2OOAA

Crystal structure of the uba domain from cbl-b ubiquitin ligase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
VDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ooaA00
1G4AE 3LCUA 2DI0A 1DO0A 4DBGB 2LVQD 1ZMWA 3K9PA 3H4JA 2DHYA 2JP7A 1KYIA 1IM2A 3GLIE 1NV8A 1TTEA 1WIVA 1DO2A 2DAKA 1OQYA 4F2LA 1GO5A 2L4FA 1HJPA 2QHOB 2HWJA 1VQ1A 1WR1B 1MN3A 2LBCA 1WGLA 2ZTCA 2BWBA 2MGWA 2LVPC 1XXHE 2JY5A 2DNAA 3LCVB 2L4EA 2JY8A 3F92A 2DKLA 2HAKA 3E46A 2LTUA 3FE3A 4Q7JA 1VEKA 3IECA 1VDLA 2JNHA 2JY7A 1T43A 2OOBA 2DAMA 2MJ5B 1HT2E 1AIPC 1G41A 1P3QQ 2DENA 3B89A 2JZ0A 1ZV1A 2K0BX 3GLFE 2KNAA 2WZJA 1F4IA 2OOAA 1JR3E 1VG5A 2H5XA 2KNZA 2B3TA 2LVNC 4F1IA 2R0IA 3GLHE 1UFZA 2LVAA 3FRHA 2CP8A 2ZTDA 1VEJA 3K9OA 1IXSA 1WGNA 1HQYE 1QZEA 2KHHA 1OKSA 1A5TA 2EJSA 2QNJA 3IHPA 1NV9A 2JUJA 5JI2E 1G3IA 2BWEA 1PGYA 2OO9A 2JY6B 1TR8A 1OTRA 3T6PA 1Y8GA 2KNVA 2CWBA 2MR9A 1V92A 1SG9A 1XB2B 2DAGA 2O25A 3MMPA 2JZ1A 2EKFA 1YLAA 4UN2B 1DV0A 2DAEA 4GEWA 1VEGA 4G3OA 3E21A 2K9DA 1C7YA 3FRIA 4R71A 2EKKA 2LVOC 1R4GA 1HT1E 2QSFX 3GLGE 2MROB 2DAIA 1EFUB 1ZMVA 4WP2A 1IFYA 4HEOA 1BVSA 1WJ7A 1ZMUA 1T6OA 1Q02A 2RRUA 5DFLA 1OAIA 1E94E 3BBZA 2G3QA 1CUKA 1WHCA 2L2DA 2DZLA
chains in the Genus database with same CATH superfamily
1R5LA 1NHWC 3C9PA 3U5ZB 5FSWA 2GNOA 2Z8YM 5GKNA 3U6QA 4DV0M 4D80A 5H37D 3SMSA 2LVQD 1NJGA 1YE9A 4PD2A 1OFHA 2LNHC 1N77A 1KYIA 1Z59A 4GC9A 1IM2A 2VDBB 4L8RC 4DR7M 4LF4M 3GLIE 1TTEA 2C96A 4CGYB 1OQYA 3GRVA 4I4LA 1GO5A 2KEBA 2L4FA 1HJPA 1L2DA 1WR1B 2I7PA 1L2BA 1HNXM 1W5SA 4R7GA 1N36M 4FCVA 4GKJM 3ZH9B 2LXEA 3JR5A 4JI5M 2ZTCA 5BPVA 1IN4A 2BWBA 2GQFA 2DWMA 4LG2A 1IY0A 1MX0A 4DUYM 2L4EA 1NSFA 2QPAA 3F92A 1N33M 2CV1A 2DKLA 3AOEC 2VF8A 4Q7JA 1NHGC 3U6EA 1PJTA 3Q8XA 4IBIA 4AZFA 4R3DA 1IY2A 3KW6A 1MU5A 3JR4A 2QZ4A 3AOGA 2OOBA 1EIJA 1QANA 2DAMA 4JV5M 5FTKA 2KXEA 2MJ5B 3MJ5A 4LJ5A 3KS8A 1G71A 1HT2E 1AIPC 3FTDA 5IT9S 2XGNA 2DENA 4GMQA 2JZ0A 4FD2A 3M7GA 4JI6M 2Y0TA 2FFJA 1JB0F 2UUBM 2NQ8C 2L09A 2OOAA 4LJ4A 3KSJA 5EP3A 1XMOM 1Q3BA 1NY6A 1NJFA 2B3TA 2QP9X 1KSFX 1Q3CA 4X64M 3GPYA 5EXPA 4LZZA 3QAUA 2LVAA 3HX3A 4GIPA 2CP8A 4MM3B 3RGSA 5KO3A 4DV3M 1VEJA 1QAMA 5EP4A 1XC8A 2CUZA 1QZEA 1W5TA 3AFHA 4MGZE 2QCUA 3R8FA 3R9XB 4IJEA 2ZANA 2QNJA 1N75A 1E9SA 5EXXA 4GITA 3E4RA 2JUJA 5JI2E 1G3IA 3VKGA 4OW0A 3B9PA 2BWEA 3T15A 4DR6M 1EE8A 1TR8A 1K3XA 2CV2A 1Y8GA 1D0LA 2W82A 2KNVA 2M5ZA 1HR0M 3PXGA 2MR9A 1IY1A 1LV7A 2J5YA 3PNVA 1TGUA 1SG9A 1UM8A 3IG5A 1L8QA 1QUSA 2HKJA 3U6SA 2DAGA 2O25A 5EJCA 1XNQM 3EIHA 3GRRA 4DR1M 3KOXE 2X8AA 3BOSA 3FTCA 3SFZA 1GJTA 3W0LB 3L26A 3TWMA 4G3OA 1GABA 5FTMA 3KVWA 5LMUM 2R46A 3HU2A 2G8LA 1FJGM 3ZC7B 4JN6A 4LZJA 2RGOA 1SXJE 2Q2EB 1QDRA 4AW4A 3JAMS 3C58A 2H1RA 4KODA 5KQDA 1I4WA 1SXJC 2MROB 2DAIA 1EFUB 3D8BA 4OU7A 3AL0C 4FWHA 4HEOA 1BVSA 4IBJA 5KPTA 1QZMA 3SC3A 3TPZA 3GLGA 4GRIA 3H4MA 1OAIA 2R45A 4P17A 1L2CA 2KRKA 1ZQ9A 2WSCF 2E5LM 2DWNA 1G4AE 4WW0A 4LJ7A 4MGYE 1C1KA 1Z6TA 2LHGA 2QBYA 3VDPA 5JI3E 4W5WA 3HJQA 2CHVA 1ZMWA 3VFDA 2Z3XA 1IBMM 5BR8M 1X37A 3A46A 1NNUC 1R7RA 3I4YA 3M0EA 1NV8A 2C98A 1DO2A 3KOWE 4G6ZA 2QHOB 3PNYA 1VQ1A 3DZDA 4TUWA 5KPRA 3HJSA 2I7NA 1PM5A 2UUAM 4DUZM 3QWLA 4ZPXA 4JI0M 2CEAA 2LWXA 1K82A 4JI2M 2DWZB 2F5SA 2QBYB 4M0DA 2R18A 3ZQJA 5ITQA 1XXHA 4JI4M 4DV6M 2LTUA 3FE3A 3LQRA 3K8ZA 2F5QA 3M6AA 2JXNA 5IREB 1IQPA 1OFIA 2HCBA 3DOAA 2FOIC 4PDIA 2OPFA 3WHKA 5LMNM 4DV7M 2XZUA 3GQ3A 4K0KM 2Y20A 1L1TA 4GH9A 3HGIA 5DYIA 3VKHA 1TF0B 4NSOB 1ZV1A 4QHTA 3GLFE 2KNAA 2XSZA 3E9SA 1V33A 1F4IA 1XXHB 3K92A 1VG5A 1OJLA 4X62M 2RGHA 3J2PB 2QENA 3J7BA 3SAWA 3GLHB 4B3RM 1XHBA 2FNAA 5KQ8A 2LVNC 4F1IA 4AKGA 4M9SA 1UFZA 3B74A 3C3EA 3D8LA 4CHTB 2M60A 3I01M 5C1BA 1HQCA 4D81A 1HQYE 4IJFA 1OIZA 2KHHA 1OKSA 2R6FA 3Q8GA 1Z5BA 1IN7A 4OVZA 4RF0A 4NXMM 3U6PA 2EA0A 2F5OA 1IN5A 2G5GX 2N35A 3THGA 3FTFA 2JWSA 1PGYA 5ITYA 2BJVA 2XF3A 1QUTA 4WURA 4NSRA 4LRSA 3T6PA 1TDZA 4LFCM 1XNRM 2ERCA 3B7QA 2VIIA 4FCWA 4NRVA 2X49A 3LVWA 4GHLA 4DR2M 1XB2B 1QAQA 3MMPA 4S12A 4DV1M 4I81A 4DR3M 4OVZB 2LH0A 4B08A 4MGHA 4JI8M 2AHMA 4Z8XA 3TE6A 1IXRC 2EKFA 3LW5F 4NC6A 4LCBA 4UN2B 3LVVA 3WHLA 2V1CA 4AG5A 4CJ6A 4LJ8A 1PJIA 2UU9M 1VEGA 1PJJA 2V6ZM 2FE8A 4NXNM 2ZM6M 3GPUA 1JR3D 1I94M 3EIEA 1WXQA 2FS1A 2XH9A 3FRIA 3HJ8A 3HHYA 4CIZA 5ITRA 4L6V6 4RNAA 2R65A 2X4AA 3AJIB 3KOZE 1HNZM 2UXDM 4G4NA 5ITXA 1DGBA 1R4GA 4IBFA 3SYLA 1GL7A 2QSFX 5L8RF 3GLGE 4JI7M 3NBXX 1Z5AA 3GRYA 1T6OA 4GKKM 4IBBA 1GLNA 2XEPA 1E94E 2LHCA 1WHCA 3MK6A 3LCUA 1MJGM 3AOEA 2R62A 5FTNA 1SXJD 1DO0A 4LGYA 4KT0F 4B7FA 3HWSA 3HU3A 5IWAM 3U60A 2A5YB 3U61B 3CTWB 1Z5CA 5FTJA 4RF1A 3H4JA 2JP7A 2DWLA 4BLCA 4LJAA 4MB7A 4X65M 1PRBA 1R6BX 5FLXS 4IBDA 4ANRA 3J27B 1L1ZA 2DAKA 1J5EM 4F2LA 3UMMA 5EXTA 2K47A 4Z6YA 3SAVA 3T1YM 2C5RA 4DV4M 3AKZA 2VQFM 3W68A 1IXZA 2D7HA 2DHRA 2Z7JA 3NWLA 1MN3A 2LBCA 1V34A 2C9OA 2UUCM 2MGWA 1XXHE 3U60B 4LRTA 2FH0A 2Y0QA 4YY3M 2UXBM 4BB9A 1DGFA 3CF0A 1PJSA 1Q39A 3L29A 3AV0A 4REZA 3FYDA 1ZAEA 2HAKA 3E46A 3DFZA 2F4VM 2ZBKB 3I4VA 3FUUA 4B3MM 5A2QS 4YHHM 3IECA 1VDLA 3SBJA 3C3DA 2JA2A 1T43A 5F3WA 3VDUA 2R44A 2P5TA 2KZUA 1ORYB 3KP0E 4LY6A 3W0FA 1N34M 4MH0E 4II7A 2RKOA 3DA1A 4FWDA 3J81S 5EP1A 5EXSA 3U61A 5FTLA 1P3QQ 2L7IA 4NRWA 2KZSA 1DGHA 3GQ4A 4QHSA 3U6LA 5E6JA 1LTMA 3I51A 2UXCM 4LF5M 3PFIA 2KNZA 1D2NA 2C9CA 2MH8A 2KW0A 4X66M 4L78A 3SYKA 1JR3A 2R0IA 4HLQA 3HY5A 4EIWA 4LF7M 3CF6E 3VLFB 1VDDA 4LFBM 2ZTDA 3K2LA 2Y21A 2XFSA 4RKUF 4AI6A 2CV0A 4L15A 3GLHA 4FW9A 3OTOM 1XMQM 1IBLM 1A5TA 2O01F 4LF8M 1DGHB 2K6BA 2V1UA 4GC5A 3IHPA 2YQZA 3HHWA 3GO8A 2Z4SA 4QNRA 3HHXA 4ITQA 1TH3A 3KXEC 2YR0A 3L28A 2DZNB 2R4EA 1OTRA 1E9RA 1RU3A 2APLA 4PDGA 3J7AS 3FUXA 2CWBA 1J7KA 3FUVA 2F5PA 2L7HA 3VK7A 3FYCA 2KA6B 1PJQA 3UZUA 3KDSE 1IBKM 3UGJA 2JZ1A 2R4JA 1D0KA 1NY5A 1G59A 1QDTA 1AUAA 1YLAA 4IBKA 4XBOA 2DAEA 4GEWA 1GJSA 2CRUA 1E32A 3HHZA 2K9DA 5ITXE 4AKIA 3NBIA 3FUWA 4DR4M 1NVMA 1SXJB 4R71A 3U6DA 2LVOC 4B3SM 3KFUG 3SHGB 4FVMA 3TWKA 2OQ4A 2CE7A 1IN6A 2L6OA 3FD9A 4WP2A 2DZOB 3T1HM 4A3VB 2XZFA 1WJ7A 3A42A 4PT5A 1YSYA 2ZAMA 3QYBA 2Z4RA 3BBZA 3HKPA 1CUKA 3VK8A 3GPPA 4QOZC 2D7EA 4G4QA 1R2ZA 2DI0A 5ITUA 1JQJC 2F5NA 4M0WA 4DBGB 4IBGA 2EO2A 2ZAOA 2QQ8A 3K9PA 4QNMA 2DHYA 1OIPA 3QYEA 2KRUA 4AQYM 3SATA 1WIVA 3MHVC 4G4OA 2HWJA 1NNJA 1H6UA 2BJWA 4M9ZA 3GLIA 1KFVA 2YFQA 1TH2A 3KS4A 4IBEA 4JYAM 1WGLA 4IBCA 3T38A 4B7HA 4LF9M 7CATA 4LF6M 3GLFA 2LVPC 1K3WA 3J80S 4HL4A 1TH4A 1D0MA 2JY5A 2DNAA 3LCVB 4L4UA 4LGMA 2JY8A 4LFAM 2WSEF 4Y28F 3SASA 2XLJA 3FUTA 4AKHA 4JI3M 5DYGA 3GQ5A 3ILKA 2VF7A 1J09A 1VEKA 5C18A 2JNHA 2JY7A 1TDHA 1YUBA 3SHFA 3GPXA 3GLIB 4IIWA 5DNYA 4DV2M 3HZJA 1GVNA 5EQTA 2J7OA 1OAOC 2EUCA 2VQEM 4MGKE 4DR5M 1G41A 3KSXA 3GLFB 4B7GA 4I5SA 1IN8A 3B89A 4P16A 4LJ9A 2K0BX 4I8OA 3TL4X 2WZJA 3GRUA 2CFOA 5E26A 4MGIE 2HHHM 3KP1E 1JR3E 3FKEA 4G4RA 2H5XA 3RFWA 8CATA 2KDLA 2XSZD 3GLHE 3RGPA 4KLNA 4PCZA 1R2YA 3FRHA 3GP1A 2C99A 2BNKA 2D7GA 3K9OA 1IXSA 1QYRA 1WGNA 4L16A 3IG8A 2CHGA 2DXIA 4B3TM 3KOYE 4NOOB 4OX9M 2EJSA 3B7ZA 3K1JA 3BXWA 2YNMD 3HU1A 2J7NA 3V76A 4KO8A 1QQWA 2XFTA 3L27A 4D82A 2DVWB 1NV9A 1T3TA 5ITTA 1GL6A 2OO9A 2WSFF 3UJNA 2JY6B 3FTEA 4BBAA 3U6MA 1DV0A 1G8PA 1N32M 3B7NA 3CGWA 1V92A 3A45A 4XK8F 2CHQA 3RE8A 1IXSB 3ZCBB 3SARA 1S3SA 3I04M 4LJ6A 3U6OA 5EP2A 4M9XA 4JI1M 4DV5M 3A98B 1QAOA 4FCTA 1QVRA 2HL7A 3TWLA 3W67A 4GHAA 4FWGA 4NL4H 3U6CA 3U5ZA 1FNNA 3E21A 1HNWM 1GKIA 1C7YA 4KHPM 3L2AA 2O5RA 4AG6A 3CF2A 1DGGA 5IZ7D 3L25A 3SMPA 4CISA 2EKKA 3LQQA 3GLGB 5KPZA 1HT1E 1ZMVA 1IFYA 3SAUA 1SXJA 3LMMA 1NO1A 1ZMUA 4QOSA 1N78A 1Q02A 2RRUA 5DFLA 4JXJA 3PVSA 3UK6A 3TQSA 4XGIA 1XWIA 2G3QA 2L2DA 2DZLA
chains in the Genus database with same CATH topology
1G4AE 3LCUA 2DI0A 1DO0A 4DBGB 2LVQD 1ZMWA 3K9PA 3H4JA 2DHYA 2JP7A 1KYIA 1IM2A 3GLIE 1NV8A 1TTEA 1WIVA 1DO2A 2DAKA 1OQYA 4F2LA 1GO5A 2L4FA 1HJPA 2QHOB 2HWJA 1VQ1A 1WR1B 1MN3A 2LBCA 1WGLA 2ZTCA 2BWBA 2MGWA 2LVPC 1XXHE 2JY5A 2DNAA 3LCVB 2L4EA 2JY8A 3F92A 2DKLA 2HAKA 3E46A 2LTUA 3FE3A 4Q7JA 1VEKA 3IECA 1VDLA 2JNHA 2JY7A 1T43A 2OOBA 2DAMA 2MJ5B 1HT2E 1AIPC 1G41A 1P3QQ 2DENA 3B89A 2JZ0A 1ZV1A 2K0BX 3GLFE 2KNAA 2WZJA 1F4IA 2OOAA 1JR3E 1VG5A 2H5XA 2KNZA 2B3TA 2LVNC 4F1IA 2R0IA 3GLHE 1UFZA 2LVAA 3FRHA 2CP8A 2ZTDA 1VEJA 3K9OA 1IXSA 1WGNA 1HQYE 1QZEA 2KHHA 1OKSA 1A5TA 2EJSA 2QNJA 3IHPA 1NV9A 2JUJA 5JI2E 1G3IA 2BWEA 1PGYA 2OO9A 2JY6B 1TR8A 1OTRA 3T6PA 1Y8GA 2KNVA 2CWBA 2MR9A 1V92A 1SG9A 1XB2B 2DAGA 2O25A 3MMPA 2JZ1A 2EKFA 1YLAA 4UN2B 1DV0A 2DAEA 4GEWA 1VEGA 4G3OA 3E21A 2K9DA 1C7YA 3FRIA 4R71A 2EKKA 2LVOC 1R4GA 1HT1E 2QSFX 3GLGE 2MROB 2DAIA 1EFUB 1ZMVA 4WP2A 1IFYA 4HEOA 1BVSA 1WJ7A 1ZMUA 1T6OA 1Q02A 2RRUA 5DFLA 1OAIA 1E94E 3BBZA 2G3QA 1CUKA 1WHCA 2L2DA 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4A E;  3LCU A;  2DI0 A;  1DO0 A;  4DBG B;  2LVQ D;  1ZMW A;  3K9P A;  3H4J A;  2DHY A;  2JP7 A;  1KYI A;  1IM2 A;  3GLI E;  1NV8 A;  1TTE A;  1WIV A;  1DO2 A;  2DAK A;  1OQY A;  4F2L A;  1GO5 A;  2L4F A;  1HJP A;  2QHO B;  2HWJ A;  1VQ1 A;  1WR1 B;  1MN3 A;  2LBC A;  1WGL A;  2ZTC A;  2BWB A;  2MGW A;  2LVP C;  1XXH E;  2JY5 A;  2DNA A;  3LCV B;  2L4E A;  2JY8 A;  3F92 A;  2DKL A;  2HAK A;  3E46 A;  2LTU A;  3FE3 A;  4Q7J A;  1VEK A;  3IEC A;  1VDL A;  2JNH A;  2JY7 A;  1T43 A;  2OOB A;  2DAM A;  2MJ5 B;  1HT2 E;  1AIP C;  1G41 A;  1P3Q Q;  2DEN A;  3B89 A;  2JZ0 A;  1ZV1 A;  2K0B X;  3GLF E;  2KNA A;  2WZJ A;  1F4I A;  2OOA A;  1JR3 E;  1VG5 A;  2H5X A;  2KNZ A;  2B3T A;  2LVN C;  4F1I A;  2R0I A;  3GLH E;  1UFZ A;  2LVA A;  3FRH A;  2CP8 A;  2ZTD A;  1VEJ A;  3K9O A;  1IXS A;  1WGN A;  1HQY E;  1QZE A;  2KHH A;  1OKS A;  1A5T A;  2EJS A;  2QNJ A;  3IHP A;  1NV9 A;  2JUJ A;  5JI2 E;  1G3I A;  2BWE A;  1PGY A;  2OO9 A;  2JY6 B;  1TR8 A;  1OTR A;  3T6P A;  1Y8G A;  2KNV A;  2CWB A;  2MR9 A;  1V92 A;  1SG9 A;  1XB2 B;  2DAG A;  2O25 A;  3MMP A;  2JZ1 A;  2EKF A;  1YLA A;  4UN2 B;  1DV0 A;  2DAE A;  4GEW A;  1VEG A;  4G3O A;  3E21 A;  2K9D A;  1C7Y A;  3FRI A;  4R71 A;  2EKK A;  2LVO C;  1R4G A;  1HT1 E;  2QSF X;  3GLG E;  2MRO B;  2DAI A;  1EFU B;  1ZMV A;  4WP2 A;  1IFY A;  4HEO A;  1BVS A;  1WJ7 A;  1ZMU A;  1T6O A;  1Q02 A;  2RRU A;  5DFL A;  1OAI A;  1E94 E;  3BBZ A;  2G3Q A;  1CUK A;  1WHC A;  2L2D A;  2DZL A; 
#chains in the Genus database with same CATH topology
 1R5L A;  1NHW C;  3C9P A;  3U5Z B;  5FSW A;  2GNO A;  2Z8Y M;  5GKN A;  3U6Q A;  4DV0 M;  4D80 A;  5H37 D;  3SMS A;  2LVQ D;  1NJG A;  1YE9 A;  4PD2 A;  1OFH A;  2LNH C;  1N77 A;  1KYI A;  1Z59 A;  4GC9 A;  1IM2 A;  2VDB B;  4L8R C;  4DR7 M;  4LF4 M;  3GLI E;  1TTE A;  2C96 A;  4CGY B;  1OQY A;  3GRV A;  4I4L A;  1GO5 A;  2KEB A;  2L4F A;  1HJP A;  1L2D A;  1WR1 B;  2I7P A;  1L2B A;  1HNX M;  1W5S A;  4R7G A;  1N36 M;  4FCV A;  4GKJ M;  3ZH9 B;  2LXE A;  3JR5 A;  4JI5 M;  2ZTC A;  5BPV A;  1IN4 A;  2BWB A;  2GQF A;  2DWM A;  4LG2 A;  1IY0 A;  1MX0 A;  4DUY M;  2L4E A;  1NSF A;  2QPA A;  3F92 A;  1N33 M;  2CV1 A;  2DKL A;  3AOE C;  2VF8 A;  4Q7J A;  1NHG C;  3U6E A;  1PJT A;  3Q8X A;  4IBI A;  4AZF A;  4R3D A;  1IY2 A;  3KW6 A;  1MU5 A;  3JR4 A;  2QZ4 A;  3AOG A;  2OOB A;  1EIJ A;  1QAN A;  2DAM A;  4JV5 M;  5FTK A;  2KXE A;  2MJ5 B;  3MJ5 A;  4LJ5 A;  3KS8 A;  1G71 A;  1HT2 E;  1AIP C;  3FTD A;  5IT9 S;  2XGN A;  2DEN A;  4GMQ A;  2JZ0 A;  4FD2 A;  3M7G A;  4JI6 M;  2Y0T A;  2FFJ A;  1JB0 F;  2UUB M;  2NQ8 C;  2L09 A;  2OOA A;  4LJ4 A;  3KSJ A;  5EP3 A;  1XMO M;  1Q3B A;  1NY6 A;  1NJF A;  2B3T A;  2QP9 X;  1KSF X;  1Q3C A;  4X64 M;  3GPY A;  5EXP A;  4LZZ A;  3QAU A;  2LVA A;  3HX3 A;  4GIP A;  2CP8 A;  4MM3 B;  3RGS A;  5KO3 A;  4DV3 M;  1VEJ A;  1QAM A;  5EP4 A;  1XC8 A;  2CUZ A;  1QZE A;  1W5T A;  3AFH A;  4MGZ E;  2QCU A;  3R8F A;  3R9X B;  4IJE A;  2ZAN A;  2QNJ A;  1N75 A;  1E9S A;  5EXX A;  4GIT A;  3E4R A;  2JUJ A;  5JI2 E;  1G3I A;  3VKG A;  4OW0 A;  3B9P A;  2BWE A;  3T15 A;  4DR6 M;  1EE8 A;  1TR8 A;  1K3X A;  2CV2 A;  1Y8G A;  1D0L A;  2W82 A;  2KNV A;  2M5Z A;  1HR0 M;  3PXG A;  2MR9 A;  1IY1 A;  1LV7 A;  2J5Y A;  3PNV A;  1TGU A;  1SG9 A;  1UM8 A;  3IG5 A;  1L8Q A;  1QUS A;  2HKJ A;  3U6S A;  2DAG A;  2O25 A;  5EJC A;  1XNQ M;  3EIH A;  3GRR A;  4DR1 M;  3KOX E;  2X8A A;  3BOS A;  3FTC A;  3SFZ A;  1GJT A;  3W0L B;  3L26 A;  3TWM A;  4G3O A;  1GAB A;  5FTM A;  3KVW A;  5LMU M;  2R46 A;  3HU2 A;  2G8L A;  1FJG M;  3ZC7 B;  4JN6 A;  4LZJ A;  2RGO A;  1SXJ E;  2Q2E B;  1QDR A;  4AW4 A;  3JAM S;  3C58 A;  2H1R A;  4KOD A;  5KQD A;  1I4W A;  1SXJ C;  2MRO B;  2DAI A;  1EFU B;  3D8B A;  4OU7 A;  3AL0 C;  4FWH A;  4HEO A;  1BVS A;  4IBJ A;  5KPT A;  1QZM A;  3SC3 A;  3TPZ A;  3GLG A;  4GRI A;  3H4M A;  1OAI A;  2R45 A;  4P17 A;  1L2C A;  2KRK A;  1ZQ9 A;  2WSC F;  2E5L M;  2DWN A;  1G4A E;  4WW0 A;  4LJ7 A;  4MGY E;  1C1K A;  1Z6T A;  2LHG A;  2QBY A;  3VDP A;  5JI3 E;  4W5W A;  3HJQ A;  2CHV A;  1ZMW A;  3VFD A;  2Z3X A;  1IBM M;  5BR8 M;  1X37 A;  3A46 A;  1NNU C;  1R7R A;  3I4Y A;  3M0E A;  1NV8 A;  2C98 A;  1DO2 A;  3KOW E;  4G6Z A;  2QHO B;  3PNY A;  1VQ1 A;  3DZD A;  4TUW A;  5KPR A;  3HJS A;  2I7N A;  1PM5 A;  2UUA M;  4DUZ M;  3QWL A;  4ZPX A;  4JI0 M;  2CEA A;  2LWX A;  1K82 A;  4JI2 M;  2DWZ B;  2F5S A;  2QBY B;  4M0D A;  2R18 A;  3ZQJ A;  5ITQ A;  1XXH A;  4JI4 M;  4DV6 M;  2LTU A;  3FE3 A;  3LQR A;  3K8Z A;  2F5Q A;  3M6A A;  2JXN A;  5IRE B;  1IQP A;  1OFI A;  2HCB A;  3DOA A;  2FOI C;  4PDI A;  2OPF A;  3WHK A;  5LMN M;  4DV7 M;  2XZU A;  3GQ3 A;  4K0K M;  2Y20 A;  1L1T A;  4GH9 A;  3HGI A;  5DYI A;  3VKH A;  1TF0 B;  4NSO B;  1ZV1 A;  4QHT A;  3GLF E;  2KNA A;  2XSZ A;  3E9S A;  1V33 A;  1F4I A;  1XXH B;  3K92 A;  1VG5 A;  1OJL A;  4X62 M;  2RGH A;  3J2P B;  2QEN A;  3J7B A;  3SAW A;  3GLH B;  4B3R M;  1XHB A;  2FNA A;  5KQ8 A;  2LVN C;  4F1I A;  4AKG A;  4M9S A;  1UFZ A;  3B74 A;  3C3E A;  3D8L A;  4CHT B;  2M60 A;  3I01 M;  5C1B A;  1HQC A;  4D81 A;  1HQY E;  4IJF A;  1OIZ A;  2KHH A;  1OKS A;  2R6F A;  3Q8G A;  1Z5B A;  1IN7 A;  4OVZ A;  4RF0 A;  4NXM M;  3U6P A;  2EA0 A;  2F5O A;  1IN5 A;  2G5G X;  2N35 A;  3THG A;  3FTF A;  2JWS A;  1PGY A;  5ITY A;  2BJV A;  2XF3 A;  1QUT A;  4WUR A;  4NSR A;  4LRS A;  3T6P A;  1TDZ A;  4LFC M;  1XNR M;  2ERC A;  3B7Q A;  2VII A;  4FCW A;  4NRV A;  2X49 A;  3LVW A;  4GHL A;  4DR2 M;  1XB2 B;  1QAQ A;  3MMP A;  4S12 A;  4DV1 M;  4I81 A;  4DR3 M;  4OVZ B;  2LH0 A;  4B08 A;  4MGH A;  4JI8 M;  2AHM A;  4Z8X A;  3TE6 A;  1IXR C;  2EKF A;  3LW5 F;  4NC6 A;  4LCB A;  4UN2 B;  3LVV A;  3WHL A;  2V1C A;  4AG5 A;  4CJ6 A;  4LJ8 A;  1PJI A;  2UU9 M;  1VEG A;  1PJJ A;  2V6Z M;  2FE8 A;  4NXN M;  2ZM6 M;  3GPU A;  1JR3 D;  1I94 M;  3EIE A;  1WXQ A;  2FS1 A;  2XH9 A;  3FRI A;  3HJ8 A;  3HHY A;  4CIZ A;  5ITR A;  4L6V 6;  4RNA A;  2R65 A;  2X4A A;  3AJI B;  3KOZ E;  1HNZ M;  2UXD M;  4G4N A;  5ITX A;  1DGB A;  1R4G A;  4IBF A;  3SYL A;  1GL7 A;  2QSF X;  5L8R F;  3GLG E;  4JI7 M;  3NBX X;  1Z5A A;  3GRY A;  1T6O A;  4GKK M;  4IBB A;  1GLN A;  2XEP A;  1E94 E;  2LHC A;  1WHC A;  3MK6 A;  3LCU A;  1MJG M;  3AOE A;  2R62 A;  5FTN A;  1SXJ D;  1DO0 A;  4LGY A;  4KT0 F;  4B7F A;  3HWS A;  3HU3 A;  5IWA M;  3U60 A;  2A5Y B;  3U61 B;  3CTW B;  1Z5C A;  5FTJ A;  4RF1 A;  3H4J A;  2JP7 A;  2DWL A;  4BLC A;  4LJA A;  4MB7 A;  4X65 M;  1PRB A;  1R6B X;  5FLX S;  4IBD A;  4ANR A;  3J27 B;  1L1Z A;  2DAK A;  1J5E M;  4F2L A;  3UMM A;  5EXT A;  2K47 A;  4Z6Y A;  3SAV A;  3T1Y M;  2C5R A;  4DV4 M;  3AKZ A;  2VQF M;  3W68 A;  1IXZ A;  2D7H A;  2DHR A;  2Z7J A;  3NWL A;  1MN3 A;  2LBC A;  1V34 A;  2C9O A;  2UUC M;  2MGW A;  1XXH E;  3U60 B;  4LRT A;  2FH0 A;  2Y0Q A;  4YY3 M;  2UXB M;  4BB9 A;  1DGF A;  3CF0 A;  1PJS A;  1Q39 A;  3L29 A;  3AV0 A;  4REZ A;  3FYD A;  1ZAE A;  2HAK A;  3E46 A;  3DFZ A;  2F4V M;  2ZBK B;  3I4V A;  3FUU A;  4B3M M;  5A2Q S;  4YHH M;  3IEC A;  1VDL A;  3SBJ A;  3C3D A;  2JA2 A;  1T43 A;  5F3W A;  3VDU A;  2R44 A;  2P5T A;  2KZU A;  1ORY B;  3KP0 E;  4LY6 A;  3W0F A;  1N34 M;  4MH0 E;  4II7 A;  2RKO A;  3DA1 A;  4FWD A;  3J81 S;  5EP1 A;  5EXS A;  3U61 A;  5FTL A;  1P3Q Q;  2L7I A;  4NRW A;  2KZS A;  1DGH A;  3GQ4 A;  4QHS A;  3U6L A;  5E6J A;  1LTM A;  3I51 A;  2UXC M;  4LF5 M;  3PFI A;  2KNZ A;  1D2N A;  2C9C A;  2MH8 A;  2KW0 A;  4X66 M;  4L78 A;  3SYK A;  1JR3 A;  2R0I A;  4HLQ A;  3HY5 A;  4EIW A;  4LF7 M;  3CF6 E;  3VLF B;  1VDD A;  4LFB M;  2ZTD A;  3K2L A;  2Y21 A;  2XFS A;  4RKU F;  4AI6 A;  2CV0 A;  4L15 A;  3GLH A;  4FW9 A;  3OTO M;  1XMQ M;  1IBL M;  1A5T A;  2O01 F;  4LF8 M;  1DGH B;  2K6B A;  2V1U A;  4GC5 A;  3IHP A;  2YQZ A;  3HHW A;  3GO8 A;  2Z4S A;  4QNR A;  3HHX A;  4ITQ A;  1TH3 A;  3KXE C;  2YR0 A;  3L28 A;  2DZN B;  2R4E A;  1OTR A;  1E9R A;  1RU3 A;  2APL A;  4PDG A;  3J7A S;  3FUX A;  2CWB A;  1J7K A;  3FUV A;  2F5P A;  2L7H A;  3VK7 A;  3FYC A;  2KA6 B;  1PJQ A;  3UZU A;  3KDS E;  1IBK M;  3UGJ A;  2JZ1 A;  2R4J A;  1D0K A;  1NY5 A;  1G59 A;  1QDT A;  1AUA A;  1YLA A;  4IBK A;  4XBO A;  2DAE A;  4GEW A;  1GJS A;  2CRU A;  1E32 A;  3HHZ A;  2K9D A;  5ITX E;  4AKI A;  3NBI A;  3FUW A;  4DR4 M;  1NVM A;  1SXJ B;  4R71 A;  3U6D A;  2LVO C;  4B3S M;  3KFU G;  3SHG B;  4FVM A;  3TWK A;  2OQ4 A;  2CE7 A;  1IN6 A;  2L6O A;  3FD9 A;  4WP2 A;  2DZO B;  3T1H M;  4A3V B;  2XZF A;  1WJ7 A;  3A42 A;  4PT5 A;  1YSY A;  2ZAM A;  3QYB A;  2Z4R A;  3BBZ A;  3HKP A;  1CUK A;  3VK8 A;  3GPP A;  4QOZ C;  2D7E A;  4G4Q A;  1R2Z A;  2DI0 A;  5ITU A;  1JQJ C;  2F5N A;  4M0W A;  4DBG B;  4IBG A;  2EO2 A;  2ZAO A;  2QQ8 A;  3K9P A;  4QNM A;  2DHY A;  1OIP A;  3QYE A;  2KRU A;  4AQY M;  3SAT A;  1WIV A;  3MHV C;  4G4O A;  2HWJ A;  1NNJ A;  1H6U A;  2BJW A;  4M9Z A;  3GLI A;  1KFV A;  2YFQ A;  1TH2 A;  3KS4 A;  4IBE A;  4JYA M;  1WGL A;  4IBC A;  3T38 A;  4B7H A;  4LF9 M;  7CAT A;  4LF6 M;  3GLF A;  2LVP C;  1K3W A;  3J80 S;  4HL4 A;  1TH4 A;  1D0M A;  2JY5 A;  2DNA A;  3LCV B;  4L4U A;  4LGM A;  2JY8 A;  4LFA M;  2WSE F;  4Y28 F;  3SAS A;  2XLJ A;  3FUT A;  4AKH A;  4JI3 M;  5DYG A;  3GQ5 A;  3ILK A;  2VF7 A;  1J09 A;  1VEK A;  5C18 A;  2JNH A;  2JY7 A;  1TDH A;  1YUB A;  3SHF A;  3GPX A;  3GLI B;  4IIW A;  5DNY A;  4DV2 M;  3HZJ A;  1GVN A;  5EQT A;  2J7O A;  1OAO C;  2EUC A;  2VQE M;  4MGK E;  4DR5 M;  1G41 A;  3KSX A;  3GLF B;  4B7G A;  4I5S A;  1IN8 A;  3B89 A;  4P16 A;  4LJ9 A;  2K0B X;  4I8O A;  3TL4 X;  2WZJ A;  3GRU A;  2CFO A;  5E26 A;  4MGI E;  2HHH M;  3KP1 E;  1JR3 E;  3FKE A;  4G4R A;  2H5X A;  3RFW A;  8CAT A;  2KDL A;  2XSZ D;  3GLH E;  3RGP A;  4KLN A;  4PCZ A;  1R2Y A;  3FRH A;  3GP1 A;  2C99 A;  2BNK A;  2D7G A;  3K9O A;  1IXS A;  1QYR A;  1WGN A;  4L16 A;  3IG8 A;  2CHG A;  2DXI A;  4B3T M;  3KOY E;  4NOO B;  4OX9 M;  2EJS A;  3B7Z A;  3K1J A;  3BXW A;  2YNM D;  3HU1 A;  2J7N A;  3V76 A;  4KO8 A;  1QQW A;  2XFT A;  3L27 A;  4D82 A;  2DVW B;  1NV9 A;  1T3T A;  5ITT A;  1GL6 A;  2OO9 A;  2WSF F;  3UJN A;  2JY6 B;  3FTE A;  4BBA A;  3U6M A;  1DV0 A;  1G8P A;  1N32 M;  3B7N A;  3CGW A;  1V92 A;  3A45 A;  4XK8 F;  2CHQ A;  3RE8 A;  1IXS B;  3ZCB B;  3SAR A;  1S3S A;  3I04 M;  4LJ6 A;  3U6O A;  5EP2 A;  4M9X A;  4JI1 M;  4DV5 M;  3A98 B;  1QAO A;  4FCT A;  1QVR A;  2HL7 A;  3TWL A;  3W67 A;  4GHA A;  4FWG A;  4NL4 H;  3U6C A;  3U5Z A;  1FNN A;  3E21 A;  1HNW M;  1GKI A;  1C7Y A;  4KHP M;  3L2A A;  2O5R A;  4AG6 A;  3CF2 A;  1DGG A;  5IZ7 D;  3L25 A;  3SMP A;  4CIS A;  2EKK A;  3LQQ A;  3GLG B;  5KPZ A;  1HT1 E;  1ZMV A;  1IFY A;  3SAU A;  1SXJ A;  3LMM A;  1NO1 A;  1ZMU A;  4QOS A;  1N78 A;  1Q02 A;  2RRU A;  5DFL A;  4JXJ A;  3PVS A;  3UK6 A;  3TQS A;  4XGI A;  1XWI A;  2G3Q A;  2L2D A;  2DZL A; 
#chains in the Genus database with same CATH homology
 1G4A E;  3LCU A;  2DI0 A;  1DO0 A;  4DBG B;  2LVQ D;  1ZMW A;  3K9P A;  3H4J A;  2DHY A;  2JP7 A;  1KYI A;  1IM2 A;  3GLI E;  1NV8 A;  1TTE A;  1WIV A;  1DO2 A;  2DAK A;  1OQY A;  4F2L A;  1GO5 A;  2L4F A;  1HJP A;  2QHO B;  2HWJ A;  1VQ1 A;  1WR1 B;  1MN3 A;  2LBC A;  1WGL A;  2ZTC A;  2BWB A;  2MGW A;  2LVP C;  1XXH E;  2JY5 A;  2DNA A;  3LCV B;  2L4E A;  2JY8 A;  3F92 A;  2DKL A;  2HAK A;  3E46 A;  2LTU A;  3FE3 A;  4Q7J A;  1VEK A;  3IEC A;  1VDL A;  2JNH A;  2JY7 A;  1T43 A;  2OOB A;  2DAM A;  2MJ5 B;  1HT2 E;  1AIP C;  1G41 A;  1P3Q Q;  2DEN A;  3B89 A;  2JZ0 A;  1ZV1 A;  2K0B X;  3GLF E;  2KNA A;  2WZJ A;  1F4I A;  2OOA A;  1JR3 E;  1VG5 A;  2H5X A;  2KNZ A;  2B3T A;  2LVN C;  4F1I A;  2R0I A;  3GLH E;  1UFZ A;  2LVA A;  3FRH A;  2CP8 A;  2ZTD A;  1VEJ A;  3K9O A;  1IXS A;  1WGN A;  1HQY E;  1QZE A;  2KHH A;  1OKS A;  1A5T A;  2EJS A;  2QNJ A;  3IHP A;  1NV9 A;  2JUJ A;  5JI2 E;  1G3I A;  2BWE A;  1PGY A;  2OO9 A;  2JY6 B;  1TR8 A;  1OTR A;  3T6P A;  1Y8G A;  2KNV A;  2CWB A;  2MR9 A;  1V92 A;  1SG9 A;  1XB2 B;  2DAG A;  2O25 A;  3MMP A;  2JZ1 A;  2EKF A;  1YLA A;  4UN2 B;  1DV0 A;  2DAE A;  4GEW A;  1VEG A;  4G3O A;  3E21 A;  2K9D A;  1C7Y A;  3FRI A;  4R71 A;  2EKK A;  2LVO C;  1R4G A;  1HT1 E;  2QSF X;  3GLG E;  2MRO B;  2DAI A;  1EFU B;  1ZMV A;  4WP2 A;  1IFY A;  4HEO A;  1BVS A;  1WJ7 A;  1ZMU A;  1T6O A;  1Q02 A;  2RRU A;  5DFL A;  1OAI A;  1E94 E;  3BBZ A;  2G3Q A;  1CUK A;  1WHC A;  2L2D A;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...