2XSZD

The dodecameric human ruvbl1:ruvbl2 complex with truncated domains ii
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
331
structure length
310
Chain Sequence
b'GAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIHTVSLHEIDVINSREIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUVB-LIKE 1
publication title Structural and Functional Insights Into a Dodecameric Molecular Machine - the Ruvbl1/Ruvbl2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 310
sequence length 331
chains with identical sequence E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06068 TIP49 TIP49 P-loop domain
D PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xszD02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xszD01
2ZSDA 1SXJB 2FNAA 1ZUHA 1DPFA 2ZQ5A 2HUPA 4C7OB 1R6BX 3QXJA 1W44A 2ZSEA 4DLRA 1J7KA 2UZ3A 2WWWA 1JR6A 4OI0A 4EUNA 4ARZB 3BIFA 4UNPA 2IS1A 5FPKA 3AVTA 3CX7A 4RVCA 1OXVA 5GJBA 1W1WA 2OG2A 4UXIA 3DM9B 2WSSA 5TVKA 1KHTA 4MH0R 3DVLA 3NBFA 3ONWA 3OE7D 2QA5A 2W2XA 5FL3A 3VKGA 2JIZD 1Z47A 3U4QB 2QM8A 1D2EA 1AS2A 4D0GA 5EXPA 3OFNA 1QZXA 1L4YA 4EKDA 3HP1A 1J8MF 1Z6AA 4IVQA 3GFTA 4KVAA 1LTQA 1KOFA 1LS1A 1EX6A 1NBMD 3KUDA 4AURA 1WBDA 2O8EB 1ESMA 1GRNA 4BLTA 1GOTA 2JLWA 2KRKA 4OYHA 4AC9A 1VYVA 3PJRA 2G0NA 1W48A 2CHGA 2P5SA 3G82C 1W0JD 2QMUA 4M1SA 4QHYA 1KAOA 1R0XA 3PITA 1ETUA 3C16C 1Q1QA 3DMDA 4JBYA 3BORA 1KI9A 2FU5C 4JBXA 5L3SA 2ZJYA 3C5HA 5FPSA 4LJ4A 1JXOA 3ICEA 3TE6A 2CL6X 4MRRA 4A82A 3M6AA 2AX4A 2V8OA 3U7FB 1E2LA 2JATA 3N70A 5EE5B 4HDQB 1XP8A 3EZ2A 3VKHA 3M1IA 4JMPA 4JJZA 4NL4H 3U3KA 1N5JA 4IFEA 3NXSA 4A0RA 3A37A 3SFZA 3QIAA 1P2SA 2X1VA 2ZI3A 2ZVQX 3ZZTA 5ANRB 4TYNA 4AI6A 3FHOA 4Z1MA 2CE2X 4RZXA 4E5UA 5KU1A 3NEJA 3PV0A 2OBNA 5GVRA 2WOOA 1TF2A 1ZM4A 5UKDA 1G20E 1MRNA 1OXUA 1EX7A 2ZSFA 4OK5A 2JASA 3SHWA 1OFHA 1R5NA 1RRPA 2DPXA 3BFKA 2NO6A 4KFRA 4W5JA 1VG0B 4DSTA 5JS8A 2XGJA 3K1JA 4I1VA 3L0PA 2WZQA 2V1UA 1ZP6A 2J41A 2FGKA 2FSGA 3AB3A 5IHPA 1R8QA 2G1JA 3SN6A 3TK1A 3CNLA 1HE8B 2QZ4A 4LI0A 2LKDA 2BIFA 4YMUA 1M34E 4POAA 2YC4C 1GILA 3F3YA 2WWYA 1ZW6A 2JDIA 1N0UA 2QEQA 2W6JD 4FWTA 2ATVA 3FKSA 1KAGA 3B1XA 4A8JC 1S9DA 1XTIA 1XX6A 2CBZA 4MDEA 2KWIA 3HYRA 2QT0A 4QL3A 3CH5A 2EVWX 4NMMA 4B34A 1M7HA 3U7GA 5JMTA 1E4VA 1CXZA 2HLDA 1G18A 3ZIAA 4OHZA 1HYQA 2VHUA 3GFPA 4NCNA 1ZC4A 1JNYA 3QXSA 3FGNA 3K0EA 4EQ6B 1XEXB 3BB3A 3IO3A 1E99A 5CYPA 2P67A 3VX3A 1XNJA 4GBMA 1X3SA 3AKDA 1BS1A 1U8AA 4DLYA 2JLZA 4UKDA 5J4LA 4NYIQ 2AXNA 1OF1A 2REXB 1IN4A 1US8A 3PQCA 4OK3A 1QBKC 2DFLA 4WZAE 1SVMA 3WXMA 4PPNA 4BRUA 1EESA 5JJKA 1DVRA 2RGXA 2QPTA 2GCNA 2NIPA 5JRZA 3IHLA 1EXMA 1KK2A 3Q85A 1CKEA 1N6NA 1TQ6A 2YC2C 3KKPA 3U61B 1OKKD 2FOLA 2OCYC 2R2AA 4RD0A 1XD8A 3QEOA 1AN0A 1XXHA 4MYHA 1JAHA 3AVWA 2VSXA 1ZU4A 3QG5A 3BWDD 1ZM2A 3T35A 1NBME 2JJ2D 3PUYA 4CEIA 1ZINA 2RMKA 2ZRPA 2ZSBA 1BKDR 4QBIA 1SHZA 3FWYA 4EPXA 1XZPA 1R5BA 1KY3A 1K5DA 4G5GA 4QJ3A 3EIEA 2YOGA 4JLMA 1XF9A 4CDGA 1Q1EA 1QVRA 2ZJ8A 1W49A 4MGYR 2CHVA 1KY2A 1AS0A 2WMNB 5HKKD 2KI5A 2QMOA 4Q4HA 3MUFA 5FPHA 2ZRMA 2V6ZM 1E2QA 2FPMA 3AVUA 1W2GA 3X1WA 2OAP1 4I99A 1LS6A 1TUEA 2WWXA 1KSHA 3X1XA 1G3MA 2QP4A 1IXSB 1TEVA 1GL6A 1OIXA 1ZAKA 4PQYA 3SS8A 3QI2A 5SZKB 4B3CA 2FPKA 4BLOA 8OHMA 1NI3A 3EPHA 1VHTA 4M9XA 4ZIRB 1TF7A 4URXR 2H1LA 4TTRA 3THWA 3L0OA 2AK2A 5CIQA 1JAIA 4KU4A 1TQ4A 5AR1A 4DUGD 2IC5A 5L8VA 2REBA 4FWGA 1CR4A 1NG1A 3DKPA 5KSZA 1D5CA 4OBEA 2IX3A 3I62A 2VA8A 5DN6D 1G8HA 3S1AB 3BB4A 2ZJOA 2GESA 4X8LA 4DDWA 3KQUA 4FMCF 3IILA 4PHTA 4XD7A 3GD7A 5SZJA 2R62A 1XTQA 4YLGA 1QHXA 4D4MA 4DT1A 3SDZA 3K9HA 1W5SA 4D0NA 1RJ9A 3NC1C 2E9SA 4S2EA 4URYR 2JGNA 2DWZB 3UANA 3PIRA 1Z83A 2GEUA 2A7QA 3W90A 3IEVA 2A3RA 3CR7A 4A2PA 5H8WA 4JVLA 2G3YA 4LJ7A 1TPZA 2REOA 3G0HA 1AGPA 3GLIE 4IVPA 4XWAA 2DZNB 4OQMA 1G17A 2RHMA 2VP0A 2IS6A 4JVNA 1CR2A 1E79A 2QORA 4XSHA 1M74A 2GBLC 2LWIA 1NN5A 4NZYA 2WJJA 1KDPA 2JLUA 2AR7A 1KMHA 4TYPA 4KLZA 3ZQJA 1YZLA 3OHMA 1Q1ZA 1Z0AA 3UWOA 1G1MA 2F3TA 3EWSA 1TU3A 4OQFA 1OB2A 4A0GA 1ZMXA 2GCOA 4ASUD 4N0DA 1G5PA 3L43A 1QHNA 3VQTA 1DAMA 2QY9A 2BBOA 4HLQB 5TDHA 1NRJB 4KCGA 4BFZA 1I4TD 1E4YA 3E70C 1XXHE 4DIDA 3GLGA 4EAQA 1P6XA 3TRFA 2GHIA 4B76A 2V54A 5GJCA 3B1WA 1E9DA 2ZJAA 2PLFA 4P4SB 2IXGA 3EIQA 4Q21A 3FKQA 1X8JA 1KKMA 1RIFA 1RRGA 4LJ6A 3K0AA 2NPFA 2P6NA 1MO3A 3I5XA 4LRWA 3U3RA 3LO5A 2HYDA 1F2UA 2G77B 2OFWA 4PHFA 1KI6B 2Q21A 2WWFA 4CT4B 5E7IA 3WBJA 2CHQA 2ERYA 3RS2A 2NZJA 4RZUA 1J70A 1E2KA 4BFXA 4C30A 1W5TA 1K5GA 2FZ4A 4GP7A 1JPJA 5FL7D 4V03A 3I73A 1VMAA 2QAGA 3QKSA 4M2LA 4MDFA 2FWRA 2YWEA 2X2FA 1NMZA 3RWMB 3I8XA 3QKRA 5CK5A 4OI1A 4LHXA 1X37A 1SXJD 4LYJA 2FH5B 4B3XA 4HUQA 4LK2A 3VR3A 4ESHA 3EIHA 1DAHA 1SXJA 5TB5A 5K8TA 2A5FA 2OLKA 2ZREA 2ZJZA 3B9PA 4JLJA 3HDTA 3PEUA 1TAGA 3O8BA 2EW1A 2FFBA 1SQ5A 2L0XA 4CEHA 2DVWB 1YZGA 4L8GA 3PUVA 4HZUA 3W8RA 5FBVB 2OZEA 4TTPA 2GJKA 2IYQA 2XTZA 5CDFA 1KI2A 3LBIA 1YHNA 2XOKA 1JECA 2UKDA 4Q9KA 4MKHA 4JL5A 5LD2B 1G6HA 5FUYA 3U3OA 721PA 1N5IA 2R6FA 2Z6VA 4IEIA 1S8FA 3V9PA 1JQLB 2BHRA 5L3SB 5HCIA 2LKCA 2VHTA 2J7PD 3IO5A 3U4QA 3CRW1 5G41A 3GQBA 2QBYB 4F91B 2GJ9A 1OXXK 2FN4A 2GAAA 1UKZA 2ZETA 4LX0A 1Z6YA 1DARA 1GG2A 1OH6A 2BKEA 1AZSC 3K70C 3SQWA 1G7TA 2O8EA 4RZ3A 3REFA 1XFAA 3LVRE 3KXLA 5DHAA 3OIWA 4G5OA 2R6DA 2FV8A 1AQUA 4TMTA 4FCVA 2J46A 2V6IA 1COWA 3MCAA 1E98A 4NCJA 4B71A 3LDAA 4D4LA 3GJ0A 2IA5A 4HLDA 1Z6GA 3BH0A 3WMEA 1D6JA 4MRNA 4XTRA 4PC6A 3BOSA 5CM8B 2CCGA 4A36A 1ZD8A 4QBFA 2YOHA 2YYZA 4Q1DA 4Q7KA 1HQCA 3SHFA 3GLGE 1FTNA 2VSFA 1TMKA 4PAMA 3BERA 4AYXA 1DAIA 2QMHA 3N2EA 5GJVC 2IHYA 1AA9A 1GZSA 2QROA 2ZR0A 3FMIA 821PA 1S3GA 1WMSA 3K53A 1W36B 3K8YA 2GEDA 3U3MA 4LGMA 4L9SA 4M22A 1OIVA 1UEIA 3K09C 1RVDA 4WZBE 3W3ZB 1F60A 1IOZA 2V55B 2FFQA 2NGRA 2RH5A 2VYFA 5J4KA 1LNZA 2WPDD 4LWZA 3RLFA 3NTUA 4DLZA 1KDOA 2VEDA 4EPWA 5AUQA 4PFSA 1OT3A 4HAUA 1JI0A 4PO8A 5KNDA 5JZVA 4LRTA 4JL8A 2OESA 2HF8A 1VIAA 3QXCA 2ZRBA 3TVTA 3AGPA 4W9MC 4JZKA 2AFIE 2C5LA 4ERNA 1P7CA 1C9KA 4MRSA 3CH4B 3ZZ0A 3ZH9B 3VLFB 1E2FA 2G1KA 4US2R 2KBEA 2ZYVX 1U81A 2RGDA 2XZOA 4NYMR 3VFDA 4IW3B 4F4CA 3PCRB 4NCKA 2BVNA 2WSMA 4US1R 4UXHA 1U0HC 3KTAA 1SXJE 4YXWD 3VNUA 1FUKA 2ZE8A 1Q21A 1RYFA 2WHXA 4BEJA 1ANKA 5EP2A 1W47A 4Q03A 3P4YA 4B48A 4Q4JB 3TUJC 1VCIA 4FXPA 4L5BA 4WIAA 3FDIA 5HCNA 4NYJR 3VR1A 4LV5B 2WJVA 1XEXA 2HT6A 3AEZA 2NMVA 2F1JA 1UKVY 2VHJA 2D62A 3LAWA 4B47A 4CEIB 3HR8A 3CWQA 2H16A 1SVLA 1PLJA 3T34A 1VCMA 1EWRA 5EP4A 1X86B 2TMKA 4B3FX 1BH2A 2PEZA 5FI1B 4PO9A 5B57C 5JCZA 1U9IC 3KB1A 4GNKA 4ZI3A 3EASA 1IN7A 1BMFA 5C1BA 4DIEA 4Q4HB 5CK4A 1JEEA 2GXUA 5LDDC 2J7KA 1M6NA 4P33A 4RFSB 2CLDX 3L2OB 1UPTA 5G3ZA 4JJKA 3A6PC 4GITA 1T8TA 3VNVA 3R7WB 3M4YA 1NL3A 4Q4LA 2ZROA 4XVUA 1QF9A 3W6PA 1KIMA 1KI8A 3K9NA 4TWZA 3BD9A 3RYTC 5DE3A 1PV4A 1ZM9A 2QTFA 1MOZA 3B8HA 4NYIR 3THYA 2XNDD 4B3GA 1J90A 1LF5A 4TMXA 2BMEA 1Q0UA 4L4UA 2P5TB 2DBYA 3TSZA 4BEBA 1FPMA 2XNDA 4A0HA 1N5LA 5AUOB 3B60A 3T1VA 5CLLA 1G19A 4MITA 1A2KC 4QJ4A 4DDVA 3LW8A 4XJXA 3LLMA 3BB1A 2W6IA 4C4PA 2GILA 3A58B 5EZ6B 4BFTA 4HSEA 4B73A 4HATA 1TL7C 2QRZA 2Z83A 4FWHA 4C3ZA 4ACAA 1T9HA 1Y63A 3WMFA 5IK2D 4W5WA 3AVPA 1H8HD 4ZIRA 2ZRNA 4LPKA 3A1SA 3UPUA 1R0WA 3QUSA 2VH5R 4CRWB 3TUZC 4ILEA 2PX3A 1VKJA 2XZPA 3Q72A 4RZ2A 1YZQA 5HE9A 3OEHD 3SZRA 1SULA 3X1DA 3MJHA 3UK6A 1X6VA 1ZVQA 3LX8A 3GLFE 5JEDA 3TW8B 2VIIA 1A7JA 2AKYA 1R7RA 4TLDA 2XITA 4IDHA 2XTNA 4B2PA 2CK3A 2RGNA 5P21A 2HF9A 3LH5A 2PMDA 3B5JA 3KJEA 4BRWA 1E0SA 1X1RA 5HR5A 1CP2A 1S1CA 5BYKA 1UJ2A 4A3VB 3QF4B 2ZE5A 4F4IA 4AWXA 2ECKA 2VPPA 4TSFA 4E07A 2AFHE 3CNOA 3D3QA 3CBQA 1OE0A 2SHKA 1E2EA 3VKWA 2FJUA 2ZRCA 4TLCA 4BPBA 2FZLA 1YZUA 2VP6A 3IBGA 3LBHA 4LBWA 4WVFA 5C4GB 4CYMA 2QNRA 1NN1A 1KJZA 1XD2B 4CGZA 1NVUQ 2A5YB 1VG1A 3K0FB 4FMCB 4C0HA 1GFIA 1TF5A 1N6PA 3VAAA 2A78A 1S9HA 4TYYA 1XPOA 2XXAA 3R9XA 1Z06A 2K5UA 2EFHB 3LQQA 3K0AB 4BLPA 2J0SA 1UKEA 1II0A 4QFMA 4GL2A 2CCJA 4HLUC 2EFEB 4B32A 2RGCA 3O8DA 5AJWA 1OHHD 2GDJA 4KITB 3RVBA 3W9YA 5B30A 2CLCX 5JSZA 3QOFA 4IOJA 4G1UC 4B33A 2F1HA 1EFRD 1WXQA 3DO6A 4EPTA 1II9A 4YMVA 2HT1A 1EFUA 1A5TA 3LQRA 3VU9A 4A1FA 5E3HA 3EZ7A 1MRSA 3KQLA 2QM7A 2F1RA 4KBFA 4FMBB 2Q6TA 3GJ3A 3PEVA 2GK7A 2RHDA 5JFGA 5FTMA 2XAUA 2F1IA 2JJ1A 1I2MA 3I1FA 4HUQB 4Q5IA 4IXNA 1VIYA 3IDQA 3MD0A 1KI6A 2Q3HA 5FBRB 3QVUA 2CLSA 5EUMA 1L2TA 1C4OA 3Q3JB 2ODWA 3MAAC 4GOJA 3Q8XB 2GZDA 2QGZA 3LRPA 1WF3A 1G4AE 4CEHB 4JBWA 5CIWA 4YMSA 4HZUB 3GFOA 4QHTA 3VR4A 4FCWA 3RABA 2EYUA 2WSSD 3AF3A 3TQCA 2GJ8A 3EA5A 3GJ5A 3LNCA 1YU9A 3W6OA 2BOVA 3SEAA 3CIOA 3T15A 3DZ8A 3R8CA 5H1YA 5GJWC 3PEWA 1JQJC 3TLXA 2OHFA 1FQJA 3IPXA 4ZDIA 2C9OA 4RSGA 2OBMA 3OFND 5FR1A 1HUQA 1FMJA 1UKYA 2W2TA 3LA6A 5CJPA 1WCV1 2WOJA 1U0LA 1YR9A 5L3RA 2YNMA 5JJLA 1DAKA 4JL6A 2R8RA 2WBLC 3NH9A 6Q21A 4PANA 1TQ2A 1D9ZA 4A6PA 3REGA 4EPVA 3W6NA 5JS7A 3EW9A 4A8JB 5DI9A 4LV6A 4WW0A 1M7GA 2WWHA 2ANBA 3QKUA 4DCTA 1ZIPA 4RJLA 4UJ5A 2VF7A 3SJCA 1P62B 3QG1A 2ZRGA 4KBGA 2GJAA 2PT5A 5E4FA 4ZDKA 4BLRA 3QNUA 1GL7A 3HWSA 3F8TA 4JLDA 3DDCA 1IAQA 4AYWA 3EPJA 4O2LA 4BFYA 2QBYA 3MFYA 5CJ2A 2QGNA 3T1QA 4TQAA 3CWZA 2JLXA 1FNMA 2FMXA 4JKIA 4P4TA 4GDFA 1E2NA 1YR6A 3SJAA 2MSCB 2OXCA 4KLNA 2P6UA 4Z1MD 1TQDA 1SVOA 4KFSA 4OJQA 2P6RA 1H65A 1XMVA 2QAGC 4LDJA 1KSFX 4KODA 1NY5A 1SKYB 4NYMQ 3QSYA 1OH7A 3AJIB 4R9UC 2D2EA 2GVZC 4PHHA 1Z0JA 4NU0A 1Z8FA 2O8CB 4LOAA 3GJXC 3U2QA 1E9FA 4EJSC 4O2RA 2HJVA 2Q9AA 1G3IA 2N42A 4PC3A 4B43A 4NYJQ 5M04A 3VMFA 3FPAA 4O25A 4MYCA 1W36D 4BQSA 1MO4A 2ATXA 2JDID 1QZMA 4W5HA 2O8FA 2ZJ5A 3FKSD 5LB2A 5F9FA 4AG5A 5A5GA 2E1RA 121PA 4XTCS 1SVWA 3OZXA 3VR6A 4D4KA 1NJGA 1N0WA 1WQ1R 2ZU0C 2XB4A 1NVWQ 3H1TA 4C0LA 5JLJA 2R6GA 4HDOB 2HLDD 2ZEJA 1CIPA 3I32A 3KTAB 4GZMA 3ZIAD 2EU8A 4LHVA 1GITA 2I3BA 1XEFA 1R8SA 2GEVA 5KSPA 5KUTA 2BM1A 4LUCA 3BFVA 1W7AA 1D8TA 1C1YA 4JYCA 4LZZA 1DAEA 2ZRKA 5KSOA 1XMSA 4XH9B 4QG7A 4CEJB 3CNNA 4QHSA 4MGIR 4RD4A 1DAGA 1FMLA 2ZJBA 2O0KA 1NP6A 3H2YA 5LB4A 1E0KA 1WP9A 1N5KA 3AP3A 1MO6A 1Q3HA 2JA1A 5CLQA 3K9GA 5FBWB 4RCYA 3T12A 2C99A 5C2JB 3HR7A 4RCZA 4PZLA 3ND8A 3IGFA 2C2HA 1O3YA 1A4RA 3C4JA 4JLOA 2YKGA 1B23P 4RKFA 4B35A 4Q4JA 1QDEA 5TV2A 2VP2A 1XBTA 4EPYA 2QTHA 3H84A 1JJ7A 3TW4A 3ZVLA 4AG6A 1QHYA 2BEKA 5SZHB 3DL0A 4P4UA 3R20A 3NKVA 1KO1A 4RD6A 3VTKA 1WB9A 3B78A 3CRRA 2OILA 3EG5A 4C0KA 5EP1A 4DSUA 4LC1A 1XZQA 3CUEF 1XD9A 5A4JA 2Z4RA 1EK0A 4HUTA 3U60B 4NKRA 4V0NA 3TSWA 3THYB 4RFVA 1ZNYA 3MJRA 3MSXA 3FOZA 2FEMA 2GRJA 5IT5A 4WZ6A 4C0QC 4XIGS 4MYTA 1MV5A 2BBWA 4AKEA 5H68A 2VHQA 3TNFA 4Q19A 1A1VA 1YZKA 3EC1A 4C0AC 2WJYA 2RGGA 2BV3A 3BGWA 1B0UA 1AIPA 4RFSA 1W4RA 2BM0A 2IUSA 3T61A 3ICQB 4JLPA 4IXMA 1R2QA 4M1OA 3KUCA 4Q02A 3R7WA 2BMFA 1KI3A 2ZRLA 1QG4A 2IYSA 1CRQA 3WY9A 1SVKA 5K8IA 1NLYA 3H4MA 3GLHA 4XWKA 1KSJA 4YC7A 5EXSA 1X8KA 5TARA 3U7EB 1ZIOA 2VTKA 3LXRA 1JPNA 4DCUA 2NO7A 2P0EA 2BBSA 2XNSA 2IHBA 3AUXA 3NG1A 3TUIC 4NPHA 4TMZA 4UNSA 5JWOA 1AS3A 1PJRA 1W2HA 4XD7D 1ZUIA 2QPAA 2A9KA 2IEZA 4OI4A 4QC2A 1DE0A 1L4UA 3EWAA 4MUAA 1ZNXA 4DBLC 4PSVA 5FTKA 5E7MA 4N3NA 1U90A 2XSZA 2FF7A 4MGKR 2GAOA 5K8UA 1M8PA 1YR8A 1DG1G 3ZLJA 2MSEB 3EA0A 1T0HB 5H70A 4R2HA 4TT3A 2WAYA 3OIVA 1Q22A 2EWWA 1BO6A 4A4DA 4B3DA 2ZS7A 1OFIA 4IOLA 3ASYA 5HE8A 4QOSA 1KZGB 4DZZA 1RFLA 4S35A 5AJVB 3Q9LA 5FOWA 4K46A 4URWR 3W5JA 1OV4A 1E79D 4PTLA 2W2VA 3THXA 5CM9C 4C0BA 3ADBA 2O8BA 2GWHA 4URUR 2B21A 5F3WB 2AD1A 2XXAB 4BZPA 4MKGA 4F4JA 2BWJA 1NSFA 4L16A 1XU4A 4II7A 2FDCA 1NIJA 3QF4A 4LYFA 1XPRA 3QXHA 1E0JA 1E2MA 1GNPA 1NKSA 1UADA 2RGBA 3RS5A 1S3SA 1GKIA 4M53A 1ELOA 4NCIA 2HEIA 4F93B 4ESVA 5J47A 2QP3A 1OH8A 3EPLA 4LJYA 3ECCA 2J45A 5SZIA 1W0KA 2G83A 2Q9CA 1KTVA 4OQLA 5JSZB 1NVVQ 2HDNB 1XD2A 4Q18A 2NQ2C 3CRMA 3K0FA 3P26A 5G40A 2YZ2A 3WHKA 1R4AA 1OXSC 2NO9A 3KJGA 3PENA 4JKYA 5G53C 3UMFA 3VU9B 3UG6A 2ZI4A 3PUXA 4C9BA 4OKSA 2DR3A 1G3RA 3W8NA 1XMIA 3CRQA 3CF6R 1SVIA 3Q7PA 1XPUA 3NDBB 1AQYA 2BC9A 3UMRA 3WNCA 5C18A 5AUPB 1XRJA 2GTPA 1E1QA 3SI7A 3O8CA 4H1UA 4PAQA 1Q3TA 3K70B 4WBSA 1DS6A 1KZ7B 3KKNA 3RSLA 2ZU6A 2GJSA 1EGAA 4C2UA 4KYUA 1QHHA 2J0VA 3E1SA 4YMWA 4URZR 3KB2A 2RKOA 1NVMA 3U5ZB 3B1ZA 1HTWA 4TN1A 2P2LA 1W4CA 1GRQA 3EZFA 3UG7A 3P27A 5E95A 4BZXA 2UVQA 3SYKA 4Q01A 4Q9IA 1KJYA 4IVRA 4RD2A 3FMFA 2D06A 4IDOA 1U94A 3GMTA 3NHBA 4UJ3A 1PLKA 3KQNA 4QJ5A 3KX2A 1M1YE 5HZHA 1CULC 2AD5A 2AKAB 4AY2A 3B1VA 1FUUA 4KSCA 2XEXA 4TMVA 2QTVB 2XTMA 4FINA 3CONA 5JBQA 3TAHA 3LY5A 4JN6A 1EFHA 1YKSA 2IYYA 2RCNA 2ZI5A 5FOVA 4BZQA 3ZD7A 1I4LD 1MKYA 2AWOA 3RS4A 2CXXA 3AF0A 1MABB 1CJVC 4DKXA 4OHVA 2WMOB 4AIIA 3QF7A 1JR3A 1T3LA 2OCPA 2CNWA 1KK1A 2XOKD 5DIFA 4U02A 3SR0A 3SQXA 1ZUNB 3BC1A 1HEIA 4XSGA 4JVSB 1QG2A 3C14C 4PSKA 3NH6A 1J99A 1NVXQ 3I5YA 1F3OA 1G8FA 3U6BA 1N2CE 1UDWA 5IDVA 1N6LA 2XB2A 1ODFA 2BMJA 1T4GA 2CL0X 4GSYA 3H86A 3J81k 2QT1A 1G7SA 4DSNA 1LFDB 2IL1A 3LLUA 2VHCA 2YV5A 4MA4A 2D74A 3CPJB 5AJZA 4QGGA 3T5GA 2QE7A 3D6TB 2ZRDA 2IUTA 3NHAA 1G3QA 4NE2A 4BE7B 5BN3A 5C46F 4CF7A 3C8UA 5J4VA 4A8JA 4ZDWA 5JI3E 4R7ZA 3HPQA 2WTUA 3KL4A 3LVQE 4A92A 1COWD 2F9LA 3CB4A 3QPUA 4LYAA 3C41J 4KI0A 5D3QA 1QHGA 1YQTA 1OJLA 3OAAA 2B8WA 2ZRAA 3LD9A 2ODEA 1IN6A 1YJ5A 2B7BA 2X8AA 4QGFA 2N46A 4D0LB 5AJXA 3V4FA 2CVHA 2YINC 221PA 5FOTA 3MHVC 4TQUS 1X8LA 1JXMA 1CEEA 2GF9A 3A4NA 2FGJA 3CX6A 4FWDA 2KB0A 2VF8A 3WYGA 2H92A 4R98A 2O8FB 5KYKA 1EFTA 3FMOB 3RHFA 4DLTA 1XDBA 1R10A 2PL3A 1OFTA 4Q7LA 3DOEA 1T0JB 4Q9HA 1GDDA 2ORWA 1AM4D 3B7GA 3F5FA 5BW8A 3OF5A 4K8OA 4KHZA 3PR1A 1NY6A 2IYZA 4LJAA 2J9RA 2O8CA 4LYHA 4D4JA 3AF4A 3NBXX 1E2GA 4F7WA 4Y0VA 1KO5A 2QUZA 3PFIA 3BK7A 4PXAA 5EE1A 2N1BA 4HZIA 4DWJA 4HI0E 3N2IA 1NSTA 4H1VA 1KDTA 1ZU5A 2IF0A 2QQEA 3TVDA 3AQ4A 4HYYA 4L9WA 3GCGA 4LRSA 2VP4A 3TMKA 1P72A 1GAJA 5FBQB 3SBEA 2FFHA 4M1TA 3WP0A 2A30A 1NG9A 4URVR 2HCJB 2JEOA 2OLJA 2VRWA 1GUAA 421PA 1KO8A 4ZKDA 1AKEA 2BJVA 2J59A 1W4BA 1P9WA 1GTVA 3A8TA 3GLIB 4PZZA 1NIPA 3RC3A 5IRCD 3HPRA 4BFUA 2G9NA 3RRMA 3P1JA 3CRVA 4BFWA 5KO2A 2FSFA 4LPSA 4YMTA 1HE1C 3HYTA 2IWHA 1HA3A 4ZDJA 3B85A 2CCKA 3CPHA 2IW3A 5CDFE 3WHLA 1UBCA 4WXRA 5J4YA 4TZ0A 4CEJA 4TLBA 1E3MA 2DZOB 1WDTA 3OEEA 4BWYA 1XTRA 2BJWA 1IM2A 1UBFA 2GCPA 2CE7A 3FE2A 3DPUA 4DCVA 3EPKA 1Q20A 1GL9B 4QBHA 4IDQA 1CR1A 4M8NE 4QGAA 2C96A 1BMFD 4M1YA 4U00A 4Q1CA 1I2DA 3CM0A 3GJ7A 3A1WA 2OXRA 3KFXA 3LBNA 4GI7A 4B74A 1AZTA 4Q66C 4AD8A 1KO7A 3RS7A 1GP2A 3SC3A 1E96A 2PZFA 5FI0B 4FIDA 5HPYB 2RGEA 1NKTA 2FEOA 3NVAA 3ADKA 3RC8A 4YDSA 2WWIA 3NBZC 1NN0A 2OV2A 4FCTA 3Q7QA 3FFBA 2GK6A 4JLAA 2PJRA 4M9SA 3GLHB 1IONA 2VBCA 3BH6A 4HLCA 2JLYA 1X1SA 2ERXA 3JVVA 1W36C 5F9HA 3B6EA 3Q5DA 4PQRA 2FA9A 5JRJA 2W6ID 2DY1A 1Z0DA 4BLQA 3SBDA 2GBLA 1KI4A 3AVQA 1P9RA 4LC0A 1CF4A 4IOKA 3AKCA 2QSZA 5FOXA 2B7CA 2IYUA 2VSOA 3AKEA 4RY2A 4V02A 5KNBA 2DWOA 4P0TA 2GXQA 3KKMA 2NOAA 2O0JA 2V9PA 4UXJA 5TMPA 1GNRA 4D81A 1R0ZA 2C77A 4ZCMA 3AM1A 5DI3A 1Z63A 4ZV4A 5DNYB 1SKYE 2C03A 2J87A 4FD2A 3PG5A 3O47A 4LSGA 1G6OA 4O0MA 4EIWA 1E9EA 3H0KA 1A82A 4DRZA 1FFHA 2I1VB 2C9CA 2ZRHA 4QM7A 2W83A 3QBTA 1UDXA 2ZUCA 1VCNA 4LHZA 4BECA 1U98A 1GKYA 3THXB 2CK3D 2V7QA 4V0OA 2O8BB 1CJUC 3AH8A 4KVGA 2B8TA 1RPZA 4PHGA 2QP9X 2VQSA 5AWFC 2CJWA 3BXZA 4TSFD 5E7JA 1XJCA 3EZ9A 2WVJA 4IRUB 3WP1B 1CS4C 1DO2A 2ZR9A 3QJYA 1J8YF 4NP6A 2NZ8A 1QHSA 1AK2A 5TXGA 1IHUA 4ZCIA 1GRRA 3EZ6A 1Z0FA 2ZS9A 3I4LA 4HAWA 2DHRA 2BMDA 4LBYA 2BBTA 1T5LA 3SFVA 4MRVA 5B2ZA 3CPEA 3BBPA 2H18A 3SYNA 1N25A 4Z51A 1VDZA 2IXEA 3ZS8A 2C04A 2DYKA 2OFOA 3I3SR 4EFLA 2F43A 2ZYTX 1V43A 3QPWA 4Q1AA 5JWHA 3IIMA 5BYJA 3AUYA 1CLUA 2VLIA 4C0SA 2C8VA 1KNXA 4PSAA 4CZ2A 3Q5EA 4HB3A 1C1KA 4Q4AA 1IY2A 2EFGA 3GEIA 3T06B 5FTJA 5CB6A 2NTYC 1NJFA 4D82A 2HYIC 2BKUA 1FP7A 1OYYA 2JCSA 1WBBA 1QHHB 1ONBA 3AVOA 2D7CA 4OL0A 5JJIA 1E1RA 4NHOA 3IKJA 2FE4A 4MKFA 1OFUX 2Z5FA 1H8EA 2F6RA 1Z22A 2FX3A 1P5ZB 5D3MA 3ZS9A 621PA 3ZD6A 4W7SA 4B3BA 1XCMA 1JALA 2JJ1D 3W34A 1OXTA 5JHHB 5FOUA 3U3JA 2W0MA 2NO0A 1RRCA 3I72A 3KKOA 4DLSA 3BJIC 5BN5A 1KNQA 1D9XA 5F98A 1NVVR 1Z6XA 2ONJA 1XWIA 5DYIA 2XJ4A 4EFMA 3FMPB 2J0UB 3LX5A 4NH0A 5F2EA 2QAJA 1SKQA 3DMNA 3O8RA 2ZVPX 2G0TA 2VP5A 4YQFA 2DB3A 3DM5A 1KGDA 3D8BA 5JI2E 2EYQA 1L8QA 2QPOA 3QBVA 4NCHA 4EJSB 1UFQA 4D2IA 3D7MA 4R71A 1DG3A 2FSHA 3IEUA 1KSGA 3SU8A 1GWNA 3T1OA 1Y3AA 1AGRA 1LVGA 2YWHA 3LW7A 4KAXA 5ELXA 2JAQA 1KI1A 4M21A 4WA7A 2KBFA 5EE3A 1E9AA 3WYFA 3AGQA 2IYWA 4IKEA 5KPDA 1P3JA 2QU8A 1MABA 4FWIB 1JJVA 2WIBA 3K09A 3WRXC 1HT1E 4XVQA 3U44B 2Q0HA 2CDNA 4G5QA 4XWOA 1DELA 1CJKC 1M7BA 1N6IA 1E9SA 4M9QA 4Q9LA 1E9RA 3ND9A 2D2FA 3NEYA 4OI2A 1ZC3A 5CB8A 3QEJA 4JLKA 3OE7A 4IDPA 4JYBA 1S1MA 1JBKA 4M9ZA 3SYLA 2H17A 2JIZA 1IY0A 3ZJYA 4B2LA 4I1OA 4TLEA 2W58A 5DH9A 1LW7A 3IPYA 4OHXA 2DFNA 3AP2A 1XTSA 3L8YA 4PQFA 4A15A 1VECA 1RYHA 1T5IA 4C2TA 4IEEA 1NBMA 2O0HA 3C5CA 1E9BA 4KFUA 4GFDA 2J1LA 2D3WA 2F9MA 1G5TA 3T5DA 2ZSAA 1FW6A 1PVOA 2ZM5A 2Z0MA 5JCPA 3MRSA 2EQBA 3NDPA 4ITRC 2I4IA 4TL8A 4UNRA 4FW9A 1W0JA 5BN4A 2WKRA 1XCPA 1PZNA 2C95A 2X2EA 3B2EA 4Y0AA 3TJZA 4LJ8A 5B64A 1E32A 1VYUA 1SXJC 1EWQA 3SNHA 1UBGA 4HB0A 2AL7A 4D6PA 3GJ8A 1KMQA 4TQ9A 5KSYA 4I81A 4US0R 4QGHA 2X19A 1N0VC 2MMCA 1U9IA 5JHGB 1RRFA 5HTKA 4LHYA 2JLRA 4O3MA 3ZYCA 2IS4A 4JLVA 1KK0A 1DTSA 4DHEA 1CBUA 1Z0IA 4XVRA 4HAVA 3VR2A 1IBRA 1OH5A 4JSYA 1P2VA 2XJ9A 4OQXA 3ZQ6A 3QPVA 1OIWA 3GLFB 3NIBA 2DFKB 2ZIAA 3B82A 3TR0A 3ADCA 1T91A 2YJTD 2OCBA 4X8HA 3AVVA 3CKLA 1V5WA 4KO8A 4JSTA 4MYUA 1LY1A 4TL9A 1G7RA 4KXFB 5FPYA 2PZGA 4EDHA 5LPNA 3G5UA 3MWLA 4P31A 3RRNA 4QXAA 1ZD1A 1S0UA 1KO4A 5K8LA 2OM2A 1VPLA 2QENA 2W6JA 4HEJA 2I1QA 4TLAA 2AHOA 4QRHA 1ESNA 1XJQA 1SGWA 4G01B 4LHWA 2YHSA 1EG7A 2PCLA 1YRAA 4DCSA 3GLIA 3BE4A 1F2TB 2B6HA 4JLNA 2ZTSA 5JECA 4P32A 4DC9A 1VHLA 3SE0A 4G5RA 3FVQA 4LY6A 4HB4A 1S4QA 3BRWD 1T8UA 2BEJA 2VO1A 4M1KA 4QBGB 4E03A 2ODNA 1D2NA 4F92B 1ZJ6A 2PEYA 3SJBA 2ZS8A 2FSIA 2OT3B 3C7KA 1G8PA 2WKPA 3E2IA 1FX0B 3LFUA 2PT7A 3IQXA 2ZUDA 4GPTA 4PC1A 3AVXA 4LCBA 3KQKA 2PCJA 3AP1A 4B6FA 4DDTA 1AJEA 2X77A 3R8FA 4Q7JB 1WA5A 2RAPA 1T3HA 1OKKA 4TL7A 2ANCA 3WNBA 3RANA 4GMDA 4NTZA 4L15A 1PUJA 5KDOA 3ETLA 1GSIA 1K6MA 2GETA 2WICA 4A2QA 4RD3A 3FHTA 1UAAA 1YZNA 1ZM7A 4JVMA 2JJ2A 1KDRA 1IJFA 2ZI9A 5DI3B 3KFVA 3P32A 1NMXA 4BASA 4QM6A 5EP3A 1E2IA 3PVSA 2O5VA 3A1UA 1AKYA 2OO7A 1LV7A 3VHLB 1BOFA 1L7VC 2PJZA 4PAOA 1LF0A 4OHWA 5TY0A 2ZAOA 1P9NA 2ORIA 5HKKA 1RKBA 3ZVRA 3QKTA 2GA8A 2IXFA 2V6JA 4KFTA 2EFCB 2R6CA 4V0MA 2IWRA 4QNMA 2QN6A 3PUWA 2XSZD 4DVGA 4GP6A 3GPLA 2YOFA 1G8YA 4JIMA 5EXTA 4HLUA 2CJWB 1HH4A 5JWRA 3U6KA 4TT3D 3MWKA 3ADDA 3WMGA 2ZRFA 3DEFA 1Z5ZA 2OSBA 1MR3F 1Z07A 4MGZR 2CVFA 5DSZA 1U8YA 2IF2A 2QMEA 1YE8A 4I1UA 1CJTC 2P65A 1M2OB 3QXXA 2ZXUA 5GVSA 4DUGA 4UNNA 5L3QA 4HAYA 4GT1A 1DOAA 4IHQA 4PPQA 3RSOA 1E94E 3IQWA 3ASZA 1P4SA 3AKYA 2JJ8A 5DN6A 2F43B 3X2SA 3JZMA 4XOIA 3GJ6A 1CJMA 2QQ0A 1CR0A 5AK0A 3K0CA 2W00A 3HU2A 4PX9A 1W4AA 4FMDB 3CX8A 4Q4AB 4BGDA 3MGCA 4G5SA 1FOEB 4DDUA 3HJNA 1W0KD 1Q1BA 2YVUA 2F55A 3T1TA 1XEWX 4P3YA 5FPTA 4MKIA 3D31A 5EJEA 4TMKA 1N6RA 2QI9C 2KE5A 4JT2A 1R0YA 4A9AA 1QHIA 3EAQA 3IIJA 4DCNA 1NN3A 4TL6A 2R9VA 5D3MB 3OESA 5G3YA 4GOKA 1P73A 1E1QD 3A4MA 5FR2A 4RKEA 1HV8A 4AYTA 3VR5A 3RRZA 1E0AA 1II8B 2JLQA 5HZKA 1P75A 1NMYA 2V3CC 2WJGA 3IUYA 2QG6A 1CTQA 2HCBA 1IXRC 1JEDA 1NLFA 3N5CA 4HDCA 1OW3B 2WWGA 4U7DA 4ASUA 1NLZA 5FH9A 4LBZA 5B58C 1UBEA 2G88A 1Z2AA 4M1MA 1TEXA 2ZR7A 2R65A 3GEEA 4TYWA 2AK3A 1ZM3A 4TMWA 1R5OA 4LV8B 2B92A 2MSDB 4BLSA 2XZLA 4UNQA 4DLWA 2W0SA 3MMPA 3K9LA 2HJGA 3KZ1E 2OCAA 3DZDA 4LJ5A 1EFCA 1XTJA 2H7VA 3GLHE 4Q1FA 2RGNC 1HURA 4PPGA 4G0NA 1GM5A 1K8RA 4EFNA 3K0SA 3TQFA 4M4SA 2O8DA 5CYOA 3X1YA 2YWGA 3FB4A 3KW6A 3KXIA 2NPIA 4MRPA 4Q48A 2ZYWX 3R9WA 3TGPA 4I1SA 4WXPA 4CT5A 3JZAA 4CVNA 2KSQA 1JR3D 4V0KA 4V0ME 2CNWD 2ZE7A 3RWOA 5BWMA 2FFAA 1E2HA 2WKQA 521PA 5A0FA 1FP6A 3UIEA 3UKDA 5FL7A 1DAFA 2OFXA 2J0UA 3ZDQA 2F3RA 1TX4B 1KYIA 2ZITA 2OBLA 2IBMA 3BAFA 1G5RA 1MH1A 2J3EA 4I4LA 3PXGA 1FZQA 2V4ZA 4EJSA 2FPLA 2NO1A 1E2PA 1XMJA 2IT1A 5BQ5A 5FBLB 4UQOA 3GP8A 3RNLA 2GF0A 5AUNB 5J5CA 2GXSA 3CF2A 4C7OA 3KKQA 4F38A 1P61B 2QE7D 2R6AA 2GZAA 3IHWA 2WV9A 2DWPA 3FFAA 2R44A 1DADA 4Q1EA 3HU3A 1FQKA 2ZANA 1Q12A 4GOXA 4Q00A 1Z3IX 4ZCLA 3UWKA 1UM8A 4ARZA 1W46A 4Q1BA 1WE2A 4Z54A 4KV9A 3QE0A 1IN5A 3U44A 1RE0A 3EX7C 2J0QA 3OAAD 1OB5A 3FHCB 2ZI6A 1BYUA 4IDNA 5FUXA 4BFVA 2C98A 1O87A 3OIYA 1G64A 3RAPR 2G6BA 3L82B 3MWYW 5DLQC 4OHYA 1N6OA 3MWJA 5EE0A 2C9YA 1T3SA 2NG1A 2WIAA 5KTYA 4GZLA 1G16A 1DBSA 1F6BA 2QRNA 1OSNA 2BDTA 2J7PA 2WJHA 4MQBA 3WRYC 3W3AA 4ZPXA 2ZI7A 3HU1A 1J2JA 3AV0B 5FFMA 2IEYA 1XJ0A 2VP9A 3DOFA 2ZPTX 3MG9A 2PZEA 2HXSA 2GZHA 4N1AA 2DCUA 1GNQA 3JVUA 4CIDA 4GMXA 4D80A 1VCOA 3CR8A 4J0QA 3TR5A 4G3XA 4HB2A 3EARA 1TADA 3GJ4A 3UMSA 4OJKA 3IIKA 2F7SA 4DEXA 3LWNA 2A2ZA 3KJHA 2ORVA 2DFTA 2Q3FA 1RW4A 1G7CA 1Z08A 2PLRA 3B9QA 2ASEA 3FYHA 2OEPA 2RGAA 2WM9B 1RZ3A 1VG8A 3ZGXA 1G4UR 3P4XA 1F5NA 4BFSA 1JB1A 3I8SA 4QKQA 1PLLA 1NF3A 4YONB 4LJ9A 1G21E 4NBSA 2ZUBA 3A1TA 2PH1A 4YDHB 5LD2C 1G41A 4AKIA 1HY3A 3GLFA 2Q9BA 2WAXA 2WPDA 2KJQA 4ZO4A 4PO1A 2A5GA 1SHKA 5FTNA 4N0EA 5DGXA 4ON9A 4A0FA 5KDLA 3FTQA 3VHXA 3QENA 4DEYA 1UEJA 2IYXA 4DB2A 1YR7A 2MMGA 3P20A 3OEED 1JR3E 4R2IA 5AJYA 4JS0A 5FUVA 3V00A 4D25A 4ZKEA 1U0JA 4DXAA 4Z8XA 3KJIA 3L8ZA 3PUZA 3R9IA 4HAXA 2A5DA 5DYGA 1US8B 3BS4A 1P2UA 4IJMA 4DLUA 1YZTA 1D2MA 2OAQ1 2ONKA 2E87A 1FNNA 2IYRA 2ZRJA 1P2TA 1Z6TA 1QRAA 2CL7X 4M1WA 4Q9JA 3ZVMA 2HV8A 4AKHA 1IN8A 4JLBA 4YXWA 5EUQB 1XTKA 2Y8EA 2CEAA 1GIAA 5J40A 2VL7A 4U5XA 3M0EA 1F2TA 5CITA 1TUIA 3WYAA 3RRYA 5C4MA 4PPFA 4B2IA 1XXHB 3TSOA 4BUJA 1U2RA 4E22A 4EQ6A 1Z2CA 1NNEA 4H9GA 1N6HA 2A5JA 1LB1B 3F0TA 4IOMA 3CW2A 1UF9A 4DLXA 4X8OA 4TZ6A 4LBVA 3KDSE 2AXPA 2CMKA 4WOPA 4NONA 2D4HA 3BFXA 3NBYC 3NC0C 3RS3A 5FTLA 4B75A 1CU1A 1FX0A 4OQNA 1G9XA 3OIUA 3A1VA 4GRAA 3E5HA 3B13B 3THOA 1TNDA 3KXKA 3VX4A 1XCGB 3SJZA 1Q44A 3DKVA 1T6NA 1A2BA 2GNOA 3X1ZA 1GVNB 1N3BA 2QSYA 3TH5A 2AN9A 1ZYUA 1I4DD 4RD1A 3GEHA 3SOPA 2IYLD 1E6CA 4M0LA 1S96A 5EXXA 1E9CA 5KNCA 4X8MA 3CZPA 1U8ZA 2ODBA 3W5IA 4C0JA 3CLVA 5L3VA 1VTKA 4Q7MB 1FL9A 2Q3MA 3ZZUA 3THWB 1P60A 4A2WA 5J4HA 4V0LA 4K81B 5EQTA 3RS0A 1ZNZA 4FMDF 1IJEA 5DHFA 4FI3C 3AF2A 1PUIA 3BH7A 1IY1A 2V7QD 1IQPA 3L0SA 4PC2A 1E2JA 3NWJA 2Z4SA 5L3QB 1KKLA 3LV8A 2HXYA 3CO5A 4HAZA 2XX3A 5LBIA 5EE9A 2ZAMA 5BXQC 3V4RA 1OYWA 1WRBA 1FTSA 3AVYA 4PR0A 3I61A 2QL6A 4DT1B 3UATA 1S2MA 4PC7A 3WBKA 1OPXA 1RJ9B 2YWFA 3TBKA 3C15C 5IK2A 1ZRHA 1H8HA 3AF1A 4E09A 1Q57A 2V1XA 5IF9A 1G291 2IUUA 2ZRIA 4PZYA 4ACBA 1GKUB 1TU4A 3DHWC 1CRPA 3OEHA 1KI7A 1VYTA 2ZE6A 1E2DA 3MLEA 4EPRA 1XB2A 3KQHA 5FUWA 3ZVNA 3QY0A 3U7HB 1Z28A 4AK9A 3S1AA 2GKSA 4QNRA 1SZPA 1E69A 4MUBA 4ZI2A 2OUKA 1Z0KA 3CZQA 1BYIA 2IYTA 2DWQA 1KMHB 3EXAA 4CW7A 4WAUA 2BCJQ 2O52A 5KDDA 4TYQA 1ZD9A 4Q47A 1YRBA 3TAUA 2D7DA 2GCOB 2ZJ2A 1OLOA 1MO5A 3L0IB 4DLVA 4KJZA 2PX0A 1RC8A 3PEYA 3LXXA 1Z29A 2PMKA 5FOSA 2J5XA 1BIFA 3EC2A 3WNDA 5GADl 3TKLA 2P3SA 1E1RD 2OE2A 2IYVA 1ZCBA 3GLGB 1MT0A 2AWNA 1F48A 1H8ED 3A4LA 1U99A 1YVDA 4IFBA 2FG5A 5DISB 1G8GA 1ZNWA 2EWVA 4A6XA 1ZBDA 4D26A 2EFDB 1DO0A 5KHOC 2H8KA 2H57A 1F2UB 3K70D 1II8A 3I92A 4TTQA 4B44A 4Z8YA 2LCFA 2H5EA 5KPJA 2O8DB 1N6KA 4ABYA 3TIFA 1QVAA 1VG9B 4KYIB 5DO9A 3A36A 2GXAA 1OHHA 2WJIA 3CF0A 5EZ5A 4OK6A 1KJWA 1HQYE 2C78A 2PBRA 4DJTA 2QAGB 1KK3A 2UZIR 3QKSB 4B6EA 4FN5A 2BCGY 1IXZA 1EFRA 4JT4A 5JEEA 1ZCAA 2JLSA 2IS2A 1HT2E 3RDPA 3QQ5A 4DSOA 4DB4A 2RB4A 4P4SA 2Z43A 3IBYA 3QKRB 3QVVA 4NDZA 1G3UA 4AKGA 1DEKA 1XEWY 2ZYUX 2GVDC 3UXMA 1TTTA 2IK8A 2JLVA 5KOYA 4KSBA 3B1YA 3K0CC 1SVSA
chains in the Genus database with same CATH superfamily
3SAVA 4EVRA 1ZJZA 3BL8A 3KL2A 3WMWA 1RP1A 1Z6QA 4JODA 1TUBB 5PNTA 3PC2A 3HKCA 3EXG1 3PXXA 3K9WA 4S1WA 1KVQA 4UXIA 2WSSA 2G1AA 2IPAB 1YZYA 3ONWA 5CD1A 3MLAA 2QM8A 1D2EA 1AXGA 1KFEB 4EKDA 1SXPA 3FNBA 5KREA 1A96A 1LQ2A 2PVPA 5TC4A 4N3BA 5FV7A 2W71A 3PZRA 1R0XA 3GHYA 4I9NA 3BORA 5JUWA 2CL6X 2VBIA 3IE0A 3FLAA 4HDAA 5ALWA 5EXEA 1L9XA 4YCAA 4RGBA 4IQ4A 4Z1MA 4OQEA 2WG0A 5KU1A 3QBDA 4EI2A 3OT1B 2NO6A 3VOSA 2XA9A 4LI0A 4YMUA 2C4WA 2ISQA 1SCUB 2VSQA 5CLFA 5E6UA 2C8KA 1S9DA 2KWIA 1MGPA 2QT0A 4LJRA 2EVWX 1Q2XA 3ROFA 1G18A 4RE5A 5CYPA 2J7OA 4RPCA 4RWEA 1FP2A 3Q85A 5AM2A 1E5LA 1JDZA 3BMQB 1JXQA 4WKCA 1VYHA 4YROA 1YBVA 1XF9A 5E9AA 3HKPA 2HN9A 2UZ4A 1ZW1A 4IIFA 2V6ZM 3W2EA 2IYNA 4ZXFA 3IFSA 2V0GA 3FR7A 3HI4A 2E49A 1ZAKA 1KR2A 3FTCA 3MJFA 2AOUB 3H19A 1V0JA 4WLVA 4PVDA 5HNKA 4I1PA 1XO1A 2X42A 4WECA 4I4CA 2NWQA 4RVNA 2VA8A 1G8HA 3S1AB 3A0RB 2WU0A 4XD7A 2IYFA 1ZA1A 5HDQA 1IVNA 5SZJA 3WO1A 3NBUA 5KMGA 4HZGA 4S2EA 4MR8B 3QRWA 4RLHA 3RVJA 3V4ZA 4OQMA 4M89A 1FRQA 4P0PB 5M34A 4YRDA 1E79A 5AXAA 1FJ2A 2WD8A 5CCDA 4L02A 3DGFC 1KGSA 2OOSA 3GLQA 1J9ZA 1KEEA 5TDHA 1PR6A 2D5CA 2WQ7A 2FY8A 5DM2A 1E9DA 1KKMA 1PZFA 2A0XA 3GNLA 3K0AA 1ND6A 2YX1A 2GZ3A 5IKEA 2KX7A 2I7TA 3ZHCA 2X2FA 3AYZB 4H3KB 4U6QA 2LE0A 5HX7A 2OBFA 2DZDA 3CLUC 3DZIA 1ILWA 2OZEA 5KPRA 5FUYA 3EEFA 1L5OA 2BFCB 2ABWA 1JQLB 4GBJA 2J7PD 3IO5A 4QRDA 1ZD2P 3D54D 3BD6A 4EYSA 1YU6A 3ZU5A 3IAUA 2FH0A 2Z2IA 4NFYA 3QA3E 1E92A 2X1LA 2IA5A 2EKPA 3BH0A 2FE1A 2YOHA 4QU5A 1HQCA 4B2YA 3H4TA 1DAIA 3T7KA 3Q6IA 3CE9A 5TGZA 2YJ6A 3K53A 2GEDA 3U3MA 3B9RA 3ZE1B 3F90A 4F5DA 4WY5A 2XUHA 4DLZA 2BNKA 5AUQA 1DQYA 2J5QA 4BPRA 3DVSX 1JJBA 1X7WB 4B6GA 2FQYA 3C43A 4WCFC 4UBNA 5EQDA 1PL7A 4YCNA 2WVGA 5HVNA 3QOYA 3P4YA 3K2IA 2K4MA 3MTQA 5EIWA 2RKWA 2NMVA 4L6CA 1V8OA 4GKVA 2AOTB 1NM5A 3TZLA 3B6ZA 3H6GA 4RY0A 5CBKA 2DR2A 2ZYGA 3G17A 4RFSB 3GU3A 4J43A 4QQKA 2ZROA 3EG9A 2QQ8A 1SZJG 4MQMA 2NSLA 4E51A 2XNDD 1DXOA 2OTCA 1M1XB 1C4WA 1CQZA 3FDJA 2YJGA 4RPLA 3U6EA 3HSSA 4JJEA 4F2GA 4P9NA 1AB5A 2BKAA 4RGYA 4B73A 1V96A 3RRFA 2QRZA 4KXMA 4EFDA 2PO5A 2B8NA 3VYWA 3DDZX 1R0WA 2VXYA 4DQUA 3X1DA 3UK6A 3W5VA 2AYYA 4F4FA 3CQ9A 4TLDA 3WGTA 1RWMA 3EZXA 4BNDA 5B55A 5HR5A 4KQKA 5EMJA 1KFCB 1WJGA 4UDNA 4HDNA 1G2PA 2L42A 3KEFA 3AR3A 3BTOA 4YJ2A 2Q41A 3I6MA 3KZKA 1PWYE 3HHEA 4IQGA 2EFHB 3X43A 2W2QA 3HZOA 2IZZA 2BGTA 4J9VA 5B30A 1J09A 2CLCX 4YIKA 5BV2P 4JDUA 1EWVA 2DTEA 1C1DA 1A8IA 2TMGA 1WXQA 1L4KA 4A1FA 3U4DA 1CUUA 1EGHA 3ZDRA 3U9TA 3FPSA 3MK6A 2JJ1A 4RKUF 2YVKA 2CLSA 4LF6B 1ZJWA 3BTVA 5KPZA 4HZUB 2IXDA 3GFOA 5ALPA 3MTJA 3WLAA 3ND5A 1T2UA 3CPSA 3M1YA 1MQSA 1DAKA 4LF8M 1V7QA 5DI9A 3DFMA 3DZGA 5I9BA 2XUJA 1PHPA 3GLRA 4N01A 1Y3IA 4UJ5A 1J06A 4X20A 4HXFB 4FXOA 1QZTA 3A6ZA 4K9DA 3U4HA 3NQ41 1RAHA 4TQAA 1ZBQA 2DHEA 4G0QA 3REQA 4XJTA 1RR6A 2JF0A 2I3AA 3EXIB 3N59A 1EBUA 1H65A 2QM3A 4O08A 2OAGA 3GPCA 4G36A 2GB4A 1PG2A 1RQ2A 2Q2NA 1MO4A 3R74A 3ORFA 4RNDB 2DTXA 2CUTA 2OXFA 2BZ1A 5CD9A 2AN3A 1C1YA 1QK3A 4V1CB 3T0FA 2ID4A 3NDJA 2GHRA 1N5KA 1MO6A 1Q3HA 4IJ5A 1HXHA 5J23A 1B23P 2P2DA 1R6VA 2RG1A 1ORVA 4YRBA 4UN2B 3C1TA 4DSUA 5AK5A 5A4JA 2QLLA 2Z4RA 3VH3A 4C7JA 2SBTA 3VDUA 1EZ1A 2A58A 2BBWA 2EEPA 1QIEA 4LFAM 4P80A 1W4RA 1FP1D 3KUCA 2QQGA 1D0SA 1ZA2A 3WY9A 1WJ7A 3MOGA 3R7AA 5A6SA 3I01A 1XVVA 3TUIC 4LXYA 4ZK6A 2WRZA 1MD9A 3E58A 2KYRA 3NTOA 3DWIA 5KYVA 1M8PA 4F9GA 3HP7A 2XQVA 2QSUA 3CN7A 2X0EA 3ZWKA 4WLOA 4RPGA 2Q0SA 2H0RA 3ADBA 1FFDA 5B1IA 1VXOA 4HDMB 3PUHA 4LYFA 2H7YA 2LPMA 2KLHA 3I5UA 4W8GA 3A4YA 1KTVA 3ZWVA 2CXTA 4W5TA 2F8TA 3QMVA 2DR3A 4PGMA 5EY5B 1L5ZA 2BC9A 5IFLA 3Q3GE 2VDWA 2ZOSA 2PT9A 2GTPA 4MXDA 4OA5A 1NXOA 4K3VA 4Q16A 3KKNA 3WLQA 4MQLA 3A1FA 4JXXA 1CZHA 4RENA 4G1MB 1U94A 1PJCA 2ZBKB 1OC4A 5FTWA 4DV2B 1ECGA 1G21A 5DU2A 1R8YA 1R4GA 3ZGZA 1MENA 3V7FA 1I2ZA 1USGA 4BQOA 2NSJA 4DUYB 1Y7IA 3OPYI 1J99A 4ALNA 3U6BA 1YZ3A 1CR6A 3K8QA 1TC1A 2G76A 2P7IA 3VDMA 3ZW7A 4NSNA 4NRDA 4X71A 4KI0A 2AZTA 2ODEA 1IN6A 1M1UA 1XLTC 2DEUA 1Q39A 1AKWA 1GPYA 3HY6A 1A2OA 2Z1NA 3U40A 4COOA 3RYFB 3H9JA 3O4IA 2VTBB 4LG1A 4K8OA 2R47A 5J5AA 1U0GA 3AESB 1ZEJA 2R6R1 3M7IA 2JGDB 4DA7A 1Y6JA 1U2SA 4NHEA 4M1TA 2DCMA 3BPSA 1HYHA 3WYBA 1GUAA 4CQNA 1MP0A 4RK1A 2JGMA 1WWKA 4X84A 3JXEA 3SMSA 3OLYA 3HCPA 4N12A 1L8LA 1DIOB 5K0TA 5CDFE 1UBCA 1YBAA 1PT9A 2QQ5A 1HDOA 5DGDA 3GCDA 2E2WA 2J0EA 1O97C 5EJGA 2TSYB 4ZEXA 2RGEA 5IH3A 3HY3A 3KYCA 4ZN6A 2RK3A 4FCTA 3L8GA 3H9GA 3TSYA 1IONA 3ZDDA 1MEJA 5F9HA 3B6EA 4P7KA 3Q7TA 2W6ID 4BLQA 1H05A 3AVQA 2XLJA 1UT6A 3JZIA 5B1SA 2O1XA 1DGBA 3AV3A 3L7JA 4UXJA 4D81A 4H16A 1SKYE 1NV8A 4CLRB 2LVNC 2C9CA 4O29A 1K8YB 2P9EA 4ARIA 5JNUA 2A0WA 3I83A 2HPZA 2H54A 2VDNB 1LWNA 1IHUA 2FR1A 1GRRA 4F5YA 3I4LA 1FVOA 2BBTA 2I2FA 4MRVA 5ULLA 3IHPA 3IXLA 4EI8A 2IXEA 3DYVA 3N0RA 4Q1AA 3QJGA 5JWHA 5BYJA 1YDEA 1CLUA 4HB3A 1IEWA 5IBPA 4OBBA 5J5VA 3R5XA 2Y1DA 5KVQA 2IDZA 4YMGA 3OF2A 3BMCA 3MBKA 4D9NA 2ONYA 4CETA 4BN5A 1DDIA 2VOJA 1P5ZB 1JALA 3KAKA 2EJCA 1VFNA 5JAUA 1S7GA 1OAAA 4LGVA 3N74A 2VRNA 5FO1A 1ZVMA 5DXAA 4Y6SA 4MLCA 3KKOA 4B46A 1EVEA 4OKNA 2W90A 3ZD9A 2G0TA 1HQKA 3QY9A 1OWLA 1ZRSA 4K5QA 5K01A 1H23A 1UFQA 4R71A 3ICCA 3SU8A 2YNMD 3G9ZA 4LTDA 2JC3A 2KBFA 5EE3A 2J4DA 1O95D 4XGRA 5BN3B 1U65A 3GRVA 2QRVB 4XWOA 4MS3A 5DM1A 5E8RA 1WM1A 4DCCA 4YR7A 2Z8ZA 3ND9A 5E26A 4CLXA 1FF9A 2JGRA 1TM3E 4PSUA 3NB0A 4XI9A 2D3TA 1T5IA 5LUBA 3UFXB 3JD4A 4Y9TA 1PVOA 2ZM5A 1IWBB 4PLGA 4IICA 4R7TA 5U1PA 1QU3A 2X2EA 4GMHA 1K66A 4UE2A 1KMQA 3T5BA 1ZKMA 4I5IA 5IYZF 1JU9A 2QZ9A 1QE3A 2CJPA 4O3MA 1DTSA 3IOMA 4EJFA 1KQNA 2ZUUA 2EF1A 3TPZA 2EIXA 4B09A 2XGSA 3CKLA 2I65A 2VQEM 1G8AA 1PV1A 5KINB 4K86A 4R3WA 3DXZA 4KQJA 1MORA 4E4YA 3VV2A 3CY6A 1J97A 3DR3A 3BE4A 1YRWA 2B6HA 4RQAA 5JECA 2H07A 4HB4A 5CXSA 5KSWB 3LFUA 3SSMA 2WNIA 4OHBA 2DTDA 4BKOA 3L4BC 4JC5A 2V65A 1T3HA 3SM3A 1JA9A 4Q3AA 4IDGA 3VNRA 1I8TA 4MH0E 2C2KA 3ZHBA 4AZVA 5D6NA 3AR2A 1AKYA 2OO7A 4QNNA 1LV7A 4Y6OA 2F8SA 4AP9A 3OM8A 3QKTA 2II6A 4G0XA 2XSZD 1PJIA 4XWTA 2DWNA 3UC5A 4FK8A 3MWKA 2ZRFA 3P5BA 4TWJA 1XDGA 3PJDA 3AOEC 5LOVF 1FW8A 2QMEA 4A03A 1M2OB 4DUGA 1SN7A 1RPAA 5L3QA 2DAMA 2IGBA 1A72A 2JI6A 4FFOA 3HXLA 5AK0A 4ALJA 1FOEB 1I3MA 2YVUA 3D31A 1T35A 1I0LA 1UC9A 1VRCA 1NW9B 2LDXA 4OXIA 3ORHA 2IU0A 2GPSA 3L1JA 3S6JA 1GCUA 1XVAA 4B79A 2A0UA 2JLQA 1CTQA 4AW4A 5A5EA 5I7UA 1NLFA 4XWWA 4KAFA 2WWGA 4X7RA 2BSAA 1XF1A 1LFAA 4OH1A 1EIZA 4U7WA 4UNQA 1WHTB 3K9LA 2EKQA 4IRXA 1UAGA 4IJFA 3FB4A 3JD2A 5DGIA 4WXPA 3J80A 1A27A 3JZAA 4LZNA 3GFBA 5BWMA 2ZE7A 1JMVA 1P3Y1 1GPAA 2F3RA 3DR5A 4UHKA 3U48A 4DNPA 1RE1A 5ALJA 4H27A 3CLTD 1VSUA 5J3JA 3ZWDA 3WLOA 1OB5A 5TQJA 2P2GA 4NQZA 4GM1A 2ZUWA 1U0FA 3MWYW 5DLQC 4EY7A 3D7RA 1UPUA 5BN4B 1G5IA 4LEIA 4CG2A 1IIRA 1IBKM 5BR8B 4N5IX 1AKVA 4UHEA 2RBGA 2JAXA 3LM8A 3DD1A 3RGSA 4Y7DA 2ZXFA 3ZCPA 2QRQA 4FNMA 2CMFA 3FYHA 3ZGXA 1KYXA 1HSZA 2PZ8A 3INRA 3BJZA 1TXGA 2MSNA 1B3BA 3G3EA 5DMXA 4HAXA 5T5QA 1TCUA 3FOCA 1E1CA 1SG9A 5DYYA 1RS0A 1DJPA 1HQDA 3KJZA 3FDZB 8CATA 3RSSA 3PQ3A 4OL9A 3F0TA 4WE3A 4KTVE 1Q91A 2R25B 3NC0C 4YVFA 3AINA 5CW2A 3Q6MA 4NC6A 2E4YA 3ENVA 1GPH1 3AB7A 5EZYF 2ADFA 2YXEA 1K5PA 4TXMA 4G1CA 3WLEA 2FDXA 4PS0A 1FP4B 2Q3MA 5ICMA 3RS0A 5LVAA 3BH7A 5ESXA 5DNCA 2NV2B 4CTNA 2XNHA 1MAAA 5EE9A 1L9KA 2UYGA 4CKYA 4PC7A 5IJ9B 3BEOA 5IK2A 1BN6A 1ZRHA 1B42A 4H77A 4HT3B 2IUUA 2ZRIA 2OORA 3WLKX 1FSFA 5FUWA 4I1YA 4YRMA 3GZTB 3IUBA 4DR3M 5JISA 3GX1A 2O2SA 1GL3A 4I36A 5EINA 2YWCA 1KMHB 5KDDA 1ZD9A 4RX1A 5FULA 2P3SA 1YJQA 3A4LA 1EVQA 4JI4B 4RHTA 1SC3A 3AZQA 3LIIA 3K70D 4BP8A 3FOAA 4QYSA 1H4TA 3TIFA 1UZMA 2PBRA 3HKEA 3RT7A 1SRQA 1WZUA 3AW9A 2VJCA 4P4SA 2Z43A 1E4OA 1KQOA 1Z7YA 3JWPA 1U8UA 5AVRA 5J2TA 4KSBA 3DF7A 1IWPB 2UXDB 1O5IA 2ZSEA 3U5TA 2RCYA 5JALA 1VA5A 3EGXB 2KA6B 4C76A 1WEKA 3CG4A 4DR7B 1XV5A 3KWJA 5DBEX 4MR7A 5GY7A 4MH0R 2BHLA 3W5DA 1OR8A 1YB1A 4KNWA 4ZTBA 2JBAB 3MAGA 1JILA 3G7NA 3P7MA 5K3AA 5G0UA 4LY3A 4LJ4A 4G8BA 4RL4A 4JASB 1C8VB 2JATA 2YIMA 4N8EA 2H2HA 1D03A 1QP7A 3ZZTA 4K2HA 4AI6A 2J31A 1EX9A 2Z09A 1W1IA 1OXUA 5I7AA 1R5NA 1RRPA 2D00A 2W2PA 1E7QA 5A62A 1VG0B 3H18A 2F9FA 2J41A 4WESA 3AB3A 1HE8B 4XDGA 4L8WB 2QVXX 1X1EA 2GCIA 2A1UA 4PYRA 4OHZA 2VHUA 2CDCA 4J0EA 3BD8A 3QXSA 3NASA 4I2NA 4GXQA 4UKDA 1US8A 4OK3A 3W06A 4LE2A 1FYXA 1MN6A 1I5EA 3ZKWB 4UARA 2Y0BA 2FOLA 2YY5A 3UXHA 1W34A 3T3HA 1JAHA 4OBWA 2JZOA 1KETA 1SCAA 1K5DA 4CDGA 2ZJ8A 1AKMA 3KSXA 1HNWB 3HQ4O 4CN8A 5KOIA 4JBLA 3VYVA 1FUEA 3NONA 3U6PA 4GI1A 1M8KA 3X1XA 2QP4A 3WHPA 1Z59A 4JP5A 1V4VA 3QI2A 4F9TA 4BLOA 4J1QA 4XB2A 3UCEA 1E64A 5IUNC 1SWVA 1NG1A 1PW5A 3ETHA 4FJ0A 2ZJOA 1TYBE 3DC2A 5IEBA 3PC6A 4YLGA 4DT1A 3K9HA 3IV9A 5D6OA 4NNJA 3OC0A 5FWXA 2QAIA 2P2CA 4B3SM 5FBKA 2G9QA 3GYGA 4BHTA 3NYIA 4DMHA 1Z7GA 2V0CA 3CYFA 1V9SA 5IAJA 1XGKA 2HDOA 4KLZA 3B70A 1NJ5A 4ASUD 4PRYA 1RZRD 1M6YA 2K7ZA 4GIPA 2PUFA 2YXPX 2HMYB 2C2WA 2IV2X 1K06A 4Q21A 1U02A 1P0CA 4D8UA 1PL8A 1OFUA 1U2GA 1BH6A 2ZCUA 2NZJA 2EJVA 4FU0A 1MOPA 3GRRA 3BWCA 4UULA 3LP6A 4X92A 4D7AA 3WNQA 1M5UA 4LF9B 2FW8A 4J75A 2ZJFA 4LHXA 5IVKA 4IV8A 4QGBA 1UJBA 1YS7A 1DAHA 4IMPA 2Z3WA 1MPXA 3QUQA 1HKUA 3RUEA 3O8BA 2EW1A 1H5NA 4L8GA 1TZMA 5TT1A 4K40A 1QR6A 1FJHA 4MYRA 1JECA 4N82A 2LKCA 4I19A 3S7ZA 1KRWA 1OH6A 1AZSC 2JIDA 4M0UA 3K2BA 1QH8A 1VE9A 4YAEA 3AY6A 1Q0RA 1L7XA 5FP0A 4NULA 1BU8A 5F3RA 3BGIA 5KO3A 1FFWA 3P52A 1IEXA 4BQFA 2BMAA 4UUBA 2A0FA 4A36A 5JXWA 2DC1A 1ZMRA 2CN1A 3EIFA 3TLCA 4ECAA 3E9CA 2B1QA 2L4FA 1I30A 5DLYA 3NHLA 5J2UA 1TKAA 1SUSA 2ID8A 4CNBA 2VYFA 4UU0A 2ATCA 1HL3A 2H1WA 1OT3A 3RV4A 4PO8A 2VDKB 1VIAA 3FZGA 4W9MC 4PHCA 4L5AA 3H7AA 1L5GB 4N48A 5LXTB 4US2R 4TXJA 1MB3A 1Q95A 2WSMA 5FWNA 1Q21A 4L5BA 3AL2A 1OZFA 4Z99A 1RQPA 4XEUA 4EA6A 5CA1B 3K94A 4NENB 1VCHA 5EIBD 1ZJYA 4HGYA 4LN1A 3CVYA 4P33A 1KDYA 1T8TA 2LZ0A 2VPZA 1TFRA 4UVEA 4OFBA 2K7FA 1LKZA 1Z73A 2I62A 3TSZA 3DLPX 3L84A 4YPFA 4L2IB 2ZR8A 2QVYX 1CUFA 2XD9A 2OV4A 1E5XA 3LIPA 3HABA 1KMMA 1H8HD 2ZRNA 2VJQA 5MFZA 3QM1A 3QUSA 4YJHA 3COSA 3OEHD 2QB5A 5JEDA 3M5DA 2XTNA 3VDQA 3NDRA 5DNUA 1E0SA 1CP2A 3CISA 5H7XA 1T1JA 2FZLA 2VP6A 1LLCA 4WVFA 1JSRA 1K7EB 2Q1SA 1KJZA 1XD2B 4GSLA 1TF5A 4YRGA 1XPOA 4JOSA 2B9EA 2Z04A 1CUVA 3FWNA 3DEIA 3WLPA 4CTKA 4HLUC 4EKIA 4QICA 3Q7SA 2XDQB 3UCXA 1ZMTA 4TTSA 3RFTA 4G1UC 5F51A 3CVUA 2HK8A 1CYEA 3T9EA 3CZMA 3H9UA 2DHYA 4REQA 3UJCA 4B6RA 3EULA 1I2MA 3I1FA 4RF1A 2FRXA 3MD0A 5JFOA 4DJFC 4EWLA 1TLFA 1O89A 4E5YA 2GZDA 4R6WA 1D2RA 1XDUA 3KU1A 3FFXA 4CKEB 3I9NA 3MWFA 1O0BA 5H1YA 4ZVRA 3EFOB 1FQJA 3LFHA 3OFND 4K9LA 4W82A 1JHDA 6Q21A 4PANA 3P0HA 5BORA 1T2NA 3G8AA 4MJ3A 4B87A 1R9MA 5BUSA 3OICA 2OQ4A 1GPNA 4K6GA 5IW8A 1OC2A 2H51A 2CSUA 4QUHA 1EEXB 4O2LA 2QBYA 3T1QA 3CIFA 2X23A 3N2GB 4O6VA 1SIWA 4GKKM 2Q5LA 2P5UA 3H17A 1SVOA 3BIWA 1T3ZA 2Q7XA 2FMTA 5AK3A 4BQPA 4IGIA 2UVPB 4D9GA 1E9FA 2XE6A 4JJ6A 5K2MA 4ZT7A 5EMNA 4XUDA 1O94D 1JWBB 3QAUA 3KPUA 2XB4A 4X0EA 2R6GA 3H42B 3I32A 5LJIA 4J4BA 5CG2A 1GITA 2E4WA 2P6PA 2P9HA 4ZU1X 1FXUA 1QQ7A 4B3MM 3V2IA 3WGKA 4KH1A 2VI5A 4KN8A 2PKWA 5EYPA 5HMMA 3VKUA 4G4NA 4RCYA 4GQIA 5FJJA 1X7ZA 1JJ7A 3KR1A 4OKIA 3V2UA 2BM8A 2LCIA 3U19A 1Y3HA 1M67A 4LSWA 4YHHB 5JJCA 4WKOA 3HRKA 1E3EA 3FOZA 1H66A 3LECA 4LW8A 2OC4A 2G4CA 3B2NA 4NS1A 4M1EA 1TT7A 4NMXB 4ZVUA 4OAPA 4YQEA 4XWKA 3SY8A 2EBWA 1H42A 1E5TA 5EJ6A 1ZIOA 1DGFA 2YFHA 3GPXA 3GBPA 3AUXA 2M60A 5DHTA 3CZ5A 4R40A 5JRDS 2G7MC 2QR3A 1KYYA 1AMOA 1GNSA 1PFGA 5K8UA 2XWPA 5SYMA 1TVKA 4WN9A 4TT3A 2EWWA 1OFIA 1HE2A 3ASYA 1JIJA 1QIJA 2O8BA 2NW6A 4FHEA 1Z4IA 2VYNA 1ACJA 3SHTA 1XU4A 4P5EA 3VOTA 5IXYA 3DEJA 4IBEA 1Y5MA 4GMKA 2J45A 4OQLA 2F67A 4XFDA 1Z8NA 1L5SA 1TO2E 3TGLA 4QT0A 1R3DA 3QNWA 1E1QA 5ELMA 1ZUWA 4PAQA 3A05A 3EGCA 3P2IA 4C07A 2I99A 5ITTA 1GYPA 1CVIA 1K3TA 2UVQA 1BEZA 3AI1A 1XCOA 1PLKA 4EEZA 4TRMA 1CLEA 1LJUA 4PLTA 5ALHA 1IEQA 3PGXA 1Z45A 2ZI5A 4BZQA 4TUWA 3RS4A 1CJVC 2NPOA 3SQXA 4OHFA 1KU6A 3KWLA 4JJGA 4IIYA 5CCXA 3INTA 3H2GA 2BPOA 3CE6A 4WCVA 4EGJA 3C70A 2QT1A 4MA4A 2Q2QA 5AJZA 2ZRDA 1IOVA 1NTRA 5J4VA 1YCGA 2WTUA 5CHYA 2F9LA 3B7ZA 5D3QA 5KYTA 2FW9A 1O9GA 2WTNA 2BE7A 3V4FA 4TM8A 3VR4H 2QRPA 5LCXA 1DRKA 3EOZA 1R64A 3UMCA 4NU6A 3VC1A 4A8PA 1BCSB 2ORYA 1P0FA 2QM0A 4KQXA 4L73A 3WLMA 3FUWA 3MVEA 1P31A 3AQ4A 4HYYA 2O57A 2RBEA 4PEVA 3D0OA 3K2QA 3JD0A 2JEOA 2VRWA 4GYKA 1AN9A 1BVHA 5JBNA 3TQIA 2ZVDA 3CRVA 4OUKX 2IWHA 3WIDA 5JY1A 3S5UA 1CVRA 2DZOB 1WDTA 3KS9A 2GCPA 3QGMA 3V80A 1N5RA 2YN2A 5D5HA 1W6RA 4G0PA 5DEOA 2Y76A 3RS7A 3I51A 1GP2A 1GQ2A 1MLDA 1EFPA 3DZJA 1W59A 5IT0A 4RKRA 2G5GX 3NBZC 5JOQA 1C14A 2VBCA 2IZOA 1X1SA 3NBMA 1W30A 4WEOA 5JRJA 5B7PA 5GAJA 2VK2A 3FHLA 3WL7A 2QZJA 1KYWA 3G0DA 3NZEA 2YWRA 4DG8A 1GNRA 1R0ZA 3R6DA 4GQBA 1HC7A 1NR7A 5DV9A 3EXHB 1ZI9A 4M9RA 5D86A 1IMJA 2V98A 2AI2A 3RSHA 1UZLA 4O2BF 3LPCA 1QHSA 4WOCA 3SE7A 3NYRA 1H2FA 1WLYA 2DHRA 5CT4A 2JAUA 4E5MA 2YHIB 4CKCB 3TWMA 4HNUA 4QO8A 1WSWA 1CUYA 1V43A 2ZJ1A 4PSAA 3BXXA 2JK0A 2YL2A 3EBPA 2M1XA 5CB6A 3DBIA 2JCSA 3FNHA 1R0KA 1A95A 1ATZA 2CB9A 1VSBA 3AXSA 4QUIA 2HM7A 4Z4QA 3U16A 4BVAA 1RI3A 3HBAA 3QLJA 3N0XA 2B4RO 1G71A 1KNQA 4KAJA 1WSBA 3JR7A 3W8DA 2WMYA 1O77A 2RHWA 1YSYA 3IVRA 3OU6A 3QBVA 4NCHA 1FUIA 4D2IA 1I94M 2YYAA 2R751 5LP6C 2R6ZA 1G63A 2VJKA 3H75A 4D98A 2X1MA 2EKDA 2PH5A 1TTHA 1PNRA 2PUWA 1HNXB 1DKOA 5DPMA 5JYBA 3N28A 1XMOB 5JCJD 5JVDF 3OZCA 3VZBA 3PJFA 3C87A 3MC1A 1TCBA 1IY0A 2J3IA 3ZJYA 4TLEA 3BTSA 1O03A 3UMGA 1BQ3A 2Z2ZA 4C2TA 2C5AA 2X7JA 1E3QA 4X1IA 4UNRA 1MIOB 3MT8A 3IBCA 2XGOA 2MT9A 2HWJA 3JZDA 2ZM6M 1ABFA 4LRSB 2HWKA 4DHEA 3Q8KA 3MPUA 1IATA 3DQZA 3CTWB 2AR9A 3ZHVA 4ZQFA 2FN3A 1N1GA 4D97A 1CUXA 4DM7A 2DULA 4EDHA 3JVEA 3MWLA 4P31A 3I5MA 1U04A 1ZD1A 3FSJX 5BVGB 4OX9B 2R1VA 3K5PA 3ZV7A 2ZBEA 1U1CA 4JJIA 2PMFA 4IIUA 4A3SA 5AW5A 2ZTSA 1TAHA 1YZHA 2VO1A 4F92B 3JQAA 4HF7A 5JD5A 2I6XA 3HEAA 4XUCA 2WKPA 3SZOA 4Q3NA 1UOQA 4ERXA 1Y3FE 5K8VA 1DFHA 1SHUX 1LBSA 4PX5A 3VH2A 3KWMA 1ZESA 3IB3A 4XVHA 3RANA 2F00A 3QUAA 3TLMA 5JAPA 4QM6A 4ZEMA 2YQ5A 2ZBRA 4I5FA 2O5VA 3A1UA 1CY7A 4DR4B 2X15A 1BA2A 2JFOA 1SUEA 4F85A 3A9RA 3DDWA 4E32A 1V7CA 1Y7HA 1GXSB 3U6KA 1SRRA 3E9YA 2FR0A 4X44A 4OHOA 1DC3A 4CLEA 5K6AA 3JZMA 3I04M 1GZUA 3CUTA 2ZJ6A 4Z0TA 1JHZA 5KYXB 3ROGA 3WGIA 1N9KA 1N6RA 1OXBB 3K8OE 3NI2A 1X80A 1QOQB 3HBFA 4HFMA 3H1GA 5DTRA 4PAWA 3LS2A 1TECE 1QKKA 4LBZA 2G88A 4ZOLB 1R5OA 4L8YA 2EJBA 4PE5B 2HO4A 2Z8XA 3EJWA 1UZAA 4PLHA 2FPIA 1F06A 3EF3A 4P54A 3GLHE 2DRIA 4EFNA 3K0SA 5K3BA 3X1YA 5L3ZA 3KW6A 4LNUB 4OJMX 3QFSA 2AMJA 3WGZA 5AVYA 4CVNA 1JR3D 1T4DA 3G79A 3JWJA 3U1TA 4YNBA 1J5EB 4J6FA 5T4FA 1J8QA 5LQMA 2G40A 2GXSA 2C42A 4BDTA 4ATNA 1Q12A 4R0MA 1Z3IX 3ZQKA 4WCFB 4P1ZA 3FF4A 4IM7A 1B1CA 4B8YA 1DQRA 4BQIA 3ZDEA 2G6BA 1D6NA 3L82B 1QBGA 3MWJA 4E3ZA 5HIJA 3S2YA 2WIAA 4GZLA 4C4XA 2X9GA 1JHVA 4JEIA 4K3UA 1PGYA 1XJ0A 3DOFA 2ZPTX 1R8JA 3FROA 4PFQA 4S1NA 4ZYLA 2J9XB 5K45A 1KA9H 1CY6A 1V26A 2LCQA 4DR2B 1KY5A 2A2ZA 2YNMC 5DJ5A 1X1AA 4GI5A 1NE2A 4XR9A 1KAQA 1O95C 2O01F 4N7BA 2QRJA 3GD5A 2AV6A 4M6WA 5KVVA 4Y67A 4MHTA 3R5JA 2DBVO 2OL4A 5D5QA 2AMVA 4E4TA 4R2IA 1JR3E 4JGIA 1EMDA 1VLQA 2OR3A 4GVXA 3WGQA 2XA2A 1A3CA 1SBCA 2PU7A 1DEAA 4G97A 3DE2X 5GZ1A 4GRIA 4TZ6A 2ZYRA 3TXYA 1QYRA 2CLFB 5ICCA 5FUMA 4RQBA 3E5HA 3COVA 3K72B 5GV7A 3QK7A 2IYPA 4E6EA 1N3BA 1Y4DE 5FYQA 4RV5A 1TR8A 4QDKA 5GONA 3R9KA 5EGNA 3SOPA 4LXTA 2DPGA 3L7IA 3CMCO 3O84A 2VNHA 4M8SA 4ER3A 3THWB 2CFTA 1O6CA 4K81B 2EBFX 2VG8A 2VWQA 3LK7A 4KMSA 3EOBI 4FI3C 1XNQB 3FOFC 5JV5A 5AVZA 5K6RA 1IHXA 2E37A 1YB6A 4N40A 2D7GA 3A2NA 3SZGA 3O8OA 5KQMA 5B4VA 3T5AA 4GYYA 1ZK0A 3C6MA 4QNRA 4CIYA 1JV2B 1ZV1A 5I4KA 3V4VB 2WPNA 4GQAA 2XF3A 4WAUA 4JYMA 3RJMA 1QJCA 3A2LA 1EFAA 3QYBA 4PDGA 2R84A 3BG5A 1ZAEA 3OBBA 4FC6A 1TZBA 2I4LA 1FRNA 1U99A 4KL8S 3FVVA 1KP9A 1YD7A 3A1CA 4FSXA 4WZBB 2H57A 4AB1A 4B44A 1NE7A 2KEBA 2XLBA 3W7BA 3U09A 3M6LA 4DIMA 5MGBA 4TTVA 4O4HB 2I2XB 3LOUA 4DSOA 1ABBA 2QJRA 2NUPA 5KOYA 4HEQA 1ECFA 2D5AA 1Q15A 3R0JA 3S99A 3H4JA 4A1OA 1R6BX 4DLRA 4H35A 2WD7B 4RVCA 1CFJA 3OD1A 2WJZB 3HCAA 1A5BB 4BJ3A 5FL3A 4E2WA 3T7EA 1Z47A 4P22A 1ZS9A 5EXPA 3ZJ5A 1X9IA 3E46A 3I39X 4GPIB 1UBRS 5IX8A 2GVNA 2KRKA 3WQRA 2CHGA 3ONVA 2ZUTA 1VQ1A 3Q9SA 4N5MA 1Q1QA 4QT4A 3GEGA 5ITWA 5AI0A 2Y6VA 3R8XA 3TWOA 5IAEA 1YA6A 3GJZA 4Y6RA 1XP8A 1KFBB 4IFEA 3O7WA 3FHOA 4MB2A 3VR2D 1PR3A 4YB8A 3PV0A 2JLBA 1M0SA 1ZM4A 3WB2A 4PBSA 2VR1A 4DSTA 3EIWA 4MS4A 4I1VA 3L0PA 2WZQA 4EABA 3NIDB 3O4JA 5DGCA 3RVKA 4BV2A 3G13A 5JNLA 1KAGA 3CLTC 5CJJA 3B1XA 4A8JC 1XTIA 1XX6A 4MDEA 1GAXA 3CH5A 4NMMA 2D1QA 1CXZA 4LFBB 4BB9A 4JOBA 4B3HA 2HMAA 5ILGA 3OO1A 1VZ2A 1CB7A 5F1OA 3WG9A 3UOAB 3HACA 1W76A 1Y80A 3KNZA 1WHSA 2IOHA 1N6NA 4R84A 3FNQA 1OKKD 3ORQA 5DRYA 2WQ6A 4KC0A 3CT4A 4AJ4A 4QBIA 4CJXA 3UT0A 5ENVA 1W49A 4MGYR 2CHVA 2WMNB 1PM5A 2QMOA 4IBDA 2DFVA 1JDPA 4P53A 3K35A 3RAEC 2KNAA 4K9RA 2AK2A 3REOA 4NCXA 3VBEA 4BX3A 1N3YA 4OBEA 4M86A 4UOZA 3HBMA 4UHDA 5AKLA 3WJ2A 1E7RA 3HCOA 3DZFA 4HGQA 1W5SA 4DJDC 2ZKIA 2DWZB 1T4CA 2FZCA 3W90A 4KWCA 4RA9A 3Q11A 4N39A 4AMYA 3R9XB 4BMDA 2F5NA 1XJ5A 3ZQJA 1Z0AA 4A0GA 1YONA 2OG1A 4N0DA 2C97A 4NBUA 3L7AA 1BVYF 4XX0B 3B6JA 4RNAA 1J0DA 4W1SA 3TRFA 3U1BA 1FTWA 4B3RM 1XZKA 3FKQA 4L6V6 1U7TA 3H1AA 1RM3A 1SNYA 2OFWA 5KTKA 1F0KA 2PPLA 2FZWA 4WK2B 4BO5A 4RTNA 5CUQA 3D6FA 4TUYB 1F3LA 1CETA 2I4NA 1X37A 2XE7A 4HUQA 3DDUA 2A5FA 4WFJA 2I91A 2A7XA 3NVMB 3ENWA 1U6IA 4UM9D 2FFBA 2DVWB 2Q5QA 1L4NA 4NLLA 1KF0A 3TZEA 4NBWA 2XOKA 3KBOA 4KR6A 3RREA 4AZ3B 5C81A 1U2QA 1LSSA 2BHRA 4R31A 4ZCSA 1Z6YA 2GUWA 4KQIA 5FNVB 3K70C 2EOAA 3GH3A 1GVHA 1I3KA 1UK8A 1Y8RB 3IP5A 4CE6A 1D6JA 4Q7KA 1I32A 1QLJA 3AIOA 4L3WA 1AA9A 1MQ8B 3A3OA 4BRZA 4ZRNA 3QEMB 1XKQA 1Q17A 2CXOA 3NTUA 2XBMA 3GPBA 1LPBB 3GZNA 4ERNA 3BXFA 1C9KA 4DRXB 2G1KA 1U3UA 3TX2A 3SXUA 4BGEA 4YXWD 1HO3A 3HVUA 4Q03A 4B48A 2HA6A 4FXPA 4F5WA 3B52X 2HRRA 4FFPA 2VNIA 3U6CA 5CNIA