2OOAA

Crystal structure of the uba domain from cbl-b ubiquitin ligase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
VDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ooaA00
2OOAA 3K9PA 3B89A 1YLAA 1ZMVA 2DI0A 1VEGA 1WGLA 2JY7A 2L2DA 1E94E 2LVNC 3T6PA 1WIVA 1MN3A 2LVPC 2ZTDA 3FE3A 1WHCA 1NV9A 1HT1E 1VEKA 1G4AE 2KHHA 1A5TA 3E21A 2CWBA 1DV0A 4GEWA 1T6OA 1IXSA 1EFUB 1SG9A 4WP2A 2DAKA 2EJSA 1F4IA 1KYIA 3H4JA 3E46A 2MGWA 2LBCA 2DAIA 2BWEA 3GLGE 1XB2B 1OKSA 1QZEA 1P3QQ 2RRUA 2OO9A 1VEJA 2JZ0A 1ZMUA 2CP8A 2JY5A 1TR8A 3MMPA 2QNJA 2HWJA 1IM2A 2LTUA 2K0BX 2DAMA 2LVAA 1DO2A 2JP7A 2JZ1A 2L4FA 1Y8GA 4F2LA 3LCVB 1UFZA 3LCUA 2DENA 1BVSA 2K9DA 3IHPA 3K9OA 1JR3E 2KNVA 4G3OA 1CUKA 1IFYA 5DFLA 2JNHA 1HJPA 1WJ7A 2EKFA 2DNAA 2ZTCA 4Q7JA 2JUJA 1G3IA 2OOBA 2R0IA 1HT2E 1HQYE 1R4GA 2MR9A 1T43A 5JI2E 1C7YA 2QHOB 2DHYA 2MJ5B 1ZMWA 2JY8A 2QSFX 2DKLA 1GO5A 1TTEA 2L4EA 4R71A 2DAEA 3FRHA 4HEOA 1ZV1A 1PGYA 1Q02A 2B3TA 3IECA 1VQ1A 1XXHE 1AIPC 3BBZA 3GLHE 1VDLA 3GLIE 1OQYA 4F1IA 1WR1B 3F92A 2MROB 2HAKA 1NV8A 2BWBA 1VG5A 2LVOC 1OAIA 1DO0A 2LVQD 2WZJA 1OTRA 2EKKA 2KNZA 2O25A 1V92A 3GLFE 4UN2B 2KNAA 1WGNA 4DBGB 2G3QA 3FRIA 2H5XA 1G41A 2DAGA 2JY6B 2DZLA
chains in the Genus database with same CATH superfamily
2OOAA 1SXJA 1R5LA 2G5GX 3E9SA 3NBXX 2UU9M 1GJTA 3H4MA 2HKJA 4LGYA 1PJQA 2QBYB 1XXHA 2CEAA 1IBKM 2DVWB 2VIIA 2CV1A 1E94E 4NOOB 3SC3A 4B3MM 4M9SA 3FE3A 4G4OA 4JI1M 1S3SA 2CV2A 2R18A 1HT1E 2LNHC 3GO8A 2XZFA 1VEKA 5H37D 1FJGM 3GRVA 3E21A 3FUUA 4LRTA 4IBKA 4JN6A 3SHFA 2ZM6M 4B3RM 4QOZC 4LJ4A 2DWZB 1N33M 3V76A 3SFZA 5C1BA 1WXQA 3GP1A 3WHKA 3L2AA 1E9SA 1OFHA 4GMQA 1IXSA 4M9XA 1K82A 3R8FA 2DAKA 1E32A 8CATA 1V34A 3PNYA 4DR1M 4L15A 2KA6B 3A98B 3VK7A 2MGWA 5FTMA 1G71A 3HX3A 1OIZA 2UXBM 2BWEA 3J80S 3PNVA 1XB2B 2C96A 2RRUA 3L25A 2OO9A 2XSZD 3RGPA 4I4LA 4XK8F 3GPPA 4I81A 1D0MA 3FTDA 3GRYA 3DZDA 2QNJA 5KQ8A 4GKJM 3Q8XA 2LTUA 4ZPXA 1JR3D 3LMMA 4IBGA 4OVZB 4B7HA 3GPYA 5DNYA 4FWHA 4OU7A 3U6MA 3LCUA 1TH3A 4G4QA 5ITRA 4MGKE 1SXJB 3BXWA 4BLCA 3J7BA 5KPRA 1IQPA 4G3OA 3U5ZB 2JNHA 3KVWA 3ZC7B 5EP4A 1MJGM 4GITA 2V6ZM 1Q39A 2BJWA 1YE9A 2WSCF 3U6LA 2ZTCA 2YR0A 5EXPA 4KO8A 3CF2A 1GABA 2C99A 4DR3M 1I94M 1EE8A 1HT2E 1HQYE 2MR9A 3SATA 2CFOA 2QHOB 5IZ7D 2MH8A 3LQQA 1ZMWA 3T38A 3VKHA 3KP0E 4QHSA 4D80A 1T3TA 3HKPA 3TL4X 4YHHM 4AW4A 1KFVA 1IY1A 1J7KA 3CF0A 3MHVC 1Q02A 3K92A 1VQ1A 2XSZA 2ZAOA 1IXSB 3EIEA 4ANRA 1HNXM 2UXDM 1IXRC 1XNRM 3GLIE 1OQYA 1W5TA 2HL7A 4G6ZA 4F1IA 1JR3A 2MROB 2X8AA 1NV8A 4AG6A 2BWBA 2P5TA 1VG5A 4L4UA 3U6QA 5EJCA 2M60A 1N77A 1TDHA 2EKKA 2KNZA 2KEBA 4LFCM 3TWMA 3C58A 5BPVA 4IBDA 4P16A 1NNUC 4IIWA 4MGIE 3FRIA 2V1CA 4LZZA 4PDGA 2JY6B 1L8QA 2DAGA 1QDTA 2Y0QA 2Z4RA 1IN4A 4LF9M 1GL6A 4LF5M 1TH2A 2X49A 3RFWA 5KO3A 3B89A 1HQCA 5FTNA 3FYCA 3SHGB 2JY7A 4DV2M 3I4YA 3LQRA 3RGSA 2L09A 3ZCBB 4KHPM 2Z7JA 2QP9X 4MB7A 4OW0A 4QNRA 4I8OA 5EP3A 3KSJA 2F5QA 1RU3A 1A5TA 2DWLA 2YNMD 1Q3CA 1L2DA 2EUCA 3AFHA 4WW0A 4GEWA 2XLJA 1XWIA 3HU1A 1V33A 3SYLA 1PJIA 4DV0M 2KDLA 4NRVA 3GQ3A 3J81S 1OFIA 1OIPA 3U5ZA 4AZFA 4FW9A 2R44A 2XF3A 3TE6A 2UUCM 3E46A 2LBCA 3U6SA 3HZJA 1VDDA 2QPAA 3GPXA 3GLGE 1L2CA 1OKSA 4B3SM 2D7GA 3GLIB 1P3QQ 3TPZA 2EO2A 2JZ0A 4QHTA 4Z8XA 3AKZA 4LF6M 2G8LA 2F5OA 1HNWM 2CP8A 1Q3BA 2JY5A 5ITXE 2K47A 2W82A 4MH0E 5C18A 2XFTA 3MMPA 5FSWA 1N34M 5IT9S 3M7GA 1QVRA 4PT5A 3EIHA 5ITXA 2K0BX 3VLFB 2ZANA 2JZ1A 1MX0A 4FD2A 5BR8M 3J7AS 2C9OA 4M0DA 4S12A 1QUTA 3HU3A 4P17A 1IBLM 2K9DA 5FTJA 3IHPA 1IN8A 1DGHB 1Z5BA 3AOEC 2R65A 2D7HA 2QQ8A 3A45A 1K3WA 2YQZA 1CUKA 3KOWE 3K2LA 5ITUA 3KOXE 3AL0C 3L28A 3SASA 2R4JA 3M6AA 2E5LM 4D82A 2EKFA 3FTCA 4Z6YA 3SARA 4IJEA 2KRKA 3HJ8A 3NWLA 4WURA 1IN5A 2H1RA 4B7GA 3JR5A 3KDSE 2O5RA 5GKNA 4LFAM 3UMMA 4PDIA 1GVNA 4TUWA 1JB0F 2LXEA 3KOZE 3T1HM 3U6CA 2XZUA 3DFZA 1X37A 2MJ5B 3B7QA 3U6OA 1N78A 4GRIA 3FD9A 1XMOM 4CJ6A 2DAEA 4HEOA 3W0FA 1Z59A 2DWMA 3JAMS 1OAOC 3GLHE 2VQFM 4AQYM 2VF7A 2JXNA 5JI3E 4L78A 1IXZA 1N75A 3GLHA 2ERCA 2M5ZA 3HJSA 4X64M 3SYKA 1XNQM 4NSOB 5EXXA 4CIZA 4KODA 1QAMA 2LVOC 4X62M 3I01M 4NXMM 2LVQD 2JA2A 1UM8A 3GLFE 5DYGA 2KNAA 1WGNA 4PD2A 4DV7M 4QOSA 1NNJA 3GLFA 1ZAEA 4DV4M 4KLNA 4K0KM 1PJSA 4HL4A 4GHLA 1HR0M 3GPUA 3IG5A 4II7A 1EIJA 1N36M 2HHHM 2Q2EB 3FUXA 3K9PA 1W5SA 1NSFA 4L6V6 1YLAA 2RKOA 1NO1A 1VEGA 1SXJC 4M0WA 3HHXA 1YUBA 1D0KA 3JR4A 2L2DA 3IG8A 3C9PA 4QNMA 5ITYA 1IY2A 2NQ8C 3GLIA 2D7EA 4NRWA 2R45A 2F4VM 3R9XB 3W0LB 3MK6A 3I51A 2QCUA 3SMPA 2GNOA 5ITQA 4RF0A 5F3WA 5E6JA 2J5YA 1FNNA 2CWBA 4JI7M 3KXEC 1DV0A 4DV3M 2C5RA 1YSYA 4R7GA 2R6FA 3HWSA 4LRSA 5FTKA 4IBIA 1DGGA 4LFBM 1EFUB 1SG9A 2YFQA 3T15A 1DGHA 3FYDA 3VKGA 2APLA 1Z5AA 4CISA 2HCBA 2KZUA 3SMSA 3A42A 1NVMA 4IJFA 1AUAA 1F4IA 4A3VB 3K1JA 1KYIA 3QWLA 4JI0M 3KP1E 3W68A 3SBJA 2DAIA 1C1KA 2K6BA 4RKUF 3TWKA 2Y21A 4BB9A 3B9PA 2FH0A 3VFDA 4MGYE 3GLHB 1HNZM 1GJSA 2Z4SA 4AKIA 2FS1A 4FWGA 2FNAA 4DUZM 4LJ7A 1VEJA 5EXTA 2CRUA 4MGHA 3QAUA 1LTMA 1TR8A 4IBBA 3B74A 1MU5A 2HWJA 1NJFA 3L26A 2L7HA 5KPTA 2DAMA 3GQ4A 3GLFB 1PJJA 4AKGA 4DV1M 3QYEA 3FTEA 3KS4A 2L4FA 1Y8GA 3THGA 1UFZA 2RGHA 1NY5A 3FTFA 2QENA 4EIWA 4B3TM 2EA0A 1R2ZA 2R62A 2DZOB 3U61B 2J7NA 4IBEA 4I5SA 4XBOA 2KW0A 3AOGA 3L29A 1IFYA 1G8PA 4DR7M 2CE7A 3CGWA 4JI5M 1QZMA 2KZSA 1WJ7A 4AKHA 2DNAA 4LJ8A 2JWSA 4Q7JA 2R46A 3PVSA 3A46A 4CGYB 3FUTA 3GLGA 2R0IA 1J09A 3CF6E 4GIPA 3U6EA 2Z8YM 3LVVA 3NBIA 1R4GA 3SAWA 4Y28F 5JI2E 1C7YA 1IBMM 3KS8A 2DHRA 1J5EM 1SXJE 4M9ZA 2JY8A 4LJAA 1NHGC 2FFJA 3B7NA 1QQWA 2DKLA 3C3DA 3HHWA 3VK8A 1GO5A 1TTEA 4R71A 3FRHA 2XGNA 1XXHE 1E9RA 3VDUA 1Z6TA 1H6UA 2CHQA 3BBZA 4LJ9A 4LF4M 1VDLA 1QAOA 2LHCA 2R4EA 3FKEA 1GKIA 5FLXS 4FVMA 2XFSA 3U6DA 2VF8A 1L2BA 3F92A 1NY6A 4DR2M 4ITQA 1OAIA 4JI4M 3FUWA 4DUYM 1GLNA 4DR4M 3I4VA 4DBGB 1NHWC 3E4RA 5IREB 4GKKM 1ZQ9A 1DGBA 2G3QA 3HY5A 4JXJA 4NL4H 1L1TA 4L16A 3TQSA 2H5XA 4D81A 2UUBM 4B08A 1G41A 4KT0F 5EQTA 3U60A 1TDZA 4DR6M 2DZLA 4X66M 1PRBA 3K8ZA 2XEPA 5FTLA 2L7IA 2VDBB 3UZUA 1ZMVA 2DI0A 1JQJC 4JI3M 1XHBA 2XH9A 1TH4A 1WGLA 2CUZA 3TWLA 4NSRA 2Y0TA 2O01F 4YY3M 1R2YA 2F5NA 1R6BX 4L8RC 1QANA 1N32M 5KQDA 1KSFX 4R3DA 2LVNC 5L8RF 3T6PA 1WIVA 1MN3A 2LVPC 2ZTDA 1WHCA 4NC6A 1Z5CA 1NV9A 2WSEF 3UJNA 1G4AE 2KHHA 2L6OA 3PXGA 2LHGA 3GRRA 3GLGB 4IBFA 1T6OA 4IBCA 4AG5A 1D2NA 1GL7A 2KRUA 3GQ5A 3CTWB 1IY0A 3FUVA 2DXIA 4CHTB 3SAVA 3UGJA 4WP2A 3U61A 1TF0B 4W5WA 3HU2A 2X4AA 3HGIA 4FWDA 2EJSA 3PFIA 3H4JA 3ZH9B 5LMNM 1XXHB 2C9CA 4FCWA 5A2QS 3T1YM 2WSFF 2FE8A 1G59A 3U6PA 1QZEA 4LJ6A 4FCVA 4XGIA 1QDRA 3RE8A 1XC8A 3KOYE 1ZMUA 3LW5F 3ZQJA 5E26A 3WHLA 1ORYB 4REZA 2UXCM 3UK6A 2BNKA 2C98A 1IM2A 4LZJA 3J27B 2LVAA 1DO2A 3L27A 1XMQM 2JP7A 1LV7A 1DGFA 5IWAM 3Q8GA 3AOEA 3LCVB 3AV0A 3DOAA 4F2LA 3HHZA 3U60B 1PJTA 1BVSA 2DENA 4GH9A 1QAQA 2CV0A 1D0LA 4LG2A 5EP1A 2QBYA 2UUAM 3KFUG 2CHGA 3K9OA 1JR3E 2KNVA 4GC5A 2BJVA 4NXNM 2ZBKB 5DFLA 4G4RA 4PCZA 4GHAA 1HJPA 3DA1A 5EXSA 3OTOM 2DZNB 1SXJD 4G4NA 4RNAA 4JI8M 4FCTA 3I04M 1R7RA 2GQFA 2JUJA 3HHYA 4B7FA 4LCBA 1G3IA 1I4WA 2OOBA 5ITTA 5LMUM 3VDPA 4DV5M 3BOSA 1L1ZA 2KXEA 4LY6A 1T43A 3LVWA 2DHYA 4JV5M 2QSFX 3AJIB 3HJQA 2OPFA 2DWNA 3KW6A 4LGMA 2L4EA 2LWXA 2I7PA 4BBAA 2F5PA 2I7NA 5KPZA 4X65M 1ZV1A 3C3EA 1PGYA 2B3TA 4MGZE 3IECA 1K3XA 1QUSA 2QZ4A 5EP2A 4OX9M 1AIPC 2V1UA 3M0EA 4DV6M 1NJGA 3B7ZA 2AHMA 4LF8M 4MM3B 4JYAM 1WR1B 1TGUA 2HAKA 2ZAMA 2A5YB 4HLQA 4IBJA 7CATA 2Z3XA 3GRUA 1DO0A 2WZJA 2LH0A 1OTRA 5DYIA 4LF7M 2O25A 4JI2M 2J7OA 2RGOA 1V92A 3W67A 2OQ4A 4JI6M 4UN2B 3D8BA 4DR5M 3ILKA 3SAUA 4RF1A 2CHVA 3J2PB 4OVZA 1IN6A 1QYRA 2VQEM 2N35A 3QYBA 1IN7A 3KSXA 1OJLA 3D8LA 4LJ5A 3MJ5A 4AI6A 1PM5A 2FOIC 4GC9A 2F5SA 2Y20A
chains in the Genus database with same CATH topology
2OOAA 3K9PA 3B89A 1YLAA 1ZMVA 2DI0A 1VEGA 1WGLA 2JY7A 2L2DA 1E94E 2LVNC 3T6PA 1WIVA 1MN3A 2LVPC 2ZTDA 3FE3A 1WHCA 1NV9A 1HT1E 1VEKA 1G4AE 2KHHA 1A5TA 3E21A 2CWBA 1DV0A 4GEWA 1T6OA 1IXSA 1EFUB 1SG9A 4WP2A 2DAKA 2EJSA 1F4IA 1KYIA 3H4JA 3E46A 2MGWA 2LBCA 2DAIA 2BWEA 3GLGE 1XB2B 1OKSA 1QZEA 1P3QQ 2RRUA 2OO9A 1VEJA 2JZ0A 1ZMUA 2CP8A 2JY5A 1TR8A 3MMPA 2QNJA 2HWJA 1IM2A 2LTUA 2K0BX 2DAMA 2LVAA 1DO2A 2JP7A 2JZ1A 2L4FA 1Y8GA 4F2LA 3LCVB 1UFZA 3LCUA 2DENA 1BVSA 2K9DA 3IHPA 3K9OA 1JR3E 2KNVA 4G3OA 1CUKA 1IFYA 5DFLA 2JNHA 1HJPA 1WJ7A 2EKFA 2DNAA 2ZTCA 4Q7JA 2JUJA 1G3IA 2OOBA 2R0IA 1HT2E 1HQYE 1R4GA 2MR9A 1T43A 5JI2E 1C7YA 2QHOB 2DHYA 2MJ5B 1ZMWA 2JY8A 2QSFX 2DKLA 1GO5A 1TTEA 2L4EA 4R71A 2DAEA 3FRHA 4HEOA 1ZV1A 1PGYA 1Q02A 2B3TA 3IECA 1VQ1A 1XXHE 1AIPC 3BBZA 3GLHE 1VDLA 3GLIE 1OQYA 4F1IA 1WR1B 3F92A 2MROB 2HAKA 1NV8A 2BWBA 1VG5A 2LVOC 1OAIA 1DO0A 2LVQD 2WZJA 1OTRA 2EKKA 2KNZA 2O25A 1V92A 3GLFE 4UN2B 2KNAA 1WGNA 4DBGB 2G3QA 3FRIA 2H5XA 1G41A 2DAGA 2JY6B 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOA A;  3K9P A;  3B89 A;  1YLA A;  1ZMV A;  2DI0 A;  1VEG A;  1WGL A;  2JY7 A;  2L2D A;  1E94 E;  2LVN C;  3T6P A;  1WIV A;  1MN3 A;  2LVP C;  2ZTD A;  3FE3 A;  1WHC A;  1NV9 A;  1HT1 E;  1VEK A;  1G4A E;  2KHH A;  1A5T A;  3E21 A;  2CWB A;  1DV0 A;  4GEW A;  1T6O A;  1IXS A;  1EFU B;  1SG9 A;  4WP2 A;  2DAK A;  2EJS A;  1F4I A;  1KYI A;  3H4J A;  3E46 A;  2MGW A;  2LBC A;  2DAI A;  2BWE A;  3GLG E;  1XB2 B;  1OKS A;  1QZE A;  1P3Q Q;  2RRU A;  2OO9 A;  1VEJ A;  2JZ0 A;  1ZMU A;  2CP8 A;  2JY5 A;  1TR8 A;  3MMP A;  2QNJ A;  2HWJ A;  1IM2 A;  2LTU A;  2K0B X;  2DAM A;  2LVA A;  1DO2 A;  2JP7 A;  2JZ1 A;  2L4F A;  1Y8G A;  4F2L A;  3LCV B;  1UFZ A;  3LCU A;  2DEN A;  1BVS A;  2K9D A;  3IHP A;  3K9O A;  1JR3 E;  2KNV A;  4G3O A;  1CUK A;  1IFY A;  5DFL A;  2JNH A;  1HJP A;  1WJ7 A;  2EKF A;  2DNA A;  2ZTC A;  4Q7J A;  2JUJ A;  1G3I A;  2OOB A;  2R0I A;  1HT2 E;  1HQY E;  1R4G A;  2MR9 A;  1T43 A;  5JI2 E;  1C7Y A;  2QHO B;  2DHY A;  2MJ5 B;  1ZMW A;  2JY8 A;  2QSF X;  2DKL A;  1GO5 A;  1TTE A;  2L4E A;  4R71 A;  2DAE A;  3FRH A;  4HEO A;  1ZV1 A;  1PGY A;  1Q02 A;  2B3T A;  3IEC A;  1VQ1 A;  1XXH E;  1AIP C;  3BBZ A;  3GLH E;  1VDL A;  3GLI E;  1OQY A;  4F1I A;  1WR1 B;  3F92 A;  2MRO B;  2HAK A;  1NV8 A;  2BWB A;  1VG5 A;  2LVO C;  1OAI A;  1DO0 A;  2LVQ D;  2WZJ A;  1OTR A;  2EKK A;  2KNZ A;  2O25 A;  1V92 A;  3GLF E;  4UN2 B;  2KNA A;  1WGN A;  4DBG B;  2G3Q A;  3FRI A;  2H5X A;  1G41 A;  2DAG A;  2JY6 B;  2DZL A; 
#chains in the Genus database with same CATH topology
 2OOA A;  1SXJ A;  1R5L A;  2G5G X;  3E9S A;  3NBX X;  2UU9 M;  1GJT A;  3H4M A;  2HKJ A;  4LGY A;  1PJQ A;  2QBY B;  1XXH A;  2CEA A;  1IBK M;  2DVW B;  2VII A;  2CV1 A;  1E94 E;  4NOO B;  3SC3 A;  4B3M M;  4M9S A;  3FE3 A;  4G4O A;  4JI1 M;  1S3S A;  2CV2 A;  2R18 A;  1HT1 E;  2LNH C;  3GO8 A;  2XZF A;  1VEK A;  5H37 D;  1FJG M;  3GRV A;  3E21 A;  3FUU A;  4LRT A;  4IBK A;  4JN6 A;  3SHF A;  2ZM6 M;  4B3R M;  4QOZ C;  4LJ4 A;  2DWZ B;  1N33 M;  3V76 A;  3SFZ A;  5C1B A;  1WXQ A;  3GP1 A;  3WHK A;  3L2A A;  1E9S A;  1OFH A;  4GMQ A;  1IXS A;  4M9X A;  1K82 A;  3R8F A;  2DAK A;  1E32 A;  8CAT A;  1V34 A;  3PNY A;  4DR1 M;  4L15 A;  2KA6 B;  3A98 B;  3VK7 A;  2MGW A;  5FTM A;  1G71 A;  3HX3 A;  1OIZ A;  2UXB M;  2BWE A;  3J80 S;  3PNV A;  1XB2 B;  2C96 A;  2RRU A;  3L25 A;  2OO9 A;  2XSZ D;  3RGP A;  4I4L A;  4XK8 F;  3GPP A;  4I81 A;  1D0M A;  3FTD A;  3GRY A;  3DZD A;  2QNJ A;  5KQ8 A;  4GKJ M;  3Q8X A;  2LTU A;  4ZPX A;  1JR3 D;  3LMM A;  4IBG A;  4OVZ B;  4B7H A;  3GPY A;  5DNY A;  4FWH A;  4OU7 A;  3U6M A;  3LCU A;  1TH3 A;  4G4Q A;  5ITR A;  4MGK E;  1SXJ B;  3BXW A;  4BLC A;  3J7B A;  5KPR A;  1IQP A;  4G3O A;  3U5Z B;  2JNH A;  3KVW A;  3ZC7 B;  5EP4 A;  1MJG M;  4GIT A;  2V6Z M;  1Q39 A;  2BJW A;  1YE9 A;  2WSC F;  3U6L A;  2ZTC A;  2YR0 A;  5EXP A;  4KO8 A;  3CF2 A;  1GAB A;  2C99 A;  4DR3 M;  1I94 M;  1EE8 A;  1HT2 E;  1HQY E;  2MR9 A;  3SAT A;  2CFO A;  2QHO B;  5IZ7 D;  2MH8 A;  3LQQ A;  1ZMW A;  3T38 A;  3VKH A;  3KP0 E;  4QHS A;  4D80 A;  1T3T A;  3HKP A;  3TL4 X;  4YHH M;  4AW4 A;  1KFV A;  1IY1 A;  1J7K A;  3CF0 A;  3MHV C;  1Q02 A;  3K92 A;  1VQ1 A;  2XSZ A;  2ZAO A;  1IXS B;  3EIE A;  4ANR A;  1HNX M;  2UXD M;  1IXR C;  1XNR M;  3GLI E;  1OQY A;  1W5T A;  2HL7 A;  4G6Z A;  4F1I A;  1JR3 A;  2MRO B;  2X8A A;  1NV8 A;  4AG6 A;  2BWB A;  2P5T A;  1VG5 A;  4L4U A;  3U6Q A;  5EJC A;  2M60 A;  1N77 A;  1TDH A;  2EKK A;  2KNZ A;  2KEB A;  4LFC M;  3TWM A;  3C58 A;  5BPV A;  4IBD A;  4P16 A;  1NNU C;  4IIW A;  4MGI E;  3FRI A;  2V1C A;  4LZZ A;  4PDG A;  2JY6 B;  1L8Q A;  2DAG A;  1QDT A;  2Y0Q A;  2Z4R A;  1IN4 A;  4LF9 M;  1GL6 A;  4LF5 M;  1TH2 A;  2X49 A;  3RFW A;  5KO3 A;  3B89 A;  1HQC A;  5FTN A;  3FYC A;  3SHG B;  2JY7 A;  4DV2 M;  3I4Y A;  3LQR A;  3RGS A;  2L09 A;  3ZCB B;  4KHP M;  2Z7J A;  2QP9 X;  4MB7 A;  4OW0 A;  4QNR A;  4I8O A;  5EP3 A;  3KSJ A;  2F5Q A;  1RU3 A;  1A5T A;  2DWL A;  2YNM D;  1Q3C A;  1L2D A;  2EUC A;  3AFH A;  4WW0 A;  4GEW A;  2XLJ A;  1XWI A;  3HU1 A;  1V33 A;  3SYL A;  1PJI A;  4DV0 M;  2KDL A;  4NRV A;  3GQ3 A;  3J81 S;  1OFI A;  1OIP A;  3U5Z A;  4AZF A;  4FW9 A;  2R44 A;  2XF3 A;  3TE6 A;  2UUC M;  3E46 A;  2LBC A;  3U6S A;  3HZJ A;  1VDD A;  2QPA A;  3GPX A;  3GLG E;  1L2C A;  1OKS A;  4B3S M;  2D7G A;  3GLI B;  1P3Q Q;  3TPZ A;  2EO2 A;  2JZ0 A;  4QHT A;  4Z8X A;  3AKZ A;  4LF6 M;  2G8L A;  2F5O A;  1HNW M;  2CP8 A;  1Q3B A;  2JY5 A;  5ITX E;  2K47 A;  2W82 A;  4MH0 E;  5C18 A;  2XFT A;  3MMP A;  5FSW A;  1N34 M;  5IT9 S;  3M7G A;  1QVR A;  4PT5 A;  3EIH A;  5ITX A;  2K0B X;  3VLF B;  2ZAN A;  2JZ1 A;  1MX0 A;  4FD2 A;  5BR8 M;  3J7A S;  2C9O A;  4M0D A;  4S12 A;  1QUT A;  3HU3 A;  4P17 A;  1IBL M;  2K9D A;  5FTJ A;  3IHP A;  1IN8 A;  1DGH B;  1Z5B A;  3AOE C;  2R65 A;  2D7H A;  2QQ8 A;  3A45 A;  1K3W A;  2YQZ A;  1CUK A;  3KOW E;  3K2L A;  5ITU A;  3KOX E;  3AL0 C;  3L28 A;  3SAS A;  2R4J A;  3M6A A;  2E5L M;  4D82 A;  2EKF A;  3FTC A;  4Z6Y A;  3SAR A;  4IJE A;  2KRK A;  3HJ8 A;  3NWL A;  4WUR A;  1IN5 A;  2H1R A;  4B7G A;  3JR5 A;  3KDS E;  2O5R A;  5GKN A;  4LFA M;  3UMM A;  4PDI A;  1GVN A;  4TUW A;  1JB0 F;  2LXE A;  3KOZ E;  3T1H M;  3U6C A;  2XZU A;  3DFZ A;  1X37 A;  2MJ5 B;  3B7Q A;  3U6O A;  1N78 A;  4GRI A;  3FD9 A;  1XMO M;  4CJ6 A;  2DAE A;  4HEO A;  3W0F A;  1Z59 A;  2DWM A;  3JAM S;  1OAO C;  3GLH E;  2VQF M;  4AQY M;  2VF7 A;  2JXN A;  5JI3 E;  4L78 A;  1IXZ A;  1N75 A;  3GLH A;  2ERC A;  2M5Z A;  3HJS A;  4X64 M;  3SYK A;  1XNQ M;  4NSO B;  5EXX A;  4CIZ A;  4KOD A;  1QAM A;  2LVO C;  4X62 M;  3I01 M;  4NXM M;  2LVQ D;  2JA2 A;  1UM8 A;  3GLF E;  5DYG A;  2KNA A;  1WGN A;  4PD2 A;  4DV7 M;  4QOS A;  1NNJ A;  3GLF A;  1ZAE A;  4DV4 M;  4KLN A;  4K0K M;  1PJS A;  4HL4 A;  4GHL A;  1HR0 M;  3GPU A;  3IG5 A;  4II7 A;  1EIJ A;  1N36 M;  2HHH M;  2Q2E B;  3FUX A;  3K9P A;  1W5S A;  1NSF A;  4L6V 6;  1YLA A;  2RKO A;  1NO1 A;  1VEG A;  1SXJ C;  4M0W A;  3HHX A;  1YUB A;  1D0K A;  3JR4 A;  2L2D A;  3IG8 A;  3C9P A;  4QNM A;  5ITY A;  1IY2 A;  2NQ8 C;  3GLI A;  2D7E A;  4NRW A;  2R45 A;  2F4V M;  3R9X B;  3W0L B;  3MK6 A;  3I51 A;  2QCU A;  3SMP A;  2GNO A;  5ITQ A;  4RF0 A;  5F3W A;  5E6J A;  2J5Y A;  1FNN A;  2CWB A;  4JI7 M;  3KXE C;  1DV0 A;  4DV3 M;  2C5R A;  1YSY A;  4R7G A;  2R6F A;  3HWS A;  4LRS A;  5FTK A;  4IBI A;  1DGG A;  4LFB M;  1EFU B;  1SG9 A;  2YFQ A;  3T15 A;  1DGH A;  3FYD A;  3VKG A;  2APL A;  1Z5A A;  4CIS A;  2HCB A;  2KZU A;  3SMS A;  3A42 A;  1NVM A;  4IJF A;  1AUA A;  1F4I A;  4A3V B;  3K1J A;  1KYI A;  3QWL A;  4JI0 M;  3KP1 E;  3W68 A;  3SBJ A;  2DAI A;  1C1K A;  2K6B A;  4RKU F;  3TWK A;  2Y21 A;  4BB9 A;  3B9P A;  2FH0 A;  3VFD A;  4MGY E;  3GLH B;  1HNZ M;  1GJS A;  2Z4S A;  4AKI A;  2FS1 A;  4FWG A;  2FNA A;  4DUZ M;  4LJ7 A;  1VEJ A;  5EXT A;  2CRU A;  4MGH A;  3QAU A;  1LTM A;  1TR8 A;  4IBB A;  3B74 A;  1MU5 A;  2HWJ A;  1NJF A;  3L26 A;  2L7H A;  5KPT A;  2DAM A;  3GQ4 A;  3GLF B;  1PJJ A;  4AKG A;  4DV1 M;  3QYE A;  3FTE A;  3KS4 A;  2L4F A;  1Y8G A;  3THG A;  1UFZ A;  2RGH A;  1NY5 A;  3FTF A;  2QEN A;  4EIW A;  4B3T M;  2EA0 A;  1R2Z A;  2R62 A;  2DZO B;  3U61 B;  2J7N A;  4IBE A;  4I5S A;  4XBO A;  2KW0 A;  3AOG A;  3L29 A;  1IFY A;  1G8P A;  4DR7 M;  2CE7 A;  3CGW A;  4JI5 M;  1QZM A;  2KZS A;  1WJ7 A;  4AKH A;  2DNA A;  4LJ8 A;  2JWS A;  4Q7J A;  2R46 A;  3PVS A;  3A46 A;  4CGY B;  3FUT A;  3GLG A;  2R0I A;  1J09 A;  3CF6 E;  4GIP A;  3U6E A;  2Z8Y M;  3LVV A;  3NBI A;  1R4G A;  3SAW A;  4Y28 F;  5JI2 E;  1C7Y A;  1IBM M;  3KS8 A;  2DHR A;  1J5E M;  1SXJ E;  4M9Z A;  2JY8 A;  4LJA A;  1NHG C;  2FFJ A;  3B7N A;  1QQW A;  2DKL A;  3C3D A;  3HHW A;  3VK8 A;  1GO5 A;  1TTE A;  4R71 A;  3FRH A;  2XGN A;  1XXH E;  1E9R A;  3VDU A;  1Z6T A;  1H6U A;  2CHQ A;  3BBZ A;  4LJ9 A;  4LF4 M;  1VDL A;  1QAO A;  2LHC A;  2R4E A;  3FKE A;  1GKI A;  5FLX S;  4FVM A;  2XFS A;  3U6D A;  2VF8 A;  1L2B A;  3F92 A;  1NY6 A;  4DR2 M;  4ITQ A;  1OAI A;  4JI4 M;  3FUW A;  4DUY M;  1GLN A;  4DR4 M;  3I4V A;  4DBG B;  1NHW C;  3E4R A;  5IRE B;  4GKK M;  1ZQ9 A;  1DGB A;  2G3Q A;  3HY5 A;  4JXJ A;  4NL4 H;  1L1T A;  4L16 A;  3TQS A;  2H5X A;  4D81 A;  2UUB M;  4B08 A;  1G41 A;  4KT0 F;  5EQT A;  3U60 A;  1TDZ A;  4DR6 M;  2DZL A;  4X66 M;  1PRB A;  3K8Z A;  2XEP A;  5FTL A;  2L7I A;  2VDB B;  3UZU A;  1ZMV A;  2DI0 A;  1JQJ C;  4JI3 M;  1XHB A;  2XH9 A;  1TH4 A;  1WGL A;  2CUZ A;  3TWL A;  4NSR A;  2Y0T A;  2O01 F;  4YY3 M;  1R2Y A;  2F5N A;  1R6B X;  4L8R C;  1QAN A;  1N32 M;  5KQD A;  1KSF X;  4R3D A;  2LVN C;  5L8R F;  3T6P A;  1WIV A;  1MN3 A;  2LVP C;  2ZTD A;  1WHC A;  4NC6 A;  1Z5C A;  1NV9 A;  2WSE F;  3UJN A;  1G4A E;  2KHH A;  2L6O A;  3PXG A;  2LHG A;  3GRR A;  3GLG B;  4IBF A;  1T6O A;  4IBC A;  4AG5 A;  1D2N A;  1GL7 A;  2KRU A;  3GQ5 A;  3CTW B;  1IY0 A;  3FUV A;  2DXI A;  4CHT B;  3SAV A;  3UGJ A;  4WP2 A;  3U61 A;  1TF0 B;  4W5W A;  3HU2 A;  2X4A A;  3HGI A;  4FWD A;  2EJS A;  3PFI A;  3H4J A;  3ZH9 B;  5LMN M;  1XXH B;  2C9C A;  4FCW A;  5A2Q S;  3T1Y M;  2WSF F;  2FE8 A;  1G59 A;  3U6P A;  1QZE A;  4LJ6 A;  4FCV A;  4XGI A;  1QDR A;  3RE8 A;  1XC8 A;  3KOY E;  1ZMU A;  3LW5 F;  3ZQJ A;  5E26 A;  3WHL A;  1ORY B;  4REZ A;  2UXC M;  3UK6 A;  2BNK A;  2C98 A;  1IM2 A;  4LZJ A;  3J27 B;  2LVA A;  1DO2 A;  3L27 A;  1XMQ M;  2JP7 A;  1LV7 A;  1DGF A;  5IWA M;  3Q8G A;  3AOE A;  3LCV B;  3AV0 A;  3DOA A;  4F2L A;  3HHZ A;  3U60 B;  1PJT A;  1BVS A;  2DEN A;  4GH9 A;  1QAQ A;  2CV0 A;  1D0L A;  4LG2 A;  5EP1 A;  2QBY A;  2UUA M;  3KFU G;  2CHG A;  3K9O A;  1JR3 E;  2KNV A;  4GC5 A;  2BJV A;  4NXN M;  2ZBK B;  5DFL A;  4G4R A;  4PCZ A;  4GHA A;  1HJP A;  3DA1 A;  5EXS A;  3OTO M;  2DZN B;  1SXJ D;  4G4N A;  4RNA A;  4JI8 M;  4FCT A;  3I04 M;  1R7R A;  2GQF A;  2JUJ A;  3HHY A;  4B7F A;  4LCB A;  1G3I A;  1I4W A;  2OOB A;  5ITT A;  5LMU M;  3VDP A;  4DV5 M;  3BOS A;  1L1Z A;  2KXE A;  4LY6 A;  1T43 A;  3LVW A;  2DHY A;  4JV5 M;  2QSF X;  3AJI B;  3HJQ A;  2OPF A;  2DWN A;  3KW6 A;  4LGM A;  2L4E A;  2LWX A;  2I7P A;  4BBA A;  2F5P A;  2I7N A;  5KPZ A;  4X65 M;  1ZV1 A;  3C3E A;  1PGY A;  2B3T A;  4MGZ E;  3IEC A;  1K3X A;  1QUS A;  2QZ4 A;  5EP2 A;  4OX9 M;  1AIP C;  2V1U A;  3M0E A;  4DV6 M;  1NJG A;  3B7Z A;  2AHM A;  4LF8 M;  4MM3 B;  4JYA M;  1WR1 B;  1TGU A;  2HAK A;  2ZAM A;  2A5Y B;  4HLQ A;  4IBJ A;  7CAT A;  2Z3X A;  3GRU A;  1DO0 A;  2WZJ A;  2LH0 A;  1OTR A;  5DYI A;  4LF7 M;  2O25 A;  4JI2 M;  2J7O A;  2RGO A;  1V92 A;  3W67 A;  2OQ4 A;  4JI6 M;  4UN2 B;  3D8B A;  4DR5 M;  3ILK A;  3SAU A;  4RF1 A;  2CHV A;  3J2P B;  4OVZ A;  1IN6 A;  1QYR A;  2VQE M;  2N35 A;  3QYB A;  1IN7 A;  3KSX A;  1OJL A;  3D8L A;  4LJ5 A;  3MJ5 A;  4AI6 A;  1PM5 A;  2FOI C;  4GC9 A;  2F5S A;  2Y20 A; 
#chains in the Genus database with same CATH homology
 2OOA A;  3K9P A;  3B89 A;  1YLA A;  1ZMV A;  2DI0 A;  1VEG A;  1WGL A;  2JY7 A;  2L2D A;  1E94 E;  2LVN C;  3T6P A;  1WIV A;  1MN3 A;  2LVP C;  2ZTD A;  3FE3 A;  1WHC A;  1NV9 A;  1HT1 E;  1VEK A;  1G4A E;  2KHH A;  1A5T A;  3E21 A;  2CWB A;  1DV0 A;  4GEW A;  1T6O A;  1IXS A;  1EFU B;  1SG9 A;  4WP2 A;  2DAK A;  2EJS A;  1F4I A;  1KYI A;  3H4J A;  3E46 A;  2MGW A;  2LBC A;  2DAI A;  2BWE A;  3GLG E;  1XB2 B;  1OKS A;  1QZE A;  1P3Q Q;  2RRU A;  2OO9 A;  1VEJ A;  2JZ0 A;  1ZMU A;  2CP8 A;  2JY5 A;  1TR8 A;  3MMP A;  2QNJ A;  2HWJ A;  1IM2 A;  2LTU A;  2K0B X;  2DAM A;  2LVA A;  1DO2 A;  2JP7 A;  2JZ1 A;  2L4F A;  1Y8G A;  4F2L A;  3LCV B;  1UFZ A;  3LCU A;  2DEN A;  1BVS A;  2K9D A;  3IHP A;  3K9O A;  1JR3 E;  2KNV A;  4G3O A;  1CUK A;  1IFY A;  5DFL A;  2JNH A;  1HJP A;  1WJ7 A;  2EKF A;  2DNA A;  2ZTC A;  4Q7J A;  2JUJ A;  1G3I A;  2OOB A;  2R0I A;  1HT2 E;  1HQY E;  1R4G A;  2MR9 A;  1T43 A;  5JI2 E;  1C7Y A;  2QHO B;  2DHY A;  2MJ5 B;  1ZMW A;  2JY8 A;  2QSF X;  2DKL A;  1GO5 A;  1TTE A;  2L4E A;  4R71 A;  2DAE A;  3FRH A;  4HEO A;  1ZV1 A;  1PGY A;  1Q02 A;  2B3T A;  3IEC A;  1VQ1 A;  1XXH E;  1AIP C;  3BBZ A;  3GLH E;  1VDL A;  3GLI E;  1OQY A;  4F1I A;  1WR1 B;  3F92 A;  2MRO B;  2HAK A;  1NV8 A;  2BWB A;  1VG5 A;  2LVO C;  1OAI A;  1DO0 A;  2LVQ D;  2WZJ A;  1OTR A;  2EKK A;  2KNZ A;  2O25 A;  1V92 A;  3GLF E;  4UN2 B;  2KNA A;  1WGN A;  4DBG B;  2G3Q A;  3FRI A;  2H5X A;  1G41 A;  2DAG A;  2JY6 B;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...