3D8LA

Crystal structure of orf12 from the lactococcus lactis bacteriophage p2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
b'GAKQLSTARKFKMITGKDLFQQQKAMDTELKKEDGEITDLMEFVQYGLYLALFQDNIVKAKSDFSDFRSSFEFDTDGKGLKELVELWQKEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Crystal structure of ORF12 from Lactococcus lactis phage p2 identifies a tape measure protein chaperone
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 31
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.940 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3d8lA00
3D8LA
chains in the Genus database with same CATH superfamily
2KZSA 3RFWA 3ZQJA 4AKGA 4ITQA 4JI7M 4LFCM 1PRBA 3U61A 2I7NA 2ERCA 3HKPA 2CWBA 4LFBM 5EP3A 1EE8A 1QVRA 3BXWA 1NV9A 2C99A 2VF7A 4FCVA 2HAKA 2FS1A 3FRHA 1E9RA 2VF8A 1IY1A 3HJQA 2E5LM 2DXIA 4YY3M 2R4EA 2RKOA 1TGUA 3L28A 1FJGM 5JI3E 5ITXE 3GRVA 3GO8A 2C9CA 5EJCA 1HT2E 3LMMA 3QYEA 2EJSA 4S12A 5FLXS 2JY7A 1IFYA 3L29A 5FTJA 1V33A 3B7ZA 4R7GA 3GRYA 4LGMA 1XNQM 4ZPXA 4GC5A 3VK8A 4LF8M 2R6FA 1L1ZA 3GQ5A 2CEAA 3TWMA 1QZEA 1IBLM 2DHRA 2UU9M 3A42A 1TTEA 1VEKA 2CV0A 4DUYM 4MM3B 1XHBA 4DV5M 2K47A 1DGHB 2R62A 4FCTA 4GC9A 4OVZA 5EP2A 2YFQA 3V76A 4Z6YA 5KPZA 1VG5A 2FH0A 3ZH9B 3GPYA 2D7HA 2DAIA 4XBOA 1XXHE 2C96A 1NHWC 3QAUA 4LY6A 4IBIA 1N32M 1PGYA 1IY2A 3PFIA 3THGA 4LRSA 4F1IA 2ZAOA 3J7AS 3GPUA 4RF0A 2MROB 4FD2A 3H4JA 5E6JA 1DGHA 3VLFB 1SXJD 3J80S 3GLIE 1IN8A 3B9PA 4DV4M 1QUTA 2R44A 4B3MM 1HNZM 4QOZC 4MH0E 5EXPA 4DUZM 1IN5A 1J5EM 1PM5A 1XXHB 3I51A 4BB9A 1WGNA 3FTDA 3HU2A 4LJ5A 1T6OA 2BJWA 4BLCA 1Z5CA 4REZA 2G3QA 2XGNA 2MJ5B 1QAOA 5ITUA 4TUWA 1E32A 4JN6A 4JV5M 4FVMA 3U6LA 1R2ZA 3IG5A 4M9ZA 1WHCA 1Z59A 2DZNB 3H4MA 2DWZB 4AZFA 3T1HM 3NWLA 2HCBA 4DR7M 2K6BA 1QYRA 2B3TA 3FYDA 4LF4M 2KNVA 1SXJA 2LH0A 4GEWA 1MU5A 4L4UA 2BWEA 1OJLA 1C7YA 1I4WA 5C1BA 2V1UA 3VKHA 3IECA 4CISA 2XZFA 4MGYE 5EQTA 1HNXM 1TF0B 2CHGA 2V6ZM 4DR4M 3GLHB 3U6PA 3HHYA 3BBZA 4LJ4A 4QNMA 3FTCA 3GPXA 2WSCF 3GLGB 1W5TA 3A45A 4CJ6A 5FTMA 4IJEA 3Q8GA 3FTEA 2HKJA 3KS8A 2LTUA 3FUUA 1V92A 4R3DA 5EXSA 1DGGA 4W5WA 3HHZA 4XK8F 4NXMM 2G8LA 2QZ4A 1PJIA 3W67A 3U6DA 3LCVB 1ZV1A 4A3VB 1VDLA 2HWJA 4FWGA 2Y0TA 1R6BX 5DYGA 1ZQ9A 1Q02A 4I5SA 1UFZA 4IBFA 2KDLA 3TQSA 2DWLA 3KOWE 3GLHA 2X8AA 3AOGA 5IREB 1WGLA 4BBAA 3KW6A 1D0LA 4DV7M 4L78A 1GLNA 2DI0A 3D8LA 3EIHA 4NOOB 4NXNM 4EIWA 3TPZA 2XF3A 3J81S 1KYIA 1IM2A 1EFUB 1QZMA 4K0KM 2DVWB 2O25A 4IBDA 3I01M 1IBKM 1J09A 2QBYB 3C58A 3FYCA 4DR1M 1IXRC 3HJ8A 4FWHA 1N75A 2DAKA 1OFHA 3U6QA 4MGHA 4LJ9A 4CIZA 4G4NA 1JR3D 1GO5A 2EKKA 3UJNA 1NY5A 2DAEA 4B7HA 4JI3M 2JWSA 1X37A 4IBBA 5DFLA 3W68A 1N77A 4NL4H 1OAIA 4JI2M 2AHMA 3SYKA 3KSXA 3W0FA 4LJ8A 4DV3M 2J5YA 2KNAA 2QBYA 1TH4A 3LCUA 4WW0A 3K9OA 3M7GA 4M9SA 8CATA 3HX3A 2XFTA 1AIPC 1TH2A 2EA0A 1DO2A 2XEPA 4F2LA 3RGPA 1IN7A 2YQZA 2BNKA 4FWDA 4I8OA 2K0BX 3K8ZA 4HEOA 3HWSA 1IXSB 4OU7A 3GQ4A 2VDBB 1JR3A 3QYBA 4OVZB 1R4GA 3OTOM 1H6UA 2O5RA 4DR3M 1T3TA 3MHVC 2L6OA 2QP9X 3AFHA 2OO9A 3ZC7B 1CUKA 1JQJC 3B7NA 4G6ZA 4B08A 1ZMWA 2KNZA 1QAMA 1IN6A 1YUBA 3TWLA 4QNRA 4B3RM 1E94E 4KT0F 1VQ1A 3J27B 1IXSA 3CF2A 4WURA 1HQYE 5IZ7D 3RE8A 2JNHA 2OQ4A 2C9OA 1ZAEA 2RGHA 4IJFA 2XZUA 4IBKA 1IXZA 3FD9A 2HL7A 1Q39A 1LTMA 1FNNA 1NHGC 2M60A 1VEJA 1SXJE 2Z3XA 1UM8A 3HZJA 1LV7A 2CP8A 4L15A 3DZDA 4GKJM 3SFZA 2L7IA 4B7FA 1OIZA 2LHGA 3KOYE 2CE7A 2ZTDA 4I81A 1KSFX 1V34A 1SG9A 3SMSA 1EIJA 2L09A 4IIWA 2JP7A 1GJSA 5C18A 2A5YB 3NBIA 4X66M 1OTRA 1HJPA 3IG8A 1SXJC 2RRUA 2KZUA 1SXJB 3K2LA 4ANRA 5BR8M 1ZMUA 5KO3A 4DV1M 3GRRA 1K3XA 2F4VM 4DV2M 3U6MA 2EO2A 4GMQA 5FTLA 2CFOA 2R18A 1MX0A 3HU1A 4LG2A 1DV0A 3FKEA 3GLHE 3SHFA 3KFUG 5IT9S 3HJSA 2Q2EB 3SAUA 3GLGE 2DZOB 1Z5AA 3LVWA 2KRUA 3KDSE 4RF1A 1GJTA 1NNUC 4MGKE 2QENA 2YNMD 2X49A 7CATA 3T1YM 1Y8GA 2J7OA 1XB2B 3I4VA 3MK6A 4P16A 2FNAA 4PT5A 5A2QS 2VQFM 4LF9M 2W82A 4LRTA 2MGWA 3L27A 2Y21A 4NC6A 2RGOA 2KHHA 3A98B 2X4AA 2C98A 2QSFX 3K9PA 3T6PA 2KA6B 5EXXA 3GLFB 1OKSA 2LNHC 3M6AA 2KEBA 4PDGA 5L8RF 2ZANA 2OOAA 3UZUA 3SASA 3MMPA 3W0LB 1DGBA 4X64M 2JY5A 2WZJA 3IHPA 3NBXX 4AQYM 1QQWA 3WHKA 2KRKA 3ILKA 1NJGA 3T38A 5JI2E 3AJIB 4I4LA 4QOSA 4AG5A 2MH8A 2FFJA 5DNYA 2F5NA 1HQCA 1G71A 2WSFF 3C3DA 4WP2A 5LMNM 2D7EA 1K3WA 1QAQA 2K9DA 4JI5M 3GLFA 2DZLA 3VKGA 1MN3A 3E9SA 1G3IA 2XH9A 4OX9M 3CTWB 2CV1A 1D0MA 5KPRA 2WSEF 2ZBKB 3WHLA 1J7KA 2O01F 3I04M 2H5XA 1JR3E 4LGYA 4G4OA 2Z4RA 4PDIA 4FW9A 1F4IA 1NVMA 2FE8A 3LVVA 3PXGA 2L4FA 4JI6M 3PNVA 4HL4A 3UGJA 1W5SA 2UUAM 1QDRA 3KS4A 1NSFA 4AKHA 1D0KA 1YE9A 3SAVA 2M5ZA 3E21A 4JI0M 3A46A 3FUVA 2LVOC 2ZM6M 4FCWA 3JR4A 1VDDA 1WJ7A 1YLAA 1GKIA 3L2AA 3CGWA 3U6OA 2XSZD 3C9PA 1L1TA 1G8PA 4D81A 4JYAM 1YSYA 1TH3A 3DFZA 5LMUM 1PJSA 5ITTA 1HT1E 5KQDA 3JR5A 3R8FA 4CHTB 5EP1A 3FRIA 2KW0A 5FTKA 3VFDA 2ZAMA 3SYLA 3VDUA 1OFIA 3E46A 1E9SA 2CV2A 4L8RC 2Z8YM 4KHPM 1GL7A 1G41A 2EKFA 3ZCBB 3PNYA 5KQ8A 1L2BA 1N78A 4X62M 2DHYA 4P17A 3Q8XA 3SARA 4M0WA 3AOEA 2I7PA 3SHGB 3UMMA 1GVNA 4DR2M 2XSZA 2LVPC 2QPAA 4DV0M 1RU3A 2QCUA 3U5ZB 4KO8A 4B7GA 1QUSA 2L2DA 3SMPA 4JI1M 2CUZA 4LZZA 2BWBA 4LF5M 2KXEA 3B89A 4GITA 2MR9A 1XMOM 2VIIA 3QWLA 4M9XA 5E26A 2UXCM 2OOBA 4GH9A 1DGFA 1N34M 2DWMA 4CGYB 2DAMA 2HHHM 2UXDM 2R65A 1WR1B 3B7QA 1D2NA 1IBMM 1DO0A 4QHTA 1ORYB 2Y0QA 2R0IA 4HLQA 5ITRA 2Z7JA 3KXEC 5EP4A 3CF0A 2R4JA 3U6EA 4NSRA 3U5ZA 3LQQA 3L26A 3U6SA 3TE6A 1NNJA 4B3SM 3KSJA 4LJ6A 5F3WA 1IQPA 1BVSA 3D8BA 3LQRA 2JZ1A 4M0DA 1ZMVA 4MB7A 4MGIE 2UUBM 1R5LA 3AV0A 4JI4M 4LFAM 1PJQA 2Y20A 3KOZE 3FUWA 4JXJA 2R46A 3DOAA 2P5TA 2YR0A 4XGIA 2XLJA 3HHWA 4YHHM 1NJFA 4IBJA 5BPVA 4LCBA 4G4RA 2FOIC 3PVSA 3FUTA 2BJVA 1VEGA 2DWNA 2EUCA 3TL4X 1GL6A 2JXNA 1MJGM 4PCZA 2DENA 5ITYA 2APLA 3AL0C 1R2YA 4UN2B 4LJAA 1XWIA 4B3TM 1I94M 4NSOB 3GP1A 3EIEA 1IY0A 3GLFE 4IBGA 3TWKA 5FTNA 2UXBM 4DR5M 4AW4A 3L25A 4GIPA 3BOSA 5ITXA 1XMQM 3FTFA 1WXQA 1P3QQ 2LVNC 1L8QA 3FE3A 3AKZA 1PJJA 1HNWM 5IWAM 4AI6A 4D82A 1OAOC 2LHCA 4MGZE 4X65M 1NO1A 2DNAA 3KP1E 2JUJA 4LJ7A 1XC8A 4L16A 3T15A 2JZ0A 3HHXA 4NRVA 2H1RA 2JY8A 3JAMS 4Q7JA 4KLNA 3MJ5A 5GKNA 3HY5A 4Z8XA 1A5TA 3GLIB 2GQFA 4G3OA 1G59A 1TDHA 1K82A 4RNAA 4AKIA 2LWXA 4D80A 3K92A 1IN4A 4R71A 3SAWA 2JY6B 3SC3A 3GQ3A 4GHAA 1Q3BA 1TR8A 5FSWA 1XXHA 5ITQA 4NRWA 1S3SA 3R9XB 1Z6TA 3B74A 3J2PB 1L2DA 2V1CA 1GABA 1WIVA 2UUCM 2OPFA 2QHOB 3HGIA 4KODA 4AG6A 1QDTA 2LVQD 2LXEA 4GRIA 1NV8A 1OQYA 2CHQA 3HU3A 3GLIA 4G4QA 3SBJA 1L2CA 4LF6M 1N33M 1HR0M 2GNOA 3KP0E 5DYIA 3U6CA 3K1JA 4L6V6 3GRUA 2J7NA 4DR6M 4IBEA 2CRUA 4RKUF 3F92A 3J7BA 4GKKM 3DA1A 2LBCA 3I4YA 1XNRM 4PD2A 2L4EA 3RGSA 2L7HA 4LF7M 2QNJA 2LVAA 2ZTCA 3CF6E 1C1KA 4Y28F 3KOXE 1KFVA 4GHLA 1T43A 1JB0F 1OIPA 1Z5BA 3M0EA 3GLGA 3U60B 3C3EA 2F5QA 4DBGB 1PJTA 4DV6M 2F5SA 1QANA 1TDZA 2DAGA 4II7A 3AOEC 1G4AE 2DKLA 3UK6A 4JI8M 2N35A 2F5PA 2G5GX 3KVWA 3VK7A 1N36M 2XFSA 4QHSA 4IBCA 5EXTA 3U61B 2C5RA 1Q3CA 3GPPA 4OW0A 3SATA 3LW5F 2CHVA 3U60A 4LZJA 2NQ8C 3FUXA 1AUAA 1R7RA 2QQ8A 2F5OA 2VQEM 2D7GA 3E4RA 5KPTA 2Z4SA 2JA2A 3VDPA 5H37D 2R45A 1NY6A
chains in the Genus database with same CATH topology
2KZSA 3RFWA 4AKGA 4ITQA 4JI7M 4LFCM 3U61A 2I7NA 2ERCA 3HKPA 4LFBM 5EP3A 1EE8A 1QVRA 2C99A 4FCVA 3HJQA 1E9RA 2DXIA 1IY1A 2E5LM 4YY3M 2R4EA 2RKOA 1TGUA 3L28A 1FJGM 5JI3E 5ITXE 3GRVA 3GO8A 2C9CA 5EJCA 1HT2E 3LMMA 4S12A 5FLXS 3L29A 5FTJA 4R7GA 3GRYA 4LGMA 4ZPXA 4GC5A 3VK8A 4LF8M 1L1ZA 3GQ5A 2CEAA 3TWMA 1IBLM 2DHRA 2UU9M 3A42A 2CV0A 4DUYM 4MM3B 1XHBA 4DV5M 2K47A 1DGHB 2R62A 4FCTA 4GC9A 4OVZA 5EP2A 2YFQA 4Z6YA 5KPZA 3ZH9B 3GPYA 2D7HA 4XBOA 2C96A 1NHWC 3QAUA 4LY6A 4IBIA 1N32M 1IY2A 3PFIA 3THGA 4LRSA 2ZAOA 3J7AS 3GPUA 4RF0A 4FD2A 5E6JA 1DGHA 3VLFB 1SXJD 3J80S 4DV4M 1IN8A 3B9PA 4B3MM 1HNZM 4QOZC 4MH0E 5EXPA 4DUZM 1IN5A 1J5EM 1PM5A 1XXHB 3I51A 4BB9A 3FTDA 3HU2A 4LJ5A 2BJWA 4BLCA 1Z5CA 4REZA 5ITUA 2XGNA 1QAOA 4TUWA 1E32A 4JN6A 4JV5M 4FVMA 3U6LA 1R2ZA 3IG5A 4M9ZA 3H4MA 1Z59A 2DZNB 3T1HM 2DWZB 4AZFA 3NWLA 2HCBA 4DR7M 1QYRA 3FYDA 4LF4M 1SXJA 2LH0A 1MU5A 4L4UA 3VKHA 1OJLA 2V1UA 1I4WA 5C1BA 4CISA 2XZFA 4MGYE 5EQTA 1HNXM 2CHGA 2V6ZM 4DR4M 3GLHB 3U6PA 3HHYA 4LJ4A 4QNMA 3FTCA 3GPXA 3GLGB 1W5TA 3A45A 5FTMA 4IJEA 3FTEA 2HKJA 3KS8A 3FUUA 4R3DA 5EXSA 1DGGA 4W5WA 3HHZA 4NXMM 2G8LA 2QZ4A 1PJIA 3U6DA 4A3VB 4FWGA 2Y0TA 1R6BX 5DYGA 1ZQ9A 4IBFA 4I5SA 3TQSA 2DWLA 3KOWE 3GLHA 2X8AA 3AOGA 5IREB 4BBAA 3KW6A 4DV7M 4L78A 1GLNA 3D8LA 3EIHA 4NOOB 4NXNM 4EIWA 3TPZA 2XF3A 3J81S 1KYIA 1IM2A 4K0KM 1QZMA 2DVWB 4IBDA 1IBKM 1J09A 2QBYB 3C58A 3FYCA 4DR1M 1IXRC 3HJ8A 4FWHA 1N75A 1OFHA 3U6QA 4MGHA 4LJ9A 4G4NA 1JR3D 3UJNA 1NY5A 4B7HA 4JI3M 1X37A 4IBBA 1N77A 4NL4H 4JI2M 2AHMA 3SYKA 3KSXA 3W0FA 4LJ8A 4DV3M 2QBYA 1TH4A 4WW0A 3M7GA 4M9SA 8CATA 2XFTA 1TH2A 2EA0A 1DO2A 2XEPA 3RGPA 1IN7A 2YQZA 2BNKA 4FWDA 4I8OA 3K8ZA 3HWSA 1IXSB 4OU7A 3GQ4A 1JR3A 4OVZB 3OTOM 1H6UA 2O5RA 4DR3M 1T3TA 3MHVC 2L6OA 2QP9X 3AFHA 3ZC7B 1JQJC 4G6ZA 4B08A 1QAMA 1IN6A 1YUBA 3TWLA 4QNRA 4B3RM 1E94E 3J27B 3CF2A 4WURA 1HQYE 5IZ7D 3RE8A 2OQ4A 2C9OA 1ZAEA 2RGHA 4IJFA 2XZUA 4IBKA 1IXZA 3FD9A 2HL7A 1Q39A 1FNNA 1NHGC 2M60A 1SXJE 2Z3XA 1UM8A 1LV7A 4L15A 3DZDA 4GKJM 3SFZA 2L7IA 4B7FA 3KOYE 2CE7A 4I81A 1KSFX 3SMSA 2L09A 4IIWA 5C18A 2A5YB 3NBIA 4X66M 3IG8A 1SXJC 2KZUA 1SXJB 3K2LA 5BR8M 5KO3A 4DV1M 3GRRA 1K3XA 2F4VM 4DV2M 3U6MA 2EO2A 4GMQA 5FTLA 2CFOA 2R18A 1MX0A 3HU1A 4LG2A 3FKEA 3SHFA 3KFUG 5IT9S 3HJSA 2Q2EB 3SAUA 2DZOB 1Z5AA 3LVWA 2KRUA 3KDSE 4RF1A 1NNUC 4MGKE 2QENA 2YNMD 2X49A 7CATA 3T1YM 3I4VA 2J7OA 3MK6A 4PT5A 4P16A 5A2QS 2FNAA 2VQFM 4LF9M 1XNQM 2W82A 4LRTA 3L27A 2Y21A 2RGOA 3A98B 2X4AA 2C98A 3GLFB 2KA6B 5EXXA 2LNHC 3M6AA 2KEBA 4PDGA 2ZANA 3UZUA 3SASA 3W0LB 4X64M 1DGBA 4AQYM 1QQWA 3WHKA 2KRKA 3ILKA 1NJGA 3T38A 5JI2E 3AJIB 4I4LA 4QOSA 4AG5A 2FFJA 5DNYA 2F5NA 1HQCA 5LMNM 2D7EA 1K3WA 1QAQA 4JI5M 3GLFA 3VKGA 3E9SA 1G3IA 2XH9A 4OX9M 3CTWB 2CV1A 5KPRA 2ZBKB 3WHLA 1J7KA 4LGYA 4G4OA 2Z4RA 4PDIA 4FW9A 1NVMA 2FE8A 3LVVA 3PXGA 4JI6M 3PNVA 4HL4A 3UGJA 1W5SA 2UUAM 3KS4A 1NSFA 4AKHA 1YE9A 3SAVA 2M5ZA 4JI0M 3A46A 3FUVA 2ZM6M 4FCWA 3JR4A 1VDDA 1GKIA 3L2AA 3U6OA 2XSZD 1L1TA 1G8PA 4D81A 4JYAM 1YSYA 1TH3A 3DFZA 5LMUM 5ITTA 1HT1E 5KQDA 3JR5A 3R8FA 4CHTB 5EP1A 2KW0A 5FTKA 3VFDA 2ZAMA 3SYLA 3VDUA 1OFIA 1E9SA 2CV2A 4L8RC 4KHPM 1GL7A 1G41A 1L2BA 3ZCBB 3PNYA 5KQ8A 1N78A 4X62M 3Q8XA 3SARA 4M0WA 3AOEA 2I7PA 3SHGB 3UMMA 1GVNA 4DR2M 2XSZA 2QPAA 4DV0M 2QCUA 3U5ZB 4KO8A 4B7GA 3SMPA 4JI1M 2CUZA 4LZZA 4LF5M 2KXEA 4GITA 1XMOM 2UXCM 2VIIA 3QWLA 4M9XA 5E26A 4GH9A 1DGFA 1N34M 2DWMA 4CGYB 2HHHM 2UXDM 2R65A 1D2NA 1IBMM 1DO0A 4QHTA 1ORYB 2Y0QA 4HLQA 5ITRA 2Z7JA 3KXEC 5EP4A 3CF0A 2R4JA 3U6EA 4NSRA 3U5ZA 3LQQA 3L26A 3U6SA 3TE6A 1NNJA 4B3SM 3KSJA 4LJ6A 5F3WA 1IQPA 3D8BA 4M0DA 3LQRA 4MB7A 4MGIE 2UUBM 3AV0A 4JI4M 4LFAM 2Y20A 3KOZE 3FUWA 4JXJA 2R46A 3DOAA 2P5TA 2YR0A 4XGIA 2XLJA 3HHWA 4YHHM 1NJFA 4IBJA 5BPVA 4LCBA 4G4RA 2FOIC 3PVSA 3FUTA 2BJVA 2DWNA 2EUCA 3TL4X 1GL6A 4PCZA 5ITYA 3AL0C 1R2YA 4LJAA 1XWIA 4B3TM 1I94M 4NSOB 3GP1A 3EIEA 1IY0A 4IBGA 3TWKA 5FTNA 2UXBM 4DR5M 4AW4A 3L25A 4GIPA 3BOSA 5ITXA 1XMQM 3FTFA 1WXQA 3AKZA 1L8QA 1PJJA 1HNWM 5IWAM 4AI6A 4D82A 4MGZE 4X65M 3KP1E 4LJ7A 1XC8A 4L16A 3T15A 3HHXA 4NRVA 2H1RA 3JAMS 4KLNA 3MJ5A 5GKNA 3GLIB 4Z8XA 1G59A 1TDHA 1K82A 4RNAA 4AKIA 2LWXA 4D80A 3K92A 1IN4A 3SAWA 3SC3A 3GQ3A 4GHAA 1Q3BA 5FSWA 1XXHA 5ITQA 4NRWA 1S3SA 3R9XB 1Z6TA 3J2PB 1L2DA 2V1CA 2UUCM 2OPFA 3HGIA 4KODA 4AG6A 2LXEA 4GRIA 2CHQA 3GLIA 3HU3A 4G4QA 3SBJA 1L2CA 4LF6M 1N33M 1HR0M 3KP0E 5DYIA 3U6CA 3K1JA 3GRUA 2J7NA 4DR6M 4IBEA 4GKKM 3J7BA 3DA1A 3I4YA 1XNRM 4PD2A 3RGSA 2L7HA 4LF7M 3CF6E 1C1KA 1KFVA 3KOXE 4GHLA 1Z5BA 3M0EA 3GLGA 3U60B 2F5QA 4DV6M 2F5SA 1QANA 1TDZA 4II7A 3AOEC 1G4AE 3UK6A 4JI8M 2F5PA 2G5GX 3KVWA 3VK7A 1N36M 2XFSA 4QHSA 4IBCA 5EXTA 3U61B 2C5RA 1Q3CA 3GPPA 4OW0A 3SATA 2CHVA 3U60A 4LZJA 2NQ8C 3FUXA 1R7RA 2F5OA 2VQEM 2D7GA 3E4RA 5KPTA 2Z4SA 2JA2A 3VDPA 5H37D 2R45A 1NY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8L A; 
#chains in the Genus database with same CATH topology
 2KZS A;  3RFW A;  3ZQJ A;  4AKG A;  4ITQ A;  4JI7 M;  4LFC M;  1PRB A;  3U61 A;  2I7N A;  2ERC A;  3HKP A;  2CWB A;  4LFB M;  5EP3 A;  1EE8 A;  1QVR A;  3BXW A;  1NV9 A;  2C99 A;  2VF7 A;  4FCV A;  2HAK A;  2FS1 A;  3FRH A;  1E9R A;  2VF8 A;  1IY1 A;  3HJQ A;  2E5L M;  2DXI A;  4YY3 M;  2R4E A;  2RKO A;  1TGU A;  3L28 A;  1FJG M;  5JI3 E;  5ITX E;  3GRV A;  3GO8 A;  2C9C A;  5EJC A;  1HT2 E;  3LMM A;  3QYE A;  2EJS A;  4S12 A;  5FLX S;  2JY7 A;  1IFY A;  3L29 A;  5FTJ A;  1V33 A;  3B7Z A;  4R7G A;  3GRY A;  4LGM A;  1XNQ M;  4ZPX A;  4GC5 A;  3VK8 A;  4LF8 M;  2R6F A;  1L1Z A;  3GQ5 A;  2CEA A;  3TWM A;  1QZE A;  1IBL M;  2DHR A;  2UU9 M;  3A42 A;  1TTE A;  1VEK A;  2CV0 A;  4DUY M;  4MM3 B;  1XHB A;  4DV5 M;  2K47 A;  1DGH B;  2R62 A;  4FCT A;  4GC9 A;  4OVZ A;  5EP2 A;  2YFQ A;  3V76 A;  4Z6Y A;  5KPZ A;  1VG5 A;  2FH0 A;  3ZH9 B;  3GPY A;  2D7H A;  2DAI A;  4XBO A;  1XXH E;  2C96 A;  1NHW C;  3QAU A;  4LY6 A;  4IBI A;  1N32 M;  1PGY A;  1IY2 A;  3PFI A;  3THG A;  4LRS A;  4F1I A;  2ZAO A;  3J7A S;  3GPU A;  4RF0 A;  2MRO B;  4FD2 A;  3H4J A;  5E6J A;  1DGH A;  3VLF B;  1SXJ D;  3J80 S;  3GLI E;  1IN8 A;  3B9P A;  4DV4 M;  1QUT A;  2R44 A;  4B3M M;  1HNZ M;  4QOZ C;  4MH0 E;  5EXP A;  4DUZ M;  1IN5 A;  1J5E M;  1PM5 A;  1XXH B;  3I51 A;  4BB9 A;  1WGN A;  3FTD A;  3HU2 A;  4LJ5 A;  1T6O A;  2BJW A;  4BLC A;  1Z5C A;  4REZ A;  2G3Q A;  2XGN A;  2MJ5 B;  1QAO A;  5ITU A;  4TUW A;  1E32 A;  4JN6 A;  4JV5 M;  4FVM A;  3U6L A;  1R2Z A;  3IG5 A;  4M9Z A;  1WHC A;  1Z59 A;  2DZN B;  3H4M A;  2DWZ B;  4AZF A;  3T1H M;  3NWL A;  2HCB A;  4DR7 M;  2K6B A;  1QYR A;  2B3T A;  3FYD A;  4LF4 M;  2KNV A;  1SXJ A;  2LH0 A;  4GEW A;  1MU5 A;  4L4U A;  2BWE A;  1OJL A;  1C7Y A;  1I4W A;  5C1B A;  2V1U A;  3VKH A;  3IEC A;  4CIS A;  2XZF A;  4MGY E;  5EQT A;  1HNX M;  1TF0 B;  2CHG A;  2V6Z M;  4DR4 M;  3GLH B;  3U6P A;  3HHY A;  3BBZ A;  4LJ4 A;  4QNM A;  3FTC A;  3GPX A;  2WSC F;  3GLG B;  1W5T A;  3A45 A;  4CJ6 A;  5FTM A;  4IJE A;  3Q8G A;  3FTE A;  2HKJ A;  3KS8 A;  2LTU A;  3FUU A;  1V92 A;  4R3D A;  5EXS A;  1DGG A;  4W5W A;  3HHZ A;  4XK8 F;  4NXM M;  2G8L A;  2QZ4 A;  1PJI A;  3W67 A;  3U6D A;  3LCV B;  1ZV1 A;  4A3V B;  1VDL A;  2HWJ A;  4FWG A;  2Y0T A;  1R6B X;  5DYG A;  1ZQ9 A;  1Q02 A;  4I5S A;  1UFZ A;  4IBF A;  2KDL A;  3TQS A;  2DWL A;  3KOW E;  3GLH A;  2X8A A;  3AOG A;  5IRE B;  1WGL A;  4BBA A;  3KW6 A;  1D0L A;  4DV7 M;  4L78 A;  1GLN A;  2DI0 A;  3D8L A;  3EIH A;  4NOO B;  4NXN M;  4EIW A;  3TPZ A;  2XF3 A;  3J81 S;  1KYI A;  1IM2 A;  1EFU B;  1QZM A;  4K0K M;  2DVW B;  2O25 A;  4IBD A;  3I01 M;  1IBK M;  1J09 A;  2QBY B;  3C58 A;  3FYC A;  4DR1 M;  1IXR C;  3HJ8 A;  4FWH A;  1N75 A;  2DAK A;  1OFH A;  3U6Q A;  4MGH A;  4LJ9 A;  4CIZ A;  4G4N A;  1JR3 D;  1GO5 A;  2EKK A;  3UJN A;  1NY5 A;  2DAE A;  4B7H A;  4JI3 M;  2JWS A;  1X37 A;  4IBB A;  5DFL A;  3W68 A;  1N77 A;  4NL4 H;  1OAI A;  4JI2 M;  2AHM A;  3SYK A;  3KSX A;  3W0F A;  4LJ8 A;  4DV3 M;  2J5Y A;  2KNA A;  2QBY A;  1TH4 A;  3LCU A;  4WW0 A;  3K9O A;  3M7G A;  4M9S A;  8CAT A;  3HX3 A;  2XFT A;  1AIP C;  1TH2 A;  2EA0 A;  1DO2 A;  2XEP A;  4F2L A;  3RGP A;  1IN7 A;  2YQZ A;  2BNK A;  4FWD A;  4I8O A;  2K0B X;  3K8Z A;  4HEO A;  3HWS A;  1IXS B;  4OU7 A;  3GQ4 A;  2VDB B;  1JR3 A;  3QYB A;  4OVZ B;  1R4G A;  3OTO M;  1H6U A;  2O5R A;  4DR3 M;  1T3T A;  3MHV C;  2L6O A;  2QP9 X;  3AFH A;  2OO9 A;  3ZC7 B;  1CUK A;  1JQJ C;  3B7N A;  4G6Z A;  4B08 A;  1ZMW A;  2KNZ A;  1QAM A;  1IN6 A;  1YUB A;  3TWL A;  4QNR A;  4B3R M;  1E94 E;  4KT0 F;  1VQ1 A;  3J27 B;  1IXS A;  3CF2 A;  4WUR A;  1HQY E;  5IZ7 D;  3RE8 A;  2JNH A;  2OQ4 A;  2C9O A;  1ZAE A;  2RGH A;  4IJF A;  2XZU A;  4IBK A;  1IXZ A;  3FD9 A;  2HL7 A;  1Q39 A;  1LTM A;  1FNN A;  1NHG C;  2M60 A;  1VEJ A;  1SXJ E;  2Z3X A;  1UM8 A;  3HZJ A;  1LV7 A;  2CP8 A;  4L15 A;  3DZD A;  4GKJ M;  3SFZ A;  2L7I A;  4B7F A;  1OIZ A;  2LHG A;  3KOY E;  2CE7 A;  2ZTD A;  4I81 A;  1KSF X;  1V34 A;  1SG9 A;  3SMS A;  1EIJ A;  2L09 A;  4IIW A;  2JP7 A;  1GJS A;  5C18 A;  2A5Y B;  3NBI A;  4X66 M;  1OTR A;  1HJP A;  3IG8 A;  1SXJ C;  2RRU A;  2KZU A;  1SXJ B;  3K2L A;  4ANR A;  5BR8 M;  1ZMU A;  5KO3 A;  4DV1 M;  3GRR A;  1K3X A;  2F4V M;  4DV2 M;  3U6M A;  2EO2 A;  4GMQ A;  5FTL A;  2CFO A;  2R18 A;  1MX0 A;  3HU1 A;  4LG2 A;  1DV0 A;  3FKE A;  3GLH E;  3SHF A;  3KFU G;  5IT9 S;  3HJS A;  2Q2E B;  3SAU A;  3GLG E;  2DZO B;  1Z5A A;  3LVW A;  2KRU A;  3KDS E;  4RF1 A;  1GJT A;  1NNU C;  4MGK E;  2QEN A;  2YNM D;  2X49 A;  7CAT A;  3T1Y M;  1Y8G A;  2J7O A;  1XB2 B;  3I4V A;  3MK6 A;  4P16 A;  2FNA A;  4PT5 A;  5A2Q S;  2VQF M;  4LF9 M;  2W82 A;  4LRT A;  2MGW A;  3L27 A;  2Y21 A;  4NC6 A;  2RGO A;  2KHH A;  3A98 B;  2X4A A;  2C98 A;  2QSF X;  3K9P A;  3T6P A;  2KA6 B;  5EXX A;  3GLF B;  1OKS A;  2LNH C;  3M6A A;  2KEB A;  4PDG A;  5L8R F;  2ZAN A;  2OOA A;  3UZU A;  3SAS A;  3MMP A;  3W0L B;  1DGB A;  4X64 M;  2JY5 A;  2WZJ A;  3IHP A;  3NBX X;  4AQY M;  1QQW A;  3WHK A;  2KRK A;  3ILK A;  1NJG A;  3T38 A;  5JI2 E;  3AJI B;  4I4L A;  4QOS A;  4AG5 A;  2MH8 A;  2FFJ A;  5DNY A;  2F5N A;  1HQC A;  1G71 A;  2WSF F;  3C3D A;  4WP2 A;  5LMN M;  2D7E A;  1K3W A;  1QAQ A;  2K9D A;  4JI5 M;  3GLF A;  2DZL A;  3VKG A;  1MN3 A;  3E9S A;  1G3I A;  2XH9 A;  4OX9 M;  3CTW B;  2CV1 A;  1D0M A;  5KPR A;  2WSE F;  2ZBK B;  3WHL A;  1J7K A;  2O01 F;  3I04 M;  2H5X A;  1JR3 E;  4LGY A;  4G4O A;  2Z4R A;  4PDI A;  4FW9 A;  1F4I A;  1NVM A;  2FE8 A;  3LVV A;  3PXG A;  2L4F A;  4JI6 M;  3PNV A;  4HL4 A;  3UGJ A;  1W5S A;  2UUA M;  1QDR A;  3KS4 A;  1NSF A;  4AKH A;  1D0K A;  1YE9 A;  3SAV A;  2M5Z A;  3E21 A;  4JI0 M;  3A46 A;  3FUV A;  2LVO C;  2ZM6 M;  4FCW A;  3JR4 A;  1VDD A;  1WJ7 A;  1YLA A;  1GKI A;  3L2A A;  3CGW A;  3U6O A;  2XSZ D;  3C9P A;  1L1T A;  1G8P A;  4D81 A;  4JYA M;  1YSY A;  1TH3 A;  3DFZ A;  5LMU M;  1PJS A;  5ITT A;  1HT1 E;  5KQD A;  3JR5 A;  3R8F A;  4CHT B;  5EP1 A;  3FRI A;  2KW0 A;  5FTK A;  3VFD A;  2ZAM A;  3SYL A;  3VDU A;  1OFI A;  3E46 A;  1E9S A;  2CV2 A;  4L8R C;  2Z8Y M;  4KHP M;  1GL7 A;  1G41 A;  2EKF A;  3ZCB B;  3PNY A;  5KQ8 A;  1L2B A;  1N78 A;  4X62 M;  2DHY A;  4P17 A;  3Q8X A;  3SAR A;  4M0W A;  3AOE A;  2I7P A;  3SHG B;  3UMM A;  1GVN A;  4DR2 M;  2XSZ A;  2LVP C;  2QPA A;  4DV0 M;  1RU3 A;  2QCU A;  3U5Z B;  4KO8 A;  4B7G A;  1QUS A;  2L2D A;  3SMP A;  4JI1 M;  2CUZ A;  4LZZ A;  2BWB A;  4LF5 M;  2KXE A;  3B89 A;  4GIT A;  2MR9 A;  1XMO M;  2VII A;  3QWL A;  4M9X A;  5E26 A;  2UXC M;  2OOB A;  4GH9 A;  1DGF A;  1N34 M;  2DWM A;  4CGY B;  2DAM A;  2HHH M;  2UXD M;  2R65 A;  1WR1 B;  3B7Q A;  1D2N A;  1IBM M;  1DO0 A;  4QHT A;  1ORY B;  2Y0Q A;  2R0I A;  4HLQ A;  5ITR A;  2Z7J A;  3KXE C;  5EP4 A;  3CF0 A;  2R4J A;  3U6E A;  4NSR A;  3U5Z A;  3LQQ A;  3L26 A;  3U6S A;  3TE6 A;  1NNJ A;  4B3S M;  3KSJ A;  4LJ6 A;  5F3W A;  1IQP A;  1BVS A;  3D8B A;  3LQR A;  2JZ1 A;  4M0D A;  1ZMV A;  4MB7 A;  4MGI E;  2UUB M;  1R5L A;  3AV0 A;  4JI4 M;  4LFA M;  1PJQ A;  2Y20 A;  3KOZ E;  3FUW A;  4JXJ A;  2R46 A;  3DOA A;  2P5T A;  2YR0 A;  4XGI A;  2XLJ A;  3HHW A;  4YHH M;  1NJF A;  4IBJ A;  5BPV A;  4LCB A;  4G4R A;  2FOI C;  3PVS A;  3FUT A;  2BJV A;  1VEG A;  2DWN A;  2EUC A;  3TL4 X;  1GL6 A;  2JXN A;  1MJG M;  4PCZ A;  2DEN A;  5ITY A;  2APL A;  3AL0 C;  1R2Y A;  4UN2 B;  4LJA A;  1XWI A;  4B3T M;  1I94 M;  4NSO B;  3GP1 A;  3EIE A;  1IY0 A;  3GLF E;  4IBG A;  3TWK A;  5FTN A;  2UXB M;  4DR5 M;  4AW4 A;  3L25 A;  4GIP A;  3BOS A;  5ITX A;  1XMQ M;  3FTF A;  1WXQ A;  1P3Q Q;  2LVN C;  1L8Q A;  3FE3 A;  3AKZ A;  1PJJ A;  1HNW M;  5IWA M;  4AI6 A;  4D82 A;  1OAO C;  2LHC A;  4MGZ E;  4X65 M;  1NO1 A;  2DNA A;  3KP1 E;  2JUJ A;  4LJ7 A;  1XC8 A;  4L16 A;  3T15 A;  2JZ0 A;  3HHX A;  4NRV A;  2H1R A;  2JY8 A;  3JAM S;  4Q7J A;  4KLN A;  3MJ5 A;  5GKN A;  3HY5 A;  4Z8X A;  1A5T A;  3GLI B;  2GQF A;  4G3O A;  1G59 A;  1TDH A;  1K82 A;  4RNA A;  4AKI A;  2LWX A;  4D80 A;  3K92 A;  1IN4 A;  4R71 A;  3SAW A;  2JY6 B;  3SC3 A;  3GQ3 A;  4GHA A;  1Q3B A;  1TR8 A;  5FSW A;  1XXH A;  5ITQ A;  4NRW A;  1S3S A;  3R9X B;  1Z6T A;  3B74 A;  3J2P B;  1L2D A;  2V1C A;  1GAB A;  1WIV A;  2UUC M;  2OPF A;  2QHO B;  3HGI A;  4KOD A;  4AG6 A;  1QDT A;  2LVQ D;  2LXE A;  4GRI A;  1NV8 A;  1OQY A;  2CHQ A;  3HU3 A;  3GLI A;  4G4Q A;  3SBJ A;  1L2C A;  4LF6 M;  1N33 M;  1HR0 M;  2GNO A;  3KP0 E;  5DYI A;  3U6C A;  3K1J A;  4L6V 6;  3GRU A;  2J7N A;  4DR6 M;  4IBE A;  2CRU A;  4RKU F;  3F92 A;  3J7B A;  4GKK M;  3DA1 A;  2LBC A;  3I4Y A;  1XNR M;  4PD2 A;  2L4E A;  3RGS A;  2L7H A;  4LF7 M;  2QNJ A;  2LVA A;  2ZTC A;  3CF6 E;  1C1K A;  4Y28 F;  3KOX E;  1KFV A;  4GHL A;  1T43 A;  1JB0 F;  1OIP A;  1Z5B A;  3M0E A;  3GLG A;  3U60 B;  3C3E A;  2F5Q A;  4DBG B;  1PJT A;  4DV6 M;  2F5S A;  1QAN A;  1TDZ A;  2DAG A;  4II7 A;  3AOE C;  1G4A E;  2DKL A;  3UK6 A;  4JI8 M;  2N35 A;  2F5P A;  2G5G X;  3KVW A;  3VK7 A;  1N36 M;  2XFS A;  4QHS A;  4IBC A;  5EXT A;  3U61 B;  2C5R A;  1Q3C A;  3GPP A;  4OW0 A;  3SAT A;  3LW5 F;  2CHV A;  3U60 A;  4LZJ A;  2NQ8 C;  3FUX A;  1AUA A;  1R7R A;  2QQ8 A;  2F5O A;  2VQE M;  2D7G A;  3E4R A;  5KPT A;  2Z4S A;  2JA2 A;  3VDP A;  5H37 D;  2R45 A;  1NY6 A; 
#chains in the Genus database with same CATH homology
 2KZS A;  3RFW A;  4AKG A;  4ITQ A;  4JI7 M;  4LFC M;  3U61 A;  2I7N A;  2ERC A;  3HKP A;  4LFB M;  5EP3 A;  1EE8 A;  1QVR A;  2C99 A;  4FCV A;  3HJQ A;  1E9R A;  2DXI A;  1IY1 A;  2E5L M;  4YY3 M;  2R4E A;  2RKO A;  1TGU A;  3L28 A;  1FJG M;  5JI3 E;  5ITX E;  3GRV A;  3GO8 A;  2C9C A;  5EJC A;  1HT2 E;  3LMM A;  4S12 A;  5FLX S;  3L29 A;  5FTJ A;  4R7G A;  3GRY A;  4LGM A;  4ZPX A;  4GC5 A;  3VK8 A;  4LF8 M;  1L1Z A;  3GQ5 A;  2CEA A;  3TWM A;  1IBL M;  2DHR A;  2UU9 M;  3A42 A;  2CV0 A;  4DUY M;  4MM3 B;  1XHB A;  4DV5 M;  2K47 A;  1DGH B;  2R62 A;  4FCT A;  4GC9 A;  4OVZ A;  5EP2 A;  2YFQ A;  4Z6Y A;  5KPZ A;  3ZH9 B;  3GPY A;  2D7H A;  4XBO A;  2C96 A;  1NHW C;  3QAU A;  4LY6 A;  4IBI A;  1N32 M;  1IY2 A;  3PFI A;  3THG A;  4LRS A;  2ZAO A;  3J7A S;  3GPU A;  4RF0 A;  4FD2 A;  5E6J A;  1DGH A;  3VLF B;  1SXJ D;  3J80 S;  4DV4 M;  1IN8 A;  3B9P A;  4B3M M;  1HNZ M;  4QOZ C;  4MH0 E;  5EXP A;  4DUZ M;  1IN5 A;  1J5E M;  1PM5 A;  1XXH B;  3I51 A;  4BB9 A;  3FTD A;  3HU2 A;  4LJ5 A;  2BJW A;  4BLC A;  1Z5C A;  4REZ A;  5ITU A;  2XGN A;  1QAO A;  4TUW A;  1E32 A;  4JN6 A;  4JV5 M;  4FVM A;  3U6L A;  1R2Z A;  3IG5 A;  4M9Z A;  3H4M A;  1Z59 A;  2DZN B;  3T1H M;  2DWZ B;  4AZF A;  3NWL A;  2HCB A;  4DR7 M;  1QYR A;  3FYD A;  4LF4 M;  1SXJ A;  2LH0 A;  1MU5 A;  4L4U A;  3VKH A;  1OJL A;  2V1U A;  1I4W A;  5C1B A;  4CIS A;  2XZF A;  4MGY E;  5EQT A;  1HNX M;  2CHG A;  2V6Z M;  4DR4 M;  3GLH B;  3U6P A;  3HHY A;  4LJ4 A;  4QNM A;  3FTC A;  3GPX A;  3GLG B;  1W5T A;  3A45 A;  5FTM A;  4IJE A;  3FTE A;  2HKJ A;  3KS8 A;  3FUU A;  4R3D A;  5EXS A;  1DGG A;  4W5W A;  3HHZ A;  4NXM M;  2G8L A;  2QZ4 A;  1PJI A;  3U6D A;  4A3V B;  4FWG A;  2Y0T A;  1R6B X;  5DYG A;  1ZQ9 A;  4IBF A;  4I5S A;  3TQS A;  2DWL A;  3KOW E;  3GLH A;  2X8A A;  3AOG A;  5IRE B;  4BBA A;  3KW6 A;  4DV7 M;  4L78 A;  1GLN A;  3D8L A;  3EIH A;  4NOO B;  4NXN M;  4EIW A;  3TPZ A;  2XF3 A;  3J81 S;  1KYI A;  1IM2 A;  4K0K M;  1QZM A;  2DVW B;  4IBD A;  1IBK M;  1J09 A;  2QBY B;  3C58 A;  3FYC A;  4DR1 M;  1IXR C;  3HJ8 A;  4FWH A;  1N75 A;  1OFH A;  3U6Q A;  4MGH A;  4LJ9 A;  4G4N A;  1JR3 D;  3UJN A;  1NY5 A;  4B7H A;  4JI3 M;  1X37 A;  4IBB A;  1N77 A;  4NL4 H;  4JI2 M;  2AHM A;  3SYK A;  3KSX A;  3W0F A;  4LJ8 A;  4DV3 M;  2QBY A;  1TH4 A;  4WW0 A;  3M7G A;  4M9S A;  8CAT A;  2XFT A;  1TH2 A;  2EA0 A;  1DO2 A;  2XEP A;  3RGP A;  1IN7 A;  2YQZ A;  2BNK A;  4FWD A;  4I8O A;  3K8Z A;  3HWS A;  1IXS B;  4OU7 A;  3GQ4 A;  1JR3 A;  4OVZ B;  3OTO M;  1H6U A;  2O5R A;  4DR3 M;  1T3T A;  3MHV C;  2L6O A;  2QP9 X;  3AFH A;  3ZC7 B;  1JQJ C;  4G6Z A;  4B08 A;  1QAM A;  1IN6 A;  1YUB A;  3TWL A;  4QNR A;  4B3R M;  1E94 E;  3J27 B;  3CF2 A;  4WUR A;  1HQY E;  5IZ7 D;  3RE8 A;  2OQ4 A;  2C9O A;  1ZAE A;  2RGH A;  4IJF A;  2XZU A;  4IBK A;  1IXZ A;  3FD9 A;  2HL7 A;  1Q39 A;  1FNN A;  1NHG C;  2M60 A;  1SXJ E;  2Z3X A;  1UM8 A;  1LV7 A;  4L15 A;  3DZD A;  4GKJ M;  3SFZ A;  2L7I A;  4B7F A;  3KOY E;  2CE7 A;  4I81 A;  1KSF X;  3SMS A;  2L09 A;  4IIW A;  5C18 A;  2A5Y B;  3NBI A;  4X66 M;  3IG8 A;  1SXJ C;  2KZU A;  1SXJ B;  3K2L A;  5BR8 M;  5KO3 A;  4DV1 M;  3GRR A;  1K3X A;  2F4V M;  4DV2 M;  3U6M A;  2EO2 A;  4GMQ A;  5FTL A;  2CFO A;  2R18 A;  1MX0 A;  3HU1 A;  4LG2 A;  3FKE A;  3SHF A;  3KFU G;  5IT9 S;  3HJS A;  2Q2E B;  3SAU A;  2DZO B;  1Z5A A;  3LVW A;  2KRU A;  3KDS E;  4RF1 A;  1NNU C;  4MGK E;  2QEN A;  2YNM D;  2X49 A;  7CAT A;  3T1Y M;  3I4V A;  2J7O A;  3MK6 A;  4PT5 A;  4P16 A;  5A2Q S;  2FNA A;  2VQF M;  4LF9 M;  1XNQ M;  2W82 A;  4LRT A;  3L27 A;  2Y21 A;  2RGO A;  3A98 B;  2X4A A;  2C98 A;  3GLF B;  2KA6 B;  5EXX A;  2LNH C;  3M6A A;  2KEB A;  4PDG A;  2ZAN A;  3UZU A;  3SAS A;  3W0L B;  4X64 M;  1DGB A;  4AQY M;  1QQW A;  3WHK A;  2KRK A;  3ILK A;  1NJG A;  3T38 A;  5JI2 E;  3AJI B;  4I4L A;  4QOS A;  4AG5 A;  2FFJ A;  5DNY A;  2F5N A;  1HQC A;  5LMN M;  2D7E A;  1K3W A;  1QAQ A;  4JI5 M;  3GLF A;  3VKG A;  3E9S A;  1G3I A;  2XH9 A;  4OX9 M;  3CTW B;  2CV1 A;  5KPR A;  2ZBK B;  3WHL A;  1J7K A;  4LGY A;  4G4O A;  2Z4R A;  4PDI A;  4FW9 A;  1NVM A;  2FE8 A;  3LVV A;  3PXG A;  4JI6 M;  3PNV A;  4HL4 A;  3UGJ A;  1W5S A;  2UUA M;  3KS4 A;  1NSF A;  4AKH A;  1YE9 A;  3SAV A;  2M5Z A;  4JI0 M;  3A46 A;  3FUV A;  2ZM6 M;  4FCW A;  3JR4 A;  1VDD A;  1GKI A;  3L2A A;  3U6O A;  2XSZ D;  1L1T A;  1G8P A;  4D81 A;  4JYA M;  1YSY A;  1TH3 A;  3DFZ A;  5LMU M;  5ITT A;  1HT1 E;  5KQD A;  3JR5 A;  3R8F A;  4CHT B;  5EP1 A;  2KW0 A;  5FTK A;  3VFD A;  2ZAM A;  3SYL A;  3VDU A;  1OFI A;  1E9S A;  2CV2 A;  4L8R C;  4KHP M;  1GL7 A;  1G41 A;  1L2B A;  3ZCB B;  3PNY A;  5KQ8 A;  1N78 A;  4X62 M;  3Q8X A;  3SAR A;  4M0W A;  3AOE A;  2I7P A;  3SHG B;  3UMM A;  1GVN A;  4DR2 M;  2XSZ A;  2QPA A;  4DV0 M;  2QCU A;  3U5Z B;  4KO8 A;  4B7G A;  3SMP A;  4JI1 M;  2CUZ A;  4LZZ A;  4LF5 M;  2KXE A;  4GIT A;  1XMO M;  2UXC M;  2VII A;  3QWL A;  4M9X A;  5E26 A;  4GH9 A;  1DGF A;  1N34 M;  2DWM A;  4CGY B;  2HHH M;  2UXD M;  2R65 A;  1D2N A;  1IBM M;  1DO0 A;  4QHT A;  1ORY B;  2Y0Q A;  4HLQ A;  5ITR A;  2Z7J A;  3KXE C;  5EP4 A;  3CF0 A;  2R4J A;  3U6E A;  4NSR A;  3U5Z A;  3LQQ A;  3L26 A;  3U6S A;  3TE6 A;  1NNJ A;  4B3S M;  3KSJ A;  4LJ6 A;  5F3W A;  1IQP A;  3D8B A;  4M0D A;  3LQR A;  4MB7 A;  4MGI E;  2UUB M;  3AV0 A;  4JI4 M;  4LFA M;  2Y20 A;  3KOZ E;  3FUW A;  4JXJ A;  2R46 A;  3DOA A;  2P5T A;  2YR0 A;  4XGI A;  2XLJ A;  3HHW A;  4YHH M;  1NJF A;  4IBJ A;  5BPV A;  4LCB A;  4G4R A;  2FOI C;  3PVS A;  3FUT A;  2BJV A;  2DWN A;  2EUC A;  3TL4 X;  1GL6 A;  4PCZ A;  5ITY A;  3AL0 C;  1R2Y A;  4LJA A;  1XWI A;  4B3T M;  1I94 M;  4NSO B;  3GP1 A;  3EIE A;  1IY0 A;  4IBG A;  3TWK A;  5FTN A;  2UXB M;  4DR5 M;  4AW4 A;  3L25 A;  4GIP A;  3BOS A;  5ITX A;  1XMQ M;  3FTF A;  1WXQ A;  3AKZ A;  1L8Q A;  1PJJ A;  1HNW M;  5IWA M;  4AI6 A;  4D82 A;  4MGZ E;  4X65 M;  3KP1 E;  4LJ7 A;  1XC8 A;  4L16 A;  3T15 A;  3HHX A;  4NRV A;  2H1R A;  3JAM S;  4KLN A;  3MJ5 A;  5GKN A;  3GLI B;  4Z8X A;  1G59 A;  1TDH A;  1K82 A;  4RNA A;  4AKI A;  2LWX A;  4D80 A;  3K92 A;  1IN4 A;  3SAW A;  3SC3 A;  3GQ3 A;  4GHA A;  1Q3B A;  5FSW A;  1XXH A;  5ITQ A;  4NRW A;  1S3S A;  3R9X B;  1Z6T A;  3J2P B;  1L2D A;  2V1C A;  2UUC M;  2OPF A;  3HGI A;  4KOD A;  4AG6 A;  2LXE A;  4GRI A;  2CHQ A;  3GLI A;  3HU3 A;  4G4Q A;  3SBJ A;  1L2C A;  4LF6 M;  1N33 M;  1HR0 M;  3KP0 E;  5DYI A;  3U6C A;  3K1J A;  3GRU A;  2J7N A;  4DR6 M;  4IBE A;  4GKK M;  3J7B A;  3DA1 A;  3I4Y A;  1XNR M;  4PD2 A;  3RGS A;  2L7H A;  4LF7 M;  3CF6 E;  1C1K A;  1KFV A;  3KOX E;  4GHL A;  1Z5B A;  3M0E A;  3GLG A;  3U60 B;  2F5Q A;  4DV6 M;  2F5S A;  1QAN A;  1TDZ A;  4II7 A;  3AOE C;  1G4A E;  3UK6 A;  4JI8 M;  2F5P A;  2G5G X;  3KVW A;  3VK7 A;  1N36 M;  2XFS A;  4QHS A;  4IBC A;  5EXT A;  3U61 B;  2C5R A;  1Q3C A;  3GPP A;  4OW0 A;  3SAT A;  2CHV A;  3U60 A;  4LZJ A;  2NQ8 C;  3FUX A;  1R7R A;  2F5O A;  2VQE M;  2D7G A;  3E4R A;  5KPT A;  2Z4S A;  2JA2 A;  3VDP A;  5H37 D;  2R45 A;  1NY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...