2OOAA

Crystal structure of the uba domain from cbl-b ubiquitin ligase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
VDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
total genus 15
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ooaA00
1NV9A 2LVAA 1HT1E 4G3OA 5JI2E 1YLAA 1CUKA 4UN2B 3K9PA 2DHYA 1C7YA 1R4GA 2DKLA 2DNAA 1WHCA 2CP8A 4GEWA 1TR8A 2OO9A 1A5TA 1VEKA 2EKFA 1OKSA 1WR1B 1NV8A 1WJ7A 1ZMUA 1ZMWA 2O25A 1G3IA 1ZV1A 1UFZA 3GLIE 1OQYA 2DAMA 1WGLA 2LVQD 1IFYA 4R71A 2L2DA 3MMPA 2DI0A 2BWEA 2KNVA 2EJSA 2CWBA 1OTRA 1HJPA 2DZLA 2ZTDA 3FRHA 1Q02A 2DAGA 4WP2A 2R0IA 2QSFX 1JR3E 1V92A 1VEGA 2B3TA 1WGNA 2DAKA 2JY7A 2LBCA 2OOBA 1AIPC 1E94E 1WIVA 2G3QA 2JY8A 3T6PA 3B89A 3H4JA 4DBGB 3GLFE 2JNHA 1VEJA 1IM2A 4HEOA 2JP7A 2WZJA 2JZ1A 3FRIA 1P3QQ 3IECA 2MR9A 2MJ5B 4F1IA 1GO5A 2LVPC 2JY6B 4F2LA 1BVSA 1DO2A 2DAIA 1PGYA 1VDLA 3LCVB 1MN3A 2DENA 2EKKA 3GLGE 1QZEA 2BWBA 2K9DA 4Q7JA 2KNAA 1VG5A 3E21A 1T6OA 1G41A 2RRUA 1IXSA 1VQ1A 3GLHE 2L4FA 1SG9A 3LCUA 2LVNC 2MGWA 1XB2B 2K0BX 2L4EA 1OAIA 2QHOB 3BBZA 2KNZA 2LTUA 2LVOC 2KHHA 3IHPA 1G4AE 2JZ0A 1DO0A 1KYIA 3FE3A 1HQYE 1F4IA 1ZMVA 1HT2E 2HAKA 1XXHE 5DFLA 2HWJA 2QNJA 1EFUB 1DV0A 1TTEA 2JUJA 1T43A 3F92A 3E46A 2MROB 2ZTCA 2OOAA 3K9OA 1Y8GA 2H5XA 2DAEA 2JY5A
chains in the Genus database with same CATH superfamily
2RGHA 4B7HA 2KA6B 2C5RA 3U6SA 1ZQ9A 3HU2A 4PDGA 2Z8YM 4R7GA 4WURA 1R5LA 3VFDA 3SAUA 4CJ6A 3K92A 3TE6A 4Z6YA 1XNQM 3QYBA 4IBEA 3GRRA 1G71A 2QBYB 1IBKM 3U6QA 4DR2M 1OIPA 1ZMWA 2VF8A 4QHTA 2O25A 1ZV1A 3HJSA 5L8RF 3GLIE 2WSCF 5LMUM 2BJWA 2K6BA 2HL7A 2M5ZA 2DAMA 5IT9S 4G6ZA 4RKUF 5FLXS 4LF4M 4AG5A 1IFYA 4LJ4A 4JXJA 5A2QS 2UU9M 3IG8A 2DI0A 3RGSA 4FCTA 5KPZA 3GRUA 3DZDA 3PVSA 4FCVA 4CHTB 4JI1M 2CWBA 1OTRA 4AKIA 3U6PA 2DAGA 2QSFX 1VEGA 1V92A 2DWNA 4GHLA 4LFBM 2X8AA 1VDDA 3CF2A 2FNAA 3FUTA 2X49A 1QYRA 1SXJD 2DAKA 2BNKA 2CRUA 2AHMA 3FUUA 4JI2M 3KS8A 2LH0A 4NXMM 2G3QA 4MH0E 2DVWB 4QOZC 3B89A 4B3TM 4NXNM 1L8QA 1TF0B 4S12A 4DBGB 3GLFE 4DUYM 4OX9M 4K0KM 1QUTA 2JNHA 2HHHM 4RF1A 2JA2A 2VQEM 4LF5M 3D8BA 5FSWA 1PJJA 1IN5A 2VF7A 4GC5A 4AG6A 3DA1A 1IBMM 1J09A 2Z3XA 2CEAA 4B7FA 2WZJA 4YY3M 3U6LA 4Y28F 3SATA 3J80S 4B08A 1IN7A 4PDIA 3JR5A 4DR1M 1I4WA 4L8RC 3T38A 2DZNB 2V6ZM 4G4RA 3R9XB 4KT0F 1DO2A 2Y21A 2HKJA 2C96A 3NBXX 4REZA 1QAQA 3KSJA 3PXGA 1VDLA 1MU5A 5DYGA 3LCVB 3HJ8A 5KPRA 4P16A 1OIZA 3UGJA 4MGKE 2KNAA 1NO1A 2Z7JA 1G41A 3U5ZB 1IXSA 1OFHA 3ILKA 4LRSA 4GKKM 1N78A 4L6V6 3B9PA 1IN4A 2L4FA 3FUVA 5EJCA 3KP0E 3KP1E 1E9RA 2MGWA 3J7BA 4MGYE 2I7PA 3HHZA 4JI8M 1LV7A 3QWLA 3U6CA 4FVMA 1XHBA 3GO8A 4R3DA 2RGOA 4LF8M 3KS4A 2LXEA 4JI5M 2UXCM 3AJIB 3SHGB 4DV5M 1NNUC 1N77A 2WSFF 1L1TA 2JZ0A 1N36M 4IJEA 3FE3A 2QQ8A 2C98A 1HQYE 2ZM6M 3MJ5A 1GVNA 5FTKA 1NNJA 3D8LA 1ZMVA 1XC8A 3GLIB 2HAKA 3KSXA 3E9SA 2W82A 1XXHE 1NHWC 1QZMA 2HWJA 3L25A 3LQRA 2OPFA 1DV0A 4LF6M 1QAMA 4NOOB 1L2BA 2DZOB 4ITQA 3FTFA 4JV5M 1IN8A 4IBBA 2Y0QA 2L7IA 4AQYM 3K9OA 1DGHA 3U6DA 2DXIA 1HT1E 1R6BX 2BJVA 3TWLA 3GPUA 2DHYA 1C7YA 2QENA 1N33M 3JAMS 3PNYA 3MK6A 1JR3A 4CISA 2DKLA 5ITTA 2CP8A 2YQZA 1QVRA 2YFQA 2OO9A 1VEKA 3JR4A 1OKSA 2OQ4A 4X64M 1V34A 1WJ7A 1NJGA 4DR3M 2CHVA 2EA0A 3C3EA 4WW0A 1UFZA 3FTCA 1D0MA 1OQYA 2XEPA 4I4LA 4M9ZA 1AUAA 4FCWA 3TWKA 2LVQD 4IIWA 5F3WA 1XWIA 3UK6A 4JI6M 2R65A 2HCBA 2XSZD 3MMPA 2FFJA 2J5YA 1JQJC 1SXJC 3A45A 1ZAEA 3FUWA 4AZFA 4IBFA 4BB9A 4LF9M 3ZC7B 2ZTDA 3FRHA 1Q02A 4LJ8A 4X65M 2C9OA 4WP2A 2R0IA 5LMNM 5ITXE 1OJLA 5GKNA 1IY2A 1W5SA 2CHGA 3V76A 2Y0TA 1JB0F 3Q8XA 3DFZA 4W5WA 2ZBKB 1HNWM 2JY7A 4LJ6A 2L7HA 1AIPC 3ZCBB 5EP3A 2JY8A 5KO3A 4JI7M 3H4JA 4DV7M 3GLHB 4M9SA 1OFIA 1VEJA 5FTJA 2JP7A 3DOAA 3SC3A 4D81A 3SBJA 3B7NA 3T1YM 1D0LA 2KW0A 3IG5A 1FJGM 2JZ1A 5BR8M 4G4OA 3IECA 3GLGA 3LVVA 3FD9A 3SAWA 4DR4M 3SASA 2J7OA 3HWSA 4LCBA 2XZUA 2LVPC 1Z59A 4MGZE 3VLFB 3U6OA 4D80A 2DAIA 2UUBM 4AKHA 2F5NA 4XK8F 1MN3A 2EKKA 3GLGE 4I5SA 2XH9A 1YSYA 3KOYE 4KO8A 2XF3A 2F5OA 4M9XA 3GPPA 1XXHB 1VG5A 4XGIA 3E21A 3AV0A 5BPVA 4DV3M 1J5EM 2CFOA 2ZANA 2R45A 3FUXA 1R2YA 1XB2B 5C1BA 4GHAA 2CHQA 2GNOA 3UZUA 3VKHA 1QDRA 1MX0A 3B7ZA 3BBZA 1XMQM 5IWAM 4DV1M 1C1KA 4NSOB 2ERCA 2LTUA 3I04M 2KHHA 2ZAOA 3VDPA 4NRVA 2WSEF 1G4AE 1WXQA 3FTDA 3LVWA 4YHHM 3HZJA 1E32A 3GLIA 4GC9A 1SXJE 3GPYA 1TH2A 2JXNA 2NQ8C 3UMMA 2E5LM 5DFLA 2QNJA 1Q3BA 1IY0A 2JUJA 3L27A 2JWSA 4PD2A 1T43A 2F5SA 1YE9A 3KW6A 3K2LA 3I51A 2DWLA 3FTEA 1Y8GA 3T6PA 4HL4A 1R2ZA 3GQ5A 2JY5A 1NV9A 4A3VB 3A46A 5EQTA 3M0EA 1YLAA 1CUKA 1X37A 4UN2B 3K9PA 1R4GA 2QZ4A 3I01M 1J7KA 2FH0A 2A5YB 3AOGA 4GITA 4B3MM 3T15A 2L09A 4BLCA 4LG2A 2DNAA 1WHCA 3SMPA 2N35A 4LZJA 4DR6M 3GLGB 2EKFA 2XGNA 2Z4RA 4IJFA 3FYDA 3GPXA 1Q3CA 1WR1B 4GIPA 1NV8A 1ZMUA 4DR7M 3CGWA 1TDZA 2F4VM 3RFWA 3TPZA 1YUBA 4L16A 5EXXA 2KRUA 2L6OA 3A42A 4QNMA 5ITYA 3GQ4A 3SARA 1WGLA 4LJ5A 3SHFA 1TH3A 1G59A 2Y20A 3U60B 4D82A 5DNYA 4R71A 3NBIA 3SYKA 1FNNA 4JI0M 2CV0A 4NSRA 4FWGA 2DZLA 3AL0C 1JR3E 3LQQA 4IBDA 5IZ7D 5E6JA 5FTNA 3U5ZA 4L78A 2LWXA 2LBCA 4AW4A 2KRKA 3H4MA 3HU1A 2D7HA 1E94E 4M0DA 1GKIA 2R6FA 1QUSA 1MJGM 3VKGA 4CIZA 3TWMA 3B7QA 5H37D 2D7GA 3L29A 4HLQA 3KXEC 5EXSA 4MB7A 2APLA 4DV6M 1PM5A 1R7RA 4CGYB 1IM2A 4HEOA 2VIIA 1IN6A 4DR5M 4FD2A 2R18A 3VK8A 3VK7A 3L2AA 1H6UA 1NSFA 1SXJA 1K82A 1V33A 2R62A 3J7AS 2C99A 1DGHB 3LMMA 3L28A 4DV0M 3EIEA 4KLNA 3RE8A 2MR9A 4BBAA 5JI3E 4AKGA 1E9SA 1DGFA 2CV2A 2JY6B 1DGBA 1XXHA 1OAOC 3C9PA 4KODA 1UM8A 3HHYA 1NJFA 3TQSA 5KQ8A 2V1UA 4LFCM 4G4NA 1PGYA 4FWDA 1L2CA 4IBCA 4I81A 3Q8GA 4B7GA 4DV4M 4KHPM 2QBYA 1D0KA 4RF0A 3W67A 5C18A 1HR0M 3AOEA 2KZSA 1TGUA 4GH9A 4Q7JA 4LGYA 1Q39A 2DWZB 4MM3B 1TDHA 1T6OA 3FKEA 1QDTA 3W0LB 1S3SA 2J7NA 3GLHE 3KOXE 4OW0A 2I7NA 5ITUA 3KOZE 3GLFA 4LJ7A 3LCUA 4DV2M 3HHWA 2F5QA 4MGHA 1DGGA 2K0BX 2Q2EB 3QAUA 3SFZA 2L4EA 1OAIA 2QHOB 3GRVA 3KOWE 7CATA 1GJTA 2KEBA 4FWHA 2KNZA 3W68A 2FOIC 4IBGA 4DUZM 2LVOC 3FYCA 2G8LA 3IHPA 4QOSA 1W5TA 3SMSA 1GLNA 2UUCM 4LF7M 1HQCA 1GABA 3KFUG 1F4IA 3THGA 4XBOA 5DYIA 4NC6A 4JYAM 1EFUB 1QQWA 2DHRA 2M60A 3LW5F 2CUZA 1GL6A 3WHKA 1RU3A 4B3RM 1PJSA 2QCUA 3F92A 2C9CA 5KPTA 2CE7A 2KZUA 3U6EA 2OOAA 2CV1A 1Z5CA 2H5XA 2VQFM 2DAEA 1IY1A 4LZZA 4I8OA 2LVAA 4G3OA 5JI2E 3J2PB 2RKOA 3KVWA 5IREB 2XLJA 3T1HM 4G4QA 1PJIA 1IQPA 4GKJM 4GRIA 1PJQA 3QYEA 4LJAA 3HJQA 1K3XA 2X4AA 1SXJB 1IXSB 1TR8A 1T3TA 2LHCA 2O01F 1A5TA 2GQFA 3HGIA 4GEWA 3U61A 3AFHA 4B3SM 4QHSA 1IBLM 1G3IA 2H1RA 2Z4SA 5ITXA 1IXRC 3I4YA 3BXWA 4IBJA 5KQDA 3OTOM 1K3WA 3U60A 4NL4H 2VDBB 2XSZA 4P17A 3UJNA 1KFVA 2L2DA 2R46A 1N32M 3AOEC 2BWEA 3L26A 2KNVA 2D7EA 4RNAA 1GJSA 2EJSA 2XFSA 1HJPA 4EIWA 3AKZA 2R44A 4OU7A 4GMQA 2V1CA 2R4JA 1PJTA 3GLHA 2B3TA 4QNRA 1WGNA 4X62M 2FE8A 1G8PA 3HX3A 2XFTA 3WHLA 2OOBA 1WIVA 3SYLA 1KSFX 2UUAM 1NHGC 4L4UA 2XZFA 5E26A 5EXPA 4AI6A 3U6MA 3EIHA 4NRWA 1XMOM 5FTMA 4ANRA 2LHGA 1QANA 1QAOA 2LNHC 3GQ3A 3FRIA 4IBIA 1P3QQ 1N75A 3PFIA 4PT5A 3SAVA 1N34M 2UXBM 3HU3A 3MHVC 8CATA 2MJ5B 2QPAA 3BOSA 4F1IA 1L1ZA 1GO5A 2UXDM 1NY6A 3HY5A 4F2LA 2YR0A 1BVSA 1Z5AA 3RGPA 3C58A 3CTWB 1XNRM 4MGIE 1D2NA 1EE8A 2YNMD 2R4EA 2DENA 1L2DA 3HHXA 3GLFB 4JI4M 1QZEA 4JI3M 2BWBA 1GL7A 2K9DA 4PCZA 3J81S 3A98B 5FTLA 4X66M 4IBKA 3NWLA 5ITRA 3K1JA 2QP9X 3R8FA 2RRUA 1IXZA 4LJ9A 3U61B 2DWMA 1TH4A 3CF0A 3GRYA 4LGMA 4LFAM 1SG9A 3TL4X 4JN6A 2LVNC 3VDUA 3J27B 2O5RA 4LRTA 4TUWA 4FW9A 4L15A 4II7A 3I4VA 2MH8A 4M0WA 3M7GA 1NY5A 1Z6TA 3ZH9B 4LY6A 5ITQA 2EUCA 3C3DA 3ZQJA 1ORYB 1HNXM 1JR3D 3KDSE 5EXTA 1DO0A 1KYIA 5EP1A 1NVMA 5EP4A 3K8ZA 3GP1A 3PNVA 2G5GX 1HT2E 2KDLA 2ZAMA 1EIJA 2F5PA 1Z5BA 5EP2A 1LTMA 3E4RA 1HNZM 1PRBA 3B74A 4ZPXA 4Z8XA 1TTEA 2KXEA 2K47A 1I94M 2P5TA 2FS1A 3E46A 2MROB 4OVZA 3W0FA 2ZTCA 3CF6E 4OVZB 3M6AA 2EO2A 1VQ1A 3HKPA
chains in the Genus database with same CATH topology
1NV9A 2LVAA 1HT1E 4G3OA 5JI2E 1YLAA 1CUKA 4UN2B 3K9PA 2DHYA 1C7YA 1R4GA 2DKLA 2DNAA 1WHCA 2CP8A 4GEWA 1TR8A 2OO9A 1A5TA 1VEKA 2EKFA 1OKSA 1WR1B 1NV8A 1WJ7A 1ZMUA 1ZMWA 2O25A 1G3IA 1ZV1A 1UFZA 3GLIE 1OQYA 2DAMA 1WGLA 2LVQD 1IFYA 4R71A 2L2DA 3MMPA 2DI0A 2BWEA 2KNVA 2EJSA 2CWBA 1OTRA 1HJPA 2DZLA 2ZTDA 3FRHA 1Q02A 2DAGA 4WP2A 2R0IA 2QSFX 1JR3E 1V92A 1VEGA 2B3TA 1WGNA 2DAKA 2JY7A 2LBCA 2OOBA 1AIPC 1E94E 1WIVA 2G3QA 2JY8A 3T6PA 3B89A 3H4JA 4DBGB 3GLFE 2JNHA 1VEJA 1IM2A 4HEOA 2JP7A 2WZJA 2JZ1A 3FRIA 1P3QQ 3IECA 2MR9A 2MJ5B 4F1IA 1GO5A 2LVPC 2JY6B 4F2LA 1BVSA 1DO2A 2DAIA 1PGYA 1VDLA 3LCVB 1MN3A 2DENA 2EKKA 3GLGE 1QZEA 2BWBA 2K9DA 4Q7JA 2KNAA 1VG5A 3E21A 1T6OA 1G41A 2RRUA 1IXSA 1VQ1A 3GLHE 2L4FA 1SG9A 3LCUA 2LVNC 2MGWA 1XB2B 2K0BX 2L4EA 1OAIA 2QHOB 3BBZA 2KNZA 2LTUA 2LVOC 2KHHA 3IHPA 1G4AE 2JZ0A 1DO0A 1KYIA 3FE3A 1HQYE 1F4IA 1ZMVA 1HT2E 2HAKA 1XXHE 5DFLA 2HWJA 2QNJA 1EFUB 1DV0A 1TTEA 2JUJA 1T43A 3F92A 3E46A 2MROB 2ZTCA 2OOAA 3K9OA 1Y8GA 2H5XA 2DAEA 2JY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV9 A;  2LVA A;  1HT1 E;  4G3O A;  5JI2 E;  1YLA A;  1CUK A;  4UN2 B;  3K9P A;  2DHY A;  1C7Y A;  1R4G A;  2DKL A;  2DNA A;  1WHC A;  2CP8 A;  4GEW A;  1TR8 A;  2OO9 A;  1A5T A;  1VEK A;  2EKF A;  1OKS A;  1WR1 B;  1NV8 A;  1WJ7 A;  1ZMU A;  1ZMW A;  2O25 A;  1G3I A;  1ZV1 A;  1UFZ A;  3GLI E;  1OQY A;  2DAM A;  1WGL A;  2LVQ D;  1IFY A;  4R71 A;  2L2D A;  3MMP A;  2DI0 A;  2BWE A;  2KNV A;  2EJS A;  2CWB A;  1OTR A;  1HJP A;  2DZL A;  2ZTD A;  3FRH A;  1Q02 A;  2DAG A;  4WP2 A;  2R0I A;  2QSF X;  1JR3 E;  1V92 A;  1VEG A;  2B3T A;  1WGN A;  2DAK A;  2JY7 A;  2LBC A;  2OOB A;  1AIP C;  1E94 E;  1WIV A;  2G3Q A;  2JY8 A;  3T6P A;  3B89 A;  3H4J A;  4DBG B;  3GLF E;  2JNH A;  1VEJ A;  1IM2 A;  4HEO A;  2JP7 A;  2WZJ A;  2JZ1 A;  3FRI A;  1P3Q Q;  3IEC A;  2MR9 A;  2MJ5 B;  4F1I A;  1GO5 A;  2LVP C;  2JY6 B;  4F2L A;  1BVS A;  1DO2 A;  2DAI A;  1PGY A;  1VDL A;  3LCV B;  1MN3 A;  2DEN A;  2EKK A;  3GLG E;  1QZE A;  2BWB A;  2K9D A;  4Q7J A;  2KNA A;  1VG5 A;  3E21 A;  1T6O A;  1G41 A;  2RRU A;  1IXS A;  1VQ1 A;  3GLH E;  2L4F A;  1SG9 A;  3LCU A;  2LVN C;  2MGW A;  1XB2 B;  2K0B X;  2L4E A;  1OAI A;  2QHO B;  3BBZ A;  2KNZ A;  2LTU A;  2LVO C;  2KHH A;  3IHP A;  1G4A E;  2JZ0 A;  1DO0 A;  1KYI A;  3FE3 A;  1HQY E;  1F4I A;  1ZMV A;  1HT2 E;  2HAK A;  1XXH E;  5DFL A;  2HWJ A;  2QNJ A;  1EFU B;  1DV0 A;  1TTE A;  2JUJ A;  1T43 A;  3F92 A;  3E46 A;  2MRO B;  2ZTC A;  2OOA A;  3K9O A;  1Y8G A;  2H5X A;  2DAE A;  2JY5 A; 
#chains in the Genus database with same CATH topology
 2RGH A;  4B7H A;  2KA6 B;  2C5R A;  3U6S A;  1ZQ9 A;  3HU2 A;  4PDG A;  2Z8Y M;  4R7G A;  4WUR A;  1R5L A;  3VFD A;  3SAU A;  4CJ6 A;  3K92 A;  3TE6 A;  4Z6Y A;  1XNQ M;  3QYB A;  4IBE A;  3GRR A;  1G71 A;  2QBY B;  1IBK M;  3U6Q A;  4DR2 M;  1OIP A;  1ZMW A;  2VF8 A;  4QHT A;  2O25 A;  1ZV1 A;  3HJS A;  5L8R F;  3GLI E;  2WSC F;  5LMU M;  2BJW A;  2K6B A;  2HL7 A;  2M5Z A;  2DAM A;  5IT9 S;  4G6Z A;  4RKU F;  5FLX S;  4LF4 M;  4AG5 A;  1IFY A;  4LJ4 A;  4JXJ A;  5A2Q S;  2UU9 M;  3IG8 A;  2DI0 A;  3RGS A;  4FCT A;  5KPZ A;  3GRU A;  3DZD A;  3PVS A;  4FCV A;  4CHT B;  4JI1 M;  2CWB A;  1OTR A;  4AKI A;  3U6P A;  2DAG A;  2QSF X;  1VEG A;  1V92 A;  2DWN A;  4GHL A;  4LFB M;  2X8A A;  1VDD A;  3CF2 A;  2FNA A;  3FUT A;  2X49 A;  1QYR A;  1SXJ D;  2DAK A;  2BNK A;  2CRU A;  2AHM A;  3FUU A;  4JI2 M;  3KS8 A;  2LH0 A;  4NXM M;  2G3Q A;  4MH0 E;  2DVW B;  4QOZ C;  3B89 A;  4B3T M;  4NXN M;  1L8Q A;  1TF0 B;  4S12 A;  4DBG B;  3GLF E;  4DUY M;  4OX9 M;  4K0K M;  1QUT A;  2JNH A;  2HHH M;  4RF1 A;  2JA2 A;  2VQE M;  4LF5 M;  3D8B A;  5FSW A;  1PJJ A;  1IN5 A;  2VF7 A;  4GC5 A;  4AG6 A;  3DA1 A;  1IBM M;  1J09 A;  2Z3X A;  2CEA A;  4B7F A;  2WZJ A;  4YY3 M;  3U6L A;  4Y28 F;  3SAT A;  3J80 S;  4B08 A;  1IN7 A;  4PDI A;  3JR5 A;  4DR1 M;  1I4W A;  4L8R C;  3T38 A;  2DZN B;  2V6Z M;  4G4R A;  3R9X B;  4KT0 F;  1DO2 A;  2Y21 A;  2HKJ A;  2C96 A;  3NBX X;  4REZ A;  1QAQ A;  3KSJ A;  3PXG A;  1VDL A;  1MU5 A;  5DYG A;  3LCV B;  3HJ8 A;  5KPR A;  4P16 A;  1OIZ A;  3UGJ A;  4MGK E;  2KNA A;  1NO1 A;  2Z7J A;  1G41 A;  3U5Z B;  1IXS A;  1OFH A;  3ILK A;  4LRS A;  4GKK M;  1N78 A;  4L6V 6;  3B9P A;  1IN4 A;  2L4F A;  3FUV A;  5EJC A;  3KP0 E;  3KP1 E;  1E9R A;  2MGW A;  3J7B A;  4MGY E;  2I7P A;  3HHZ A;  4JI8 M;  1LV7 A;  3QWL A;  3U6C A;  4FVM A;  1XHB A;  3GO8 A;  4R3D A;  2RGO A;  4LF8 M;  3KS4 A;  2LXE A;  4JI5 M;  2UXC M;  3AJI B;  3SHG B;  4DV5 M;  1NNU C;  1N77 A;  2WSF F;  1L1T A;  2JZ0 A;  1N36 M;  4IJE A;  3FE3 A;  2QQ8 A;  2C98 A;  1HQY E;  2ZM6 M;  3MJ5 A;  1GVN A;  5FTK A;  1NNJ A;  3D8L A;  1ZMV A;  1XC8 A;  3GLI B;  2HAK A;  3KSX A;  3E9S A;  2W82 A;  1XXH E;  1NHW C;  1QZM A;  2HWJ A;  3L25 A;  3LQR A;  2OPF A;  1DV0 A;  4LF6 M;  1QAM A;  4NOO B;  1L2B A;  2DZO B;  4ITQ A;  3FTF A;  4JV5 M;  1IN8 A;  4IBB A;  2Y0Q A;  2L7I A;  4AQY M;  3K9O A;  1DGH A;  3U6D A;  2DXI A;  1HT1 E;  1R6B X;  2BJV A;  3TWL A;  3GPU A;  2DHY A;  1C7Y A;  2QEN A;  1N33 M;  3JAM S;  3PNY A;  3MK6 A;  1JR3 A;  4CIS A;  2DKL A;  5ITT A;  2CP8 A;  2YQZ A;  1QVR A;  2YFQ A;  2OO9 A;  1VEK A;  3JR4 A;  1OKS A;  2OQ4 A;  4X64 M;  1V34 A;  1WJ7 A;  1NJG A;  4DR3 M;  2CHV A;  2EA0 A;  3C3E A;  4WW0 A;  1UFZ A;  3FTC A;  1D0M A;  1OQY A;  2XEP A;  4I4L A;  4M9Z A;  1AUA A;  4FCW A;  3TWK A;  2LVQ D;  4IIW A;  5F3W A;  1XWI A;  3UK6 A;  4JI6 M;  2R65 A;  2HCB A;  2XSZ D;  3MMP A;  2FFJ A;  2J5Y A;  1JQJ C;  1SXJ C;  3A45 A;  1ZAE A;  3FUW A;  4AZF A;  4IBF A;  4BB9 A;  4LF9 M;  3ZC7 B;  2ZTD A;  3FRH A;  1Q02 A;  4LJ8 A;  4X65 M;  2C9O A;  4WP2 A;  2R0I A;  5LMN M;  5ITX E;  1OJL A;  5GKN A;  1IY2 A;  1W5S A;  2CHG A;  3V76 A;  2Y0T A;  1JB0 F;  3Q8X A;  3DFZ A;  4W5W A;  2ZBK B;  1HNW M;  2JY7 A;  4LJ6 A;  2L7H A;  1AIP C;  3ZCB B;  5EP3 A;  2JY8 A;  5KO3 A;  4JI7 M;  3H4J A;  4DV7 M;  3GLH B;  4M9S A;  1OFI A;  1VEJ A;  5FTJ A;  2JP7 A;  3DOA A;  3SC3 A;  4D81 A;  3SBJ A;  3B7N A;  3T1Y M;  1D0L A;  2KW0 A;  3IG5 A;  1FJG M;  2JZ1 A;  5BR8 M;  4G4O A;  3IEC A;  3GLG A;  3LVV A;  3FD9 A;  3SAW A;  4DR4 M;  3SAS A;  2J7O A;  3HWS A;  4LCB A;  2XZU A;  2LVP C;  1Z59 A;  4MGZ E;  3VLF B;  3U6O A;  4D80 A;  2DAI A;  2UUB M;  4AKH A;  2F5N A;  4XK8 F;  1MN3 A;  2EKK A;  3GLG E;  4I5S A;  2XH9 A;  1YSY A;  3KOY E;  4KO8 A;  2XF3 A;  2F5O A;  4M9X A;  3GPP A;  1XXH B;  1VG5 A;  4XGI A;  3E21 A;  3AV0 A;  5BPV A;  4DV3 M;  1J5E M;  2CFO A;  2ZAN A;  2R45 A;  3FUX A;  1R2Y A;  1XB2 B;  5C1B A;  4GHA A;  2CHQ A;  2GNO A;  3UZU A;  3VKH A;  1QDR A;  1MX0 A;  3B7Z A;  3BBZ A;  1XMQ M;  5IWA M;  4DV1 M;  1C1K A;  4NSO B;  2ERC A;  2LTU A;  3I04 M;  2KHH A;  2ZAO A;  3VDP A;  4NRV A;  2WSE F;  1G4A E;  1WXQ A;  3FTD A;  3LVW A;  4YHH M;  3HZJ A;  1E32 A;  3GLI A;  4GC9 A;  1SXJ E;  3GPY A;  1TH2 A;  2JXN A;  2NQ8 C;  3UMM A;  2E5L M;  5DFL A;  2QNJ A;  1Q3B A;  1IY0 A;  2JUJ A;  3L27 A;  2JWS A;  4PD2 A;  1T43 A;  2F5S A;  1YE9 A;  3KW6 A;  3K2L A;  3I51 A;  2DWL A;  3FTE A;  1Y8G A;  3T6P A;  4HL4 A;  1R2Z A;  3GQ5 A;  2JY5 A;  1NV9 A;  4A3V B;  3A46 A;  5EQT A;  3M0E A;  1YLA A;  1CUK A;  1X37 A;  4UN2 B;  3K9P A;  1R4G A;  2QZ4 A;  3I01 M;  1J7K A;  2FH0 A;  2A5Y B;  3AOG A;  4GIT A;  4B3M M;  3T15 A;  2L09 A;  4BLC A;  4LG2 A;  2DNA A;  1WHC A;  3SMP A;  2N35 A;  4LZJ A;  4DR6 M;  3GLG B;  2EKF A;  2XGN A;  2Z4R A;  4IJF A;  3FYD A;  3GPX A;  1Q3C A;  1WR1 B;  4GIP A;  1NV8 A;  1ZMU A;  4DR7 M;  3CGW A;  1TDZ A;  2F4V M;  3RFW A;  3TPZ A;  1YUB A;  4L16 A;  5EXX A;  2KRU A;  2L6O A;  3A42 A;  4QNM A;  5ITY A;  3GQ4 A;  3SAR A;  1WGL A;  4LJ5 A;  3SHF A;  1TH3 A;  1G59 A;  2Y20 A;  3U60 B;  4D82 A;  5DNY A;  4R71 A;  3NBI A;  3SYK A;  1FNN A;  4JI0 M;  2CV0 A;  4NSR A;  4FWG A;  2DZL A;  3AL0 C;  1JR3 E;  3LQQ A;  4IBD A;  5IZ7 D;  5E6J A;  5FTN A;  3U5Z A;  4L78 A;  2LWX A;  2LBC A;  4AW4 A;  2KRK A;  3H4M A;  3HU1 A;  2D7H A;  1E94 E;  4M0D A;  1GKI A;  2R6F A;  1QUS A;  1MJG M;  3VKG A;  4CIZ A;  3TWM A;  3B7Q A;  5H37 D;  2D7G A;  3L29 A;  4HLQ A;  3KXE C;  5EXS A;  4MB7 A;  2APL A;  4DV6 M;  1PM5 A;  1R7R A;  4CGY B;  1IM2 A;  4HEO A;  2VII A;  1IN6 A;  4DR5 M;  4FD2 A;  2R18 A;  3VK8 A;  3VK7 A;  3L2A A;  1H6U A;  1NSF A;  1SXJ A;  1K82 A;  1V33 A;  2R62 A;  3J7A S;  2C99 A;  1DGH B;  3LMM A;  3L28 A;  4DV0 M;  3EIE A;  4KLN A;  3RE8 A;  2MR9 A;  4BBA A;  5JI3 E;  4AKG A;  1E9S A;  1DGF A;  2CV2 A;  2JY6 B;  1DGB A;  1XXH A;  1OAO C;  3C9P A;  4KOD A;  1UM8 A;  3HHY A;  1NJF A;  3TQS A;  5KQ8 A;  2V1U A;  4LFC M;  4G4N A;  1PGY A;  4FWD A;  1L2C A;  4IBC A;  4I81 A;  3Q8G A;  4B7G A;  4DV4 M;  4KHP M;  2QBY A;  1D0K A;  4RF0 A;  3W67 A;  5C18 A;  1HR0 M;  3AOE A;  2KZS A;  1TGU A;  4GH9 A;  4Q7J A;  4LGY A;  1Q39 A;  2DWZ B;  4MM3 B;  1TDH A;  1T6O A;  3FKE A;  1QDT A;  3W0L B;  1S3S A;  2J7N A;  3GLH E;  3KOX E;  4OW0 A;  2I7N A;  5ITU A;  3KOZ E;  3GLF A;  4LJ7 A;  3LCU A;  4DV2 M;  3HHW A;  2F5Q A;  4MGH A;  1DGG A;  2K0B X;  2Q2E B;  3QAU A;  3SFZ A;  2L4E A;  1OAI A;  2QHO B;  3GRV A;  3KOW E;  7CAT A;  1GJT A;  2KEB A;  4FWH A;  2KNZ A;  3W68 A;  2FOI C;  4IBG A;  4DUZ M;  2LVO C;  3FYC A;  2G8L A;  3IHP A;  4QOS A;  1W5T A;  3SMS A;  1GLN A;  2UUC M;  4LF7 M;  1HQC A;  1GAB A;  3KFU G;  1F4I A;  3THG A;  4XBO A;  5DYI A;  4NC6 A;  4JYA M;  1EFU B;  1QQW A;  2DHR A;  2M60 A;  3LW5 F;  2CUZ A;  1GL6 A;  3WHK A;  1RU3 A;  4B3R M;  1PJS A;  2QCU A;  3F92 A;  2C9C A;  5KPT A;  2CE7 A;  2KZU A;  3U6E A;  2OOA A;  2CV1 A;  1Z5C A;  2H5X A;  2VQF M;  2DAE A;  1IY1 A;  4LZZ A;  4I8O A;  2LVA A;  4G3O A;  5JI2 E;  3J2P B;  2RKO A;  3KVW A;  5IRE B;  2XLJ A;  3T1H M;  4G4Q A;  1PJI A;  1IQP A;  4GKJ M;  4GRI A;  1PJQ A;  3QYE A;  4LJA A;  3HJQ A;  1K3X A;  2X4A A;  1SXJ B;  1IXS B;  1TR8 A;  1T3T A;  2LHC A;  2O01 F;  1A5T A;  2GQF A;  3HGI A;  4GEW A;  3U61 A;  3AFH A;  4B3S M;  4QHS A;  1IBL M;  1G3I A;  2H1R A;  2Z4S A;  5ITX A;  1IXR C;  3I4Y A;  3BXW A;  4IBJ A;  5KQD A;  3OTO M;  1K3W A;  3U60 A;  4NL4 H;  2VDB B;  2XSZ A;  4P17 A;  3UJN A;  1KFV A;  2L2D A;  2R46 A;  1N32 M;  3AOE C;  2BWE A;  3L26 A;  2KNV A;  2D7E A;  4RNA A;  1GJS A;  2EJS A;  2XFS A;  1HJP A;  4EIW A;  3AKZ A;  2R44 A;  4OU7 A;  4GMQ A;  2V1C A;  2R4J A;  1PJT A;  3GLH A;  2B3T A;  4QNR A;  1WGN A;  4X62 M;  2FE8 A;  1G8P A;  3HX3 A;  2XFT A;  3WHL A;  2OOB A;  1WIV A;  3SYL A;  1KSF X;  2UUA M;  1NHG C;  4L4U A;  2XZF A;  5E26 A;  5EXP A;  4AI6 A;  3U6M A;  3EIH A;  4NRW A;  1XMO M;  5FTM A;  4ANR A;  2LHG A;  1QAN A;  1QAO A;  2LNH C;  3GQ3 A;  3FRI A;  4IBI A;  1P3Q Q;  1N75 A;  3PFI A;  4PT5 A;  3SAV A;  1N34 M;  2UXB M;  3HU3 A;  3MHV C;  8CAT A;  2MJ5 B;  2QPA A;  3BOS A;  4F1I A;  1L1Z A;  1GO5 A;  2UXD M;  1NY6 A;  3HY5 A;  4F2L A;  2YR0 A;  1BVS A;  1Z5A A;  3RGP A;  3C58 A;  3CTW B;  1XNR M;  4MGI E;  1D2N A;  1EE8 A;  2YNM D;  2R4E A;  2DEN A;  1L2D A;  3HHX A;  3GLF B;  4JI4 M;  1QZE A;  4JI3 M;  2BWB A;  1GL7 A;  2K9D A;  4PCZ A;  3J81 S;  3A98 B;  5FTL A;  4X66 M;  4IBK A;  3NWL A;  5ITR A;  3K1J A;  2QP9 X;  3R8F A;  2RRU A;  1IXZ A;  4LJ9 A;  3U61 B;  2DWM A;  1TH4 A;  3CF0 A;  3GRY A;  4LGM A;  4LFA M;  1SG9 A;  3TL4 X;  4JN6 A;  2LVN C;  3VDU A;  3J27 B;  2O5R A;  4LRT A;  4TUW A;  4FW9 A;  4L15 A;  4II7 A;  3I4V A;  2MH8 A;  4M0W A;  3M7G A;  1NY5 A;  1Z6T A;  3ZH9 B;  4LY6 A;  5ITQ A;  2EUC A;  3C3D A;  3ZQJ A;  1ORY B;  1HNX M;  1JR3 D;  3KDS E;  5EXT A;  1DO0 A;  1KYI A;  5EP1 A;  1NVM A;  5EP4 A;  3K8Z A;  3GP1 A;  3PNV A;  2G5G X;  1HT2 E;  2KDL A;  2ZAM A;  1EIJ A;  2F5P A;  1Z5B A;  5EP2 A;  1LTM A;  3E4R A;  1HNZ M;  1PRB A;  3B74 A;  4ZPX A;  4Z8X A;  1TTE A;  2KXE A;  2K47 A;  1I94 M;  2P5T A;  2FS1 A;  3E46 A;  2MRO B;  4OVZ A;  3W0F A;  2ZTC A;  3CF6 E;  4OVZ B;  3M6A A;  2EO2 A;  1VQ1 A;  3HKP A; 
#chains in the Genus database with same CATH homology
 1NV9 A;  2LVA A;  1HT1 E;  4G3O A;  5JI2 E;  1YLA A;  1CUK A;  4UN2 B;  3K9P A;  2DHY A;  1C7Y A;  1R4G A;  2DKL A;  2DNA A;  1WHC A;  2CP8 A;  4GEW A;  1TR8 A;  2OO9 A;  1A5T A;  1VEK A;  2EKF A;  1OKS A;  1WR1 B;  1NV8 A;  1WJ7 A;  1ZMU A;  1ZMW A;  2O25 A;  1G3I A;  1ZV1 A;  1UFZ A;  3GLI E;  1OQY A;  2DAM A;  1WGL A;  2LVQ D;  1IFY A;  4R71 A;  2L2D A;  3MMP A;  2DI0 A;  2BWE A;  2KNV A;  2EJS A;  2CWB A;  1OTR A;  1HJP A;  2DZL A;  2ZTD A;  3FRH A;  1Q02 A;  2DAG A;  4WP2 A;  2R0I A;  2QSF X;  1JR3 E;  1V92 A;  1VEG A;  2B3T A;  1WGN A;  2DAK A;  2JY7 A;  2LBC A;  2OOB A;  1AIP C;  1E94 E;  1WIV A;  2G3Q A;  2JY8 A;  3T6P A;  3B89 A;  3H4J A;  4DBG B;  3GLF E;  2JNH A;  1VEJ A;  1IM2 A;  4HEO A;  2JP7 A;  2WZJ A;  2JZ1 A;  3FRI A;  1P3Q Q;  3IEC A;  2MR9 A;  2MJ5 B;  4F1I A;  1GO5 A;  2LVP C;  2JY6 B;  4F2L A;  1BVS A;  1DO2 A;  2DAI A;  1PGY A;  1VDL A;  3LCV B;  1MN3 A;  2DEN A;  2EKK A;  3GLG E;  1QZE A;  2BWB A;  2K9D A;  4Q7J A;  2KNA A;  1VG5 A;  3E21 A;  1T6O A;  1G41 A;  2RRU A;  1IXS A;  1VQ1 A;  3GLH E;  2L4F A;  1SG9 A;  3LCU A;  2LVN C;  2MGW A;  1XB2 B;  2K0B X;  2L4E A;  1OAI A;  2QHO B;  3BBZ A;  2KNZ A;  2LTU A;  2LVO C;  2KHH A;  3IHP A;  1G4A E;  2JZ0 A;  1DO0 A;  1KYI A;  3FE3 A;  1HQY E;  1F4I A;  1ZMV A;  1HT2 E;  2HAK A;  1XXH E;  5DFL A;  2HWJ A;  2QNJ A;  1EFU B;  1DV0 A;  1TTE A;  2JUJ A;  1T43 A;  3F92 A;  3E46 A;  2MRO B;  2ZTC A;  2OOA A;  3K9O A;  1Y8G A;  2H5X A;  2DAE A;  2JY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...