1OX3A 1XMOM 4JI3M 1QVFO 1L0LG 3TQSA 2A45G 4CHTB 2WPRA 2OTKE 4I7ZC 5TISH 2UUCM 4DUZM 4U3FG 1YHQP 1S72P 3RL0g 2QBYA 1RF0A 3CXHH 1D0MA 1L0ND 3U6SA 3HU3A 3FUVA 3AV0A 2XSZD 4IBEA 5AW2B 3WUTA 1JR3A 1LWUC 3K1JA 2QZ4A 5IZ7D 2V1UA 1L0NG 4BXLA 3AE3C 2MKVA 1DGHB 3KXEC 1FDIA 1SQXD 2JP7A 1QZEA 4X62M 1AVYA 4OX9M 4HL4A 1L0LK 2CUZA 1JY3P 5CCHA 5AVXB 3CF0A 5KLVE 2E5TA 2L2DA 4CJ6A 4OW0A 5AVSB 1QDRA 5JI3E 2L6OA 3B9PA 1KTMA 1TR8A 1V92A 3FWNA 1KQLA 2E5YA 3QWOC 2JZ0A 4TT3H 1N36M 1FZCB 5CCGA 3HTKA 1FE6A 4IFDK 1NYHA 2DENA 2JZ1A 1JEKA 2N1TC 4K3AA 3BBZA 3BCCE 5E26A 1GLNA 1HR0M 2XLJA 4R3DA 5BU5A 1W5SA 2V6ZM 4R71A 1IN6A 2F5QA 3CF2A 4TLFA 3SMSA 1HGVA 3W0FA 1BDCA 1KB9E 1DX7A 5EQTA 2JXNA 1LTJA 1ZV1A 1ZOYC 3GQ5A 2OARA 4ASWA 3QH9A 1Q81Q 2OYIB 2DVWB 1KC8Q 1YLAA 1LT9B 1NAFA 3CC2P 1LJ2A 1N75A 2C98A 3TYYA 1X37A 2AEMA 3BXWA 4L6V6 2I7PA 4OGQD 1SQVD 3UGJA 2IYOA 2E74D 2ZVOB 2NQ8C 4H44C 4WY4B 3B8EB 4IBCA 3D8LA 4Y28F 1NTKD 2DHRA 1PGPA 2QE7H 1HTLC 4ZNCA 2Z7JA 1URQD 1E9RA 2Y0CA 5IWAM 3H1KG 3L26A 3TWLA 4BLCA 2KA6B 2JUJA 4DR3M 4B08A 4GIPA 4IIWA 4I2LC 1NH4A 4PCZA 3VMAA 1NTKG 2X8AA 1IC2A 1JY2O 4L4UA 4GMQA 1IFPA 3B5NA 4AUWA 2WVRA 3H32A 3GQ4A 1S3JA 2IBZE 3I01M 1K9MQ 3K8ZA 1QAMA 1S5LE 2JJLA 2UXBM 2RGOA 4DR1M 2VIIA 3H1LE 3HD7C 2R45A 4OWFA 1N7LA 1E94E 2BNKA 3I04M 2JDIH 4GT1A 5ITUA 2QJPB 1N7SA 3E4RA 2QM8A 3G3ZA 1DGBA 1P84E 3S9OA 1OAOC 3GF7A 3H32B 3M0AA 4PV1C 2YNMD 3Q8GA 4IBKA 2D2CC 5TISE 4B3MM 1VDDA 2WSFF 3HZJA 2G8YA 5H37D 4Q7JA 3HUSC 2KSEA 1XNRM 1J09A 2R4EA 3GRVA 1VQOP 3M7GA 1XB2B 2KSJA 1QUTA 2F5PA 2W6BA 2K1AA 1SQQJ 3FX0A 1R6BX 3L29A 3HHXA 1ZRTE 4GRIA 5LMUM 2I7NA 4WVZA 4Y99B 2Z4SA 2UUBM 1P84I 4IL6H 2XDJA 1OIPA 1YQ3C 2P67A 3FUXA 1IFNA 4GOEA 1LT1A 3FUWA 3TGUE 4LJ9A 1LP1B 3QYEA 3FXEA 1ZN5A 1DH3A 3D70A 3LW5J 4JV5M 2JR8A 5EFWB 2KNZA 1NTME 2LKMA 3K9PA 4D81A 1OTRA 3A0BE 4GITA 3HE5B 5F3WA 4UB6E 5ITYA 1Q2NA 2O25A 1RQUA 3V76A 1NAYA 3P7KA 2FYUG 3L71E 3HE4A 4DV0M 1A5TA 3USSA 3WUUA 5KLVJ 2Q5UA 3MUDA 1UIXA 2APLA 2XF3A 4YXWH 1QAQA 4LGYA 3UJNA 3CWBJ 1SQBK 4DV4M 2M3BA 2LXBA 1FZCC 3GG2A 1SQPK 3T1YM 3SMPA 3ABVC 2M5ZA 3BRVB 1TH4A 5AW5B 1E32A 2R32A 5B66E 3TNUA 1BGYJ 4OGQB 3R8FA 1OFHA 2Z3XA 2YNYA 4PJ0H 4LGDE 2E74B 2FYUK 2WSCF 3L2AA 1BCCJ 2GM4A 2ZBKB 2KOGA 2ZAOA 2K3RA 4OVZA 1N2DC 5GTHE 2L91A 2FXPA 4J7QA 3L75J 2F5SA 2ZVNB 1URQB 2O5RA 1Y8GA 1R7RA 1V34A 1GVNA 2OYIC 2E2XA 1LT9C 2LWXA 1AVOA 2FFDA 1VQMP 3TNUB 1EXIA 4BRYA 4JI5M 2H7HA 2WTYA 1G3IA 2YMKA 5BR8M 2W90A 3VK7A 2Z8YM 4X65M 2DKLA 4B3SM 1JMBA 1DO0A 4U3FE 4WY4C 5CJ4A 1G4AE 3GW6A 2ZYDA 3U6OA 3IECA 5BU8B 3B7ZA 3T97B 1GU5A 1OZHA 3VMXA 1WXQA 2J7NA 3MK6A 2BEZF 4EIWA 2QRXA 4RF1A 4DR5M 1QQWA 1LV7A 3E46A 3HU2A 3PVSA 2N1TD 4AQYM 2Q9IA 2HFED 3PXGA 1VEKA 5DJUB 3CCRP 1T2KC 5KAIE 5CMZA 3GP1A 1L0NE 1PGJA 1C1KA 2BCCG 1VQKP 4PD2A 1FZBA 4C7RA 1NV9A 3K9OA 2Q3IA 2YKPA 3PFIA 2JWAA 5KJ7C 1GL2D 2LVOC 2R5DA 2QPAA 1S1CX 4FW9A 1QEXA 2IX7C 1YJ9P 1NNUC 1SQXE 3PH0A 1OJLA 1C7YA 2A45I 3MGNA 2Q1KA 3SWYA 1K04A 3B89A 1OW7A 1JNMA 3HJ8A 2M3EA 2LNHC 2J58A 3V6IA 1YBKA 4G6ZA 1SG9A 1E79H 2XGNA 1G41A 4AG5A 4LZZA 1WT6A 1A02J 2MR9A 4FWHA 4AQRD 2ZAEB 1CZQA 2GA1A 1VQ9P 3F5HA 3RE8A 1G1IA 2QG4A 3M6AA 1M1JC 4JF7A 3BCCG 3NBXX 3I55P 5DNYA 1GMJA 1VQNP 1HGZA 4MH0E 3PNVA 1OWAA 3KS4A 3SFZA 1NTZJ 1GL7A 2DW3A 3W67A 5JI2E 2K9JB 1HBWA 2JNHA 4MM3B 1ZR2A 4YHHM 5KLVK 2FNAA 2WMMA 1JY2N 2FYNC 1KYOD 1NKZB 1OVRA 1J1EC 1VG5A 2XNXA 1TF0B 2FYZA 1FNNA 3AEDC 2DZNB 4PV1D 4JYBA 5IREB 3R2PA 3SATA 3U59A 3KS8A 1IM2A 3H4JA 3H1KE 3P8MC 1ZLLA 5AW7B 3AEAC 3O8ZA 4DV3M 3CCVP 3C9IA 3A3YB 4I7ZB 3B71A 3TDKA 1K3WA 2JWSA 1PV3A 3SFEC 3VTPC 1K8AQ 3W0LB 2E5LM 1GL6A 1NTKE 4TUWA 4O9BA 3J7BA 1Y47A 3L71J 4GKKM 2WPSA 2AEFA 1YJNP 4MGZE 1H89A 1LTTC 2LVPC 3VP9A 5E79E 4J7PA 3H1JG 5KTBA 1LWUB 4DZOA 2XKMA 3M9QA 4OMKA 4DV6M 2N9YB 3L27A 3U61A 4DR6M 1SLQA 2ITAA 2KNAA 3T6PA 3F92A 1GABA 3H1HJ 1UM8A 4MB7A 2X4AA 4NPEA 4LY6A 1FZAA 3DA1A 4D6TD 4NL4H 3LMMA 4RJTA 4LGMA 3WUVA 1N73B 2F5NA 1VQ5P 3AKZA 3UZUA 1BSHA 3OA7A 2N35A 1HJPA 2YO2A 1HJ0A 2R18A 1H0TA 4WW0A 3CXHD 1VQ8P 1CI6B 4D6TG 4PT5A 1IZNB 4RKUJ 5KLIC 3WU2H 3CX5I 4XBOA 4P17A 1T3JA 1URQC 1PPJD 2FE8A 4NXMM 3LVWA 3FGAD 2HPCA 3IF4A 2HCBA 2N1TB 1H0TB 1ZR4A 4LFCM 3EWKA 4L15A 4W7YA 3VK8A 2FFJA 1L0LJ 3ILKA 4NRVA 3AEGC 1H88A 2D7HA 1W5CE 4B3RM 3MZWB 3PNYA 4U3FJ 1PPJG 4G4NA 3LW5H 1IY2A 2LVAA 1Z5AA 1BE3D 3C9PA 4LF6M 2HPCB 4GKGA 1PJJA 2DAMA 1GL2B 5KKZC 3GLFB 2IFMA 1EQ7A 1J7KA 2MH8A 3L4FA 5KAFH 5KPTA 4YXDC 1T8ZA 1LGHB 5L8RF 5DJTB 3LIEA 2KXEA 1Q3BA 3NXSA 3B7QA 5FSWA 1OXZA 1K82A 3RGPA 5APVA 1Z59A 1QANA 3EQ2A 3HD7A 4BB9A 3VN0A 1RF1B 5CJ0A 1SVFA 1X9VA 4QOSA 1S3SA 1CSBA 2DAEA 1M7LA 4AKHA 2KHHA 3KOYE 1L4AD 1PJIA 1KYOH 2IZ0A 4L76A 1NO1A 2G8LA 1OIZA 3UK6A 5IT9S 2YKOA 3KOXE 1HF9A 3I56P 3IAOA 3KYQA 3H1ID 1LTAC 1NTMK 2MROB 1JM0A 1T2KD 2M8RA 4PDIA 2M60A 2CRUA 2KNCA 2WWWA 4C46A 4PV1B 3B7NA 2WQYC 2IDBA 1JUNA 4NSRA 2D2CB 3AECC 2VDBB 1V33A 3CI9A 3CC4P 3MMPA 5KPZA 3VFDA 1QX8A 1KFNA 1JB0F 5KJ7D 1ZMUA 2O01J 1N77A 1YITP 2KEBA 1NWQA 1DIPA 1XTCC 2P5TA 1VDFA 2O01N 2WSEJ 1IXZA 3J81S 3HUSB 2KNCB 1YQ4C 4DV2M 4L74A 2UXDM 2I8DA 1FU1A 5M1BA 1GKIA 3LQRA 2JY7A 2QSIA 1YE9A 4LFAM 4I4LA 1MJGM 3GLGB 3SAWA 3H1KJ 5ITRA 1QL1A 4AI6A 4DBGB 2Y0DA 1AQTA 1PRBA 1X8YA 3L70D 1DGHA 4ZKPA 1T3TA 3AEBC 2H43A 2C5RA 3L28A 1XXHB 2QSFX 2BCCE 2J7OA 1IY0A 3PEGA 3WU2E 5CBNA 2OPFA 4XE5B 1EZVD 1DEBA 1OQYA 2KRKA 3U6LA 1O6UA 3L70G 3VMZA 1HWTC 3JAMS 1EDKA 4N78D 3H4MA 1L1ZA 4U7JA 4UYBA 3L73J 1S9KE 1FZCA 1R2ZA 4WURA 4LZJA 1OVUA 1N73C 4HEOA 4LF4M 3CCJP 2DWNA 2OYHB 4ASVA 3GLFE 1RHZB 3U5ZB
chains in the Genus database with same CATH topology
1OLMA 3PEGA 4CIZA 3B7NA 2E2XA 1AUAA 3B74A 1O6UA 4J7PA 2D4QA 3W68A 1OIPA 4OMKA 3HY5A 3HX3A 3B7QA 1OIZA 4FMMA 1R5LA 4OMJA 4UYBA 4TLGA 3PG7A 3P7ZA 3W67A 4M8ZA 3Q8GA 1OLME 3B7ZA 4J7QA 4CJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OLM A;  3PEG A;  4CIZ A;  3B7N A;  2E2X A;  1AUA A;  3B74 A;  1O6U A;  4J7P A;  2D4Q A;  3W68 A;  1OIP A;  4OMK A;  3HY5 A;  3HX3 A;  3B7Q A;  1OIZ A;  4FMM A;  1R5L A;  4OMJ A;  4UYB A;  4TLG A;  3PG7 A;  3P7Z A;  3W67 A;  4M8Z A;  3Q8G A;  1OLM E;  3B7Z A;  4J7Q A;  4CJ6 A; 
#chains in the Genus database with same CATH topology
 3J7A S;  1S5L X;  4X64 M;  1SQX G;  3L72 J;  3RL0 C;  4LC1 A;  3E7K A;  3IG8 A;  3MTU E;  4N6J A;  2AXT E;  4D80 A;  2D4Q A;  3S1K A;  3L74 D;  1IY1 A;  1LNQ A;  2W6J H;  2V1C A;  5KAF E;  4II7 A;  1L0N K;  3WHK A;  4ANR A;  2HAK A;  2H88 C;  2OYI A;  1LT9 A;  2W27 A;  3TPZ A;  2V7Q J;  5APX A;  1KD1 Q;  4JI0 M;  2PAJ A;  2F4V M;  1RE4 C;  4M3L A;  5APT A;  3A0H H;  1HNZ M;  5AW1 B;  1TDZ A;  1PP9 D;  4G4O A;  1PL5 A;  4WY4 A;  5EP4 A;  1SQX K;  3BOS A;  2DI0 A;  1GL2 C;  1ZMV A;  2FOI C;  3AOG A;  2IFN A;  1KIL C;  1SQB J;  1XC8 A;  2VF8 A;  4H0L C;  1FC2 C;  1NU1 D;  3SAS A;  3PG7 A;  1U7J A;  2UWJ E;  1SQP J;  2PRR A;  3D71 A;  4B3T M;  2WSS H;  1PP9 G;  1OLM E;  1Q82 Q;  1KYO E;  2RGH A;  2C0X A;  3D8B A;  1L4A B;  2LXE A;  1WGN A;  3HKP A;  4IOI H;  1NU1 G;  2FYU J;  1FAV A;  2OYO A;  1M90 Q;  4FD2 A;  5AW9 B;  1HT1 E;  3GPU A;  1SQV G;  3H1J E;  2GQF A;  5KJ7 A;  1Z56 A;  3M0D C;  2HYN A;  2K6B A;  2KP8 A;  2YQZ A;  3EIE A;  1VPC A;  2YMY A;  1RF1 C;  1RE3 A;  4GHA A;  1W5T A;  3IN6 A;  2ZFC A;  2E43 A;  1SFC C;  5EJC A;  3EFF K;  1N33 M;  1KB9 I;  2JY5 A;  2K88 A;  2Q3E A;  1D0L A;  2PGD A;  4UB8 E;  2J5U A;  5BVZ A;  1UFZ A;  1NY6 A;  1KOR A;  1Z6T A;  2FXO A;  2DAI A;  4DV5 M;  1R8E A;  3GLG E;  3KP1 E;  3GRR A;  4CGY B;  4XFJ A;  2ZYG A;  1HT2 E;  5KQ8 A;  4GC5 A;  3AE8 C;  5AW4 B;  4D6T E;  1IO4 A;  4I1L A;  4FCW A;  3AOE C;  2Z4R A;  2XSZ A;  1X79 B;  2KZU A;  1XXH E;  1NTK K;  4IBB A;  2DNA A;  1TDH A;  1YSY A;  2LHC A;  3RFW A;  3CXH E;  1JY2 P;  7CAT A;  1QZM A;  4L16 A;  2XH9 A;  4HLQ A;  2H1R A;  4D82 A;  1MN3 A;  5LMN M;  2XFT A;  1GU4 A;  2R44 A;  4KHX A;  1PPJ E;  1OFI A;  2G3Q A;  1UII A;  5CHX A;  1GW4 A;  2IBZ I;  1M1J B;  2W82 A;  1LP1 A;  3VYI A;  3KHU A;  1IN4 A;  2RKL A;  2M5A B;  4PD4 H;  5AVT B;  4KOD A;  3HE5 A;  3GRU A;  2FYN B;  4HB1 A;  4L8R C;  1J1E B;  1G1J A;  2BCC J;  4R4L A;  3CME P;  1NKN A;  4IJE A;  1DGG A;  5DYI A;  2IZ1 A;  3KZI H;  1X22 A;  4F1I A;  3JC2 2;  3HRN A;  1LTS C;  3OJA B;  1VQ4 P;  2P1J A;  2HLO A;  2XZU A;  1R2Y A;  5GTI H;  3NBI A;  5B5E H;  3ZCB B;  4GHL A;  4WWI A;  3U6P A;  1IFD A;  3G6E P;  2R62 A;  5E6J A;  2B87 B;  3SFD C;  1DD3 A;  2OYH C;  4QOZ C;  4JQ0 D;  4LRT A;  2QEN A;  2CE7 A;  3GLH B;  4LF9 M;  3S4R A;  5EXX A;  1EXJ A;  3SHF A;  1Z5C A;  2UU9 M;  4LF7 M;  1RF0 C;  1A02 F;  1Y8A A;  2UUA M;  3VKG A;  1NVO A;  4Y28 J;  3RGU A;  5FTN A;  2DXI A;  2GUV A;  2JP3 A;  2NPS C;  1VQ7 P;  1URQ A;  3U1A A;  2KUB A;  1Q86 Q;  2I1J A;  3T38 A;  3BCC J;  2ZXX A;  4RNA A;  4G4R A;  1WR1 B;  2NRG A;  4OVN F;  1K73 Q;  4KHP M;  3AE4 C;  3IG5 A;  4IL6 X;  1Y9B A;  2C9L Y;  1TGU A;  5KLI B;  3LID A;  1W2B O;  2BJV A;  2CPB A;  5CCH C;  2HL7 A;  2OTL P;  4M9Z A;  1ORY B;  3A98 B;  2KZJ A;  3T97 A;  3CX5 H;  3U6M A;  3TE6 A;  1HQY E;  2HR3 A;  2CV1 A;  2JA2 A;  3ZQJ A;  3E9S A;  2DWM A;  3C1L A;  3T15 A;  3RL0 D;  2L4F A;  4AKI A;  1L4A C;  1MU5 A;  4C7N B;  2WSF J;  5KPR A;  5KKZ B;  1EDJ A;  3H1J J;  1PIX A;  3RK3 D;  1SQQ D;  5EXP A;  3LQQ A;  3L25 A;  1T3U A;  1VQ6 P;  3KOZ E;  3L70 E;  4FMM A;  3V4Q A;  2CEA A;  3II6 A;  1VQL P;  3H25 A;  3WMM 0;  3H1L J;  1EZV E;  3M0E A;  2CHV A;  3J27 B;  1IN8 A;  2ZM6 M;  1KIL D;  4H0L D;  3QWL A;  3HWS A;  1KSF X;  2C9C A;  2ZT9 D;  4N78 E;  1QL2 A;  4AW4 A;  1EE8 A;  2G3A A;  4LJ5 A;  2V7Q H;  3RK2 D;  4B86 A;  1AFO A;  3CPW O;  2YXQ B;  3J2P B;  3FTC A;  2KZI A;  1T6A A;  3HGI A;  1IBM M;  4GC9 A;  4IL6 E;  5KLV D;  4YY3 M;  2EO2 A;  2K9J A;  5AVR B;  5ITQ A;  3GPX A;  1XTG B;  3CWB D;  2BWB A;  3I51 A;  1SFC D;  2H5X A;  3HX3 A;  2C96 A;  3TWM A;  2R6F A;  1EC5 A;  2EJS A;  5GTI E;  1IK9 A;  3GLM A;  3R9X B;  1BGY D;  1LTG C;  1N7S C;  5EP3 A;  3GLH E;  2MJZ A;  3CWB G;  1FOS E;  2DHY A;  2I1K A;  5AW8 B;  2K37 A;  1BCC D;  2KLU A;  2W8Z A;  3O6Q B;  1PP9 E;  3BAT A;  3I4V A;  5ITX A;  5GKN A;  1L2C A;  4JI1 M;  1QYR A;  2H8P D;  4WBA A;  4GKJ M;  3TGU J;  3L75 D;  3MJ5 A;  1GO5 A;  2XZF A;  1PZQ A;  1JQJ C;  1MZ9 A;  3ZC7 B;  2HOD A;  4K35 A;  3ZH9 B;  3AE5 C;  1BGY G;  1NTM J;  1NU1 E;  2KW0 A;  4EOT A;  1LWU A;  2YXR B;  2WSC J;  1VEG A;  1SS1 A;  4FWG A;  1BCC G;  2KRU A;  1SQV E;  2M0B A;  1L8Q A;  2ERC A;  1VF5 C;  4EIJ A;  4GOF A;  3L75 G;  4LJ8 A;  4DCK A;  1EDI A;  4PJ0 E;  2VF7 A;  1H6U A;  2HOD B;  3M06 A;  1N73 A;  1FBM A;  1IJD B;  4IBJ A;  5EXT A;  3C58 A;  2DWL A;  1D2N A;  3SWF A;  3PLN A;  3VDP A;  4M9S A;  1X0T A;  5A2Q S;  1CI6 A;  4TLG A;  3OTO M;  1FOS F;  3HHZ A;  2Y21 A;  4KT0 F;  3MHV C;  2Z5I A;  3AE9 C;  1NOH A;  2WIT A;  1RH5 B;  1KZU B;  1BSN A;  1HNX M;  2EKK A;  2KS1 A;  2N1T A;  1OAI A;  2K9D A;  2O1J A;  2HKJ A;  3FKE A;  1YI2 P;  1Q90 D;  2R3S A;  3Q5S A;  2C9O A;  2KB7 P;  2KI7 B;  4XGI A;  3HY5 A;  3JCU H;  3RL0 B;  2DAG A;  1NGM B;  1FZG A;  4B7H A;  3SHG B;  1NNJ A;  2ZTD A;  3GF3 A;  3IHP A;  2KS1 B;  1GL2 A;  3GLF A;  3RK3 B;  5AVW B;  3KP0 E;  4LF5 M;  2B88 A;  2VRS A;  4WP2 A;  4I5S A;  2QNJ A;  1Q02 A;  2KDL A;  4FCT A;  1R5S A;  1PJS A;  1J1D C;  4S12 A;  2JO1 A;  4LG2 A;  2NPS D;  2C99 A;  2LH0 A;  3NWL A;  4YTP C;  3JR4 A;  1JR3 D;  1HNW M;  1KIL B;  1G59 A;  2RMZ A;  5KQD A;  4H0L B;  4OH8 B;  1NTZ D;  4EDF A;  3M0D A;  2ZT9 B;  2OO9 A;  1GJS A;  1VQP P;  1BE3 G;  3GRY A;  1RF1 A;  1L0N J;  3RK2 B;  3EIH A;  1IFM A;  2K9Y A;  2FFD C;  1DGF A;  1BVS A;  5CCH D;  2BWE A;  2EA0 A;  1HVV A;  1NTZ G;  1CUK A;  3TWK A;  4HJG H;  2L7I A;  1HH0 A;  2A5Y B;  5TJH A;  1IBK M;  3P8C D;  1NHW C;  1SQX J;  2G5G X;  1M8O B;  2QCU A;  2JWD A;  3FXD A;  1OLM A;  3FTF A;  1YUB A;  4H13 D;  4DJG A;  1LTI C;  1SFC B;  3TF5 A;  3V2N A;  3AOE A;  5CCG D;  3CCM P;  3L71 D;  1PGO A;  1K05 A;  4DV7 M;  1KB9 H;  1R5L A;  2ZYA A;  1AA0 A;  2V4H A;  1WJ7 A;  1DD4 A;  3LCU A;  4LJ7 A;  3CGW A;  3RBX A;  4HKZ H;  3GMA A;  1YTZ I;  2DWZ B;  1L2B A;  3CD6 P;  1U57 A;  3H1H D;  2LHG A;  4NOO B;  4MGY E;  2QJK C;  2LR2 A;  5ITX E;  4IBD A;  1QVR A;  4AG6 A;  3HUS A;  2OTJ P;  1PM5 A;  1YJW P;  3SYL A;  1FZE A;  3GLG A;  2WZ7 A;  1D0K A;  3H1I G;  1JMM A;  1WRG A;  4OMJ A;  2QM7 A;  2L5G B;  3AJI B;  3P7Z A;  1FDM A;  1IFY A;  3KDP B;  2E42 A;  3HHW A;  1OW8 A;  1XXH A;  2R4J A;  1SXJ C;  2C0W A;  3FD9 A;  1H8A A;  1M57 D;  5APU A;  2ZAN A;  3PTZ A;  4JI4 M;  3FWL A;  2LXC B;  1SQV J;  3FUT A;  4DT0 A;  2K47 A;  3Q2Y A;  1S5L H;  3GPP A;  2WPV B;  1L0L D;  5ITT A;  1IN5 A;  1Z5B A;  2B9B A;  4DV1 M;  4U3F D;  1NTK J;  3GLI B;  4M9X A;  4ZKU A;  1FS0 E;  2W83 C;  3B5N D;  4JI8 M;  1TTE A;  1MUU A;  1P84 H;  3FRH A;  2R0I A;  3Q5R A;  4CIZ A;  1MFT A;  2CFO A;  1NJI Q;  2OYH A;  1ZQ9 A;  1NV8 A;  2Y0E A;  3RK3 E;  1SQQ E;  1JY3 O;  3U5Z A;  2CHQ A;  3SAU A;  1N7S D;  3K92 A;  1G2C B;  3E1I A;  2YIU C;  2NPS A;  2POH A;  4PD4 D;  1EZV G;  1T43 A;  1JCD A;  1N34 M;  1KIL E;  3GHG C;  4NXN M;  5L8R J;  2QHO B;  2RH0 A;  3PP5 A;  2QBY B;  2SPZ A;  4CIS A;  3KOW E;  4IBG A;  1VF5 D;  3M9H A;  1GJT A;  2NPS B;  3FE3 A;  3C8V A;  4GIF A;  1JO5 A;  4NRW A;  3RK3 C;  4I8O A;  1J5E M;  4JI6 M;  2QJY C;  2DZL A;  3AE6 C;  3PJS K;  2H89 C;  1RU3 A;  1NHL A;  3L74 G;  3G71 P;  1T6O A;  3CWB E;  4X66 M;  5AVY B;  3GQ3 A;  2WSC H;  1AQ5 A;  3SYK A;  2E76 C;  2WT7 A;  1L4A A;  3A0B H;  1KN7 A;  4UB6 H;  2LTU A;  1PJT A;  1N32 M;  3LW5 F;  3SAR A;  1BGY E;  4PDG A;  2ZT9 C;  4H13 B;  4ZMD A;  3DFZ A;  3WHL A;  3SBJ A;  2FY8 A;  1BCC E;  3RK2 C;  4LF8 M;  1FDO A;  2P7J A;  1Q39 A;  3HTK B;  2WT7 B;  4QMA A;  3L75 E;  4DR2 M;  2CV2 A;  2AXC A;  1GZL A;  5EXS A;  1RQV A;  1YTZ T;  3L35 A;  1N8R Q;  2MGW A;  2E75 C;  4GH9 A;  1ZXG A;  4JBZ A;  4MGI E;  1IQP A;  1JB0 J;  2FXM A;  1PJQ A;  1K3X A;  2L09 A;  3H1K D;  2QQ8 A;  1OFC X;  1KV4 A;  4IBF A;  1TH3 A;  2RN0 A;  3CX5 D;  3QYB A;  5B66 H;  1KQS O;  1LTJ B;  1AV1 A;  4IFM A;  2KIK A;  2QIW A;  3L36 A;  4A7P A;  2KLV A;  3AEF C;  3EFG A;  4A3V B;  4NPD A;  5GTH H;  2XZR A;  4MGK E;  2XFS A;  1HJB A;  1NU1 K;  4R7G A;  2XU6 A;  3TL4 X;  1E5W A;  4IBI A;  1I4W A;  1KYO I;  1OKS A;  1SQV K;  5C39 A;  3GLI E;  1JCC A;  2A06 D;  3L73 D;  2A45 H;  3CCS P;  3M91 A;  2R46 A;  2MJ5 B;  3NFQ A;  1M1J A;  1KQF B;  3Q1M A;  3R4Y A;  1P3Q Q;  1ZP0 C;  2KZS A;  2M5A A;  3L72 D;  3U6D A;  1QUS A;  3CC7 P;  3L73 G;  2A06 G;  3B5N B;  3AEE C;  3RBZ A;  1WGL A;  4JYC A;  2CV0 A;  4LJ4 A;  1RY3 A;  5KAI H;  4JYA M;  1PGY A;  1NHG C;  3NMD A;  5FTL A;  5AVZ B;  3D6Y A;  3L72 G;  1N7S B;  1VQ1 A;  1QDT A;  3W68 A;  2O3J A;  3KSX A;  3CCL P;  3K5B A;  3VOP A;  1BE3 E;  3FUU A;  3RGS A;  2K0B X;  2XND H;  1AIP C;  3U6E A;  1IFI A;  3HU1 A;  1MFZ A;  4LFB M;  5DYG A;  3N4X A;  3JSV C;  3U6C A;  5H2F H;  2QEX P;  2B87 A;  5FTM A;  3A2A A;  4QNM A;  1JR3 E;  3BAS A;  1NTZ E;  3CXH I;  1SQB D;  1S4X A;  3AE1 C;  3GLH A;  1PGQ A;  4L73 A;  5AVQ B;  3Q5P A;  1XWI A;  1SQP D;  4NPF X;  1WIV A;  1VF5 B;  3V2R A;  2DAK A;  3AE2 C;  2YFQ A;  5K5G B;  3GO8 A;  3A5T A;  1AJY A;  3SWK A;  3CF6 E;  3I5C A;  2FBW C;  2AEJ A;  2ZXE B;  4HH2 A;  3SAV A;  5KO3 A;  3MHV A;  3HJQ A;  2OQQ A;  2UXC M;  3VKH A;  3KQG A;  1SQB G;  2L7H A;  3FTE A;  2FYU D;  3TK1 A;  1SXJ D;  3J80 S;  3A0H E;  5FTJ A;  1SQP G;  2YO3 A;  2LVQ D;  1TU3 F;  3P8C E;  2EKF A;  5AW0 B;  1JOC A;  1IFJ A;  4LJ6 A;  1GD2 E;  2KK7 A;  3V5B A;  2QVA A;  2P10 A;  4RES B;  4JPZ B;  4Z1M H;  2IPP A;  1LTM A;  4M0D A;  4N3Y B;  2O01 H;  5BPV A;  4RO0 A;  1G8P A;  4RF0 A;  2WSE H;  3TSI A;  5APS A;  2Z4E A;  1ZAE A;  2CK3 H;  4MN4 C;  3H1I E;  2BJW A;  2JEE A;  2XV5 A;  2PP6 A;  3H1H E;  3OW2 O;  4W5W A;  2FH0 A;  3F89 A;  2FKW B;  3QAU A;  4W80 A;  2NZ2 A;  3CLQ A;  3AL0 C;  4NC6 A;  1DO2 A;  3U60 A;  3HE4 B;  3ZDM A;  2Q7C A;  4C7N A;  1XNQ M;  3KFU G;  3MD0 A;  4DOJ A;  1JY3 N;  2Q6Q A;  4JI7 M;  2BAS A;  3CCQ P;  4H13 C;  2VQE M;  2RRU A;  1GDT A;  5E79 H;  1LTB C;  3H6P A;  4M0W A;  5CCG C;  1MX0 A;  1J1D B;  3VP8 A;  3FTD A;  3LVV A;  3JR5 A;  3U60 B;  4DR7 M;  1QAO A;  1Q7Y Q;  1ZV8 A;  1IXS A;  4DR4 M;  1QGK B;  2LVN C;  2Q2E B;  4OU7 A;  1IBL M;  3UMM A;  1L0L E;  2CPS A;  4OVZ B;  3V4W A;  1LTJ C;  3KPE A;  1W2E A;  3OAK A;  2OGU A;  5AVU B;  2BCC D;  1IXS B;  2XEP A;  4GDO A;  2FFD B;  1ZME C;  1USE A;  2KNV A;  2E76 D;  5FLX S;  2JY8 A;  1SQQ G;  2J59 M;  1IK7 A;  2L4E A;  4BRY B;  1WMK A;  3HHY A;  3BRT B;  1Q3C A;  5C18 A;  2JY6 B;  4D6T J;  2KXP B;  4RKU F;  4Z6Y A;  2OQ4 A;  2OOA A;  4FVM A;  3SC3 A;  1DEE G;  4NSO B;  1S9K D;  2P2U A;  4PD4 E;  1GTW A;  3FRI A;  1U7M A;  4ZPX A;  3MIW A;  3V2Q A;  3FYD A;  1GK4 A;  2O1K A;  1RE3 C;  5DFL A;  2E75 D;  1G71 A;  4UN2 B;  2QJP C;  2CP8 A;  1SQQ K;  3L74 E;  3B5N C;  5H2F E;  5C1B A;  3O6Q A;  1KQG B;  2QJK B;  3KZI E;  4H44 D;  3C3D A;  5KLV G;  3NTN A;  1SP4 A;  1SXJ A;  3BCC D;  3BVH A;  3FYC A;  2J5Y A;  1EZV I;  1USD A;  5B5E E;  4JN6 A;  2QP9 X;  4BWN A;  4K0K M;  4FCV A;  3Q8X A;  1GK6 A;  2N9B A;  3CL3 D;  3HJS A;  4G4Q A;  1ZW0 A;  1BE3 J;  3VMY A;  2QA4 P;  1KB9 D;  4IJF A;  2PFX A;  1NY5 A;  1SXJ B;  4PD4 I;  1OW6 A;  4REZ A;  3KVW A;  2FS1 A;  2Y0T A;  4F2L A;  2YKQ A;  1NVM A;  3A46 A;  3HD7 D;  3I4Y A;  4Y99 C;  1IN7 A;  2Z5H A;  4B7G A;  4XK8 F;  1HUC A;  1FJG M;  1KFM A;  3T1H M;  1NJG A;  3MP7 B;  4GEW A;  4JI2 M;  1PFI A;  1VEJ A;  2D2C D;  3M9B A;  1L2P A;  1YYC A;  2B3T A;  2HHH M;  2WPQ A;  3H1J D;  2D7G A;  1EFU B;  4W7Z A;  4ITQ A;  2KYV A;  3GHG A;  3G4S P;  1QLE D;  1NJF A;  3U1C A;  4I81 A;  3CX5 E;  3P32 A;  2R5B A;  4FWD A;  3Q3D A;  2Y9Z A;  4LLH A;  3PRJ A;  3VDU A;  2YIU B;  1OVV A;  2IBZ D;  5EP1 A;  2R3C A;  4QNR A;  3ITK A;  1CW5 A;  4G3O A;  1MKM A;  5EP2 A;  3H1L D;  3H1I J;  3GHG B;  3C3E A;  1N78 A;  1RE4 A;  2O01 F;  1P84 D;  4KLN A;  1GW3 A;  1L1T A;  1JTH A;  2CWB A;  2AHM A;  4DUY M;  2IBZ G;  2WSE F;  4LCB A;  3L73 E;  2A06 E;  3U6Q A;  3AFH A;  3MUD C;  2HWJ A;  3L37 A;  3H1L G;  4QHT A;  4OGQ C;  3U61 B;  1KIL A;  1S2E A;  2QJY B;  2E74 C;  3D6Z A;  3KXD A;  3PHL A;  3L72 E;  3DOA A;  3IR9 A;  1JTH B;  2ZAM A;  1N86 A;  3KW6 A;  5APW A;  2F5O A;  1KYI A;  4XA4 A;  2E76 B;  2Y20 A;  4EI2 A;  4P16 A;  3N7N A;  4KO8 A;  4QHS A;  4AKG A;  3A42 A;  1TH2 A;  1ZRT D;  3L70 J;  4YPC A;  1BDD A;  2W6A A;  1SFC A;  4L78 A;  3DZD A;  3TGU D;  3LCV B;  4AZF A;  2AXT H;  3KSJ A;  1FJK A;  1VDL A;  3K2L A;  2C9N Y;  2E75 B;  3CTW B;  1SQB E;  1NTM D;  3B4S A;  3SSU A;  4WB4 A;  1SQP E;  2Y0Q A;  5AW6 B;  5CBO A;  4Z8X A;  4H44 B;  2LBC A;  2R65 A;  3TGU G;  2Y9Y A;  1NO4 A;  4CPG A;  4EYY Q;  2BEQ D;  1NTM G;  2FYU E;  3V2P A;  1QVG O;  8CAT A;  2OOB A;  1SXJ E;  4R4M A;  5APY A;  2YR0 A;  3KDS E;  3AE7 C;  2RKO A;  4MGH A;  4HYT B;  1FZF A;  3IFM A;  1M1K Q;  2DZO B;  3CCE P;  1NTZ K;  3L74 J;  1M56 D;  1KFV A;  1E9S A;  4IFF A;  5FTK A;  2D7E A;  1AUA A;  3L71 G;  2CHG A;  2WZJ A;  1EIJ A;  4AYC A;  1R4G A;  4WY4 D;  3UIA A;  2ZTC A;  1OMI A;  2B89 A;  1FJP A;  5AW3 B;  1WHC A;  2GUS A;  1I94 M;  3HD7 B;  3H1H G;  2IYP A;  4I6M C;  1J2J B;  1NSF A;  1EDL A;  2VQF M;  4M8Z A;  1XMQ M;  2ZJS E;  2WSF H;  4KT0 J;  1PP9 J;  1HQC A;  3THG A;  3GLI A;  3G9R A;  3E21 A;  3B74 A;  1ZMW A;  2X49 A;  4L75 A;  3CMA P;  2EUC A;  1NU1 J;  1DV0 A;  3VLF B;  4KJM A;  3GPY A;  1F4I A;  1VL2 A;  1YIJ P;  4BBA A;  1KMI Z;  1L2D A;  2HG5 D;  4UB8 H;  3A7O A;  4JXJ A;  3A45 A;  1MV8 A;  3E1R A;  5AVV B;  4GOD A;  4B7F A;  2P58 A;  1G2C A;  2JKV A;  5APQ A;  2GNO A;  4LRS A;  3JCU E;  3CCU P;  1IXR C;  1XHB A;  4LJA A;  1D7M A;  1OX3 A;  1XMO M;  4JI3 M;  1QVF O;  1L0L G;  3TQS A;  2A45 G;  4CHT B;  2WPR A;  2OTK E;  4I7Z C;  5TIS H;  2UUC M;  4DUZ M;  4U3F G;  1YHQ P;  1S72 P;  3RL0 g;  2QBY A;  1RF0 A;  3CXH H;  1D0M A;  1L0N D;  3U6S A;  3HU3 A;  3FUV A;  3AV0 A;  2XSZ D;  4IBE A;  5AW2 B;  3WUT A;  1JR3 A;  1LWU C;  3K1J A;  2QZ4 A;  5IZ7 D;  2V1U A;  1L0N G;  4BXL A;  3AE3 C;  2MKV A;  1DGH B;  3KXE C;  1FDI A;  1SQX D;  2JP7 A;  1QZE A;  4X62 M;  1AVY A;  4OX9 M;  4HL4 A;  1L0L K;  2CUZ A;  1JY3 P;  5CCH A;  5AVX B;  3CF0 A;  5KLV E;  2E5T A;  2L2D A;  4CJ6 A;  4OW0 A;  5AVS B;  1QDR A;  5JI3 E;  2L6O A;  3B9P A;  1KTM A;  1TR8 A;  1V92 A;  3FWN A;  1KQL A;  2E5Y A;  3QWO C;  2JZ0 A;  4TT3 H;  1N36 M;  1FZC B;  5CCG A;  3HTK A;  1FE6 A;  4IFD K;  1NYH A;  2DEN A;  2JZ1 A;  1JEK A;  2N1T C;  4K3A A;  3BBZ A;  3BCC E;  5E26 A;  1GLN A;  1HR0 M;  2XLJ A;  4R3D A;  5BU5 A;  1W5S A;  2V6Z M;  4R71 A;  1IN6 A;  2F5Q A;  3CF2 A;  4TLF A;  3SMS A;  1HGV A;  3W0F A;  1BDC A;  1KB9 E;  1DX7 A;  5EQT A;  2JXN A;  1LTJ A;  1ZV1 A;  1ZOY C;  3GQ5 A;  2OAR A;  4ASW A;  3QH9 A;  1Q81 Q;  2OYI B;  2DVW B;  1KC8 Q;  1YLA A;  1LT9 B;  1NAF A;  3CC2 P;  1LJ2 A;  1N75 A;  2C98 A;  3TYY A;  1X37 A;  2AEM A;  3BXW A;  4L6V 6;  2I7P A;  4OGQ D;  1SQV D;  3UGJ A;  2IYO A;  2E74 D;  2ZVO B;  2NQ8 C;  4H44 C;  4WY4 B;  3B8E B;  4IBC A;  3D8L A;  4Y28 F;  1NTK D;  2DHR A;  1PGP A;  2QE7 H;  1HTL C;  4ZNC A;  2Z7J A;  1URQ D;  1E9R A;  2Y0C A;  5IWA M;  3H1K G;  3L26 A;  3TWL A;  4BLC A;  2KA6 B;  2JUJ A;  4DR3 M;  4B08 A;  4GIP A;  4IIW A;  4I2L C;  1NH4 A;  4PCZ A;  3VMA A;  1NTK G;  2X8A A;  1IC2 A;  1JY2 O;  4L4U A;  4GMQ A;  1IFP A;  3B5N A;  4AUW A;  2WVR A;  3H32 A;  3GQ4 A;  1S3J A;  2IBZ E;  3I01 M;  1K9M Q;  3K8Z A;  1QAM A;  1S5L E;  2JJL A;  2UXB M;  2RGO A;  4DR1 M;  2VII A;  3H1L E;  3HD7 C;  2R45 A;  4OWF A;  1N7L A;  1E94 E;  2BNK A;  3I04 M;  2JDI H;  4GT1 A;  5ITU A;  2QJP B;  1N7S A;  3E4R A;  2QM8 A;  3G3Z A;  1DGB A;  1P84 E;  3S9O A;  1OAO C;  3GF7 A;  3H32 B;  3M0A A;  4PV1 C;  2YNM D;  3Q8G A;  4IBK A;  2D2C C;  5TIS E;  4B3M M;  1VDD A;  2WSF F;  3HZJ A;  2G8Y A;  5H37 D;  4Q7J A;  3HUS C;  2KSE A;  1XNR M;  1J09 A;  2R4E A;  3GRV A;  1VQO P;  3M7G A;  1XB2 B;  2KSJ A;  1QUT A;  2F5P A;  2W6B A;  2K1A A;  1SQQ J;  3FX0 A;  1R6B X;  3L29 A;  3HHX A;  1ZRT E;  4GRI A;  5LMU M;  2I7N A;  4WVZ A;  4Y99 B;  2Z4S A;  2UUB M;  1P84 I;  4IL6 H;  2XDJ A;  1OIP A;  1YQ3 C;  2P67 A;  3FUX A;  1IFN A;  4GOE A;  1LT1 A;  3FUW A;  3TGU E;  4LJ9 A;  1LP1 B;  3QYE A;  3FXE A;  1ZN5 A;  1DH3 A;  3D70 A;  3LW5 J;  4JV5 M;  2JR8 A;  5EFW B;  2KNZ A;  1NTM E;  2LKM A;  3K9P A;  4D81 A;  1OTR A;  3A0B E;  4GIT A;  3HE5 B;  5F3W A;  4UB6 E;  5ITY A;  1Q2N A;  2O25 A;  1RQU A;  3V76 A;  1NAY A;  3P7K A;  2FYU G;  3L71 E;  3HE4 A;  4DV0 M;  1A5T A;  3USS A;  3WUU A;  5KLV J;  2Q5U A;  3MUD A;  1UIX A;  2APL A;  2XF3 A;  4YXW H;  1QAQ A;  4LGY A;  3UJN A;  3CWB J;  1SQB K;  4DV4 M;  2M3B A;  2LXB A;  1FZC C;  3GG2 A;  1SQP K;  3T1Y M;  3SMP A;  3ABV C;  2M5Z A;  3BRV B;  1TH4 A;  5AW5 B;  1E32 A;  2R32 A;  5B66 E;  3TNU A;  1BGY J;  4OGQ B;  3R8F A;  1OFH A;  2Z3X A;  2YNY A;  4PJ0 H;  4LGD E;  2E74 B;  2FYU K;  2WSC F;  3L2A A;  1BCC J;  2GM4 A;  2ZBK B;  2KOG A;  2ZAO A;  2K3R A;  4OVZ A;  1N2D C;  5GTH E;  2L91 A;  2FXP A;  4J7Q A;  3L75 J;  2F5S A;  2ZVN B;  1URQ B;  2O5R A;  1Y8G A;  1R7R A;  1V34 A;  1GVN A;  2OYI C;  2E2X A;  1LT9 C;  2LWX A;  1AVO A;  2FFD A;  1VQM P;  3TNU B;  1EXI A;  4BRY A;  4JI5 M;  2H7H A;  2WTY A;  1G3I A;  2YMK A;  5BR8 M;  2W90 A;  3VK7 A;  2Z8Y M;  4X65 M;  2DKL A;  4B3S M;  1JMB A;  1DO0 A;  4U3F E;  4WY4 C;  5CJ4 A;  1G4A E;  3GW6 A;  2ZYD A;  3U6O A;  3IEC A;  5BU8 B;  3B7Z A;  3T97 B;  1GU5 A;  1OZH A;  3VMX A;  1WXQ A;  2J7N A;  3MK6 A;  2BEZ F;  4EIW A;  2QRX A;  4RF1 A;  4DR5 M;  1QQW A;  1LV7 A;  3E46 A;  3HU2 A;  3PVS A;  2N1T D;  4AQY M;  2Q9I A;  2HFE D;  3PXG A;  1VEK A;  5DJU B;  3CCR P;  1T2K C;  5KAI E;  5CMZ A;  3GP1 A;  1L0N E;  1PGJ A;  1C1K A;  2BCC G;  1VQK P;  4PD2 A;  1FZB A;  4C7R A;  1NV9 A;  3K9O A;  2Q3I A;  2YKP A;  3PFI A;  2JWA A;  5KJ7 C;  1GL2 D;  2LVO C;  2R5D A;  2QPA A;  1S1C X;  4FW9 A;  1QEX A;  2IX7 C;  1YJ9 P;  1NNU C;  1SQX E;  3PH0 A;  1OJL A;  1C7Y A;  2A45 I;  3MGN A;  2Q1K A;  3SWY A;  1K04 A;  3B89 A;  1OW7 A;  1JNM A;  3HJ8 A;  2M3E A;  2LNH C;  2J58 A;  3V6I A;  1YBK A;  4G6Z A;  1SG9 A;  1E79 H;  2XGN A;  1G41 A;  4AG5 A;  4LZZ A;  1WT6 A;  1A02 J;  2MR9 A;  4FWH A;  4AQR D;  2ZAE B;  1CZQ A;  2GA1 A;  1VQ9 P;  3F5H A;  3RE8 A;  1G1I A;  2QG4 A;  3M6A A;  1M1J C;  4JF7 A;  3BCC G;  3NBX X;  3I55 P;  5DNY A;  1GMJ A;  1VQN P;  1HGZ A;  4MH0 E;  3PNV A;  1OWA A;  3KS4 A;  3SFZ A;  1NTZ J;  1GL7 A;  2DW3 A;  3W67 A;  5JI2 E;  2K9J B;  1HBW A;  2JNH A;  4MM3 B;  1ZR2 A;  4YHH M;  5KLV K;  2FNA A;  2WMM A;  1JY2 N;  2FYN C;  1KYO D;  1NKZ B;  1OVR A;  1J1E C;  1VG5 A;  2XNX A;  1TF0 B;  2FYZ A;  1FNN A;  3AED C;  2DZN B;  4PV1 D;  4JYB A;  5IRE B;  3R2P A;  3SAT A;  3U59 A;  3KS8 A;  1IM2 A;  3H4J A;  3H1K E;  3P8M C;  1ZLL A;  5AW7 B;  3AEA C;  3O8Z A;  4DV3 M;  3CCV P;  3C9I A;  3A3Y B;  4I7Z B;  3B71 A;  3TDK A;  1K3W A;  2JWS A;  1PV3 A;  3SFE C;  3VTP C;  1K8A Q;  3W0L B;  2E5L M;  1GL6 A;  1NTK E;  4TUW A;  4O9B A;  3J7B A;  1Y47 A;  3L71 J;  4GKK M;  2WPS A;  2AEF A;  1YJN P;  4MGZ E;  1H89 A;  1LTT C;  2LVP C;  3VP9 A;  5E79 E;  4J7P A;  3H1J G;  5KTB A;  1LWU B;  4DZO A;  2XKM A;  3M9Q A;  4OMK A;  4DV6 M;  2N9Y B;  3L27 A;  3U61 A;  4DR6 M;  1SLQ A;  2ITA A;  2KNA A;  3T6P A;  3F92 A;  1GAB A;  3H1H J;  1UM8 A;  4MB7 A;  2X4A A;  4NPE A;  4LY6 A;  1FZA A;  3DA1 A;  4D6T D;  4NL4 H;  3LMM A;  4RJT A;  4LGM A;  3WUV A;  1N73 B;  2F5N A;  1VQ5 P;  3AKZ A;  3UZU A;  1BSH A;  3OA7 A;  2N35 A;  1HJP A;  2YO2 A;  1HJ0 A;  2R18 A;  1H0T A;  4WW0 A;  3CXH D;  1VQ8 P;  1CI6 B;  4D6T G;  4PT5 A;  1IZN B;  4RKU J;  5KLI C;  3WU2 H;  3CX5 I;  4XBO A;  4P17 A;  1T3J A;  1URQ C;  1PPJ D;  2FE8 A;  4NXM M;  3LVW A;  3FGA D;  2HPC A;  3IF4 A;  2HCB A;  2N1T B;  1H0T B;  1ZR4 A;  4LFC M;  3EWK A;  4L15 A;  4W7Y A;  3VK8 A;  2FFJ A;  1L0L J;  3ILK A;  4NRV A;  3AEG C;  1H88 A;  2D7H A;  1W5C E;  4B3R M;  3MZW B;  3PNY A;  4U3F J;  1PPJ G;  4G4N A;  3LW5 H;  1IY2 A;  2LVA A;  1Z5A A;  1BE3 D;  3C9P A;  4LF6 M;  2HPC B;  4GKG A;  1PJJ A;  2DAM A;  1GL2 B;  5KKZ C;  3GLF B;  2IFM A;  1EQ7 A;  1J7K A;  2MH8 A;  3L4F A;  5KAF H;  5KPT A;  4YXD C;  1T8Z A;  1LGH B;  5L8R F;  5DJT B;  3LIE A;  2KXE A;  1Q3B A;  3NXS A;  3B7Q A;  5FSW A;  1OXZ A;  1K82 A;  3RGP A;  5APV A;  1Z59 A;  1QAN A;  3EQ2 A;  3HD7 A;  4BB9 A;  3VN0 A;  1RF1 B;  5CJ0 A;  1SVF A;  1X9V A;  4QOS A;  1S3S A;  1CSB A;  2DAE A;  1M7L A;  4AKH A;  2KHH A;  3KOY E;  1L4A D;  1PJI A;  1KYO H;  2IZ0 A;  4L76 A;  1NO1 A;  2G8L A;  1OIZ A;  3UK6 A;  5IT9 S;  2YKO A;  3KOX E;  1HF9 A;  3I56 P;  3IAO A;  3KYQ A;  3H1I D;  1LTA C;  1NTM K;  2MRO B;  1JM0 A;  1T2K D;  2M8R A;  4PDI A;  2M60 A;  2CRU A;  2KNC A;  2WWW A;  4C46 A;  4PV1 B;  3B7N A;  2WQY C;  2IDB A;  1JUN A;  4NSR A;  2D2C B;  3AEC C;  2VDB B;  1V33 A;  3CI9 A;  3CC4 P;  3MMP A;  5KPZ A;  3VFD A;  1QX8 A;  1KFN A;  1JB0 F;  5KJ7 D;  1ZMU A;  2O01 J;  1N77 A;  1YIT P;  2KEB A;  1NWQ A;  1DIP A;  1XTC C;  2P5T A;  1VDF A;  2O01 N;  2WSE J;  1IXZ A;  3J81 S;  3HUS B;  2KNC B;  1YQ4 C;  4DV2 M;  4L74 A;  2UXD M;  2I8D A;  1FU1 A;  5M1B A;  1GKI A;  3LQR A;  2JY7 A;  2QSI A;  1YE9 A;  4LFA M;  4I4L A;  1MJG M;  3GLG B;  3SAW A;  3H1K J;  5ITR A;  1QL1 A;  4AI6 A;  4DBG B;  2Y0D A;  1AQT A;  1PRB A;  1X8Y A;  3L70 D;  1DGH A;  4ZKP A;  1T3T A;  3AEB C;  2H43 A;  2C5R A;  3L28 A;  1XXH B;  2QSF X;  2BCC E;  2J7O A;  1IY0 A;  3PEG A;  3WU2 E;  5CBN A;  2OPF A;  4XE5 B;  1EZV D;  1DEB A;  1OQY A;  2KRK A;  3U6L A;  1O6U A;  3L70 G;  3VMZ A;  1HWT C;  3JAM S;  1EDK A;  4N78 D;  3H4M A;  1L1Z A;  4U7J A;  4UYB A;  3L73 J;  1S9K E;  1FZC A;  1R2Z A;  4WUR A;  4LZJ A;  1OVU A;  1N73 C;  4HEO A;  4LF4 M;  3CCJ P;  2DWN A;  2OYH B;  4ASV A;  3GLF E;  1RHZ B;  3U5Z B; 
#chains in the Genus database with same CATH homology
 1OLM A;  3PEG A;  4CIZ A;  3B7N A;  2E2X A;  1AUA A;  3B74 A;  1O6U A;  4J7P A;  2D4Q A;  3W68 A;  1OIP A;  4OMK A;  3HY5 A;  3HX3 A;  3B7Q A;  1OIZ A;  4FMM A;  1R5L A;  4OMJ A;  4UYB A;  4TLG A;  3PG7 A;  3P7Z A;  3W67 A;  4M8Z A;  3Q8G A;  1OLM E;  3B7Z A;  4J7Q A;  4CJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...