2OOAA

Crystal structure of the uba domain from cbl-b ubiquitin ligase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
b'VDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ooaA00
3GLFE 1KYIA 2EKKA 4WP2A 1Y8GA 2LVQD 2MGWA 4HEOA 1HQYE 5JI2E 2HAKA 2CP8A 1WIVA 1UFZA 1T6OA 1OKSA 2MROB 2JZ1A 2ZTCA 1WHCA 1WR1B 2DAMA 2K9DA 3BBZA 1VG5A 1Q02A 3LCVB 2DAIA 2DENA 1IFYA 1GO5A 3GLGE 1R4GA 3FRHA 4Q7JA 2JY8A 1WJ7A 3MMPA 2KHHA 3F92A 3GLHE 1G3IA 4F1IA 1IXSA 3FRIA 2LVOC 2R0IA 2DAGA 1HJPA 2LTUA 1G4AE 3FE3A 1TR8A 2BWEA 1OQYA 2LVAA 1DO0A 2MR9A 2DAKA 4GEWA 2G3QA 1VEKA 3E21A 1PGYA 2OOAA 2DNAA 2B3TA 4F2LA 1ZMVA 4UN2B 1XXHE 2KNAA 1VEJA 3IHPA 1ZMWA 1G41A 1BVSA 2L4EA 1V92A 1OTRA 2JY5A 1SG9A 2L4FA 2DKLA 2OOBA 2DAEA 2QHOB 2H5XA 1HT1E 1ZMUA 5DFLA 1P3QQ 2LVPC 2QNJA 4G3OA 3GLIE 1T43A 1CUKA 2JY6B 1DO2A 1VQ1A 2JY7A 2EJSA 2JUJA 2DHYA 3K9PA 1EFUB 1A5TA 1NV8A 3LCUA 1WGLA 1HT2E 1C7YA 1XB2B 1NV9A 2ZTDA 2JZ0A 4R71A 2DI0A 2EKFA 1WGNA 2RRUA 1YLAA 1IM2A 2LVNC 1DV0A 2K0BX 1ZV1A 3K9OA 1QZEA 3H4JA 2HWJA 2KNZA 3B89A 2LBCA 4DBGB 1VDLA 2MJ5B 1F4IA 1VEGA 2DZLA 2JP7A 2OO9A 1MN3A 2O25A 2L2DA 3T6PA 2BWBA 2KNVA 3IECA 1E94E 1OAIA 1AIPC 1JR3E 2JNHA 3E46A 2QSFX 2CWBA 2WZJA 1TTEA
chains in the Genus database with same CATH superfamily
3TWKA 2M60A 2EKKA 3AJIB 2OPFA 4IBGA 2D7HA 4LRSA 4D82A 2UUAM 3GLHA 5JI2E 3UGJA 4CJ6A 3FUWA 1OIPA 1N32M 2M5ZA 3R9XB 2XGNA 2Y0QA 3AOEC 3KOXE 4KODA 2DAIA 4LFBM 2J7NA 4LF4M 3FYDA 1X37A 2C9OA 3RGSA 1SXJD 1C1KA 3GRRA 4OVZB 3GLGE 1QZMA 4MGKE 3SASA 3SAWA 3MMPA 5E6JA 1YSYA 1LTMA 2BJVA 3FD9A 3I4YA 1G3IA 3UK6A 4F1IA 3OTOM 1K82A 1Z6TA 4LF5M 2D7EA 3HJQA 4FVMA 4REZA 3FRIA 2QPAA 4LF8M 1GJSA 1DGHB 2A5YB 4IBBA 2H1RA 2MR9A 3KS4A 2DAKA 4FCTA 4GEWA 4BLCA 1MU5A 4DV0M 5BPVA 3K1JA 1PGYA 4DR2M 3D8LA 1R2YA 3KS8A 3A46A 4KLNA 1HQCA 5FTMA 3GLGB 5FTNA 1XMOM 4I5SA 7CATA 4JYAM 3KOYE 2Q2EB 1XXHE 3A98B 2I7PA 1AUAA 1VEJA 3IHPA 4MM3B 4JI1M 3L25A 3CF2A 4IBDA 3T38A 4WW0A 2X49A 1V92A 3B74A 2JY5A 3J2PB 3LW5F 4P16A 3KXEC 4XK8F 2DAEA 3THGA 3ZH9B 2APLA 2V6ZM 4PD2A 4NSOB 2H5XA 3J27B 2AHMA 2FE8A 5DFLA 3W0FA 3GRUA 1XHBA 4BBAA 1D2NA 3U6SA 2WSFF 1CUKA 5KPTA 3KVWA 1QUTA 2JY6B 3SMPA 3TL4X 3M0EA 3ZC7B 2JA2A 3SAVA 3K2LA 1XXHB 1KFVA 2CHQA 4AI6A 1VQ1A 2JY7A 1QANA 3KOZE 1XNQM 2EJSA 2R45A 3HX3A 2JUJA 2DHYA 3NBIA 4X62M 3HHZA 5LMUM 3TWMA 2NQ8C 2XF3A 1IQPA 3GQ3A 2CHVA 1OJLA 4AQYM 2Y21A 5H37D 1DGGA 2L7HA 2DWLA 5GKNA 1WGLA 4L16A 1PM5A 1TH2A 1XB2B 1C7YA 4FWHA 3VFDA 1NV9A 4R71A 1QDTA 4X64M 2RRUA 1WGNA 4YHHM 1WXQA 1YLAA 1ZQ9A 2XSZD 4JI7M 4MGZE 5KPZA 1XNRM 4DR5M 4B7FA 3U6OA 3SAUA 1D0LA 2FH0A 1L1ZA 3HHXA 2WSEF 3H4JA 2DXIA 3VK7A 4NOOB 3HU1A 4HL4A 3B7NA 2LBCA 1VDLA 5FTKA 3UZUA 1DGHA 1T3TA 3GRYA 4JI2M 2OO9A 1MN3A 2K47A 2L2DA 2O25A 2EO2A 4MB7A 3I51A 2JNHA 2Z7JA 2QSFX 4L4UA 2Y20A 1QYRA 3FUUA 3AKZA 1I94M 4GKJM 4LF9M 4ANRA 2D7GA 2LVQD 2EUCA 3TPZA 1QUSA 2R62A 2RGOA 3QAUA 4LJ4A 4IIWA 3AOGA 5EXTA 1JR3D 1LV7A 2R6FA 2ERCA 4XBOA 2R46A 2CP8A 3FUVA 1UFZA 1T6OA 4M9SA 3I4VA 3T1HM 2MROB 3C3EA 2F5PA 4GHAA 2ZTCA 1WHCA 1WR1B 2DAMA 2K9DA 2O5RA 2C9CA 2ZAMA 3BBZA 3HKPA 3VLFB 3EIHA 1EIJA 4DUZM 5EXSA 4G6ZA 3J7BA 3FUTA 5C18A 4Q7JA 3BXWA 3FTCA 1IN8A 1R6BX 2KHHA 3KP1E 4JN6A 4NL4H 1FNNA 2C5RA 3W67A 1FJGM 3KFUG 1J7KA 2P5TA 5EP1A 2DHRA 3JAMS 4OU7A 1IXSA 3Q8GA 4JI5M 1IBMM 1TF0B 4LGMA 3DA1A 5ITTA 1YE9A 2XFTA 2LTUA 4DV3M 1G4AE 5EQTA 2CHGA 2BWEA 3A45A 3DFZA 1DO0A 4MGHA 3CF6E 1D0KA 3ZQJA 1E9RA 1VEKA 1SXJA 3FUXA 4DV2M 4QHTA 2DWNA 2I7NA 3TQSA 5DYGA 4ZPXA 5A2QS 1YUBA 1N33M 3M7GA 4JI4M 2B3TA 3U61B 3R8FA 1ZMVA 3K92A 1XC8A 3H4MA 1QQWA 2L6OA 2KNAA 1Q3BA 4M0DA 2LWXA 3MK6A 1N75A 1Z59A 4KT0F 1SG9A 4LG2A 2L4FA 1L1TA 1NVMA 2DKLA 2Z4RA 4MGIE 1S3SA 2N35A 2XLJA 2QQ8A 1ZMUA 4IBKA 1N34M 2BNKA 1Z5CA 1P3QQ 4Y28F 3GRVA 1TH3A 4II7A 2RKOA 2C96A 5ITQA 3RFWA 3GLIE 3U6QA 2L7IA 1N77A 4D80A 3PNVA 2KDLA 3B9PA 1MJGM 4RF0A 3SATA 3J81S 1OFIA 5KQ8A 5FTJA 3KOWE 3IG8A 3KSXA 4FWGA 4GITA 4NXMM 4X66M 3BOSA 4MGYE 1A5TA 3VDPA 1DGFA 4QNRA 5ITYA 1OFHA 4NC6A 2R4EA 2VF7A 4KO8A 4KHPM 2F5QA 3GPPA 1G71A 4NXNM 4AKGA 5FSWA 2ZTDA 1IN5A 2DI0A 1E32A 3GLIB 1SXJE 4R7GA 2QZ4A 2LVNC 1XWIA 1ORYB 1J5EM 3ILKA 3QYEA 4IBJA 3LQRA 2FOIC 1QZEA 4B3RM 1E9SA 1KSFX 2HWJA 3C9PA 2GNOA 4L15A 4LCBA 4DBGB 1IY0A 4QOZC 1GL6A 1IXZA 1NJFA 2LHGA 2MJ5B 4GH9A 3UMMA 4DV1M 4DV4M 1IXSB 2BWBA 3E46A 1QAQA 4QNMA 1L2BA 2WZJA 3HWSA 4LJAA 4QOSA 4X65M 1PJIA 2JWSA 4B3TM 1KYIA 3GQ4A 3GPXA 3U61A 2DZNB 1SXJB 1Y8GA 1NSFA 2MGWA 4CISA 3B7ZA 5DNYA 4LZJA 2ZBKB 1HQYE 2RGHA 4B3SM 2F5SA 2KZUA 2VQEM 3WHKA 1G59A 2V1UA 3T1YM 1OKSA 3I04M 3T15A 3AOEA 2JZ1A 2YFQA 1GKIA 1VG5A 1Q02A 2ZANA 3LVWA 3PFIA 1PJJA 3I01M 1IBLM 2BJWA 4L6V6 5ITUA 2KZSA 4A3VB 4LRTA 3U6CA 1R4GA 1W5TA 2LHCA 3QWLA 2Y0TA 4CGYB 4PCZA 5KPRA 2OQ4A 1HNXM 3F92A 4AZFA 4B3MM 1MX0A 4IBIA 3GQ5A 1PJSA 4AKHA 1J09A 2QENA 2LVOC 2R0IA 1L2DA 1HJPA 2Z3XA 4DV5M 3SYLA 3NWLA 2UXCM 2XZUA 1TR8A 1L8QA 1OQYA 2LVAA 5IWAM 2R65A 2FS1A 2J7OA 1ZAEA 1HNZM 4EIWA 3GPYA 3SC3A 4M0WA 2X4AA 4IJFA 1XMQM 4JI3M 2OOAA 3HJ8A 2C99A 1GJTA 3HHYA 5L8RF 5EJCA 3GLIA 2DNAA 3L2AA 3TE6A 5KQDA 5EXPA 4AW4A 4UN2B 3L28A 3W68A 1QDRA 3U6DA 1V33A 1NHWC 1IY2A 2J5YA 4PT5A 4XGIA 3SHGB 1ZMWA 3AV0A 1G41A 2CUZA 2CV2A 1BVSA 3D8BA 1DGBA 1Z5BA 4IJEA 3SMSA 2HCBA 3DZDA 3E4RA 3GPUA 1R2ZA 2ZM6M 1NJGA 5FLXS 4L8RC 4K0KM 2YQZA 2DZOB 3GLFA 3FYCA 4JV5M 1R5LA 1HT1E 3CGWA 4Z6YA 5LMNM 2QNJA 1T43A 2YNMD 1QAOA 4GRIA 4G4QA 2F5NA 3KW6A 4IBEA 3QYBA 1IBKM 2XH9A 4I81A 4GMQA 4BB9A 3EIEA 2F5OA 2X8AA 4LFAM 2XZFA 3SFZA 4G4NA 3SYKA 5E26A 1NNJA 4WURA 5IZ7D 2KA6B 3K9PA 3RGPA 1EFUB 4B7GA 4DR6M 4GC5A 4G4OA 4DR4M 4GHLA 2HL7A 1OIZA 2LNHC 3LVVA 3WHLA 3U6PA 2GQFA 3LCUA 2XEPA 2QBYA 2DVWB 2L09A 3CF0A 4DR3M 2G5GX 2JZ0A 3CTWB 5ITXA 1L2CA 2EKFA 4QHSA 3AL0C 2ZAOA 2KRUA 1W5SA 2VQFM 1DV0A 1TDZA 4OW0A 2K0BX 5DYIA 1ZV1A 1R7RA 2LH0A 4FW9A 4HLQA 5EP4A 3VDUA 4B7HA 3MHVC 1NY6A 2KNZA 3B7QA 4RNAA 4LJ8A 4JI6M 1OAOC 1G8PA 1TDHA 2Z4SA 5EP2A 4CHTB 1VEGA 2DZLA 4NSRA 3U5ZB 1K3XA 2JP7A 5ITRA 3VK8A 4R3DA 1PRBA 1E94E 1OAIA 4M9ZA 5IT9S 3M6AA 1H6UA 4LJ5A 3HGIA 3GLFE 3ZCBB 1I4WA 1NHGC 1RU3A 4W5WA 1GLNA 4WP2A 4G4RA 2CV1A 4GIPA 3MJ5A 3KSJA 4HEOA 2EA0A 1IXRC 1QVRA 2HAKA 4PDGA 4OX9M 4AG5A 1WIVA 3UJNA 3U60A 3GP1A 3JR4A 3L27A 2C98A 4NRVA 3LCVB 3FTFA 2DENA 2WSCF 1IFYA 4NRWA 1QAMA 3L26A 1NO1A 1GO5A 2UUCM 1Q39A 2FNAA 3FRHA 5EP3A 4B08A 3GLFB 2JY8A 2Z8YM 1WJ7A 2E5LM 2DWZB 3FTDA 1IN7A 3Q8XA 3RE8A 4AKIA 3GO8A 2UXDM 3HU3A 3GLHE 2CE7A 4I8OA 1JQJC 4LJ9A 4RKUF 5JI3E 5ITXE 1N78A 4LJ6A 2XSZA 2JXNA 3HU2A 3VKHA 2F4VM 3KDSE 4LGYA 2DWMA 2DAGA 4LZZA 2KRKA 3FE3A 5KO3A 3TWLA 4TUWA 4JI0M 5EXXA 2UUBM 2G3QA 3V76A 3E21A 1VDDA 1SXJC 3HJSA 3K8ZA 4LY6A 8CATA 1HR0M 4DR7M 4LJ7A 4Z8XA 3U6LA 1IY1A 4M9XA 3A42A 3DOAA 4MH0E 4F2LA 1K3WA 4AG6A 2QBYB 1GABA 1NNUC 2UXBM 3HZJA 2YR0A 3LQQA 2KEBA 3FKEA 2CEAA 3GLHB 1UM8A 5F3WA 4FD2A 5IREB 2G8LA 2L4EA 2HHHM 1OTRA 1JR3A 2CRUA 3W0LB 3U5ZA 3HY5A 2OOBA 3L29A 4CIZA 4OVZA 2UU9M 2QHOB 4IBCA 3NBXX 1V34A 3HHWA 4ITQA 3E9SA 2QCUA 2LVPC 1PJTA 4FCVA 4IBFA 1PJQA 2R4JA 4G3OA 3PXGA 3C58A 1Q3CA 2CFOA 4DV7M 4LFCM 3SHFA 1DO2A 2VDBB 1D0MA 4RF1A 1IN6A 2VIIA 5BR8M 1TGUA 2FFJA 2CV0A 2VF8A 3PNYA 3U6EA 2HKJA 4FCWA 4S12A 4JXJA 1NV8A 1NY5A 3GLGA 3U6MA 3SARA 3AFHA 3KP0E 4FWDA 1EE8A 2MH8A 3U60B 3VKGA 1HT2E 3J7AS 4PDIA 2R44A 2LXEA 4L78A 4D81A 4LF7M 2K6BA 1TH4A 1IM2A 2O01F 2W82A 3LMMA 4DV6M 4DUYM 1JB0F 3K9OA 4DR1M 2XFSA 2QP9X 3IG5A 1GVNA 4YY3M 1Z5AA 3B89A 3J80S 1HNWM 3FTEA 2KW0A 4GKKM 5FTLA 1F4IA 1IN4A 4P17A 4LF6M 1GL7A 2V1CA 3PVSA 4GC9A 3JR5A 2KXEA 4I4LA 4JI8M 3T6PA 2KNVA 3IECA 5C1BA 1AIPC 1JR3E 3SBJA 1N36M 3C3DA 2CWBA 1XXHA 1TTEA 2R18A
chains in the Genus database with same CATH topology
3GLFE 1KYIA 2EKKA 4WP2A 1Y8GA 2LVQD 2MGWA 4HEOA 1HQYE 5JI2E 2HAKA 2CP8A 1WIVA 1UFZA 1T6OA 1OKSA 2MROB 2JZ1A 2ZTCA 1WHCA 1WR1B 2DAMA 2K9DA 3BBZA 1VG5A 1Q02A 3LCVB 2DAIA 2DENA 1IFYA 1GO5A 3GLGE 1R4GA 3FRHA 4Q7JA 2JY8A 1WJ7A 3MMPA 2KHHA 3F92A 3GLHE 1G3IA 4F1IA 1IXSA 3FRIA 2LVOC 2R0IA 2DAGA 1HJPA 2LTUA 1G4AE 3FE3A 1TR8A 2BWEA 1OQYA 2LVAA 1DO0A 2MR9A 2DAKA 4GEWA 2G3QA 1VEKA 3E21A 1PGYA 2OOAA 2DNAA 2B3TA 4F2LA 1ZMVA 4UN2B 1XXHE 2KNAA 1VEJA 3IHPA 1ZMWA 1G41A 1BVSA 2L4EA 1V92A 1OTRA 2JY5A 1SG9A 2L4FA 2DKLA 2OOBA 2DAEA 2QHOB 2H5XA 1HT1E 1ZMUA 5DFLA 1P3QQ 2LVPC 2QNJA 4G3OA 3GLIE 1T43A 1CUKA 2JY6B 1DO2A 1VQ1A 2JY7A 2EJSA 2JUJA 2DHYA 3K9PA 1EFUB 1A5TA 1NV8A 3LCUA 1WGLA 1HT2E 1C7YA 1XB2B 1NV9A 2ZTDA 2JZ0A 4R71A 2DI0A 2EKFA 1WGNA 2RRUA 1YLAA 1IM2A 2LVNC 1DV0A 2K0BX 1ZV1A 3K9OA 1QZEA 3H4JA 2HWJA 2KNZA 3B89A 2LBCA 4DBGB 1VDLA 2MJ5B 1F4IA 1VEGA 2DZLA 2JP7A 2OO9A 1MN3A 2O25A 2L2DA 3T6PA 2BWBA 2KNVA 3IECA 1E94E 1OAIA 1AIPC 1JR3E 2JNHA 3E46A 2QSFX 2CWBA 2WZJA 1TTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLF E;  1KYI A;  2EKK A;  4WP2 A;  1Y8G A;  2LVQ D;  2MGW A;  4HEO A;  1HQY E;  5JI2 E;  2HAK A;  2CP8 A;  1WIV A;  1UFZ A;  1T6O A;  1OKS A;  2MRO B;  2JZ1 A;  2ZTC A;  1WHC A;  1WR1 B;  2DAM A;  2K9D A;  3BBZ A;  1VG5 A;  1Q02 A;  3LCV B;  2DAI A;  2DEN A;  1IFY A;  1GO5 A;  3GLG E;  1R4G A;  3FRH A;  4Q7J A;  2JY8 A;  1WJ7 A;  3MMP A;  2KHH A;  3F92 A;  3GLH E;  1G3I A;  4F1I A;  1IXS A;  3FRI A;  2LVO C;  2R0I A;  2DAG A;  1HJP A;  2LTU A;  1G4A E;  3FE3 A;  1TR8 A;  2BWE A;  1OQY A;  2LVA A;  1DO0 A;  2MR9 A;  2DAK A;  4GEW A;  2G3Q A;  1VEK A;  3E21 A;  1PGY A;  2OOA A;  2DNA A;  2B3T A;  4F2L A;  1ZMV A;  4UN2 B;  1XXH E;  2KNA A;  1VEJ A;  3IHP A;  1ZMW A;  1G41 A;  1BVS A;  2L4E A;  1V92 A;  1OTR A;  2JY5 A;  1SG9 A;  2L4F A;  2DKL A;  2OOB A;  2DAE A;  2QHO B;  2H5X A;  1HT1 E;  1ZMU A;  5DFL A;  1P3Q Q;  2LVP C;  2QNJ A;  4G3O A;  3GLI E;  1T43 A;  1CUK A;  2JY6 B;  1DO2 A;  1VQ1 A;  2JY7 A;  2EJS A;  2JUJ A;  2DHY A;  3K9P A;  1EFU B;  1A5T A;  1NV8 A;  3LCU A;  1WGL A;  1HT2 E;  1C7Y A;  1XB2 B;  1NV9 A;  2ZTD A;  2JZ0 A;  4R71 A;  2DI0 A;  2EKF A;  1WGN A;  2RRU A;  1YLA A;  1IM2 A;  2LVN C;  1DV0 A;  2K0B X;  1ZV1 A;  3K9O A;  1QZE A;  3H4J A;  2HWJ A;  2KNZ A;  3B89 A;  2LBC A;  4DBG B;  1VDL A;  2MJ5 B;  1F4I A;  1VEG A;  2DZL A;  2JP7 A;  2OO9 A;  1MN3 A;  2O25 A;  2L2D A;  3T6P A;  2BWB A;  2KNV A;  3IEC A;  1E94 E;  1OAI A;  1AIP C;  1JR3 E;  2JNH A;  3E46 A;  2QSF X;  2CWB A;  2WZJ A;  1TTE A; 
#chains in the Genus database with same CATH topology
 3TWK A;  2M60 A;  2EKK A;  3AJI B;  2OPF A;  4IBG A;  2D7H A;  4LRS A;  4D82 A;  2UUA M;  3GLH A;  5JI2 E;  3UGJ A;  4CJ6 A;  3FUW A;  1OIP A;  1N32 M;  2M5Z A;  3R9X B;  2XGN A;  2Y0Q A;  3AOE C;  3KOX E;  4KOD A;  2DAI A;  4LFB M;  2J7N A;  4LF4 M;  3FYD A;  1X37 A;  2C9O A;  3RGS A;  1SXJ D;  1C1K A;  3GRR A;  4OVZ B;  3GLG E;  1QZM A;  4MGK E;  3SAS A;  3SAW A;  3MMP A;  5E6J A;  1YSY A;  1LTM A;  2BJV A;  3FD9 A;  3I4Y A;  1G3I A;  3UK6 A;  4F1I A;  3OTO M;  1K82 A;  1Z6T A;  4LF5 M;  2D7E A;  3HJQ A;  4FVM A;  4REZ A;  3FRI A;  2QPA A;  4LF8 M;  1GJS A;  1DGH B;  2A5Y B;  4IBB A;  2H1R A;  2MR9 A;  3KS4 A;  2DAK A;  4FCT A;  4GEW A;  4BLC A;  1MU5 A;  4DV0 M;  5BPV A;  3K1J A;  1PGY A;  4DR2 M;  3D8L A;  1R2Y A;  3KS8 A;  3A46 A;  4KLN A;  1HQC A;  5FTM A;  3GLG B;  5FTN A;  1XMO M;  4I5S A;  7CAT A;  4JYA M;  3KOY E;  2Q2E B;  1XXH E;  3A98 B;  2I7P A;  1AUA A;  1VEJ A;  3IHP A;  4MM3 B;  4JI1 M;  3L25 A;  3CF2 A;  4IBD A;  3T38 A;  4WW0 A;  2X49 A;  1V92 A;  3B74 A;  2JY5 A;  3J2P B;  3LW5 F;  4P16 A;  3KXE C;  4XK8 F;  2DAE A;  3THG A;  3ZH9 B;  2APL A;  2V6Z M;  4PD2 A;  4NSO B;  2H5X A;  3J27 B;  2AHM A;  2FE8 A;  5DFL A;  3W0F A;  3GRU A;  1XHB A;  4BBA A;  1D2N A;  3U6S A;  2WSF F;  1CUK A;  5KPT A;  3KVW A;  1QUT A;  2JY6 B;  3SMP A;  3TL4 X;  3M0E A;  3ZC7 B;  2JA2 A;  3SAV A;  3K2L A;  1XXH B;  1KFV A;  2CHQ A;  4AI6 A;  1VQ1 A;  2JY7 A;  1QAN A;  3KOZ E;  1XNQ M;  2EJS A;  2R45 A;  3HX3 A;  2JUJ A;  2DHY A;  3NBI A;  4X62 M;  3HHZ A;  5LMU M;  3TWM A;  2NQ8 C;  2XF3 A;  1IQP A;  3GQ3 A;  2CHV A;  1OJL A;  4AQY M;  2Y21 A;  5H37 D;  1DGG A;  2L7H A;  2DWL A;  5GKN A;  1WGL A;  4L16 A;  1PM5 A;  1TH2 A;  1XB2 B;  1C7Y A;  4FWH A;  3VFD A;  1NV9 A;  4R71 A;  1QDT A;  4X64 M;  2RRU A;  1WGN A;  4YHH M;  1WXQ A;  1YLA A;  1ZQ9 A;  2XSZ D;  4JI7 M;  4MGZ E;  5KPZ A;  1XNR M;  4DR5 M;  4B7F A;  3U6O A;  3SAU A;  1D0L A;  2FH0 A;  1L1Z A;  3HHX A;  2WSE F;  3H4J A;  2DXI A;  3VK7 A;  4NOO B;  3HU1 A;  4HL4 A;  3B7N A;  2LBC A;  1VDL A;  5FTK A;  3UZU A;  1DGH A;  1T3T A;  3GRY A;  4JI2 M;  2OO9 A;  1MN3 A;  2K47 A;  2L2D A;  2O25 A;  2EO2 A;  4MB7 A;  3I51 A;  2JNH A;  2Z7J A;  2QSF X;  4L4U A;  2Y20 A;  1QYR A;  3FUU A;  3AKZ A;  1I94 M;  4GKJ M;  4LF9 M;  4ANR A;  2D7G A;  2LVQ D;  2EUC A;  3TPZ A;  1QUS A;  2R62 A;  2RGO A;  3QAU A;  4LJ4 A;  4IIW A;  3AOG A;  5EXT A;  1JR3 D;  1LV7 A;  2R6F A;  2ERC A;  4XBO A;  2R46 A;  2CP8 A;  3FUV A;  1UFZ A;  1T6O A;  4M9S A;  3I4V A;  3T1H M;  2MRO B;  3C3E A;  2F5P A;  4GHA A;  2ZTC A;  1WHC A;  1WR1 B;  2DAM A;  2K9D A;  2O5R A;  2C9C A;  2ZAM A;  3BBZ A;  3HKP A;  3VLF B;  3EIH A;  1EIJ A;  4DUZ M;  5EXS A;  4G6Z A;  3J7B A;  3FUT A;  5C18 A;  4Q7J A;  3BXW A;  3FTC A;  1IN8 A;  1R6B X;  2KHH A;  3KP1 E;  4JN6 A;  4NL4 H;  1FNN A;  2C5R A;  3W67 A;  1FJG M;  3KFU G;  1J7K A;  2P5T A;  5EP1 A;  2DHR A;  3JAM S;  4OU7 A;  1IXS A;  3Q8G A;  4JI5 M;  1IBM M;  1TF0 B;  4LGM A;  3DA1 A;  5ITT A;  1YE9 A;  2XFT A;  2LTU A;  4DV3 M;  1G4A E;  5EQT A;  2CHG A;  2BWE A;  3A45 A;  3DFZ A;  1DO0 A;  4MGH A;  3CF6 E;  1D0K A;  3ZQJ A;  1E9R A;  1VEK A;  1SXJ A;  3FUX A;  4DV2 M;  4QHT A;  2DWN A;  2I7N A;  3TQS A;  5DYG A;  4ZPX A;  5A2Q S;  1YUB A;  1N33 M;  3M7G A;  4JI4 M;  2B3T A;  3U61 B;  3R8F A;  1ZMV A;  3K92 A;  1XC8 A;  3H4M A;  1QQW A;  2L6O A;  2KNA A;  1Q3B A;  4M0D A;  2LWX A;  3MK6 A;  1N75 A;  1Z59 A;  4KT0 F;  1SG9 A;  4LG2 A;  2L4F A;  1L1T A;  1NVM A;  2DKL A;  2Z4R A;  4MGI E;  1S3S A;  2N35 A;  2XLJ A;  2QQ8 A;  1ZMU A;  4IBK A;  1N34 M;  2BNK A;  1Z5C A;  1P3Q Q;  4Y28 F;  3GRV A;  1TH3 A;  4II7 A;  2RKO A;  2C96 A;  5ITQ A;  3RFW A;  3GLI E;  3U6Q A;  2L7I A;  1N77 A;  4D80 A;  3PNV A;  2KDL A;  3B9P A;  1MJG M;  4RF0 A;  3SAT A;  3J81 S;  1OFI A;  5KQ8 A;  5FTJ A;  3KOW E;  3IG8 A;  3KSX A;  4FWG A;  4GIT A;  4NXM M;  4X66 M;  3BOS A;  4MGY E;  1A5T A;  3VDP A;  1DGF A;  4QNR A;  5ITY A;  1OFH A;  4NC6 A;  2R4E A;  2VF7 A;  4KO8 A;  4KHP M;  2F5Q A;  3GPP A;  1G71 A;  4NXN M;  4AKG A;  5FSW A;  2ZTD A;  1IN5 A;  2DI0 A;  1E32 A;  3GLI B;  1SXJ E;  4R7G A;  2QZ4 A;  2LVN C;  1XWI A;  1ORY B;  1J5E M;  3ILK A;  3QYE A;  4IBJ A;  3LQR A;  2FOI C;  1QZE A;  4B3R M;  1E9S A;  1KSF X;  2HWJ A;  3C9P A;  2GNO A;  4L15 A;  4LCB A;  4DBG B;  1IY0 A;  4QOZ C;  1GL6 A;  1IXZ A;  1NJF A;  2LHG A;  2MJ5 B;  4GH9 A;  3UMM A;  4DV1 M;  4DV4 M;  1IXS B;  2BWB A;  3E46 A;  1QAQ A;  4QNM A;  1L2B A;  2WZJ A;  3HWS A;  4LJA A;  4QOS A;  4X65 M;  1PJI A;  2JWS A;  4B3T M;  1KYI A;  3GQ4 A;  3GPX A;  3U61 A;  2DZN B;  1SXJ B;  1Y8G A;  1NSF A;  2MGW A;  4CIS A;  3B7Z A;  5DNY A;  4LZJ A;  2ZBK B;  1HQY E;  2RGH A;  4B3S M;  2F5S A;  2KZU A;  2VQE M;  3WHK A;  1G59 A;  2V1U A;  3T1Y M;  1OKS A;  3I04 M;  3T15 A;  3AOE A;  2JZ1 A;  2YFQ A;  1GKI A;  1VG5 A;  1Q02 A;  2ZAN A;  3LVW A;  3PFI A;  1PJJ A;  3I01 M;  1IBL M;  2BJW A;  4L6V 6;  5ITU A;  2KZS A;  4A3V B;  4LRT A;  3U6C A;  1R4G A;  1W5T A;  2LHC A;  3QWL A;  2Y0T A;  4CGY B;  4PCZ A;  5KPR A;  2OQ4 A;  1HNX M;  3F92 A;  4AZF A;  4B3M M;  1MX0 A;  4IBI A;  3GQ5 A;  1PJS A;  4AKH A;  1J09 A;  2QEN A;  2LVO C;  2R0I A;  1L2D A;  1HJP A;  2Z3X A;  4DV5 M;  3SYL A;  3NWL A;  2UXC M;  2XZU A;  1TR8 A;  1L8Q A;  1OQY A;  2LVA A;  5IWA M;  2R65 A;  2FS1 A;  2J7O A;  1ZAE A;  1HNZ M;  4EIW A;  3GPY A;  3SC3 A;  4M0W A;  2X4A A;  4IJF A;  1XMQ M;  4JI3 M;  2OOA A;  3HJ8 A;  2C99 A;  1GJT A;  3HHY A;  5L8R F;  5EJC A;  3GLI A;  2DNA A;  3L2A A;  3TE6 A;  5KQD A;  5EXP A;  4AW4 A;  4UN2 B;  3L28 A;  3W68 A;  1QDR A;  3U6D A;  1V33 A;  1NHW C;  1IY2 A;  2J5Y A;  4PT5 A;  4XGI A;  3SHG B;  1ZMW A;  3AV0 A;  1G41 A;  2CUZ A;  2CV2 A;  1BVS A;  3D8B A;  1DGB A;  1Z5B A;  4IJE A;  3SMS A;  2HCB A;  3DZD A;  3E4R A;  3GPU A;  1R2Z A;  2ZM6 M;  1NJG A;  5FLX S;  4L8R C;  4K0K M;  2YQZ A;  2DZO B;  3GLF A;  3FYC A;  4JV5 M;  1R5L A;  1HT1 E;  3CGW A;  4Z6Y A;  5LMN M;  2QNJ A;  1T43 A;  2YNM D;  1QAO A;  4GRI A;  4G4Q A;  2F5N A;  3KW6 A;  4IBE A;  3QYB A;  1IBK M;  2XH9 A;  4I81 A;  4GMQ A;  4BB9 A;  3EIE A;  2F5O A;  2X8A A;  4LFA M;  2XZF A;  3SFZ A;  4G4N A;  3SYK A;  5E26 A;  1NNJ A;  4WUR A;  5IZ7 D;  2KA6 B;  3K9P A;  3RGP A;  1EFU B;  4B7G A;  4DR6 M;  4GC5 A;  4G4O A;  4DR4 M;  4GHL A;  2HL7 A;  1OIZ A;  2LNH C;  3LVV A;  3WHL A;  3U6P A;  2GQF A;  3LCU A;  2XEP A;  2QBY A;  2DVW B;  2L09 A;  3CF0 A;  4DR3 M;  2G5G X;  2JZ0 A;  3CTW B;  5ITX A;  1L2C A;  2EKF A;  4QHS A;  3AL0 C;  2ZAO A;  2KRU A;  1W5S A;  2VQF M;  1DV0 A;  1TDZ A;  4OW0 A;  2K0B X;  5DYI A;  1ZV1 A;  1R7R A;  2LH0 A;  4FW9 A;  4HLQ A;  5EP4 A;  3VDU A;  4B7H A;  3MHV C;  1NY6 A;  2KNZ A;  3B7Q A;  4RNA A;  4LJ8 A;  4JI6 M;  1OAO C;  1G8P A;  1TDH A;  2Z4S A;  5EP2 A;  4CHT B;  1VEG A;  2DZL A;  4NSR A;  3U5Z B;  1K3X A;  2JP7 A;  5ITR A;  3VK8 A;  4R3D A;  1PRB A;  1E94 E;  1OAI A;  4M9Z A;  5IT9 S;  3M6A A;  1H6U A;  4LJ5 A;  3HGI A;  3GLF E;  3ZCB B;  1I4W A;  1NHG C;  1RU3 A;  4W5W A;  1GLN A;  4WP2 A;  4G4R A;  2CV1 A;  4GIP A;  3MJ5 A;  3KSJ A;  4HEO A;  2EA0 A;  1IXR C;  1QVR A;  2HAK A;  4PDG A;  4OX9 M;  4AG5 A;  1WIV A;  3UJN A;  3U60 A;  3GP1 A;  3JR4 A;  3L27 A;  2C98 A;  4NRV A;  3LCV B;  3FTF A;  2DEN A;  2WSC F;  1IFY A;  4NRW A;  1QAM A;  3L26 A;  1NO1 A;  1GO5 A;  2UUC M;  1Q39 A;  2FNA A;  3FRH A;  5EP3 A;  4B08 A;  3GLF B;  2JY8 A;  2Z8Y M;  1WJ7 A;  2E5L M;  2DWZ B;  3FTD A;  1IN7 A;  3Q8X A;  3RE8 A;  4AKI A;  3GO8 A;  2UXD M;  3HU3 A;  3GLH E;  2CE7 A;  4I8O A;  1JQJ C;  4LJ9 A;  4RKU F;  5JI3 E;  5ITX E;  1N78 A;  4LJ6 A;  2XSZ A;  2JXN A;  3HU2 A;  3VKH A;  2F4V M;  3KDS E;  4LGY A;  2DWM A;  2DAG A;  4LZZ A;  2KRK A;  3FE3 A;  5KO3 A;  3TWL A;  4TUW A;  4JI0 M;  5EXX A;  2UUB M;  2G3Q A;  3V76 A;  3E21 A;  1VDD A;  1SXJ C;  3HJS A;  3K8Z A;  4LY6 A;  8CAT A;  1HR0 M;  4DR7 M;  4LJ7 A;  4Z8X A;  3U6L A;  1IY1 A;  4M9X A;  3A42 A;  3DOA A;  4MH0 E;  4F2L A;  1K3W A;  4AG6 A;  2QBY B;  1GAB A;  1NNU C;  2UXB M;  3HZJ A;  2YR0 A;  3LQQ A;  2KEB A;  3FKE A;  2CEA A;  3GLH B;  1UM8 A;  5F3W A;  4FD2 A;  5IRE B;  2G8L A;  2L4E A;  2HHH M;  1OTR A;  1JR3 A;  2CRU A;  3W0L B;  3U5Z A;  3HY5 A;  2OOB A;  3L29 A;  4CIZ A;  4OVZ A;  2UU9 M;  2QHO B;  4IBC A;  3NBX X;  1V34 A;  3HHW A;  4ITQ A;  3E9S A;  2QCU A;  2LVP C;  1PJT A;  4FCV A;  4IBF A;  1PJQ A;  2R4J A;  4G3O A;  3PXG A;  3C58 A;  1Q3C A;  2CFO A;  4DV7 M;  4LFC M;  3SHF A;  1DO2 A;  2VDB B;  1D0M A;  4RF1 A;  1IN6 A;  2VII A;  5BR8 M;  1TGU A;  2FFJ A;  2CV0 A;  2VF8 A;  3PNY A;  3U6E A;  2HKJ A;  4FCW A;  4S12 A;  4JXJ A;  1NV8 A;  1NY5 A;  3GLG A;  3U6M A;  3SAR A;  3AFH A;  3KP0 E;  4FWD A;  1EE8 A;  2MH8 A;  3U60 B;  3VKG A;  1HT2 E;  3J7A S;  4PDI A;  2R44 A;  2LXE A;  4L78 A;  4D81 A;  4LF7 M;  2K6B A;  1TH4 A;  1IM2 A;  2O01 F;  2W82 A;  3LMM A;  4DV6 M;  4DUY M;  1JB0 F;  3K9O A;  4DR1 M;  2XFS A;  2QP9 X;  3IG5 A;  1GVN A;  4YY3 M;  1Z5A A;  3B89 A;  3J80 S;  1HNW M;  3FTE A;  2KW0 A;  4GKK M;  5FTL A;  1F4I A;  1IN4 A;  4P17 A;  4LF6 M;  1GL7 A;  2V1C A;  3PVS A;  4GC9 A;  3JR5 A;  2KXE A;  4I4L A;  4JI8 M;  3T6P A;  2KNV A;  3IEC A;  5C1B A;  1AIP C;  1JR3 E;  3SBJ A;  1N36 M;  3C3D A;  2CWB A;  1XXH A;  1TTE A;  2R18 A; 
#chains in the Genus database with same CATH homology
 3GLF E;  1KYI A;  2EKK A;  4WP2 A;  1Y8G A;  2LVQ D;  2MGW A;  4HEO A;  1HQY E;  5JI2 E;  2HAK A;  2CP8 A;  1WIV A;  1UFZ A;  1T6O A;  1OKS A;  2MRO B;  2JZ1 A;  2ZTC A;  1WHC A;  1WR1 B;  2DAM A;  2K9D A;  3BBZ A;  1VG5 A;  1Q02 A;  3LCV B;  2DAI A;  2DEN A;  1IFY A;  1GO5 A;  3GLG E;  1R4G A;  3FRH A;  4Q7J A;  2JY8 A;  1WJ7 A;  3MMP A;  2KHH A;  3F92 A;  3GLH E;  1G3I A;  4F1I A;  1IXS A;  3FRI A;  2LVO C;  2R0I A;  2DAG A;  1HJP A;  2LTU A;  1G4A E;  3FE3 A;  1TR8 A;  2BWE A;  1OQY A;  2LVA A;  1DO0 A;  2MR9 A;  2DAK A;  4GEW A;  2G3Q A;  1VEK A;  3E21 A;  1PGY A;  2OOA A;  2DNA A;  2B3T A;  4F2L A;  1ZMV A;  4UN2 B;  1XXH E;  2KNA A;  1VEJ A;  3IHP A;  1ZMW A;  1G41 A;  1BVS A;  2L4E A;  1V92 A;  1OTR A;  2JY5 A;  1SG9 A;  2L4F A;  2DKL A;  2OOB A;  2DAE A;  2QHO B;  2H5X A;  1HT1 E;  1ZMU A;  5DFL A;  1P3Q Q;  2LVP C;  2QNJ A;  4G3O A;  3GLI E;  1T43 A;  1CUK A;  2JY6 B;  1DO2 A;  1VQ1 A;  2JY7 A;  2EJS A;  2JUJ A;  2DHY A;  3K9P A;  1EFU B;  1A5T A;  1NV8 A;  3LCU A;  1WGL A;  1HT2 E;  1C7Y A;  1XB2 B;  1NV9 A;  2ZTD A;  2JZ0 A;  4R71 A;  2DI0 A;  2EKF A;  1WGN A;  2RRU A;  1YLA A;  1IM2 A;  2LVN C;  1DV0 A;  2K0B X;  1ZV1 A;  3K9O A;  1QZE A;  3H4J A;  2HWJ A;  2KNZ A;  3B89 A;  2LBC A;  4DBG B;  1VDL A;  2MJ5 B;  1F4I A;  1VEG A;  2DZL A;  2JP7 A;  2OO9 A;  1MN3 A;  2O25 A;  2L2D A;  3T6P A;  2BWB A;  2KNV A;  3IEC A;  1E94 E;  1OAI A;  1AIP C;  1JR3 E;  2JNH A;  3E46 A;  2QSF X;  2CWB A;  2WZJ A;  1TTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...