3D8LA

Crystal structure of orf12 from the lactococcus lactis bacteriophage p2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
GAKQLSTARKFKMITGKDLFQQQKAMDTELKKEDGEITDLMEFVQYGLYLALFQDNIVKAKSDFSDFRSSFEFDTDGKGLKELVELWQKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Crystal structure of ORF12 from Lactococcus lactis phage p2 identifies a tape measure protein chaperone
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 31
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.940 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3d8lA00
3D8LA
chains in the Genus database with same CATH superfamily
4YY3M 5KPRA 1HJPA 2XH9A 3TPZA 2ZTDA 2B3TA 2ERCA 2O01F 3BXWA 1YE9A 3C3EA 2DXIA 2DAIA 3H4MA 4LJ5A 5EXSA 4PCZA 2DHRA 1R5LA 5E6JA 3U60B 1ZAEA 2I7PA 2UU9M 2Y21A 3C58A 3AV0A 4IIWA 4REZA 1Z5BA 3GRUA 1PGYA 4QNRA 3SMPA 4JYAM 1R6BX 4LF7M 4JI0M 3DOAA 3VDPA 4LRSA 1XXHA 3E4RA 2QBYB 2A5YB 2QENA 2Z8YM 3KOZE 5KQDA 4GHLA 2LBCA 3VKHA 3FYCA 3HU1A 3VK8A 3BOSA 2KNVA 1EFUB 1D0LA 2QHOB 1TR8A 4NXNM 2HL7A 1E9SA 1OQYA 4NRVA 1SXJA 4AKIA 2FFJA 3GLHA 5FTJA 1TTEA 3FTFA 3HHYA 2R44A 1JR3D 4R3DA 3W67A 5LMUM 1JR3E 2XSZA 2CWBA 2EA0A 1NY5A 4JI6M 1IBMM 3L25A 2Y20A 4QNMA 1N36M 2OOBA 3LVVA 2DWLA 3GLGE 1F4IA 2DAKA 3KVWA 3TL4X 4KLNA 1E32A 3IG5A 1DGHA 3KOWE 4F2LA 1YUBA 2Z3XA 1WR1B 4X65M 1JQJC 2R6FA 2R18A 1NJGA 4IBDA 1N78A 1QAOA 2KNAA 3K1JA 1TH4A 2K0BX 2R4EA 2DZOB 4L6V6 2FS1A 5IT9S 4LZZA 1R2ZA 2CV1A 5IREB 5EJCA 4M0DA 2CV2A 1CUKA 4LFBM 1NSFA 1WGNA 1KYIA 2GQFA 3CF0A 2UUBM 4D82A 2Z7JA 2CP8A 4LJ7A 3U6CA 3SBJA 3ZH9B 4DR4M 3L26A 3I4VA 2KW0A 2DAEA 2O5RA 2R46A 3L29A 2ZM6M 4PD2A 3GP1A 1DGFA 2C9OA 4FCTA 4L8RC 1ZMVA 3M7GA 5DYIA 4OVZA 2LVNC 3SAUA 4JI5M 3MK6A 1Q3CA 3GLHB 1L1ZA 2XFSA 3CF6E 5ITXE 3SARA 4OW0A 3DZDA 4MH0E 3ILKA 2KEBA 5ITQA 3R8FA 3L28A 3F92A 3E21A 1NO1A 5EP3A 5H37D 2BJVA 2HWJA 3GLFA 3BBZA 1KFVA 2LHGA 2WSFF 4XK8F 5DYGA 3GQ5A 2HCBA 2O25A 2YR0A 1LV7A 4GITA 5ITRA 4LF4M 1QYRA 3D8LA 3NWLA 2HKJA 4L15A 2CHQA 4B7FA 2DAMA 3GPPA 3RFWA 1GO5A 2LVPC 3MHVC 1T3TA 4CISA 3CTWB 3T1YM 3I4YA 4I8OA 1DGHB 2M60A 2Y0TA 2LXEA 3SAWA 3U61B 1IXRC 4FWDA 3B7ZA 1SXJD 2R4JA 3TQSA 2HAKA 3GPYA 4DR1M 1SXJE 2BJWA 2Z4SA 3QYEA 1QAQA 4GH9A 3VK7A 4DR6M 3SAVA 1XMQM 1IXSB 1XB2B 4B08A 1L8QA 1OKSA 5F3WA 1N33M 2WSEF 3CF2A 1PJIA 4DV2M 4DV6M 2RGOA 3AOGA 3HU3A 4LJAA 1X37A 1PJSA 3LW5F 4RNAA 5EP4A 3U6OA 1D0KA 2MH8A 4KHPM 5ITTA 2ZANA 1N75A 4GMQA 3D8BA 3J27B 4GKJM 5ITUA 3SC3A 2UXDM 2Y0QA 3SYKA 2R0IA 2L4FA 4M9SA 4X66M 2C5RA 1NY6A 4AQYM 2R65A 4F1IA 3PVSA 4MGIE 1Z5CA 1QZEA 2DAGA 1VG5A 3NBXX 1HT2E 1PJJA 2LVQD 1LTMA 1XWIA 5KO3A 4LF6M 2G5GX 2XLJA 3EIEA 5KPTA 5JI2E 2QNJA 2JY6B 1WHCA 1WJ7A 1Y8GA 1ZQ9A 2DZLA 3ZC7B 2F5SA 1YLAA 4KO8A 4IJFA 4LG2A 2D7EA 4RKUF 3QAUA 4M9XA 3B89A 4MGHA 3KS4A 2Q2EB 7CATA 3I04M 3U5ZA 1R4GA 1IXZA 2XZUA 1AUAA 5KPZA 4IBKA 3U6PA 1NJFA 1YSYA 2ZAMA 1Q02A 4B3SM 4JI1M 1D2NA 3Q8XA 1DGGA 2YFQA 2KXEA 3EIHA 3B7NA 4KODA 2QP9X 3AOEC 3QYBA 3GLFE 4FWHA 4B3TM 2JUJA 3FKEA 2DWNA 2W82A 4P16A 1IN4A 3I01M 4WURA 3GLIB 1HNWM 1HQCA 2L09A 2FOIC 4DR3M 4RF1A 4PT5A 4JI4M 2DWMA 2D7HA 4LJ8A 1NHWC 2FNAA 2XFTA 1QQWA 2D7GA 4LGMA 2ZTCA 4LRTA 1N34M 2ZAOA 1J7KA 3T38A 3VKGA 2JWSA 2M5ZA 2CEAA 3GLGB 3U6LA 1IBLM 2YQZA 2CUZA 2JA2A 2WZJA 3M0EA 1JB0F 2P5TA 4S12A 1VEJA 1OJLA 1FJGM 4NOOB 1G41A 1HNZM 2J7NA 2I7NA 2EJSA 2LH0A 1R2YA 2F5OA 4LJ9A 4UN2B 3UZUA 1IN6A 1P3QQ 3E9SA 1IY1A 4M9ZA 1G8PA 1MN3A 4B7HA 2UUCM 3KXEC 4XGIA 2JNHA 3HX3A 4G6ZA 3U5ZB 4LFCM 4HEOA 4IBBA 3U61A 5EP1A 2E5LM 2ZBKB 4IBGA 1Q3BA 1IN8A 4JI3M 3LCVB 3FUUA 1MU5A 2JZ0A 2KA6B 1TF0B 3LCUA 4X62M 4MGZE 5FSWA 1HNXM 1IXSA 3TWLA 2XEPA 4NRWA 2BWBA 3PXGA 4R71A 3C9PA 3K8ZA 2V1UA 1W5TA 3TE6A 1I4WA 4MB7A 3HHZA 1QAMA 3HKPA 2EUCA 1S3SA 4GC5A 3OTOM 3KFUG 5JI3E 2C96A 3KP1E 2OO9A 4NSOB 1QANA 3LQQA 1Z59A 3K9OA 4L4UA 2H5XA 2CRUA 4BB9A 3VLFB 1XHBA 1XNQM 3SFZA 1V34A 2DKLA 4RF0A 1UFZA 3HJSA 4D80A 4X64M 2QZ4A 1L2DA 2K9DA 5FTLA 2X8AA 1EE8A 4BBAA 1OFHA 1K82A 4LF5M 1XXHE 2QSFX 4IJEA 4GRIA 4FD2A 1MJGM 1OAOC 3HY5A 4QOSA 3AJIB 3W0LB 3UJNA 2LHCA 3IECA 3MMPA 1G71A 2JY7A 3SYLA 4B3RM 1GJSA 4DBGB 1T6OA 3DA1A 3HHWA 1Z5AA 4PDGA 2V6ZM 1G4AE 4NL4H 3SASA 4AI6A 2DVWB 2OPFA 3GLHE 4B7GA 2VQFM 2L4EA 4XBOA 4G4OA 1PRBA 1K3XA 1IN7A 1GVNA 2L6OA 2XF3A 2XSZD 4DV7M 4AZFA 3NBIA 4IBIA 4Q7JA 2JY5A 4Z8XA 1TDHA 2DZNB 2K47A 4LJ6A 1QVRA 4L16A 4I4LA 2MROB 4LZJA 2LNHC 3VFDA 4TUWA 2C9CA 3FUTA 2MR9A 3K2LA 2R62A 4DV1M 3GLIA 2CFOA 4NXMM 2AHMA 4DR7M 1L2CA 3UMMA 1IQPA 5IZ7D 1JR3A 3SHGB 1W5SA 4JV5M 1L1TA 3FTDA 3IG8A 4AG6A 4GKKM 2Z4RA 2DHYA 2QPAA 3HWSA 1L2BA 4QOZC 1KSFX 1PJTA 2KZUA 3RGPA 4K0KM 4NSRA 4GC9A 4ITQA 4QHTA 4LF8M 1Q39A 1V33A 3THGA 3GLGA 3W0FA 4HLQA 3I51A 2CHGA 3FRHA 4IBFA 2JXNA 1TDZA 1VDDA 1ZV1A 1VEKA 2RRUA 3KSJA 3B7QA 3RE8A 2KZSA 3KOXE 2DNAA 2UXBM 1D0MA 1GABA 1WIVA 1NV8A 4CGYB 5C18A 3J81S 3A46A 4DUZM 1QUTA 5FTNA 1XNRM 1OIZA 3FUWA 4JI7M 3WHKA 3L27A 4KT0F 2QQ8A 1AIPC 2HHHM 3L2AA 4IBJA 3ZCBB 2C98A 2DENA 4FCVA 1TH2A 3B9PA 3K9PA 4G3OA 2DWZB 3ZQJA 1ZMWA 1TH3A 3JR4A 3KS8A 1DO0A 1IN5A 3LQRA 3A42A 1K3WA 3CGWA 3W68A 2VQEM 3HGIA 1I94M 3AL0C 1G3IA 2L2DA 5ITXA 3J7BA 3AOEA 4W5WA 2UXCM 4JI8M 3GRYA 1NVMA 3J80S 4HL4A 5BPVA 4CJ6A 3GQ4A 1V92A 3J2PB 2C99A 2L7HA 4NC6A 2YNMD 3LMMA 3KOYE 2JP7A 2G8LA 2CE7A 4IBCA 3GPXA 1GKIA 1GL6A 2H1RA 4FVMA 4IBEA 1G59A 1OAIA 2WSCF 3M6AA 4LGYA 4MGKE 2VF8A 1SXJC 1WXQA 2FH0A 2QCUA 1OIPA 1C1KA 4Z6YA 4YHHM 4G4QA 3VDUA 5LMNM 4G4RA 2LTUA 1J5EM 1WGLA 4JI2M 2CV0A 1QUSA 3FD9A 4AW4A 4JN6A 1VDLA 2J7OA 1GL7A 1QDRA 4FW9A 4LJ4A 4Y28F 1OFIA 4DR2M 2LVOC 1ORYB 2JY8A 4LY6A 3TWMA 1R7RA 2VDBB 5EP2A 4GEWA 2RGHA 1NHGC 4B3MM 3GLIE 4LF9M 3GPUA 3FRIA 1DO2A 3GQ3A 3AFHA 1E94E 5EXTA 2F5QA 4I5SA 1OTRA 3JR5A 4GHAA 3FYDA 3SMSA 2FE8A 1VEGA 5IWAM 1PM5A 2VIIA 1N77A 1DGBA 1HT1E 5EQTA 1QDTA 3GRVA 4BLCA 3PNYA 4DV3M 4G4NA 1SG9A 2X49A 1C7YA 1E9RA 4JXJA 1HR0M 5EXPA 3T15A 2XGNA 2F5PA 4ZPXA 2MGWA 1H6UA 2BNKA 5KQ8A 2LVAA 3A45A 4EIWA 5FLXS 4LFAM 5DNYA 3U6EA 2NQ8C 5GKNA 3PNVA 2CHVA 1GJTA 3SATA 3HU2A 2KRUA 1XXHB 4WP2A 3TWKA 1XMOM 8CATA 3AKZA 2VF7A 3FE3A 2X4AA 4FCWA 2R45A 4GIPA 2F4VM 4AG5A 2KNZA 4AKHA 3FUXA 1IY0A 3T6PA 3GRRA 4FWGA 4ANRA 5L8RF 4OU7A 3KP0E 1IBKM 2MJ5B 4DV0M 1TGUA 1SXJB 3C3DA 1XC8A 4A3VB 3U6QA 2JZ1A 4CIZA 3J7AS 4CHTB 1ZMUA 3QWLA 1MX0A 2OQ4A 2N35A 2GNOA 4P17A 1UM8A 5EXXA 2RKOA 3HZJA 5DFLA 4DV5M 2J5YA 3DFZA 3HJQA 1NNJA 3HHXA 2UUAM 1A5TA 2L7IA 3MJ5A 4II7A 2V1CA 1J09A 3WHLA 1DV0A 4AKGA 2EO2A 4DUYM 3IHPA 2XZFA 3HJ8A 2EKKA 3KSXA 4WW0A 1NV9A 1RU3A 5FTMA 1IY2A 1FNNA 3H4JA 4M0WA 3U60A 3RGSA 1PJQA 1QZMA 2K6BA 3SHFA 2G3QA 4PDIA 2OOAA 5E26A 5C1BA 3U6MA 3LVWA 3UGJA 1N32M 2KDLA 1EIJA 1NNUC 3JAMS 1HQYE 3GO8A 4MM3B 2APLA 2EKFA 1IM2A 5A2QS 3PFIA 2QBYA 3Q8GA 3FTCA 3V76A 4OVZB 3U6DA 2LWXA 4DR5M 3KDSE 5BR8M 4I81A 2F5NA 4D81A 3FTEA 1IFYA 3UK6A 2DI0A 4OX9M 1Z6TA 3B74A 3K92A 5FTKA 4QHSA 3FUVA 5ITYA 4DV4M 2KHHA 1VQ1A 2BWEA 3A98B 3R9XB 3E46A 4L78A 3GLFB 3U6SA 4R7GA 1GLNA 1BVSA 4MGYE 4LCBA 3T1HM 2KRKA 1T43A 3KW6A
chains in the Genus database with same CATH topology
4YY3M 5KPRA 2XH9A 3TPZA 2ERCA 1YE9A 2DXIA 5EXSA 3H4MA 4LJ5A 4PCZA 2DHRA 5E6JA 3U60B 1ZAEA 2I7PA 2UU9M 2Y21A 3C58A 3AV0A 4IIWA 4REZA 1Z5BA 3GRUA 4QNRA 3SMPA 4JYAM 1R6BX 4LF7M 4JI0M 3DOAA 3VDPA 4LRSA 1XXHA 3E4RA 2QBYB 2A5YB 2QENA 3KOZE 5KQDA 4GHLA 3VKHA 3FYCA 3HU1A 3VK8A 3BOSA 4NXNM 2HL7A 1E9SA 4NRVA 1SXJA 4AKIA 2FFJA 3GLHA 5FTJA 3FTFA 3HHYA 1JR3D 4R3DA 5LMUM 2XSZA 2EA0A 1NY5A 4JI6M 1IBMM 3L25A 2Y20A 4QNMA 1N36M 3LVVA 2DWLA 3KVWA 3TL4X 4KLNA 1E32A 3IG5A 1DGHA 3KOWE 2Z3XA 1YUBA 4X65M 1JQJC 1N78A 2R18A 1NJGA 4IBDA 1QAOA 3K1JA 1TH4A 5IT9S 2R4EA 2DZOB 4LZZA 1R2ZA 2CV1A 5IREB 5EJCA 4M0DA 2CV2A 4LFBM 1NSFA 1KYIA 3CF0A 2UUBM 4D82A 2Z7JA 4LJ7A 3U6CA 3SBJA 3ZH9B 4DR4M 3L26A 3I4VA 2KW0A 3L29A 2O5RA 2R46A 2ZM6M 4PD2A 3GP1A 1DGFA 2C9OA 4FCTA 4L8RC 3M7GA 5DYIA 3SAUA 4OVZA 4JI5M 3MK6A 1Q3CA 3GLHB 1L1ZA 2XFSA 3CF6E 5ITXE 3SARA 4OW0A 3DZDA 4MH0E 3ILKA 2KEBA 5ITQA 3R8FA 3L28A 5EP3A 5H37D 2BJVA 1KFVA 3GLFA 5DYGA 3GQ5A 2HCBA 4GITA 2YR0A 1LV7A 5ITRA 4LF4M 1QYRA 3D8LA 3NWLA 2HKJA 4L15A 2CHQA 4B7FA 3GPPA 3RFWA 3MHVC 1T3TA 4CISA 3CTWB 3T1YM 3I4YA 4I8OA 1DGHB 2M60A 2Y0TA 2LXEA 3SAWA 3U61B 1IXRC 4FWDA 1SXJD 2R4JA 3TQSA 3GPYA 4DR1M 1SXJE 2BJWA 2Z4SA 4GH9A 1QAQA 3VK7A 4DR6M 3SAVA 1XMQM 1IXSB 4B08A 5F3WA 1L8QA 1N33M 3CF2A 1PJIA 4DV2M 4DV6M 2RGOA 3AOGA 3HU3A 4LJAA 1X37A 4RNAA 5EP4A 3U6OA 4KHPM 5ITTA 2ZANA 1N75A 4GMQA 3D8BA 3J27B 4GKJM 5ITUA 3SC3A 2UXDM 2Y0QA 3SYKA 4M9SA 4X66M 1NY6A 4AQYM 2R65A 3PVSA 4MGIE 1Z5CA 1HT2E 1PJJA 1XWIA 5KO3A 4LF6M 2G5GX 2XLJA 3EIEA 5KPTA 5JI2E 3ZC7B 1ZQ9A 2F5SA 4KO8A 4IJFA 4LG2A 2D7EA 3QAUA 4M9XA 4MGHA 3KS4A 2Q2EB 7CATA 3U5ZA 1IXZA 2XZUA 5KPZA 3U6PA 4IBKA 1NJFA 1YSYA 2ZAMA 4B3SM 4JI1M 1D2NA 3Q8XA 1DGGA 2YFQA 2KXEA 3EIHA 4KODA 2QP9X 3AOEC 4FWHA 4B3TM 3FKEA 2DWNA 2W82A 4P16A 1IN4A 4WURA 3GLIB 1HNWM 1HQCA 2L09A 2FOIC 4DR3M 4RF1A 4PT5A 4JI4M 2DWMA 2D7HA 4LJ8A 1NHWC 2FNAA 2XFTA 1QQWA 2D7GA 4LGMA 4LRTA 1N34M 2ZAOA 1J7KA 3T38A 3VKGA 2M5ZA 2CEAA 3GLGB 3U6LA 1IBLM 2YQZA 2CUZA 2JA2A 3M0EA 4S12A 2P5TA 1OJLA 1FJGM 4NOOB 1G41A 1HNZM 2J7NA 2I7NA 2LH0A 1R2YA 2F5OA 4LJ9A 3UZUA 1IN6A 3E9SA 1IY1A 4M9ZA 1G8PA 4B7HA 2UUCM 3KXEC 4XGIA 3U5ZB 4G6ZA 4LFCM 4IBBA 3U61A 5EP1A 2E5LM 2ZBKB 4IBGA 1Q3BA 1IN8A 4JI3M 3FUUA 1MU5A 4X62M 2KA6B 4MGZE 5FSWA 1HNXM 3TWLA 2XEPA 4NRWA 3PXGA 3K8ZA 2V1UA 1W5TA 3TE6A 1I4WA 4MB7A 3HHZA 1QAMA 3HKPA 2EUCA 1S3SA 4GC5A 3OTOM 3KFUG 5JI3E 2C96A 3KP1E 4NSOB 1QANA 3LQQA 1Z59A 4L4UA 4BB9A 3VLFB 1XHBA 1XNQM 3SFZA 4RF0A 3HJSA 4D80A 4X64M 2QZ4A 1L2DA 5FTLA 2X8AA 1EE8A 4BBAA 1OFHA 1K82A 4LF5M 4IJEA 4GRIA 4FD2A 4QOSA 3AJIB 3W0LB 3UJNA 4B3RM 3SYLA 3DA1A 3HHWA 1Z5AA 4PDGA 2V6ZM 1G4AE 4NL4H 3SASA 4AI6A 2DVWB 2OPFA 4B7GA 2VQFM 4XBOA 4G4OA 1K3XA 1IN7A 1GVNA 2L6OA 2XF3A 2XSZD 4DV7M 4AZFA 3NBIA 4IBIA 4Z8XA 1TDHA 2DZNB 2K47A 4LJ6A 1QVRA 4L16A 4I4LA 4LZJA 2LNHC 3VFDA 4TUWA 2C9CA 3FUTA 3K2LA 2R62A 4DV1M 3GLIA 2CFOA 4NXMM 2AHMA 4DR7M 1L2CA 3UMMA 1IQPA 5IZ7D 1JR3A 3SHGB 1W5SA 4JV5M 1L1TA 3FTDA 3IG8A 4AG6A 4GKKM 2Z4RA 2QPAA 3HWSA 1L2BA 4QOZC 1KSFX 2KZUA 3RGPA 4K0KM 4NSRA 4GC9A 4ITQA 4QHTA 4LF8M 1Q39A 3THGA 3GLGA 3W0FA 4HLQA 3I51A 2CHGA 4IBFA 1TDZA 1VDDA 3KSJA 3RE8A 2KZSA 3KOXE 2UXBM 3J81S 4CGYB 5C18A 3A46A 4DUZM 5FTNA 1XNRM 3FUWA 4JI7M 3WHKA 3L27A 2HHHM 3L2AA 4IBJA 3ZCBB 2C98A 4FCVA 1TH2A 3B9PA 2DWZB 1TH3A 3JR4A 3KS8A 1DO0A 1IN5A 3LQRA 3A42A 1K3WA 2VQEM 1I94M 3HGIA 3AL0C 1G3IA 5ITXA 3J7BA 3AOEA 4W5WA 2UXCM 4JI8M 3GRYA 1NVMA 3J80S 4HL4A 5BPVA 3GQ4A 3J2PB 2C99A 2L7HA 2YNMD 3LMMA 3KOYE 2G8LA 2CE7A 4IBCA 3GPXA 1GKIA 1GL6A 2H1RA 4FVMA 4IBEA 1G59A 3M6AA 4LGYA 4MGKE 1SXJC 1WXQA 2QCUA 4Z6YA 4G4QA 1C1KA 4YHHM 4G4RA 1J5EM 3VDUA 5LMNM 4JI2M 2CV0A 4AW4A 3FD9A 2C5RA 4JN6A 2J7OA 1GL7A 4FW9A 4LJ4A 4DR2M 1OFIA 1ORYB 4LY6A 3TWMA 1R7RA 5EP2A 2RGHA 1NHGC 4B3MM 4LF9M 3GPUA 1DO2A 3GQ3A 3AFHA 1E94E 5EXTA 2F5QA 4I5SA 3JR5A 4GHAA 3FYDA 3SMSA 2FE8A 5IWAM 1PM5A 2VIIA 1N77A 1DGBA 1HT1E 5EQTA 3GRVA 4BLCA 3PNYA 4DV3M 4G4NA 2X49A 1E9RA 4JXJA 1HR0M 5EXPA 3T15A 2XGNA 2F5PA 4ZPXA 1H6UA 2BNKA 5KQ8A 5FLXS 3A45A 4EIWA 3U6EA 4LFAM 5DNYA 2NQ8C 5GKNA 3PNVA 2CHVA 3SATA 3HU2A 2KRUA 1XXHB 3TWKA 1XMOM 8CATA 3AKZA 2X4AA 4FCWA 2R45A 4GIPA 2F4VM 4AG5A 4AKHA 3FUXA 1IY0A 3GRRA 4FWGA 4OU7A 1IBKM 3KP0E 4DV0M 1TGUA 1SXJB 1XC8A 4A3VB 3U6QA 3J7AS 4CHTB 3QWLA 1MX0A 2OQ4A 1UM8A 5EXXA 2RKOA 4DV5M 3DFZA 3HJQA 1NNJA 3HHXA 2UUAM 2L7IA 3MJ5A 4II7A 2V1CA 1J09A 3WHLA 4AKGA 2EO2A 4DUYM 2XZFA 3HJ8A 3KSXA 4WW0A 5FTMA 1IY2A 1FNNA 4M0WA 3U60A 3RGSA 1QZMA 3SHFA 4PDIA 5C1BA 5E26A 3U6MA 3LVWA 3UGJA 1N32M 1NNUC 3JAMS 1HQYE 3GO8A 4MM3B 1IM2A 5A2QS 3PFIA 2QBYA 3FTCA 4OVZB 3U6DA 2LWXA 4DR5M 3KDSE 5BR8M 4I81A 2F5NA 4D81A 3FTEA 3UK6A 4OX9M 1Z6TA 3K92A 5FTKA 4QHSA 3FUVA 5ITYA 4DV4M 3A98B 3R9XB 4L78A 3GLFB 3U6SA 4R7GA 1GLNA 4MGYE 3T1HM 4LCBA 2KRKA 3KW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8L A; 
#chains in the Genus database with same CATH topology
 4YY3 M;  5KPR A;  1HJP A;  2XH9 A;  3TPZ A;  2ZTD A;  2B3T A;  2ERC A;  2O01 F;  3BXW A;  1YE9 A;  3C3E A;  2DXI A;  2DAI A;  3H4M A;  4LJ5 A;  5EXS A;  4PCZ A;  2DHR A;  1R5L A;  5E6J A;  3U60 B;  1ZAE A;  2I7P A;  2UU9 M;  2Y21 A;  3C58 A;  3AV0 A;  4IIW A;  4REZ A;  1Z5B A;  3GRU A;  1PGY A;  4QNR A;  3SMP A;  4JYA M;  1R6B X;  4LF7 M;  4JI0 M;  3DOA A;  3VDP A;  4LRS A;  1XXH A;  3E4R A;  2QBY B;  2A5Y B;  2QEN A;  2Z8Y M;  3KOZ E;  5KQD A;  4GHL A;  2LBC A;  3VKH A;  3FYC A;  3HU1 A;  3VK8 A;  3BOS A;  2KNV A;  1EFU B;  1D0L A;  2QHO B;  1TR8 A;  4NXN M;  2HL7 A;  1E9S A;  1OQY A;  4NRV A;  1SXJ A;  4AKI A;  2FFJ A;  3GLH A;  5FTJ A;  1TTE A;  3FTF A;  3HHY A;  2R44 A;  1JR3 D;  4R3D A;  3W67 A;  5LMU M;  1JR3 E;  2XSZ A;  2CWB A;  2EA0 A;  1NY5 A;  4JI6 M;  1IBM M;  3L25 A;  2Y20 A;  4QNM A;  1N36 M;  2OOB A;  3LVV A;  2DWL A;  3GLG E;  1F4I A;  2DAK A;  3KVW A;  3TL4 X;  4KLN A;  1E32 A;  3IG5 A;  1DGH A;  3KOW E;  4F2L A;  1YUB A;  2Z3X A;  1WR1 B;  4X65 M;  1JQJ C;  2R6F A;  2R18 A;  1NJG A;  4IBD A;  1N78 A;  1QAO A;  2KNA A;  3K1J A;  1TH4 A;  2K0B X;  2R4E A;  2DZO B;  4L6V 6;  2FS1 A;  5IT9 S;  4LZZ A;  1R2Z A;  2CV1 A;  5IRE B;  5EJC A;  4M0D A;  2CV2 A;  1CUK A;  4LFB M;  1NSF A;  1WGN A;  1KYI A;  2GQF A;  3CF0 A;  2UUB M;  4D82 A;  2Z7J A;  2CP8 A;  4LJ7 A;  3U6C A;  3SBJ A;  3ZH9 B;  4DR4 M;  3L26 A;  3I4V A;  2KW0 A;  2DAE A;  2O5R A;  2R46 A;  3L29 A;  2ZM6 M;  4PD2 A;  3GP1 A;  1DGF A;  2C9O A;  4FCT A;  4L8R C;  1ZMV A;  3M7G A;  5DYI A;  4OVZ A;  2LVN C;  3SAU A;  4JI5 M;  3MK6 A;  1Q3C A;  3GLH B;  1L1Z A;  2XFS A;  3CF6 E;  5ITX E;  3SAR A;  4OW0 A;  3DZD A;  4MH0 E;  3ILK A;  2KEB A;  5ITQ A;  3R8F A;  3L28 A;  3F92 A;  3E21 A;  1NO1 A;  5EP3 A;  5H37 D;  2BJV A;  2HWJ A;  3GLF A;  3BBZ A;  1KFV A;  2LHG A;  2WSF F;  4XK8 F;  5DYG A;  3GQ5 A;  2HCB A;  2O25 A;  2YR0 A;  1LV7 A;  4GIT A;  5ITR A;  4LF4 M;  1QYR A;  3D8L A;  3NWL A;  2HKJ A;  4L15 A;  2CHQ A;  4B7F A;  2DAM A;  3GPP A;  3RFW A;  1GO5 A;  2LVP C;  3MHV C;  1T3T A;  4CIS A;  3CTW B;  3T1Y M;  3I4Y A;  4I8O A;  1DGH B;  2M60 A;  2Y0T A;  2LXE A;  3SAW A;  3U61 B;  1IXR C;  4FWD A;  3B7Z A;  1SXJ D;  2R4J A;  3TQS A;  2HAK A;  3GPY A;  4DR1 M;  1SXJ E;  2BJW A;  2Z4S A;  3QYE A;  1QAQ A;  4GH9 A;  3VK7 A;  4DR6 M;  3SAV A;  1XMQ M;  1IXS B;  1XB2 B;  4B08 A;  1L8Q A;  1OKS A;  5F3W A;  1N33 M;  2WSE F;  3CF2 A;  1PJI A;  4DV2 M;  4DV6 M;  2RGO A;  3AOG A;  3HU3 A;  4LJA A;  1X37 A;  1PJS A;  3LW5 F;  4RNA A;  5EP4 A;  3U6O A;  1D0K A;  2MH8 A;  4KHP M;  5ITT A;  2ZAN A;  1N75 A;  4GMQ A;  3D8B A;  3J27 B;  4GKJ M;  5ITU A;  3SC3 A;  2UXD M;  2Y0Q A;  3SYK A;  2R0I A;  2L4F A;  4M9S A;  4X66 M;  2C5R A;  1NY6 A;  4AQY M;  2R65 A;  4F1I A;  3PVS A;  4MGI E;  1Z5C A;  1QZE A;  2DAG A;  1VG5 A;  3NBX X;  1HT2 E;  1PJJ A;  2LVQ D;  1LTM A;  1XWI A;  5KO3 A;  4LF6 M;  2G5G X;  2XLJ A;  3EIE A;  5KPT A;  5JI2 E;  2QNJ A;  2JY6 B;  1WHC A;  1WJ7 A;  1Y8G A;  1ZQ9 A;  2DZL A;  3ZC7 B;  2F5S A;  1YLA A;  4KO8 A;  4IJF A;  4LG2 A;  2D7E A;  4RKU F;  3QAU A;  4M9X A;  3B89 A;  4MGH A;  3KS4 A;  2Q2E B;  7CAT A;  3I04 M;  3U5Z A;  1R4G A;  1IXZ A;  2XZU A;  1AUA A;  5KPZ A;  4IBK A;  3U6P A;  1NJF A;  1YSY A;  2ZAM A;  1Q02 A;  4B3S M;  4JI1 M;  1D2N A;  3Q8X A;  1DGG A;  2YFQ A;  2KXE A;  3EIH A;  3B7N A;  4KOD A;  2QP9 X;  3AOE C;  3QYB A;  3GLF E;  4FWH A;  4B3T M;  2JUJ A;  3FKE A;  2DWN A;  2W82 A;  4P16 A;  1IN4 A;  3I01 M;  4WUR A;  3GLI B;  1HNW M;  1HQC A;  2L09 A;  2FOI C;  4DR3 M;  4RF1 A;  4PT5 A;  4JI4 M;  2DWM A;  2D7H A;  4LJ8 A;  1NHW C;  2FNA A;  2XFT A;  1QQW A;  2D7G A;  4LGM A;  2ZTC A;  4LRT A;  1N34 M;  2ZAO A;  1J7K A;  3T38 A;  3VKG A;  2JWS A;  2M5Z A;  2CEA A;  3GLG B;  3U6L A;  1IBL M;  2YQZ A;  2CUZ A;  2JA2 A;  2WZJ A;  3M0E A;  1JB0 F;  2P5T A;  4S12 A;  1VEJ A;  1OJL A;  1FJG M;  4NOO B;  1G41 A;  1HNZ M;  2J7N A;  2I7N A;  2EJS A;  2LH0 A;  1R2Y A;  2F5O A;  4LJ9 A;  4UN2 B;  3UZU A;  1IN6 A;  1P3Q Q;  3E9S A;  1IY1 A;  4M9Z A;  1G8P A;  1MN3 A;  4B7H A;  2UUC M;  3KXE C;  4XGI A;  2JNH A;  3HX3 A;  4G6Z A;  3U5Z B;  4LFC M;  4HEO A;  4IBB A;  3U61 A;  5EP1 A;  2E5L M;  2ZBK B;  4IBG A;  1Q3B A;  1IN8 A;  4JI3 M;  3LCV B;  3FUU A;  1MU5 A;  2JZ0 A;  2KA6 B;  1TF0 B;  3LCU A;  4X62 M;  4MGZ E;  5FSW A;  1HNX M;  1IXS A;  3TWL A;  2XEP A;  4NRW A;  2BWB A;  3PXG A;  4R71 A;  3C9P A;  3K8Z A;  2V1U A;  1W5T A;  3TE6 A;  1I4W A;  4MB7 A;  3HHZ A;  1QAM A;  3HKP A;  2EUC A;  1S3S A;  4GC5 A;  3OTO M;  3KFU G;  5JI3 E;  2C96 A;  3KP1 E;  2OO9 A;  4NSO B;  1QAN A;  3LQQ A;  1Z59 A;  3K9O A;  4L4U A;  2H5X A;  2CRU A;  4BB9 A;  3VLF B;  1XHB A;  1XNQ M;  3SFZ A;  1V34 A;  2DKL A;  4RF0 A;  1UFZ A;  3HJS A;  4D80 A;  4X64 M;  2QZ4 A;  1L2D A;  2K9D A;  5FTL A;  2X8A A;  1EE8 A;  4BBA A;  1OFH A;  1K82 A;  4LF5 M;  1XXH E;  2QSF X;  4IJE A;  4GRI A;  4FD2 A;  1MJG M;  1OAO C;  3HY5 A;  4QOS A;  3AJI B;  3W0L B;  3UJN A;  2LHC A;  3IEC A;  3MMP A;  1G71 A;  2JY7 A;  3SYL A;  4B3R M;  1GJS A;  4DBG B;  1T6O A;  3DA1 A;  3HHW A;  1Z5A A;  4PDG A;  2V6Z M;  1G4A E;  4NL4 H;  3SAS A;  4AI6 A;  2DVW B;  2OPF A;  3GLH E;  4B7G A;  2VQF M;  2L4E A;  4XBO A;  4G4O A;  1PRB A;  1K3X A;  1IN7 A;  1GVN A;  2L6O A;  2XF3 A;  2XSZ D;  4DV7 M;  4AZF A;  3NBI A;  4IBI A;  4Q7J A;  2JY5 A;  4Z8X A;  1TDH A;  2DZN B;  2K47 A;  4LJ6 A;  1QVR A;  4L16 A;  4I4L A;  2MRO B;  4LZJ A;  2LNH C;  3VFD A;  4TUW A;  2C9C A;  3FUT A;  2MR9 A;  3K2L A;  2R62 A;  4DV1 M;  3GLI A;  2CFO A;  4NXM M;  2AHM A;  4DR7 M;  1L2C A;  3UMM A;  1IQP A;  5IZ7 D;  1JR3 A;  3SHG B;  1W5S A;  4JV5 M;  1L1T A;  3FTD A;  3IG8 A;  4AG6 A;  4GKK M;  2Z4R A;  2DHY A;  2QPA A;  3HWS A;  1L2B A;  4QOZ C;  1KSF X;  1PJT A;  2KZU A;  3RGP A;  4K0K M;  4NSR A;  4GC9 A;  4ITQ A;  4QHT A;  4LF8 M;  1Q39 A;  1V33 A;  3THG A;  3GLG A;  3W0F A;  4HLQ A;  3I51 A;  2CHG A;  3FRH A;  4IBF A;  2JXN A;  1TDZ A;  1VDD A;  1ZV1 A;  1VEK A;  2RRU A;  3KSJ A;  3B7Q A;  3RE8 A;  2KZS A;  3KOX E;  2DNA A;  2UXB M;  1D0M A;  1GAB A;  1WIV A;  1NV8 A;  4CGY B;  5C18 A;  3J81 S;  3A46 A;  4DUZ M;  1QUT A;  5FTN A;  1XNR M;  1OIZ A;  3FUW A;  4JI7 M;  3WHK A;  3L27 A;  4KT0 F;  2QQ8 A;  1AIP C;  2HHH M;  3L2A A;  4IBJ A;  3ZCB B;  2C98 A;  2DEN A;  4FCV A;  1TH2 A;  3B9P A;  3K9P A;  4G3O A;  2DWZ B;  3ZQJ A;  1ZMW A;  1TH3 A;  3JR4 A;  3KS8 A;  1DO0 A;  1IN5 A;  3LQR A;  3A42 A;  1K3W A;  3CGW A;  3W68 A;  2VQE M;  3HGI A;  1I94 M;  3AL0 C;  1G3I A;  2L2D A;  5ITX A;  3J7B A;  3AOE A;  4W5W A;  2UXC M;  4JI8 M;  3GRY A;  1NVM A;  3J80 S;  4HL4 A;  5BPV A;  4CJ6 A;  3GQ4 A;  1V92 A;  3J2P B;  2C99 A;  2L7H A;  4NC6 A;  2YNM D;  3LMM A;  3KOY E;  2JP7 A;  2G8L A;  2CE7 A;  4IBC A;  3GPX A;  1GKI A;  1GL6 A;  2H1R A;  4FVM A;  4IBE A;  1G59 A;  1OAI A;  2WSC F;  3M6A A;  4LGY A;  4MGK E;  2VF8 A;  1SXJ C;  1WXQ A;  2FH0 A;  2QCU A;  1OIP A;  1C1K A;  4Z6Y A;  4YHH M;  4G4Q A;  3VDU A;  5LMN M;  4G4R A;  2LTU A;  1J5E M;  1WGL A;  4JI2 M;  2CV0 A;  1QUS A;  3FD9 A;  4AW4 A;  4JN6 A;  1VDL A;  2J7O A;  1GL7 A;  1QDR A;  4FW9 A;  4LJ4 A;  4Y28 F;  1OFI A;  4DR2 M;  2LVO C;  1ORY B;  2JY8 A;  4LY6 A;  3TWM A;  1R7R A;  2VDB B;  5EP2 A;  4GEW A;  2RGH A;  1NHG C;  4B3M M;  3GLI E;  4LF9 M;  3GPU A;  3FRI A;  1DO2 A;  3GQ3 A;  3AFH A;  1E94 E;  5EXT A;  2F5Q A;  4I5S A;  1OTR A;  3JR5 A;  4GHA A;  3FYD A;  3SMS A;  2FE8 A;  1VEG A;  5IWA M;  1PM5 A;  2VII A;  1N77 A;  1DGB A;  1HT1 E;  5EQT A;  1QDT A;  3GRV A;  4BLC A;  3PNY A;  4DV3 M;  4G4N A;  1SG9 A;  2X49 A;  1C7Y A;  1E9R A;  4JXJ A;  1HR0 M;  5EXP A;  3T15 A;  2XGN A;  2F5P A;  4ZPX A;  2MGW A;  1H6U A;  2BNK A;  5KQ8 A;  2LVA A;  3A45 A;  4EIW A;  5FLX S;  4LFA M;  5DNY A;  3U6E A;  2NQ8 C;  5GKN A;  3PNV A;  2CHV A;  1GJT A;  3SAT A;  3HU2 A;  2KRU A;  1XXH B;  4WP2 A;  3TWK A;  1XMO M;  8CAT A;  3AKZ A;  2VF7 A;  3FE3 A;  2X4A A;  4FCW A;  2R45 A;  4GIP A;  2F4V M;  4AG5 A;  2KNZ A;  4AKH A;  3FUX A;  1IY0 A;  3T6P A;  3GRR A;  4FWG A;  4ANR A;  5L8R F;  4OU7 A;  3KP0 E;  1IBK M;  2MJ5 B;  4DV0 M;  1TGU A;  1SXJ B;  3C3D A;  1XC8 A;  4A3V B;  3U6Q A;  2JZ1 A;  4CIZ A;  3J7A S;  4CHT B;  1ZMU A;  3QWL A;  1MX0 A;  2OQ4 A;  2N35 A;  2GNO A;  4P17 A;  1UM8 A;  5EXX A;  2RKO A;  3HZJ A;  5DFL A;  4DV5 M;  2J5Y A;  3DFZ A;  3HJQ A;  1NNJ A;  3HHX A;  2UUA M;  1A5T A;  2L7I A;  3MJ5 A;  4II7 A;  2V1C A;  1J09 A;  3WHL A;  1DV0 A;  4AKG A;  2EO2 A;  4DUY M;  3IHP A;  2XZF A;  3HJ8 A;  2EKK A;  3KSX A;  4WW0 A;  1NV9 A;  1RU3 A;  5FTM A;  1IY2 A;  1FNN A;  3H4J A;  4M0W A;  3U60 A;  3RGS A;  1PJQ A;  1QZM A;  2K6B A;  3SHF A;  2G3Q A;  4PDI A;  2OOA A;  5E26 A;  5C1B A;  3U6M A;  3LVW A;  3UGJ A;  1N32 M;  2KDL A;  1EIJ A;  1NNU C;  3JAM S;  1HQY E;  3GO8 A;  4MM3 B;  2APL A;  2EKF A;  1IM2 A;  5A2Q S;  3PFI A;  2QBY A;  3Q8G A;  3FTC A;  3V76 A;  4OVZ B;  3U6D A;  2LWX A;  4DR5 M;  3KDS E;  5BR8 M;  4I81 A;  2F5N A;  4D81 A;  3FTE A;  1IFY A;  3UK6 A;  2DI0 A;  4OX9 M;  1Z6T A;  3B74 A;  3K92 A;  5FTK A;  4QHS A;  3FUV A;  5ITY A;  4DV4 M;  2KHH A;  1VQ1 A;  2BWE A;  3A98 B;  3R9X B;  3E46 A;  4L78 A;  3GLF B;  3U6S A;  4R7G A;  1GLN A;  1BVS A;  4MGY E;  4LCB A;  3T1H M;  2KRK A;  1T43 A;  3KW6 A; 
#chains in the Genus database with same CATH homology
 4YY3 M;  5KPR A;  2XH9 A;  3TPZ A;  2ERC A;  1YE9 A;  2DXI A;  5EXS A;  3H4M A;  4LJ5 A;  4PCZ A;  2DHR A;  5E6J A;  3U60 B;  1ZAE A;  2I7P A;  2UU9 M;  2Y21 A;  3C58 A;  3AV0 A;  4IIW A;  4REZ A;  1Z5B A;  3GRU A;  4QNR A;  3SMP A;  4JYA M;  1R6B X;  4LF7 M;  4JI0 M;  3DOA A;  3VDP A;  4LRS A;  1XXH A;  3E4R A;  2QBY B;  2A5Y B;  2QEN A;  3KOZ E;  5KQD A;  4GHL A;  3VKH A;  3FYC A;  3HU1 A;  3VK8 A;  3BOS A;  4NXN M;  2HL7 A;  1E9S A;  4NRV A;  1SXJ A;  4AKI A;  2FFJ A;  3GLH A;  5FTJ A;  3FTF A;  3HHY A;  1JR3 D;  4R3D A;  5LMU M;  2XSZ A;  2EA0 A;  1NY5 A;  4JI6 M;  1IBM M;  3L25 A;  2Y20 A;  4QNM A;  1N36 M;  3LVV A;  2DWL A;  3KVW A;  3TL4 X;  4KLN A;  1E32 A;  3IG5 A;  1DGH A;  3KOW E;  2Z3X A;  1YUB A;  4X65 M;  1JQJ C;  1N78 A;  2R18 A;  1NJG A;  4IBD A;  1QAO A;  3K1J A;  1TH4 A;  5IT9 S;  2R4E A;  2DZO B;  4LZZ A;  1R2Z A;  2CV1 A;  5IRE B;  5EJC A;  4M0D A;  2CV2 A;  4LFB M;  1NSF A;  1KYI A;  3CF0 A;  2UUB M;  4D82 A;  2Z7J A;  4LJ7 A;  3U6C A;  3SBJ A;  3ZH9 B;  4DR4 M;  3L26 A;  3I4V A;  2KW0 A;  3L29 A;  2O5R A;  2R46 A;  2ZM6 M;  4PD2 A;  3GP1 A;  1DGF A;  2C9O A;  4FCT A;  4L8R C;  3M7G A;  5DYI A;  3SAU A;  4OVZ A;  4JI5 M;  3MK6 A;  1Q3C A;  3GLH B;  1L1Z A;  2XFS A;  3CF6 E;  5ITX E;  3SAR A;  4OW0 A;  3DZD A;  4MH0 E;  3ILK A;  2KEB A;  5ITQ A;  3R8F A;  3L28 A;  5EP3 A;  5H37 D;  2BJV A;  1KFV A;  3GLF A;  5DYG A;  3GQ5 A;  2HCB A;  4GIT A;  2YR0 A;  1LV7 A;  5ITR A;  4LF4 M;  1QYR A;  3D8L A;  3NWL A;  2HKJ A;  4L15 A;  2CHQ A;  4B7F A;  3GPP A;  3RFW A;  3MHV C;  1T3T A;  4CIS A;  3CTW B;  3T1Y M;  3I4Y A;  4I8O A;  1DGH B;  2M60 A;  2Y0T A;  2LXE A;  3SAW A;  3U61 B;  1IXR C;  4FWD A;  1SXJ D;  2R4J A;  3TQS A;  3GPY A;  4DR1 M;  1SXJ E;  2BJW A;  2Z4S A;  4GH9 A;  1QAQ A;  3VK7 A;  4DR6 M;  3SAV A;  1XMQ M;  1IXS B;  4B08 A;  5F3W A;  1L8Q A;  1N33 M;  3CF2 A;  1PJI A;  4DV2 M;  4DV6 M;  2RGO A;  3AOG A;  3HU3 A;  4LJA A;  1X37 A;  4RNA A;  5EP4 A;  3U6O A;  4KHP M;  5ITT A;  2ZAN A;  1N75 A;  4GMQ A;  3D8B A;  3J27 B;  4GKJ M;  5ITU A;  3SC3 A;  2UXD M;  2Y0Q A;  3SYK A;  4M9S A;  4X66 M;  1NY6 A;  4AQY M;  2R65 A;  3PVS A;  4MGI E;  1Z5C A;  1HT2 E;  1PJJ A;  1XWI A;  5KO3 A;  4LF6 M;  2G5G X;  2XLJ A;  3EIE A;  5KPT A;  5JI2 E;  3ZC7 B;  1ZQ9 A;  2F5S A;  4KO8 A;  4IJF A;  4LG2 A;  2D7E A;  3QAU A;  4M9X A;  4MGH A;  3KS4 A;  2Q2E B;  7CAT A;  3U5Z A;  1IXZ A;  2XZU A;  5KPZ A;  3U6P A;  4IBK A;  1NJF A;  1YSY A;  2ZAM A;  4B3S M;  4JI1 M;  1D2N A;  3Q8X A;  1DGG A;  2YFQ A;  2KXE A;  3EIH A;  4KOD A;  2QP9 X;  3AOE C;  4FWH A;  4B3T M;  3FKE A;  2DWN A;  2W82 A;  4P16 A;  1IN4 A;  4WUR A;  3GLI B;  1HNW M;  1HQC A;  2L09 A;  2FOI C;  4DR3 M;  4RF1 A;  4PT5 A;  4JI4 M;  2DWM A;  2D7H A;  4LJ8 A;  1NHW C;  2FNA A;  2XFT A;  1QQW A;  2D7G A;  4LGM A;  4LRT A;  1N34 M;  2ZAO A;  1J7K A;  3T38 A;  3VKG A;  2M5Z A;  2CEA A;  3GLG B;  3U6L A;  1IBL M;  2YQZ A;  2CUZ A;  2JA2 A;  3M0E A;  4S12 A;  2P5T A;  1OJL A;  1FJG M;  4NOO B;  1G41 A;  1HNZ M;  2J7N A;  2I7N A;  2LH0 A;  1R2Y A;  2F5O A;  4LJ9 A;  3UZU A;  1IN6 A;  3E9S A;  1IY1 A;  4M9Z A;  1G8P A;  4B7H A;  2UUC M;  3KXE C;  4XGI A;  3U5Z B;  4G6Z A;  4LFC M;  4IBB A;  3U61 A;  5EP1 A;  2E5L M;  2ZBK B;  4IBG A;  1Q3B A;  1IN8 A;  4JI3 M;  3FUU A;  1MU5 A;  4X62 M;  2KA6 B;  4MGZ E;  5FSW A;  1HNX M;  3TWL A;  2XEP A;  4NRW A;  3PXG A;  3K8Z A;  2V1U A;  1W5T A;  3TE6 A;  1I4W A;  4MB7 A;  3HHZ A;  1QAM A;  3HKP A;  2EUC A;  1S3S A;  4GC5 A;  3OTO M;  3KFU G;  5JI3 E;  2C96 A;  3KP1 E;  4NSO B;  1QAN A;  3LQQ A;  1Z59 A;  4L4U A;  4BB9 A;  3VLF B;  1XHB A;  1XNQ M;  3SFZ A;  4RF0 A;  3HJS A;  4D80 A;  4X64 M;  2QZ4 A;  1L2D A;  5FTL A;  2X8A A;  1EE8 A;  4BBA A;  1OFH A;  1K82 A;  4LF5 M;  4IJE A;  4GRI A;  4FD2 A;  4QOS A;  3AJI B;  3W0L B;  3UJN A;  4B3R M;  3SYL A;  3DA1 A;  3HHW A;  1Z5A A;  4PDG A;  2V6Z M;  1G4A E;  4NL4 H;  3SAS A;  4AI6 A;  2DVW B;  2OPF A;  4B7G A;  2VQF M;  4XBO A;  4G4O A;  1K3X A;  1IN7 A;  1GVN A;  2L6O A;  2XF3 A;  2XSZ D;  4DV7 M;  4AZF A;  3NBI A;  4IBI A;  4Z8X A;  1TDH A;  2DZN B;  2K47 A;  4LJ6 A;  1QVR A;  4L16 A;  4I4L A;  4LZJ A;  2LNH C;  3VFD A;  4TUW A;  2C9C A;  3FUT A;  3K2L A;  2R62 A;  4DV1 M;  3GLI A;  2CFO A;  4NXM M;  2AHM A;  4DR7 M;  1L2C A;  3UMM A;  1IQP A;  5IZ7 D;  1JR3 A;  3SHG B;  1W5S A;  4JV5 M;  1L1T A;  3FTD A;  3IG8 A;  4AG6 A;  4GKK M;  2Z4R A;  2QPA A;  3HWS A;  1L2B A;  4QOZ C;  1KSF X;  2KZU A;  3RGP A;  4K0K M;  4NSR A;  4GC9 A;  4ITQ A;  4QHT A;  4LF8 M;  1Q39 A;  3THG A;  3GLG A;  3W0F A;  4HLQ A;  3I51 A;  2CHG A;  4IBF A;  1TDZ A;  1VDD A;  3KSJ A;  3RE8 A;  2KZS A;  3KOX E;  2UXB M;  3J81 S;  4CGY B;  5C18 A;  3A46 A;  4DUZ M;  5FTN A;  1XNR M;  3FUW A;  4JI7 M;  3WHK A;  3L27 A;  2HHH M;  3L2A A;  4IBJ A;  3ZCB B;  2C98 A;  4FCV A;  1TH2 A;  3B9P A;  2DWZ B;  1TH3 A;  3JR4 A;  3KS8 A;  1DO0 A;  1IN5 A;  3LQR A;  3A42 A;  1K3W A;  2VQE M;  1I94 M;  3HGI A;  3AL0 C;  1G3I A;  5ITX A;  3J7B A;  3AOE A;  4W5W A;  2UXC M;  4JI8 M;  3GRY A;  1NVM A;  3J80 S;  4HL4 A;  5BPV A;  3GQ4 A;  3J2P B;  2C99 A;  2L7H A;  2YNM D;  3LMM A;  3KOY E;  2G8L A;  2CE7 A;  4IBC A;  3GPX A;  1GKI A;  1GL6 A;  2H1R A;  4FVM A;  4IBE A;  1G59 A;  3M6A A;  4LGY A;  4MGK E;  1SXJ C;  1WXQ A;  2QCU A;  4Z6Y A;  4G4Q A;  1C1K A;  4YHH M;  4G4R A;  1J5E M;  3VDU A;  5LMN M;  4JI2 M;  2CV0 A;  4AW4 A;  3FD9 A;  2C5R A;  4JN6 A;  2J7O A;  1GL7 A;  4FW9 A;  4LJ4 A;  4DR2 M;  1OFI A;  1ORY B;  4LY6 A;  3TWM A;  1R7R A;  5EP2 A;  2RGH A;  1NHG C;  4B3M M;  4LF9 M;  3GPU A;  1DO2 A;  3GQ3 A;  3AFH A;  1E94 E;  5EXT A;  2F5Q A;  4I5S A;  3JR5 A;  4GHA A;  3FYD A;  3SMS A;  2FE8 A;  5IWA M;  1PM5 A;  2VII A;  1N77 A;  1DGB A;  1HT1 E;  5EQT A;  3GRV A;  4BLC A;  3PNY A;  4DV3 M;  4G4N A;  2X49 A;  1E9R A;  4JXJ A;  1HR0 M;  5EXP A;  3T15 A;  2XGN A;  2F5P A;  4ZPX A;  1H6U A;  2BNK A;  5KQ8 A;  5FLX S;  3A45 A;  4EIW A;  3U6E A;  4LFA M;  5DNY A;  2NQ8 C;  5GKN A;  3PNV A;  2CHV A;  3SAT A;  3HU2 A;  2KRU A;  1XXH B;  3TWK A;  1XMO M;  8CAT A;  3AKZ A;  2X4A A;  4FCW A;  2R45 A;  4GIP A;  2F4V M;  4AG5 A;  4AKH A;  3FUX A;  1IY0 A;  3GRR A;  4FWG A;  4OU7 A;  1IBK M;  3KP0 E;  4DV0 M;  1TGU A;  1SXJ B;  1XC8 A;  4A3V B;  3U6Q A;  3J7A S;  4CHT B;  3QWL A;  1MX0 A;  2OQ4 A;  1UM8 A;  5EXX A;  2RKO A;  4DV5 M;  3DFZ A;  3HJQ A;  1NNJ A;  3HHX A;  2UUA M;  2L7I A;  3MJ5 A;  4II7 A;  2V1C A;  1J09 A;  3WHL A;  4AKG A;  2EO2 A;  4DUY M;  2XZF A;  3HJ8 A;  3KSX A;  4WW0 A;  5FTM A;  1IY2 A;  1FNN A;  4M0W A;  3U60 A;  3RGS A;  1QZM A;  3SHF A;  4PDI A;  5C1B A;  5E26 A;  3U6M A;  3LVW A;  3UGJ A;  1N32 M;  1NNU C;  3JAM S;  1HQY E;  3GO8 A;  4MM3 B;  1IM2 A;  5A2Q S;  3PFI A;  2QBY A;  3FTC A;  4OVZ B;  3U6D A;  2LWX A;  4DR5 M;  3KDS E;  5BR8 M;  4I81 A;  2F5N A;  4D81 A;  3FTE A;  3UK6 A;  4OX9 M;  1Z6T A;  3K92 A;  5FTK A;  4QHS A;  3FUV A;  5ITY A;  4DV4 M;  3A98 B;  3R9X B;  4L78 A;  3GLF B;  3U6S A;  4R7G A;  1GLN A;  4MGY E;  3T1H M;  4LCB A;  2KRK A;  3KW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...