2XSZD

The dodecameric human ruvbl1:ruvbl2 complex with truncated domains ii
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
331
structure length
310
Chain Sequence
GAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIHTVSLHEIDVINSREIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RUVB-LIKE 1
publication title Structural and Functional Insights Into a Dodecameric Molecular Machine - the Ruvbl1/Ruvbl2 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 310
sequence length 331
chains with identical sequence E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06068 TIP49 TIP49 P-loop domain
D PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xszD02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xszD01
1M8PA 4LJAA 5FOWA 4KYIB 2BBTA 2WPDD 3GJ8A 5BW8A 2Q21A 2FWRA 4B43A 1VCNA 2KJQA 1EX6A 1KJZA 1P9RA 2W00A 5JHHB 4LJ5A 4DCSA 5EJEA 3MWJA 4BEBA 1YKSA 2DFLA 4EKDA 2ZRLA 3AV0B 5CITA 2E87A 1Z6TA 2WJJA 3TSWA 2X8AA 4BLRA 1N2CE 4BZXA 2J0UB 4FXPA 2ZU6A 1A4RA 3KFVA 5DNYB 5FPTA 1BMFA 4KV9A 3KXIA 1ZYUA 3AVTA 2ZI5A 1N5KA 3SQXA 4TYNA 1C9KA 4YMWA 3MUFA 4ILEA 1IY2A 3I3SR 3EXAA 1GP2A 4GZMA 3VX4A 1XMJA 4Q7JB 2JDIA 4M1SA 1CP2A 1WCV1 4BUJA 3GJ5A 2UZ3A 3WMFA 4R71A 2OCBA 2J0UA 1DELA 3AKDA 3HYRA 3HR7A 3SN6A 4HAXA 1E0AA 3K70C 3L0OA 1M6NA 3WNCA 2IYXA 2HUPA 3LVQE 4LHWA 5HTKA 2QM8A 1Z63A 4CEIB 1DO0A 1KO8A 1Z06A 4HB0A 4US1R 4WZ6A 3TR0A 2V9PA 2EWVA 4KBGA 4ACAA 1YR8A 4UJ3A 3QJYA 3A4NA 2GK6A 4Q1BA 2J7KA 1MR3F 4AC9A 2QE7A 4LHVA 4ESVA 3CRW1 2ZXUA 1P2TA 5FOSA 1T3HA 2EYUA 1T8UA 3VX3A 2XTMA 1TQ6A 3SR0A 1XZQA 2Q3MA 4Q9IA 3LW7A 5B58C 4GT1A 3WMEA 1XP8A 5CLLA 3BC1A 4CEIA 2MMCA 1XB2A 4QGAA 4P3YA 1OFUX 3MWLA 4A8JC 1J8YF 4P4UA 4US2R 2J46A 3HU1A 1N6KA 4AK9A 5L3SB 2VL7A 1ZD8A 2OBMA 4TLDA 2JLWA 4RJLA 1E9SA 1Q12A 1A82A 3A1WA 4JL6A 4DVGA 3CR7A 3H0KA 5CJPA 1KI8A 3NTUA 2VSOA 4Q1FA 5KSYA 5JWRA 5FTNA 2VSXA 3P27A 2J7PD 1Q3TA 2QA5A 1JR6A 1XEWY 3ETLA 1KDOA 5DLQC 1JXOA 4Q66C 5E95A 3U7HB 3DZDA 1QVAA 3AVUA 1LTQA 1NVUQ 3Q85A 1RVDA 4RVCA 4TYPA 4B71A 1E9RA 3KKPA 3UG7A 3V4FA 2ZU0C 4DWJA 1E2KA 2JASA 2YINC 2FSIA 3VR2A 4B3DA 1XMIA 4IEEA 3W8RA 5JJIA 4B2PA 3NC1C 1CU1A 4PQYA 5EP4A 3PV0A 4DSTA 1K5GA 1IQPA 2CL0X 1KNQA 1L4YA 3HWSA 3T61A 2DVWB 1E2EA 3F0TA 5HCIA 1KKLA 4EPYA 4QJ5A 1RJ9B 4AY2A 1YJ5A 4LY6A 3EZ9A 4PC1A 2BC9A 2NPFA 2ZSDA 5KPDA 2QMOA 2C95A 4KHZA 1HTWA 4FIDA 5HZHA 3U6KA 1NVVQ 1YQTA 4MRPA 5GVRA 2QPOA 2J3EA 1TQ4A 6Q21A 1JJVA 5JLJA 2RCNA 2IYLD 1KMQA 4C0SA 3CLVA 3GEHA 4ZO4A 5AWFC 2RH5A 1OIVA 1VYTA 2GBLC 1RJ9A 3PFIA 2XITA 4FMCB 4Z54A 1G21E 4AWXA 4KCGA 2DZNB 2C99A 4EFMA 1G7TA 2ZI4A 1ZW6A 4QL3A 1ZP6A 4C7OB 4GITA 1FQKA 1UBEA 4HEJA 3O8DA 1U0JA 5EUQB 2VEDA 3I62A 2AHOA 4OJKA 2WV9A 3BS4A 4L9WA 1G19A 3PEVA 1U8ZA 4AYWA 4JN6A 2V6JA 2BWJA 1CKEA 4EPVA 4URXR 1XPOA 2RHMA 1G7SA 2ZE5A 4B34A 3DOEA 3M4YA 2NMVA 2ZSFA 4P4TA 4HDQB 4C4PA 3VFDA 3GFOA 3RABA 4FMDF 3HJNA 4LYAA 1JECA 3KJHA 2FJUA 1TUIA 4S2EA 4WZAE 3RRZA 3FHOA 4M1YA 1NN3A 1Z6XA 5ANRB 2ZROA 2BBOA 1ZUHA 4L15A 1LV7A 3P20A 2FFAA 2PMKA 2ZETA 1NF3A 1EWQA 1G20E 1IHUA 4IXMA 2R6AA 3N2EA 4Q18A 4MGKR 4DSNA 2GBLA 4HAUA 3B9PA 4M0LA 3ADBA 4P4SA 1E9DA 3X1DA 4LZZA 5B57C 3LW8A 2BKUA 2EFGA 1G8PA 2R8RA 5D3MB 4A3VB 4LJYA 3RNLA 1E9AA 5JI2E 1E94E 1Q1BA 1ESMA 1T0HB 4GFDA 3O8RA 1TNDA 2VSFA 1YU9A 4TLEA 2XAUA 4TMVA 4PHGA 1B23P 4CYMA 4NZYA 1ZJ6A 1KMHB 4P33A 2QZ4A 1VCMA 2IXFA 5FBWB 1SVMA 5JWHA 3EX7C 2HYIC 2LKDA 2BMDA 4NYMQ 2XSZA 1HYQA 1EK0A 2VH5R 3W5JA 1KK0A 2ZE6A 4JL5A 1N6IA 1W4RA 5IRCD 3U44B 2R65A 1U9IC 1LFDB 2IYZA 1EXMA 4FINA 4JLJA 3THWA 1Z6GA 5EQTA 2DFKB 3GJ6A 2ZRNA 4I81A 2HCJB 5TV2A 4C0BA 4LC1A 3I8XA 4R9UC 5A0FA 4BLOA 4HB2A 1KMHA 3ADCA 1R5NA 2OCPA 4NBSA 4IFBA 2GK7A 2RKOA 4UKDA 1QRAA 4RSGA 3KQUA 1TADA 2VIIA 3A36A 3KTAB 2Z43A 4DXAA 3QIAA 4DUGA 1G1MA 3U44A 5JWOA 1XCPA 2FMXA 5DE3A 4C3ZA 1XXHE 4Q9HA 1W0KD 2WWYA 3K0AB 1YZTA 2NO9A 1KI6B 1V43A 5FPYA 1XDBA 2FPMA 2ZREA 3TAHA 2FPKA 4QHSA 2QT1A 4V0KA 2JLYA 4Q4LA 3ZD6A 4Q4HB 3K9GA 1JNYA 3CNNA 4HAYA 1XXHB 4NTZA 1BKDR 3QE0A 3W3AA 4EQ6A 3ASZA 4V0NA 1CR2A 2FOLA 1U9IA 3KTAA 1UKEA 2D7CA 1DAGA 1D9XA 2J0VA 4NCJA 5BN4A 4F4IA 2EFDB 1ZCAA 3K0AA 1T3LA 1KI6A 1GWNA 2D7DA 2QY9A 3LWNA 1BIFA 4JSYA 3V4RA 2OESA 1PLLA 2V54A 1X8KA 3QOFA 5EP3A 1NP6A 2CCJA 2IS4A 1RRCA 5J4VA 3GJ0A 1KO4A 2GJAA 2H17A 4PC7A 4MKGA 3GLHB 4D0NA 3NKVA 4Q4HA 4C0QC 2JGNA 1SVIA 3QENA 2RGGA 1XXHA 4S35A 2PCJA 3LRPA 4Q47A 4Q7MB 2JLRA 1CJVC 1Z47A 2OAQ1 2ZYTX 3NDBB 4WZBE 1CLUA 4D0LB 2IUSA 2IWHA 2FH5B 5FH9A 2WAXA 1Y63A 5J4HA 1D2MA 1EG7A 3NG1A 3QF4B 5DIFA 2JLXA 3Q8XB 4EJSC 3IQWA 4G1UC 1AKYA 1E2IA 1D5CA 3U3RA 2VHUA 4B6FA 1KSFX 1XNJA 1E2NA 1RE0A 1VG0B 4BLSA 2G88A 3GJ4A 3LLUA 4QGFA 5P21A 3KKNA 4XH9B 2DFTA 3VTKA 3UG6A 4H9GA 4CEJB 4XWAA 4PO8A 3FFBA 2RAPA 1SXJE 2QAGC 1ZM4A 1FP7A 4V0ME 4IDHA 4EJSB 2VBCA 1XEXB 3SFVA 4R98A 3SI7A 3QF4A 3GEIA 4DCTA 1Z8FA 3F5FA 1R8SA 1R5OA 2IYTA 3AUXA 3GQBA 3CBQA 1DPFA 2CK3A 4MRSA 3R9WA 3SBDA 2QSZA 4IDNA 2WWWA 3ZS9A 2GDJA 1QHHB 1G17A 1FP6A 1XEFA 4HSEA 4CEJA 3AP2A 2VO1A 1RPZA 2UKDA 3RRNA 4QNRA 4EJSA 1XEXA 2FGJA 2UVQA 3U6BA 3HPRA 4J0QA 3HU2A 4KBFA 4NH0A 1EFTA 4KO8A 2Q0HA 3KJIA 4PSVA 4D4JA 3N2IA 3MJHA 4LDJA 1N6OA 2KBEA 1NMXA 3QVUA 1SXJA 4PSKA 2IUTA 5AK0A 5L8VA 3R9XA 1CF4A 4OK5A 4MRNA 1VHLA 1QHXA 1QHHA 2YHSA 4DZZA 5HKKA 4P32A 4Z1MD 4PZLA 2H8KA 2YKGA 4ZDJA 2CLDX 3K1JA 2AX4A 4M21A 1SVKA 2ZEJA 4GDFA 3CZPA 3BRWD 5CYPA 4ZIRB 1G64A 2BCJQ 4NE2A 1IJFA 4C0KA 4LBVA 4TQ9A 4UNNA 5C2JB 3TRFA 4HI0E 2FFHA 2F55A 4L16A 5F9FA 1GL9B 1N0VC 3T1OA 1Q21A 2AK3A 1W49A 2Z0MA 3B1XA 4P31A 4B3CA 4DLWA 5AUOB 1IBRA 3OAAD 4MITA 1PUJA 2ZRDA 2F1HA 1G18A 1HV8A 3FYHA 5AJWA 1KO7A 3UWKA 2KE5A 1ANKA 2OFXA 1UKYA 2BVNA 2RGNC 1VYUA 1JQJC 4ZIRA 4JVMA 3EWSA 4G5RA 3IIKA 2BV3A 2GXUA 1QHNA 5EXXA 1BOFA 3T35A 1J70A 3CRVA 2XOKA 3VR4A 2FPLA 3R20A 2HLDA 3U5ZB 4HDCA 5CIQA 4JL8A 4LOAA 4BFZA 3LX5A 1NBMD 3AVWA 4CZ2A 2NO6A 5KOYA 3TUIC 5FFMA 1UM8A 3ZGXA 3C7KA 4Q1EA 1N6PA 5TDHA 1SVWA 1KSGA 2VHQA 1XD9A 3O8BA 3OFNA 2G1JA 1S3SA 1E2JA 4Q1CA 4LGMA 1DADA 4V02A 2IEZA 4A15A 4TLCA 2BHRA 1PLJA 1ZUIA 2JJ1A 3C14C 4LWZA 1UKZA 2C9OA 4MUAA 1M34E 1XX6A 4CEHA 1WMSA 3TW8B 3F8TA 3R9IA 3K0SA 2JJ2A 4FI3C 4FMCF 2RGNA 1Z2CA 3G5UA 3CPJB 3LAWA 3ZH9B 3IPYA 3THOA 2QTFA 4YQFA 4IDQA 2JIZA 2XJ9A 4EFLA 4Z51A 5B2ZA 2VP2A 3TKLA 1UPTA 1W36D 1RYFA 1KSHA 1CRPA 4EIWA 4URWR 2IWRA 4GOJA 4LHYA 3Q5EA 3PUYA 5CDFE 3I72A 4UXIA 3OEHD 1OXSC 5EE1A 1JAHA 3EPKA 3RC3A 4PPQA 2CLSA 3M0EA 2YOGA 2FGKA 3W90A 2ZSEA 1JAIA 4NP6A 1OKKD 4XSHA 4DEXA 4LJ9A 5HR5A 1AGRA 5IF9A 1Z07A 4AYXA 2VYFA 3GFTA 3CWZA 1LS1A 2H1LA 2ZS8A 3IPXA 2HXSA 3A1VA 4QBFA 1XTIA 2G6BA 2J0SA 1EFRA 2IYYA 3KZ1E 4MKFA 3QXCA 4TMXA 4A4DA 1JALA 2QSYA 3NBYC 3CPEA 4TLBA 4Q9LA 4ZKEA 4KVAA 1E69A 5C4GB 4NCNA 4F38A 2WAYA 1U8YA 3Q72A 5AUQA 2B6HA 1U90A 1E9EA 3AGQA 3QI2A 4HUQB 1QZXA 5KNDA 5HCNA 4TL9A 4KLZA 5DYGA 3HPQA 2FSHA 2PBRA 3WXMA 2DCUA 1G6HA 3D6TB 4LJ8A 2O8DA 5CDFA 2GVZC 4F4CA 5LBIA 2REXB 4FN5A 4JJZA 1ZVQA 4URZR 3MHVC 4FMDB 3FTQA 1R7RA 4WBSA 4Q03A 1UBFA 3ZYCA 4TZ0A 1DAEA 1W0JA 3BD9A 4HZUB 2PZEA 1E1RA 1CS4C 3EWAA 1OHHA 4WXRA 3OHMA 1N6RA 2O8EB 4A0RA 2ZE8A 4PC2A 1FMJA 1KIMA 3CKLA 3FWYA 4MRVA 3QQ5A 3T1QA 4OJQA 4KFUA 1LF0A 2PT7A 1FUUA 1NIPA 4JLPA 4EPRA 3V9PA 2YWHA 4FWTA 1H8HD 3SHWA 1A2KC 2XZPA 5AJZA 2KBFA 2CVHA 4HB3A 3RANA 4HZUA 1R4AA 2C77A 3MAAC 3HU3A 4B2LA 3OE7A 1L7VC 1XTKA 2IL1A 3GMTA 2O8EA 5JMTA 2ZRBA 2DHRA 3AQ4A 4TWZA 2ZS9A 2GJSA 4XTCS 3B1ZA 3PEWA 4ARZB 2WICA 2JJ8A 2HV8A 4LJ4A 4IRUB 3NIBA 5E7MA 1E0JA 4YXWD 5CB8A 4TZ6A 2ZAOA 3B82A 4TMKA 2KSQA 2NG1A 2O0HA 2OV2A 2WSSA 1W48A 4D80A 1W2GA 4HAZA 4TL7A 3A58B 2QPAA 2ONKA 1GUAA 4XWOA 5F98A 2WMOB 4I1OA 4DDVA 2IYQA 3A1SA 5EZ6B 3BFVA 4JYCA 1N3BA 4RZ2A 5BN3A 1QHSA 2NO0A 2PZFA 2RHDA 2XNDA 3U7EB 4JVNA 1Z0IA 4OHZA 3QXHA 1PZNA 4ZDKA 3VKWA 2QQEA 2VP0A 2HT6A 1QG2A 3LLMA 1JR3E 1UEIA 4JVSB 2FG5A 2GHIA 3BK7A 1WE2A 2WTUA 1S3GA 2ZJ5A 3JZAA 4JLKA 3WP1B 2EQBA 1KK1A 421PA 2VF8A 4Q1AA 1F60A 2AD1A 3P4XA 2WIAA 3D3QA 5JRZA 5FTJA 3W9YA 1CEEA 1HY3A 5FPSA 4TMWA 1NVMA 1P75A 3K9NA 2AXNA 4B3BA 3PITA 1R0XA 1XPRA 1Z0FA 1S9HA 2GF0A 2QP9X 4MDFA 2F43B 2GJ9A 2P3SA 2W2XA 1R6BX 4ERNA 2BDTA 4IOMA 3T12A 2A7QA 2WSMA 1E1QA 1KK3A 4GNKA 2J1LA 3UATA 4FWGA 3GLGB 2EFEB 5EP1A 4M22A 1XD8A 3I32A 1Y3AA 1ZIPA 1TEVA 3QY0A 2FFBA 1NG9A 1JR3A 4ZPXA 2XZOA 1XF9A 2GXSA 5TVKA 3WNDA 1T8TA 2A2ZA 3UMSA 3LFUA 4C9BA 2C96A 4DSOA 2OFWA 2ZJZA 4LK2A 5A5GA 5B64A 4I1UA 4PPGA 2QN6A 2V55B 4EPXA 2HT1A 8OHMA 1G3RA 4Q19A 1UDXA 5FL7A 3KB2A 4RCYA 2WKQA 1NY5A 3B13B 3KKOA 4M53A 2NZ8A 1IN8A 4M9QA 4AKIA 4XOIA 4E22A 1F5NA 3PR1A 4EPWA 1ZCBA 2R6FA 1YR7A 1E2GA 1Z83A 3NHAA 1TTTA 4A36A 5CJ2A 3G0HA 1EFUA 1X1SA 2ZRHA 5JS7A 4R7ZA 1MABB 3TBKA 2D06A 2IYVA 1I4LD 1M7GA 3ASYA 4TN1A 2EFCB 3RVBA 1COWD 3T1VA 3T06B 1HT1E 1BYUA 3CUEF 1BMFD 4JMPA 3X1ZA 3T5DA 3QF7A 2QEQA 1JB1A 3OESA 2OILA 4LV6A 1M7BA 1WBDA 1M74A 3MLEA 4PAOA 2A5DA 3L0IB 3UMFA 3AJIB 2F1RA 4NU0A 1UBGA 1NLFA 1X86B 2FN4A 1OXUA 1P60A 2JDID 2VF7A 2GJ8A 4M1OA 3LO5A 5GJBA 2AFIE 1E3MA 2HCBA 4ESHA 3ND8A 3PEUA 3QPUA 2R6GA 5EE9A 1MABA 5GVSA 1E2DA 4OQFA 3SE0A 3JVUA 4EUNA 2A3RA 3GLIB 1KAOA 3RSLA 4A82A 1XRJA 4HAVA 2ASEA 3EC2A 3K70B 5GJCA 2IYRA 2FFQA 3SJZA 1Q22A 3KQKA 4Y0AA 3DM5A 3SHFA 4NL4H 4FCVA 3K0FB 2GILA 4QBHA 4GBMA 1G4AE 1HT2E 2B8WA 4DCUA 2IHYA 4A2QA 2V7QD 2O52A 4BEJA 3B1VA 4Q5IA 2JATA 1VG9B 3ZJYA 1TQ2A 1S9DA 1JBKA 1F3OA 3GLIA 2QE7D 1P3JA 2ZUBA 3SJCA 5JEEA 4AURA 2BCGY 4ZCIA 4HAWA 1KOFA 4Q4AB 1NLZA 1Z08A 4CT5A 4DLTA 2X19A 1V5WA 4DCNA 1Q1QA 4TT3A 3BERA 2I4IA 4BZQA 1IAQA 2YVUA 2BMEA 2Z83A 2J7PA 1KO1A 5FOXA 4A8JB 4POAA 4BLQA 3IEVA 2FU5C 3VKGA 5C18A 4NONA 1L8QA 1UJ2A 3NEYA 3TE6A 1OXXK 2ZRJA 1QHIA 4IVQA 2WJGA 2W0SA 3LXRA 5L3SA 3T34A 2DWQA 2OCYC 5CIWA 1TU4A 4Q4AA 2EWWA 1T91A 4UNQA 1ELOA 1MO6A 1RC8A 4YDSA 4M9SA 5L3RA 1EWRA 4DB4A 4G3XA 3C5HA 4N1AA 3TGPA 2GCOB 1J90A 2IS1A 2VHJA 4FWIB 5ELXA 1NMZA 2WM9B 4HB4A 4A8JA 1TUEA 2GJKA 4OQNA 3BIFA 3BBPA 1VKJA 1G3IA 4ZCLA 2PX0A 4D4MA 4U00A 4CW7A 2Y8EA 3QEJA 5FOTA 3AVYA 5TMPA 2C78A 2Q3HA 4JZKA 2WBLC 2O0JA 1XMVA 1JI0A 4QKQA 4IVPA 3FPAA 2C04A 5TARA 1CJKC 4RD4A 2JCSA 4AG6A 4LV5B 1WDTA 2GCOA 1MH1A 2MSDB 3EG5A 5JJKA 2FA9A 2X2FA 1G5PA 4X8HA 2R2AA 4LBYA 1NG1A 1SHKA 1E79A 1NN5A 2ZJOA 4QJ4A 4JVLA 521PA 3WNBA 2EFHB 4ASUA 2IEYA 3FMIA 2NTYC 3E1SA 4BLPA 1GFIA 1D6JA 1NVVR 4PANA 3IIMA 3L0SA 1AS2A 5H68A 5AJXA 3NH9A 5FR2A 3SOPA 2VP6A 3PUWA 2JEOA 1YR6A 3PENA 2XTNA 3B8HA 2DR3A 3QEOA 1VPLA 3B2EA 4QFMA 2GEVA 3FMPB 1XU4A 5CM8B 3SNHA 5L3QB 5KDDA 1RRGA 2Z4RA 1PUIA 4GRAA 3AVVA 1IJEA 3VAAA 4E03A 4MKHA 2QMUA 2P6NA 2CE7A 4JLMA 3EPJA 4GMDA 4PHTA 1Q57A 1EESA 1NKSA 3ZD7A 1E2HA 2CMKA 4IOLA 4K46A 1ZM3A 4C7OA 3W3ZB 3U3MA 3NWJA 2V1UA 3Q7QA 1J99A 1S1CA 2AL7A 4PPNA 1II0A 3PQCA 2W6JA 5L3QA 1GKYA 2BM0A 1Q1EA 2WWHA 3CNOA 4L8GA 1Z3IX 4NDZA 4TTPA 4V0OA 3EZFA 4NKRA 2WOJA 1KYIA 4IXNA 3HYTA 2AWOA 5FBQB 1XTQA 4DT1B 2O8FB 2WJHA 2WOOA 4F91B 1VMAA 1CXZA 2HEIA 2MMGA 1I4TD 3FE2A 4M9ZA 4F7WA 2YWEA 2FNAA 1IXRC 1HA3A 2ORWA 1UF9A 1XPUA 4RD3A 2GESA 5JCZA 1DVRA 3RS5A 2GXAA 3GJ3A 4MQBA 2CCKA 4LPKA 4B33A 1OFHA 4MUBA 4LSGA 4DJTA 5D3MA 5FI0B 2GZHA 3E2IA 3ZQ6A 2JLVA 3D7MA 4DT1A 2O8FA 1FTSA 1G291 1B0UA 2P65A 3BB1A 4OHVA 2GNOA 4YLGA 5FTLA 5CM9C 5SZKB 4L4UA 5C46F 2ORIA 4HLDA 3CB4A 3B85A 2B21A 4TQUS 3MJRA 4PAMA 2LKCA 1P62B 4NYMR 1C1YA 3OZXA 4NYJR 2WKPA 2XZLA 2FEMA 2A30A 1TU3A 4RZ3A 4C0JA 2IS2A 1D9ZA 4A0FA 2OAP1 3B78A 4QXAA 3A37A 1OW3B 3NBZC 3VLFB 1O3YA 1RW4A 1E6CA 2GWHA 4V03A 3BWDD 4BWYA 3KDSE 4DLVA 3HR8A 3LY5A 3MWYW 1OSNA 4BRWA 1T0JB 1N6NA 5JFGA 1D8TA 1GKIA 5JRJA 4KFRA 1Z29A 2DY1A 4RY2A 3TJZA 2B8TA 721PA 3P1JA 1GAJA 2ZR9A 1W5SA 1GKUB 4D0GA 2IHBA 3BXZA 3ZS8A 1YZUA 3K09C 3GLHE 1GL7A 1XTJA 1VG1A 4M1TA 1M2OB 4RD6A 4CGZA 1A1VA 3I5XA 4A0GA 2FE4A 1G5TA 1TX4B 2H16A 3CX8A 1DAKA 4MYUA 5BQ5A 3I1FA 1SKYE 1NY6A 1M1YE 2WZQA 1JEDA 1ZNZA 2OLKA 4MDEA 1UBCA 4V0LA 1G7RA 2V6ZM 1JPNA 1OFIA 4LC0A 4IKEA 1DTSA 5F3WB 2R6DA 3QPWA 5KNBA 4CF7A 4WVFA 1FNNA 3LH5A 4PO9A 1JJ7A 1OLOA 2P5TB 4LRTA 1SKYB 4CRWB 2ZJAA 3BE4A 2AK2A 5BXQC 4RZUA 3BFKA 3O8CA 1Q44A 4I4LA 2G1KA 4NCIA 4JBWA 1QHYA 4BFUA 3N5CA 2ZYWX 2IT1A 2WWFA 5AUPB 1DAHA 1T3SA 3GLHA 5FBVB 3ADKA 2XXAB 2C8VA 1U98A 5BWMA 4LHXA 4ZV4A 3CH4B 3K09A 3MWKA 1WBBA 2P6RA 1T9HA 3CX6A 4DCVA 2NGRA 3DL0A 3A6PC 3C41J 1G5RA 1IY1A 1ZC3A 4O3MA 4JLDA 3KUCA 1LF5A 4TYQA 3OIVA 5EE0A 4RZXA 3MGCA 3LBNA 1T5IA 4GOXA 5DHFA 1OIXA 2FSFA 2F9MA 2NZJA 2V4ZA 2XXAA 2R62A 3QKUA 3O47A 2QAGB 4US0R 4ACBA 4FCWA 5DSZA 2ZI9A 3GD7A 4G01B 1HQCA 1F2TB 2QMHA 1D2NA 5G3ZA 3CONA 3SYKA 2ECKA 3H2YA 1IN5A 1CIPA 4LUCA 1E2PA 4G5OA 3QKTA 1SKQA 4NMMA 5K8LA 3BAFA 4GL2A 4OI1A 1AGPA 3KX2A 3VNVA 2CHQA 1KJWA 2ZIAA 4KJZA 4A1FA 2QAGA 4O25A 1XJCA 1X8LA 4PX9A 4BGDA 2NOAA 2XGJA 1E4VA 4LHZA 2ZUCA 5K8UA 4ZI3A 5FBLB 4A9AA 1I2DA 1AS0A 2N42A 4R2IA 4KYUA 1N6HA 1RKBA 4LBZA 4AKGA 2W2VA 1LY1A 4TL6A 4EPTA 3KW6A 5KUTA 2WJIA 3JZMA 4A6XA 4ITRC 5K8IA 1SXJD 3KJGA 4H1VA 3ZQJA 1HURA 5DO9A 4JLNA 2ZSAA 4PZZA 2OM2A 4C30A 3W6NA 1E9BA 1FQJA 3ZIAA 5AJVB 1N0WA 1Z28A 1G3UA 5HKKD 1QDEA 3AVQA 1GM5A 5JI3E 1CRQA 1GIAA 1VIAA 2ERXA 4UQOA 3VR1A 2BIFA 2PL3A 4DKXA 2WMNB 3PUZA 5E4FA 4CIDA 2JLZA 5DISB 1F2UB 4U5XA 1KAGA 3DZ8A 1KI9A 3L0PA 3RS0A 3UKDA 4K8OA 2IA5A 3AH8A 3BB3A 3GEEA 3LVRE 3RAPR 1W36C 1I2MA 1ODFA 1SVLA 2GXQA 2N1BA 2EVWX 3EARA 1SHZA 4NYIR 1OPXA 1NBMA 1YZQA 2UZIR 2ZRKA 3RLFA 1K6MA 1QF9A 3LXXA 3DOFA 1P72A 3RS4A 1CBUA 1AN0A 4GSYA 4TTQA 5E7JA 3VR5A 4LBWA 3ZDQA 5JEDA 1W36B 2RGCA 2ZRMA 2IF0A 5FUWA 2XOKD 2L0XA 3LV8A 4DRZA 3MG9A 3ICEA 1W46A 1XFAA 2HLDD 2RGAA 3BORA 1OFTA 3BH0A 2VP5A 5E7IA 2W6IA 4C2TA 2QTVB 2RGEA 2A5YB 1XJ0A 4KSBA 1R2QA 1SULA 1YRBA 1VCOA 1KY3A 4MGYR 3KXKA 1YRAA 3CWQA 2QL6A 1SVOA 4MYCA 1NJFA 1ZAKA 2ODNA 3AF3A 3OFND 1N6LA 1ZU5A 3SYNA 3NVAA 1U0HC 1GTVA 4LCBA 1ZM7A 1OH7A 4QHYA 1GG2A 5SZHB 5IK2D 2JJ1D 2RGDA 4HLUC 3L43A 4ON9A 1E2QA 5J4YA 2Z4SA 3X2SA 3GJ7A 5C1BA 5J4LA 5KU1A 4A92A 5KDOA 3ZVLA 2JLQA 4W9MC 2JJ2D 3T1TA 1R8QA 4QHTA 2YV5A 2ZTSA 3AKYA 4OL0A 2JIZD 2P0EA 1NVXQ 3EASA 2MSEB 2H7VA 5IT5A 3PG5A 3LQQA 1GNPA 3U2QA 1R0WA 4AYTA 1D2EA 4XSGA 2SHKA 5JS8A 2GVDC 2F3RA 2ODWA 3VKHA 3H4MA 3U60B 1YZKA 5BN5A 2ODBA 1I4DD 4BFXA 4QGGA 4Q4JB 3TH5A 1Z5ZA 3UMRA 4PFSA 2KB0A 2BJVA 5G3YA 2CHGA 1IM2A 2O5VA 4DLZA 1EFRD 1AK2A 5DHAA 2BEKA 2GETA 4HLUA 4Q21A 1G41A 4UXHA 1KO5A 1GZSA 1HE1C 2QPTA 2GA8A 2CNWA 3TAUA 1OB2A 4L5BA 2CCGA 2PJRA 4C2UA 4D4KA 4HUQA 2H5EA 1TF7A 3EPLA 1VIYA 2ZYUX 4DIEA 1FX0B 2ATVA 2ODEA 1MKYA 2OE2A 4KI0A 2YOFA 2WIBA 1N25A 3MRSA 3FGNA 2HXYA 3ZLJA 3RS7A 3IUYA 1W44A 1ZINA 1FOEB 1ZM2A 1FZQA 2J59A 4HLCA 3FKSA 3X1YA 5KSZA 1GNQA 3TNFA 1QG4A 1NN1A 2GKSA 1W0JD 2Q9AA 3CW2A 3W6PA 2PJZA 4XIGS 3D31A 3DDCA 3U61B 5CK5A 1A5TA 3C4JA 4Y0VA 5GJVC 4PHFA 3J81k 2EYQA 1OHHD 1ZNYA 2G3YA 2F6RA 2ZR0A 3OEEA 3R8FA 1IXSB 4N0DA 4X8OA 2ZQ5A 1QHGA 2G77B 2F3TA 4D2IA 4PC3A 5EE5B 3WHKA 3LD9A 1XD2B 4ZI2A 4LX0A 1G3QA 1GRRA 2PLRA 3WBKA 5KTYA 3EIEA 2OZEA 2QENA 2QRNA 5FBRB 2V3CC 3IILA 4NCKA 3UANA 4M4SA 3NDPA 2ZRGA 1IY0A 3PUVA 4KAXA 1M7HA 5FOUA 3CM0A 3CRRA 1IOZA 2CL6X 3GCGA 1ZIOA 1P73A 3FMFA 3H84A 1PVOA 4OYHA 4ARZA 4LPSA 3EAQA 3MCAA 3K53A 1MO5A 2IW3A 3ZZTA 1XD2A 1XBTA 4LYFA 1FUKA 2WSSD 2ZRIA 2HJGA 5JSZB 3FDIA 1OE0A 4XD7A 1VCIA 1H8EA 1P2UA 3WYFA 4BASA 5CLQA 2EW1A 4TSFD 5DN6D 4B47A 2BMJA 2OHFA 1DOAA 1HH4A 3CF2A 2DWPA 4OI0A 2VLIA 4FD2A 1S8FA 3BH6A 5FPKA 3RWOA 4IHQA 3OIWA 5KDLA 3OIYA 4Z8YA 1AKEA 2QORA 4M9XA 3GLGE 2OCAA 2QT0A 2IXGA 3A1TA 3KB1A 1AJEA 2BKEA 2ONJA 3IHWA 4A6PA 4BFWA 4C0AC 1KI1A 5JSZA 1J7KA 5LB4A 4DDUA 1Z6AA 3GFPA 3SS8A 4UJ5A 1RFLA 1VECA 3TIFA 3K8YA 5LB2A 4BRUA 1VG8A 5JHGB 3QXJA 4PQRA 1CULC 1HQYE 1KDPA 2P67A 2X77A 2QM7A 3KFXA 5IHPA 2GF9A 2QTHA 2ZVQX 3A4MA 4MRRA 4GI7A 1LVGA 4RFVA 3UXMA 3LX8A 4KFTA 5LPNA 3EPHA 2WPDA 2V1XA 2DWZB 1OYWA 1CR4A 1E2LA 3WRYC 1T5LA 3EZ6A 2PX3A 3QXXA 2F43A 3AVXA 2NO1A 2XTZA 1YZLA 2O8CB 4XWKA 4O2LA 3AM1A 2REBA 4BE7B 4ZDWA 1EFHA 4BFSA 5KO2A 1W1WA 2R9VA 1E1QD 4KLNA 4OK6A 3GLGA 1XWIA 4DLXA 3LNCA 4F92B 3PUXA 2OT3B 4D81A 4IDOA 1G8GA 4PZYA 5JCPA 1YHNA 1JR3D 2YOHA 3PXGA 2GRJA 1II9A 4JKYA 1P4SA 4B2IA 2JAQA 3BOSA 4BECA 5AUNB 2YJTD 2Q9CA 3QG1A 3RHFA 1CTQA 121PA 2GAOA 2O8CA 3I8SA 3EZ2A 3EIQA 3KJEA 3SC3A 2A78A 4I1SA 4URUR 1COWA 2QP3A 3SFZA 2FV8A 3NC0C 1NSTA 2LCFA 5FL7D 2WKRA 3ONWA 1E9FA 1VDZA 1Z0DA 5TY0A 1KSJA 4JBXA 5EE3A 2QQ0A 1KZ7B 1FMLA 2BOVA 2ZE7A 2DFNA 3I73A 3GLIE 1UDWA 3AGPA 4TMZA 2GEUA 1G9XA 2ERYA 2AFHE 3K0CC 2EU8A 3SEAA 4QOSA 4IDPA 1BYIA 3VHLB 2G0NA 3KKMA 3CF6R 1KTVA 1TQDA 3EZ7A 5EZ5A 1TL7C 5L3VA 3M6AA 1TF5A 2BEJA 2VP9A 3HP1A 4M8NE 3CR8A 1CR0A 4B75A 4LV8B 2ZM5A 2E1RA 4AKHA 3CX7A 5LD2C 1LNZA 2JLSA 2I3BA 4A2PA 1MRSA 4PR0A 5KSPA 3TQFA 4DSUA 3U3JA 4UNRA 3QKRB 3BJIC 1VYVA 1ZM9A 2AD5A 2J41A 1WP9A 4MYHA 5FOVA 2OEPA 1F48A 1OB5A 3PIRA 2J5XA 1W4CA 4PO1A 4D25A 4OQLA 4PPFA 2OLJA 2C9CA 5TB5A 4JYBA 5DI9A 1HE8B 1W4AA 2V7QA 3AEZA 3WHLA 5LD2B 4GP7A 1DEKA 5HE9A 4DLUA 3NH6A 1AQYA 3CRQA 3H86A 1AZSC 3W34A 3LA6A 3ICQB 5LDDC 1GITA 2IYWA 3CPHA 3MD0A 2OFOA 3AKCA 3QKRA 4FCTA 2IYSA 3UIEA 3K0CA 1BH2A 4Q02A 3WYGA 1IN6A 4II7A 4L9SA 2ZRAA 1AIPA 3K0FA 3X1XA 1GDDA 1SVSA 5G53C 2LWIA 4TYYA 4Q01A 2C5LA 1P2SA 2D62A 3RS2A 4DB2A 1JEEA 3CIOA 1N5JA 3DKVA 4QGHA 2GCNA 4BFYA 3GLFE 3ZVNA 3MFYA 2RGXA 4KSCA 4UNPA 3PCRB 3K70D 5J4KA 4MKIA 3P32A 4WA7A 4YMSA 3TK1A 4BZPA 3L8ZA 3OF5A 1J8MF 1NKTA 4ZKDA 1LS6A 5DI3B 1FFHA 4TT3D 5IDVA 1KK2A 1YR9A 3MSXA 5FI1B 4LJ7A 3GLFB 1Z0JA 1E99A 5BYJA 5GJWC 3A8TA 2WWIA 5CYOA 4Q48A 1OIWA 4ZCMA 1GILA 1K8RA 5DGXA 4B3XA 4B3GA 4LRSA 5F9HA 1X37A 2ATXA 1C1KA 1G7CA 3BFXA 3WYAA 2DB3A 3FOZA 2CVFA 2YNMA 1P61B 1BO6A 4XTRA 4WOPA 3RS3A 5DI3A 4W7SA 1UEJA 3DPUA 3GLFA 3CZQA 2YYZA 3H1TA 2QBYB 1RRPA 4HLQB 3GJXC 1Z22A 2CHVA 2PEZA 1W2HA 3LQRA 4PC6A 3JVVA 2CL7X 3DKPA 2ZRFA 2KWIA 2IC5A 2C9YA 1ONBA 4TQAA 1TEXA 2X2EA 1TPZA 3I4LA 1SQ5A 2FF7A 3QUSA 4D6PA 2ZVPX 2PCLA 2VP4A 3X1WA 5KSOA 1GOTA 5AJYA 4F93B 4W5WA 2A9KA 2IF2A 3DM9B 4Q7KA 4KODA 1E96A 4AKEA 1DAFA 1E79D 2QBYA 2VHTA 4IEIA 4W5JA 1ZNXA 3SYLA 2J0QA 4X8MA 1ZUNB 2D2FA 4PQFA 3P4YA 3NBFA 4ASUD 4G0NA 4X8LA 4LRWA 3TMKA 3B7GA 3TSZA 2IK8A 1MO4A 4YMVA 2Q3FA 4OHXA 2VQSA 2E9SA 1FW6A 1U99A 3C8UA 3NEJA 3EC1A 3L8YA 5J40A 2QGNA 1HUQA 3WBJA 1NNEA 3B9QA 3R8CA 3RRYA 5EXTA 4PHHA 3FHTA 1JQLB 1Z0AA 2VHCA 2AN9A 4BQSA 2KRKA 5HZKA 2H18A 1NL3A 1IN4A 1E9CA 1W4BA 2TMKA 1NIJA 1NJGA 1DO2A 2G0TA 2P2LA 2V6IA 4HYYA 5C4MA 4P4SB 3NBXX 3B5JA 3T5GA 5M04A 1N0UA 2ZITA 1DS6A 5EXSA 1XJQA 4G5GA 4LYJA 4MYTA 4DLRA 1T6NA 1P7CA 1ZC4A 1ZD9A 4F4JA 1AM4D 1RIFA 4FWHA 1KNXA 3ADDA 1VTKA 2BM1A 2WJVA 5FUVA 3AP1A 2YC4C 1A2BA 1KI7A 1R5BA 2ZS7A 4HATA 2NQ2C 3IBGA 2QNRA 3TVTA 3DMDA 2FZLA 1II8B 4DLYA 2W6JD 2ZUDA 4OI2A 4QG7A 4FW9A 4JSTA 2DYKA 2WHXA 4A0HA 4C0LA 1E2MA 3AVPA 3VU9B 3R7WB 2OUKA 1KHTA 4OQMA 4PSAA 3RC8A 2HF9A 2VTKA 4B74A 1KJYA 1FTNA 2QUZA 2B7CA 3THWB 3DMNA 2ZRPA 3ZZUA 2ANCA 4B6EA 2NO7A 3TSOA 3WP0A 1UKVY 1KGDA 4B76A 1II8A 1XMSA 1OXTA 1XCGB 4JKIA 1NI3A 2CXXA 2DWOA 2XSZD 2AXPA 2HJVA 3QXSA 4JBYA 4NYJQ 1Q20A 2KI5A 3R7WA 3VU9A 4U7DA 4U02A 1AS3A 2ZR7A 3ZZ0A 4AG5A 1CJUC 2K5UA 3ECCA 4HZIA 4JLVA 4OQXA 4A2WA 3WMGA 1ESNA 2C03A 3CH5A 3RYTC 1W0KA 3VQTA 1XTRA 1OH6A 4KXFB 2G83A 3A1UA 5JZVA 1U8AA 4PTLA 4MA4A 1JPJA 3AVOA 3PEYA 2O0KA 1X8JA 2WWGA 2Z6VA 3K9HA 4QC2A 2OBNA 1NLYA 3TR5A 2FZ4A 2IYUA 4EQ6B 2AR7A 3U7GA 4DUGD 2A5GA 3Q5DA 4EDHA 2G9NA 2OBLA 3THXB 4DDTA 2C2HA 1DAMA 1AA9A 1X3SA 1ZD1A 3EW9A 4K81B 3SJAA 2JA1A 1C4OA 4CDGA 4RCZA 1OH5A 4YDHB 1CJMA 1MV5A 1UADA 3SZRA 3OIUA 1PJRA 4I99A 1SGWA 2RMKA 4IOJA 1RYHA 3SU8A 1FPMA 2WVJA 2OG2A 2CEAA 1WXQA 5E3HA 5JJLA 1KY2A 5H1YA 3KQNA 2BBWA 4DHEA 3AF4A 2HDNB 2PZGA 1TMKA 3AB3A 1Z2AA 1ZU4A 3DHWC 3W5IA 1DARA 1P5ZB 1WA5A 1UAAA 3THXA 4Q9KA 2QROA 2VRWA 3SBEA 2JLUA 5HPYB 4TMTA 4H1UA 3G82C 1G6OA 5EUMA 3FVQA 2GAAA 3RWMB 1KKMA 2H57A 4RD0A 3T15A 3FFAA 2J45A 3UK6A 2A5FA 2W83A 4P0TA 2GZAA 1ZRHA 2IUUA 3PJRA 4KFSA 3A4LA 4IW3B 2QAJA 4DC9A 1RRFA 5FUXA 2BJWA 3GPLA 1MRNA 1N5LA 2FDCA 2GEDA 2I1VB 3LBHA 2YWGA 4TTRA 4XJXA 5KYKA 4O2RA 5FUYA 3WY9A 4AIIA 3UPUA 4M1KA 1R0ZA 2ZI3A 4FMBB 1XTSA 2D2EA 1L2TA 2ZJ8A 3NXSA 2OO7A 2YWFA 2ZJYA 1G16A 4D26A 3EIHA 4KVGA 2BBSA 2YZ2A 2V8OA 4JJKA 1XZPA 2H92A 4JLOA 4GZLA 2ZPTX 4M1MA 2YC2C 5SZIA 1SXJC 5SZJA 1GVNB 4B48A 1LB1B 2DBYA 3KL4A 3KUDA 4IFEA 1G8HA 1KI4A 2ZSBA 4WW0A 5FTKA 4OBEA 4UXJA 4FWDA 3B1YA 2IXEA 3TW4A 3C16C 3FMOB 1ZBDA 4BFVA 4YMUA 1XCMA 3I5YA 3DEFA 2CK3D 2OSBA 3BH7A 5H70A 2CDNA 4BPBA 4WXPA 4GP6A 1SXJB 2ZYVX 3KXLA 1QVRA 2XB2A 4QJ3A 4OHWA 1Q3HA 1YZGA 1N5IA 1KZGB 4Z1MA 1DAIA 3DVLA 4JLAA 2QRZA 1ETUA 2ZJ2A 5JECA 3AF2A 1NN0A 1F2TA 3IKJA 1U2RA 3M1IA 2PMDA 2XNSA 3L2OB 1A7JA 3VR6A 3B6EA 1YE8A 2ZRCA 3IEUA 1DG1G 1NBME 1PLKA 3K9LA 4ABYA 4V0MA 1Q0UA 5FPHA 4HDOB 2Q6TA 3THYB 1UFQA 3IGFA 2GCPA 1U81A 3IIJA 3Q3JB 3Q7PA 4RKEA 3AF0A 3DO6A 4I1VA 1WRBA 621PA 3OAAA 1P2VA 1P9NA 4D82A 1IONA 5H8WA 1SZPA 4QNMA 4AI6A 2WWXA 1MO3A 4LYHA 4D4LA 1IN7A 4TLAA 3U3KA 3MMPA 4N3NA 1X1RA 2F9LA 4JLBA 3THYA 5UKDA 3ZIAD 1GRNA 3KQHA 4TL8A 3ZVRA 4XVRA 2DPXA 1HEIA 3CO5A 2VA8A 3I92A 2W58A 3VMFA 1PV4A 1NSFA 3QG5A 2N46A 3QSYA 2Z5FA 3F3YA 4NYIQ 3BB4A 2W2TA 1F2UA 4UNSA 4DEYA 3LBIA 1W47A 4B3FX 4YMTA 4WAUA 4TYWA 2MSCB 2NPIA 2XEXA 3FKQA 4PXAA 1TAGA 1ZNWA 4DIDA 5CB6A 4CEHB 4AD8A 1FNMA 3CF0A 2O8BB 3P26A 4QRHA 3RSOA 1NRJB 4E5UA 5D3QA 1E98A 2F7SA 2IBMA 1YZNA 2R44A 3TUZC 5DYIA 1BS1A 1AZTA 4RD2A 5FL3A 1U0LA 3W8NA 2IX3A 5IK2A 1QZMA 4LI0A 3OEHA 3CRMA 4MGZR 4G5SA 4YONB 1Z6YA 3IHLA 3VNUA 1WF3A 2W6ID 1JXMA 4BFTA 2P5SA 4DLSA 2O8BA 2IS6A 4W5HA 2HF8A 1OKKA 3EA0A 4Q1DA 1ZMXA 4M2LA 3WRXC 2REOA 4QBIA 1Q1ZA 1S0UA 2CLCX 2HYDA 2QMEA 4G5QA 4OK3A 5JBQA 4EFNA 3B60A 221PA 2J9RA 2ZAMA 5DH9A 3QBTA 3IQXA 1R0YA 3SQWA 3FB4A 4YC7A 1W5TA 5EXPA 1GSIA 2PEYA 4HUTA 1O87A 2FEOA 2QGZA 2O8DB 4OI4A 3QVVA 4MH0R 2Q9BA 4NHOA 3SJBA 2XX3A 2X1VA 3BGWA 2ZI7A 2AKYA 1DE0A 1RZ3A 1E32A 2XB4A 4OKSA 4B32A 1CR1A 2NIPA 5KPJA 3KQLA 2ZANA 1MT0A 4E07A 2D74A 3IO5A 1F6BA 5A4JA 1P6XA 2AWNA 3B1WA 1QBKC 3PVSA 1EFCA 4Q4JA 2QI9C 3HDTA 3I61A 1E4YA 3V00A 3C15C 4RD1A 3QNUA 2PT5A 1AQUA 1G8FA 3FHCB 5CK4A 3IO3A 1KDRA 5J5CA 3TVDA 2ZI6A 1IXZA 2RB4A 1R10A 3REFA 3E5HA 1K5DA 5AR1A 3UWOA 5FTMA 1H8HA 1WB9A 2CNWD 4QM6A 2GZDA 5FR1A 4JS0A 1OJLA 1XEWX 1Z0KA 3E70C 3NHBA 4MGIR 1E1RD 5HE8A 1OT3A 4RFSB 1DG3A 1FX0A 2A5JA 1YVDA 2XJ4A 3AKEA 3RRMA 2WJYA 5BYKA 3GP8A 2C98A 2D4HA 1OXVA 3TLXA 4NPHA 4XVQA 2W0MA 3L82B 2CJWB 4N0EA 2OXRA 2QU8A 1EGAA 3S1AB 4GPTA 4QM7A 2DZOB 2GTPA 4YXWA 4XVUA 2CBZA 3FKSD 2QG6A 4LJ6A 3K0EA 3W6OA 1KI3A 4EAQA 4KITB 2R6CA 3QBVA 1DBSA 5J47A 2BMFA 1S96A 1H65A 3TQCA 1OH8A 3D8BA 5K8TA 1E0KA 2F1IA 1NVWQ 5EP2A 5F2EA 4RFSA 4Z8XA 3U3OA 1TF2A 4RKFA 3OE7D 1KDTA 3QKSB 1NMYA 3OEED 4B35A 4DBLC 2ANBA 1X6VA 3AUYA 2CJWA 5KNCA 3ND9A 3ZVMA 2FSGA 3S1AA 4C0HA 2P6UA 1US8B 3LDAA 3AP3A 1U94A 4QBGB 4CT4B 4Q9JA 821PA 4NCHA 3QPVA 1W7AA 2J87A 4URYR 3SDZA 1GL6A 1G4UR 1S1MA 2B92A 3VR3A 5GADl 3KKQA 3RDPA 1OV4A 1WQ1R 4OHYA 2B7BA 4IJMA 3IBYA 3Q9LA 4TSFA 5DN6A 3U4QB 4JT2A 4CVNA 1GRQA 3QKSA 1P9WA 4M1WA 1CJTC 5G41A 4BLTA 2XNDD 3N70A 3TUJC 2F1JA 2PLFA 1E0SA 2ZJBA 3CNLA 1US8A 1MOZA 1GNRA 1S4QA 5TXGA 1VHTA 4JIMA 2FX3A 2CE2X 2RGBA 3AF1A 4XD7D 4O0MA 4IVRA 1H8ED 3C5CA 4WIAA 4B73A 2VPPA 4IOKA 1OYYA 1L4UA 3U4QA 1G3MA 4Q7LA 4KU4A 1J2JA 2D3WA 5KHOC 1FL9A 1S2MA 5B30A 2ORVA 1E2FA 4GMXA 4JT4A 4PAQA 3VHXA 3U7FB 2QP4A 4Q00A 1EX7A 2OXCA 4E09A 1KI2A 2I1QA 4R2HA 1T4GA 5G40A 4URVR 1G8YA 4DDWA 4GOKA 3REGA 4B44A 2AKAB 2PH1A 4ZDIA 1OF1A 1LW7A 3IDQA 3EA5A
chains in the Genus database with same CATH superfamily
2D5LA 1M8PA 2L82A 5HKBA 1VCNA 5EJEA 4Q05A 1VGRA 3V4ZA 4KR6A 3FNIA 3IP8A 3MUFA 3RAEC 4LAFA 2P2NA 1ZMVA 1BQ4A 4GW3A 2W90A 4YMIA 2C2KA 2UZ3A 3UH0A 5KB3A 3H1AA 3LPLA 1OXMA 4YPOA 1JA9A 4HAXA 2UUAM 1SK8A 2HUPA 5HTKA 2P91A 2QM8A 3P0JA 1XB2B 3BIXA 4WZ6A 3HYCA 1QZZA 2J7KA 4AC9A 4Z3KA 4TUYF 3A4VA 2EFJA 2YUIA 4O4IB 4B5LA 2JH3A 1C7JA 1VYHA 1KZYC 5L3SB 5ADUS 2QQ5A 3L8GA 3B3FA 2JLWA 4PLHA 3ISJA 4RJLA 3CR7A 4M87A 1XEWY 2A4KA 4YCBA 3ON5A 4B71A 1V45E 2L18A 3HXKA 3KKPA 4WQMA 3WWYA 1O94D 4X61A 2JASA 2F67A 1P7YA 3LC0A 1L6IA 3DMTC 4UATA 1E2EA 4QJ5A 4RYDA 5ESDA 4ND8B 1P7PA 3DNPA 1SELA 1LVUA 4XLLA 1ABEA 3OY2A 4ZO4A 3GA7A 4N8SA 1FNCA 3TRIA 1XLUA 1PDVA 5EUQB 1T34A 3I62A 3LHDA 1NWCA 1U8ZA 3MIZA 4ZWNA 2NMVA 4ISCA 3WWPA 2I8AA 3E5NA 3NWPA 4G1FA 4NWIA 2O1WA 2BKUA 4EYQA 1G20B 4HH0A 5IUKC 4X1YB 1ZJ6A 4P08A 4Y28F 3J7AS 3DVAA 1QFZA 1FRFS 2PUGA 1HYQA 3SK0A 3WIBA 4JL5A 3EDMA 5ALQA 4BLCA 3X44A 2DFKB 5A0FA 3HM9A 1R5NA 4RF5A 3OCUA 2FF5A 2APLA 2NNWB 3I2KA 3KB6A 5EZSA 1M2WA 5K51A 1LGYA 4IDAA 3V9AA 1XXHB 1OR8A 1DJQA 1T3LA 3LWNA 4IV8A 2V54A 3LWBA 3K5IA 1E3TA 1AB5A 1PFUA 4C0QC 4A0SA 2ECOA 4DVJA 1E3EA 2C94A 5LNK1 2FKAA 2WAXA 3NG1A 4G1UC 3P52A 1XVTA 2A9JA 2UUBM 2G88A 2IXAA 5BMVB 3K6SA 2YS7A 4YR7A 4CTMA 5ICFA 4LHSA 2L42A 1FP7A 1ZA1A 4OYRA 3SAWA 2GN9A 4Y2VA 4HSEA 4ZTBA 3H0EA 3HB4X 3K7EA 1Y1LA 2CZQA 2NO4A 4HN2A 1WHTA 4RTNA 5L8VA 2PX5A 1F0NA 3OBIA 3PNBA 5DNDA 1EBUA 5K0BA 1FFGA 3DL4A 2ZEJA 1SC9A 2Y71A 3SHOA 4YAUA 2ZUVA 4F46A 3TRFA 4EVRA 3OM8A 5LQMA 4DLWA 5CA0B 5LWQA 4YRBA 3GFBA 3TLGA 1ZMOA 3TLKA 3JXEA 4ND3A 1JI3A 1M2EA 2FEKA 3EZLA 4Q24A 1KYXA 1X92A 4UM7A 1SUCA 1WXHA 4BFZA 1DHRA 1QU2A 1AKNA 3AW9A 5FFMA 1UM8A 2WE8A 2PGNA 4YP1A 1RP7A 2HO4A 1A8SA 3RSCA 3FZQA 4BDTA 4ARVA 3C14C 4X20A 4ZQCB 3KC2A 4MUAA 1WMSA 4HBGA 2I6UA 2NXJA 5CEEA 4GMQA 3T4PA 2RGNA 1QIEA 2LUOA 4RF4A 4Z4GA 4HBZA 5BUZA 4X85A 1JAIA 4X6UA 4PS0A 4ZTZB 4DV4M 2VYFA 3GFTA 2H1LA 1XTIA 3FYSA 2A1IA 3V80A 4KVAA 3TCXB 3BSSA 5C4GB 6YASA 4NFHA 4F38A 1N8KA 3U39A 3HPQA 4KGXA 2DCUA 4LJ8A 4IDEA 1YRHA 3V32A 3C7DB 3A3NA 3AR8A 2JH9A 2KNAA 3BN3A 1CS4C 1KA9H 3D8UA 3E22A 3I30X 1CF2O 2NU8B 4CM8A 3V9PA 4F21A 3DMPA 3UKJA 1G59A 4B2LA 5TPZA 4MUFA 4ZT4A 2EHDA 2JJ8A 4F5ZA 4UUAA 5K4HA 2G7ZA 1ST2A 3F49S 4ZICA 3IAM1 5ECDA 4GRIA 1ZITA 3DE0X 1XT6A 2XNDA 3UB2A 1K82A 4YRKA 3L4KA 3UV6A 4EO4A 1GEEA 5A2QS 1UP4A 2XGNA 3HBJA 2GBIA 1B43A 2AXNA 3U4CA 1S9HA 2VN8A 1PR9A 4MDFA 1Z62A 4LGCA 4UEKA 5I7OA 5I5EA 1DEOA 3SX0A 3NAMA 3ZV6A 1JQ5A 4UBIA 2WV7A 2A0FA 1OAOA 4M9QA 2SECE 3GJTA 2ZRHA 4MUJA 1QDLB 4MLPA 3S2IA 3CZ4A 1A76A 2EG5A 4G8CA 3T5DA 6REQB 4S1NA 2QVLA 3CXRA 3JD3A 4DCCA 3M6IA 2A5DA 1EHCA 3DJYA 4Q7JA 1P60A 1YCDA 2Q45A 5FBZA 1E3MA 3ND8A 4MKZA 2NLOA 3FJYA 1Q7RA 4DBVO 4ZO7A 3AYXB 2E18A 1QQ5A 4G1MB 4L8RC 1Z5CA 3BG5A 3SJCA 2ZUBA 4OJYA 2FQ1A 4HO1X 4PIMA 1MG0A 2DAPA 1V5WA 3YASA 1J5EM 2Z83A 1LDMA 4A8JB 4POAA 4EGFA 1EDOA 2GCIA 1YZFA 3LXRA 3O2JA 1QR6A 2V7GA 3JALB 3STWA 4NNJA 2G9RA 2R4UA 3SY8A 1RC8A 2CLMB 1CETA 4FR2A 4HXFB 3E9RA 3AVYA 4QA9A 3BDAA 1HZZC 4HNQA 3IRUA 3WJ2A 5IASA 4RMIA 1LXCA 4X8HA 3KEQA 2VG8A 4UAGA 3O90A 3USZA 2QZZA 4CLEA 3FMIA 1WP4A 3KKZA 4PY2A 2DXIA 4A03A 3A3KA 3OX2A 3LUGA 4LYYA 3M6LA 1O6GA 5JSUA 3K30A 2CMKA 5DF1A 3W3ZB 1LDBA 2BZ0A 3LIPA 4OPMA 3Q7QA 2AL7A 5FXMA 5L3QA 4RSHA 3MNFA 4CIZA 1LPBB 4DT1B 4E2ZA 3RS9A 3FI9A 5SY9A 3UXHA 1P3DA 2XIJA 5JCZA 3GJ3A 1B6RA 1HSZA 2BGNA 3LKVA 1DIGA 4LJSA 4MUBA 4HPXB 5D3MA 2YVAA 1ZD4A 1G291 2P65A 5FTLA 2XYRA 4UU1A 2WNSA 4C2BA 4MQEA 4TQUS 4HD8A 2JGIA 1P31A 4NYJR 1J0EA 3KQQA 4P7JA 1TU3A 4TWJA 2G06A 2HU5A 1QUFA 1GPKA 2BMVA 3TPZA 1GGKA 1F7UA 5HS6A 3VKVA 721PA 1N1GA 3CFYA 5EL0A 1GKUB 1HWYA 3I9V6 1RVV1 5JD6A 2FCAA 1G5TA 4N48A 1I2ZA 3RCBA 3CNEA 4D3ZA 4JOSA 4Z0NA 1NY6A 1ENOA 4LWPA 4HVLA 3PDJA 2HIHA 2OYRA 3PFBA 4RZUA 1I7SB 4RKQA 3M8KA 4H6XA 4LVOA 1B6GA 1D0IA 1YBHA 1K89A 1JU4A 3G0OA 3CX6A 3OZIA 4JR1A 1MQAA 3DL0A 1B00A 1OI7A 4I5IA 1LF5A 3WSVA 1R12A 4EW1A 1GUFA 2R62A 1HYGA 4ACBA 1D2NA 1ZRMA 3HWX1 3ED1A 2JHCA 1NVTA 2NAFA 4RS4A 1FTQA 1VJTA 1ZA2A 3K2BA 3T7JA 3OHSX 1U63A 3J7TA 5IKXA 2C2BA 1PNQA 5DO9A 4PZZA 5HWSA 2JRLA 3LQ2A 3UMMA 1YMVA 13PKA 2GO1A 2J7OA 1O4VA 2J3KA 2AW3A 4V1CI 3QVTA 1RWBA 4U2EA 2GXQA 3PDHA 3I45A 4A91A 1H0SA 2GK3A 1NBMA 4LRQA 4DBGB 3C6KA 4TROA 4GSYA 3HNRA 2NUTA 5I3ZA 3AL0C 3AIMA 2RGEA 1M6VB 2IP2A 1XJ0A 4MGYR 1SULA 1KY3A 2C7OA 3OFND 1NP7A 4GYKA 3FCUB 1FS6A 4MROA 1OH7A 4R0VA 5SZHB 2JFPA 3P0IA 2XF3A 3U37A 1HR0M 2OMEA 2PZMA 2O54A 3G9QA 2UVPA 4OHCA 3F67A 2DWCA 5MFZA 4QHTA 5LA6F 4NQZA 1S7CA 2L2QA 3PG5A 3DKRA 2D1SA 3FZEA 4IL5A 3GXBA 4ENSA 5D3ZA 1OA1A 1FYVA 3DW3X 3FLBA 4Y98A 4FZ5A 1A9YA 3L6RA 4PGGA 4ZPJA 1GTL1 4KDRA 2BEKA 5DX8A 3TAUA 1U3FA 2V45A 4ETNA 3X2FA 1TF7A 2ZYUX 1D1SA 3P71T 4ND5A 3RLIA 1QH1A 3MJFA 2AFRA 5J1TB 1VP3A 4HLCA 2ZJ3A 1GNQA 2H4ZA 3FJ1A 1X7XB 4PCUA 2ARKA 3W6PA 4Y0VA 3IT1A 2UYCA 3J81k 2ZQ5A 4KTVE 5JDIA 1JWLA 2RHTA 1YJCA 2QENA 5HJ7A 4NEHB 4M4SA 3PUVA 1WD7A 3IXLA 3EAQA 3K53A 4YV7A 3DVQX 2CLHB 3FCSB 2JZNA 4HH4A 1P4GA 1VCIA 3PZBA 3MIIA 4TSFD 3AERB 3CMMA 5L8RF 1QGAA 2QZPA 1GEGA 3H9QA 2PLWA 4AW4A 5B58T 3I2HA 2FEAA 2ONJA 1N34B 4Z9AA 3JQCA 3TIFA 3ZI4A 2I4TA 3EPHA 2Z6QA 1E2LA 4ZCPA 3WK8A 4BE7B 2QJOA 4ZDWA 4BFSA 2QRKA 4EB3A 2H7CA 3GLGA 1Z7YA 1OGYA 3KYBA 2PUEA 5AUNB 1O89A 3BXOA 2O8CA 3EIQA 2YJ3A 3FNQA 3I4CA 4CMJA 3L5OA 2DFNA 2B2CA 3K0CC 1GKKA 4DLAA 4OU7A 3RGPA 2RC6A 3CR8A 3JYLA 3ZDDA 5EWMA 3OX4A 1IU9A 1FA9A 5PNTA 4JYBA 3L84A 3RE8A 5K0ZA 2H8GA 2V7UA 5I9SA 2O7SA 5TF4A 3D7KA 3KSMA 4PYLA 4ZU6X 4I08A 2WSFF 1N5JA 3COWA 3F8WA 5CAEB 2HA6A 3K70D 4YMSA 1X70A 3WGLA 5BRNA 3EDYA 1ZL2A 5IN5A 4N41A 2BDUA 4IBCA 1QG0A 3M34A 4X9XA 1E8NA 1KFVA 5K4AA 1FRNA 1BO6A 3E9CA 3L18A 2D7EA 1TDZA 4AXXA 4LGYA 1Y81A 4NSOB 1S4MA 3IECA 5MHTA 1BCSA 1V26A 4H7IA 4MK4A 3IMEA 1KDVA 1DAFA 3SYLA 5ITVA 4ED9A 3EFOB 3EG9B 4G0NA 4F2DA 4WKOA 4DM4A 3E2PA 2VHYA 2VQSA 3F1LA 1VEJA 1E4EB 1OD6A 3LUKA 1Y1QA 2ZITA 5EXSA 4NMHA 1T6NA 1JH9A 1MXFA 3OZTA 1HDGO 2INGX 2NQ2C 2IHZA 4KDCA 3TVTA 1VLLA 3AU9A 5CURA 3EVGA 2H5IA 4FW9A 3PF9A 2ZWIA 2Z8YM 3NUQA 1JXQA 2DHDA 1KJYA 1YCGA 1WMEA 1WW8A 3DMNA 1RI2A 2ANCA 4B6EA 3WP0A 2G1PA 3FIJA 3SZUA 4U7DA 1AG9A 2Z9BA 5JH7A 1XTRA 4K86A 1EX1A 4L6V6 4AMGA 1B76A 4UHBA 2OMKA 4F3CA 3T95A 1NLYA 2I2DA 3PHJA 4AJNA 4KXYA 3Q5DA 4IXTA 2F8SA 1EZZA 4DDTA 2LD4A 2CHUA 1RYHA 4PNZA 1FPMA 1IJKA 2FYTA 4A1OA 1KY2A 5KINB 5JU6A 3DONA 2IPAB 3PIIA 3RU2A 4F71A 4URHA 1QNLA 4G5FA 5HPYB 4B6JA 1XR3A 4EITA 2OB2A 2I22A 4TXHA 4TTSA 2P0YA 3LXUX 3WGZA 4KFSA 4IW3B 3FHLA 1N75A 2GEDA 2A9OA 2P8SA 3JYNA 5JO0A 1L2TA 3NXSA 3ZJ5A 1N2OA 1UDAA 1KBZA 3H8SA 4WZBB 2PU7A 2ZPTX 5SZIA 3NTVA 2WUEA 1VCHA 4O6VA 4CT0A 1ZBDA 4L76A 1L4LA 5E6JA 2OSBA 4J6EA 1Q3HA 5GWXA 1N5IA 3ZHBA 3DVLA 2GTIA 1F2TA 1T25A 1OZAA 3B6EA 1BHO1 4EUSA 4KPGA 4ENTA 4ABYA 4HDOB 3Q7PA 3LL4A 4UM9D 1TB4A 1C1DA 3UQYS 2VJNA 2PUAA 1WHSB 1FVHA 3UH1A 2DPYA 2PWYA 2QGFA 3VMFA 2PKRA 4L57A 1YDMA 4DEYA 3AL3A 4BX8A 3HJAA 3K0HA 2XEXA 4LJLA 1TAGA 5E9WA 4FWBA 1PO7A 1CUJA 3W8NA 1GQOA 1K8YB 3TXXA 4DLSA 3KK0A 4DMKA 1ZMXA 4EFKA 4G5QA 1JHPA 2KMLA 2W2PA 3PJFA 5E3IA 4DV0M 1GSIA 4C03A 5AYVA 4XGQA 1V8PA 3STTA 4B32A 3P94A 3K1ZA 3KLBA 3PNQA 5A4JA 3W5VA 2QX4A 4GXTA 1ZJ5A 1AQUA 3Q9NA 4KYTA 1FJXA 1ODTC 3WZLA 1Z0KA 2OGWA 4RV9A 2Z57A 4G63A 4FDAA 2OQ2A 4Z4FA 3IR7A 4PLZA 1FX0A 1IBSA 1YVDA 2QWXA 4XVHA 4NV0A 2WVAA 4NPHA 4XVQA 3TZLA 1VI2A 2D7JA 2R4EA 2Z8YA 5ALJA 3QBVA 1DBSA 1PI3A 1KARA 5A5DA 1CQJA 2AG5A 1I6LA 5JMWA 4PGAA 3CX3A 3ZDYB 1Q3CA 1E62A 2EQAA 2NVUA 5IAJA 3IKTA 4IJMA 4BB9A 5DOZA 4FC7A 4JFRA 4MRMA 1AC5A 1JT9A 2BSAA 3SLRA 3UT5A 3CNLA 4BXOB 2I4MA 3U7QA 4XPIB 2H1WA 3AMVA 1WAMA 5B30A 1R9GA 1F6DA 5IMSA 3BXPA 1OAOC 3QKIA 1U0TA 3USCS 2NU9A 1SA0A 5GPBA 3M3PA 4O25A 3EA5A 1IBKM 5DP1A 5FOWA 4DA0A 3RYIA 4S1TA 2KJQA 4XEUA 2EDAA 4RHUA 4IRMA 3Q40A 5HDQA 4QGSA 3DAGA 2LTAA 2HL6A 4JC4A 2WYHA 4BUJA 2RHGB 3HYRA 1K7SN 4LSWA 3HR7A 1KDZA 1F38A 3VH2A 1ID1A 2E48A 3OM9A 1Z63A 3BIOA 2UUCM 5ARBA 1T5BA 5HJ2A 1MF7A 5EJMA 1ZR4A 2JK0A 3U6DA 2FHSA 4IHJF 1TQ6A 1Y89A 1DQSA 4QGAA 4PG4A 1K3XA 3GRRA 5WRFA 2X3UA 1WU7A 3GJYA 3NTUA 2PZ8A 3G2LA 1PVVA 1YL6A 4I55F 5DLQC 3AVUA 1LTQA 1KFKB 2QUHA 4NY1A 4BMZA 5JAOA 1WSDA 2J67A 1S8OA 2DBRA 1R0CA 1NDUA 4RTJA 3IBSA 4PQYA 4UUBA 5AK3A 2XHEA 2CXPA 3FI0A 3IBTA 3MGGA 4LY6A 4PC1A 3SBJA 4BJ3A 2FUG1 1NVVQ 2HCFA 5ALTA 2OV3A 2IYLD 3LK6A 5B1YA 5B12A 2BUCA 1F9AA 1P5JA 4EFMA 2CKMA 4MR8A 1FQKA 3DMTA 3DTVB 2BP7B 4ILKA 1IOVA 2V6JA 1JG4A 4KKVA 2FZ5A 3HJNA 4G6ZA 2P1DA 1L2CA 3RRZA 1R6AA 3ZQUA 5L4SA 4M0WA 1IHUA 3HVHA 3VYTB 3BHJA 5FLYA 3R23A 1E94E 1TNDA 3TD6A 2XAUA 1M3SA 3TECE 2YV2A 1Z5PA 1KQPA 3M6WA 1KK0A 1Q0ZA 4DIFA 3PPIA 2R66A 3G8YA 2ZRNA 4FOSA 3BZUA 4U4AA 4R9UC 4R05A 2VDJA 3A4IA 1X9HA 4CU2A 4WEQA 2MSKA 3CVYA 5CBPB 3PGKA 3TAHA 1BMTA 3VYRB 2VZ0A 2RB5A 1FK8A 4LYGA 1BKDR 4C4RA 5G0VA 1UKEA 4N0PA 5BV7A 1E7QA 3DFUA 1AKUA 2BFWA 4K0KB 4KMOA 2OHGA 4TZTA 3HO1A 2QV0A 1NLUA 1OLXB 3UT6A 4CMAA 3LY9A 1TT5B 1CNFA 1P45A 3QF4B 2PL1A 3P0FA 3DMYA 4CCYB 4I50A 4FDTA 4HVTA 3FUTA 4QGFA 2PGDA 3WWZA 5F5NA 1T1EA 2L7IA 2IH4A 2P35A 1SQSA 2JI7A 4HGPA 3NNSA 1ORHA 1XZNA 3TXAA 4E5YA 3F5FA 2H9IA 4UVDA 1LZKA 1PJQA 4FVTA 4CM5A 2X0FA 3SZLA 2OP1A 4FPXA 1EM8A 5H59A 3MJHA 1NMXA 3G23A 2IUTA 4OK5A 1C9EA 3T7RA 1KQNA 4ZDJA 2XMGA 4UUNA 3ABQB 1B8UA 4G97A 5HEKA 3BRWD 4ZIRB 1G64A 1Q1GA 4OMCA 4AXBA 4GBED 3HFGA 5HVNA 5IULC 4G5XA 2RI0A 1VYUA 5CHYA 1BOFA 1J70A 1WUKS 1F06A 3LHKA 3FPJA 1D0MA 5IVDA 1H23A 4WP2A 3LDHA 3M9LA 2JGDB 1CUUA 5E38A 2ZJ7A 5A3JA 1DADA 3EH1A 1UKZA 4RLHA 1XX6A 1QYIA 4LMBA 1SUEA 2I0FA 3IPYA 3E9ZA 2QTLA 1X1AA 1D6MA 4RGQA 3TW8A 4QTTB 1EUCB 1RHQA 2GM3A 1LW6E 1ZGHA 2FB9A 4I36A 4OH7A 4RQUA 5FWYA 3HZJA 4BFLA 2WAYA 5AUQA 4JNKA 1U90A 4ZA2A 5LBUA 1TEZA 3BMOB 3FTFA 1XRQA 1UT5A 1VGQA 2EA0A 1ZVQA 4LF9M 2XQVA 5CXXA 2E4AA 5JDIC 1T3GA 5IBCA 1PYOA 4P3XA 5HNKA 4QYSA 2OD9A 1V11A 3JQ8A 4NICA 4AICA 4MA0A 1H8HD 3GGPA 2G63A 3UUFA 3CJTA 3AQ4A 3M6XA 4IRUB 4LJ4A 4F0JA 5BSFA 1KTIA 3TEMA 3E48A 1RXVA 2RHDA 2RHRA 1J49A 3NXKA 1LLFA 3FB1A 1V8BA 3H17A 3DE4X 4BE9A 1NXVA 5DGIA 1QG2A 4JVSB 1PHRA 1S3GA 3DZHA 3R5FA 4YS6A 1MDBA 1HY3A 4TMWA 3AY3A 1OBVA 3JATA 4BUCA 3S2UA 3PUHA 1XRPA 3H87A 2EBWA 4Z0PA 4OF4A 2ZJZA 3PP8A 1R6DA 4UAVA 3AHEA 4EPXA 4XX0A 1IY9A 2YDXA 1LTHR 1CYDA 5AVUA 2JGJA 4LMRA 2DNAA 3LRXA 2D2IA 4BNHA 5CVTA 1Z83A 2VHVA 4TRMA 4OJMX 2W22A 1I4LD 2E37A 1COWD 1F4IA 2WB4A 4UEQA 4B3HA 3UMFA 3ZUPA 4HRXA 2HCBA 3MBKA 4M60A 1V6SA 5LC1A 3U6SA 4HX9A 3DBOB 2BCGY 2I4IA 3LJKA 1WULS 5PGMA 4NU8X 1EE9A 1DWQA 1GU7A 2ZBGA 5LKAA 1T91A 4LZAA 4RJKA 1LDYA 1J90A 3L0CA 4G81A 2JBAA 3A6JA 3VPAA 4D4MA 2BEUB 2Y8EA 2Q3HA 4IVPA 5C8DA 3FPAA 4LV5B 3M82A 1G5PA 4WBNB 4C5AA 1E79A 1NN5A 4QJ4A 3I5MA 2J08A 1NVVR 1D6JA 4NU6A 3A6KA 4HFNA 4G4SP 5DEIA 4ZQFA 3B8HA 4OLAA 1VPLA 2GEVA 1A5BB 3WLMA 3HUFA 4AJOA 1SZCA 5AMXA 3MFQA 1YS1X 2PSSA 4GMDA 5A4FS 1EESA 1HJPA 1D6NA 1FXWA 1LI7A 4O2AF 1USVA 2VDVE 2WOJA 4I1PA 3PHIA 5DN9A 3BXEA 3V1YA 4DR5B 2XEPA 4EMSA 1X0VA 1FS4A 5GONF 4EECA 3JQGB 3IESA 4WKBA 4LPKA 4D9IA 4EOGA 3D7MA 2CP8A 2ZKIA 1ADBA 1WXDA 4XJTA 3WIOA 3CCCA 3QFFA 2VF2A 1TFUA 4MCIA 5A9SB 1MV8A 2PMWB 1DSSG 1P0PA 3E2MA 4IH4A 1DBWA 3OLWA 4OH1A 3JRWA 4X94A 3IR5A 1U4OA 4HWKA 4JXXA 3PFGA 4CGZA 5D5PA 3DDNA 3CX8A 1ZQ9A 4JGIA 1S2GA 3NHPA 2R6DA 4LTNA 3UXEA 4LRTA 2GNPA 4B3MM 5CDSA 1FFDA 5BXQC 2G70A 1Q44A 1KC3A 4BFUA 2BMAA 3M1LA 3B8EA 4LW8A 3TSCA 3GY0A 3R4VA 1U7UA 1FFSA 1XQ9A 3DOOA 10MHA 4PCAA 5LNK6 2GNAA 2HO5A 2H59A 4WXHA 2AN1A 3J81S 3LBNA 4GOXA 2X7XA 1HDZA 2IV3A 3FZNA 2FSFA 3DDZX 3QSGA 3WKAA 4QQFA 4FCWA 3OT1A 4JHXA 5LZ2A 2ECKA 4BNIA 4QRDA 3ZOZA 4R0NA 4G5OA 2YQ5A 2FK8A 2RK3A 2OZLA 1KJWA 2QAGA 4PYJA 1Z2NX 4I9UA 1UBMS 1UXIA 2Q6LA 3L40A 1R00A 4CLRB 3LPDA 4LOIA 5ALGA 1YDGA 1SXJD 1BDHA 3ZE0B 3ME5A 3KSUA 1SQGA 1PSDA 4PLTA 3AI1A 2C0CA 4A7PA 1MQ8B 3LVRE 2A3NA 4PFQA 3DYVA 1XZHA 4P4GA 2G09A 2QN3A 3DOFA 4DMUB 1AA6A 1AN0A 1IWBB 5L3ZA 5JEDA 3F9RA 1JV2B 1YJQA 3QHPA 3L8FA 3ZDBA 5E7IA 2A5YB 1ZONA 1TGYA 4K7JA 3I6ZA 1QHEA 4MYCA 5FWAA 2C9ZA 3TQOA 3B53X 4A8HA 5KU1A 1L4NA 2PQ0A 3SKYA 3BEDA 2GEJA 2HA0A 5CDTA 2R8XA 4P22A 2PO7A 4CR6A 1HRKA 1VLHA 2EKQA 4U2CA 4GPBA 4QO7A 5DHTA 4DYHA 4RXUA 2B4TO 4X63A 1WSWA 1IRIA 1G5HA 4L5BA 1RYMA 2H5EA 3U60A 4KI0A 5GGYA 2YOFA 1GJTA 2WIBA 2PY6A 3FCCA 2NTJA 3TBHA 1F8FA 1Z5WA 3KQYA 3D3WB 1NN1A 1X1DA 2Q9AA 2PL9A 4PHFA 3H04A 1PWZA 3KR2A 4J7XA 3QYFA 1ZKMA 4C6HA 4YR9A 1UM9A 4HQOA 3F90A 4RJTA 5EUCA 4MVJM 4KVFA 3ENVA 2QVGA 1ZIOA 1P2BA 5ES3A 1SC1A 1ISSA 1CCWA 2CVPA 4JUCA 4LYFA 3RU7A 3FDIA 1XNRM 3PL1A 2GBFA 5DN6D 1Y7PA 2QRGA 3G9TA 3C8DA 3HA7A 3OIYA 2N0SA 3K1AB 3KB1A 5LB4A 3DNFA 2GPSA 3L6BA 1E6UA 1NPYA 1XL1A 5LPNA 1OYWA 1NBIA 4ER6A 4S24A 4OQZA 5KVCA 4BNUA 2L69A 4PG5A 3EQ8A 1FNDA 1BZYA 1E3QA 2ZTLA 4POOA 4IJ5A 3URKA 1A9TA 4OO3A 4NHEA 2ZCVA 4IH9A 2C2MA 3S40A 2GVNA 4ML3A 5EE3A 3MINA 3GLIE 4RTRA 3VJLA 1GY8A 2G9VA 3PDIB 1BYIA 3VHLB 4JU8A 5FJIA 3EJWA 2VT7A 2Y6VA 4FDLA 5FUMA 3T7SA 2JLSA 5KTTA 2ETXA 1MRSA 1R4MB 1AGNA 1ZM9A 4F9FA 2QZSA 5TB5A 4MIOA 2NUAA 5HE9A 4GMHA 1VOTA 5KI6A 3K0CA 1BH2A 4Q02A 4UAUA 5D5QA 2K9DA 3TM4A 3A9RA 1D2GA 5AI9A 1TAUA 3KOZE 1CRLA 1UXOA 4WACA 5J4KA 3BVPA 1RRKA 4FEEA 5LQAA 1X0XA 3VPHA 3DMGA 2LHCA 4ZCMA 4RVHA 4MXDA 2V6FA 4UUMA 4DR3B 2VQEM 1UBNA 2G5PA 1JEAA 4RPLA 2W42A 2MINA 3H1TA 1GG5A 3WGGA 4UBJA 1WDLA 1DC5A 2RJNA 4FK8A 2LTUA 4YBRA 5J3JA 4MAMA 1BE1A 4W5JA 3BWBA 4B3IA 3G2KA 3P4YA 2MHCA 8MHTA 1Y6ZA 4XQ9A 2BFFB 5EXTA 2YS6A 4WK4B 1VPDA 1BX1A 1KIAA 3B5JA 5IFKA 4NDAA 2H1FA 5SYMA 5LQRA 2ZIFA 1D4FA 4JYAB 5FUVA 1Z68A 3HHPA 1KOGA 1A2BA 3GEBA 1VKOA 1NMSA 2YYYA 3U7JA 4EW6A 4HRAA 4G4JA 2P6PA 3NUGA 5JS1A 1OC2A 3D3JA 4NYJQ 2KI5A 4U02A 1ABFA 4OX9M 1DOHA 3QYBA 1U6JA 4O4JB 1ESNA 1B8VA 4B80A 2BFDA 3FCXA 3RFTA 4QUBA 1U8AA 3VH4A 1WPQA 1QQTA 5ENZA 1GTJ1 1NU6A 4MVJA 5AVQA 4I4NA 5BR4A 4D4KA 4Z7QB 5KMGA 3I9KA 4C0WA 5TR9A 3UJPA 1PJRA 1XA3A 1J21A 2RMKA 3GEMA 4J3JA 3AB3A 4XASA 1UAAA 3CUKA 2M5ZA 4AO7A 3G82C 1G6OA 5M2QA 5KYUB 2FPSA 2EGHA 4IIVA 4P0TA 2X4GA 4NXNM 3ZE1B 1EJ6A 3CUUA 1ZVMA 2XI4A 5DBFA 4L2IB 3MRXA 2I9PA 1A71A 3ZJTA 4U5QA 4IXWA 3BREA 3DZIA 4EI8A 1YQUA 3FWPA 1YNSA 3A2KA 2GN0A 2QX7A 3T7KA 2CK3D 2ZDQA 3PD0A 1QVRA 1I33A 5ALSA 1DAIA 1K75A 1NN0A 1VE1A 2DAMA 1FLAA 2XNSA 2C3OA 3DAHA 5IYZA 2E49A 1NOKA 4BEWA 1J1ZA 1QE5A 2WWXA 1UK6A 4HJXA 4IX1A 4TLAA 3U3KA 1UODA 3RSGA 3CZCA 2F9LA 3H9UA 3CG4A 4E46A 3F3YA 2B82A 2FR8A 2A1TS 4UNSA 5DLYA 1G98A 1DL5A 3CXUA 3DFFA 1GL3A 4CM9D 1EXVA 4ZO8A 3ZWKA 3RSOA 2BTEA 1WXFA 4JOCA 3ZWQA 2I76A 4H0NA 5BXYA 1Z7WA 3IHLA 3OI7A 3HGMA 3R44A 2GHTA 3G7UA 3JD0A 3UPDA 2GLTA 4C05A 1VMDA 1SU4A 4LFAB 3NJ4A 3N8DA 1N9KA 1NW7A 2E4ZA 2FEOA 1RJFA 1XK6A 3MELA 2P9JA 3CIFA 4Y6GB 5C5IA 4A16A 5EHGA 3OHPA 1PTJA 2ZJ4A 3JQQA 2I80A 4EJ6A 2ON6A 1DGBA 3MUNA 2XCQA 4V3BA 2HMSA 3JRNA 3UMVA 2BGKA 1LDNA 2JIBA 3ZUGA 3MYRA 3FHCB 4WNAA 4ZT5A 4GZ3A 3NHBA 2O2SA 5BYKA 1U1IA 1ORTA 2SKEA 3L82B 3IPLA 3V6MA 4KWTA 4KITB 2R6CA 4S0XA 1PZMA 1UFRA 1LBSA 3OE7D 2ODAA 2CFIA 3AUYA 4BEVA 3Q8WA 3OFSA 4D5GA 1WB6A 2QSFX 2P69A 3GPYA 5GADl 1U7ZA 2V7XA 1THZA 1R27A 5BOSB 3N8HA 3V97A 3BICA 4FYYA 2L4EA 3PLNA 1N2GA 5K3FA 1H8ED 4KYVA 4BKQA 3QFHA 4B73A 4ZP1A 3N0XA 1S2MA 3ZWVA 3OFKA 1EX7A 2OXCA 2XKBA 1PJ2A 3IDZA 4E3WA 3OECA 5G40A 2DR2A 4F2WA 2W2NA 5D86A 2ILVA 1RAHA 1NX9A 3FOWA 3PT5A 1U0FA 2WPDD 4IGIA 3O94A 3UJ3X 4GF5A 1M8GA 4FBLA 2A9FA 4MDHA 1LFAA 3NHKA 1E63A 3E8SA 1PFKA 1T9BA 2VQ6A 2CMGA 1ORWA 1DGFA 2XRZA 2JDIA 1H6CA 4KOEC 2C84A 1DELA 4JIGA 3ZGNA 5CRIA 2RSLA 2JFYA 3JQ6A 2ZIZA 1N2CA 4F1JA 2EWVA 2COUA 1ND5A 2GZ3A 2ZXUA 1PAUA 1MXHA 2ZULA 5EIBD 4C78A 3M1YA 3NDIA 3P9NA 4Q9IA 2JHFA 3LW7A 4QTUB 1EM6A 3OVMA 1XP5A 4C43A 4TV9B 1FDTA 1KR2A 3R7BA 4J91A 2JGKA 2VSXA 3L4JA 4CWAA 1GO2A 3O8QA 3ETLA 3E27A 1JXOA 4Q66C 2NQTA 4ZQGA 1EP2B 2ODPA 4C7VA 3I4VA 3AFGA 4OHUA 3U3ZA 3DDWA 1DJOA 5JC8A 3PV0A 5G1PA 4QDTA 3VH1A 2KPOA 3B3JA 4O4LB 4KK4A 2ZSDA 1YK0A 3FWZA 1TQ4A 4I9FA 8ATCA 5A06A 4NCBA 5A2GA 3EDRA 4JI2B 1RHKA 2ZI4A 4W1SA 2OHHA 3V7FA 5JZMA 1YIOA 4GG1A 3DF9A 2P4HX 1G19A 4URXR 3C5EA 1DEAA 2J3HA 3MTJA 1BWSA 3FHOA 3JZFA 4AW9A 4L15A 1YBVA 4IXMA 5DBGA 3DVAB 1EEHA 4LDAA 4DDHA 4A3VB 2IZ0A 2AJLI 3AEQA 5AVYA 3C39A 2C7RA 2R8EA 4OVZA 4NYMQ 2XB8A 5EGSA 2BGGA 4O63O 4D9JA 4GZ5A 2B5OA 3ADCA 3D6NB 3NHSA 3EOBI 1JAYA 2Q5QA 4N3GA 4HNTA 4AL4A 4O4HF 1T35A 3BJMA 2FPKA 1LPNA 3PCXA 3RUIA 2O4UX 4NTZA 2BTQA 1J0BA 3J80S 4F4IA 2X7JA 3AILA 1RWNA 1DAOA 3G3EA 1UINA 2OESA 5IEJA 4KRYA 1X8KA 3S44A 4BC0A 4MKGA 3H1EA 1SVIA 2AUNA 4GUDA 3K6SB 3Q87B 4Q7MB 1CLUA 3I42A 1Y63A 4M55A 1CZUA 4CG2A 4YIKA 1VGVA 3IYLW 3T5AA 4H9GA 3TTXA 4PO8A 2QAGC 4R98A 3Q8XA 4QJIA 1Q5PA 3R9WA 1USIA 1WHTB 4H15A 5K3AA 2EBHX 1G17A 1XEFA 4M8IA 2YV3A 1RPZA 3M3DA 3JAWA 4B7AA 4J0QA 3HU2A 3N2IA 4B4VA 3JY6A 1MEEA 5AK0A 3H1PA 5K8JB 4XJSA 1SUPA 1CWUA 1E1NA 2QJWA 4DZZA 4P32A 5LMCA 3TLGB 2W37A 1L2DA 3BFJA 4L16A 1HOXA 2AYZA 4RABA 1MNAA 1DNPA 1HV8A 1KO7A 2FWBA 2C5FA 1V6CA 1EWKA 1WLSA 1RLJA 3T35A 3CMCO 2O3JA 4X20B 4HTFB 1UBSB 5TMDA 2DPHA 1RXEA 2R0QC 4P7GA 4D9KA 4AJKA 2IE8A 2VDPB 3EPRA 2BFCA 3R5SA 1S3SA 4DUZB 3PE6A 2J5KA 4UASA 2VP3A 3KD2A 5TLSA 1N8TA 4H0FA 1OBFO 4KPYA 2MYUA 2JJ2A 4FI3C 2I1LA 4I9HA 4QUHA 4FSHA 5CT8A 4GECA 2XJ9A 1P1RA 4NXMM 1QJCA 1OXSC 3PU6A 3RC3A 4DJFC 3FOCA 1OTHA 4YP6A 1JYFA 3TZQA 1ONPA 5AI0A 3VOAA 2XA9A 4MKFA 4A4DA 1KP3A 1I7DA 2PQ6A 3E22B 5BV8A 2GPWA 2O8DA 5FP0A 4CM8B 1MAHA 1XQXA 1L1QA 3ZYCA 4IIJF 1EWYA 3RVRA 1GCOA 2MIIA 1ZZGA 1A77A 4A0RA 2D4AA 3QQ5A 5IVIA 1KEPA 3KBBA 4MA5A 3CEHA 1ZGAA 1U7WA 3PRKE 4LF5M 1A4XA 4MWOA 1X7GA 3PEWA 4G1CA 3M81A 4TL7A 1DZ3A 1F8XA 1MNQA 5IAOA 3U7EB 2J4FA 2QJTA 3QXHA 3OPNA 3G0DA 2PRJA 4UHJA 5FQOA 4AIRA 4TMFA 2C4KA 4H3KB 3PJEA 5DNUA 421PA 2VF8A 4Q4CA 2WIAA 1C1HA 1SUIA 1CEEA 4N0QA 4Q9AA 5C1IA 1EBFA 3MRVA 1C8LA 2FPGA 1R0XA 1UBRS 1UBTS 1LPSA 2G9ZA 2FFBA 4ZAFA