3D8LA

Crystal structure of orf12 from the lactococcus lactis bacteriophage p2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
GAKQLSTARKFKMITGKDLFQQQKAMDTELKKEDGEITDLMEFVQYGLYLALFQDNIVKAKSDFSDFRSSFEFDTDGKGLKELVELWQKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ORF12
publication title Crystal structure of ORF12 from Lactococcus lactis phage p2 identifies a tape measure protein chaperone
pubmed doi rcsb
source organism Lactococcus phage p2
total genus 31
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.940 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3d8lA00
3D8LA
chains in the Genus database with same CATH superfamily
3T1YM 2MJ5B 4DR1M 5C18A 3GLGE 1VDDA 1SG9A 4F1IA 2KZSA 4LJ8A 4L4UA 3U61B 1ZMUA 4KHPM 2DAIA 3KOZE 2L09A 2R45A 3K9OA 5DNYA 2LBCA 3H4MA 1N32M 4IBIA 1TH4A 4JI4M 2XLJA 3LQRA 4P17A 2L7HA 2JA2A 4AKIA 1MN3A 3I4VA 3U6PA 2LTUA 1XXHB 3OTOM 3PNYA 1SXJD 2L2DA 4LZJA 4L8RC 1EFUB 2CFOA 2MR9A 1OAOC 2ZM6M 3SAUA 4I5SA 2C9CA 2MROB 4LGYA 4LFAM 3GLFE 1FJGM 4G4NA 4G4RA 2FFJA 2LWXA 4WW0A 4XGIA 4B7HA 3U6OA 2KRUA 1N78A 1DGHA 4GIPA 1SXJE 1WJ7A 3I01M 1XNQM 3KP0E 2R4JA 3K1JA 5KPTA 2VQFM 4PDGA 1NJGA 4D82A 1QAQA 2E5LM 2OOBA 4OU7A 1NV9A 1E9SA 1ZMVA 2HKJA 2EKKA 5ITXE 3GLIA 3U6MA 2DZNB 1QAMA 3CGWA 2WSEF 1V34A 1HJPA 1GABA 5ITUA 1NVMA 4X65M 1KSFX 5EP4A 4JI6M 3KVWA 2LNHC 2ZBKB 1IN6A 3GQ3A 4GMQA 2X4AA 2DAGA 4NOOB 3SMPA 4B3MM 3GLHE 2DENA 3QYBA 2CUZA 3GLGB 1GO5A 3U61A 2Z4SA 2FOIC 4IJFA 3EIEA 3FYDA 4NRVA 2FH0A 4AKHA 2H1RA 1I94M 5KPZA 4I81A 4UN2B 2KZUA 1HT1E 1XXHA 2B3TA 2KNAA 1NV8A 3UGJA 2D7EA 5EP2A 3NBXX 2DAEA 4QOSA 4CIZA 3U5ZB 1L1TA 1T3TA 2R4EA 3PNVA 4NXNM 2LHGA 1J5EM 1Z5BA 2FE8A 1JQJC 3FYCA 5EXSA 2HCBA 2CP8A 4FCTA 1Q3BA 3GLFB 2OPFA 1G71A 2KRKA 4JYAM 3B89A 3GLIE 2HWJA 2JY6B 3E21A 3WHKA 1IY1A 1GJTA 1ZQ9A 1WGLA 5EP3A 1LV7A 3Q8XA 3U6SA 1Z59A 4IBBA 2M5ZA 4LJAA 2UXCM 3SHFA 4B3TM 2F4VM 3AOGA 5EJCA 4IBJA 4DV6M 2XZUA 4LJ6A 3L25A 2Y21A 1G4AE 1PRBA 3FTCA 4IJEA 3ZC7B 3GRVA 3SAVA 1QZMA 1HNZM 3SHGB 1UM8A 3IHPA 1HR0M 4GC9A 4ITQA 2G3QA 1G41A 2YQZA 3FUWA 2Q2EB 3IG8A 3TL4X 4LCBA 5BR8M 4LJ7A 4DV2M 3U6EA 1I4WA 4BLCA 5KPRA 3U6LA 4YY3M 1ZAEA 4NSOB 4QNRA 4LF5M 4DV0M 3RE8A 5H37D 3SMSA 3GLHB 3K9PA 1XB2B 2RGOA 5E6JA 3K8ZA 4B3RM 1L2BA 4OX9M 2Z4RA 2F5NA 4PD2A 5FTLA 1GVNA 1TH3A 2VDBB 3LCVB 2FS1A 1IFYA 4IBKA 4WURA 5FTNA 1QYRA 5GKNA 1YUBA 3FUUA 3GRYA 3AOEC 4KO8A 2GNOA 2UUCM 3B74A 1W5TA 3PVSA 1OIZA 3L29A 4KLNA 2CHQA 5FLXS 4LRSA 3DOAA 2WSCF 4IBDA 2X49A 3KW6A 1TH2A 3BBZA 3GLFA 2C5RA 4JI0M 3U6DA 2I7PA 3W67A 2DWMA 3FUXA 1FNNA 1R7RA 2QHOB 2V6ZM 1EIJA 1E9RA 1N34M 1E32A 1DO2A 1HQYE 3FRHA 3VKGA 2XEPA 2UXDM 1SXJC 4RF0A 3I51A 1QUSA 1PJJA 2DKLA 2MH8A 1IQPA 1IY2A 1PJIA 1F4IA 3W0FA 5DFLA 1VDLA 1K82A 2LVPC 5ITXA 3C3EA 1TGUA 2DWZB 1R5LA 2BJVA 1PJTA 1DGGA 5DYGA 1Z5AA 3QWLA 4IBGA 3THGA 2ZTDA 1XMQM 4NXMM 2LVQD 3CF2A 4A3VB 3F92A 3HJ8A 2DHRA 2JP7A 3HU2A 4AZFA 2LH0A 5ITQA 3JAMS 1GL6A 1YLAA 1OJLA 4MH0E 1WGNA 1DO0A 2UUBM 1NHWC 3GLHA 2K47A 4NRWA 3KSJA 4I4LA 5JI3E 1UFZA 4II7A 4REZA 4CISA 2N35A 2L7IA 5A2QS 3LW5F 2DNAA 4FWGA 2BJWA 3VLFB 2QNJA 3T1HM 1QZEA 5EQTA 4MGKE 4Y28F 2VQEM 3SATA 2QENA 4RF1A 5F3WA 2DWLA 1TDHA 3U6CA 2UXBM 3C3DA 2JWSA 4DV5M 3M0EA 3WHLA 1ZV1A 2LHCA 4JI7M 2C98A 1QDTA 2G5GX 2V1CA 3VDUA 4EIWA 2OO9A 3ZH9B 4AKGA 5ITYA 3NWLA 3FKEA 2CEAA 5JI2E 3K92A 2UU9M 3AL0C 3J27B 1WR1B 1AIPC 4JI1M 4QHSA 1N77A 4MGIE 4GHAA 3E4RA 2YNMD 2G8LA 1N75A 2BWBA 2LXEA 2APLA 2XFSA 4LF8M 2QSFX 2QZ4A 1PJSA 2VF7A 4KT0F 3GRRA 4R7GA 2DI0A 3MJ5A 4R3DA 2VIIA 2DAMA 2XGNA 3GPUA 1NJFA 1GKIA 4DUYM 3LVVA 5L8RF 1K3WA 4QOZC 4LY6A 2CRUA 1QVRA 2ZAMA 1C7YA 4JI2M 4GH9A 1C1KA 4JXJA 4G4OA 4LG2A 4FW9A 1XNRM 3GPPA 4I8OA 1OTRA 2DVWB 4OW0A 5IZ7D 1NY6A 3AV0A 2EJSA 2L6OA 2EO2A 2V1UA 1LTMA 4RKUF 4LFBM 2XSZD 1GL7A 3RGSA 3BOSA 4LJ9A 2R18A 1T43A 4B3SM 1VEKA 2D7GA 2W82A 4JI5M 3KP1E 4FWHA 3TWMA 1XWIA 4D81A 1RU3A 7CATA 2XH9A 3CTWB 2J7OA 1NNUC 4P16A 1TDZA 2JUJA 4OVZB 1EE8A 1TF0B 2CHGA 2JY7A 4ZPXA 3DFZA 5IWAM 2K9DA 3PXGA 3L28A 5ITTA 1R4GA 4BBAA 2WZJA 1DV0A 1J7KA 2H5XA 1G8PA 1QQWA 2M60A 4GKJM 3FUVA 1NHGC 2Z7JA 1DGFA 2Z8YM 3B9PA 3NBIA 2RKOA 3KOXE 2O5RA 3IG5A 1IN5A 1QUTA 3Q8GA 5E26A 3KS8A 1PJQA 1QDRA 1T6OA 4PDIA 4LF6M 5EXXA 4LF4M 1GJSA 4X66M 4DBGB 2WSFF 1K3XA 3HJQA 2JZ1A 4M9SA 3CF6E 1HQCA 3HJSA 1MJGM 1D0MA 2LVNC 1XMOM 1WXQA 4Z8XA 3T38A 4AW4A 4R71A 2Z3XA 4DR6M 2JY8A 3A45A 4M0DA 3SC3A 2HAKA 4DV1M 2DHYA 3L27A 1VEJA 1Q3CA 2O25A 3GO8A 3M7GA 4DUZM 2JZ0A 4RNAA 3UK6A 1BVSA 5FSWA 4B7FA 1AUAA 1D2NA 3E46A 3QAUA 3SARA 2J5YA 4S12A 4FD2A 1G3IA 2KW0A 2CV0A 4ANRA 3HHXA 4GHLA 4GKKM 1MU5A 3TE6A 2EUCA 2MGWA 5IT9S 4DV4M 1OQYA 1R2ZA 3CF0A 4OVZA 3A42A 4F2LA 1IXSB 5IREB 1R6BX 2R44A 2C99A 2C9OA 2Y0TA 3K2LA 5ITRA 2Y20A 3LMMA 4D80A 2BWEA 1GLNA 4MB7A 2I7NA 2KNVA 2L4FA 5FTMA 3SYLA 4KODA 3SASA 4IBFA 3JR4A 3D8BA 1IBKM 1E94E 4LJ4A 2RGHA 1CUKA 2ZAOA 3V76A 2R62A 3GPXA 2DWNA 4IBEA 4W5WA 2QBYB 1JR3A 5EXTA 3DZDA 4JI8M 5EP1A 2DZOB 1IBLM 1NSFA 3VFDA 3W68A 4MGZE 2EKFA 3KFUG 2XZFA 2HHHM 4DR3M 3QYEA 1V92A 3MK6A 3FTEA 3C9PA 1KFVA 1IN8A 3L26A 3E9SA 3BXWA 2A5YB 2QP9X 2F5OA 1N33M 3IECA 3VDPA 3UMMA 4AG6A 2GQFA 3AKZA 4YHHM 1P3QQ 1OIPA 2D7HA 2XF3A 4X62M 4DV3M 2AHMA 3HGIA 3FTFA 5BPVA 3D8LA 3DA1A 1JR3D 1V33A 3UJNA 1NNJA 4LZZA 1HNWM 2ZTCA 1MX0A 1Q02A 2CWBA 3J7AS 3AFHA 2XFTA 1IXSA 4FWDA 2XSZA 4LRTA 4QHTA 4FCWA 3RFWA 2DXIA 3PFIA 2KNZA 2YFQA 2P5TA 3ZCBB 4JV5M 4TUWA 3FD9A 3FRIA 1JR3E 3HHYA 3J81S 2CV1A 1ZMWA 3GRUA 4L6V6 1J09A 2LVOC 2KXEA 1Q39A 3J80S 3VK8A 4IIWA 1NY5A 4IBCA 2EA0A 1IXRC 3MHVC 2HL7A 4MGYE 4X64M 3MMPA 4CJ6A 2KHHA 1S3SA 3VK7A 2R46A 2QBYA 2UUAM 3HU3A 4DR5M 2F5SA 4LJ5A 3GQ4A 2X8AA 1W5SA 3TWKA 1WIVA 1HNXM 4NC6A 3KS4A 1H6UA 3J7BA 3HY5A 1VQ1A 2FNAA 3SYKA 1VG5A 1A5TA 2JY5A 2ZANA 3B7NA 1L2DA 1TTEA 2KEBA 1YSYA 1L8QA 1NO1A 2OOAA 1PM5A 2QPAA 1L2CA 2LVAA 1QAOA 2JXNA 4G4QA 2F5PA 4CGYB 4AI6A 1Z5CA 2C96A 4XBOA 1L1ZA 3U60B 2DAKA 3U6QA 4JN6A 2RRUA 2BNKA 3LCUA 3I04M 2R6FA 4DV7M 4LFCM 3KOYE 1HT2E 2K6BA 3J2PB 3L2AA 5FTKA 1D0LA 4JI3M 4FCVA 4B08A 1XHBA 3AJIB 2CE7A 1OAIA 3ZQJA 3JR5A 1N36M 2L4EA 1D0KA 3TWLA 5KQ8A 5LMNM 5EXPA 1Z6TA 4M0WA 4L78A 4DR4M 3EIHA 3T15A 4Z6YA 3FUTA 4HEOA 1IXZA 3KOWE 4BB9A 3I4YA 2KDLA 4Q7JA 3LQQA 1SXJB 4PT5A 1VEGA 3A46A 5KQDA 4NL4H 1IM2A 1Y8GA 1G59A 3GP1A 4AQYM 3LVWA 3R9XB 3VKHA 4GEWA 3HHZA 1DGBA 4L15A 4L16A 2YR0A 5FTJA 3HU1A 4GRIA 3FTDA 4QNMA 1TR8A 1PGYA 1XC8A 2QCUA 2DZLA 4HL4A 4M9ZA 2J7NA 4PCZA 3W0LB 3GLGA 1WHCA 1XXHE 4DR2M 2ERCA 2Y0QA 3U60A 1IY0A 3KXEC 5DYIA 2QQ8A 3TPZA 3M6AA 3T6PA 2OQ4A 3SAWA 3AOEA 3KSXA 3GPYA 1IN7A 1OFIA 4CHTB 3R8FA 3HHWA 3TQSA 2CV2A 2VF8A 4GITA 2F5QA 2R65A 3A98B 3UZUA 3U5ZA 1IBMM 1OKSA 1QANA 4K0KM 1X37A 4AG5A 1DGHB 2KA6B 4MGHA 5KO3A 3RGPA 4M9XA 1OFHA 3FE3A 4MM3B 4B7GA 1IN4A 4LF7M 4LGMA 1KYIA 4GC5A 2R0IA 4NSRA 3HZJA 3B7ZA 4HLQA 3HX3A 4FVMA 3GLIB 3B7QA 8CATA 2JNHA 3GQ5A 3C58A 4G6ZA 4G3OA 3SBJA 1SXJA 5C1BA 4WP2A 2K0BX 5LMUM 4XK8F 4DR7M 1YE9A 2NQ8C 3HWSA 3SFZA 1R2YA 3ILKA 3H4JA 3HKPA 2CHVA 4LF9M 3KDSE 1ORYB 1JB0F 2O01F
chains in the Genus database with same CATH topology
3T1YM 4DR1M 5C18A 1VDDA 2KZSA 4LJ8A 4L4UA 3U61B 4KHPM 3KOZE 5DNYA 2L09A 2R45A 3H4MA 1N32M 4IBIA 1TH4A 4JI4M 2XLJA 3LQRA 2L7HA 2JA2A 4AKIA 3I4VA 3U6PA 1XXHB 3OTOM 3PNYA 1SXJD 4LZJA 4L8RC 2CFOA 2ZM6M 3SAUA 4I5SA 2C9CA 4LGYA 4LFAM 1FJGM 4G4NA 4G4RA 2FFJA 2LWXA 4WW0A 4XGIA 4B7HA 3U6OA 2KRUA 1N78A 1DGHA 4GIPA 1SXJE 1XNQM 3KP0E 2R4JA 3K1JA 5KPTA 2VQFM 4PDGA 1NJGA 4D82A 1QAQA 2E5LM 4OU7A 2HKJA 1E9SA 5ITXE 3GLIA 3U6MA 2DZNB 1QAMA 5ITUA 1NVMA 4X65M 1KSFX 5EP4A 4JI6M 3KVWA 2LNHC 2ZBKB 1IN6A 3GQ3A 4GMQA 2X4AA 4NOOB 4B3MM 3SMPA 3GLGB 2CUZA 3U61A 2Z4SA 2FOIC 4IJFA 3EIEA 3FYDA 4NRVA 4AKHA 2H1RA 1I94M 5KPZA 4I81A 2KZUA 1HT1E 1XXHA 3UGJA 2D7EA 5EP2A 4QOSA 3U5ZB 1L1TA 1T3TA 2R4EA 3PNVA 4NXNM 1J5EM 1Z5BA 2FE8A 1JQJC 3FYCA 5EXSA 2HCBA 4FCTA 3GLFB 1Q3BA 2OPFA 4JYAM 2KRKA 3WHKA 1IY1A 1ZQ9A 5EP3A 1LV7A 3Q8XA 3U6SA 1Z59A 4IBBA 2M5ZA 4LJAA 2UXCM 3SHFA 4B3TM 2F4VM 3AOGA 5EJCA 4IBJA 4DV6M 2XZUA 4LJ6A 3L25A 2Y21A 1G4AE 3FTCA 4IJEA 3ZC7B 3SAVA 3GRVA 1HNZM 1QZMA 1HR0M 3SHGB 1UM8A 4GC9A 4ITQA 3IG8A 3FUWA 1G41A 2Q2EB 2YQZA 3TL4X 4LCBA 5BR8M 4LJ7A 4DV2M 3U6EA 1I4WA 4BLCA 5KPRA 3U6LA 4YY3M 1ZAEA 4NSOB 4QNRA 4LF5M 4DV0M 3RE8A 5H37D 3SMSA 3GLHB 4B3RM 2RGOA 5E6JA 3K8ZA 1L2BA 4OX9M 2Z4RA 2F5NA 4PD2A 5FTLA 1GVNA 1TH3A 4IBKA 4WURA 5FTNA 1QYRA 5GKNA 1YUBA 3FUUA 3GRYA 3AOEC 4KO8A 2UUCM 1W5TA 3PVSA 3L29A 4KLNA 2CHQA 5FLXS 4LRSA 3DOAA 4IBDA 2X49A 3KW6A 1TH2A 3GLFA 2C5RA 4JI0M 3U6DA 2I7PA 2DWMA 3FUXA 1FNNA 1R7RA 2V6ZM 1E9RA 1N34M 1E32A 1DO2A 1HQYE 3VKGA 2XEPA 2UXDM 1SXJC 4RF0A 3I51A 1PJJA 1IQPA 1IY2A 1PJIA 3W0FA 1K82A 5ITXA 1TGUA 2DWZB 2BJVA 1DGGA 5DYGA 1Z5AA 3QWLA 4IBGA 3THGA 1XMQM 4NXMM 3CF2A 4A3VB 3HJ8A 4AZFA 2DHRA 3HU2A 5ITQA 2LH0A 3JAMS 1GL6A 1OJLA 4MH0E 1DO0A 2UUBM 1NHWC 3GLHA 2K47A 4NRWA 3KSJA 4I4LA 5JI3E 4II7A 4REZA 4CISA 2L7IA 5A2QS 4FWGA 2BJWA 3VLFB 3T1HM 5EQTA 4MGKE 2VQEM 3SATA 2QENA 4RF1A 5F3WA 2DWLA 1TDHA 3U6CA 2UXBM 4DV5M 3M0EA 3WHLA 4JI7M 2C98A 2G5GX 2V1CA 4EIWA 3VDUA 3ZH9B 4AKGA 5ITYA 3NWLA 3FKEA 2CEAA 5JI2E 3K92A 2UU9M 3AL0C 3J27B 4JI1M 4QHSA 1N77A 4MGIE 4GHAA 3E4RA 2YNMD 2G8LA 1N75A 2LXEA 2XFSA 4LF8M 2QZ4A 3GRRA 4R7GA 3MJ5A 4R3DA 2VIIA 2XGNA 3GPUA 1NJFA 1GKIA 4DUYM 3LVVA 1K3WA 4QOZC 4LY6A 1QVRA 2ZAMA 4JI2M 4GH9A 1C1KA 4JXJA 4G4OA 4LG2A 4FW9A 1XNRM 3GPPA 4I8OA 2DVWB 4OW0A 5IZ7D 1NY6A 3AV0A 2L6OA 2EO2A 2V1UA 4LFBM 2XSZD 1GL7A 3RGSA 3BOSA 4LJ9A 2R18A 4B3SM 2D7GA 2W82A 4JI5M 3KP1E 4FWHA 3TWMA 1XWIA 4D81A 7CATA 2XH9A 3CTWB 2J7OA 1NNUC 4P16A 1TDZA 4OVZB 1EE8A 2CHGA 4ZPXA 5IWAM 3DFZA 3PXGA 3L28A 5ITTA 4BBAA 1J7KA 2M60A 1G8PA 1QQWA 4GKJM 3FUVA 1NHGC 2Z7JA 1DGFA 3B9PA 3NBIA 5EXTA 2RKOA 3KOXE 2O5RA 3IG5A 1IN5A 5E26A 3KS8A 4LF6M 4PDIA 5EXXA 4LF4M 4X66M 1K3XA 3HJQA 4M9SA 3CF6E 1HQCA 3HJSA 1XMOM 1WXQA 4Z8XA 3T38A 4AW4A 2Z3XA 4DR6M 3A45A 4M0DA 3SC3A 4DV1M 3L27A 1Q3CA 3GO8A 3M7GA 4DUZM 4RNAA 3UK6A 5FSWA 4B7FA 1D2NA 3QAUA 3SARA 4S12A 4FD2A 1G3IA 2KW0A 2CV0A 3HHXA 4GHLA 4GKKM 1MU5A 3TE6A 2EUCA 5IT9S 4DV4M 1R2ZA 3CF0A 4OVZA 3A42A 1IXSB 5IREB 1R6BX 2C99A 2C9OA 2Y0TA 3K2LA 5ITRA 2Y20A 3LMMA 4D80A 1GLNA 4MB7A 2I7NA 5FTMA 3SYLA 4KODA 3SASA 4IBFA 3JR4A 3D8BA 1IBKM 1E94E 4LJ4A 2RGHA 2ZAOA 3GPXA 2R62A 2DWNA 4IBEA 4W5WA 2QBYB 1JR3A 4JI8M 3DZDA 5EP1A 2DZOB 1IBLM 1NSFA 3VFDA 4MGZE 3KFUG 2XZFA 2HHHM 4DR3M 3FTEA 3MK6A 1KFVA 1IN8A 3L26A 3E9SA 2A5YB 2QP9X 2F5OA 1N33M 3VDPA 3UMMA 4AG6A 3AKZA 4YHHM 2D7HA 2XF3A 4X62M 4DV3M 2AHMA 3HGIA 3FTFA 5BPVA 3D8LA 3DA1A 1JR3D 3UJNA 1NNJA 4LZZA 1HNWM 1MX0A 3J7AS 3AFHA 2XFTA 4FWDA 2XSZA 4LRTA 4QHTA 4FCWA 3RFWA 2DXIA 3PFIA 2YFQA 2P5TA 3ZCBB 4JV5M 4TUWA 3FD9A 3HHYA 2CV1A 3J81S 3GRUA 1J09A 2KXEA 1Q39A 3J80S 3VK8A 4IIWA 1NY5A 4IBCA 2EA0A 1IXRC 3MHVC 2HL7A 4MGYE 4X64M 3VK7A 1S3SA 2R46A 2QBYA 2UUAM 3HU3A 4DR5M 2F5SA 4LJ5A 3GQ4A 2X8AA 1W5SA 3TWKA 1HNXM 3KS4A 1H6UA 3J7BA 2FNAA 3SYKA 2ZANA 1L2DA 2KEBA 1YSYA 1L8QA 1PM5A 2QPAA 1L2CA 1QAOA 4G4QA 2F5PA 4CGYB 4AI6A 1Z5CA 2C96A 4XBOA 1L1ZA 3U60B 3U6QA 4JN6A 2BNKA 4DV7M 4LFCM 3KOYE 1HT2E 3J2PB 3L2AA 5FTKA 4JI3M 4FCVA 4B08A 1XHBA 3AJIB 2CE7A 3JR5A 1N36M 3TWLA 5KQ8A 5LMNM 5EXPA 1Z6TA 4M0WA 4L78A 4DR4M 3EIHA 3T15A 4Z6YA 3FUTA 1IXZA 3KOWE 4BB9A 3I4YA 3LQQA 1SXJB 4PT5A 3A46A 5KQDA 4NL4H 1IM2A 1G59A 3GP1A 4AQYM 3LVWA 3R9XB 3VKHA 3HHZA 1DGBA 4L15A 4L16A 2YR0A 5FTJA 3HU1A 4GRIA 3FTDA 4QNMA 1XC8A 2QCUA 4HL4A 4M9ZA 2J7NA 4PCZA 3W0LB 3GLGA 4DR2M 2ERCA 2Y0QA 3U60A 1IY0A 3KXEC 5DYIA 2OQ4A 3TPZA 3M6AA 3SAWA 3AOEA 3KSXA 3GPYA 1IN7A 1OFIA 4CHTB 3R8FA 3HHWA 3TQSA 2CV2A 2F5QA 4GITA 2R65A 3A98B 3UZUA 3U5ZA 1IBMM 1QANA 4K0KM 1X37A 4AG5A 1DGHB 2KA6B 4MGHA 5KO3A 3RGPA 4M9XA 1OFHA 4MM3B 4B7GA 1IN4A 4LF7M 4LGMA 1KYIA 4GC5A 4NSRA 4HLQA 4FVMA 3GLIB 8CATA 3GQ5A 3C58A 4G6ZA 3SBJA 1SXJA 5C1BA 5LMUM 4DR7M 1YE9A 2NQ8C 3HWSA 3SFZA 1R2YA 3ILKA 3HKPA 2CHVA 4LF9M 3KDSE 1ORYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8L A; 
#chains in the Genus database with same CATH topology
 3T1Y M;  2MJ5 B;  4DR1 M;  5C18 A;  3GLG E;  1VDD A;  1SG9 A;  4F1I A;  2KZS A;  4LJ8 A;  4L4U A;  3U61 B;  1ZMU A;  4KHP M;  2DAI A;  3KOZ E;  2L09 A;  2R45 A;  3K9O A;  5DNY A;  2LBC A;  3H4M A;  1N32 M;  4IBI A;  1TH4 A;  4JI4 M;  2XLJ A;  3LQR A;  4P17 A;  2L7H A;  2JA2 A;  4AKI A;  1MN3 A;  3I4V A;  3U6P A;  2LTU A;  1XXH B;  3OTO M;  3PNY A;  1SXJ D;  2L2D A;  4LZJ A;  4L8R C;  1EFU B;  2CFO A;  2MR9 A;  1OAO C;  2ZM6 M;  3SAU A;  4I5S A;  2C9C A;  2MRO B;  4LGY A;  4LFA M;  3GLF E;  1FJG M;  4G4N A;  4G4R A;  2FFJ A;  2LWX A;  4WW0 A;  4XGI A;  4B7H A;  3U6O A;  2KRU A;  1N78 A;  1DGH A;  4GIP A;  1SXJ E;  1WJ7 A;  3I01 M;  1XNQ M;  3KP0 E;  2R4J A;  3K1J A;  5KPT A;  2VQF M;  4PDG A;  1NJG A;  4D82 A;  1QAQ A;  2E5L M;  2OOB A;  4OU7 A;  1NV9 A;  1E9S A;  1ZMV A;  2HKJ A;  2EKK A;  5ITX E;  3GLI A;  3U6M A;  2DZN B;  1QAM A;  3CGW A;  2WSE F;  1V34 A;  1HJP A;  1GAB A;  5ITU A;  1NVM A;  4X65 M;  1KSF X;  5EP4 A;  4JI6 M;  3KVW A;  2LNH C;  2ZBK B;  1IN6 A;  3GQ3 A;  4GMQ A;  2X4A A;  2DAG A;  4NOO B;  3SMP A;  4B3M M;  3GLH E;  2DEN A;  3QYB A;  2CUZ A;  3GLG B;  1GO5 A;  3U61 A;  2Z4S A;  2FOI C;  4IJF A;  3EIE A;  3FYD A;  4NRV A;  2FH0 A;  4AKH A;  2H1R A;  1I94 M;  5KPZ A;  4I81 A;  4UN2 B;  2KZU A;  1HT1 E;  1XXH A;  2B3T A;  2KNA A;  1NV8 A;  3UGJ A;  2D7E A;  5EP2 A;  3NBX X;  2DAE A;  4QOS A;  4CIZ A;  3U5Z B;  1L1T A;  1T3T A;  2R4E A;  3PNV A;  4NXN M;  2LHG A;  1J5E M;  1Z5B A;  2FE8 A;  1JQJ C;  3FYC A;  5EXS A;  2HCB A;  2CP8 A;  4FCT A;  1Q3B A;  3GLF B;  2OPF A;  1G71 A;  2KRK A;  4JYA M;  3B89 A;  3GLI E;  2HWJ A;  2JY6 B;  3E21 A;  3WHK A;  1IY1 A;  1GJT A;  1ZQ9 A;  1WGL A;  5EP3 A;  1LV7 A;  3Q8X A;  3U6S A;  1Z59 A;  4IBB A;  2M5Z A;  4LJA A;  2UXC M;  3SHF A;  4B3T M;  2F4V M;  3AOG A;  5EJC A;  4IBJ A;  4DV6 M;  2XZU A;  4LJ6 A;  3L25 A;  2Y21 A;  1G4A E;  1PRB A;  3FTC A;  4IJE A;  3ZC7 B;  3GRV A;  3SAV A;  1QZM A;  1HNZ M;  3SHG B;  1UM8 A;  3IHP A;  1HR0 M;  4GC9 A;  4ITQ A;  2G3Q A;  1G41 A;  2YQZ A;  3FUW A;  2Q2E B;  3IG8 A;  3TL4 X;  4LCB A;  5BR8 M;  4LJ7 A;  4DV2 M;  3U6E A;  1I4W A;  4BLC A;  5KPR A;  3U6L A;  4YY3 M;  1ZAE A;  4NSO B;  4QNR A;  4LF5 M;  4DV0 M;  3RE8 A;  5H37 D;  3SMS A;  3GLH B;  3K9P A;  1XB2 B;  2RGO A;  5E6J A;  3K8Z A;  4B3R M;  1L2B A;  4OX9 M;  2Z4R A;  2F5N A;  4PD2 A;  5FTL A;  1GVN A;  1TH3 A;  2VDB B;  3LCV B;  2FS1 A;  1IFY A;  4IBK A;  4WUR A;  5FTN A;  1QYR A;  5GKN A;  1YUB A;  3FUU A;  3GRY A;  3AOE C;  4KO8 A;  2GNO A;  2UUC M;  3B74 A;  1W5T A;  3PVS A;  1OIZ A;  3L29 A;  4KLN A;  2CHQ A;  5FLX S;  4LRS A;  3DOA A;  2WSC F;  4IBD A;  2X49 A;  3KW6 A;  1TH2 A;  3BBZ A;  3GLF A;  2C5R A;  4JI0 M;  3U6D A;  2I7P A;  3W67 A;  2DWM A;  3FUX A;  1FNN A;  1R7R A;  2QHO B;  2V6Z M;  1EIJ A;  1E9R A;  1N34 M;  1E32 A;  1DO2 A;  1HQY E;  3FRH A;  3VKG A;  2XEP A;  2UXD M;  1SXJ C;  4RF0 A;  3I51 A;  1QUS A;  1PJJ A;  2DKL A;  2MH8 A;  1IQP A;  1IY2 A;  1PJI A;  1F4I A;  3W0F A;  5DFL A;  1VDL A;  1K82 A;  2LVP C;  5ITX A;  3C3E A;  1TGU A;  2DWZ B;  1R5L A;  2BJV A;  1PJT A;  1DGG A;  5DYG A;  1Z5A A;  3QWL A;  4IBG A;  3THG A;  2ZTD A;  1XMQ M;  4NXM M;  2LVQ D;  3CF2 A;  4A3V B;  3F92 A;  3HJ8 A;  2DHR A;  2JP7 A;  3HU2 A;  4AZF A;  2LH0 A;  5ITQ A;  3JAM S;  1GL6 A;  1YLA A;  1OJL A;  4MH0 E;  1WGN A;  1DO0 A;  2UUB M;  1NHW C;  3GLH A;  2K47 A;  4NRW A;  3KSJ A;  4I4L A;  5JI3 E;  1UFZ A;  4II7 A;  4REZ A;  4CIS A;  2N35 A;  2L7I A;  5A2Q S;  3LW5 F;  2DNA A;  4FWG A;  2BJW A;  3VLF B;  2QNJ A;  3T1H M;  1QZE A;  5EQT A;  4MGK E;  4Y28 F;  2VQE M;  3SAT A;  2QEN A;  4RF1 A;  5F3W A;  2DWL A;  1TDH A;  3U6C A;  2UXB M;  3C3D A;  2JWS A;  4DV5 M;  3M0E A;  3WHL A;  1ZV1 A;  2LHC A;  4JI7 M;  2C98 A;  1QDT A;  2G5G X;  2V1C A;  3VDU A;  4EIW A;  2OO9 A;  3ZH9 B;  4AKG A;  5ITY A;  3NWL A;  3FKE A;  2CEA A;  5JI2 E;  3K92 A;  2UU9 M;  3AL0 C;  3J27 B;  1WR1 B;  1AIP C;  4JI1 M;  4QHS A;  1N77 A;  4MGI E;  4GHA A;  3E4R A;  2YNM D;  2G8L A;  1N75 A;  2BWB A;  2LXE A;  2APL A;  2XFS A;  4LF8 M;  2QSF X;  2QZ4 A;  1PJS A;  2VF7 A;  4KT0 F;  3GRR A;  4R7G A;  2DI0 A;  3MJ5 A;  4R3D A;  2VII A;  2DAM A;  2XGN A;  3GPU A;  1NJF A;  1GKI A;  4DUY M;  3LVV A;  5L8R F;  1K3W A;  4QOZ C;  4LY6 A;  2CRU A;  1QVR A;  2ZAM A;  1C7Y A;  4JI2 M;  4GH9 A;  1C1K A;  4JXJ A;  4G4O A;  4LG2 A;  4FW9 A;  1XNR M;  3GPP A;  4I8O A;  1OTR A;  2DVW B;  4OW0 A;  5IZ7 D;  1NY6 A;  3AV0 A;  2EJS A;  2L6O A;  2EO2 A;  2V1U A;  1LTM A;  4RKU F;  4LFB M;  2XSZ D;  1GL7 A;  3RGS A;  3BOS A;  4LJ9 A;  2R18 A;  1T43 A;  4B3S M;  1VEK A;  2D7G A;  2W82 A;  4JI5 M;  3KP1 E;  4FWH A;  3TWM A;  1XWI A;  4D81 A;  1RU3 A;  7CAT A;  2XH9 A;  3CTW B;  2J7O A;  1NNU C;  4P16 A;  1TDZ A;  2JUJ A;  4OVZ B;  1EE8 A;  1TF0 B;  2CHG A;  2JY7 A;  4ZPX A;  3DFZ A;  5IWA M;  2K9D A;  3PXG A;  3L28 A;  5ITT A;  1R4G A;  4BBA A;  2WZJ A;  1DV0 A;  1J7K A;  2H5X A;  1G8P A;  1QQW A;  2M60 A;  4GKJ M;  3FUV A;  1NHG C;  2Z7J A;  1DGF A;  2Z8Y M;  3B9P A;  3NBI A;  2RKO A;  3KOX E;  2O5R A;  3IG5 A;  1IN5 A;  1QUT A;  3Q8G A;  5E26 A;  3KS8 A;  1PJQ A;  1QDR A;  1T6O A;  4PDI A;  4LF6 M;  5EXX A;  4LF4 M;  1GJS A;  4X66 M;  4DBG B;  2WSF F;  1K3X A;  3HJQ A;  2JZ1 A;  4M9S A;  3CF6 E;  1HQC A;  3HJS A;  1MJG M;  1D0M A;  2LVN C;  1XMO M;  1WXQ A;  4Z8X A;  3T38 A;  4AW4 A;  4R71 A;  2Z3X A;  4DR6 M;  2JY8 A;  3A45 A;  4M0D A;  3SC3 A;  2HAK A;  4DV1 M;  2DHY A;  3L27 A;  1VEJ A;  1Q3C A;  2O25 A;  3GO8 A;  3M7G A;  4DUZ M;  2JZ0 A;  4RNA A;  3UK6 A;  1BVS A;  5FSW A;  4B7F A;  1AUA A;  1D2N A;  3E46 A;  3QAU A;  3SAR A;  2J5Y A;  4S12 A;  4FD2 A;  1G3I A;  2KW0 A;  2CV0 A;  4ANR A;  3HHX A;  4GHL A;  4GKK M;  1MU5 A;  3TE6 A;  2EUC A;  2MGW A;  5IT9 S;  4DV4 M;  1OQY A;  1R2Z A;  3CF0 A;  4OVZ A;  3A42 A;  4F2L A;  1IXS B;  5IRE B;  1R6B X;  2R44 A;  2C99 A;  2C9O A;  2Y0T A;  3K2L A;  5ITR A;  2Y20 A;  3LMM A;  4D80 A;  2BWE A;  1GLN A;  4MB7 A;  2I7N A;  2KNV A;  2L4F A;  5FTM A;  3SYL A;  4KOD A;  3SAS A;  4IBF A;  3JR4 A;  3D8B A;  1IBK M;  1E94 E;  4LJ4 A;  2RGH A;  1CUK A;  2ZAO A;  3V76 A;  2R62 A;  3GPX A;  2DWN A;  4IBE A;  4W5W A;  2QBY B;  1JR3 A;  5EXT A;  3DZD A;  4JI8 M;  5EP1 A;  2DZO B;  1IBL M;  1NSF A;  3VFD A;  3W68 A;  4MGZ E;  2EKF A;  3KFU G;  2XZF A;  2HHH M;  4DR3 M;  3QYE A;  1V92 A;  3MK6 A;  3FTE A;  3C9P A;  1KFV A;  1IN8 A;  3L26 A;  3E9S A;  3BXW A;  2A5Y B;  2QP9 X;  2F5O A;  1N33 M;  3IEC A;  3VDP A;  3UMM A;  4AG6 A;  2GQF A;  3AKZ A;  4YHH M;  1P3Q Q;  1OIP A;  2D7H A;  2XF3 A;  4X62 M;  4DV3 M;  2AHM A;  3HGI A;  3FTF A;  5BPV A;  3D8L A;  3DA1 A;  1JR3 D;  1V33 A;  3UJN A;  1NNJ A;  4LZZ A;  1HNW M;  2ZTC A;  1MX0 A;  1Q02 A;  2CWB A;  3J7A S;  3AFH A;  2XFT A;  1IXS A;  4FWD A;  2XSZ A;  4LRT A;  4QHT A;  4FCW A;  3RFW A;  2DXI A;  3PFI A;  2KNZ A;  2YFQ A;  2P5T A;  3ZCB B;  4JV5 M;  4TUW A;  3FD9 A;  3FRI A;  1JR3 E;  3HHY A;  3J81 S;  2CV1 A;  1ZMW A;  3GRU A;  4L6V 6;  1J09 A;  2LVO C;  2KXE A;  1Q39 A;  3J80 S;  3VK8 A;  4IIW A;  1NY5 A;  4IBC A;  2EA0 A;  1IXR C;  3MHV C;  2HL7 A;  4MGY E;  4X64 M;  3MMP A;  4CJ6 A;  2KHH A;  1S3S A;  3VK7 A;  2R46 A;  2QBY A;  2UUA M;  3HU3 A;  4DR5 M;  2F5S A;  4LJ5 A;  3GQ4 A;  2X8A A;  1W5S A;  3TWK A;  1WIV A;  1HNX M;  4NC6 A;  3KS4 A;  1H6U A;  3J7B A;  3HY5 A;  1VQ1 A;  2FNA A;  3SYK A;  1VG5 A;  1A5T A;  2JY5 A;  2ZAN A;  3B7N A;  1L2D A;  1TTE A;  2KEB A;  1YSY A;  1L8Q A;  1NO1 A;  2OOA A;  1PM5 A;  2QPA A;  1L2C A;  2LVA A;  1QAO A;  2JXN A;  4G4Q A;  2F5P A;  4CGY B;  4AI6 A;  1Z5C A;  2C96 A;  4XBO A;  1L1Z A;  3U60 B;  2DAK A;  3U6Q A;  4JN6 A;  2RRU A;  2BNK A;  3LCU A;  3I04 M;  2R6F A;  4DV7 M;  4LFC M;  3KOY E;  1HT2 E;  2K6B A;  3J2P B;  3L2A A;  5FTK A;  1D0L A;  4JI3 M;  4FCV A;  4B08 A;  1XHB A;  3AJI B;  2CE7 A;  1OAI A;  3ZQJ A;  3JR5 A;  1N36 M;  2L4E A;  1D0K A;  3TWL A;  5KQ8 A;  5LMN M;  5EXP A;  1Z6T A;  4M0W A;  4L78 A;  4DR4 M;  3EIH A;  3T15 A;  4Z6Y A;  3FUT A;  4HEO A;  1IXZ A;  3KOW E;  4BB9 A;  3I4Y A;  2KDL A;  4Q7J A;  3LQQ A;  1SXJ B;  4PT5 A;  1VEG A;  3A46 A;  5KQD A;  4NL4 H;  1IM2 A;  1Y8G A;  1G59 A;  3GP1 A;  4AQY M;  3LVW A;  3R9X B;  3VKH A;  4GEW A;  3HHZ A;  1DGB A;  4L15 A;  4L16 A;  2YR0 A;  5FTJ A;  3HU1 A;  4GRI A;  3FTD A;  4QNM A;  1TR8 A;  1PGY A;  1XC8 A;  2QCU A;  2DZL A;  4HL4 A;  4M9Z A;  2J7N A;  4PCZ A;  3W0L B;  3GLG A;  1WHC A;  1XXH E;  4DR2 M;  2ERC A;  2Y0Q A;  3U60 A;  1IY0 A;  3KXE C;  5DYI A;  2QQ8 A;  3TPZ A;  3M6A A;  3T6P A;  2OQ4 A;  3SAW A;  3AOE A;  3KSX A;  3GPY A;  1IN7 A;  1OFI A;  4CHT B;  3R8F A;  3HHW A;  3TQS A;  2CV2 A;  2VF8 A;  4GIT A;  2F5Q A;  2R65 A;  3A98 B;  3UZU A;  3U5Z A;  1IBM M;  1OKS A;  1QAN A;  4K0K M;  1X37 A;  4AG5 A;  1DGH B;  2KA6 B;  4MGH A;  5KO3 A;  3RGP A;  4M9X A;  1OFH A;  3FE3 A;  4MM3 B;  4B7G A;  1IN4 A;  4LF7 M;  4LGM A;  1KYI A;  4GC5 A;  2R0I A;  4NSR A;  3HZJ A;  3B7Z A;  4HLQ A;  3HX3 A;  4FVM A;  3GLI B;  3B7Q A;  8CAT A;  2JNH A;  3GQ5 A;  3C58 A;  4G6Z A;  4G3O A;  3SBJ A;  1SXJ A;  5C1B A;  4WP2 A;  2K0B X;  5LMU M;  4XK8 F;  4DR7 M;  1YE9 A;  2NQ8 C;  3HWS A;  3SFZ A;  1R2Y A;  3ILK A;  3H4J A;  3HKP A;  2CHV A;  4LF9 M;  3KDS E;  1ORY B;  1JB0 F;  2O01 F; 
#chains in the Genus database with same CATH homology
 3T1Y M;  4DR1 M;  5C18 A;  1VDD A;  2KZS A;  4LJ8 A;  4L4U A;  3U61 B;  4KHP M;  3KOZ E;  5DNY A;  2L09 A;  2R45 A;  3H4M A;  1N32 M;  4IBI A;  1TH4 A;  4JI4 M;  2XLJ A;  3LQR A;  2L7H A;  2JA2 A;  4AKI A;  3I4V A;  3U6P A;  1XXH B;  3OTO M;  3PNY A;  1SXJ D;  4LZJ A;  4L8R C;  2CFO A;  2ZM6 M;  3SAU A;  4I5S A;  2C9C A;  4LGY A;  4LFA M;  1FJG M;  4G4N A;  4G4R A;  2FFJ A;  2LWX A;  4WW0 A;  4XGI A;  4B7H A;  3U6O A;  2KRU A;  1N78 A;  1DGH A;  4GIP A;  1SXJ E;  1XNQ M;  3KP0 E;  2R4J A;  3K1J A;  5KPT A;  2VQF M;  4PDG A;  1NJG A;  4D82 A;  1QAQ A;  2E5L M;  4OU7 A;  2HKJ A;  1E9S A;  5ITX E;  3GLI A;  3U6M A;  2DZN B;  1QAM A;  5ITU A;  1NVM A;  4X65 M;  1KSF X;  5EP4 A;  4JI6 M;  3KVW A;  2LNH C;  2ZBK B;  1IN6 A;  3GQ3 A;  4GMQ A;  2X4A A;  4NOO B;  4B3M M;  3SMP A;  3GLG B;  2CUZ A;  3U61 A;  2Z4S A;  2FOI C;  4IJF A;  3EIE A;  3FYD A;  4NRV A;  4AKH A;  2H1R A;  1I94 M;  5KPZ A;  4I81 A;  2KZU A;  1HT1 E;  1XXH A;  3UGJ A;  2D7E A;  5EP2 A;  4QOS A;  3U5Z B;  1L1T A;  1T3T A;  2R4E A;  3PNV A;  4NXN M;  1J5E M;  1Z5B A;  2FE8 A;  1JQJ C;  3FYC A;  5EXS A;  2HCB A;  4FCT A;  3GLF B;  1Q3B A;  2OPF A;  4JYA M;  2KRK A;  3WHK A;  1IY1 A;  1ZQ9 A;  5EP3 A;  1LV7 A;  3Q8X A;  3U6S A;  1Z59 A;  4IBB A;  2M5Z A;  4LJA A;  2UXC M;  3SHF A;  4B3T M;  2F4V M;  3AOG A;  5EJC A;  4IBJ A;  4DV6 M;  2XZU A;  4LJ6 A;  3L25 A;  2Y21 A;  1G4A E;  3FTC A;  4IJE A;  3ZC7 B;  3SAV A;  3GRV A;  1HNZ M;  1QZM A;  1HR0 M;  3SHG B;  1UM8 A;  4GC9 A;  4ITQ A;  3IG8 A;  3FUW A;  1G41 A;  2Q2E B;  2YQZ A;  3TL4 X;  4LCB A;  5BR8 M;  4LJ7 A;  4DV2 M;  3U6E A;  1I4W A;  4BLC A;  5KPR A;  3U6L A;  4YY3 M;  1ZAE A;  4NSO B;  4QNR A;  4LF5 M;  4DV0 M;  3RE8 A;  5H37 D;  3SMS A;  3GLH B;  4B3R M;  2RGO A;  5E6J A;  3K8Z A;  1L2B A;  4OX9 M;  2Z4R A;  2F5N A;  4PD2 A;  5FTL A;  1GVN A;  1TH3 A;  4IBK A;  4WUR A;  5FTN A;  1QYR A;  5GKN A;  1YUB A;  3FUU A;  3GRY A;  3AOE C;  4KO8 A;  2UUC M;  1W5T A;  3PVS A;  3L29 A;  4KLN A;  2CHQ A;  5FLX S;  4LRS A;  3DOA A;  4IBD A;  2X49 A;  3KW6 A;  1TH2 A;  3GLF A;  2C5R A;  4JI0 M;  3U6D A;  2I7P A;  2DWM A;  3FUX A;  1FNN A;  1R7R A;  2V6Z M;  1E9R A;  1N34 M;  1E32 A;  1DO2 A;  1HQY E;  3VKG A;  2XEP A;  2UXD M;  1SXJ C;  4RF0 A;  3I51 A;  1PJJ A;  1IQP A;  1IY2 A;  1PJI A;  3W0F A;  1K82 A;  5ITX A;  1TGU A;  2DWZ B;  2BJV A;  1DGG A;  5DYG A;  1Z5A A;  3QWL A;  4IBG A;  3THG A;  1XMQ M;  4NXM M;  3CF2 A;  4A3V B;  3HJ8 A;  4AZF A;  2DHR A;  3HU2 A;  5ITQ A;  2LH0 A;  3JAM S;  1GL6 A;  1OJL A;  4MH0 E;  1DO0 A;  2UUB M;  1NHW C;  3GLH A;  2K47 A;  4NRW A;  3KSJ A;  4I4L A;  5JI3 E;  4II7 A;  4REZ A;  4CIS A;  2L7I A;  5A2Q S;  4FWG A;  2BJW A;  3VLF B;  3T1H M;  5EQT A;  4MGK E;  2VQE M;  3SAT A;  2QEN A;  4RF1 A;  5F3W A;  2DWL A;  1TDH A;  3U6C A;  2UXB M;  4DV5 M;  3M0E A;  3WHL A;  4JI7 M;  2C98 A;  2G5G X;  2V1C A;  4EIW A;  3VDU A;  3ZH9 B;  4AKG A;  5ITY A;  3NWL A;  3FKE A;  2CEA A;  5JI2 E;  3K92 A;  2UU9 M;  3AL0 C;  3J27 B;  4JI1 M;  4QHS A;  1N77 A;  4MGI E;  4GHA A;  3E4R A;  2YNM D;  2G8L A;  1N75 A;  2LXE A;  2XFS A;  4LF8 M;  2QZ4 A;  3GRR A;  4R7G A;  3MJ5 A;  4R3D A;  2VII A;  2XGN A;  3GPU A;  1NJF A;  1GKI A;  4DUY M;  3LVV A;  1K3W A;  4QOZ C;  4LY6 A;  1QVR A;  2ZAM A;  4JI2 M;  4GH9 A;  1C1K A;  4JXJ A;  4G4O A;  4LG2 A;  4FW9 A;  1XNR M;  3GPP A;  4I8O A;  2DVW B;  4OW0 A;  5IZ7 D;  1NY6 A;  3AV0 A;  2L6O A;  2EO2 A;  2V1U A;  4LFB M;  2XSZ D;  1GL7 A;  3RGS A;  3BOS A;  4LJ9 A;  2R18 A;  4B3S M;  2D7G A;  2W82 A;  4JI5 M;  3KP1 E;  4FWH A;  3TWM A;  1XWI A;  4D81 A;  7CAT A;  2XH9 A;  3CTW B;  2J7O A;  1NNU C;  4P16 A;  1TDZ A;  4OVZ B;  1EE8 A;  2CHG A;  4ZPX A;  5IWA M;  3DFZ A;  3PXG A;  3L28 A;  5ITT A;  4BBA A;  1J7K A;  2M60 A;  1G8P A;  1QQW A;  4GKJ M;  3FUV A;  1NHG C;  2Z7J A;  1DGF A;  3B9P A;  3NBI A;  5EXT A;  2RKO A;  3KOX E;  2O5R A;  3IG5 A;  1IN5 A;  5E26 A;  3KS8 A;  4LF6 M;  4PDI A;  5EXX A;  4LF4 M;  4X66 M;  1K3X A;  3HJQ A;  4M9S A;  3CF6 E;  1HQC A;  3HJS A;  1XMO M;  1WXQ A;  4Z8X A;  3T38 A;  4AW4 A;  2Z3X A;  4DR6 M;  3A45 A;  4M0D A;  3SC3 A;  4DV1 M;  3L27 A;  1Q3C A;  3GO8 A;  3M7G A;  4DUZ M;  4RNA A;  3UK6 A;  5FSW A;  4B7F A;  1D2N A;  3QAU A;  3SAR A;  4S12 A;  4FD2 A;  1G3I A;  2KW0 A;  2CV0 A;  3HHX A;  4GHL A;  4GKK M;  1MU5 A;  3TE6 A;  2EUC A;  5IT9 S;  4DV4 M;  1R2Z A;  3CF0 A;  4OVZ A;  3A42 A;  1IXS B;  5IRE B;  1R6B X;  2C99 A;  2C9O A;  2Y0T A;  3K2L A;  5ITR A;  2Y20 A;  3LMM A;  4D80 A;  1GLN A;  4MB7 A;  2I7N A;  5FTM A;  3SYL A;  4KOD A;  3SAS A;  4IBF A;  3JR4 A;  3D8B A;  1IBK M;  1E94 E;  4LJ4 A;  2RGH A;  2ZAO A;  3GPX A;  2R62 A;  2DWN A;  4IBE A;  4W5W A;  2QBY B;  1JR3 A;  4JI8 M;  3DZD A;  5EP1 A;  2DZO B;  1IBL M;  1NSF A;  3VFD A;  4MGZ E;  3KFU G;  2XZF A;  2HHH M;  4DR3 M;  3FTE A;  3MK6 A;  1KFV A;  1IN8 A;  3L26 A;  3E9S A;  2A5Y B;  2QP9 X;  2F5O A;  1N33 M;  3VDP A;  3UMM A;  4AG6 A;  3AKZ A;  4YHH M;  2D7H A;  2XF3 A;  4X62 M;  4DV3 M;  2AHM A;  3HGI A;  3FTF A;  5BPV A;  3D8L A;  3DA1 A;  1JR3 D;  3UJN A;  1NNJ A;  4LZZ A;  1HNW M;  1MX0 A;  3J7A S;  3AFH A;  2XFT A;  4FWD A;  2XSZ A;  4LRT A;  4QHT A;  4FCW A;  3RFW A;  2DXI A;  3PFI A;  2YFQ A;  2P5T A;  3ZCB B;  4JV5 M;  4TUW A;  3FD9 A;  3HHY A;  2CV1 A;  3J81 S;  3GRU A;  1J09 A;  2KXE A;  1Q39 A;  3J80 S;  3VK8 A;  4IIW A;  1NY5 A;  4IBC A;  2EA0 A;  1IXR C;  3MHV C;  2HL7 A;  4MGY E;  4X64 M;  3VK7 A;  1S3S A;  2R46 A;  2QBY A;  2UUA M;  3HU3 A;  4DR5 M;  2F5S A;  4LJ5 A;  3GQ4 A;  2X8A A;  1W5S A;  3TWK A;  1HNX M;  3KS4 A;  1H6U A;  3J7B A;  2FNA A;  3SYK A;  2ZAN A;  1L2D A;  2KEB A;  1YSY A;  1L8Q A;  1PM5 A;  2QPA A;  1L2C A;  1QAO A;  4G4Q A;  2F5P A;  4CGY B;  4AI6 A;  1Z5C A;  2C96 A;  4XBO A;  1L1Z A;  3U60 B;  3U6Q A;  4JN6 A;  2BNK A;  4DV7 M;  4LFC M;  3KOY E;  1HT2 E;  3J2P B;  3L2A A;  5FTK A;  4JI3 M;  4FCV A;  4B08 A;  1XHB A;  3AJI B;  2CE7 A;  3JR5 A;  1N36 M;  3TWL A;  5KQ8 A;  5LMN M;  5EXP A;  1Z6T A;  4M0W A;  4L78 A;  4DR4 M;  3EIH A;  3T15 A;  4Z6Y A;  3FUT A;  1IXZ A;  3KOW E;  4BB9 A;  3I4Y A;  3LQQ A;  1SXJ B;  4PT5 A;  3A46 A;  5KQD A;  4NL4 H;  1IM2 A;  1G59 A;  3GP1 A;  4AQY M;  3LVW A;  3R9X B;  3VKH A;  3HHZ A;  1DGB A;  4L15 A;  4L16 A;  2YR0 A;  5FTJ A;  3HU1 A;  4GRI A;  3FTD A;  4QNM A;  1XC8 A;  2QCU A;  4HL4 A;  4M9Z A;  2J7N A;  4PCZ A;  3W0L B;  3GLG A;  4DR2 M;  2ERC A;  2Y0Q A;  3U60 A;  1IY0 A;  3KXE C;  5DYI A;  2OQ4 A;  3TPZ A;  3M6A A;  3SAW A;  3AOE A;  3KSX A;  3GPY A;  1IN7 A;  1OFI A;  4CHT B;  3R8F A;  3HHW A;  3TQS A;  2CV2 A;  2F5Q A;  4GIT A;  2R65 A;  3A98 B;  3UZU A;  3U5Z A;  1IBM M;  1QAN A;  4K0K M;  1X37 A;  4AG5 A;  1DGH B;  2KA6 B;  4MGH A;  5KO3 A;  3RGP A;  4M9X A;  1OFH A;  4MM3 B;  4B7G A;  1IN4 A;  4LF7 M;  4LGM A;  1KYI A;  4GC5 A;  4NSR A;  4HLQ A;  4FVM A;  3GLI B;  8CAT A;  3GQ5 A;  3C58 A;  4G6Z A;  3SBJ A;  1SXJ A;  5C1B A;  5LMU M;  4DR7 M;  1YE9 A;  2NQ8 C;  3HWS A;  3SFZ A;  1R2Y A;  3ILK A;  3HKP A;  2CHV A;  4LF9 M;  3KDS E;  1ORY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...