2XSZD

The dodecameric human ruvbl1:ruvbl2 complex with truncated domains ii
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
331
structure length
310
Chain Sequence
GAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIHTVSLHEIDVINSREIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Insights Into a Dodecameric Molecular Machine - the Ruvbl1/Ruvbl2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords RUVB-LIKE 1
total genus 93
structure length 310
sequence length 331
chains with identical sequence E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06068 TIP49 TIP49 P-loop domain
D PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xszD02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xszD01
5FOVA 2XXAA 4PSKA 3T06B 5JS8A 2Z0MA 5CYPA 2W0MA 2ERYA 1D9ZA 1EX6A 2P0EA 4E09A 3UPUA 1EFRD 2FGJA 3THWA 4I1UA 4JT4A 4HAVA 4HLUA 1D2NA 4Q1AA 4G5RA 1NKSA 5BN3A 4M1YA 4NPHA 3ZVMA 1AN0A 2QP3A 3KKNA 1LNZA 5CK5A 4BZPA 2OCAA 1WCV1 3RS3A 4WXRA 2BBOA 2BEKA 5KTYA 1E4VA 1OB2A 1Q1ZA 1G8PA 5FL3A 3TUZC 1QG4A 2ZAMA 4EAQA 1KJZA 1VCMA 1XPOA 3AUXA 3QOFA 4U5XA 2ZU0C 2NPFA 4GMXA 1DG1G 2I1QA 3H0KA 4YDSA 2BWJA 3OEED 2QRZA 2QSZA 3KKMA 3U7GA 2QEQA 5CM9C 2RB4A 2C95A 3HYRA 2BMFA 1QVRA 4AURA 4MDFA 1W36D 1PV4A 4C30A 4URWR 1XTJA 3R9IA 1T3SA 1XMJA 3RS7A 4TLDA 2DFKB 2WSSA 5KNCA 1Z0JA 5AJWA 5K8TA 3U7FB 3HU3A 3WHLA 2FN4A 4MGIR 2IXEA 4AY2A 3GJ4A 1FQKA 5FTKA 2IUUA 4C0SA 2UKDA 2GCOB 4RSGA 1ZM2A 1T0HB 4DWJA 2N46A 5LDDC 2A5GA 1M74A 2X19A 4WAUA 5HKKA 4AKGA 1JR3A 1KMHA 4YXWD 2H17A 4QC2A 2R6CA 3AP3A 4PC1A 3RRNA 1E98A 4V0LA 2HYIC 4TL8A 5JSZA 5B58C 4TWZA 4GBMA 4PHHA 1SVLA 4IEIA 2Q0HA 3QKRB 1ZD9A 1ZUHA 2PT7A 4G5SA 4KU4A 2FZ4A 3B6EA 1I2DA 3SNHA 3UMRA 3W5JA 4CYMA 4C0AC 2OHFA 2GTPA 5DGXA 3NBZC 4GL2A 3EZFA 5CLQA 1T8UA 1FP7A 1SXJC 2YWFA 2OCYC 3RWOA 5KOYA 3NEJA 3MWKA 3ZIAD 1L7VC 4LDJA 4C0KA 4KHZA 1DO2A 3QXXA 4J0QA 4ACBA 1R5NA 1L4UA 1P9RA 1VDZA 4HZIA 2VTKA 4BASA 4EPVA 4QBIA 4P4UA 2N42A 3A8TA 5G40A 2GEVA 4JKYA 3RHFA 2JLZA 3B13B 3BH7A 4WZ6A 3I73A 1SKYB 3CRQA 2RMKA 5CYOA 1G20E 4IW3B 3PENA 5L3VA 2GK7A 1UEJA 3CRW1 4C2UA 1G4AE 5DN6D 2ZJOA 4JYCA 3IQWA 4JT2A 5TV2A 3GFPA 3GQBA 1B23P 1HQCA 5DISB 2FSFA 2V1UA 1OXUA 2FU5C 4FWGA 3KKPA 4QBGB 2GVZC 3EA5A 4MRRA 1YKSA 1TU3A 1IM2A 2ZS9A 1XNJA 3FHTA 4RD4A 5FOSA 4M8NE 2WJHA 4OJKA 2NG1A 4NYJR 2BHRA 1NSFA 4KXFB 2AXNA 5GVRA 2QTFA 3T1QA 4Q00A 4JZKA 3T15A 4NL4H 1QZMA 1OH5A 3R9WA 4QM6A 1NN0A 4B47A 3BB3A 3NBFA 2OXRA 4W7SA 2ZRLA 1G7RA 1UDWA 2P67A 4R98A 4FXPA 5KSOA 3FDIA 4R2IA 4BECA 4PQRA 4LOAA 5DNYB 2IEYA 4UXHA 5EUMA 1JEDA 4DDUA 4A6PA 1FQJA 2W2TA 1SQ5A 2QT1A 3A4MA 3BFXA 4N0DA 1N5KA 1NG1A 2AN9A 4QGAA 4LUCA 4QFMA 2J0SA 2ASEA 1W44A 5EXPA 2HEIA 2XZOA 1JXOA 4C0HA 1GWNA 1OYWA 5P21A 4BWYA 1T3LA 4GITA 4GI7A 4WBSA 1E0JA 1VYVA 4QNMA 4I1OA 2EU8A 4WZBE 2XTNA 5FPTA 1FX0A 1R8SA 1OT3A 1OF1A 4M22A 4D0GA 1W4BA 2EFGA 3GLFB 2OAP1 1Q0UA 1T4GA 1YZTA 3PQCA 2AWOA 4CEIA 1D5CA 3NWJA 4TLEA 4TZ6A 3DM5A 1W2HA 1EFTA 5JRJA 1W1WA 4TN1A 1OKKA 4NH0A 4Q1EA 2O8BA 3HP1A 1R2QA 3W34A 2R44A 1EFUA 2R6GA 3ZZUA 2BBSA 4BEBA 4EQ6B 1ZIPA 1RE0A 1SVIA 3AVUA 5JI2E 4TLBA 4RD2A 2RGNA 1M7HA 5KSZA 3BAFA 5AR1A 5KO2A 4RCYA 2DHRA 5FBVB 1KHTA 5HKKD 4GOKA 2YOGA 2FE4A 1EXMA 2RGGA 3FVQA 1IHUA 4PQYA 2QBYA 4M9XA 4X8LA 2JASA 4F4IA 3RNLA 2Z5FA 4JN6A 1NL3A 4LCBA 4FMDB 3WRXC 5D3QA 2YHSA 3FE2A 1ZD8A 1IY0A 3FMOB 5EE0A 5KPDA 3PEWA 2P2LA 3AUYA 4BGDA 4DZZA 4PTLA 5EZ5A 4NCHA 3BE4A 4TSFA 1Z0AA 2GKSA 1JJ7A 2WHXA 4RFVA 4U00A 4MRNA 2J3EA 1IBRA 4RFSA 4XJXA 4QKQA 3ICEA 1XP8A 2XJ4A 4G5GA 4QG7A 2VIIA 3JZAA 3WP1B 1BMFD 3L0SA 1LS6A 2ZROA 3A58B 4G5QA 5J40A 1G7CA 4KJZA 1J99A 2VLIA 1HTWA 1MOZA 1N5JA 3L43A 3LBIA 2F9LA 1WBDA 4H1VA 2P6RA 1E1QA 3AP1A 1P9NA 2DFTA 3AJIB 1UBEA 5DIFA 2NQ2C 1W4AA 1S9HA 4TL7A 5TDHA 1X3SA 1KZGB 1TMKA 1W48A 4C0BA 1W7AA 3L0OA 4AI6A 4B2PA 4P3YA 4E03A 1XMIA 4QL3A 3PVSA 1S4QA 2EWWA 4PHFA 3TJZA 3U6BA 4ILEA 1G3RA 2Z6VA 4TSFD 4IFBA 3BERA 5AJXA 3UWKA 2BMEA 3I72A 2WWXA 3ZS9A 1ZUNB 2JEOA 3DPUA 4BLRA 2C99A 2IK8A 1LF5A 4DKXA 1KI8A 1WRBA 1XJCA 2D3WA 4A0GA 3DO6A 2TMKA 1E9RA 221PA 2GESA 2F7SA 3HWSA 2BJWA 4U7DA 1XZQA 3K0CC 4D0NA 5FOTA 2GZAA 2IYRA 4EFLA 5H8WA 1ZW6A 3Q9LA 4HYYA 3TVDA 1MRSA 5SZHB 3GJ0A 1X8LA 3FWYA 1QRAA 3TAHA 1AGPA 2PMKA 1XFAA 3DMNA 2WV9A 3KFVA 2XSZA 3OFND 1DAIA 3AVYA 3QVVA 1M6NA 1OXXK 1EX7A 1F2UA 2A3RA 3U7HB 4WVFA 3GP8A 3VKHA 1JR6A 4TQ9A 3TH5A 4N1AA 1XTRA 5J4HA 1R0ZA 1ZMXA 2CBZA 4NZYA 4TZ0A 4JJKA 3X1WA 2J46A 4DIEA 1SXJE 2J41A 3PUWA 3U44A 2XZLA 2OSBA 3MWLA 4M21A 1VTKA 2ZI6A 3ZJYA 1KSHA 1U2RA 3M1IA 4TLAA 4RY2A 1QHGA 1X37A 4B3XA 3U4QB 1O87A 2A78A 1V5WA 3IKJA 3FMFA 1N6OA 2QSYA 3MJRA 2YINC 1D9XA 1GTVA 5FH9A 3SYKA 3U6KA 3AH8A 1N25A 1A4RA 3KZ1E 1HT1E 3WYGA 2J0VA 3EZ7A 1DOAA 4BLQA 2JJ1D 1GL6A 3VR6A 2YZ2A 2ZYUX 3PIRA 3LQRA 2OV2A 1IN5A 2ZRIA 1Z6GA 1W5TA 2HYDA 1N6HA 1Z29A 2WAXA 2LWIA 2NO6A 4ITRC 4A9AA 1BYIA 2QM7A 1BO6A 3SU8A 4KCGA 4TMVA 1UKYA 3PEUA 2ZR0A 4CF7A 3T61A 1JAIA 3TVTA 3DZ8A 4DT1B 1A82A 1A7JA 2FMXA 1UKEA 1N6NA 2DFNA 2P5TB 3I3SR 2WBLC 1T5IA 3OHMA 1T91A 4DLUA 2ZETA 821PA 2F3TA 4QGGA 5KDDA 1DG3A 2Q9AA 1GDDA 3NH9A 2GXSA 3W5IA 4BFYA 2DY1A 3ADDA 1US8A 5HTKA 1G8YA 3U3KA 4CEJB 3O8RA 1VYUA 2ZU6A 4CT4B 5CDFE 2C5LA 3TAUA 1UADA 2G0TA 2IC5A 3C4JA 1IJEA 3K1JA 3A1TA 4JBXA 3C5HA 2OCBA 5LB4A 4D2IA 2ZSBA 3LRPA 4B44A 3KDSE 1AIPA 1AM4D 3W3ZB 3O47A 2NO9A 2O8CA 1E9EA 4LJ4A 4EPRA 1PJRA 3IO5A 1OH6A 3N2EA 3SOPA 3CX7A 3QG5A 2G9NA 1E2IA 5CJ2A 2XTMA 2C03A 4MGYR 1IN4A 1Q1QA 2F1JA 1J2JA 3ASZA 2FSHA 5FUWA 5EP1A 1IOZA 3FHOA 5AJVB 1LF0A 3SS8A 1E0KA 2REBA 3GLFE 4RZ3A 4PAOA 1RRCA 3AVTA 4AKHA 3I92A 4PAQA 5B64A 5JI3E 1MO4A 3EIQA 3CPJB 1QHHB 2I3BA 1KNXA 3PEYA 4TYYA 3DVLA 4V0NA 5K8UA 2WWYA 1E2GA 2OT3B 5C1BA 4B3FX 3AVPA 3AVVA 4MGKR 2ODBA 1UFQA 1GRQA 4L5BA 1ZVQA 1FX0B 1Z6AA 5CM8B 4EPTA 4ZI3A 3EC2A 2CLDX 2OG2A 5FUXA 3IDQA 2G77B 1X1RA 2EQBA 5HCNA 2HCBA 3HYTA 3NDPA 3IUYA 3RLFA 4EJSA 2F55A 2GCOA 1U9IA 2QE7D 3MD0A 5FBWB 1G8HA 2WJVA 5FTMA 4DCUA 4OHVA 2ZR7A 1VCOA 4DDVA 3E1SA 4JSYA 1DO0A 2EFDB 2Q3MA 4KITB 3U3RA 2CEAA 4LX0A 2JLWA 4DCVA 3SJZA 2AR7A 4JLNA 1YR9A 3Q8XB 4FMCB 2BM0A 4BLOA 5FPYA 4AYWA 1AS0A 2IXGA 4PPQA 4KYIB 3C8UA 4HSEA 1E9CA 3VHXA 2KBFA 4LRSA 1CR1A 2J9RA 4NP6A 4YLGA 3OEEA 2IS1A 1UJ2A 1VIAA 2H57A 3E70C 2GK6A 2B7BA 5A0FA 4CIDA 4Q66C 4Q5IA 4UNQA 3CF2A 3QBVA 3R9XA 1G5TA 3RDPA 1N0WA 3N70A 2HT6A 1MABB 5BWMA 4XVUA 3GCGA 1COWD 1OW3B 3HDTA 5AUNB 2H18A 3ZH9B 2NO7A 4K8OA 3F3YA 2GETA 1E0SA 4URXR 4LC0A 2RAPA 4P4SA 5DYGA 5KYKA 4EPXA 2FPKA 3E2IA 2FF7A 5KUTA 2YWEA 4WXPA 4W9MC 3LW7A 1IAQA 1CRQA 1XD2B 2VL7A 1KJYA 4XSHA 2OXCA 4A8JA 4EDHA 2DWPA 2W6IA 3KJHA 2GDJA 4US2R 4QNRA 1G64A 3ZS8A 4ZV4A 2XOKD 4IRUB 4B6FA 4C3ZA 1CF4A 2YNMA 4LYJA 3MFYA 4XD7A 3NG1A 5HCIA 5IF9A 2VP2A 4WW0A 2XOKA 4G5OA 1LTQA 5DO9A 2G83A 3QE0A 4DEXA 4N3NA 5ELXA 1OH7A 3AF0A 4Y0VA 3RS4A 3PUYA 1NI3A 1M1YE 2YOHA 4HB3A 1YJ5A 2ZE6A 2WMNB 3QKSB 1KIMA 3MG9A 1PLLA 3RS2A 1J90A 2BEJA 2V4ZA 1QHYA 2BV3A 4A6XA 4IJMA 4KBFA 2VH5R 1E9FA 2A5JA 4BFVA 1F3OA 4M4SA 1G19A 1VECA 4LJYA 3OE7A 4BEJA 2A5FA 1P73A 3A37A 3MWYW 2OILA 4PHGA 4O3MA 1U98A 4IOJA 5AUPB 1K5DA 1P7CA 3J81k 2IWHA 2CJWA 3MJHA 1F2UB 4JVLA 2QPTA 2R6AA 3TBKA 1J8MF 1R7RA 3AP2A 3GLGE 2GRJA 4KI0A 4Q9IA 4LJ7A 1VHTA 3ZVRA 1W0KD 4XTCS 1BMFA 3CWZA 4PC7A 4O25A 3VU9B 1IY2A 4QBFA 3KUCA 4O2RA 3GJ8A 3ZIAA 1UEIA 1JNYA 1AZSC 1ZUIA 2QENA 2IWRA 1X8JA 4BE7B 3T5DA 1WB9A 3U3OA 4TYQA 4Q4LA 4DLSA 4PPGA 4K46A 1T0JB 2JJ8A 2WSMA 4GFDA 2D06A 3CF0A 4HAZA 4AG6A 5K8LA 4G0NA 3FKSD 4O0MA 4Q02A 3L8ZA 3GEHA 4KSBA 2MSDB 4V0OA 1I4TD 2IYTA 3K0FB 3KJEA 3IHLA 1YRAA 4Q1DA 1D6JA 3QXCA 3CONA 1CR4A 1K8RA 2P3SA 1G17A 5DN6A 1E94E 1DAEA 3VX4A 5L3SB 1F5NA 3GMTA 4MQBA 2GF0A 2IUTA 2LCFA 3KJIA 3IBGA 5D3MB 3EW9A 2WM9B 1TF7A 2A5YB 3FKSA 2WWHA 4DUGA 5KPJA 4HZUA 1MO6A 3L2OB 3AVQA 5SZJA 1XX6A 1N6RA 1CRPA 3KXLA 3WYFA 5JCPA 5JS7A 2Q9BA 1HYQA 3RVBA 3NDBB 3SQXA 3EASA 1NN3A 4LYAA 2QAGB 3AVXA 2GEUA 3EXAA 4CZ2A 1T3HA 3O8DA 3EWSA 1US8B 4Q7KA 5J4KA 4CEJA 1Q1BA 1RZ3A 2E1RA 2IS2A 1WA5A 2QPOA 1W46A 2DCUA 3MRSA 4LC1A 5EQTA 4N0EA 3MMPA 4Q1BA 2ZR9A 1KI1A 3EZ2A 4AD8A 1UKVY 4ZDJA 1E2JA 4OHWA 3GLHA 1COWA 5L3QA 1PLJA 1U9IC 2NO1A 4DLRA 1NMXA 2J45A 2Y8EA 1Z5ZA 2FPMA 4DB2A 1CBUA 2PLFA 5DHAA 1UBCA 1E2NA 2XB2A 3CR7A 1N5IA 1M7GA 4EPWA 5AJYA 1NIJA 2IF0A 2OCPA 2ZI5A 2ZJ2A 4URYR 3LD9A 1Z47A 5H68A 1DS6A 3LAWA 3K0AA 3VTKA 1GFIA 4H9GA 1NN5A 4MRVA 4KO8A 2O0KA 3PUVA 2O8DB 1ZNXA 4BFSA 4DB4A 4OHYA 1II0A 1IXZA 5IK2A 1JR3E 2J7KA 4OHZA 3PR1A 4CVNA 1SKYE 2CCKA 3QENA 1CR0A 2DZOB 3U4QA 5E3HA 4FINA 3TRFA 2FFBA 1NRJB 3GJ3A 1KY2A 3NVAA 3B5JA 1U0JA 4NYIR 3AVWA 2VSXA 2X77A 2C04A 3SHWA 1KY3A 4OK3A 1EG7A 3DM9B 4XD7D 2K5UA 4QJ5A 5HZHA 1Q1EA 1YHNA 2GAAA 4CW7A 2GZHA 2JCSA 2LKDA 2IF2A 2FOLA 2WICA 4PZYA 3AKDA 5H1YA 4LJ9A 2ZSEA 1GOTA 2ZS8A 4KLNA 3HR8A 5AUQA 5KSPA 4PSAA 1U94A 4LK2A 5FTJA 4ZDKA 4MDEA 1EFCA 5F9FA 4P31A 5EXSA 2NZJA 3A1VA 5JEDA 3D8BA 1MRNA 4LHZA 4Q4HA 1P2UA 3U44B 3I61A 2F6RA 4ZCLA 4L15A 3W9YA 5AK0A 1ETUA 3ADKA 3CRVA 5BW8A 2QPAA 4PPNA 3QQ5A 1G4UR 2GJKA 1QHSA 2O0JA 1YVDA 2XZPA 5FL7D 3R8FA 3NH6A 2QUZA 4LHWA 4LHVA 1AJEA 3ZQJA 4W5JA 3CLVA 4KFRA 4M1WA 4OBEA 4C0JA 2PZGA 1D8TA 2VA8A 4FCWA 3BJIC 1R10A 2JLYA 4ZCMA 4OL0A 2QORA 5TARA 4CDGA 5JECA 4QHSA 1CJUC 1XCPA 1RYFA 4FW9A 2IXFA 3U61B 4V02A 4ARZB 4BZXA 2WJGA 3QJYA 1Z28A 1L2TA 2OE2A 2VP6A 4BLPA 4WZAE 2CHVA 5KSYA 2DB3A 3WRYC 2P6NA 5UKDA 3K0CA 2JATA 2WJJA 4B3DA 2FFAA 3ND9A 1KI9A 2B21A 4B3BA 3QPVA 5G53C 1XD2A 1AS2A 1ZM9A 4YONB 2J5XA 3KQUA 1YZQA 1DPFA 1E79D 2EWVA 1S8FA 4JBWA 3BIFA 3Q72A 1K5GA 1RJ9B 1WDTA 2EFEB 4IFEA 3WNBA 1N0VC 3QXHA 1ZNYA 2F1HA 3IIMA 5J47A 1YZNA 3QF4B 1GUAA 4V0MA 2RGDA 2WJYA 1TL7C 1XXHE 2WZQA 1JECA 2IYYA 1E1RA 3WBKA 2OZEA 3B9QA 3UG6A 4PC3A 3LV8A 2HXSA 3CW2A 2Q21A 3R7WB 4RJLA 2QAJA 4XSGA 2ZJ5A 2ZE5A 2WPDA 4B48A 2ODWA 3TW8B 1G8GA 3RWMB 4R7ZA 4OQXA 3P32A 1XXHA 2W2XA 1PZNA 2ZYVX 3AF4A 1CLUA 2VQSA 1RRFA 4HAUA 3ASYA 1E2FA 2IL1A 3F5FA 1QHXA 3K0EA 3I4LA 1RIFA 1OXSC 1FMLA 2YWGA 4GZMA 4PC6A 4C7OB 2PJRA 3Q5DA 4EJSC 2WWGA 3BH0A 4QXAA 1CJMA 5FI1B 3SDZA 2QA5A 3QSYA 3W8NA 1W49A 2QG6A 2KRKA 2R8RA 4A82A 2AXPA 4L16A 3ZYCA 2ZYWX 4PPFA 2ZVQX 1NVUQ 3I32A 4Z51A 1NG9A 1KO5A 5C18A 2D4HA 5BYJA 4F92B 2KJQA 3VR5A 4EJSB 2ZRFA 3QUSA 2AD1A 4F38A 4JL8A 4UJ3A 1RRPA 2B8WA 3KKOA 2ERXA 3B1YA 3QEJA 3G5UA 3CZQA 4D81A 1WXQA 1KTVA 3HU1A 3D6TB 4XVQA 1UM8A 3WMGA 1HA3A 1RYHA 3U5ZB 2V6JA 3B85A 4ZKDA 5EE1A 3IPYA 4D4MA 5DHFA 1W4RA 3T1OA 1VG1A 3LX5A 1YRBA 2GHIA 1XD9A 2YC2C 1UBFA 2YVUA 5JZVA 3BBPA 5IT5A 1KZ7B 1DVRA 1E1QD 1NVMA 1WBBA 1Z6XA 2NZ8A 1VMAA 4ZIRA 3W90A 3AF3A 3GJ5A 4MYTA 3RANA 5KNBA 1L8QA 1MABA 1F2TA 1FUKA 2OBMA 4IDPA 1HE8B 2NIPA 2W0SA 3H2YA 2FZLA 1E9AA 4RVCA 1JAHA 1JQLB 3TW4A 4DSOA 1ZNWA 4B74A 4IOKA 1ODFA 3KTAA 5FOXA 2DPXA 4DCSA 1M8PA 3ZZ0A 3TKLA 5CITA 3DOFA 1G16A 2RCNA 3LWNA 4JLPA 1KI7A 1FL9A 2FX3A 2FG5A 3CF6R 5BYKA 1XPRA 3CPEA 2H16A 2RKOA 1SVKA 2GJSA 3NBXX 4ZDWA 4AC9A 1XMSA 3EZ6A 4QBHA 1EGAA 4X8OA 4PZZA 2UZIR 5HE8A 2J0UB 3OEHD 1NN1A 4FMDF 3GLHB 2F43A 1EFRA 2FJUA 4RCZA 3BH6A 1FW6A 2FFHA 4JLVA 3G82C 2EVWX 4TTQA 4IVQA 5JWHA 1JJVA 1KDRA 1Z2AA 3Q85A 4TMKA 1Z0IA 2H1LA 1LS1A 4OQNA 1P2VA 3REFA 1JXMA 4KVAA 1RPZA 2D2EA 4HLDA 4EFNA 3ADCA 1G41A 2X8AA 5JLJA 1Q22A 5FBQB 3GLHE 2PZEA 2JJ2A 4RD3A 1K6MA 1O3YA 3EPKA 4V0KA 2VSFA 1FMJA 4W5HA 4RZXA 1G7SA 5A5GA 4RKFA 2BKUA 1GAJA 2PCJA 1XD8A 4JLBA 1S0UA 5DSZA 5HPYB 1ZYUA 2R65A 4TQAA 1OXVA 1R0XA 5DE3A 2ONJA 8OHMA 5JJKA 4HB0A 2JLVA 4DSTA 3TUJC 1EESA 1YE8A 2N1BA 2O8BB 2VYFA 1PUJA 2C96A 3THOA 4I1VA 4YMUA 3LH5A 3ECCA 1R8QA 4DCTA 1KMHB 2RH5A 2ZM5A 2GAOA 2C98A 1ZAKA 3V4FA 1E96A 3K0FA 4Q19A 2ZQ5A 1NP6A 1OE0A 3IILA 5G3ZA 1E0AA 2CNWD 2FEMA 1DAGA 1II8B 1AKEA 4ESVA 2PEYA 3KX2A 2OUKA 3I5YA 3CB4A 1U90A 2GCNA 3NIBA 2HLDA 1OLOA 3ZDQA 1DADA 2FEOA 4URZR 1SVMA 3BGWA 4L9SA 4ESHA 3I5XA 4LZZA 4PFSA 4LJ5A 1G9XA 1U8AA 3T1VA 4ERNA 2JLUA 3TSZA 4LSGA 3UWOA 3FB4A 2AWNA 1FZQA 3K53A 2XXAB 5KDLA 3NC0C 1DELA 1XEFA 3I1FA 1P9WA 1TTTA 2I4IA 4MUBA 4CEHB 1G3QA 2G1KA 4JVMA 5CB8A 4ZDIA 3LO5A 1XJ0A 2AKAB 4KFSA 2VP9A 2GBLC 3VNVA 3OAAD 4LBVA 3NBYC 1Q57A 4A92A 4LHYA 3CX8A 2OESA 1EFHA 2IX3A 2WJIA 2QNRA 3RRYA 4OI0A 3B2EA 1JPNA 2ZTSA 1M34E 1NSTA 2QQEA 4BPBA 3NKVA 3V9PA 4C2TA 4URVR 2HJGA 5EP3A 4C4PA 1WF3A 5FOUA 3NC1C 3C7KA 3K09C 3KKQA 4MKGA 4A1FA 1N5LA 4B3GA 2JLSA 4JIMA 3GFTA 3GLGA 2A30A 1OFHA 4L9WA 2IW3A 5GJVC 1KSGA 5GJBA 4QM7A 4GDFA 2BOVA 2D62A 2GVDC 1OPXA 5C2JB 2QAGA 1GKYA 1H65A 2ZUBA 1SXJA 2QP9X 4MRPA 1HE1C 1AKYA 4M0LA 1SGWA 4POAA 4LV6A 3RS5A 3GLIE 5K8IA 1Z0FA 3UMSA 1XEWX 2FWRA 4G3XA 4UJ5A 3MLEA 5JEEA 3KQNA 1F6BA 3AV0B 1N6PA 3KW6A 2XSZD 2HV8A 3IIJA 3OFNA 5FR2A 4B73A 3EPJA 1G3UA 5JMTA 5L3QB 3QY0A 2GWHA 3QKTA 2PX0A 2O52A 1DAFA 1MO3A 4KAXA 4DBLC 3K9HA 2RHDA 2IEZA 1XU4A 4CT5A 3ZD6A 1HUQA 4HB4A 2HXYA 2KB0A 1IN8A 5CB6A 1HQYE 1KI3A 1KAGA 3IO3A 2FDCA 3C14C 4KYUA 2HT1A 4JLKA 4IKEA 1FTSA 3RSLA 2WMOB 4XH9B 3E5HA 3HPRA 4PANA 3SHFA 3RC3A 5FTNA 1T8TA 1XWIA 4TQUS 2BM1A 2GNOA 1QDEA 5CJPA 4D0LB 3T1TA 1E2EA 3L0IB 2CCGA 3SQWA 1QHNA 2W6ID 3NTUA 4KLZA 4OHXA 4YMSA 1GL9B 3B8HA 3IIKA 4DC9A 1JI0A 2QY9A 1R0WA 1C9KA 5F3WB 1R5BA 1U8YA 3CRRA 4M9SA 5E7JA 2WVJA 2EFHB 2R6DA 2V1XA 4EQ6A 3VX3A 4Q21A 3QF7A 4A15A 1QHIA 1FPMA 5EE5B 2FH5B 4B71A 1AGRA 1ZRHA 2KWIA 2JLRA 4LV5B 2AFHE 3W6PA 2ZITA 2QMEA 1B0UA 2GILA 3HPQA 2BBTA 3A1WA 2ZS7A 4W5WA 1SVWA 4D4LA 1E2LA 3EPLA 3PFIA 1RW4A 1A2BA 2WOJA 2NPIA 1E4YA 1G5RA 1BS1A 1U99A 1S1MA 3EIHA 1TF2A 4V0ME 1HEIA 4R2HA 1BH2A 2ZSAA 2YJTD 5BXQC 4PXAA 1TUIA 4MKFA 4GOJA 4AKEA 2V9PA 4DLVA 3PXGA 2G6BA 2YWHA 4DRZA 3EX7C 2JA1A 2W6JD 1E9BA 1E3MA 2JDIA 2C9YA 1RRGA 4FMBB 5GJWC 1GILA 1G7TA 1KOFA 5FR1A 4DCNA 3THYA 1M7BA 4FCVA 4ZIRB 4FWTA 1G6OA 3EC1A 5EUQB 2DBYA 5G41A 4FD2A 3T35A 5CLLA 2Z83A 1SZPA 1F2TB 1F60A 2QL6A 3MSXA 3SYNA 3TUIC 4OK5A 4DLXA 4E5UA 1E32A 4LJ6A 1ONBA 2WWWA 1KK3A 3IHWA 4F4JA 1I4LD 2OAQ1 4HAWA 3BRWD 4UXIA 4A2PA 3I8XA 4WIAA 3U7EB 3WMFA 4DDTA 3OIVA 2WWFA 4XWKA 3PEVA 3L0PA 1P6XA 1L4YA 4II7A 1CJVC 5J4YA 4WOPA 3IQXA 1JEEA 3GLIA 3RYTC 2AD5A 4XIGS 4BQSA 4LPSA 2QN6A 3H1TA 2DWQA 4PO8A 1NIPA 4C7OA 4LRWA 2CL0X 4BFTA 3N5CA 3Q7PA 3GLFA 2J59A 4D80A 4V03A 5JJIA 4M9ZA 3CNNA 2CE2X 3SYLA 2PEZA 4MYUA 4NDZA 1NJGA 4OI4A 2ZRDA 1GZSA 3Q3JB 1YR7A 1LFDB 4Q4JB 5EE3A 2VBCA 4FWHA 4NKRA 3HR7A 4M9QA 2R6FA 2B7CA 1IY1A 2VRWA 1ZD1A 3OE7D 2ZRGA 4GRAA 1ZM3A 5KHOC 2REXB 1XB2A 2VPPA 1G1MA 5EXXA 4MA4A 2BVNA 3FPAA 5FUYA 1G18A 4LY6A 4ZKEA 1E79A 2GXQA 4NE2A 1VG9B 5KNDA 3SBDA 1N6LA 1GRNA 1ZCAA 2ZJZA 3VQTA 3TSWA 2QMHA 2RGAA 5C4MA 5J4LA 3LDAA 1TNDA 2IBMA 4NBSA 4CGZA 3LLUA 4UKDA 4TT3A 1YZGA 4JLAA 4DSNA 2CL7X 3UXMA 1OH8A 1MKYA 2GJAA 3ADBA 5B57C 4JLDA 3U2QA 2HUPA 3TGPA 1NVXQ 1GG2A 1FNMA 1NLFA 1KI6A 4EIWA 3MGCA 4DLYA 1NKTA 2IYVA 5EP2A 2G0NA 4JLJA 3K70B 3ZVLA 2KE5A 3QI2A 2IYSA 1TAGA 4LBZA 4X8HA 5TY0A 2IHYA 1XJQA 4JVSB 3KUDA 4TL9A 5DYIA 4XOIA 3UIEA 1XBTA 3VNUA 2ZJAA 3RS0A 4Q4AB 4LRTA 2IYWA 4HDOB 4TMZA 4ZO4A 3UG7A 2RGNC 3SFVA 1LV7A 4ON9A 1Z22A 2CLCX 3AVOA 1TUEA 1UKZA 3D31A 3W6OA 2HF9A 1SVSA 4GNKA 1TQDA 3A36A 4NYIQ 5A4JA 2DFLA 1KYIA 5FPSA 4AIIA 2QZ4A 2D7CA 1G8FA 4GP7A 1CS4C 3BWDD 4BFWA 1S9DA 3BC1A 1P62B 2ZRBA 4B43A 2UZ3A 4IOLA 3GLGB 2AKYA 1XZPA 4QJ3A 3VR2A 4XWAA 3KQHA 2IUSA 2OLJA 1NF3A 2Z4SA 4DHEA 4C0LA 4CRWB 4GOXA 2RGBA 2ZE7A 1T5LA 3GEIA 3LVQE 1G5PA 1T9HA 3L8YA 4NMMA 4IXMA 5JJLA 5M04A 1RC8A 1KMQA 4LI0A 4G01B 2VP5A 1CKEA 3Q7QA 5HE9A 4OI1A 4MITA 3UK6A 3TSOA 4TTRA 3U3JA 3QVUA 1WQ1R 2F43B 3KL4A 4NCKA 2C9OA 1OIXA 5FFMA 3GLIB 2VO1A 4KODA 3NXSA 4ZI2A 2CCJA 5LPNA 1NJFA 2XTZA 4I81A 5EJEA 5LB2A 1CJTC 1W0KA 1ZIOA 2QBYB 5G3YA 5H70A 4WA7A 3LBNA 1SXJD 1E69A 1FFHA 2VHUA 3X1XA 1Z08A 2WAYA 4A36A 2NMVA 1DARA 4XTRA 2J7PA 1HURA 2RGEA 1YQTA 1OKKD 4LYFA 1XDBA 1YR6A 3LX8A 2Z43A 4BFXA 1QZXA 4PAMA 1AQUA 3F8TA 2C9CA 1FUUA 3AKEA 4MKIA 2OM2A 2ORVA 5IDVA 5LBIA 3KQLA 2R62A 2V6IA 1NLZA 2MSCB 1X86B 3FTQA 1D2MA 4MYHA 1ZCBA 4DLZA 4IVRA 4CEHA 2NTYC 3RSOA 3GEEA 1S3GA 4BLTA 2SHKA 2VP4A 3QXSA 1R0YA 2GXUA 3A6PC 1G291 3GJ7A 3JVUA 4LJ8A 1WMSA 3MUFA 3PUXA 3K8YA 3WMEA 4NCJA 3RC8A 4UXJA 2AK2A 4RD0A 5KDOA 2PL3A 1MO5A 3FOZA 5DH9A 1YZUA 4BRUA 3ETLA 4GMDA 3A4NA 3R8CA 4XWOA 2XNDA 4A8JC 1VHLA 2EYUA 1DAHA 3C16C 3CR8A 3CO5A 4BFUA 5L3SA 1ZM4A 4TYPA 4NYJQ 2CHGA 2ZUDA 3LLMA 3FMPB 4DJTA 1ZP6A 2GBLA 4IDNA 1CIPA 2FNAA 3LW8A 4NONA 3B78A 4FCTA 2GEDA 2H92A 1G3MA 4NCIA 3CWQA 3P27A 4LBWA 1SKQA 2VHCA 3CZPA 3ZGXA 2WPDD 3FFBA 4R9UC 5TMPA 1P61B 2O8FA 3WP0A 4D25A 3ZZTA 3QPWA 3VR4A 2J0UA 4GP6A 1VIYA 1DBSA 5JHHB 3GPLA 2AX4A 4GSYA 1ZC3A 5AJZA 4QGFA 1YU9A 2G3YA 3WYAA 3QXJA 4QRHA 4A2QA 1ZNZA 4Q7MB 3K09A 721PA 2ZAOA 2VF7A 4US0R 2WTUA 2P6UA 2H5EA 1ZU5A 4ABYA 5JCZA 2V55B 1KK2A 3NHBA 4JL5A 4EUNA 1OIWA 1RVDA 2B6HA 3VR1A 5TVKA 4K81B 2ZRNA 1BIFA 4JKIA 3SBEA 1AZTA 4MKHA 1FOEB 3A1SA 3MCAA 4P33A 1JB1A 5KU1A 3H4MA 1E1RD 1AK2A 4UNNA 5CK4A 1E2DA 1KI4A 2W83A 3OESA 4OYHA 1TX4B 4QGHA 5E4FA 2ATVA 2CMKA 3EAQA 3SN6A 3TR5A 1GM5A 3VKGA 3HJNA 3OIYA 2JAQA 1E9SA 1Z07A 3OF5A 2I1VB 4Q1CA 2XGJA 4P0TA 2F9MA 3K70C 4US1R 1N6IA 4HATA 2ONKA 4TLCA 2CHQA 1KNQA 2OO7A 4JS0A 4JL6A 4KBGA 1XTSA 3RAPR 1R5OA 1J70A 2J1LA 4AG5A 4D4JA 3LVRE 1PLKA 4QOSA 2CK3D 3NHAA 3WBJA 2XJ9A 4DIDA 2CNWA 2V8OA 3KB2A 4B75A 2C77A 3K9GA 4O2LA 1U0LA 1P2TA 2FPLA 2YV5A 2P5SA 1EWQA 3AEZA 421PA 4A3VB 1A2KC 1OFUX 4Q9HA 4HLCA 2H7VA 2PLRA 1TQ2A 3ZVNA 2BBWA 4KVGA 4IDHA 2ZSFA 1LY1A 2ZIAA 4P32A 2ZJ8A 4ASUD 3CH4B 1OYYA 2FA9A 3PV0A 3QIAA 3VAAA 3B1XA 5FBLB 1X1SA 4A0HA 3RRMA 2IS4A 1N3BA 4XVRA 1GNQA 3TMKA 1ZJ6A 2O8EB 4ZCIA 1XTQA 2F3RA 621PA 2G88A 4Q47A 1XEXA 1KO4A 2Q9CA 5FOWA 5AWFC 1Q21A 2YKGA 3B1ZA 2QAGC 2V3CC 1NBME 3WHKA 2F1RA 4ASUA 1DE0A 4HEJA 3SJAA 1Q44A 3A1UA 2QU8A 1UAAA 2ANBA 4JLOA 4B6EA 5AUOB 4HUQB 1GP2A 2RGCA 4Q4AA 4BZQA 1IN7A 3OEHA 2JJ2D 1Z6TA 3BD9A 2IA5A 5CDFA 2XX3A 2RHMA 1VCIA 2R9VA 4KFUA 2VF8A 3B9PA 5JRZA 2H8KA 2WKRA 1I2MA 3S1AA 2CVHA 1OJLA 1GRRA 1LW7A 3IEUA 3W8RA 5J4VA 1SXJB 2JLQA 4RZUA 3TK1A 3V4RA 3WNDA 3THYB 1J8YF 4BUJA 4DLWA 1Z6YA 1TQ6A 2ECKA 3TNFA 3VLFB 1CP2A 3DL0A 3LBHA 4HDCA 5EE9A 3WXMA 1GNPA 1RFLA 2VHTA 3X2SA 1J7KA 1FNNA 2ZI9A 4YXWA 1G21E 2JDID 2QGNA 2GCPA 3PUZA 4DSUA 4LYHA 1JALA 4YC7A 1R4AA 1GKUB 3M0EA 4GT1A 3KFXA 3QKSA 3QNUA 2VHQA 3ICQB 4YMVA 4RD1A 1IQPA 1Z0KA 1Z2CA 4S2EA 2ZSDA 3JZMA 2IT1A 3THXB 2Q3HA 2FSGA 4UNRA 1IJFA 4NYMQ 3VFDA 4HLQB 1Y3AA 1KAOA 3A4LA 3P4YA 2WOOA 1XXHB 2AK3A 2J87A 2ANCA 3K0AB 4B3CA 3UANA 5JBQA 1YZKA 4NU0A 4I4LA 1VCNA 2HJVA 4JMPA 3OAAA 3T12A 2CJWB 2CDNA 1C4OA 2ZRJA 5J5CA 2KI5A 1NY5A 1XTKA 3IGFA 2ZEJA 1E6CA 4FI3C 2MMGA 4LPKA 3MWJA 3KXKA 3LXXA 2ZJBA 4IDQA 4Q4JA 4GZLA 2YYZA 4PSVA 2W2VA 5JHGB 3QKRA 1KK1A 1AA9A 2KSQA 2MSEB 1DTSA 1NVVQ 2PMDA 4E22A 3IBYA 3VU9A 4NHOA 4A2WA 2GF9A 3DOEA 3QPUA 3JVVA 1E2QA 2PH1A 1P2SA 2EW1A 2PCLA 4H1UA 4JLMA 1W0JD 1H8HA 4FN5A 2QI9C 1Z0DA 3UMFA 5E7MA 1H8HD 1LVGA 4QJ4A 4LBYA 1X6VA 1W2GA 4P4SB 1ANKA 5DI3A 2BIFA 3AM1A 2XNSA 4DVGA 4YQFA 5EXTA 4BFZA 4DT1A 3SFZA 1RKBA 1E9DA 3OZXA 3FGNA 4UQOA 3CRMA 4A8JB 4Q4HB 4EPYA 4PX9A 4YMTA 2QT0A 1KI6B 3DEFA 4Y0AA 2D7DA 3LNCA 4QHYA 3P20A 3ND8A 2PBRA 3EWAA 2XAUA 4F91B 1G3IA 5DI9A 3P1JA 4M53A 4TMTA 5ANRB 4KSCA 4UNPA 2IS6A 2FGKA 3AGQA 4HLUC 4HZUB 4Q18A 4DXAA 4S35A 3K0SA 1GIAA 2O8CB 1AQYA 1KGDA 4D4KA 4OQMA 2QMUA 4JYBA 4AKIA 3FYHA 2BJVA 4DLTA 2V7QA 3O8CA 4KFTA 2D2FA 3AB3A 3LA6A 4AYTA 2R2AA 1AS3A 2FFQA 3CIOA 4PQFA 2OEPA 2V7QD 4OK6A 3THWB 3ZLJA 1IXRC 2QROA 3LXRA 4NYMR 4IDOA 3AF1A 1P72A 2A5DA 2PX3A 4Q7LA 2FSIA 2OBNA 2ZE8A 5TXGA 1IN6A 3VHLB 1PVOA 2WWIA 1FP6A 3G0HA 4JSTA 4LWZA 4MRSA 4M1OA 4F4CA 4Z8XA 1Z06A 5LD2C 3DKVA 2Q3FA 4YMWA 4I1SA 1CTQA 2RGXA 3VKWA 1RJ9A 4JVNA 3QKUA 3EPHA 2NOAA 1GSIA 1ZBDA 2ATXA 4D6PA 1Q3TA 3ZQ6A 4B2IA 2BC9A 2PT5A 2BDTA 2ODNA 4FIDA 1W47A 1KKLA 3IPXA 3DDCA 3X1DA 4QHTA 2QM8A 4E07A 1KO7A 2ZRKA 4B76A 2JGNA 3WNCA 3CX6A 4D82A 3BK7A 4A0RA 3CBQA 1UF9A 4IXNA 4M2LA 4CEIB 5B30A 1TPZA 2AFIE 3P4XA 4PZLA 1OHHA 4HI0E 3SJBA 4HAYA 2FV8A 1MR3F 2WIBA 3VMFA 4IHQA 4FWDA 2JJ1A 1S96A 4AWXA 2ZRCA 2UVQA 3MAAC 5FI0B 5GVSA 1HV8A 4M1MA 1BYUA 1JQJC 1U0HC 3EA0A 3QEOA 3OIUA 2WSSD 2E9SA 3BFVA 2QP4A 3O8BA 1U8ZA 2QRNA 3GFOA 2OFOA 5JSZB 3QBTA 3C5CA 5HZKA 2ZI4A 1KJWA 1U81A 1WE2A 2ZVPX 3FFAA 3SEAA 1Q20A 1S1CA 2HDNB 3Q5EA 4M1SA 3SE0A 2DYKA 5TB5A 3AGPA 1HT2E 5E95A 1CEEA 2REOA 4OQLA 1XCGB 2C8VA 1N2CE 3T34A 4RZ2A 2CL6X 1OIVA 1SHKA 2CXXA 4D26A 2AL7A 1Z63A 1OV4A 4I99A 4ARZA 2BMJA 3CH5A 3CNOA 4OI2A 5SZKB 1HY3A 2CK3A 1M2OB 3H84A 1Y63A 4PHTA 3BFKA 1KDPA 1NLYA 4TMWA 1E2KA 2NGRA 1LB1B 3PJRA 3X1ZA 4OJQA 3SJCA 1H8EA 3DZDA 2CLSA 1WP9A 2YC4C 4BRWA 1QVAA 1YR8A 3V00A 1NNEA 2C78A 4Q9KA 3UATA 3EG5A 1JBKA 2W6JA 3AKYA 2BMDA 1VG8A 4HAXA 1VKJA 4OKSA 1QG2A 2P65A 3QG1A 5CIQA 521PA 5L8VA 1P75A 4GPTA 3I62A 2B92A 3PG5A 3CUEF 2WKQA 1W36B 3QF4A 3KQKA 3BB4A 2BCJQ 1E2PA 4M1TA 1W0JA 1VG0B 3S1AB 3X1YA 4ZPXA 1ESMA 1GVNB 1Z3IX 1ZM7A 2O8DA 2JIZA 5FL7A 3UKDA 4A4DA 6Q21A 1OFTA 4MGZR 1Q3HA 3LY5A 1SHZA 4TYNA 1CR2A 5BQ5A 1V43A 4HB2A 3K70D 5JWOA 5C4GB 2PZFA 1KO8A 1KDTA 2HF8A 1TADA 1E99A 2W00A 4B35A 2KBEA 4Z54A 2ZRMA 5F2EA 4Q03A 2Q6TA 3R7WA 2QQ0A 3REGA 3TQFA 2PJZA 4B34A 2ZRAA 4LGMA 1P5ZB 1SULA 1DEKA 1A5TA 3H86A 2ZRPA 2OLKA 1ZU4A 2EYQA 2OFXA 5HR5A 1CU1A 1XPUA 5C46F 1BOFA 2ZUCA 5SZIA 1KI2A 3W3AA 3THXA 1E2MA 2X1VA 3I8SA 4NCNA 5IHPA 3KXIA 4F7WA 1KDOA 2ZI3A 5IK2D 4RD6A 3LFUA 1Z8FA 5L3RA 1IONA 1EK0A 1MH1A 1YZLA 4G1UC 2QMOA 3B1VA 4P4TA 3B60A 5GJCA 3TIFA 1W36C 1XEWY 3EZ9A 1C1KA 3ZD7A 4TTPA 1D2EA 3F0TA 2YOFA 2A2ZA 3R20A 3AF2A 5BN4A 4FWIB 3TE6A 1ZINA 3FMIA 3DKPA 2DZNB 1XCMA 3PITA 1QBKC 1EWRA 4C9BA 1G6HA 3M6AA 2XB4A 2ZXUA 1I4DD 1XEXB 1NVVR 3P26A 3W6NA 3AKCA 1TEXA 1GITA 1Z83A 2GZDA 3BB1A 3TLXA 4TT3D 2O5VA 2V6ZM 3KJGA 4Z1MD 1KSJA 4MUAA 5F9HA 4TYWA 3TQCA 5BN5A 1XRJA 3K9LA 5D3MA 4C0QC 1TF5A 4JJZA 1NBMA 1VYTA 2IYUA 1XMVA 1KSFX 5FUVA 2ZANA 1NVWQ 1S3SA 3L82B 4YDHB 1NBMD 5E7IA 1CJKC 3MHVC 2ODEA 2CVFA 4PR0A 4PC2A 1UBGA 3N2IA 4IVPA 1F48A 2QTVB 2A9KA 5FPHA 2ORIA 4A0FA 3GJXC 1X8KA 4IOMA 4Q9LA 1OHHD 2EFCB 4DDWA 1JPJA 2AHOA 2X2EA 3D7MA 3VR3A 3B1WA 3U60B 3KB1A 2O8EA 4OQFA 4URUR 3WY9A 3BOSA 3NEYA 121PA 2E87A 4MH0R 4X8MA 3ONWA 2O8FB 3DHWC 2MMCA 2NO0A 4Q48A 3EIEA 4Z1MA 1T6NA 2HCJB 4MYCA 1CXZA 4JBYA 2XITA 3SI7A 4HUQA 2F1IA 3AQ4A 1OSNA 2ZREA 3CNLA 2G1JA 3KTAB 4BLSA 1OB5A 3OIWA 1OFIA 4M1KA 3T5GA 2GJ9A 1GNRA 2ZI7A 2ZPTX 2A7QA 3GD7A 1IXSB 4F93B 5CIWA 1KK0A 1MT0A 1KKMA 2OFWA 3FHCB 1A1VA 2WKPA 4Q7JB 1JR3D 5JFGA 5LD2B 1HH4A 3K9NA 2GA8A 1H8ED 1P60A 1PUIA 1XF9A 2DVWB 4EKDA 2V54A 2HLDD 3M4YA 2XEXA 4L4UA 3BS4A 4PO9A 1GL7A 2IYXA 1MV5A 2BCGY 2QE7A 2ORWA 4L8GA 5DLQC 4HUTA 1Q12A 1SVOA 1NMZA 1E2HA 5FPKA 1QHHA 2IYLD 4Q01A 2J0QA 3CM0A 3SC3A 3IEVA 3SZRA 1KO1A 4TL6A 4DEYA 2O0HA 4HDQB 4IEEA 2W58A 1W4CA 1P4SA 1N6KA 4UNSA 1OXTA 3BXZA 2GJ8A 4Q9JA 1QF9A 3RRZA 2QTHA 3HU2A 3CKLA 2WIAA 1FTNA 3D3QA 5FBRB 1TEVA 2VEDA 4AK9A 2JLXA 3SR0A 4NTZA 3EARA 2QGZA 1DAKA 2DWOA 4ACAA 5GADl 5EZ6B 1II9A 4RKEA 1GKIA 1ZC4A 2ZJYA 2D74A 1DAMA 3CPHA 4Z8YA 4LV8B 4B32A 1W5SA 1C1YA 2VSOA 1NY6A 5DI3B 2ZYTX 4EFMA 2X2FA 4LJAA 2OBLA 3LQQA 2CE7A 3GJ6A 1P3JA 2C2HA 2DR3A 2JIZD 2LKCA 2L0XA 4AYXA 2DWZB 3DMDA 2Z4RA 1R6BX 1N0UA 3C41J 4FMCF 1TQ4A 2J7PD 2IHBA 3TR0A 5IRCD 4PO1A 3RABA 1II8A 2B8TA 3C15C 4TMXA 4B33A 1XTIA 1TU4A 4RFSB 5FTLA 1S2MA 4LHXA 4Q1FA 3U3MA 5EP4A 1CULC 3BORA 4DUGD 1ELOA 2VP0A 5B2ZA 5JWRA 2GXAA 1NMYA 2BKEA 4B2LA 1UPTA 4KV9A 2IYZA 4R71A 3B7GA 2XNDD 2VHJA 3PCRB 2IYQA 3B82A 5F98A 1UDXA 2ZRHA 1BKDR 4U02A 1ESNA 3FKQA 1VPLA
chains in the Genus database with same CATH superfamily
1QOZA 5ALYA 4RKWA 5FLXS 4PSKA 3WFIA 4MJ3A 5LMCA 4D57A 4AJ9A 1YDGA 2VKTA 5JANA 1XZEA 3WLKX 5EMMA 2AFHB 1IEXA 3EQZA 1EFRD 2FGJA 3C3WA 1DBQA 1R3UA 1UAYA 4JT4A 2XH9A 5FO1A 4OHYA 4FOPA 3IUSA 4BX3A 3ICWA 3OZEA 4M1YA 4NPHA 5EEHA 2QRPA 2A33A 3ZZMA 4DR7M 4HVLA 2QX8A 3RYHA 4ZVKA 2QP3A 5F5LA 1LNZA 5EGSA 4MVJG 5CK5A 3TB6A 2ETXA 3RS3A 3A10A 3EXG2 4LYGA 1PCXA 2VDBB 2A4KA 1GGVA 2B7LA 5ALHA 1QG4A 5IUKC 3CLRD 4E30A 1VCMA 4V38A 2ZU0C 4BNDA 4L57A 2Q0QA 4GU5A 1I6WA 4KKXB 1F1BA 5FULA 2QRZA 3PWKA 2QEQA 2VTVA 1Z0SA 3HCNA 4R01A 4CLEA 4YRBA 2E55A 4WZBA 3U4MA 1B73A 1UFOA 1N3YA 2G6TA 2Q50A 3HYSA 4V39A 5FPTA 1IBKM 2BMFA 3U1VA 4AURA 3NORA 3OG9A 4MDFA 1RAAA 5DWQA 4C30A 3UM9A 4X7MA 4C4RA 5BV2P 1GU1A 5IH3A 2AMYA 3LCCA 5B1HA 1XMJA 2IW1A 5D5PA 3KV3O 3S0JA 4I6JA 1A9RA 4A23A 3SPXA 4DMUB 1O58A 5AJWA 4JLSA 3RYIA 5DEOA 5BSEA 4LXXA 3A6DA 5H0IA 1ISMA 3STVA 1CUIA 4AY2A 3LJKA 1EA7A 1XZLA 2ZWVA 2IUUA 4GSLA 5IJWA 2JGIA 2EJUA 3LQFA 2UKDA 2GCOB 3GUHA 3EISA 4MGEA 1ZM2A 1T0HB 2FTKE 4B8WA 2B78A 4NECA 1I3KA 1X9HA 1LPNA 2A5GA 5DWDA 1GRCA 3STHA 1ZWLA 1FPQA 4WAUA 5FWYA 1L2BA 2G70A 2X7JA 2JHAA 4KXYA 4WDRA 5ERXA 2SECE 3AIMA 4QC2A 1QZEA 2R6CA 4TMYA 5F1PA 5HUQA 3ONVA 2ZTVA 7REQA 2IS2A 3BPSA 4PC1A 5F1OA 1S2OA 1VJTA 1E98A 2C2WA 1FXUA 5J2TF 2IV3A 3EGXA 1NULA 5ALWA 5K3CA 5B58C 2VZ8A 3OJEA 5C37A 4OSOA 3U26A 2HMSA 4PHHA 4JN6B 2B0JA 3NW9A 4QA9A 2Q0HA 4G5SA 2PT7A 4KU4A 3UMRA 3OOWA 4ZV9A 2FDXA 1P6UA 3NBZC 5CLQA 1T8UA 2BGNA 3UMVA 5LZ7A 4I3FA 4ND5A 4YYEA 3QX3A 8MHTA 3K0KA 1NU6A 4WADA 1JEJA 1EB9A 1SWWA 4R2MA 4COOA 4C0KA 4KHZA 3RTAA 4F9EA 3QXXA 4AXXA 1RLOA 1U3GA 3TRDA 1QO0D 1R5NA 2HA6A 4ACBA 2UUAM 1RZRA 5BQXA 1VDZA 3CEHA 2VTKA 4BASA 4EPVA 4ER6A 5ITSA 1DCKA 4P4UA 3SIWA 4YQEA 1W87A 3EJWA 1LBHA 4HC4A 5G40A 5AVQA 4XGKA 2REQA 1YJCA 2GUGA 3RHFA 2YMQA 3B13B 4IFTA 1F17A 3I73A 3UW1A 2NWQA 1QKIA 3P9IA 1PTJA 5DM4A 3MTGA 1NDQA 2PV7A 1IZ8A 5CH5A 1G20E 5HS6A 3CF6E 5IF3A 1J2EA 2XCUA 2GK7A 3CRW1 3PENA 4PY2A 1FRVA 1LGYA 2Y9MB 4BV3A 3C4QA 1TZCA 2ZJOA 1SBQA 3G89A 3IQWA 3IRVA 1Z5BA 2QN3A 3AUJB 4JT2A 4JYCA 3EH2A 1M1ZA 1QVZA 3GFPA 3LUGA 4OSEA 1B23P 5IBRA 2FSFA 4KQWA 1WV1A 2FCAA 1Z4NA 4TM8A 1BVSA 2QYSA 3EA5A 2AUTA 5ICMA 4KQ9A 4MRRA 2AG8A 3SEQA 3WOVA 2ZS9A 3NKFA 3IHPA 1Y4ZA 1YFKA 1CZKA 1K9VF 4M8NE 2YYAA 4BNTA 3K9FC 4Y67A 1YBAA 4ZQCB 5C7LO 3GO4A 3K9BA 1X1AA 5D3ZA 3CVYA 4JZKA 5DSTA 4B40A 4X44A 4LRYA 4K6OA 3NBFA 1ZUD1 5BOSA 5CA1F 5M2QA 1E1CB 3UJPA 4QGSA 1OQYA 2ZRLA 1DGGA 2FRXA 3SS9X 2P67A 3A98B 3BE6A 4R98A 4RKYA 2OXIA 3SX0A 3U80A 3JRXA 3ZGOA 4P4GA 4PQRA 3SLGA 4W6ZA 3VXKA 3WWCA 4WACA 3RV3A 1DX9A 5B6JA 1JEDA 1V16B 2HK9A 2QT1A 3NTQA 1ZJZA 4YAUA 3BFXA 4N0DA 4QGAA 2AN9A 1AE1A 3BFPA 2PO7A 3D8LA 2WWTA 1PZXA 3DE3X 3OQJA 4JITA 1D4ZA 3OX3A 4WN9B 4Z4FA 1A4UA 4NESA 4W1RA 4E5KA 3PLAE 4WV3A 4XWTA 4IIJB 4AW9A 5ADVA 4XAQA 1FDOA 1VYVA 1GYRA 2JW5A 1E1NA 3C5VA 3D7KA 3E82A 4PYKA 4ZCPA 4MRMA 4WZBE 2PUAA 2V7VA 1BNCA 2O54A 2UXBB 1WOYA 4C7BA 4M22A 3T6KA 3RGPA 1NQAO 3LPDA 3QBEA 3VC3A 3R6DA 1F8XA 2OAP1 1TT5A 4GL4A 1T4GA 1YZTA 2AB0A 1U4NA 4MS3B 3KEMA 5ALEA 2AJCA 2CNDA 4TLEA 3UHOA 1TYEB 3JQDA 4ANRA 1W2HA 1EFTA 2O8BA 2QLNA 3FTNA 2I4TA 1PJTA 2QUIA 3VBCA 5I45A 1OYOA 5JBIA 2WFLA 3FUTA 1DGQA 1MX9A 3AVUA 4HTAA 2EG9A 4MHSA 4TUYB 4F5YA 1XAGA 4AKTA 4UTNA 2Q5FA 4D79A 1JLMA 3D8RA 1EXVA 2VNSA 2P0YA 4PNPA 2EP5A 2DHRA 4GR4A 5FBVB 3M34A 4U2DA 1V7QA 4A91A 1K7XB 5BR8M 4M9UA 1EXMA 5AKIA 3FVQA 1O7JA 1YONA 3WLRA 3LHSA 3LGXA 4XQGA 5EIEA 3DTVB 4PQYA 2V03A 4M9XA 3C3KA 1OAKA 4X8LA 2JS7A 1DGBA 1DU4A 1FNCA 5I9IA 4F2HA 2Z5FA 3PYLA 1V26A 5IWAB 1DOZA 1Z88A 2C0CA 3V5NA 1ZD8A 4AL4A 5KPDA 2JWSA 4ME6A 3PEWA 4BGDA 2NXWA 1Q7GA 2YJ3A 4OQQA 1UMBB 2R8EA 1FF9A 3ZV4A 4NCHA 5ALQA 4FB5A 2G76A 1Z0AA 3LO8A 1JJ7A 2D1SA 4U00A 4JUDX 1E6EA 4OAQA 5JALA 2O19A 5IANA 4MRNA 2VJPA 2YHUA 3ICEA 4QKQA 3R0VA 2D3TA 2XJ4A 3N1UA 2JIPA 2I5PO 5AJHA 3PQEA 1CYDA 1VSUA 4TV8F 3EPPA 5CT6A 3VOSA 4WCFA 2XMCA 4ZJYA 1JIQA 2LIPA 1BMFD 2P9CA 2QUAA 3DLCA 2ONYA 2RC5A 3L0SA 1FP2A 3H87A 3RBXA 4E31A 4X41A 4G5QA 2V65A 4UCFA 1G7CA 4KJZA 4IV5A 1J99A 3TPZA 2JAUA 1XZNA 2BMVA 5JAUA 2Z2JA 2ZKIA 2IZOA 2HOQA 2P6RA 3KELA 1CDZA 4BXOA 2G4LA 2I71A 2NQ2C 2QLTA 3DOCA 1O6CA 3JASA 1VBKA 4XM2A 1X3SA 1MW8X 1EVQA 5IHXA 5C51B 1W48A 3B5EA 3C3JA 3IE0A 4PYOA 1ZIXA 4PHCA 2XUAA 3CVOA 4P3YA 1AUQA 2VJBA 3MMXA 3MSCA 5B6IA 2GFQA 5CA1A 3QEMA 1S4QA 1JJAA 1KZ6A 3AFIA 4QFCA 1G3RA 1I5OA 2R6HA 1JZSA 2LDXA 5F76A 4IFBA 3ABSB 3FPHA 3UAZA 5CBKA 3UWKA 2O1EA 3KBOA 2I2CA 1CIVA 2WWXA 1ZUNB 2ADMA 2JEOA 3BWYA 3DPUA 2H31A 3FF1A 2DG2A 4KJXA 3P0RA 4BLRA 2C99A 2ZOSA 3O21A 1KAEA 2IK8A 3WG9A 4DKXA 1FSZA 4LF6B 2D3WA 3T0GA 1MQ8B 3AEKA 5COBA 4Y3UA 3RRXA 4MLCA 2RJ3A 1ZH8A 2YXEA 3T3GA 4LY9A 4Q4DA 5TSDA 3HWSA 3KKLA 4HNAA 4MCHA 3PJDA 4D0NA 4DMLA 2AG1A 1AHNA 1MB3A 3HHZA 3ESRA 5KJFA 1C7EA 4PEVA 3Q9LA 1ND6A 2RHHA 5SZHB 1IVYA 3FWYA 3GJ0A 1UANA 3TAHA 5TJHA 3DMNA 3IP6A 1M10A 5D2CA 2OQ4A 2FW7A 4GPAA 4XR4A 4EJ6A 2XSZA 2QMYA 2YVAA 3CZ5A 1DAIA 2DTXA 5DTRA 5I9LA 4DXDA 3AVYA 4ZEMA 4HQFA 3U7HB 4DR6B 1QLHA 4AT1A 5EHIA 1CS0A 4EHFA 4K2HA 4NH4A 4YT8A 4B1FA 1JR6A 3TH5A 4A6EA 4DR2B 3DVQX 5LQUA 1R0ZA 4MPPA 3TQRA 3GPIA 4WLUA 2HGZA 1XCOA 4JJKA 2ZDGA 3X1WA 2Q2NA 2RFLA 3HJBA 1LTMA 4DTIA 4L75A 1I14A 4ZOLA 1K66A 1Z6QA 3UKOA 4FYHA 1FDTA 1Q3CA 3L27A 1WUHS 1N2OA 1OA0A 2PRIA 2ZI6A 3ETGA 3H5IA 2RKBA 4J7UA 1U2RA 4OHBA 4RO0A 4RY2A 3ZJYA 3OJCA 3OOHA 4DARA 3U4QB 1O87A 4EX6A 1XN4A 2TMDA 4MWZA 1N6OA 2QSYA 1C7ZA 1CHNA 3DNFA 1VXRA 2ECFA 3AEQB 3LUAA 3OU7A 5FV7A 1M54A 1N3IA 2HWKA 4DQXA 3U6KA 3COJA 2X49A 4NXNM 3AH8A 1JA1A 2AG6A 1JMKC 2J0VA 2OP0A 3EZ7A 5KJEA 4ZGWA 5JR3A 4YCBA 4X64B 2YZ2A 2ZYUX 7MDHA 2PKXA 5DZSA 2BGUA 3KQTA 3LQRA 4DQUA 1JYEA 1Y6QA 1L4FA 4H60A 1ORRA 1U0EA 1W35A 1KAMA 2DBRA 3HCEA 1SCUB 5DCYA 4BBJA 4D97A 1U9ZA 2MT9A 3QUCA 3EXHB 2LWIA 2IY9A 3BVPA 2OV8A 2PWAA 2YN2A 2ZYDA 3OA2A 3PWTA 2DPHA 2AVNA 2YHIB 5ALTA 4AVYA 2OGZA 4Q1VA 2QM7A 5CMLA 3SU8A 1ECPA 1UKYA 3PEUA 5FLEX 5HFAA 5LQSA 3G0OA 3AJ9A 1J2UA 3SARA 2X4DA 3TBFA 3SBOA 4E15A 5J2TB 1WLYA 4U3JB 1WVGA 2NACA 1A82A 2FMXA 3DEAA 1UKEA 2P5TB 3KB6A 1VEKA 4BVLA 1U8XX 1EE1A 4WWHA 1PJ4A 1IBSA 4IH9A 1PBNA 2Q6VA 2WHPA 4FYIA 3W5IA 2PS0A 3BWCA 5IVKA 3FLEA 2Q3DA 4AJIA 1PX0A 5HW0A 3U3KA 1T2DA 3B70A 5KTSA 2II6A 1C1DB 2ZG6A 1REQA 2ZU6A 3L7BA 3NZEA 3PQFA 4IF4A 1QGDA 2C5LA 3TAUA 4CT4B 1UADA 4AO7A 4EABA 3M7IA 4IIWA 3QRWA 1UPAA 2FQYA 2I4MA 4P82A 4I1RA 2C54A 2P2GA 4JBXA 4EF6A 5K8CA 3WA7A 3LRPA 3PL1A 4B44A 1M0SA 4J2TA 3SBXA 3W3ZB 3FVVA 1J0AA 2DECA 4LJ4A 1WCYA 1ZD2P 4EPRA 2DUWA 1V8PA 2G80A 4UZEA 3SOPA 3NTRA 2BTQB 4YR9A 1IEQA 5E1MA 5CJ2A 2XTMA 3QOYA 2YWBA 3UN1A 2VYVD 1Q1QA 3G59A 3MA0A 1IL0A 3MMNA 2F1JA 3ASZA 3E81A 5KHAA 2P9JA 5A5EA 3VDQA 2RAUA 1IHPA 1Z56C 2ZJ1A 1LF0A 4JFRA 4PE5B 3OEWA 2C3PA 4G0OA 1MO4A 3EIQA 1Y98A 3CPJB 4MMYB 5GIPE 2I3BA 1E66A 4MW4A 4TT8A 3DVLA 4V0NA 1QK5A 1AHPA 2WWYA 1E2GA 2O06A 3HHPA 5K0CA 3E58A 4R1UA 3WV5A 4NU5A 4F6RA 1D07A 3OPNA 4OGGA 3CLTC 4GEGA 1ZVQA 1FX0B 2DBVO 4XJTA 4HDAA 4U2EA 5E8JA 1Z6AA 5CM8B 5GV8A 3T1NA 3EC2A 4EPTA 2CLDX 4ZI3A 3CEJA 1Y81A 3B74A 3AY6A 3H6GA 3IAS1 2EQBA 1B74A 1RT9A 4CTNA 4F4HA 1FLNA 3KPWA 4PYNA 1SM4A 2P9EA 4EJSA 2F55A 3B3JA 1MG5A 4R6XA 1U9IA 3MD0A 5FUMA 2WJVA 5FTMA 1GEGA 1KYVA 3G68A 2FYTA 4PFJA 4CL3A 4DV7B 2CHEA 5HX7A 3W1VA 1VCOA 2W6CX 3IPLA 4ZVLA 2BMWA 3OTOB 3F71A 4P7GA 2CEAA 4OHMA 4Q0MA 1MB2A 1Z8DA 9LDTA 5BT8A 2AR7A 1YR9A 1QAOA 1FYDA 3Q8XB 1T9GR 2PG3A 4RMGA 4R0MA 4LE0A 1NRWA 3CLKA 1EG2A 3VYWA 4HGNA 3PC8C 1AS0A 2FWMX 3G8CA 3U6DA 4OB8A 1F4LA 1LUAA 4PPQA 1M5RA 3H65A 3KUUA 5IJZA 3DYBA 2O2XA 1D0KA 1SH7A 4G2TA 3P2MA 1TO6A 4LRSA 3BA1A 2Q8NA 4XVHA 2HU8A 4JUBA 10MHA 4YLGA 3OEEA 4ONEA 3RC7A 3UAXA 3F9IA 1UJ2A 2E4VA 3WDMA 4MCAA 4KP7A 4YRTA 1H5NA 1HDCA 4BNIA 4CKBA 2KNAA 2PRZA 1WB9A 1JIXA 3V34A 3FYTA 3PQ8A 2GYVA 3QHAA 1TYBE 2C31A 1C8LA 2WNSA 2I91A 3E9QA 3OC0A 1G5TA 5AK4A 3BWBA 3FX2A 2IXTA 1WZCA 5BWMA 1TPYA 3SASA 2JB9A 1JHPA 3HCOA 1YK1A 2Q5CA 4XX0B 1LQTA 3I2FA 4M0KA 3G2KA 3F3YA 4FFVA 4YJHA 3RFUA 4L7VA 2IEDA 1IQUA 3VK7A 2LD4A 4EG6A 4ZAXA 2GD6A 4LC0A 3L4JA 4D8UA 2GKOA 4EPXA 1TCUA 1FJ2A 3R5TA 1CE8B 3B7ZA 1S3IA 2ZB8A 2QW1A 1IH8A 2A9OA 1UK9A 2YWEA 3NYQA 4HSGA 4RDHA 1VJGA 5DLDA 3NC4A 5LLSA 3EVBA 1IAQA 2R00A 2VL7A 5LZ2A 3HVRA 2P7HA 2AFIA 2OXCA 4E5PA 1SOAA 1U7TA 2BR4A 4RBNA 5AH0A 2W6IA 1EK1A 3P9YA 5EJGA 5KYGA 2OY0A 4G56A 1BTOA 3LSTA 4QNRA 5LVAA 1G64A 2R00C 2XOKD 3L7LA 3OMLA 1GKKA 3G0BA 2Q5HA 3KWFA 4WW0A 2YDXA 4Q3DA 3H2KA 3HACA 2MWMA 2DJIA 3FIUA 3QE0A 4J4HA 1MN6A 1VJDA 1XVUA 2GN2A 3LGSA 1VI2A 4WDQA 5CLGA 5GWXA 3OT4A 5ELXA 4CR8A 1KU0A 5IBQA 1SB8A 4UVIA 1FSPA 3O9VA 4Y0VA 2RHLA 1DBRA 5TE9A 3OTQA 4LVCA 3GQ3A 1M1YE 4HB3A 1YJ5A 2OK7A 2LVQD 1PK8A 2DPMA 3D4NA 2BFBA 3HUDA 3LMKA 2ATIA 2C4VA 3QKSB 2Y2VA 3DTNA 3TQTA 1I6MA 3HMQA 3LOUA 3H1BA 4Q3BA 1R6XA 3TPCA 3MN1A 2JGDA 1LK7A 3JW8A 5DX0A 3Q6IA 2PNFA 2HLPA 1J90A 4GGOA 3FNEA 3B5IA 4JR0A 4KN9S 3UEOA 1NHGC 2V4ZA 3UB3A 2IEGA 4KWIA 2PUGA 3H05A 1U0BB 2HHLA 4JJEA 2A86A 3LUFA 4BKUA 4G8JA 1PJ2A 1G71A 2UYYA 4IEFB 4EFKA 4OH7A 4CG0A 1NXOA 4LNAA 1G19A 2EQ5A 3D4LA 3OE7A 1GGEA 1SB9A 4MR7A 4OIFA 2FW0A 1P5HA 1MVOA 2HQRA 4B3JA 3K6RA 3HI6A 1ADBA 2DPYA 3WIDA 1DC5A 2EWMA 2X9QA 3HDJA 4EGAA 3J81k 3QM1A 1P7CA 3LDGA 1C0IA 3T7KA 2CJWA 1VJ0A 3MJHA 2GZRA 3HVHA 1SHTX 1R7RA 3O38A 1JDPA 3GLGE 1YRLA 2GRJA 4PG4A 2XQFA 3EIUA 3M3DA 3RF7A 4UQLA 2QVGA 3NBUA 3LZCA 4YJGB 1W0KD 5WRFA 1MNQA 2JFNA 2AI2A 3S29A 3HGTA 1HRKA 1IY2A 2HSJA 4AUEA 4PW0A 3UK1A 2SCUB 2J0EA 1JXAA 5FTWA 3V7UA 1UEIA 2JVJA 5JAOA 3NPMA 4G89A 3W1EA 2QYHA 1ZVJA 3NHRA 1FS4A 2Y0CA 1LRJA 1EGVB 4HWSA 4KNVA 3U3OA 4BVBA 1LDMA 4IGKA 2C4HA 4Q4LA 2GN0A 5HCUA 1JHYA 2J48A 2QLLA 5JDCC 4Y2RA 2JJ8A 1ABEA 5CB4B 3KU4A 3SG0A 2PD4A 3BD6A 2JY5A 3EUEA 2ODAA 1JJBA 3K1AA 3T9FA 4KC0A 5K2OA 3L8ZA 4AS1A 1I4TD 1X9IA 2IYTA 3K0FB 3R1IA 3FGPA 4TVOA 3KJEA 3IHLA 3MMZA 3UICA 3COSA 3VV3A 4F5EA 3CONA 1K8RA 2G09A 4HEHA 2I7XA 4PZEA 9GPBA 1KH1A 2P3SA 1G17A 3VPAA 5C4IA 1HNZB 1E94E 1TUBB 1DAEA 5L3SB 3IRUA 2E6UX 4H6XA 5AW2A 1SBZA 1NVMB 3IUPA 1FSSA 3L0ZA 3Q1KA 4LOHA 3GMTA 1L5KA 4KQMA 2FUEA 2IUTA 3P71T 3KJIA 4FGJA 5D3MB 5JCJD 1JQBA 1VDMA 1N78A 5TPWA 1VJCA 5GY7A 1PZFA 2WM9B 1D1QA 1USGA 1GQRA 3PUHA 1J06A 4UBLA 2Q49A 3VNSA 5BWLA 4DUGA 5KPJA 4OKNA 4YRFA 3L49A 4HZUA 5KQDA 2NQ8A 3L2OB 4NV3A 3AVQA 5SZJA 1NZFA 1CRPA 2XE7A 1XZHA 5JCPA 1HYQA 4MS4A 5J2UB 2Q9UA 1HMPA 1NN3A 4JOBA 1EBUA 4RK5A 4BQFA 4F8JA 1PEYA 1V4NA 5CEJA 3EXAA 4WLFA 2NQ8C 1T3HA 1UJ5A 2XVZA 4CZ2A 4ZI7B 5ECGC 4JB8A 1MC8A 4PGHA 4RA9A 4N76A 3UA4A 3MBKA 3DG9A 3BHNA 1BKYA 1DV1A 1QYIA 1W46A 1W8DA 4TGLA 3QBJA 4LC1A 1AHIA 4AZTA 4I19A 2WHEA 4F72A 1KI1A 3VAYA 2GO7A 4AD8A 1WABA 2WSIA 4R1QA 1FU7A 2WUFA 3KTOA 5L40A 2VJMB 1E2JA 1ADJA 3ILYA 4I5GA 4E7OA 1COWA 4BVAA 1HZZC 1BVRA 4D5GA 4EELA 3T7RA 3V1LA 4NXMB 1Z5ZA 2Q8QA 4R41A 1C7QA 3F6YA 2PLFA 1PIWA 2BTQA 2XB2A 1N5IA 2V7TA 3C70A 1NFFA 4EPWA 3EZYA 5LP6C 2ZJ2A 3I12A 4URYR 1I24A 1Y9JA 1TKBA 3ENWA 3ZDCA 4B81A 3BGVA 2QDXA 2NXEA 3ZG6A 4NZMA 4H9GA 3E5MA 2WP0A 1NT4A 4RY0A 2Z2XA 4HGYA 3W4IA 3B6IA 5DWVA 3N8DA 4XEHA 5JTTA 1A9QA 4JEHA 4AU1A 2O8DB 3TNDA 5IK2A 1JR3E 4RTOA 3CJQA 3E9MA 4BKOA 3U4QA 1PQYA 4GXRA 2C07A 4HVAA 1RXCA 4QUJA 5E3HA 3IAUA 3PLRA 1SHJA 1UBJS 13PKA 1OLUA 5FHRA 2RE8A 4IJ5A 5I4BA 4P5EA 2G3QA 4C08A 3AHDA 5K1ZA 1ZKMA 1P0PA 2E5WA 4E4TA 4QIHA 3OQMA 2GPWA 3PTAA 3N2ZB 3EEQA 3DM9B 4UDXX 5KTNA 5MN4A 1R00A 2FZWA 4GPEA 1E2BA 3VR4A 1VE9A 4QJ5A 3I39X 1S3FA 5CT8A 5IBPA 2EL9A 5KC9A 3CLUC 2GAAA 4CW7A 2JCSA 1NATA 2IF2A 2FOLA 2WICA 5H1YA 3VPSA 4OJMX 3ZCVA 4DVJA 4LJ9A 2JAXA 1N2SA 2ZSEA 4F11A 2ZS8A 2BH9A 3TRHA 2YHIA 1FDWA 3HR8A 4OSPA 4PYQA 1MPTA 5KSPA 2OHIA 3DV2A 2WHQA 5DGDA 3L2AA 2YWXA 2Z58A 3NEPX 3NALA 4P31A 4REOA 4COKA 4CIYA 3FYCA 2PQMA 5JEDA 3D8BA 1MRNA 4PLZA 4Q4HA 4D8TA 4E21A 3I61A 3AETB 5CVCA 3KAQA 3PGXA 1GN9A 3OFSA 2JH8A 3OJOA 4QUGA 1Z68A 3V80A 4RHCA 4F2WA 2QPAA 4PPNA 3SICE 3WL3A 2VYNA 4DR2M 1KFVA 1TF0B 5FL7D 1JLLA 2XZPA 1YVDA 1OREA 4M0PA 3NH6A 3AFMA 4Q12A 1M2VB 1GZVA 2XYGA 3FI9A 4LHWA 1KEVA 2HNKA 2YCLA 4LHVA 2XVXA 3W2HA 5JU6A 5HF5A 4G0UA 1UR5A 1PL6A 3HZRA 1VHJA 4C0JA 2VA8A 1IG0A 2IDJA 3L1KA 3ZXYA 5TARA 2K6GA 4CDGA 5A4DA 4QHSA 4FBLA 4DM3A 2M6RA 4LRUA 5HMLA 4O4JB 3ZK9A 2HKIA 4BZXA 5BVHB 1Q5PA 3MBOA 4NOLA 3K31A 1L2TA 1JG7A 2V98A 1W73A 2VP6A 5CAEB 4EGQA 4EQZA 4WHMA 3I3OA 2CHVA 4X84A 2OFPA 4MVJM 1OWMA 2WSCF 5UKDA 5EJ5A 3VA7A 1EP2B 1RYZA 1N5RA 4GLFA 1KORA 3WL8A 4MUKA 3QMMA 4B3BA 2XCSB 4ALKA 2YVQA 1RXYA 5G1NA 5JJ5A 1ZM9A 4FHDA 2EKQA 2H4WA 2J5XA 5ALGA 1DPFA 1Y6ZA 3RAJA 4XLTA 3JYLA 1K98A 1S8FA 1CUFA 4I8IA 3BIFA 4ROTA 4BEVA 1AUAA 1BDIA 4XARA 1WDTA 1RJ9B 2P7IA 2Y1CA 3ELWA 3G2NA 4OA8A 3VDXA 1NW4A 1CY2A 5IFKA 1RYDA 3HNPA 3I2HA 3H0EA 1EU1A 1MJFA 1Y1TA 2XVAA 1N77A 3CBGA 5D7NA 1Z75A 4HNAB 1X7WA 1PJQA 1CD5A 1W93A 3RG8A 1HI9A 1N34B 5D1NA 3RS8A 3EEBA 1QP8A 2YDYA 2WZQA 1Z38A 1JECA 1LBEA 2IYYA 3ZCSA 4UHHA 1H2EA 2UXCM 4L5IA 3OFVA 2IIQA 2HXSA 3WOHA 1KPGA 1UXOA 4DF3A 4TVKA 4C05A 3D0OA 2ZE5A 4KR9A 4Z3DA 5BSTA 1YZFA 2HTFA 4CQMB 1TMYA 3NBKA 1RKXA 1ZCJA 2NT3A 1G8GA 4RJJA 3RWMB 2NNWB 4PDIA 2C4WA 1O9HA 4I55A 2H3EA 2Y92A 1XXHA 3RE8A 1DXHA 1VKZA 3KT6A 2QV7A 2YFHA 1ESEA 1RRFA 2NUPB 3ASYA 1QHXA 3I4LA 4HN4B 4H31A 1PDVA 1OXSC 3JARA 1FMLA 3Q12A 3WHIA 2W42A 3FZEA 2GAJA 3E61A 4X90A 3Q5DA 3M3HA 2NM0A 4QXAA 1LLFA 2N0SA 3R0ZA 4YT5A 3JX9A 3GG2A 5JRDS 4NBWA 2VXCA 4Z0TA 2VQEM 1YVEI 1W49A 3MWEA 4IH4A 4NFSA 1RFGE 2AXPA 4L16A 3KXDA 2OORC 2VNKA 4MPTA 1ZEJA 1BRMA 5ICFA 3WI7A 3ZYCA 1LFAA 1Y7HA 3I32A 2UXCB 5MGNA 5AXDA 1Q84A 3BF7A 3LHFA 4R8VA 5DP1A 4FTWA 2D4HA 5BYJA 4CG1A 3UBTA 2XXBA 3K4PA 3WL4A 2ZBGA 4BJ6A 1L5VA 1YAJA 4L8LA 4CKXA 3UJ7A 4IZ6A 1KY5A 1HQDA 1L7AA 1SK8A 3LYHA 5T4HA 3GV0A 4UJ3A 4D3XA 1RRPA 3SYMA 3ND6A 1M2OA 1U6JA 4CQNA 4FW8A 1P81A 3B1YA 4MS1A 4ZK2A 5HZMA 1JMYA 1ONNA 2QYTA 3D6TB 3H9CA 1UM8A 1BAPA 3PK0A 5BR8B 3EGDA 3E23A 1YKGA 2PFGA 3QUAA 1NNUC 2J09A 2H07A 3EJ6A 1JFFB 2PIDA 4AUKA 2DQ4A 2V45A 1O96B 1DEHA 5ALDA 2NT4A 5B1IA 3WS7A 2WWVD 2DP4E 2YC2C 3FOBA 5FNVA 1UBFA 2VJLA 2YVUA 2JFYA 3JR4A 1FFSA 3PRJA 5F5XA 1KZ7B 3C6YA 4U2FA 4AZWA 1XQXA 1ZJYA 2QD2A 4OFWA 5AKJA 3UJ6A 4OLBA 4JQCA 4ZIRA 3MUEA 4DAOA 3GAFA 4JU9A 3ZCTA 5HQ3B 4JV5M 4KX3A 3GJ5A 1W76A 3NR2A 1DRWA 4IPTA 4FMPA 4GG1A 4X71A 2JFVA 3O84A 1FUKA 1JBQA 1NBEA 1ORHA 3I42A 3K2BA 3GLTA 2OB2A 1HE8B 5H02A 1B26A 4E7PA 3HADA 3AKZA 2W0SA 3H2YA 2FZLA 3KK0A 5B7GA 1L1EA 2VRCD 2X76A 2J4FA 2HU2A 3TF5A 5JBNA 4F46A 5AW4A 5CNMA 2IH5A 2LNDA 4DSOA 3A1EA 3R75A 1ZNWA 4ZTZB 3JQPA 4OUDA 1SCKA 4RL4A 3UZUA 4XJVA 4RIGA 1TGVA 3GGOA 4LTDA 5ELLA 2GA9A 1PJCA 1G16A 2WJAA 3LWNA 4JLPA 4DGSA 3FYUB 3NTOA 1K6EA 1CP3A 1UCFA 2ZJFA 3T1HM 3JWHA 5BOSB 5EJ9A 3OLZA 2RKOA 1XK7A 1LDYA 1NBIA 1SVKA 2GJSA 3IOCA 3PF9A 4GM1A 3WBFA 4AF7A 4CMAA 5LNK1 5LQKA 3S8YA 1XMSA 2C2XA 1Y33E 2D5IA 3I9LA 3PFWO 3MINA 2EX0A 5DNYA 4PZZA 5HE8A 1NN1A 2J3HA 3GLHB 2IOHA 4FJ1A 3OQBA 3MGGA 5CCBA 4RCZA 2I66A 4WXHA 4GEWA 2FUCA 2M1XA 2AQKA 2ZPUA 3BH6A 4J0KA 2PMCA 2FETA 2PUTA 5EMKA 1T2VA 3QYFA 3I51A 3G82C 3COYA 3ADOA 5JZBA 4HJXA 1V1MB 3FFXA 2EW8A 1S89A 1KDRA 2AZTA 3IDOA 1OILA 4GYJA 4XKJA 5EN4A 2H1LA 3ZK8A 4OQNA 3EAFA 1P2VA 3REFA 3EZGA 4ENPA 1R0RE 2M9MA 3A1CA 2I2WA 4RHXA 1EVZA 4FCCA 1R15A 5DU2A 5JLJA 1CUCA 1YVRA 1KS2A 2HU5A 1ZRSA 4RK0A 2VUTA 4V1CI 3ZI4A 3HJ8A 2EF1A 3A6JA 3MERA 2BDUA 4D7AA 4RZXA 1X0VA 4ZK6A 4RKFA 4JLBA 1E7RA 2PCJA 3LHDA 4MS3A 1CY0A 3E22A 5DSZA 2R65A 1QO9A 1R0XA 3R3HA 1D2HA 3N8IA 5HF8A 3UNXA 3B51X 4I55B 4FDUA 2ONZA 1YE8A 5AVKA 4BBZA 1EESA 2YFQA 5BPVA 2XHZA 4FT4A 1SKBA 5GZ6A 3KS9A 2C96A 2ZFUA 5HF6A 3THOA 4I1VA 1H4QA 2VF5X 3NVDA 5BSVA 3ECCA 2QX4A 2E2WA 1R8QA 2X14A 3H1FA 2RH5A 4TUYA 1U7UA 4CUKA 4DCPA 1ZAKA 2AQHA 3V4FA 4NC6A 3P0JA 4Q19A 1NASA 3H17A 5DULA 3F92A 2AF4C 3DJYA 3ENQA 4DPMA 2GSDA 4FR5A 1II8B 4ESVA 4F2LA 2JAWA 2PEYA 4M37A 2OUKA 4FFLA 4KIFA 1KP9A 1GNSA 2GCNA 1MJHA 5BV8A 3CE6A 3DZCA 5FP0A 1SVMA 2I6QA 4L9SA 1R3DA 5EFOA 1F8UA 4PFSA 1EGHA 4QSHA 7ABPA 2JLUA 4ZT3A 2IELA 3C24A 3QWLA 4QYMA 3TSZA 1U7WA 3ZWAA 5A5VA 1QYVA 3UWOA 4CCWA 4ENRA 2CRUA 1SK9A 2PAFA 5TPZA 3K53A 5EIWA 1XDZA 2XDQB 4YHBA 3SKYA 1FC0A 3LT1A 5KDLA 4QTXA 1XEFA 3EC7A 2CFIA 3K1ZA 1NW5A 4NDAA 1G3QA 5E9JA 4CEHB 5JS2A 1AN9A 4N8DA 5IEJA 3ESXA 4TS1A 5CT5A 3W06A 3LO5A 4XPIB 1XJ0A 2AKAB 4I4CA 4W5RA 3IV7A 3IUMA 2VP9A 2WYIA 2GPAA 3L07A 3RIMA 4LZNA 3T7DA 4B6OA 1U2DC 3JQ7A 2GAFA 4A92A 6ABPA 3CX8A 2XDAA 4IINA 3UTDA 2OESA 3QYJA 5ILGA 1K6IA 1S2IA 3WX0A 4YUZA 2WJIA 5C53B 4YRMA 2AI1A 4OI0A 3FDZA 4GWGA 1JPNA 2ZTSA 1M34E 2CUKA 2JK0A 4LAFA 4QFDA 3WNZA 1JHQA 4E5NA 5SYAA 3PXXA 4ZT4A 3V9PA 2HJGA 2Q6OA 4Z4EA 3NC1C 4AN0A 4AJNA 4MKGA 2PX2A 4LGYA 1SAYA 4KOEC 3WGQA 1ZMWA 2JLSA 3VK8A 1PNRA 4RK6A 2RD2A 1OFHA 1R18A 2Y77A 4QM7A 4GDFA 4TSKA 3HM2A 4H77A 3G9QA 5C2JB 3KWMA 4ETIA 5LYJF 3EGIA 2QAGA 2G5CA 4PAWA 4UE2A 1OFVA 1V5IA 2QP9X 5CIYA 3FTFA 1PSZA 5J5VA 1P17A 2MYPA 2YBEA 3PGVA 1FDSA 4PGAA 1BDMA 1VLQA 2QV0A 2FWBA 1X7ZA 4LV6A 4R2LA 3R7SA 3TSYA 4BCBA 4JU8A 4UJ5A 4XB6B 3I45A 4NQRA 3T7EA 5JEEA 3AV0B 3H6HA 3WLHA 1EVJA 1RPTA 2XSZD 2HV8A 2OYSA 4UUMA 3DA1A 1GTG1 3TGLA 3A2LA 1WZEA 3ENNA 1XNRB 1WETA 1B0ZA 3QKTA 1YK0A 1QG0A 4YRSA 1TR8A 4IDFA 2O52A 4DM4A 3CCBA 5LNK6 1J24A 3UFXA 1I7NA 4EBBA 2YXBA 4KAXA 4BN5A 4DBLC 3LMMA 3OY2A 3ZD6A 1N2CB 5GOZA 3WLTA 3E3NA 4DR4M 5CLHA 5ADUS 4FZVA 1HQYE 1KI3A 1UPXA 5LA6A 3SZ3A 3IO3A 3NB0A 3C14C 2HRQA 3L25A 4KYUA 2HO5A 2L69A 1O08A 2FE1A 4IKEA 1FTSA 3Q2KA 4L85A 4LOLA 1ECBA 3QFFA 3RSQA 2WMOB 4N54A 3V97A 3SFTA 5FX2A 3O6VA 5JAMA 4J91A 1FFAA 2R5WA 1RHRA 1T8TA 4PXSA 3OPMA 4DR5M 2GNOA 5TQ0B 4OXKA 1HQKA 4XM1A 3GT4A 5DK4A 2R751 3L0IB 3T1TA 1QS0B 1U3WA 3NTUA 4ITUA 3ZCRA 1IG3A 4OHXA 3IIKA 3B8HA 1R0WA 1C9KA 1LPAB 2CD7A 4ZREA 4M9SA 5ERGB 2RB5A 2WVJA 4GQAA 4BQOA 1AKVA 1UWLA 3KQYA 1NQOA 4PQGA 3VX3A 1VBMA 1BE1A 1PGNA 1QZZA