2XSZD

The dodecameric human ruvbl1:ruvbl2 complex with truncated domains ii
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
331
structure length
310
Chain Sequence
GAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIHTVSLHEIDVINSREIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUVB-LIKE 1
publication title Structural and Functional Insights Into a Dodecameric Molecular Machine - the Ruvbl1/Ruvbl2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 310
sequence length 331
chains with identical sequence E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06068 TIP49 TIP49 P-loop domain
D PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xszD02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xszD01
2P65A 3P26A 4HAWA 2IUTA 2FX3A 1UKZA 5TV2A 5KU1A 2IYZA 4TT3D 2FE4A 3ICQB 3VQTA 4KXFB 2C9CA 3FFAA 2ERYA 1XRJA 2ORIA 3GLHE 4B73A 3SFVA 1CULC 1V43A 2GBLA 3KKNA 2NG1A 5P21A 3VR6A 2O8FB 1FP7A 2ZRKA 3K9LA 2GXQA 2QGZA 3OE7D 2ZRFA 4B2IA 6Q21A 3RS0A 3ZIAA 3X1DA 4KFSA 1KI6A 1MABB 4F92B 3NBZC 3ZQ6A 2CBZA 1XPUA 3P32A 4Q9KA 3LAWA 4F93B 1T4GA 3LQRA 3CRVA 1UEIA 4DLVA 3ADKA 2DFKB 2ECKA 4NHOA 5HZKA 1SXJE 2FDCA 1NRJB 4A15A 3K0SA 1P72A 5JEEA 2JLRA 2R6AA 2GCPA 1E2MA 4S2EA 1G19A 1OXXK 4JLKA 3D6TB 4D4MA 1N0VC 4OHVA 1YZQA 1M74A 3NDBB 1GRQA 5BWMA 1KO4A 3M4YA 4BFSA 1OH5A 1X6VA 3HU3A 3A1TA 5HR5A 1OT3A 3K09C 1EWQA 3BORA 3T1OA 3CRRA 5HCIA 4Q4AB 4QJ4A 2P6UA 4JBXA 2WJVA 4LDJA 4XD7A 1OXVA 1W36D 5TDHA 2ZRNA 3C8UA 3C16C 2QQEA 4PSKA 5J4LA 3A1SA 3AVVA 4OL0A 3OIYA 1RE0A 1K5GA 3BH7A 2OSBA 2EU8A 2VQSA 2ZU6A 1XEXB 3IIMA 2QE7A 3GLIB 4OI2A 3M6AA 2BMDA 3MG9A 3K9HA 4CEJA 4OKSA 4FWHA 1P60A 2AXNA 4M4SA 3AVWA 3EASA 4E09A 2ZRGA 1YHNA 1KNXA 3IHLA 1R7RA 1W4AA 1QHSA 2HJGA 2QP4A 1Q1BA 2F3TA 5KSPA 1T91A 2IEYA 3JVUA 3GLFE 5L3QA 3RWOA 4NCHA 3GP8A 4Q01A 1G4AE 4JYCA 4KCGA 4HAZA 1DPFA 1RVDA 3L0PA 5A0FA 4NYIR 5CYPA 4D80A 3LXXA 3WRXC 1YR9A 2JJ2A 1QVRA 3T5DA 4D2IA 4B75A 3MWLA 2IYYA 4N3NA 1DAEA 121PA 1R0ZA 3AP2A 1RRPA 1W47A 2C78A 5TXGA 4ARZB 3MAAC 3K0EA 3I1FA 2IYVA 3PITA 4QBFA 4QNRA 3EPKA 3CRMA 3IEUA 3GJ5A 3TNFA 3B6EA 2VH5R 4IDPA 3K0FA 3NIBA 4V0LA 4MRVA 2QBYB 5K8IA 4A1FA 3EA0A 4V0OA 2XXAB 4MKHA 4DLRA 3HR7A 5K8TA 1GTVA 1FMLA 3GJ6A 3IO5A 1Z83A 4URVR 2WWYA 4Q7LA 2NQ2C 2REOA 4TWZA 4BRWA 1E2FA 3CKLA 4G1UC 4DEYA 3MMPA 4HZUA 3I61A 3CUEF 1ZIOA 1Z0IA 2A5YB 4HDQB 2WBLC 1ZNXA 2QAGC 1P2UA 4B3DA 3AF1A 4DDTA 5FOSA 4P33A 2BCGY 1YZLA 4DLZA 3OIVA 1NI3A 2ANCA 4LY6A 3TGPA 1NG9A 3TSWA 2VP9A 3U2QA 2ZTSA 3SNHA 3GLHA 3SYNA 3VR1A 4ZIRB 5JI3E 4GZLA 2CNWD 2ZI9A 3N2EA 3CF2A 3VLFB 1EWRA 3P1JA 3ASZA 2ZREA 4HDOB 3SBEA 4YQFA 2GA8A 2ZJYA 4KBGA 2XNDA 1WA5A 1OFTA 5DLQC 2CEAA 1KJWA 1U8ZA 2R44A 2WIAA 3TE6A 1E2DA 3CX8A 2ZS7A 3AEZA 3KTAB 1NNEA 1NIPA 4IOKA 3GJXC 3C7KA 3IILA 5EZ5A 1OH6A 1SXJA 1CR2A 2VF8A 2YNMA 3PEVA 5DHFA 3VHLB 1JBKA 3PXGA 2IYLD 3QF4B 3U61B 3HR8A 3PIRA 4C0JA 1ZC3A 2OCAA 1HURA 4DXAA 1R6BX 1HE1C 4KV9A 4TTRA 3PEYA 3QG5A 2GCOB 4B33A 1CJTC 2WAYA 3ZS9A 4EPYA 3KKOA 4LYAA 2W2XA 4O0MA 3U3KA 2A5GA 2RGEA 3QPVA 4M9ZA 2H17A 4LYJA 2RCNA 4FWTA 2BEKA 4X8MA 1L2TA 2XNSA 4NCKA 2KWIA 2IT1A 3BH6A 1UBCA 3KKMA 3WYFA 3AKCA 1J7KA 421PA 1Z2AA 2GETA 1X1RA 2OFOA 2OEPA 4F4IA 3LXRA 3PUXA 3U5ZB 1NY5A 2ZEJA 1P62B 1W36B 2VBCA 1XZQA 4V0KA 1N2CE 2X19A 4EIWA 1YR6A 4UXIA 2FFAA 4DCSA 1XTIA 2BDTA 4HZIA 2IX3A 3GLFA 3I8SA 5AK0A 4U02A 4OI4A 3EAQA 5B57C 5DN6A 2V4ZA 1M7GA 2XOKD 2ZSFA 3TAUA 3ND9A 4LZZA 2QTFA 2JDID 3B78A 3SU8A 3BS4A 1U81A 1SHZA 4PSAA 3WRYC 4A82A 3SDZA 5EQTA 5AR1A 2FNAA 2IYSA 4W7SA 4GPTA 2DWZB 2YWFA 1Z0JA 3CR7A 3X1XA 4JLAA 2IS6A 4A2WA 2WKPA 2V7QA 4XVRA 1AS0A 1N6NA 1FTNA 3A58B 1EXMA 4NBSA 3PUWA 3Q85A 3G0HA 3OEEA 2ERXA 3BRWD 2ODWA 3QKRA 2IK8A 4URZR 1L8QA 2GJKA 4X8LA 5AJXA 2QGNA 1VYVA 4XVQA 1WP9A 2V3CC 2O8BB 2FFQA 2J0QA 1UJ2A 2HYDA 2E9SA 4G5RA 2HCBA 4LC1A 3OAAA 4XSHA 3T12A 2ZJ8A 5KNCA 4JN6A 4YLGA 5L3VA 1ZAKA 2AFIE 1LY1A 3TR5A 1ZRHA 4G3XA 4JLOA 1NLFA 4LI0A 2WMNB 4WA7A 3LW7A 4Q1EA 4L4UA 5DIFA 1EG7A 4M1TA 4YXWA 4Q9JA 5EE1A 1KSGA 2G1KA 2ZI7A 3G5UA 4WVFA 1GM5A 2GNOA 1GP2A 3CZPA 3CX7A 4F4CA 4M53A 1U8YA 3LNCA 5LBIA 3O8CA 2GZDA 2OCPA 4DUGD 2WOJA 4TYPA 3THXA 3VNUA 3KQNA 2F43B 2FH5B 1KAGA 3KFXA 5JRJA 4A8JA 5JMTA 2O0HA 5FFMA 5D3MA 2FOLA 1Z0DA 2G9NA 1IY0A 4CVNA 1TQ6A 2ZJOA 2ORWA 2DZNB 1S8FA 3M1IA 3EIQA 2NPIA 1TEVA 2VHCA 1FW6A 3VX4A 1FX0A 2AHOA 2OBNA 2OLKA 4TQ9A 2Y8EA 1KI9A 2D4HA 2I1VB 2C8VA 3GPLA 5C18A 3CLVA 4LBYA 4EFNA 1QVAA 1CJKC 1E1QA 3WNDA 2BCJQ 5C4GB 4DCUA 4IOLA 1IXRC 5EXPA 1KMQA 1UKYA 1Z8FA 4CGZA 1U2RA 4N1AA 5G40A 1UM8A 1GVNB 3ZIAD 2XEXA 2QI9C 2WAXA 5H8WA 1D2NA 5BQ5A 1RIFA 2MMCA 3FKSD 1VCMA 3R9WA 2GEVA 4LBZA 2FEMA 3AVOA 3LRPA 2WSMA 4DSUA 3A4MA 2GAOA 1R8SA 2W58A 4EUNA 3SFZA 1JI0A 3HP1A 2Z83A 4DCNA 4RY2A 4BLOA 2A78A 3IKJA 5JWHA 1OYWA 3CNLA 4C0KA 5DYIA 2FFHA 2XZOA 2IS1A 2LKDA 2KBEA 1H65A 2ZJBA 3LH5A 2IUSA 4KYUA 4FMDB 1GKUB 2PLRA 1M34E 4HLCA 3B1VA 4CF7A 2ZJ2A 3E5HA 1BYIA 3B9PA 5EP2A 2A3RA 4TYWA 1DAHA 1E9DA 4I81A 1S3GA 4V02A 4QBIA 1HH4A 2KE5A 1VCNA 3Q5DA 4ZCLA 3ZZ0A 1S9DA 4XD7D 5F2EA 4OHWA 4BWYA 221PA 2MSCB 2ZETA 1JJVA 2WJHA 3TVDA 3A4LA 1W7AA 2O8DB 4TSFD 4DB4A 4YMSA 3PG5A 4I99A 1QF9A 1WBBA 1E2QA 1EESA 1CIPA 1XJQA 1Q12A 1C9KA 5CK4A 2J0UB 4TMKA 5FI0B 2A2ZA 4Q00A 4YMTA 1KK3A 2V6JA 1G16A 4PHGA 1OFUX 5FR1A 2OFXA 5KSOA 1CJMA 1P9RA 4F4JA 1KAOA 1RPZA 4B35A 4D4LA 2IWHA 1WDTA 2HT6A 2MSEB 2F55A 1GOTA 1RJ9B 3FHOA 1GNRA 4B48A 4HAXA 3R7WB 2ZVQX 1OJLA 3FHCB 4YDSA 3WP1B 2J0SA 1W4BA 2EFCB 2EYUA 1J8MF 1GITA 1MKYA 1N0UA 1UF9A 2LWIA 4C0SA 4AK9A 5KO2A 3CO5A 1QHGA 3QY0A 3WNCA 1N5LA 3TLXA 4CEIB 4EKDA 2D2FA 3BE4A 1P73A 2GJ9A 5E7JA 2OUKA 2W6IA 4RZ3A 1XB2A 1S96A 1XD8A 5JWOA 5AJYA 3L0IB 1XFAA 1PVOA 5GJBA 4WZBE 2QSZA 4XTCS 1OH8A 1Z6GA 1XXHA 2ZE5A 1BS1A 3WY9A 3ZVMA 3FB4A 4LBWA 1PZNA 3NKVA 4R2HA 4A0HA 5EJEA 4Q19A 2AFHE 1SVIA 4QM6A 3E2IA 3KXIA 3GJ0A 4PR0A 4XTRA 1OLOA 4MYTA 4PHHA 2J7PA 2ZI3A 4BQSA 5TMPA 2VHUA 2ZRBA 1I2MA 5G53C 1NBMD 3BB3A 5JRZA 4NYMQ 1TADA 3FMFA 1Q1EA 1E0JA 4TL6A 2CHVA 4HAVA 1CR4A 3K70D 2GEDA 5DYGA 1U98A 4URXR 1X8LA 1JECA 1NKSA 3TIFA 5H70A 3SJBA 5K8UA 1AM4D 1G5RA 3VU9A 1VMAA 2ZRJA 3BGWA 3NXSA 4QG7A 4DSTA 4PX9A 1BH2A 4BEBA 1NY6A 1J90A 4RCYA 4Q9IA 2DCUA 5EUMA 2BBTA 4FW9A 1XDBA 2XNDD 1W4RA 3E70C 4KSCA 3BFVA 3UXMA 5KTYA 4A6PA 1KDPA 3RVBA 4DB2A 4Q4HA 1QHXA 1QRAA 1SGWA 2HXSA 2X1VA 4PZZA 5JFGA 1MR3F 3H1TA 1VHTA 5HCNA 2DWPA 1RW4A 1CTQA 3BFKA 2D74A 3FKQA 4TQAA 3THYB 3U44B 2Z4SA 4P31A 1KI6B 3MFYA 4IVRA 4OJQA 4BECA 3W6PA 5E95A 4FN5A 1ZJ6A 1T3HA 4JL5A 2ZYVX 2QT0A 4IOMA 4AKGA 1Q1ZA 4Q18A 5A5GA 1ZD1A 4LV6A 2FGJA 2WSSD 3SJZA 3SI7A 3FDIA 2OM2A 4RD4A 3U7EB 4BFZA 4D25A 2EFDB 3CIOA 3U7GA 3DO6A 4HLUA 4JMPA 4MRPA 4JBWA 4ZO4A 4BASA 4DLXA 2RMKA 3EPHA 3IHWA 2WJJA 4H1UA 4BLPA 1IHUA 3ZH9B 4U5XA 5C2JB 2J59A 2XX3A 1NSFA 3DKPA 4PAMA 4IDQA 2R6FA 1F60A 3WNBA 1TF2A 1E0SA 1SKYB 3KJHA 5D3QA 2G88A 3EZ6A 3ZJYA 1Q3TA 2OFWA 4DSNA 2BV3A 1WF3A 4B6FA 1US8A 1ZM3A 3SHWA 4C0LA 5FPTA 5DN6D 3SQWA 3E1SA 1XX6A 1GAJA 2A5JA 3H86A 4MUAA 4CEJB 4LYHA 2KRKA 2ZUDA 2QMEA 4GSYA 1D2MA 4LPSA 1CBUA 1LF5A 3RS5A 1ZU4A 4RZUA 2FF7A 4B2LA 1CP2A 1N6OA 3ASYA 2JIZA 4C7OA 1AZSC 1XU4A 1X37A 2C5LA 2QMOA 4UXHA 1G5PA 4HB2A 5L3QB 4YMVA 1XMJA 2XOKA 5IDVA 1ZUNB 2OV2A 1XCGB 2YOGA 1UBEA 1XNJA 3QPUA 2JDIA 2V7QD 4MYCA 2JAQA 3B1YA 4FCWA 4KI0A 2PEZA 1E96A 3IQXA 3OEED 4MKGA 2QENA 3WHLA 1WMSA 3U3MA 1U9IC 1PLJA 3PENA 3F3YA 5FPYA 3QXCA 4CEHA 4PHTA 1S4QA 4KLNA 2WWFA 4QXAA 2XJ9A 3BOSA 3RS4A 4NCNA 1E4VA 2YZ2A 2ZR9A 1W5SA 4TMZA 5E3HA 3OAAD 3K0FB 4UJ5A 2FEOA 3ZD7A 2IYTA 5DH9A 2VSOA 4HEJA 4KHZA 4UNSA 4MDFA 2QP9X 1MRSA 3HYRA 4BFUA 3EPJA 2I4IA 1G7RA 2DVWB 2AWOA 1E2NA 4I1UA 2YVUA 4GP6A 4P4UA 4UNRA 1HQYE 2NO0A 4HZUB 5EP1A 4YXWD 4AG6A 1RRCA 2VSFA 1EFHA 1P7CA 4XH9B 1SZPA 5AJWA 3KB1A 1X8KA 5C4MA 4M1KA 1ZU5A 5JHGB 3PJRA 1G7SA 1M6NA 2NZJA 4ACBA 3WBJA 2R9VA 1MOZA 4PPGA 5FPHA 2CLSA 3P4YA 4NONA 3U6KA 4A3VB 1HT2E 1KO8A 4URUR 3PV0A 2QA5A 3GLHB 3AF4A 5DISB 5LDDC 3PCRB 1P2VA 1AN0A 4CRWB 3ADCA 2QPOA 5LD2B 2P5TB 4CIDA 3I3SR 4Q1DA 2F1RA 1Z29A 3DOEA 1E3MA 5EE0A 2VP0A 1TEXA 4DUGA 2HJVA 1KK1A 2WJGA 1KOFA 5L3SA 2FMXA 2F1HA 1W36C 4GP7A 3DKVA 3C15C 3HYTA 2ONJA 2FPMA 4BGDA 1SKQA 1PUJA 4WZ6A 1KK2A 1II9A 4LHXA 1SXJB 4FWDA 4ABYA 4R9UC 1TQ2A 4FXPA 4DIEA 1NBME 1P9WA 5FL7A 3ZS8A 1GRNA 1QBKC 2D06A 5AWFC 4E22A 4UJ3A 4QHTA 3RSLA 4DT1A 2N1BA 3N2IA 2QQ0A 3T06B 4EFLA 2GF0A 1Y63A 1JEEA 3AKYA 4PO8A 2FSGA 1QG2A 2WKRA 2RGDA 5L3RA 3O8BA 2R6CA 2ZR7A 5JJLA 3THYA 3U44A 4Q5IA 3TUIC 1E9BA 3LBNA 1IQPA 3HU1A 4P0TA 4UNQA 1KKMA 3MWKA 3GLGE 3FKSA 4ESVA 2JASA 3A1WA 1DOAA 2RGCA 4V03A 3IPYA 3AUYA 5AUPB 3Q9LA 5JJIA 1CF4A 4NTZA 4P4SA 4DCVA 4TMTA 2IYWA 4DDUA 4HYYA 4LHWA 2J41A 4WBSA 4CYMA 4PTLA 4US2R 4JT2A 1E0AA 1IY1A 4UQOA 2V8OA 1L7VC 4MQBA 2PMKA 2BMFA 1TPZA 4NZYA 1DG3A 1CJUC 3GLFB 2ZI4A 4LHYA 3ZYCA 4B2PA 4LCBA 3QIAA 3RRMA 3V4FA 1CR0A 2DZOB 3BK7A 4LJ8A 5AJVB 1ZM7A 2WOOA 1FUKA 1M8PA 4BZQA 1ESNA 2PZEA 3WYGA 1E9AA 3BD9A 3DL0A 4B34A 4K8OA 3RLFA 4TSFA 4WXPA 3RRYA 1EFTA 1YZGA 5DHAA 2WV9A 1X86B 4J0QA 5GVSA 2OO7A 4MKIA 3B7GA 1NMZA 4Q03A 1X1SA 4LRTA 2VP2A 1ODFA 3T61A 4QFMA 4BFVA 4HB3A 5F9HA 1E9RA 2XZLA 2ATXA 3QKRB 2P6NA 3DHWC 2JLSA 3ZZTA 721PA 2YKGA 1NLZA 3MHVC 1N6KA 4LUCA 1A5TA 4IVPA 1R10A 4MH0R 2GRJA 5JLJA 1I2DA 1WE2A 1LV7A 1XEWY 1TNDA 2CXXA 1G21E 2W6ID 1HYQA 3B60A 4HB4A 1T9HA 3RS7A 4G0NA 4TLAA 1OXSC 1FP6A 4IEIA 2GXSA 2JATA 2XAUA 1UKVY 3LQQA 3SJCA 3KB2A 4ESHA 1Z47A 1CS4C 2G77B 4JJKA 4NMMA 3LLMA 1WQ1R 3I32A 4QBGB 2J7PD 2OESA 1DS6A 5FL3A 3WXMA 2R6GA 3AJIB 1VYTA 1XJ0A 1Z5ZA 2P0EA 3OIUA 1G3MA 3PUYA 2CL0X 3THXB 3IQWA 4PQFA 2VPPA 4TQUS 4Q4JA 2IF0A 3PR1A 4A8JB 1OSNA 3CF0A 1XEFA 2VO1A 3NDPA 5D3MB 4Q4LA 3REGA 1R2QA 1G20E 3GMTA 5J4VA 2QL6A 1G3UA 5CIQA 5JECA 1E0KA 3AVYA 3IIKA 1NBMA 3TH5A 1XTSA 1FX0B 3ICEA 2BWJA 2FPKA 2HUPA 4POAA 3W3AA 3R9IA 1VG8A 4XWOA 2NOAA 1T5LA 1QG4A 4KU4A 621PA 4B74A 4HATA 5SZJA 2V1UA 3RAPR 3KKQA 2DHRA 2QM7A 2RGNA 4LJ7A 3RDPA 2EFGA 3B1ZA 5TY0A 3THOA 1Z07A 3JZAA 2D7CA 2CL6X 2ZRMA 2YWEA 1AGPA 5JS8A 2IS2A 2NTYC 3GLGA 1A4RA 3F0TA 4BUJA 1J8YF 2EWWA 1E2KA 3T34A 1CKEA 4F38A 3T1QA 1M7HA 3NWJA 1UDWA 3UMSA 3LLUA 2IA5A 5DI9A 2V6IA 4PPNA 4FINA 1QDEA 4NKRA 5DI3A 2QMHA 5AJZA 1I4TD 4Q7JB 5JCZA 2CVHA 4C2TA 4S35A 4UNNA 4ZDJA 4OK5A 3DMDA 3MWJA 1FL9A 5L8VA 1KI7A 3LO5A 4LHVA 5DNYB 4B3GA 2BVNA 1AA9A 1AQUA 1CXZA 1TX4B 4BPBA 4QJ5A 4EAQA 3VKHA 2WSSA 3B8HA 5G41A 5IT5A 1XTJA 4JL8A 2WWIA 1ZC4A 3SYLA 2B7BA 3VMFA 3ZVRA 4RZ2A 3K0CA 2FJUA 5G3ZA 3QE0A 3T15A 1VG0B 4ON9A 2FSHA 3U4QA 1Q22A 2SHKA 4LWZA 1XF9A 4M1OA 4ZDWA 3EW9A 2GESA 4PHFA 4Q1BA 1JJ7A 4NYMR 2GK6A 1ZMXA 2I3BA 1LTQA 2GILA 2AR7A 2C95A 3AF0A 1HUQA 4TL7A 1VCIA 2JIZD 4UNPA 4AC9A 4DLWA 2G6BA 2D7DA 1E2JA 1R0WA 4QNMA 1NJFA 5F3WB 1CEEA 3OFNA 4ZDIA 3GEIA 5KDDA 3IO3A 4I1SA 1ZM4A 5FBVB 1L4YA 2GZAA 3GFOA 1LS6A 1P9NA 5G3YA 4KFRA 3KXLA 3L82B 1XTRA 3EZ2A 4MUBA 1Z6TA 2QRNA 3WMGA 1ZCBA 3UPUA 4G5GA 4RD6A 1Z22A 2EVWX 1E2IA 1F2UA 2RHDA 3QUSA 2KI5A 2GAAA 2PX0A 1Z0AA 3REFA 2Z4RA 4L5BA 5UKDA 2GBLC 3L0SA 4U00A 3FMIA 1VPLA 1ELOA 4PXAA 4BLTA 3MGCA 4XIGS 1XXHB 3NH6A 2HT1A 4PC6A 2Q9BA 3QBVA 4LPKA 1EK0A 3UMRA 4B6EA 4ASUA 4FMCF 1UBFA 3X1ZA 4LOAA 2J5XA 3T5GA 1N5IA 3NG1A 3KKPA 2ASEA 1TU4A 3TQFA 3SJAA 2IXGA 1Z3IX 4ERNA 1SVLA 2H18A 1NVMA 5BW8A 3UG6A 2OLJA 5M04A 3VU9B 2ZU0C 2G3YA 4KBFA 1C1YA 4DHEA 1AKEA 1E1RA 1ZNZA 3IIJA 1U90A 3W34A 2OXRA 2QORA 1E9SA 5J4HA 4DLYA 2ZXUA 3DEFA 3KFVA 1XXHE 2FU5C 4Q1CA 2ZE8A 1CRQA 1KGDA 1W49A 3KQKA 5B64A 5AUNB 3FMOB 5J40A 4Q4HB 1T3LA 4TL8A 1E32A 5EP3A 3CPHA 4FI3C 4HI0E 3EC1A 1AJEA 1G41A 3LWNA 2GEUA 4NDZA 1E2GA 4R98A 2ZE7A 4TZ6A 4C0BA 3IBYA 5KNDA 4O3MA 3AGQA 4II7A 3LA6A 5FL7D 1DEKA 5FOUA 5SZHB 3K1JA 1N6PA 5KPDA 1NN1A 2WMOB 2BMJA 3IPXA 3HU2A 2ZSBA 4QBHA 1N6IA 3F8TA 5E7IA 1U0JA 3QQ5A 3TKLA 4US1R 1QHYA 5KPJA 3ADBA 3RRNA 1I4LD 5KDOA 3R8CA 2MMGA 3WBKA 1JXMA 3ECCA 4NPHA 1GWNA 3CNNA 4M22A 4Z1MA 3VKWA 2O8EA 1ESMA 5EZ6B 1KSHA 2Q6TA 3LW8A 1A2KC 2B21A 4GNKA 1UKEA 4KVGA 4Z54A 1G8HA 1NP6A 4MRNA 2CMKA 2BJWA 2NIPA 5EE5B 4TL9A 5FOVA 2OAQ1 4Y0AA 4NYJQ 4IFEA 3DOFA 2XB4A 2OBMA 2CCKA 3SHFA 2QPAA 4QKQA 4R71A 3QNUA 1YRBA 1DG1G 4LJ9A 1VTKA 1YKSA 1EX6A 1M7BA 5FI1B 4JLBA 3LFUA 4JLPA 3R9XA 1XD2A 3AGPA 4RVCA 1US8B 4NYIQ 5HE9A 4Q7KA 1II8B 3CPEA 2NPFA 4URYR 4QC2A 4DDWA 2HDNB 2N42A 3BB4A 3I5XA 1DELA 2GDJA 3LBIA 2O5VA 4EPTA 3MCAA 5JI2E 4MKFA 1ZM2A 3I8XA 5EP4A 4KAXA 4C7OB 2IWRA 4EJSA 4TN1A 4QM7A 2IYRA 2NO9A 3AF2A 1A1VA 3CBQA 5AUOB 2JLXA 1ZNWA 5KUTA 4JVSB 3CPJB 5FBLB 2ZRLA 2IXEA 5GJCA 5HE8A 4M0LA 2Q21A 3IUYA 3P4XA 2ZQ5A 3Q3JB 1KK0A 3EWAA 3NH9A 4PZLA 3RNLA 5LD2C 4Z51A 2NZ8A 2QAGB 2VHTA 1VDZA 2JJ1D 3BH0A 3GJ3A 3OIWA 3QEJA 5FOWA 4PQRA 4AY2A 2JCSA 4C0AC 4DLSA 4RKFA 2BOVA 1IY2A 1D9ZA 2KJQA 2BKEA 4K46A 4CEHB 1IONA 3O8RA 1PLKA 5AUQA 3LX8A 3EZ7A 3VKGA 2OZEA 3W8NA 2ZRIA 2X2FA 1WRBA 1JB1A 2JLWA 2J0VA 1SXJC 2GXUA 4A0GA 2RKOA 2AD1A 2QEQA 2ZI5A 4URWR 4ZI2A 5CJ2A 4FMBB 5EE9A 2ZRAA 2B8TA 4WW0A 4PC2A 4P32A 4Q7MB 1XMSA 2OBLA 1RYHA 4M1WA 2P3SA 3FVQA 2C98A 2QSYA 1FQJA 3GCGA 5CB8A 3D7MA 1HV8A 2VRWA 2O0KA 3D8BA 3DDCA 1PLLA 3ETLA 3UG7A 1Z28A 1WXQA 2RGBA 1F6BA 2BBWA 1JR3A 3W6OA 4Q48A 5FPKA 2PMDA 1S2MA 3EPLA 2W6JD 5HTKA 3NHBA 2HYIC 3SZRA 2IL1A 4P3YA 4QGGA 3TQCA 1VKJA 1EFCA 4IKEA 3RABA 5CDFE 2YC4C 2FGKA 3CH5A 4DWJA 2QTHA 1T3SA 4OQLA 3BC1A 5CLLA 1F3OA 1S9HA 1TF7A 4AG5A 3PEWA 5L3SB 1KI1A 3SEAA 3UK6A 2ZI6A 2RAPA 2O0JA 1JR6A 1V5WA 3H84A 4HAYA 2BM1A 2EQBA 2RGAA 1CRPA 2G83A 4WZAE 4DZZA 2XZPA 1E9EA 3PUVA 3NEJA 4RD2A 2FA9A 1EX7A 4AYTA 2XSZA 2YWGA 5FUWA 3Q7PA 2O52A 3EA5A 2FZ4A 4JVMA 5CLQA 3KX2A 1A7JA 1MO6A 3SQXA 1JPNA 4M1YA 2PCJA 4LV5B 1G5TA 1S1CA 3IDQA 1J99A 4M1MA 4DT1B 2JA1A 4IHQA 3VR3A 4ZKDA 4AIIA 2LKCA 1H8HA 1QHNA 4E5UA 1M1YE 2AX4A 3MUFA 1S0UA 1W5TA 4N0DA 2FG5A 2BBSA 3QI2A 2G1JA 1GFIA 2W83A 3LX5A 1UEJA 3WMFA 1U8AA 1H8ED 4FD2A 3K09A 2UZIR 2ZE6A 5FBQB 3DM9B 1IN5A 1TF5A 3X1YA 4M9XA 2OAP1 4OK3A 3BXZA 4L9SA 2BM0A 2C2HA 4P4SB 2F7SA 2KB0A 2VYFA 2ZYTX 1X8JA 3KUDA 1C1KA 5FTJA 1W2HA 2OCYC 1GNPA 3AQ4A 4JVLA 3R20A 5EUQB 2JLZA 2QAJA 3TW8B 4LJYA 5E7MA 3EIHA 3K53A 4EQ6A 4D6PA 1Z2CA 4TLDA 2UZ3A 2ZJZA 4A4DA 1XJCA 3CH4B 1GL6A 5CK5A 3TUZC 4KFTA 3R8FA 2QZ4A 4YC7A 3L8YA 1FOEB 4HUQA 2R62A 1KZ7B 4JS0A 1TTTA 4QL3A 3RS3A 1NF3A 3MD0A 3ZD6A 3ZGXA 2NO6A 1JXOA 2RHMA 1K8RA 1TQ4A 3CF6R 3TK1A 4K81B 3IGFA 3L0OA 1HE8B 3QOFA 4HSEA 1Z06A 4Y0VA 4JT4A 4KJZA 2ZRCA 4ZKEA 1UPTA 1II8A 3OFND 2Q0HA 2VP6A 4Q21A 1XWIA 3B2EA 5DGXA 1XCMA 2ZUBA 5HKKA 1W44A 1IOZA 5J4KA 4IDNA 4G5OA 4IFBA 3ZZUA 3A1VA 5KSYA 1E2PA 5CJPA 2E1RA 3I73A 5F98A 4MGIR 2PL3A 4W5WA 4O25A 1KO1A 3TMKA 4D4JA 1KDTA 1XTQA 2IEZA 4D82A 3PQCA 4HB0A 4V0NA 4PC7A 4Q1FA 3UMFA 3U3OA 5JSZA 4AYXA 3KJEA 1D2EA 2QAGA 5FBWB 4MGKR 3CW2A 2ZS9A 3AVTA 4TYQA 5FH9A 2MSDB 3ONWA 2D62A 2CE7A 3SYKA 3TUJC 2IHYA 4C4PA 4ASUD 3S1AA 3SE0A 3FWYA 3EWSA 4TLCA 1ZM9A 4YMUA 4MGYR 2XTMA 5CDFA 4ZV4A 2WM9B 4TTPA 1MT0A 3C14C 3KZ1E 3RS2A 2W0SA 2GF9A 3MSXA 1KTVA 4V0MA 4D0LB 5ELXA 1AZTA 4FCVA 2IBMA 4TLBA 5GJVC 3T35A 2D2EA 4Q4JB 1G3IA 4RCZA 1ZD9A 4EPRA 4A0RA 1GNQA 1VYUA 3W6NA 1SVMA 5C46F 3AKDA 2PJZA 3TVTA 1YZKA 2DFTA 2HXYA 4XSGA 5ANRB 1E1RD 1R5OA 3WHKA 1Q57A 4I4LA 3GJ7A 4L8GA 1N6HA 3EXAA 5TVKA 4GFDA 4WOPA 2ZANA 1HEIA 1NVWQ 1T8TA 3A37A 2ZM5A 4B3FX 1F5NA 1E79A 3K70B 4QHSA 2QROA 3BB1A 2QMUA 2PEYA 1O3YA 4RSGA 2LCFA 3CNOA 4XWKA 2R8RA 2ONKA 2CLCX 3T1TA 3CWQA 1G7TA 3NBFA 4QGFA 4OQFA 2GKSA 2BC9A 4W9MC 3GLGB 2ZSDA 3MRSA 5CYOA 1OFHA 2C9YA 5CM8B 3F5FA 2O8CA 4RFSA 2ZPTX 4PPFA 2ZJAA 2CJWB 1XMVA 3UKDA 2GVZC 5KOYA 1MO5A 2GJSA 4Z1MD 1MV5A 5DI3B 1LVGA 4BFTA 2NO7A 1XBTA 3QVVA 1DO2A 2VF7A 2WJYA 2DWOA 4Q9LA 2CE2X 4LJAA 4L15A 2CK3D 1Q20A 3Q7QA 3UANA 2EWVA 1G6HA 3VHXA 1R5BA 2IYUA 2J3EA 3GJ4A 2CHGA 4BFYA 1F2TA 2CCGA 4DLUA 3DVLA 4QHYA 5FTKA 1JAHA 1Z63A 3LVQE 3MLEA 2RB4A 3C5CA 2AK3A 1WCV1 1DO0A 1EFRA 4C2UA 1P75A 2VP5A 3FPAA 3U4QB 3W5JA 2QM8A 1YQTA 2JLVA 2DWQA 1IJEA 3QKTA 1OB5A 1LF0A 1E9CA 1EGAA 4OHZA 1IAQA 2JGNA 1G7CA 2WPDD 1XEWX 5GVRA 4F91B 4YONB 4DCTA 4LGMA 4E03A 3B5JA 2ORVA 4BLSA 1OFIA 3FMPB 4PAOA 2PLFA 2WVJA 1RRFA 4HUTA 1JEDA 4RD0A 1M2OB 5B30A 3KQHA 1S3SA 1BO6A 1ZNYA 2IYXA 3Q5EA 4Q02A 1OHHD 1W0JD 3U7FB 2GJAA 2J46A 4EPXA 4GOKA 4OJKA 1CLUA 1VIYA 4B3XA 4BFXA 5EXSA 1FZQA 1JNYA 4Z8YA 5EXTA 1KMHA 4Q66C 4W5JA 4FMCB 2YOHA 4A36A 5JS7A 2G0TA 1HY3A 3EARA 2CL7X 1LS1A 1NVVQ 1BYUA 4ZCMA 1OF1A 2QU8A 2Z5FA 2B8WA 4QRHA 3I72A 3FYHA 1P4SA 1F2UB 2N46A 4NE2A 1KIMA 3EG5A 2WWWA 1BIFA 2J1LA 4PO1A 2GCNA 5SZKB 4O2RA 1RC8A 2CLDX 4DLTA 4ZPXA 2JJ1A 3CM0A 2BJVA 1YZTA 4C0HA 4CZ2A 3OF5A 3NBYC 1W1WA 1UDXA 1GL7A 3NHAA 2BIFA 2IF2A 1Z0KA 4N0EA 1KJYA 4WIAA 3J81k 2OE2A 2VSXA 3W5IA 5FUVA 2ZUCA 1ZYUA 1SHKA 4A2QA 1ZD8A 4JLDA 1KSFX 4AKIA 1OXUA 2ZJ5A 4MRRA 3BFXA 3QG1A 2IW3A 2B6HA 1P6XA 4RZXA 4DRZA 1JR3D 2NGRA 4QGHA 1P5ZB 4NYJR 1AQYA 4HLUC 1IXZA 1JQLB 1KO7A 1R8QA 1VG1A 2PBRA 2ZITA 4C3ZA 4CT5A 2PT7A 3A8TA 3OHMA 4GT1A 2GTPA 1X3SA 1KI3A 1GILA 1MO4A 1QHHA 5LPNA 1B0UA 3TW4A 1UADA 2EW1A 4MRSA 1G9XA 1YVDA 1OPXA 1NLYA 1DTSA 4GMXA 2PZFA 1QHIA 1G291 3KUCA 3V4RA 3CX6A 2H5EA 4H1VA 4QJ3A 4JVNA 1A2BA 1Q44A 2RH5A 3I5YA 4MITA 2OXCA 4HLDA 2W6JA 4RKEA 2F6RA 4D4KA 3T1VA 4JLNA 3CWZA 5KYKA 3QKSA 2AKAB 2G0NA 5IRCD 2V9PA 2XSZD 1K5DA 4LRWA 4G5QA 4D0NA 3KXKA 3VR2A 3GLIE 3N70A 4L9WA 4TYNA 4HAUA 1YJ5A 3A1UA 5BYJA 1JALA 4B3CA 4PSVA 3SR0A 1SVOA 1OKKD 1QZMA 1H8HD 1OIWA 4FWGA 1TMKA 3NC0C 1D5CA 1KJZA 3K8YA 3LDAA 1KY3A 4TYYA 3BWDD 2FSFA 2ZSAA 3NVAA 2RGXA 2ZVPX 5HPYB 2A5FA 1YRAA 5J47A 3AF3A 4TLEA 2O8EB 3DZDA 1XPRA 4M21A 1N6LA 2Q9AA 2AL7A 3K0AA 1F48A 4XJXA 3QBTA 1G6OA 3W3ZB 1XZPA 4JKIA 1T0JB 3B9QA 3FE2A 4ITRC 1Y3AA 5A4JA 2ZRHA 1FMJA 1TAGA 2CJWA 5CM9C 1SQ5A 4GDFA 1H8EA 4NCIA 1DARA 3MJHA 3RSOA 3NTUA 4PQYA 3WMEA 1QZXA 2JLYA 1KHTA 1LFDB 1ANKA 1XD2B 4CT4B 2BEJA 3TSZA 1KDRA 4B3BA 5JEDA 1E2LA 3NEYA 5KNBA 3QSYA 4LC0A 5H1YA 2OCBA 4B47A 2KSQA 4AURA 4ILEA 3B82A 1E2EA 5JCPA 4PZYA 1VG9B 4JIMA 2WWXA 3U60B 2GVDC 2VTKA 4WXRA 3U6BA 1G8FA 1NVUQ 3D3QA 4EJSB 4OBEA 3EC2A 2PH1A 4MDEA 2H1LA 5LB4A 1OXTA 4BE7B 5BXQC 2Q3HA 3AVXA 1Z08A 2REBA 1JPJA 3QXHA 4PANA 5DE3A 5FTNA 3I92A 2HCJB 1FNNA 2Z6VA 4OI0A 2YHSA 4OQXA 3TSOA 1G3RA 1P3JA 1Z6YA 3FFBA 3N5CA 4I1OA 5HKKD 3TR0A 1IN6A 2O8FA 4CDGA 1NMXA 1E9FA 2V55B 5IHPA 1SULA 4LV8B 4TMXA 1E6CA 3DM5A 1MABA 2H16A 4KODA 4HDCA 4PO9A 4R7ZA 1AKYA 4RD1A 3K9GA 1G8YA 1GUAA 2W00A 3TRFA 1WB9A 1FQKA 4OQNA 4LJ4A 2XTZA 1TL7C 3CONA 1SVWA 2CVFA 1KZGB 2JEOA 2F1JA 3QXJA 2F3RA 1COWD 4A6XA 1OH7A 2DYKA 3B1WA 3QXXA 3NC1C 2QNRA 1DAGA 1YZNA 2CDNA 4JL6A 4Q9HA 2VP4A 5B58C 4MYUA 4AD8A 3WP0A 1FPMA 1W0KA 2ZYWX 4AKHA 1KI4A 2ZROA 4LJ5A 4OI1A 3W8RA 4D26A 2Z0MA 1Z6AA 2C04A 1DE0A 4Q4AA 1U0LA 4LJ6A 1DADA 3BIFA 1G8GA 2J9RA 2DB3A 1UFQA 4IVQA 1NL3A 2V6ZM 1TQDA 2W2VA 4DDVA 1UBGA 4IW3B 4EFMA 3ZQJA 3KW6A 1XEXA 5JJKA 4C30A 1J2JA 1N3BA 3GLIA 2YOFA 1U99A 4XVUA 2IXFA 3EX7C 1KI8A 2OT3B 1G18A 2H8KA 1GL9B 1E79D 3ZVLA 1BKDR 3BAFA 4GOJA 3O8DA 3H2YA 3L43A 1OB2A 1GRRA 1GZSA 3AVPA 4G5SA 1A82A 4LRSA 2DBYA 2GWHA 2A9KA 2KBFA 4TMWA 5TB5A 5CB6A 3O47A 5FTLA 2A5DA 4IXNA 5FTMA 2EFHB 1G8PA 5CITA 3EZFA 4JYBA 1JR3E 2CHQA 3EZ9A 1RKBA 4GL2A 2FSIA 1NJGA 2AWNA 3FGNA 1II0A 2V1XA 1TUEA 2AXPA 1KO5A 4A9AA 4ARZA 4W5HA 3W90A 2VEDA 5JHHB 4PFSA 4M9QA 5E4FA 1AS2A 2R65A 1RZ3A 1T6NA 2Q3MA 5HZHA 3VNVA 4DIDA 3I62A 2Q9CA 3AP3A 2IS4A 3VR5A 1TU3A 1OV4A 1YU9A 1ZUHA 4BRUA 2QBYA 1YR7A 3KL4A 2WTUA 1P61B 2AK2A 1SVKA 2EYQA 2ATVA 1P2TA 4LK2A 5FPSA 2XXAA 5FBRB 5SZIA 4GRAA 2DR3A 1E99A 4D0GA 2I1QA 1T5IA 3L2OB 2GHIA 4GITA 1C4OA 2R6DA 2AKYA 2PZGA 3C5HA 1IXSB 3SOPA 3OEHD 5KSZA 2HLDD 3PEUA 1MH1A 1Z6XA 521PA 2WJIA 2TMKA 1EFRD 1KNQA 3KQLA 4EQ6B 5KDLA 2B92A 1TUIA 3QVUA 2CK3A 1G64A 4E07A 2WWHA 4B43A 5IK2A 1MO3A 3VR4A 1ZUIA 1ZW6A 2JLQA 4EPVA 2ZS8A 4ZIRA 2H57A 4ACAA 1RRGA 1S1MA 1D6JA 3IBGA 4HUQB 4NH0A 1K6MA 2L0XA 3B13B 3GFTA 1BMFA 2IC5A 5EXXA 1O87A 1HA3A 1U9IA 1VIAA 4X8HA 1KI2A 5GJWC 5B2ZA 4BLQA 4UXJA 4TT3A 1LW7A 4B76A 2IUUA 4B32A 3RRZA 2WPDA 1DBSA 2Q3FA 2IHBA 2XB2A 3KTAA 4BLRA 2ZRDA 2J45A 2QRZA 5FOTA 4B44A 4LBVA 2C03A 3IEVA 3OE7A 3GD7A 2H7VA 4I1VA 4KITB 5FUXA 1ETUA 1NMYA 2UKDA 2JJ8A 4KYIB 1U94A 5DSZA 1OHHA 1W0JA 1W48A 2QT1A 3QF4A 3FOZA 4JLVA 1B23P 1HTWA 2QP3A 3KDSE 4L16A 1W46A 4GBMA 3K70C 2ODBA 1VCOA 1GKYA 1Z0FA 2XITA 2FFBA 4NCJA 3UIEA 4UKDA 3WYAA 4M8NE 1G3QA 1Q1QA 2GCOA 4H9GA 1ZP6A 2C77A 5JSZB 2RGNC 3AUXA 3W9YA 1NN3A 5IF9A 1GSIA 4CW7A 3V00A 4BFWA 4JJZA 2YWHA 2HF9A 3H4MA 4IOJA 3LY5A 3RYTC 1R4AA 2QUZA 3B1XA 4MYHA 3VFDA 1ZVQA 3VTKA 1GDDA 3A6PC 3S1AB 1ONBA 2PT5A 4PPQA 3PUZA 1GG2A 3RWMB 1ZINA 1CU1A 3RC3A 4A92A 2Z43A 3DPUA 4JKYA 2QE7D 3KJGA 5FR2A 1PV4A 1P2SA 1IN8A 2XJ4A 1KSJA 4DJTA 1RYFA 4OK6A 3RC8A 3A4NA 1PJRA 3CRQA 1FUUA 1Q21A 4P4TA 3HPQA 2F1IA 2GZHA 4KSBA 1DAMA 1OIVA 1T0HB 2AD5A 2ZSEA 2WIBA 1IBRA 2BBOA 3NBXX 1NVXQ 2VA8A 1Q0UA 3X2SA 2YYZA 4DKXA 3ZLJA 3P27A 3OZXA 2P67A 4O2LA 2YJTD 1AK2A 1VHLA 1N0WA 2DPXA 2HF8A 4IEEA 2JJ2D 3K0CC 2RGGA 1G4UR 4M1SA 1R0XA 1RFLA 4D81A 4U7DA 1PUIA 5BN3A 1W2GA 1XPOA 3GFPA 3OESA 4OYHA 2FV8A 2C9OA 3CZQA 4PC3A 2ZAOA 4V0ME 3MWYW 4WAUA 3FTQA 1XP8A 2J87A 3UATA 3GEHA 2FN4A 4TZ0A 1BOFA 2VL7A 3MJRA 2F9LA 1IM2A 1DAFA 2O8CB 4RFSB 3PVSA 2K5UA 1XD9A 1D9XA 2WKQA 2YC2C 2O8BA 4MA4A 1U0HC 3HJNA 1L4UA 3QJYA 1AIPA 1J70A 1NVVR 2DFNA 5FOXA 1N5JA 4OHXA 4IJMA 3ADDA 3TJZA 2C96A 2D3WA 1OKKA 4HLQB 5JZVA 2GK7A 3QF7A 4C0QC 1NN5A 1OYYA 4RJLA 3SN6A 4Z8XA 1FFHA 1DVRA 3THWB 2DY1A 4JSYA 2A30A 3G82C 1F2TB 3RANA 1N5KA 5FUYA 3TBKA 2PX3A 5F9FA 1MRNA 2OILA 1E69A 3D31A 3LVRE 4A0FA 2ZR0A 2CCJA 4BEJA 2W0MA 2EFEB 2F43A 4JBYA 4M2LA 2FZLA 4DSOA 4EDHA 1ZBDA 1D8TA 5CIWA 4PC1A 5BN5A 4JLMA 2WWGA 3U3JA 4TTQA 2DFLA 3CR8A 4FCTA 5BYKA 4GMDA 3LV8A 4NP6A 4C9BA 2ZAMA 2CNWA 3HDTA 1SXJD 1E94E 3Q8XB 1IJFA 5J4YA 1GKIA 1NSTA 5GADl 4QGAA 1CR1A 1JQJC 3JZMA 1E98A 3QXSA 4US0R 1KYIA 3EIEA 1XTKA 5H68A 1CJVC 2PJRA 2VHQA 4GI7A 4F7WA 4DBLC 1Q3HA 1LNZA 3BERA 1KMHB 4TMVA 4KO8A 3DMNA 1G1MA 1ZCAA 1WBDA 1R0YA 4DVGA 4YMWA 1KDOA 1N25A 4LYFA 1UAAA 4KVAA 4RD3A 3SC3A 1IN7A 3I4LA 8OHMA 2ZRPA 4ZDKA 2YV5A 3TAHA 4LSGA 3L8ZA 3LD9A 5JBQA 2P6RA 1YE8A 2QY9A 3CB4A 3K9NA 4XWAA 1T8UA 2W2TA 1YR8A 3CRW1 3JVVA 2FWRA 3UWKA 4ZCIA 1EFUA 2A7QA 4ZI3A 4JSTA 3U7HB 3Q72A 3QPWA 4DEXA 1HQCA 1XCPA 2WZQA 3AV0B 4JLJA 4BZPA 4R2IA 5BN4A 1KY2A 1XMIA 2ANBA 2OG2A 5TARA 5J5CA 3ZVNA 4IDOA 2E87A 3AM1A 2AN9A 1I4DD 1R5NA 1W0KD 1OW3B 3FHTA 1VECA 4IDHA 4YDHB 5LB2A 1COWA 2UVQA 5C1BA 2HV8A 2X8AA 2WHXA 3AB3A 1NG1A 3GQBA 3V9PA 3QKUA 4LHZA 1SVSA 3UWOA 3LBHA 3KQUA 1W4CA 2O8DA 4A2PA 2HEIA 4FIDA 2QTVB 4BZXA 2P2LA 3ZDQA 2B7CA 1QHHB 4OHYA 2J0UA 1NIJA 3QEOA 2ZYUX 2JLUA 2BMEA 4QOSA 1KKLA 2X2EA 3AH8A 4FMDF 4Q1AA 4Q47A 1SKYE 3C41J 4AYWA 2FPLA 2QPTA 4IXMA 3QKSB 4PAQA 2REXB 2BHRA 5DO9A 2P5SA 1LB1B 4NU0A 2NO1A 1RJ9A 2OHFA 4JZKA 3RHFA 3U3RA 4NL4H 1FNMA 4X8OA 2BKUA 3R7WA 2C99A 4FWIB 2V54A 4DC9A 4RFVA 4EJSC 2XGJA 1YZUA 2H92A 2ODNA 3BBPA 3DZ8A 2GJ8A 2QN6A 1ZIPA 2XTNA 3GEEA 3BJIC 4GZMA 4KLZA 1E2HA 3X1WA 4CEIA 3P20A 1FTSA 3AVQA 4A8JC 2ZIAA 4AWXA 2R2AA 4XOIA 3KJIA 5KHOC 2F9MA 2NMVA 2YINC 1DAKA 3B85A 3K0AB 3SBDA 4GOXA 4LX0A 1JAIA 2VIIA 1E4YA 4EPWA 3HWSA 1NN0A 1HT1E 5EE3A 3H0KA 2PCLA 4AKEA 5JWRA 4OQMA 2X77A 5K8LA 4KFUA 1IN4A 2WICA 3AKEA 3C4JA 1AS3A 2J7KA 2IYQA 2ODEA 3ND8A 2VLIA 3SS8A 4B71A 3PFIA 3M0EA 3GJ8A 4MGZR 3A36A 5IK2D 1G17A 3AP1A 3THWA 3HPRA 1OE0A 2QG6A 821PA 1GIAA 1NKTA 1E1QD 3VAAA 1N6RA 1AGRA 4M9SA 3OEHA 2HLDA 2VHJA 3VX3A 4IRUB 3AVUA 4AI6A 3QENA 4G01B 2GXAA 1OIXA 1DAIA 1BMFD
chains in the Genus database with same CATH superfamily
5HIKA 3QLEA 4I5EA 1RYNA 1NTRA 1RMYA 2NG1A 4ZTUB 4YP9A 2GXQA 3ZIAA 3HCRA 3BHJA 3Q8GA 3PBKA 3ELYA 4JHXA 5JQGA 3IUNA 4OHVA 3QUQA 2GERA 3CNHA 3VNSA 3Q7SA 2A67A 5TDHA 3C8UA 4G6ZA 2R8PA 4BVAA 3VPDA 1E1YA 2HSJA 1TM5E 3VR0A 3PRKE 1PJ2A 3PHGA 1I7LA 1Y5IA 2A9VA 4BMOB 4NENB 4DQKA 4L2IA 3EQ2A 2P35A 4P54A 3W5SA 1P1KA 3MWLA 1OKSA 1XDUA 3I1FA 2IYVA 3T5AA 2CVQA 1PNTA 3R40A 5K8IA 1JIXA 4A1FA 6ADHA 4OO3A 4BBAA 4F06A 1NM5A 4JJ7A 2D2XA 4BJ5A 1UZUA 1PWXA 5ECGC 4D8TA 4BVEA 5FOSA 3N5KA 3U4MA 1JSXA 3HV2A 3WL5A 5A7HA 4QEZA 2XVAA 3KKZA 3HKBB 1AF4A 2FEWB 4EF5A 4YQFA 2B3DA 2DUMA 3OD5A 2FHPA 4ZVPA 5ITZA 2VDWB 3MS4A 4MR8A 4E88A 4B2YA 1JQ3A 3KSUA 3OZGA 1CSEE 4NAUA 2H17A 1JHQA 3JZFA 1YU6A 3ORSA 2Z2ZA 3BH6A 2VAMA 4Y9SA 1SEPA 1GRVA 1RQ2A 2Z9DA 1Z2AA 2BFBB 2ZEJA 1W36B 1GYQA 4BU0A 1LPBB 4U7PB 3HWX1 4OHOA 1F38A 4NZ9A 5EJMA 3I42A 3G2JA 3STYA 5LJLA 3N2KA 4KE8A 4XASA 3VH1A 4PSAA 3SDZA 1EE2A 5JYDA 1V7PC 1BN6A 4M3NA 1HMPA 4FVTA 3K2BA 4RGYA 4KNVA 2VKQA 2PXAA 3KVOA 3PUWA 1JGTA 3IE2A 3MUNA 3HY3A 4LTNA 3OZRA 1IVNA 5K6RA 1LY1A 3CEMA 1WHTA 2C88A 4Q1EA 2NVUB 4O2AA 2QLFA 1QQTA 3AKZA 1YA8A 5LBIA 3OPNA 2WFLA 1TH4A 4DUGD 3UXHA 2BEUB 2K2QB 2DAGA 4I4TF 2GZMA 1PTJA 4HVLA 5CVEA 3R7LA 1OGIA 2I6FA 4DCPA 2PS0A 2X41A 2Y8EA 4PW0A 1YTUA 2OHIA 1C5KA 5BSHA 1AUQA 3RUPA 1IXRC 1CQWA 3EY4A 4GPEA 2CXQA 4ZOAA 4DCNA 4FR0A 4O4LB 4P92A 4DNOA 1WW3A 3IBCA 2ZJBA 3QMPA 3KSRA 4P93A 2H59A 2G71A 2O3QA 2XMCA 3HDYA 2ZJ2A 5EP2A 4MVJP 3NWLA 4Q0MA 4K6KA 3GNSA 3BCRA 3ZZ0A 4XD7D 3EDYA 1W7AA 3GQBB 1Y5MA 2ZTHA 3ZHVA 1EM8B 1BVYF 2VYVA 3DE6X 3K05A 5FI0B 5AMXA 2R6HA 2I8AA 2J3KA 2IWHA 4QNNA 1Y3FE 3FETA 2J0SA 2E7ZA 4MAFA 1V3TA 3UB4A 1MKYA 3QMMA 1OWMA 5C8YF 1P73A 1HG0A 2OG1A 2I6XA 4CMCA 4M54A 4AY5A 3L0IB 1Y1QA 1Y8RB 1W73A 3NV9A 4XTCS 4Q93A 4A03A 4E21A 5KYXB 3AHEA 1YS6A 4L50A 4LQDA 1M6VA 3WK4A 3TRDA 2I99A 3HCDA 1RAFA 5G53C 4Q82A 1NBMD 2Q6IA 1X3LA 3A9TA 2YJ6A 4WJZA 3GCZA 3NM6B 4AJPA 4JCOA 3W9SA 3QHAA 3NIFB 3ORQA 5L7TA 5D3KA 1J90A 1NZJA 4Q9IA 5AI9A 1T1SA 2BBTA 3VYUB 3BFVA 3ZWMA 1QHXA 4OJQA 2H3EA 3QELB 3KE9A 4ZGGA 3UN1A 4XDYA 5GM1A 1A9YA 4MX8A 4RD4A 2EFDB 4HLUA 2VXBA 3RTGA 3VVBA 3C70A 1VI5A 3QVOA 2JFQA 1JJFA 3UAXA 4Q3OA 3HGMA 3ZJYA 4B6FA 4U8HA 4D8VA 3WAKA 2IYFA 4OKIA 2ZIUB 3RS5A 4B2LA 4ZOBA 2P1RA 2P9ZA 2C5LA 2EARA 3FNRA 3QU4A 1C0KA 3VSEA 3MIIA 3QJ5A 1RKQA 3GIWA 3FF4A 4PTZA 3ZD7A 2TSYB 1EFVA 1M2VB 2W98A 1BD4A 4HEJA 3V2HA 4JR1A 2LDXA 4ZALA 4W8HA 4ER7A 1HQYE 5EP1A 1J8FA 5ALHA 2V0CA 5AJWA 5IJWA 1HDZA 4JUDX 1IOVA 1MTOA 5DBFA 4ACBA 3LUJA 2NU8B 2G5GX 1WZCA 1RP1A 3AF4A 1HR0M 3Q7IA 1ZH6A 4FFSA 2LHGA 1GD1O 2YX1A 4ZFNA 3SLKA 3QFCA 5KQDA 3OICA 3RSLA 2FSGA 4E5DA 3TRHA 2FPGA 5ITXA 2ZR7A 3GI1A 2Q5LA 2WB2A 5JY6A 3FKSA 3A1WA 4K9MA 1CY8A 1U7DA 4J4TA 1AIPC 3J81A 2AUMA 4UQOA 1D5WA 5H81A 3ZYCA 5KC8A 2QVYX 2LW7A 1R2ZA 2J85A 1SCUB 3ZK9A 4HNTA 4J0QA 3JQEA 3U1VA 2JHGA 3S6JA 4QFMA 4IIVA 3LUBA 2JKVA 5BMVB 2V5VA 1C81A 3IX7A 2QSUA 3HJGA 2GRJA 5HF6A 2UXCB 3M9WA 4E94A 3EG9A 4D92A 1U8CB 2JGKA 5HG0A 2XMZA 4OBBA 5JTUA 2G77B 2GM9A 4MTLA 1VYTA 1WO8A 3L4JA 4IFTA 4HNAB 2IF0A 5ITWA 3QKIA 2HDOA 2HWKA 1R2QA 4K03A 2WU3A 1EGQA 2OV6A 3KJXA 2NSDA 1D2AA 3WLQA 2V6GA 4XWOA 1QG4A 4KU4A 3ZI4A 3RAPR 2GPAA 2RGNA 4CTOA 1C8BA 1VIMA 2NU9A 4RY9A 4E4YA 1Z6ZA 3K32A 2W2QA 4EX6A 3L7LA 4NKRA 5AJZA 1I4TD 4C4ZA 2HWYA 1XZBA 3RVLA 1MW9X 2YN0A 1WTAA 2QYHA 1ZC4A 4DWOA 3T8YA 1J9GA 4ZDWA 3C5WP 5LP6C 2F3SA 4S0ZA 5J2UA 4X3OA 4FYMA 4HYQA 5CX4A 3ZU3A 5B7NA 3PFHA 4DR7B 3TD2A 5BQPA 3NJ8A 4MQLA 1Z6TA 1GFSA 2EVWX 4WCFB 3CLHA 5AVWA 2WHRA 1DKQA 1H6AA 4IO1A 4Z2YA 5ADHA 4L5BA 3UKJA 4U5QA 5F78A 1X1CA 1SJ9A 4PXAA 4BLTA 5KYYB 4HRVA 2HT1A 4B6EA 1NXWA 2BH9A 5AXBA 3NBIA 1ZW1A 1GUDA 1TU4A 3QKWA 4P0PB 2ZU0C 1C1YA 4QUHA 2ZXUA 3DEFA 2FU5C 4JBLA 3A10A 3BJEA 1U8UA 1L1FA 3WZMA 3ZGVA 4EMSA 1ORYB 1THZA 2NNWB 5SZHB 2DEUA 1SH7A 1MX9A 2ZSBA 1SD5A 3FE3A 2YIMA 2HNAA 4ZANA 3CNNA 1KMNA 1M9NA 4TV9F 2IXAA 3G5LA 1V1RB 5H9WA 4Z54A 2BJWA 4NSNA 3IMEA 3RR2A 1ECLA 3K16A 2N35A 3O1HB 4LJ9A 1O8CA 1M2GA 3WZ2A 4HNRA 1Z34A 4QC2A 2QRJA 1FJXA 3O95A 4KAXA 3O7MA 2ZSJA 3DLTA 4HP8A 2IYRA 3O2SB 4UM9B 3BH0A 2XCLA 4L4ZA 4ERXA 5BVHB 4K46A 5AUQA 3E3LA 2J4CA 1HDIA 4DMRA 1KP9A 3HJQA 4ZI2A 3CHYA 4WW0A 4Q7MB 1E8NA 5KWEA 3AJEA 1NQUA 1GTL1 3DDCA 3H1EA 3H9JA 3SZRA 3CIFA 2BF7A 1KDVA 1N92A 2FGKA 2VZ8A 4H0CA 3FGOA 1W1IA 3V7NA 5LUBA 1P5JA 5DCWA 1CETA 2BM1A 3NGMA 5EIBC 1DCTA 1E92A 9GPBA 1WXWA 4P5DA 4R41A 4CM3A 5KPTA 3QTLA 2R25B 4YY3B 4BLWA 3UMVA 4OK3A 1Z17A 3U16A 2ZYTX 4C0WA 1X8JA 5FTJA 1TGVA 1B8OA 1X1EA 2QAJA 4H3KB 3BJRA 2JZ0A 3CUWA 3U80A 1Z2CA 4BX2A 5TNXA 3KT6A 2BUCA 2QZ4A 4PCZA 4JS0A 2PWPA 1RLMA 3N76A 3V76A 1E58A 4V39A 4YAUA 4XRGA 1XTPA 3M3HA 1R3UA 2E1RA 3I73A 3BL5A 4QXMA 3UQZA 3ESXA 3HQ4O 3CA8A 2X42A 4MHTA 1V71A 4J07A 1QIMA 3REQA 1D2EA 4TYMA 5HVNA 4TYQA 2O5RA 3FWYA 4TLCA 4WL0A 4D9EA 4P4NA 3GDOA 1E7SA 3IKVA 4ZV7A 1I30A 2YZGA 4B0PA 1H3EA 2PJZA 4LISA 4JP1A 1N78A 3EXAA 1VMKA 2EQAA 3OLCX 3TTTA 4X7RA 3VU3A 5HF8A 4RHUA 1VC2A 4E31A 2QXYA 1PF7E 2WM8A 1T29A 1Z6QA 3S7TA 2E82A 3DZGA 2DPGA 4BMZA 2RHOA 1UT8A 2CRUA 3S2ZA 1T4MA 4MHSA 5A2GA 1SXPA 2PFKA 7ABPA 1Q20A 3ZHXA 1IMOA 2QF7A 4GM1A 5FTKA 4WNIA 5A1JA 5E1DA 2RB4A 1WCV1 3FPAA 1ZS9A 2ORED 4B85A 4BVGA 3H11A 5GVRA 2WPDD 1UJBA 5KJCA 4PLYA 1N33B 3BKWA 1ZNYA 1Y3DE 1A97A 1FZQA 2LXNA 5EPEA 4ZV9A 3H2GA 3AIKA 4DMCA 2XYRA 1HY3A 5LXTA 3E5MA 4HNGA 5LYYA 3BGDA 2GDZA 1N1EA 5F7ZA 1ZYUA 1P0FA 3F3KA 3KPJA 2EATA 3M81A 2PT7A 1E18A 4GMXA 3WBBA 2JVKA 3T0IA 5IMSA 2RH5A 1IULA 4JGIA 3P9PA 2V9PA 3K9CA 5HUHA 4M88A 1E3QA 5K8CA 2JAUA 4YRTA 5KTTA 1MNQA 2RJNA 1KY3A 3PPWA 2Q1WA 2ZVPX 5AVQA 2RRUA 4ZHQB 1WEKA 2XE7A 2VJLA 4ITRC 2I34A 3HXQA 4OM8A 1VLQA 3HX3A 2JLYA 1J25A 2FRXA 1XQWA 3IVCA 5E3JA 3TSZA 5KNLA 1E2LA 3HSKA 2Y1XA 4BKRA 2KSQA 4ILEA 4AIRA 2G08A 2VTKA 4IHJB 4WXRA 4MDEA 4GKKB 5CPBA 5BXQC 1KEEA 2HCJB 4K9KA 2WJPA 3WWOA 2FR0A 2NSYA 3H2BA 1U31A 5HQ3B 5CGQB 4PPYA 2A9PA 3TRFA 4FDUA 3OC0A 4M49A 3NHKA 1V41E 2JP7A 1D2CA 4MHOA 1PUXA 2CNDA 2AC7A 1GJRA 2VQEB 1SRRA 4U63A 2EP7A 2PO7A 4NH4A 2EV9A 2DB3A 1WKBA 2QX7A 1KQ3A 3I9FA 2P9CA 2VUIB 4RAQA 2BELA 4PNZA 4LFCB 3AL0C 5JDCC 1LD3A 1SCNE 3S29A 3JTMA 3O4FA 2Z3ZA 3SXPA 3D4LA 3LW5F 1M1NB 2B37A 3QE9Y 2GX6A 3GPUA 4C05A 1BX1A 2Q3MA 2Q9CA 2IIVA 3T0GA 1ZUHA 1SVKA 3LVBA 3M8KA 4BTLA 2GHIA 2AE1A 3HXPA 3Q7TA 4S2UA 1GSOA 2WJIA 4ND3A 5AI4A 5A7FA 2OC9A 5IK2A 2OY0A 2UYQA 1QGED 1S1MA 1B0AA 2Y76A 2L0XA 3ESBA 1AO0A 4LN1A 2EP8A 2LNHC 2RK3A 4ZARA 1DRKA 1BXRA 4DR5B 1EHYA 4RLHA 1AUOA 1MUUA 5CT4A 5F3DA 1EFUB 5FUXA 5HGJA 1W0JA 2WIKA 4L16A 3VSCA 1Z2DA 4DAOA 2GCOA 1YWGO 4BAGA 1NN3A 1GSIA 4TTTS 3DLCA 3R0QA 4BO3A 1WZ2A 3VFDA 1Q7BA 4HVAA 1GZ5A 5BNIA 4GZ3A 5B4TA 3CZMA 4CM7A 3CZRA 3Q3GE 2I22A 1OVMA 4C4RA 4QGSA 4BWFB 3E03A 2ZSEA 5JMWA 2DKOA 3AHJA 1QZTA 2X5NA 3P27A 5KTPA 1Q16A 5DSTA 4UD6A 4IAOA 4WOBA 4DR3B 3NGXA 2EW8A 1R15A 3VR2D 4WAUA 1P4GA 4R2WA 1OBCA 4MZXA 4RFSB 2K5UA 3MYRA 1IHYA 3LMMA 1IZ0A 2G36A 4AJ9A 3OO1A 2WYHA 5JZVA 1C3XA 3SSNA 1O6CA 2AFRA 1F2TB 3TECE 3ZI0A 3OJWA 3O03A 3SX4A 5ER9A 3RSHA 4FCTA 1XUOA 4BO6A 2KNZA 1T8PA 4RC9A 2UXBM 3PX2A 2R8EA 1KH2A 4JYZA 4L4XA 3QXSA 3WSVA 1CJVC 2PSHA 2LVPC 2GQFA 3G0BA 4RXUA 1XKQA 2LRHA 2ISCA 1Y4SA 4LDQA 2AUTA 5JNLA 4CQJA 2POQX 4XIFA 1R9JA 4BCBA 3MD9A 3K9PA 1YI0A 3AM1A 4XE5A 4WKOA 2MT9A 3MQ2A 3L92A 4YNBA 1SU7A 3IEMA 2XUGA 2O6HA 3TSYA 5A06A 4FSDA 1EK6A 3ZWOA 4CLEA 1DKOA 5K8JB 3AH8A 1SC3A 2F5PA 2X8WA 2UYCA 3WQQA 2BGKA 4J0DA 2V74B 1YZUA 2R46A 4BV3A 4Q4DA 4DXHA 4H0NA 1FQOA 4BGUA 1W5BA 3LC2O 4AJJA 2EJSA 5KNCH 3HJRA 2B8EA 2OYRA 3QHPA 4FEAA 5AVKA 4C7KA 4WFJA 2VHVA 4UTOA 1IN4A 1AKRA 4GLJA 4EECA 3SP1A 3UK7A 1A9OA 3GJ8A 3AYZB 1EZ1A 1O95A 4AXBA 4DWVA 3A36A 3D6MA 1RXCA 1AGRA 1WL8A 3QENA 4G01B 1SOVA 2P6UA 2FUCA 4WESA 1YOBA 4LKRA 2BSAA 2YL2A 4EUHA 1G5QA 3JRNA 1TB4A 1LBSA 3WFZA 4M0KA 2ORIA 4IBKA 3DOHA 2GBLA 3VR6A 4LF4M 2BI7A 1FEZA 4BQIA 1MB0A 3NO4A 3FNGA 3FZQA 3I04A 4F93B 3U17A 5AQ1A 3C1UA 1SOUA 4GKAA 4S2EA 1SIWA 3JWGA 4DIFA 3R6DA 1D0SA 4B7UA 4KWTA 3ROEA 3LVWA 4FDMA 5GINE 3BDAA 1L5HA 3FPSA 2O57A 4ND8B 4IXDA 3GLIB 3MG9A 5BRNA 1JSRA 1VE6A 4OKSA 4UNIA 1L5VA 2GFQA 4FGUA 2FWMX 3H1GA 1T25A 4QOHA 4IGKA 2HCRA 4JROA 1F14A 5L95A 1MMFB 2XAAA 1PWYE 2W43A 3BMOB 3PITA 4IJKA 2QD2A 4FZJA 1L8AA 4MV1A 4FDTA 4UBNA 2WTXA 1DT5A 2JIDA 4NULA 1V4NA 1X1AA 2OD2A 4URVR 3FYUB 5F23A 5DSXA 1RBZA 4B3DA 1UBOS 1HOXA 5LNK6 4I5GA 3SIPA 3DDUA 5JI3E 4MUFA 3TNYA 2WDZA 2QUKA 2ZJYA 4KBGA 2XNDA 2OWEA 4ZC1A 2O7QA 4LOIA 3MTIA 5ALVA 2XYVA 4RDHA 2OCAA 2GF2A 1N9GA 1DCFA 4L02A 4EPYA 4LYAA 4ZWNA 1O97D 4LYJA 5LQSA 2ATCA 1WPQA 1BE6A 5EKUA 2GETA 1GGHA 1MAUA 1QX3A 3GT7A 5JNVA 1XYGA 1K68A 1H4VB 2XOKD 4ZYLA 3LHKA 3UK1A 1TVCA 2A14A 2XZFA 3E15A 2NN3C 3O74A 1LWOA 5KYNA 2XVMA 1YMQA 1ZITA 4W5RA 4IJFA 3EVZA 2FFQA 3JQCA 1QYVA 2E9SA 4LC1A 4JVOA 5IXJA 3V55A 1ZAKA 4Z4GA 4J94A 4G3XA 1JJBA 1LI4A 1U2TA 4B3HA 5EE1A 2OXTA 1ZNQO 3R2JA 1DIRA 1OPRA 4K9PA 3TDNA 1L5LA 3T3NA 3TLMA 4TTAA 2YV2A 1TEVA 1Z8NA 2WP0A 4H1WA 1KI9A 4MVWA 2QRGA 1JQDA 4PONA 1RMTA 1LPMA 3D2BA 4G1MB 3DBOB 4DCUA 4N1AA 1CD5A 3ZIAD 2WAXA 2Y0CA 4WBNB 3A9UA 3O3OB 4Y2YA 2YXEA 5CHEA 3P2OA 1DRWA 3IKJA 5JWHA 1WCYA 4U6NA 3I64A 2FPPB 3PF9A 1H65A 3VC1A 4YRPA 2QL9A 3ZWWA 5FWYA 2HMTA 1UJ5A 2JZ1A 3P9RA 4HR7A 1DAHA 4V02A 2OK8A 3KSMA 4QJIA 5ICEA 1NXSA 1QH1A 5FX2A 1LZKA 2QTBA 4TSFD 4NV0A 4BLUA 3B6JA 1EESA 4L4YA 4AZ0A 2P0AA 1XA3A 5LSAA 2XD4A 4GGOA 5IVIA 1UK7A 2V6JA 1OFUX 3A70A 1M75A 1PYGA 5IPFA 1VPTA 4H7KA 3ZXUB 1LTHR 2DERA 1SVUA 4XX0B 4AK9A 1N5LA 2JBWA 3K8QA 3UVEA 2W6IA 3P2KA 2JI4A 4WZBE 1VKHA 1XXHA 3WY9A 1BS1A 2J4DA 1R4GA 1HLDA 2IUFA 2XUQA 2P91A 2IYPA 2GEDA 1YCDA 1WNTA 1VMAA 3IHTA 3N8NA 4L78A 1D04A 4E6PA 3HGQA 1E59A 1OXBB 1X0VA 2ZZNA 4REMA 2H6EA 3DV0B 4DR6M 2QQFA 1R5JA 4P84A 1VE9A 5HCNA 1PBNA 3IQIX 3DBHA 1LPAB 4LV6A 4EGJA 1G4HA 4BFZA 2DZLA 1OI4A 1JDNA 2DCMA 1KFCB 4TTIA 1UH5A 1EE9A 1Y7LA 3AESA 2QL7A 1LQUA 1KQFA 3HC7A 1WF3A 2WSYB 4C0LA 4YT8A 1TO1E 4OYLA 1ZFNA 5G1NA 2P3QA 4IP0A 4NZMA 5K09A 4MUIA 1E63A 4FNGA 3L7AA 3WIUA 5D87A 2VH1A 2ZUEA 3BXPA 1C9JA 1UBEA 1Y82A 1FJGM 3TL3A 1ISSA 1AUVA 4WZBA 2VXCA 4IZIA 5ILQA 1WMSA 1RPJA 3RW9A 5E3HA 3N8DA 5DH9A 1NYRA 2AF4C 4KHZA 1MRSA 1RS0A 2EGHA 1XN4A 4GP6A 3OLZA 2HIGA 3RFXA 2X8LA 5IKPA 1QQAA 1LQ2A 1EGHA 1RWXA 3C3WA 2ZIEA 2FPMA 2OD9A 1IPHA 3L1UA 5BSWA 5FWNA 3NI2A 4FXPA 2FHSA 1B7GO 2B36A 4RY8A 3KYBA 2QQ0A 3KWJA 4EFLA 2VQFB 3GELA 4TWAA 1E9BA 3LBNA 4JEIA 3ZHCA 3BK2A 1VEGA 4BE4A 3TTSA 1VJCA 2WSEF 3FTCA 1ZOLA 3M70A 3PC6A 4ZZ0A 2J41A 4P80A 4PTLA 2HLPA 3A9RA 3ASVA 4NZYA 4KHPM 3F5QA 2HGZA 1GQSA 3NX4A 3KYCB 1QOZA 2WRZA 1JHOA 1YBVA 2FWNA 3U49A 4XGIA 1EFTA 4W99A 1H5QA 4N3BA 4QXRA 3W2EA 1PSZA 1ECGA 3OOEA 3ZV3A 1QUFA 2UU9M 5CFNA 4C06A 2FCRA 2CDCA 721PA 1F4IA 1LTKA 1FE8A 1R10A 3AR3A 5JLJA 5TGZA 1IEQA 1HYQA 5C52B 2OXFA 3LQQA 1GZ4A 1JA0A 3CG0A 2WI8A 2P7HA 1U11A 1JTEA 2OESA 1M2NA 4KX5A 3WXMA 4LF5B 2EOAA 2CL0X 1K8XB 1A71A 1I6LA 1XEFA 4K1LA 2QL6A 3VKUA 3HU5A 4KIUA 3FAKA 1VKOA 1A8PA 2Y20A 2XDQA 3Q6IA 5SZJA 2D0IA 3T5PA 2HBRA 3K0BA 3INNA 3I37X 1AY0A 1E0DA 4FINA 3PT9A 2GKOA 2Q1UA 3GGJA 4F7DA 5ICGA 1CXZA 1XZCA 4C2AA 2VHZA 3K0CA 4ON9A 2L69A 4ISBA 1BQ3A 4YV1A 2C58A 2EP5A 1XAHA 2GQ0A 4O02B 5EZSA 1EINA 8ADHA 4MGKE 1VZ2A 3TNLA 3ONNA 3JQRA 2PUTA 3WL8A 4D4IA 4RGVA 3DMHA 5G3YA 2BTEA 3KK0A 4MUBA 5T3YA 2QRNA 4EUSA 3MZ0A 3UUEA 3FW1A 2OORA 3ZHTA 3TFQA 1DWOA 3MS7A 1X7XB 2LVBA 1GPKA 2NTJA 4BE9A 3G0CA 1ZMWA 2XXBA 3MGAA 3TTXA 5JCOA 3FTEA 1Z59A 2EL9A 3CF4A 4IINA 1D2GA 4WV3A 2VNIA 4EENA 4YUAA 1QR2A 1M6HA 4IDGA 2DAIA 4E5MA 3DEHA 4OQEA 1TA0A 2MR5A 5ECWA 1JH9A 5JTTA 1O96A 5IBQA 5LN1A 4J03A 3QQ5A 3TKLA 3ITNA 1BVHA 1IPFA 5F64A 4KH1A 4CQLB 3WBKA 1ESMA 1KSHA 3KB6A 2ZPAA 4BX8A 4ZJZA 3E3NA 4NBKA 5FOVA 5TF4A 4OHRA 1Z2EA 5DHQA 3QNUA 1YRBA 2GMWA 2CBXA 5I8PA 4JLPA 1PR4A 3PRHA 1YRLA 4Q7KA 4HDNB 1Q15A 4TTJA 1YI1A 4C7OB 4XDGA 1MIOA 3HZZA 2XI4A 2O14A 4K88A 4DLSA 3G5AA 1IY2A 2X9QA 1U7XA 3IP9A 3M5PA 4QFCA 4XFDA 3QYPA 4AZ3A 3EIXA 3GWZA 3B1KA 1GAXA 5CJ2A 4DV2M 1I2BA 4WNCA 1FQJA 2IY8A 3D8BA 2B1RA 3M7GA 3Q2IA 2RGBA 3EPLA 1OAOA 3TQCA 4F86A 4E1BA 2BHNA 4QVIA 4LY9A 3SEAA 3UK6A 1U7WA 3DTVB 1UMCA 3HEBA 2X0FA 1RI4A 2YDYA 5HDBB 2FN8A 5JSKA 3O3CA 4L1KA 4IBDA 4ZKDA 4HH1A 4WN9A 1Z62A 3F92A 2VHEA 3K2IA 4JMLA 4PTYA 3PFKA 3RREA 4C3VA 3E22B 1F4LA 4MV3A 3HZJA 4KXVA 3TW8B 2QVGA 2L2DA 3EIHA 1T8WA 4KAAA 2ESRA 2Q2OA 3RTEA 5IBRA 3ZD6A 3DJFA 1TQ4A 1T15A 3IGFA 2XE8A 3QOFA 1Z06A 2JD1A 3O9ZA 1II8A 5JVDB 4Q21A 1HYHA 4IMRA 4INZA 4P3KA 5F3RA 2TECE 3DBRA 3W6ZA 2X4GA 2X4DA 5E7QA 3TMKA 1KDTA 2AOVA 4Y2JA 1N3YA 3RGWS 4GSLA 1GR0A 2QVLA 2AOUB 3DLHA 1SMKA 1EQAA 3GROA 3F3MA 5DTRA 1H1DA 3HZHA 1RVV1 5GJVC 2XKKA 4LSMA 5AI8A 4A0RA 4BNHA 3I05A 3LLCA 5C46F 2DPLA 1E6LA 1E5XA 3JQAB 1R5OA 5H3LA 2KRUA 3ACCA 2AIRA 3RPEA 4LF6M 4KXYA 1DKPA 3H5AA 1XMXA 1G7TA 3VTFA 3CLKA 1QANA 2I7TA 5CYOA 3SEFA 3PQ4A 1QTRA 1E61A 3KUUA 1XMVA 1C4XA 3ZCPA 2JRLA 5LZ5A 5CDHA 2YWBA 3GF4A 4JI5B 4E7PA 3AXSA 4PLVA 3EIFA 5BUCA 3UAVA 1CV2A 4U9IS 2QJTA 1FY2A 3KNZA 4OIMA 4OHZA 3KTDA 3VR4H 2FX5A 4E03A 2Z1DA 4PGGA 1PT7A 1P45A 3HYNA 2VK4A 1VIYA 1NDUA 3QBDA 4Q66C 5CX1B 3L49A 3B6ZA 1W94A 1YASA 2N46A 2WWWA 1NDQA 3MXOA 1EUCA 1DRVA 3I2YX 1L4HA 1W1WA 2IF2A 1Z0KA 4YJ3F 1GGJA 3AB7A 4W6QA 4TUYF 1KPHA 3DAFA 2ATIA 4E4TA 2H5JA 4B31A 5C7YA 3ZYZA 1P6XA 5C35A 3QFSA 3UJ8A 4AMGA 4ENPA 2PO5A 4JAVC 2QD1A 1DC3A 3N0XA 4XA8A 4MRSA 1MHTA 3JQ7A 4XLLA 2QLTA 2B0JA 4MKZA 2BEVA 2HU8A 4E5SA 5KOHA 5GV7A 1V8OA 3VDNB 3N70A 4TYNA 3HL0A 4LXUA 1JZTA 2VDBB 2W8ZA 4PSVA 4DIMA 2Q3JA 3KFLA 3OT5A 3OE1A 4MLCA 1LKZA 2G70A 1JI3A 1JPUA 2JI8A 1YAJA 4XJXA 4KMRA 3VVLA 4JI0M 1T0JB 2XIQA 2ZRHA 1FMJA 5HRCA 3KPUA 3QV1A 4YAWA 1ANKA 1FPQA 3HI6A 2QTZA 1E5LA 1THTA 1TVKA 5KNBA 3QSYA 1G2OA 1NW8A 2X4IA 3JARB 3OCJA 4PZYA 3WK9A 1SK8A 1HNZM 1I8TA 1NVUQ 1X1TA 3PC8A 1OXTA 3STVA 4J16A 3ZHSA 4OQXA 2VJQA 1P3Y1 1Z12A 1POWA 2W71A 3S99A 5DP2A 3WIDA 1XNRM 3DM5A 4MW4A 3K9GA 2YRXA 2ZDQA 4XSVA 2P9EA 1SVWA 4NNOA 2YMMA 1COWD 1OH7A 2O2XA 3B1WA 4KVZA 3QXXA 4MWBA 2X0RA 2FR1A 4GBGA 5K2OA 4C14A 5B58C 1P6UA 3C8ZA 1DSSG 4L95C 1PE0A 1DADA 2C4KA 4KPEC 1UFQA 1CUGA 4RK0A 3DA1A 2H8KA 3TWKA 4GOJA 1GRRA 2NTNA 1FFXB 2XRMA 5BSVA 4MQFB 3NDRA 1Y6ZA 1H4TA 1PFWA 3OTIA 2CHQA 3EZ9A 1RKBA 4GL2A 2R68A 1QRTA 2AXPA 3LCCA 3U7RA 2ATEA 2R65A 5HZHA 1WHCA 1TU3A 1VSTA 4H7EA 1UK9A 1ZN9A 1P2TA 3RCBA 5FBRB 2QRLA 1Z39A 4UQLA 4HEQA 1DHRA 1E99A 4ZVQA 5DF1A 1AX9A 3T3MB 2IKSA 2HA2A 2RHBA 5KDLA 3I01M 4KMSA 1RU3A 3TZ6A 2GYVA 3IBGA 4OMDA 3MXTA 4X8HA 4L3OA 4B76A 4EDFA 2IUUA 4EITA 1E5VA 3KWFA 1IDN1 5ADUS 1NMYA 2F3UA 2IS4A 3ZE8A 4U0KA 3QF4A 2Y05A 1FYWA 4ZQIA 3URMA 5I9LA 1GKYA 1PW7A 4UKDA 2OC4A 1XRQA 1GV0A 4KBYA 1QKIA 1CUJA 4FPXA 2I65A 5IUNC 5KJ6A 5AIAA 1TTHA 4LXGA 4IMIB 1VEKA 4D79A 4TTSA 2GZHA 5DPMA 1L5OA 1B8PA 4DDMA 2WIBA 4Z4FA 4PZCA 3GJRA 4PGHA 4O2LA 2HF8A 1N0WA 4M1SA 1RFLA 1C9EA 1RQLA 4AO8A 4PC3A 5J63A 1XP8A 5CA0A 5DRTA 1M66A 2CN1A 2BMVA 4OVZB 2EKQA 2XODA 1SPBS 1MZVA 3M1LA 1IVSA 3PKZA 5L51A 4JASB 4YWHA 3RRBA 4IJMA 3ADDA 4AF8A 3PA6A 1OKKA 4ATNA 2UVPA 3K5PA 3WYEA 1PNVA 2C3PA 3HHWA 1GA4A 1KAQA 1UUFA 2YH2A 4ZQEA 2C59A 4QUIA 1FXWA 2V5UA 1N5KA 3RANA 2BY4A 3BL6A 4Z7OB 1ZL2A 4Z3DA 2W0MA 1O0SA 4C7BA 1ZRNA 1Q6ZA 2BSQA 4G9EA 4RETA 1YBAA 5JOQA 4OQZA 5IT9S 3A98B 2CNWA 1P33A 1FFSA 1EWVA 3CE9A 4WOKA 4NZNA 3FOBA 1Q3HA 2Z4TA 1ZXLA 1ZHOA 5HGXA 3EFOA 4LCJA 4E5YA 1X7ZB 3LD9A 4KPYA 1IEWA 4MPPA 2QY9A 3QPWA 4TKVB 3T6KA 1IHXA 4R2IA 3MTGA 5AW0A 4E32A 1M1ZA 3COYA 2UVQA 5C1BA 5JMPA 3TOZA 5ADVA 4FDAA 3RYIA 4RM2A 2XFTA 1VHDA 2B25A 1X9GA 5EHGA 3ROPA 2FRVA 4KKVA 5KSWB 3I0ZA 1QCCA 1Q7CA 4CV3A 1EKXA 2GUGA 1PFQA 2EKDA 1HPLA 4RJKA 4ENWA 3R7WA 3RVRA 4DM7A 5C8DA 4KZKA 1PHPA 4F4FA 1C1DA 1Z4KA 4S04A 3P19A 4EJ0A 3K3PA 2YINC 3TCNA 5IKMA 4W1RA 4J9VA 3IAFA 3ZG6A 3H0KA 1KFBB 3GH1A 2RARA 4U7HA 3ND7A 3HCAA 2PKXA 1BWPA 4YT4A 4NZPA 3KJFA 4ZICA 4P4LA 4DUPA 1YD7A 5AM2A 5IK2D 821PA 1JB9A 3VX3A 5B7QA 3TINA 2FI1A 4JQYA 2VBGA 2J3MA 3IKMB 5KMGA 3IR6A 3U3XA 4CF3A 5I9NA 1KAHA 2D3TA 5A5EA 5ICCA 4MW2A 1QIJA 2CBZA 5ENVA 1YJQA 2DTXA 2L42A 5AM0A 4AICA 1WUJS 2CJXA 4F2GA 2DFKB 2JLRA 5JYEA 4FR2A 4R16A 4RH3A 1F7UA 3A0UA 3NEAA 5LMNM 4RACA 3M4YA 3IJPA 1KEPA 5HR5A 2IFTA 3T1OA 4NFSA 1YUBA 4WXMA 2YMQA 1Q2UA 5J4LA 1M0WA 3RC2A 1YFJA 2LP4Y 2QE7A 4OB8A 1WABA 2BJHA 2QTVA 2Y77A 5L3QA 3QPDA 4JYCA 4HAZA 3EEIA 5CYPA 2A4KA 4YRRA 3EVGA 2RGOA 3RIGA 1OA1A 2A0KA 3OKCA 4DLRA 3VJRA 3IO5A 2WWYA 1BXZA 1ZOSA 1E2FA 3F6RA 4P35A 4PX5A 4DDTA 2Q1TA 1TF0B 2VTBB 1T9GS 3DLPX 4ND2A 3SYNA 1NRIA 1NYQA 2GA8A 1GJSA 2CEAA 3CX8A 1LUAA 2YNMA 1PJLA 3KQQA 4MJLA 4A6DA 1UP7A 4KV9A 2PGOA 3ZS9A 2WAYA 2IOQA 3PNKA 3RVSA 2QQ8A 1BDBA 4FYKA 3U3KA 4UAJA 1PJAA 3TM5A 2YXPX 5E8JA 4QUDA 1E8MA 1UFZA 2VDRB 3PUXA 4TXNA 3WXBA 4BO0A 5K4AA 3OQNA 3G8AA 1L5ZA 5IZCA 3P5BA 3ETGA 3TAUA 3SR3A 5DNVA 1J9ZA 1ZGJA 1LQTA 1W85B 4Y9RA 4MIEA 4JSRA 4DV3M 4CF5A 2H00A 2JLCA 3B3FA 3PPXA 3T1YB 3OEEA 3BRWD 2PIDA 2GJKA 4DMLA 3DBLA 2O3SA 3NT5A 5ALXA 3ZU4A 3R0ZA 4O4HF 2AFIE 1GU1A 1L5SA 1ZQ9A 5ALKA 5MFZA 1AKVA 4YXWA 4Q9JA 5DXJA 1KSGA 1WJ7A 4ZHSA 2DP4E 2NV0A 3OTOB 2HA5A 2FH5B 1KAGA 4PIPA 1XFDA 3OHSX 4GICA 4A8JA 5FFMA 1ZQ1A 3L1KA 1IJBA 1QAMA 2Q0QA 1JNXX 2B4KA 1FFYA 1QLJA 3L7NA 1J1UA 5BVGB 3VR6D 1XNGA 1UKYA 4KXWA 4Q4CA 4G0UA 4N82A 2GEVA 3I23A 1NHGA 3IP5A 2UZ4A 5C8VA 2VZLA 2FUNB 2OBYA 2FFHA 2IS1A 2FG7C 3SIRA 4YDRA 2VDUE 1M0TA 4H17A 4HS4A 5F2EA 1WLSA 4RH1A 5FDFA 3HFGA 3IPRA 1PSDA 1QH8A 4X66M 5EJIA 2RHJA 1S2OA 4ZK2A 4LMBA 2BKAA 3WLKX 2F55A 5D01A 1TDZA 3UJ9A 4W5TA 1FB5A 2OL4A 5TMDA 1I01A 3CO5A 3GA5A 5A3RA 1QAOA 2I2BA 2DH5A 1ZHFA 2M6KA 4CU5A 4EB6B 2ZE5A 1HKUA 1FFWA 4UASA 5EJEA 2RBKA 4PIVA 4NZZA 1SVIA 2X0IA 5KHLB 2FPIB 1D1TA 2R2GA 1TYCA 3AX6A 3AW9A 1Q1EA 1TJPB 3N0TA 4IGFA 1OZHA 2FETA 4AROA 3TI7A 4DSTA 1RI1A 4PX9A 3UCXA 7REQB 2XNDD 3H5WA 1FBTA 4WDQA 1ESEA