2OOAA

Crystal structure of the uba domain from cbl-b ubiquitin ligase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
VDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ooaA00
1E94E 2BWBA 3FRIA 1OAIA 2JY5A 1XB2B 2DENA 3IECA 1V92A 3GLHE 1OKSA 2JUJA 2JY6B 1TTEA 2K9DA 1WHCA 4HEOA 3GLFE 2DAGA 3K9PA 1DO2A 1VG5A 1GO5A 2LBCA 1PGYA 1WGLA 1Y8GA 1OQYA 1VDLA 3K9OA 3LCVB 1HT1E 3E21A 3F92A 1KYIA 1VEJA 1HQYE 2DKLA 4R71A 1MN3A 1ZMUA 2LVQD 1CUKA 4WP2A 1BVSA 1ZMVA 3FRHA 4Q7JA 4F1IA 1C7YA 1YLAA 1R4GA 2H5XA 1SG9A 3E46A 2RRUA 2DAEA 2BWEA 1HT2E 1G3IA 2DHYA 2JNHA 4DBGB 1WR1B 3T6PA 4GEWA 3H4JA 1AIPC 1T43A 1DV0A 2LVOC 2L4EA 2OOAA 1VQ1A 2EJSA 1IM2A 2L4FA 2QSFX 2JZ0A 1WIVA 1EFUB 2EKFA 2JP7A 2DAIA 2MR9A 2DI0A 1A5TA 1Q02A 1HJPA 2HWJA 3BBZA 2QHOB 2MROB 2L2DA 2LVPC 2JZ1A 3MMPA 3GLGE 2DAKA 2QNJA 1IFYA 2LVAA 1WGNA 1P3QQ 1UFZA 2CWBA 1WJ7A 3IHPA 2HAKA 2JY7A 2LVNC 2ZTDA 1VEGA 2DNAA 2MJ5B 1XXHE 2DZLA 2WZJA 2KNZA 1DO0A 3LCUA 1ZMWA 5JI2E 2EKKA 5DFLA 2KNAA 2CP8A 2K0BX 2KNVA 3GLIE 1QZEA 2DAMA 2JY8A 1F4IA 1OTRA 2MGWA 2LTUA 4G3OA 2ZTCA 1NV9A 1IXSA 4UN2B 2B3TA 3B89A 3FE3A 2O25A 1ZV1A 1NV8A 2R0IA 1TR8A 2OO9A 1G41A 2KHHA 1T6OA 2G3QA 4F2LA 1VEKA 2OOBA 1JR3E 1G4AE
chains in the Genus database with same CATH superfamily
4CISA 3L26A 3FD9A 3QAUA 3V76A 1WXQA 4M0DA 3IG8A 1J7KA 2JY5A 4HLQA 4LJAA 1J5EM 2DENA 4DV2M 1PJIA 2YNMD 3GQ5A 3Q8XA 3J81S 1SXJE 4LG2A 4Y28F 4R3DA 3J7AS 2EA0A 1D0MA 2DHRA 2DXIA 4I5SA 3HHXA 2HL7A 3FUXA 3ZCBB 1NJFA 3THGA 1EIJA 4LCBA 5KO3A 2C9OA 4DV7M 3ILKA 2LBCA 1WGLA 3HHWA 4ANRA 1KFVA 2RGHA 4D81A 1W5TA 4LGYA 5FTNA 3E21A 2CHGA 3F92A 4M9SA 4FWGA 1J09A 1VEJA 3NWLA 1L2BA 3MHVC 3SAVA 2A5YB 3GPXA 4R71A 4KO8A 4LJ8A 2LWXA 3UGJA 1ZMVA 2D7GA 2Z4SA 4M0WA 4G4QA 3GRYA 2WSFF 3SHGB 3KSJA 3A98B 3HJ8A 2VQEM 3U6SA 3LVWA 4GIPA 4JXJA 3SASA 4JI1M 4Z6YA 1YLAA 4IBKA 3E46A 5IT9S 1R7RA 3AOGA 1KSFX 2JWSA 4IIWA 4DV3M 1PJSA 4NRVA 4LFAM 4DBGB 4DR7M 3J7BA 4AW4A 2LVOC 4L15A 3U6DA 1OIZA 4BLCA 2L6OA 2CHVA 3GRUA 4LJ9A 2R6FA 1NNUC 4IBDA 4MGYE 2JZ0A 3U61B 3VDUA 3T1HM 1G8PA 4IBFA 4DR6M 2KA6B 3B74A 3TE6A 2UXCM 3LW5F 2KRKA 3KOYE 4OVZB 2MR9A 2C96A 1IXRC 5ITYA 4MGKE 3TWMA 1A5TA 3LVVA 4GITA 4GMQA 1HNXM 1HJPA 2LHCA 3BBZA 4JI3M 2RGOA 2MROB 4FVMA 2MH8A 2L2DA 2LVPC 5A2QS 3U6CA 1PJJA 2V6ZM 3SARA 3B7QA 3EIHA 4GKJM 1NO1A 3TWLA 3DOAA 4ITQA 3UMMA 5C18A 3I4VA 1Q3BA 1WGNA 3LMMA 3PVSA 2XZUA 2R65A 2G8LA 2F5PA 3ZH9B 3IG5A 4EIWA 3HWSA 3LQRA 3I4YA 3HZJA 3J27B 1RU3A 1L2CA 1IY2A 2G5GX 2XFSA 4GC5A 3GLIB 3GLFB 2DZOB 3NBIA 1T3TA 1G59A 3LCUA 1GABA 1NY6A 4CHTB 4D80A 4RF0A 4LRTA 1DGFA 2D7EA 1IN7A 3CF0A 2DAMA 2O01F 1TGUA 1NY5A 2XSZD 3RFWA 4G3OA 4X64M 1OIPA 4FW9A 5EP4A 4WW0A 4UN2B 4DV5M 4JV5M 2B3TA 3UZUA 5ITXE 4LJ7A 4AKHA 1K3WA 2OO9A 3L27A 2KHHA 3K92A 1SXJB 2XEPA 4F2LA 4I8OA 2OOBA 2XGNA 3GP1A 2QBYB 1JR3E 3LQQA 1G4AE 4L78A 3MK6A 4DV1M 2BWBA 3R9XB 3KSXA 1IN8A 5C1BA 2HCBA 3VFDA 3W68A 1V92A 5FLXS 2NQ8C 3GLHE 2CV2A 1SXJC 1OKSA 2X49A 5EXPA 3VKHA 1HR0M 4FWHA 1D0KA 5JI3E 1HNWM 4HEOA 4LZJA 3GLFE 1GO5A 1QVRA 1PGYA 1Y8GA 5FTKA 4X62M 4JI6M 4NRWA 3LCVB 2XH9A 2YFQA 2F4VM 2CHQA 1N33M 1PM5A 2JXNA 2KZSA 4QHTA 4Z8XA 1GLNA 3KFUG 4QNRA 1HQYE 3M6AA 2Y21A 3C58A 1MN3A 1ZMUA 4WP2A 4PDIA 3GLGB 4WURA 3J80S 3AKZA 4OU7A 4LF7M 3HU2A 1IN5A 4JN6A 2DVWB 3FRHA 4X65M 3FKEA 4Q7JA 2Y0TA 1R2ZA 4LRSA 3AL0C 2QZ4A 3C3DA 3Q8GA 4RNAA 3PXGA 4DR4M 2H5XA 4JI8M 4RKUF 4MH0E 3ZQJA 5IWAM 2BWEA 3CF2A 1HT2E 1G3IA 1PJQA 2CRUA 1TDHA 3KOWE 1E32A 2DHYA 2FOIC 3I51A 1DGHB 3B7ZA 3T6PA 3H4JA 2LXEA 1QDRA 3KP0E 3CGWA 2F5SA 1XNQM 2OOAA 3HU1A 2CE7A 4FCTA 4JI7M 1IM2A 2L4FA 2Z7JA 5FTJA 1L2DA 2QPAA 2C9CA 4GHAA 2F5QA 1WIVA 4XBOA 1EFUB 2E5LM 4JI5M 2JP7A 2LHGA 3B9PA 5BR8M 2WSEF 3U6EA 2DWMA 4MGHA 1MJGM 4IBGA 5KPTA 1QANA 1NJGA 4L8RC 3U6QA 3GQ3A 3FTCA 4P17A 1IBKM 4AKGA 1XC8A 2VF8A 4LFCM 3GLGE 3FTEA 4IBBA 3HHYA 3VDPA 3JR5A 2LVAA 2FH0A 4DR5M 4M9XA 5L8RF 2UXBM 3KW6A 4DR1M 4NOOB 3AJIB 1NSFA 2CWBA 3FUUA 3FUVA 3H4MA 1HQCA 5EXSA 3IHPA 3PNYA 4IBCA 2M5ZA 1OFIA 4LF6M 4NSOB 1TH2A 1YUBA 3KOZE 1VEGA 2HKJA 4KODA 3W0LB 2DNAA 2MJ5B 4PD2A 4B3MM 3FUTA 2Z4RA 2DZLA 1N36M 3UK6A 1IXSB 3I04M 1GL7A 3SFZA 5DFLA 4I4LA 3W0FA 2KNAA 3KS4A 4QOSA 4DV4M 2QQ8A 5F3WA 1R2YA 1LV7A 1N77A 2N35A 2HHHM 4JI2M 3HJQA 1QZEA 3TPZA 2APLA 5KPRA 4MM3B 3GLIA 3T15A 2F5NA 3GLFA 1F4IA 2ZTCA 1Q39A 1NV9A 2X4AA 2VQFM 2ZAOA 1TH4A 3FTFA 2KEBA 3FE3A 4GH9A 1GVNA 2BNKA 4RF1A 3W67A 1Z5AA 2O25A 1ZV1A 1NV8A 3AOEC 1TR8A 2M60A 2KZUA 1T6OA 3GLHB 1L1ZA 2JA2A 2J7NA 3BOSA 3HX3A 1K82A 3K9PA 4LF9M 1QUTA 1E94E 4CGYB 4DV6M 4B3RM 3FRIA 4YY3M 1OAIA 1XB2B 3IECA 1TDZA 3HGIA 5BPVA 4BBAA 4LZZA 3GPUA 4II7A 2LNHC 2D7HA 4IBEA 4B7HA 3A46A 3U6PA 1NVMA 3KP1E 1SXJA 4B08A 4JYAM 2Z3XA 2QBYA 2KDLA 1V34A 4GC9A 1GKIA 1QZMA 5EQTA 4B7FA 2KRUA 4GRIA 2DAGA 4L6V6 1VG5A 3U60A 3U5ZB 2C99A 1OQYA 1VDLA 3K9OA 3D8LA 1GJTA 1SXJD 1Z5BA 1HT1E 3AFHA 4LF5M 1IY1A 2CFOA 4NXMM 4IJFA 1QYRA 3J2PB 1VDDA 4BB9A 4DV0M 2Y20A 3L29A 8CATA 1BVSA 1QDTA 4B3SM 1ZAEA 2ZBKB 1HNZM 4XK8F 4LY6A 1XMOM 4F1IA 1XHBA 1QAQA 1TH3A 1Z59A 2WSCF 3GRVA 1SG9A 5FSWA 2RRUA 5H37D 1H6UA 4ZPXA 1K3XA 4G6ZA 2UUCM 3GRRA 1L1TA 2JNHA 1I4WA 5ITUA 3KDSE 1WR1B 2H1RA 3HU3A 4GEWA 1T43A 4CJ6A 1DV0A 2L4EA 2XLJA 1S3SA 2CUZA 2K6BA 1IBMM 1XXHB 1MX0A 1Z5CA 5GKNA 2EJSA 7CATA 2CV1A 1OJLA 4QOZC 3GPYA 2QSFX 4IBJA 4NL4H 1Q3CA 2R46A 2EKFA 3QYBA 5ITQA 2LH0A 4NSRA 1DGHA 2DAIA 5EP3A 4AG6A 4OX9M 2ZANA 2R44A 1IQPA 3RGPA 1Q02A 3K1JA 4I81A 3UJNA 3L28A 1XMQM 2RKOA 3TL4X 5IREB 2EO2A 2FNAA 2DAKA 2V1UA 1IY0A 3T38A 2VF7A 2CV0A 4GKKM 1P3QQ 2K47A 5LMNM 3D8BA 3AV0A 2UUAM 5LMUM 4CIZA 2V1CA 3SAWA 5KPZA 3SC3A 5E26A 1WJ7A 1YSYA 2QCUA 3E9SA 2KW0A 2UUBM 1FJGM 4K0KM 3TWKA 4AI6A 5FTLA 2JY7A 4M9ZA 3PFIA 3CTWB 3VK8A 3VKGA 2Z8YM 1E9SA 1QAOA 2BJVA 1XXHE 1DO0A 1V33A 3HKPA 3RE8A 3JAMS 5JI2E 4DR3M 2C5RA 2I7PA 1XNRM 2FE8A 3QWLA 4PCZA 3U6OA 3VLFB 2CP8A 2K0BX 2EUCA 2YQZA 2KNVA 4IBIA 4LJ6A 1ZQ9A 4REZA 3U61A 1EE8A 2QP9X 1NNJA 2JY8A 2MGWA 2LTUA 4P16A 2XZFA 3DA1A 1IXSA 4OVZA 2R45A 5FTMA 2XFTA 3B89A 4R7GA 2I7NA 2VIIA 4JI4M 1GJSA 2DWNA 2UXDM 4NC6A 1N75A 2CEAA 5ITXA 3AOEA 1QQWA 2G3QA 4A3VB 2AHMA 4AZFA 1XWIA 3U6MA 4L4UA 1JR3A 3RGSA 5EJCA 4YHHM 2ERCA 3I01M 2F5OA 3DFZA 3M7GA 4LFBM 2GQFA 2JUJA 2JY6B 4HL4A 4AG5A 1TTEA 2K9DA 1WHCA 3GLHA 3KOXE 2VDBB 3ZC7B 2L7HA 4S12A 2R18A 1JR3D 1OFHA 4LF8M 4TUWA 3GPPA 2P5TA 1DO2A 5EP2A 1I94M 4LGMA 3K2LA 2O5RA 4PT5A 2X8AA 3SAUA 3K8ZA 2J5YA 1KYIA 2Q2EB 3QYEA 4AKIA 1Z6TA 3A42A 2YR0A 3R8FA 4L16A 5KQDA 2DKLA 4KT0F 2LVQD 1CUKA 1MU5A 3U5ZA 3OTOM 1R5LA 3DZDA 5DYIA 2BJWA 1QUSA 4W5WA 3WHKA 4MGIE 1C7YA 1NHGC 4AQYM 1R4GA 4DUZM 2DAEA 3HHZA 1ORYB 3B7NA 5EXTA 4PDGA 3SBJA 4OW0A 3HY5A 1UM8A 1X37A 2QENA 1AIPC 2UU9M 2XF3A 1AUAA 1PJTA 1LTMA 1N78A 3SYLA 1VQ1A 1IXZA 4FD2A 2Y0QA 3A45A 1PRBA 2C98A 3PNVA 1L8QA 4GHLA 1TF0B 3SMSA 3JR4A 2XSZA 4MB7A 1D0LA 2FS1A 2KXEA 3KXEC 3SMPA 3CF6E 1XXHA 2DI0A 3NBXX 2W82A 4FCVA 4QNMA 1QAMA 1E9RA 4QHSA 4G4OA 1G71A 1IN4A 1JQJC 2HWJA 4KLNA 2QHOB 1JB0F 3C3EA 2OPFA 2JZ1A 3MMPA 4FWDA 3MJ5A 1OAOC 4MGZE 3KVWA 3U6LA 4LF4M 2QNJA 4LJ5A 3GLGA 2ZM6M 4B7GA 5DYGA 1IFYA 2R62A 4JI0M 3BXWA 3L2AA 2DWZB 1UFZA 1DGBA 3FYDA 3SHFA 5ITTA 3C9PA 3TQSA 2R4EA 2HAKA 3T1YM 3GO8A 2R4JA 1DGGA 1GL6A 2LVNC 2ZAMA 2ZTDA 3FYCA 3E4RA 1D2NA 3FTDA 4DUYM 3U60B 1IN6A 4G4RA 2WZJA 4DR2M 3EIEA 2KNZA 1R6BX 5DNYA 3GQ4A 3VK7A 1ZMWA 3KS8A 4B3TM 1N32M 1C1KA 2EKKA 4NXNM 4X66M 2OQ4A 3FUWA 5EP1A 4G4NA 3GLIE 2DWLA 2GNOA 3SYKA 3SATA 1OTRA 2L09A 2L7IA 4XGIA 3HJSA 1W5SA 4FCWA 4IJEA 4LJ4A 5ITRA 1FNNA 2FFJA 3M0EA 1N34M 1NHWC 5KQ8A 5IZ7D 5EXXA 2DZNB 2J7OA 2R0IA 5E6JA 3L25A 4KHPM 1G41A 4D82A 1VEKA 1IBLM 3WHLA 1YE9A
chains in the Genus database with same CATH topology
1E94E 2BWBA 3FRIA 1OAIA 2JY5A 1XB2B 2DENA 3IECA 1V92A 3GLHE 1OKSA 2JUJA 2JY6B 1TTEA 2K9DA 1WHCA 4HEOA 3GLFE 2DAGA 3K9PA 1DO2A 1VG5A 1GO5A 2LBCA 1PGYA 1WGLA 1Y8GA 1OQYA 1VDLA 3K9OA 3LCVB 1HT1E 3E21A 3F92A 1KYIA 1VEJA 1HQYE 2DKLA 4R71A 1MN3A 1ZMUA 2LVQD 1CUKA 4WP2A 1BVSA 1ZMVA 3FRHA 4Q7JA 4F1IA 1C7YA 1YLAA 1R4GA 2H5XA 1SG9A 3E46A 2RRUA 2DAEA 2BWEA 1HT2E 1G3IA 2DHYA 2JNHA 4DBGB 1WR1B 3T6PA 4GEWA 3H4JA 1AIPC 1T43A 1DV0A 2LVOC 2L4EA 2OOAA 1VQ1A 2EJSA 1IM2A 2L4FA 2QSFX 2JZ0A 1WIVA 1EFUB 2EKFA 2JP7A 2DAIA 2MR9A 2DI0A 1A5TA 1Q02A 1HJPA 2HWJA 3BBZA 2QHOB 2MROB 2L2DA 2LVPC 2JZ1A 3MMPA 3GLGE 2DAKA 2QNJA 1IFYA 2LVAA 1WGNA 1P3QQ 1UFZA 2CWBA 1WJ7A 3IHPA 2HAKA 2JY7A 2LVNC 2ZTDA 1VEGA 2DNAA 2MJ5B 1XXHE 2DZLA 2WZJA 2KNZA 1DO0A 3LCUA 1ZMWA 5JI2E 2EKKA 5DFLA 2KNAA 2CP8A 2K0BX 2KNVA 3GLIE 1QZEA 2DAMA 2JY8A 1F4IA 1OTRA 2MGWA 2LTUA 4G3OA 2ZTCA 1NV9A 1IXSA 4UN2B 2B3TA 3B89A 3FE3A 2O25A 1ZV1A 1NV8A 2R0IA 1TR8A 2OO9A 1G41A 2KHHA 1T6OA 2G3QA 4F2LA 1VEKA 2OOBA 1JR3E 1G4AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E94 E;  2BWB A;  3FRI A;  1OAI A;  2JY5 A;  1XB2 B;  2DEN A;  3IEC A;  1V92 A;  3GLH E;  1OKS A;  2JUJ A;  2JY6 B;  1TTE A;  2K9D A;  1WHC A;  4HEO A;  3GLF E;  2DAG A;  3K9P A;  1DO2 A;  1VG5 A;  1GO5 A;  2LBC A;  1PGY A;  1WGL A;  1Y8G A;  1OQY A;  1VDL A;  3K9O A;  3LCV B;  1HT1 E;  3E21 A;  3F92 A;  1KYI A;  1VEJ A;  1HQY E;  2DKL A;  4R71 A;  1MN3 A;  1ZMU A;  2LVQ D;  1CUK A;  4WP2 A;  1BVS A;  1ZMV A;  3FRH A;  4Q7J A;  4F1I A;  1C7Y A;  1YLA A;  1R4G A;  2H5X A;  1SG9 A;  3E46 A;  2RRU A;  2DAE A;  2BWE A;  1HT2 E;  1G3I A;  2DHY A;  2JNH A;  4DBG B;  1WR1 B;  3T6P A;  4GEW A;  3H4J A;  1AIP C;  1T43 A;  1DV0 A;  2LVO C;  2L4E A;  2OOA A;  1VQ1 A;  2EJS A;  1IM2 A;  2L4F A;  2QSF X;  2JZ0 A;  1WIV A;  1EFU B;  2EKF A;  2JP7 A;  2DAI A;  2MR9 A;  2DI0 A;  1A5T A;  1Q02 A;  1HJP A;  2HWJ A;  3BBZ A;  2QHO B;  2MRO B;  2L2D A;  2LVP C;  2JZ1 A;  3MMP A;  3GLG E;  2DAK A;  2QNJ A;  1IFY A;  2LVA A;  1WGN A;  1P3Q Q;  1UFZ A;  2CWB A;  1WJ7 A;  3IHP A;  2HAK A;  2JY7 A;  2LVN C;  2ZTD A;  1VEG A;  2DNA A;  2MJ5 B;  1XXH E;  2DZL A;  2WZJ A;  2KNZ A;  1DO0 A;  3LCU A;  1ZMW A;  5JI2 E;  2EKK A;  5DFL A;  2KNA A;  2CP8 A;  2K0B X;  2KNV A;  3GLI E;  1QZE A;  2DAM A;  2JY8 A;  1F4I A;  1OTR A;  2MGW A;  2LTU A;  4G3O A;  2ZTC A;  1NV9 A;  1IXS A;  4UN2 B;  2B3T A;  3B89 A;  3FE3 A;  2O25 A;  1ZV1 A;  1NV8 A;  2R0I A;  1TR8 A;  2OO9 A;  1G41 A;  2KHH A;  1T6O A;  2G3Q A;  4F2L A;  1VEK A;  2OOB A;  1JR3 E;  1G4A E; 
#chains in the Genus database with same CATH topology
 4CIS A;  3L26 A;  3FD9 A;  3QAU A;  3V76 A;  1WXQ A;  4M0D A;  3IG8 A;  1J7K A;  2JY5 A;  4HLQ A;  4LJA A;  1J5E M;  2DEN A;  4DV2 M;  1PJI A;  2YNM D;  3GQ5 A;  3Q8X A;  3J81 S;  1SXJ E;  4LG2 A;  4Y28 F;  4R3D A;  3J7A S;  2EA0 A;  1D0M A;  2DHR A;  2DXI A;  4I5S A;  3HHX A;  2HL7 A;  3FUX A;  3ZCB B;  1NJF A;  3THG A;  1EIJ A;  4LCB A;  5KO3 A;  2C9O A;  4DV7 M;  3ILK A;  2LBC A;  1WGL A;  3HHW A;  4ANR A;  1KFV A;  2RGH A;  4D81 A;  1W5T A;  4LGY A;  5FTN A;  3E21 A;  2CHG A;  3F92 A;  4M9S A;  4FWG A;  1J09 A;  1VEJ A;  3NWL A;  1L2B A;  3MHV C;  3SAV A;  2A5Y B;  3GPX A;  4R71 A;  4KO8 A;  4LJ8 A;  2LWX A;  3UGJ A;  1ZMV A;  2D7G A;  2Z4S A;  4M0W A;  4G4Q A;  3GRY A;  2WSF F;  3SHG B;  3KSJ A;  3A98 B;  3HJ8 A;  2VQE M;  3U6S A;  3LVW A;  4GIP A;  4JXJ A;  3SAS A;  4JI1 M;  4Z6Y A;  1YLA A;  4IBK A;  3E46 A;  5IT9 S;  1R7R A;  3AOG A;  1KSF X;  2JWS A;  4IIW A;  4DV3 M;  1PJS A;  4NRV A;  4LFA M;  4DBG B;  4DR7 M;  3J7B A;  4AW4 A;  2LVO C;  4L15 A;  3U6D A;  1OIZ A;  4BLC A;  2L6O A;  2CHV A;  3GRU A;  4LJ9 A;  2R6F A;  1NNU C;  4IBD A;  4MGY E;  2JZ0 A;  3U61 B;  3VDU A;  3T1H M;  1G8P A;  4IBF A;  4DR6 M;  2KA6 B;  3B74 A;  3TE6 A;  2UXC M;  3LW5 F;  2KRK A;  3KOY E;  4OVZ B;  2MR9 A;  2C96 A;  1IXR C;  5ITY A;  4MGK E;  3TWM A;  1A5T A;  3LVV A;  4GIT A;  4GMQ A;  1HNX M;  1HJP A;  2LHC A;  3BBZ A;  4JI3 M;  2RGO A;  2MRO B;  4FVM A;  2MH8 A;  2L2D A;  2LVP C;  5A2Q S;  3U6C A;  1PJJ A;  2V6Z M;  3SAR A;  3B7Q A;  3EIH A;  4GKJ M;  1NO1 A;  3TWL A;  3DOA A;  4ITQ A;  3UMM A;  5C18 A;  3I4V A;  1Q3B A;  1WGN A;  3LMM A;  3PVS A;  2XZU A;  2R65 A;  2G8L A;  2F5P A;  3ZH9 B;  3IG5 A;  4EIW A;  3HWS A;  3LQR A;  3I4Y A;  3HZJ A;  3J27 B;  1RU3 A;  1L2C A;  1IY2 A;  2G5G X;  2XFS A;  4GC5 A;  3GLI B;  3GLF B;  2DZO B;  3NBI A;  1T3T A;  1G59 A;  3LCU A;  1GAB A;  1NY6 A;  4CHT B;  4D80 A;  4RF0 A;  4LRT A;  1DGF A;  2D7E A;  1IN7 A;  3CF0 A;  2DAM A;  2O01 F;  1TGU A;  1NY5 A;  2XSZ D;  3RFW A;  4G3O A;  4X64 M;  1OIP A;  4FW9 A;  5EP4 A;  4WW0 A;  4UN2 B;  4DV5 M;  4JV5 M;  2B3T A;  3UZU A;  5ITX E;  4LJ7 A;  4AKH A;  1K3W A;  2OO9 A;  3L27 A;  2KHH A;  3K92 A;  1SXJ B;  2XEP A;  4F2L A;  4I8O A;  2OOB A;  2XGN A;  3GP1 A;  2QBY B;  1JR3 E;  3LQQ A;  1G4A E;  4L78 A;  3MK6 A;  4DV1 M;  2BWB A;  3R9X B;  3KSX A;  1IN8 A;  5C1B A;  2HCB A;  3VFD A;  3W68 A;  1V92 A;  5FLX S;  2NQ8 C;  3GLH E;  2CV2 A;  1SXJ C;  1OKS A;  2X49 A;  5EXP A;  3VKH A;  1HR0 M;  4FWH A;  1D0K A;  5JI3 E;  1HNW M;  4HEO A;  4LZJ A;  3GLF E;  1GO5 A;  1QVR A;  1PGY A;  1Y8G A;  5FTK A;  4X62 M;  4JI6 M;  4NRW A;  3LCV B;  2XH9 A;  2YFQ A;  2F4V M;  2CHQ A;  1N33 M;  1PM5 A;  2JXN A;  2KZS A;  4QHT A;  4Z8X A;  1GLN A;  3KFU G;  4QNR A;  1HQY E;  3M6A A;  2Y21 A;  3C58 A;  1MN3 A;  1ZMU A;  4WP2 A;  4PDI A;  3GLG B;  4WUR A;  3J80 S;  3AKZ A;  4OU7 A;  4LF7 M;  3HU2 A;  1IN5 A;  4JN6 A;  2DVW B;  3FRH A;  4X65 M;  3FKE A;  4Q7J A;  2Y0T A;  1R2Z A;  4LRS A;  3AL0 C;  2QZ4 A;  3C3D A;  3Q8G A;  4RNA A;  3PXG A;  4DR4 M;  2H5X A;  4JI8 M;  4RKU F;  4MH0 E;  3ZQJ A;  5IWA M;  2BWE A;  3CF2 A;  1HT2 E;  1G3I A;  1PJQ A;  2CRU A;  1TDH A;  3KOW E;  1E32 A;  2DHY A;  2FOI C;  3I51 A;  1DGH B;  3B7Z A;  3T6P A;  3H4J A;  2LXE A;  1QDR A;  3KP0 E;  3CGW A;  2F5S A;  1XNQ M;  2OOA A;  3HU1 A;  2CE7 A;  4FCT A;  4JI7 M;  1IM2 A;  2L4F A;  2Z7J A;  5FTJ A;  1L2D A;  2QPA A;  2C9C A;  4GHA A;  2F5Q A;  1WIV A;  4XBO A;  1EFU B;  2E5L M;  4JI5 M;  2JP7 A;  2LHG A;  3B9P A;  5BR8 M;  2WSE F;  3U6E A;  2DWM A;  4MGH A;  1MJG M;  4IBG A;  5KPT A;  1QAN A;  1NJG A;  4L8R C;  3U6Q A;  3GQ3 A;  3FTC A;  4P17 A;  1IBK M;  4AKG A;  1XC8 A;  2VF8 A;  4LFC M;  3GLG E;  3FTE A;  4IBB A;  3HHY A;  3VDP A;  3JR5 A;  2LVA A;  2FH0 A;  4DR5 M;  4M9X A;  5L8R F;  2UXB M;  3KW6 A;  4DR1 M;  4NOO B;  3AJI B;  1NSF A;  2CWB A;  3FUU A;  3FUV A;  3H4M A;  1HQC A;  5EXS A;  3IHP A;  3PNY A;  4IBC A;  2M5Z A;  1OFI A;  4LF6 M;  4NSO B;  1TH2 A;  1YUB A;  3KOZ E;  1VEG A;  2HKJ A;  4KOD A;  3W0L B;  2DNA A;  2MJ5 B;  4PD2 A;  4B3M M;  3FUT A;  2Z4R A;  2DZL A;  1N36 M;  3UK6 A;  1IXS B;  3I04 M;  1GL7 A;  3SFZ A;  5DFL A;  4I4L A;  3W0F A;  2KNA A;  3KS4 A;  4QOS A;  4DV4 M;  2QQ8 A;  5F3W A;  1R2Y A;  1LV7 A;  1N77 A;  2N35 A;  2HHH M;  4JI2 M;  3HJQ A;  1QZE A;  3TPZ A;  2APL A;  5KPR A;  4MM3 B;  3GLI A;  3T15 A;  2F5N A;  3GLF A;  1F4I A;  2ZTC A;  1Q39 A;  1NV9 A;  2X4A A;  2VQF M;  2ZAO A;  1TH4 A;  3FTF A;  2KEB A;  3FE3 A;  4GH9 A;  1GVN A;  2BNK A;  4RF1 A;  3W67 A;  1Z5A A;  2O25 A;  1ZV1 A;  1NV8 A;  3AOE C;  1TR8 A;  2M60 A;  2KZU A;  1T6O A;  3GLH B;  1L1Z A;  2JA2 A;  2J7N A;  3BOS A;  3HX3 A;  1K82 A;  3K9P A;  4LF9 M;  1QUT A;  1E94 E;  4CGY B;  4DV6 M;  4B3R M;  3FRI A;  4YY3 M;  1OAI A;  1XB2 B;  3IEC A;  1TDZ A;  3HGI A;  5BPV A;  4BBA A;  4LZZ A;  3GPU A;  4II7 A;  2LNH C;  2D7H A;  4IBE A;  4B7H A;  3A46 A;  3U6P A;  1NVM A;  3KP1 E;  1SXJ A;  4B08 A;  4JYA M;  2Z3X A;  2QBY A;  2KDL A;  1V34 A;  4GC9 A;  1GKI A;  1QZM A;  5EQT A;  4B7F A;  2KRU A;  4GRI A;  2DAG A;  4L6V 6;  1VG5 A;  3U60 A;  3U5Z B;  2C99 A;  1OQY A;  1VDL A;  3K9O A;  3D8L A;  1GJT A;  1SXJ D;  1Z5B A;  1HT1 E;  3AFH A;  4LF5 M;  1IY1 A;  2CFO A;  4NXM M;  4IJF A;  1QYR A;  3J2P B;  1VDD A;  4BB9 A;  4DV0 M;  2Y20 A;  3L29 A;  8CAT A;  1BVS A;  1QDT A;  4B3S M;  1ZAE A;  2ZBK B;  1HNZ M;  4XK8 F;  4LY6 A;  1XMO M;  4F1I A;  1XHB A;  1QAQ A;  1TH3 A;  1Z59 A;  2WSC F;  3GRV A;  1SG9 A;  5FSW A;  2RRU A;  5H37 D;  1H6U A;  4ZPX A;  1K3X A;  4G6Z A;  2UUC M;  3GRR A;  1L1T A;  2JNH A;  1I4W A;  5ITU A;  3KDS E;  1WR1 B;  2H1R A;  3HU3 A;  4GEW A;  1T43 A;  4CJ6 A;  1DV0 A;  2L4E A;  2XLJ A;  1S3S A;  2CUZ A;  2K6B A;  1IBM M;  1XXH B;  1MX0 A;  1Z5C A;  5GKN A;  2EJS A;  7CAT A;  2CV1 A;  1OJL A;  4QOZ C;  3GPY A;  2QSF X;  4IBJ A;  4NL4 H;  1Q3C A;  2R46 A;  2EKF A;  3QYB A;  5ITQ A;  2LH0 A;  4NSR A;  1DGH A;  2DAI A;  5EP3 A;  4AG6 A;  4OX9 M;  2ZAN A;  2R44 A;  1IQP A;  3RGP A;  1Q02 A;  3K1J A;  4I81 A;  3UJN A;  3L28 A;  1XMQ M;  2RKO A;  3TL4 X;  5IRE B;  2EO2 A;  2FNA A;  2DAK A;  2V1U A;  1IY0 A;  3T38 A;  2VF7 A;  2CV0 A;  4GKK M;  1P3Q Q;  2K47 A;  5LMN M;  3D8B A;  3AV0 A;  2UUA M;  5LMU M;  4CIZ A;  2V1C A;  3SAW A;  5KPZ A;  3SC3 A;  5E26 A;  1WJ7 A;  1YSY A;  2QCU A;  3E9S A;  2KW0 A;  2UUB M;  1FJG M;  4K0K M;  3TWK A;  4AI6 A;  5FTL A;  2JY7 A;  4M9Z A;  3PFI A;  3CTW B;  3VK8 A;  3VKG A;  2Z8Y M;  1E9S A;  1QAO A;  2BJV A;  1XXH E;  1DO0 A;  1V33 A;  3HKP A;  3RE8 A;  3JAM S;  5JI2 E;  4DR3 M;  2C5R A;  2I7P A;  1XNR M;  2FE8 A;  3QWL A;  4PCZ A;  3U6O A;  3VLF B;  2CP8 A;  2K0B X;  2EUC A;  2YQZ A;  2KNV A;  4IBI A;  4LJ6 A;  1ZQ9 A;  4REZ A;  3U61 A;  1EE8 A;  2QP9 X;  1NNJ A;  2JY8 A;  2MGW A;  2LTU A;  4P16 A;  2XZF A;  3DA1 A;  1IXS A;  4OVZ A;  2R45 A;  5FTM A;  2XFT A;  3B89 A;  4R7G A;  2I7N A;  2VII A;  4JI4 M;  1GJS A;  2DWN A;  2UXD M;  4NC6 A;  1N75 A;  2CEA A;  5ITX A;  3AOE A;  1QQW A;  2G3Q A;  4A3V B;  2AHM A;  4AZF A;  1XWI A;  3U6M A;  4L4U A;  1JR3 A;  3RGS A;  5EJC A;  4YHH M;  2ERC A;  3I01 M;  2F5O A;  3DFZ A;  3M7G A;  4LFB M;  2GQF A;  2JUJ A;  2JY6 B;  4HL4 A;  4AG5 A;  1TTE A;  2K9D A;  1WHC A;  3GLH A;  3KOX E;  2VDB B;  3ZC7 B;  2L7H A;  4S12 A;  2R18 A;  1JR3 D;  1OFH A;  4LF8 M;  4TUW A;  3GPP A;  2P5T A;  1DO2 A;  5EP2 A;  1I94 M;  4LGM A;  3K2L A;  2O5R A;  4PT5 A;  2X8A A;  3SAU A;  3K8Z A;  2J5Y A;  1KYI A;  2Q2E B;  3QYE A;  4AKI A;  1Z6T A;  3A42 A;  2YR0 A;  3R8F A;  4L16 A;  5KQD A;  2DKL A;  4KT0 F;  2LVQ D;  1CUK A;  1MU5 A;  3U5Z A;  3OTO M;  1R5L A;  3DZD A;  5DYI A;  2BJW A;  1QUS A;  4W5W A;  3WHK A;  4MGI E;  1C7Y A;  1NHG C;  4AQY M;  1R4G A;  4DUZ M;  2DAE A;  3HHZ A;  1ORY B;  3B7N A;  5EXT A;  4PDG A;  3SBJ A;  4OW0 A;  3HY5 A;  1UM8 A;  1X37 A;  2QEN A;  1AIP C;  2UU9 M;  2XF3 A;  1AUA A;  1PJT A;  1LTM A;  1N78 A;  3SYL A;  1VQ1 A;  1IXZ A;  4FD2 A;  2Y0Q A;  3A45 A;  1PRB A;  2C98 A;  3PNV A;  1L8Q A;  4GHL A;  1TF0 B;  3SMS A;  3JR4 A;  2XSZ A;  4MB7 A;  1D0L A;  2FS1 A;  2KXE A;  3KXE C;  3SMP A;  3CF6 E;  1XXH A;  2DI0 A;  3NBX X;  2W82 A;  4FCV A;  4QNM A;  1QAM A;  1E9R A;  4QHS A;  4G4O A;  1G71 A;  1IN4 A;  1JQJ C;  2HWJ A;  4KLN A;  2QHO B;  1JB0 F;  3C3E A;  2OPF A;  2JZ1 A;  3MMP A;  4FWD A;  3MJ5 A;  1OAO C;  4MGZ E;  3KVW A;  3U6L A;  4LF4 M;  2QNJ A;  4LJ5 A;  3GLG A;  2ZM6 M;  4B7G A;  5DYG A;  1IFY A;  2R62 A;  4JI0 M;  3BXW A;  3L2A A;  2DWZ B;  1UFZ A;  1DGB A;  3FYD A;  3SHF A;  5ITT A;  3C9P A;  3TQS A;  2R4E A;  2HAK A;  3T1Y M;  3GO8 A;  2R4J A;  1DGG A;  1GL6 A;  2LVN C;  2ZAM A;  2ZTD A;  3FYC A;  3E4R A;  1D2N A;  3FTD A;  4DUY M;  3U60 B;  1IN6 A;  4G4R A;  2WZJ A;  4DR2 M;  3EIE A;  2KNZ A;  1R6B X;  5DNY A;  3GQ4 A;  3VK7 A;  1ZMW A;  3KS8 A;  4B3T M;  1N32 M;  1C1K A;  2EKK A;  4NXN M;  4X66 M;  2OQ4 A;  3FUW A;  5EP1 A;  4G4N A;  3GLI E;  2DWL A;  2GNO A;  3SYK A;  3SAT A;  1OTR A;  2L09 A;  2L7I A;  4XGI A;  3HJS A;  1W5S A;  4FCW A;  4IJE A;  4LJ4 A;  5ITR A;  1FNN A;  2FFJ A;  3M0E A;  1N34 M;  1NHW C;  5KQ8 A;  5IZ7 D;  5EXX A;  2DZN B;  2J7O A;  2R0I A;  5E6J A;  3L25 A;  4KHP M;  1G41 A;  4D82 A;  1VEK A;  1IBL M;  3WHL A;  1YE9 A; 
#chains in the Genus database with same CATH homology
 1E94 E;  2BWB A;  3FRI A;  1OAI A;  2JY5 A;  1XB2 B;  2DEN A;  3IEC A;  1V92 A;  3GLH E;  1OKS A;  2JUJ A;  2JY6 B;  1TTE A;  2K9D A;  1WHC A;  4HEO A;  3GLF E;  2DAG A;  3K9P A;  1DO2 A;  1VG5 A;  1GO5 A;  2LBC A;  1PGY A;  1WGL A;  1Y8G A;  1OQY A;  1VDL A;  3K9O A;  3LCV B;  1HT1 E;  3E21 A;  3F92 A;  1KYI A;  1VEJ A;  1HQY E;  2DKL A;  4R71 A;  1MN3 A;  1ZMU A;  2LVQ D;  1CUK A;  4WP2 A;  1BVS A;  1ZMV A;  3FRH A;  4Q7J A;  4F1I A;  1C7Y A;  1YLA A;  1R4G A;  2H5X A;  1SG9 A;  3E46 A;  2RRU A;  2DAE A;  2BWE A;  1HT2 E;  1G3I A;  2DHY A;  2JNH A;  4DBG B;  1WR1 B;  3T6P A;  4GEW A;  3H4J A;  1AIP C;  1T43 A;  1DV0 A;  2LVO C;  2L4E A;  2OOA A;  1VQ1 A;  2EJS A;  1IM2 A;  2L4F A;  2QSF X;  2JZ0 A;  1WIV A;  1EFU B;  2EKF A;  2JP7 A;  2DAI A;  2MR9 A;  2DI0 A;  1A5T A;  1Q02 A;  1HJP A;  2HWJ A;  3BBZ A;  2QHO B;  2MRO B;  2L2D A;  2LVP C;  2JZ1 A;  3MMP A;  3GLG E;  2DAK A;  2QNJ A;  1IFY A;  2LVA A;  1WGN A;  1P3Q Q;  1UFZ A;  2CWB A;  1WJ7 A;  3IHP A;  2HAK A;  2JY7 A;  2LVN C;  2ZTD A;  1VEG A;  2DNA A;  2MJ5 B;  1XXH E;  2DZL A;  2WZJ A;  2KNZ A;  1DO0 A;  3LCU A;  1ZMW A;  5JI2 E;  2EKK A;  5DFL A;  2KNA A;  2CP8 A;  2K0B X;  2KNV A;  3GLI E;  1QZE A;  2DAM A;  2JY8 A;  1F4I A;  1OTR A;  2MGW A;  2LTU A;  4G3O A;  2ZTC A;  1NV9 A;  1IXS A;  4UN2 B;  2B3T A;  3B89 A;  3FE3 A;  2O25 A;  1ZV1 A;  1NV8 A;  2R0I A;  1TR8 A;  2OO9 A;  1G41 A;  2KHH A;  1T6O A;  2G3Q A;  4F2L A;  1VEK A;  2OOB A;  1JR3 E;  1G4A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...