2JY5A

Nmr structure of ubiquilin 1 uba domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Ubiquilin-1
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy5A00
2KNVA 2L4FA 2H5XA 2K9DA 1E94E 3FE3A 2LVAA 3MMPA 1DV0A 2DAEA 1HQYE 1UFZA 2EJSA 1KYIA 2LTUA 2LVOC 2MJ5B 1V92A 1XB2B 3GLIE 2JP7A 3IHPA 4HEOA 1VEKA 2ZTDA 2O25A 2KNAA 1VG5A 2K0BX 1Q02A 2LVPC 1IM2A 1WGLA 1ZMWA 1VEJA 2HWJA 3K9OA 4DBGB 1C7YA 3B89A 2DHYA 1NV8A 1DO2A 1VEGA 2JY8A 3GLHE 3K9PA 2JUJA 2JY7A 2QSFX 2BWBA 1P3QQ 1G41A 2DAGA 3F92A 1A5TA 4Q7JA 2DAMA 1MN3A 1BVSA 2DI0A 2LBCA 2OOBA 1QZEA 2CWBA 1WHCA 2BWEA 2KNZA 1EFUB 1DO0A 2MROB 1HJPA 1G4AE 4R71A 2DZLA 1Y8GA 3H4JA 1WR1B 5DFLA 1ZMUA 4G3OA 4UN2B 2EKKA 2HAKA 4GEWA 1F4IA 1ZMVA 2DAIA 3FRIA 3GLFE 2ZTCA 2G3QA 2QHOB 1TTEA 1G3IA 2B3TA 2WZJA 1T43A 2JNHA 4F1IA 1TR8A 2JZ0A 1AIPC 2LVQD 1WIVA 1HT1E 2EKFA 1WJ7A 2RRUA 3E21A 2QNJA 1PGYA 1ZV1A 2DENA 1IFYA 2DKLA 1HT2E 2LVNC 1JR3E 1OAIA 2MGWA 4WP2A 1VQ1A 2L2DA 2MR9A 2DAKA 1CUKA 1VDLA 3LCVB 3T6PA 3BBZA 1R4GA 3FRHA 1OTRA 1OQYA 2L4EA 2JZ1A 2JY6B 1OKSA 2R0IA 2OO9A 1WGNA 1SG9A 4F2LA 2JY5A 5JI2E 2OOAA 1YLAA 3IECA 1NV9A 3GLGE 3E46A 2CP8A 1T6OA 3LCUA 2KHHA 2DNAA 1GO5A 1XXHE 1IXSA
chains in the Genus database with same CATH superfamily
2J7OA 1HR0M 2L4FA 4WW0A 2Z4SA 3BOSA 2FNAA 3MK6A 2Z4RA 2L7IA 4AKIA 2KEBA 1I94M 2LVAA 3E9SA 5ITTA 1DV0A 1XXHB 3E4RA 1R2YA 5EP4A 1HQYE 2EJSA 4IBBA 1N75A 2JP7A 3FUVA 1IN6A 2J5YA 2L09A 2K6BA 1VEKA 4RF0A 1T3TA 4FCWA 2YFQA 4FCTA 4JI0M 4DV6M 1V33A 2F5OA 1R5LA 2XH9A 1Q02A 4NSOB 2HL7A 3U6QA 3I51A 3GRYA 4RF1A 3HU1A 4LF4M 2DWNA 4OVZB 4QOZC 1H6UA 3DA1A 3TL4X 5DYIA 2QZ4A 1NV8A 2R45A 4QHSA 5EXTA 4A3VB 2V1CA 3J7BA 3MHVC 1XC8A 1P3QQ 2YQZA 4JI6M 2Z3XA 4AI6A 1D0KA 4KODA 3FUXA 4KT0F 2Z8YM 3RFWA 4I5SA 3ZH9B 3A46A 5ITUA 2JA2A 2KNZA 2MROB 4B3MM 1HJPA 2FE8A 2F5SA 2DZLA 1IXZA 2WSCF 1JQJC 3D8BA 3VK7A 3EIEA 4GC9A 8CATA 3AL0C 4LJ8A 4GEWA 4CHTB 3HU3A 1F4IA 1ZMVA 3FRIA 1GABA 4REZA 2ERCA 2QP9X 4Y28F 5EQTA 1LV7A 4XK8F 3FTFA 3CGWA 1GKIA 2G3QA 3FUUA 1FJGM 3W68A 4X64M 2B3TA 2WZJA 2CFOA 4LZZA 3U6PA 3VKGA 1SXJD 1AIPC 2HKJA 4NXNM 4JI4M 2DHRA 1HT1E 4GKJM 1JB0F 3CTWB 4QOSA 3SASA 1WJ7A 2DZOB 2RRUA 1TDZA 1NSFA 3W0FA 1IY2A 4G4RA 2KXEA 1ZV1A 2XSZA 5E26A 2R4EA 2LH0A 2A5YB 2WSFF 2F5QA 2G8LA 3GQ3A 1IFYA 2DKLA 1PJSA 3TE6A 3VLFB 1HT2E 2LVNC 1JR3E 1TF0B 2CV2A 1E32A 1Z5CA 3UGJA 1VQ1A 4L15A 2R4JA 3RGPA 1PJQA 4AKGA 3J2PB 4B08A 4CISA 1ZQ9A 2Y0QA 4FVMA 3SC3A 4PCZA 5C1BA 3U61A 2F5PA 2FH0A 2OPFA 1OQYA 3NBXX 4L4UA 4OW0A 4G4NA 4CIZA 2UUAM 1K3XA 1WGNA 2Y20A 2LWXA 4DR5M 2UU9M 2EA0A 2O5RA 2KDLA 4MGKE 4DV3M 1NY5A 3KW6A 4Z8XA 5JI3E 3U61B 3L25A 1FNNA 2OOAA 2X49A 3GLGE 2CP8A 3LCUA 4LGMA 2QENA 4BBAA 4DR6M 2C98A 1G59A 4LG2A 2E5LM 4P16A 4LJ9A 2KNVA 2C96A 4NXMM 3PVSA 3ZC7B 4IBEA 2H5XA 2XFSA 4M0DA 4MGIE 3FTEA 5E6JA 1E94E 3KOYE 1TDHA 3PXGA 3FE3A 1R2ZA 3T1YM 1XNQM 1UFZA 1QAMA 2LVOC 3HGIA 1MJGM 2APLA 4KLNA 2MJ5B 1PJIA 3GLIE 3B74A 4DR1M 4JI2M 4JYAM 1N34M 2ZTDA 5EP1A 3KXEC 4YY3M 3L27A 2K0BX 1SXJC 3SARA 3HHXA 1G8PA 1EIJA 4FWHA 3B9PA 4GIPA 4ANRA 2ZANA 1OJLA 1TH2A 2LVPC 3IG8A 1WGLA 3KOWE 5KPRA 3SAUA 3FYDA 1XXHA 3C3EA 4NC6A 2HWJA 2XEPA 4DBGB 1C7YA 1NHWC 2DHYA 2EO2A 3LQQA 4IBCA 3B7QA 4LFAM 2RKOA 2XLJA 1NVMA 1QDRA 3GLHE 4AG5A 2JUJA 3FTCA 4XBOA 4IBDA 1QAOA 1G41A 1XMQM 2UUCM 4DV1M 3L2AA 4Q7JA 1OIPA 1YSYA 3THGA 2F5NA 4B7GA 1IY0A 1MN3A 4GH9A 3GLHB 3TQSA 1SXJE 2AHMA 2LBCA 1Q3BA 2C9CA 3U6DA 4AZFA 4OVZA 1QZEA 2CWBA 1TGUA 3OTOM 2QCUA 1G4AE 5ITRA 1Y8GA 3MJ5A 2UXCM 2XZUA 4L78A 3UK6A 1ZMUA 1D2NA 2EKKA 5KQDA 3W67A 2CHVA 1Z5BA 4MGYE 3SHFA 4DR3M 3VKHA 2DAIA 3NBIA 3KS4A 3SYLA 2WSEF 2ZTCA 4OU7A 1OIZA 5EP2A 3KOXE 3Q8GA 1IQPA 3L26A 1T43A 2JNHA 2LXEA 5EXSA 4I81A 3JR5A 3T1HM 2H1RA 2VQEM 5KPZA 1WIVA 3HZJA 4LZJA 3GPUA 4JI3M 3TWMA 1NHGC 2D7GA 4EIWA 4X62M 2YR0A 4MM3B 3T15A 1N32M 4NOOB 2QNJA 1PGYA 1GJTA 3C58A 3HKPA 1HQCA 3K8ZA 1S3SA 4JN6A 2DENA 3R8FA 4NL4H 3PFIA 3M7GA 3CF6E 1IY1A 2NQ8C 3SHGB 4HL4A 4ITQA 3RE8A 4MH0E 2XFTA 4LJ5A 4MGZE 2X4AA 3T6PA 5EP3A 1UM8A 4KO8A 1OTRA 2CUZA 1N78A 4R3DA 4D80A 1L1ZA 4WURA 1QZMA 4W5WA 2CEAA 4LFCM 1N33M 2OO9A 2CRUA 3JR4A 1IN4A 3QAUA 3QYEA 1Q3CA 4FW9A 4LF8M 5FTMA 4AKHA 2HHHM 2R44A 1AUAA 2VQFM 1NV9A 4IIWA 5ITYA 4IBKA 2M60A 5EXPA 3W0LB 1I4WA 1QYRA 4M0WA 4Z6YA 1DGGA 1GO5A 2LHGA 1W5SA 1JR3A 4PD2A 2KRKA 2ZM6M 2OQ4A 2I7NA 2K9DA 3HU2A 4IBFA 2VIIA 2KW0A 2BJWA 2ZAMA 3B7ZA 3MMPA 4FWDA 3U5ZB 3U60A 1KYIA 1N77A 1XHBA 3WHKA 4FD2A 3AKZA 1YE9A 3IHPA 4FCVA 4HEOA 4LF9M 1V34A 1VG5A 3PNVA 4S12A 3U60B 4L16A 3JAMS 4PDIA 4BLCA 1GLNA 3GLGA 3DZDA 2QPAA 1IM2A 1GVNA 2X8AA 1ZMWA 1VEJA 3K9OA 3L28A 2N35A 2KA6B 3B89A 4LJ6A 2CV1A 2UXDM 3LMMA 4OX9M 1PRBA 4R7GA 3AV0A 3GLGB 1MU5A 4B3SM 1GJSA 1IXRC 3K9PA 4L6V6 4NSRA 3SFZA 2JY7A 5LMUM 2R65A 2BWBA 1LTMA 3T38A 2QQ8A 3AOEC 5FTJA 3Q8XA 3F92A 1A5TA 5FSWA 5EJCA 3GLIA 2DZNB 2DAMA 4X66M 1ZAEA 3LW5F 1R7RA 3AJIB 5DYGA 4AQYM 1NNJA 2CHGA 1HNWM 3GRUA 3KP0E 2OOBA 4GKKM 3A42A 2Y21A 3CF2A 5LMNM 1WHCA 3U6MA 4NRVA 1D0MA 3GLIB 4R71A 3H4JA 4JI7M 3HX3A 2V6ZM 1OFIA 3FUWA 2I7PA 2L7HA 4M9XA 3I4VA 4UN2B 4B3TM 1QVRA 2MH8A 2HAKA 1NJFA 1ORYB 3HJ8A 4LY6A 3GLHA 3D8LA 2D7EA 3K1JA 1HNZM 3GLFE 3BXWA 2QHOB 4P17A 3SMPA 1L8QA 1TTEA 5C18A 3QWLA 3B7NA 3I01M 4F1IA 2YNMD 4QNRA 3UJNA 1E9RA 3HJQA 1TR8A 1SXJA 3I4YA 5GKNA 3TPZA 4LJAA 3SMSA 3GLFB 2LVQD 1KFVA 1GL6A 1E9SA 3GQ4A 2EKFA 5EXXA 2KZSA 1VDDA 3E21A 3DOAA 1YUBA 3KVWA 3GO8A 5BPVA 1XNRM 2XSZD 3TWKA 1SXJB 4LCBA 3ZCBB 4B3RM 2RGHA 1OAOC 3TWLA 4AG6A 1JR3D 4ZPXA 3SBJA 5IZ7D 1IBMM 2R62A 1OAIA 1KSFX 2BJVA 2MGWA 1IN8A 2HCBA 2JWSA 2D7HA 2ZBKB 3FKEA 5A2QS 2GQFA 1PJJA 2VF7A 1J7KA 2GNOA 2MR9A 3GRRA 3C3DA 1L2CA 1VDLA 4K0KM 1IXSB 1R4GA 4RNAA 4LRSA 3C9PA 4DV4M 3RGSA 3VK8A 3FRHA 1L1TA 3U6OA 3HHYA 1OKSA 2LHCA 3M0EA 4NRWA 3HWSA 2Q2EB 3GPXA 4DUZM 1SG9A 1TH3A 4F2LA 4LFBM 2KZUA 5JI2E 1EE8A 2J7NA 1YLAA 3U6EA 4G4OA 2F4VM 2JXNA 3KSXA 3J81S 1TH4A 5FTNA 5BR8M 2DNAA 4DR2M 4LJ4A 3V76A 4DV5M 4GRIA 5KO3A 1K82A 3I04M 3FYCA 1K3WA 1PJTA 4LF7M 1Q39A 2DVWB 3VDUA 4DV7M 1XMOM 2CV0A 4LF5M 2UXBM 3PNYA 4L8RC 2DAEA 5IWAM 2LTUA 5IT9S 5F3WA 3M6AA 1V92A 4HLQA 1XB2B 3ILKA 3NWLA 3J27B 2O25A 2KNAA 1J09A 2XF3A 2P5TA 2W82A 3UZUA 2C99A 2VF8A 4DV0M 3A45A 1QANA 3KP1E 3U6LA 4CGYB 3AOGA 3QYBA 1IBLM 1Z59A 2VDBB 4FWGA 4IBIA 3U5ZA 3H4MA 3LVVA 4G6ZA 5ITXA 2G5GX 3SAVA 1QAQA 5ITXE 1DO2A 1N36M 1VEGA 4B7HA 2JY8A 1PM5A 4I8OA 1DGBA 2Y0TA 3WHLA 4II7A 4GHAA 2QSFX 4KHPM 3VFDA 5L8RF 4G4QA 3UMMA 4IJEA 2FFJA 4M9SA 4JI1M 4JI8M 1NNUC 2DAGA 4GMQA 2DWZB 1BVSA 2DI0A 2R46A 2DXIA 3GQ5A 3EIHA 5KPTA 2K47A 3U6CA 4DR4M 4JV5M 3HY5A 3CF0A 7CATA 2BWEA 1NY6A 5IREB 1DO0A 1EFUB 1J5EM 1QUTA 1DGHA 4JXJA 5DNYA 3GP1A 2DWLA 3J80S 1WR1B 4GHLA 1L2BA 5DFLA 2KRUA 1IN5A 3LVWA 4G3OA 3GRVA 1WXQA 2EUCA 2DWMA 5FTLA 1Z6TA 3KFUG 1DGHB 2BNKA 3DFZA 1GL7A 1RU3A 1QQWA 4M9ZA 2V1UA 3SATA 3GPYA 2XGNA 4LF6M 1OFHA 3GPPA 2CE7A 2Z7JA 2CHQA 1G3IA 4IBJA 3R9XB 1IBKM 3A98B 2JZ0A 3L29A 4DUYM 5H37D 4YHHM 1L2DA 5ITQA 3FD9A 1DGFA 2C9OA 2UUBM 3J7AS 4I4LA 3KS8A 1Z5AA 3SYKA 2C5RA 2QBYA 1NJGA 2L6OA 3KDSE 4LRTA 3ZQJA 4AW4A 4MGHA 1R6BX 4GITA 4CJ6A 1D0LA 3AFHA 4WP2A 4D81A 2QBYB 5KQ8A 2RGOA 3AOEA 2L2DA 3GLFA 2DAKA 3HJSA 3HHWA 1CUKA 3K2LA 4PT5A 2XZFA 3LCVB 4JI5M 3K92A 3BBZA 4IBGA 1QUSA 1MX0A 1X37A 4QNMA 4B7FA 3HHZA 1XWIA 2L4EA 1QDTA 2JZ1A 2JY6B 2LNHC 4IJFA 3KSJA 1G71A 1W5TA 3LQRA 3FUTA 2R0IA 4LJ7A 2FOIC 2ZAOA 4X65M 5FLXS 2O01F 4RKUF 3KOZE 4DV2M 1IN7A 4MB7A 2JY5A 3FTDA 2M5ZA 3IECA 4XGIA 1NO1A 4GC5A 4QHTA 4DR7M 1HNXM 2R18A 3E46A 1T6OA 4PDGA 2KHHA 4LGYA 2FS1A 5FTKA 4TUWA 3SAWA 3IG5A 3U6SA 4BB9A 1C1KA 4D82A 2R6FA 1XXHE 3VDPA 1IXSA
chains in the Genus database with same CATH topology
2KNVA 2L4FA 2H5XA 2K9DA 1E94E 3FE3A 2LVAA 3MMPA 1DV0A 2DAEA 1HQYE 1UFZA 2EJSA 1KYIA 2LTUA 2LVOC 2MJ5B 1V92A 1XB2B 3GLIE 2JP7A 3IHPA 4HEOA 1VEKA 2ZTDA 2O25A 2KNAA 1VG5A 2K0BX 1Q02A 2LVPC 1IM2A 1WGLA 1ZMWA 1VEJA 2HWJA 3K9OA 4DBGB 1C7YA 3B89A 2DHYA 1NV8A 1DO2A 1VEGA 2JY8A 3GLHE 3K9PA 2JUJA 2JY7A 2QSFX 2BWBA 1P3QQ 1G41A 2DAGA 3F92A 1A5TA 4Q7JA 2DAMA 1MN3A 1BVSA 2DI0A 2LBCA 2OOBA 1QZEA 2CWBA 1WHCA 2BWEA 2KNZA 1EFUB 1DO0A 2MROB 1HJPA 1G4AE 4R71A 2DZLA 1Y8GA 3H4JA 1WR1B 5DFLA 1ZMUA 4G3OA 4UN2B 2EKKA 2HAKA 4GEWA 1F4IA 1ZMVA 2DAIA 3FRIA 3GLFE 2ZTCA 2G3QA 2QHOB 1TTEA 1G3IA 2B3TA 2WZJA 1T43A 2JNHA 4F1IA 1TR8A 2JZ0A 1AIPC 2LVQD 1WIVA 1HT1E 2EKFA 1WJ7A 2RRUA 3E21A 2QNJA 1PGYA 1ZV1A 2DENA 1IFYA 2DKLA 1HT2E 2LVNC 1JR3E 1OAIA 2MGWA 4WP2A 1VQ1A 2L2DA 2MR9A 2DAKA 1CUKA 1VDLA 3LCVB 3T6PA 3BBZA 1R4GA 3FRHA 1OTRA 1OQYA 2L4EA 2JZ1A 2JY6B 1OKSA 2R0IA 2OO9A 1WGNA 1SG9A 4F2LA 2JY5A 5JI2E 2OOAA 1YLAA 3IECA 1NV9A 3GLGE 3E46A 2CP8A 1T6OA 3LCUA 2KHHA 2DNAA 1GO5A 1XXHE 1IXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNV A;  2L4F A;  2H5X A;  2K9D A;  1E94 E;  3FE3 A;  2LVA A;  3MMP A;  1DV0 A;  2DAE A;  1HQY E;  1UFZ A;  2EJS A;  1KYI A;  2LTU A;  2LVO C;  2MJ5 B;  1V92 A;  1XB2 B;  3GLI E;  2JP7 A;  3IHP A;  4HEO A;  1VEK A;  2ZTD A;  2O25 A;  2KNA A;  1VG5 A;  2K0B X;  1Q02 A;  2LVP C;  1IM2 A;  1WGL A;  1ZMW A;  1VEJ A;  2HWJ A;  3K9O A;  4DBG B;  1C7Y A;  3B89 A;  2DHY A;  1NV8 A;  1DO2 A;  1VEG A;  2JY8 A;  3GLH E;  3K9P A;  2JUJ A;  2JY7 A;  2QSF X;  2BWB A;  1P3Q Q;  1G41 A;  2DAG A;  3F92 A;  1A5T A;  4Q7J A;  2DAM A;  1MN3 A;  1BVS A;  2DI0 A;  2LBC A;  2OOB A;  1QZE A;  2CWB A;  1WHC A;  2BWE A;  2KNZ A;  1EFU B;  1DO0 A;  2MRO B;  1HJP A;  1G4A E;  4R71 A;  2DZL A;  1Y8G A;  3H4J A;  1WR1 B;  5DFL A;  1ZMU A;  4G3O A;  4UN2 B;  2EKK A;  2HAK A;  4GEW A;  1F4I A;  1ZMV A;  2DAI A;  3FRI A;  3GLF E;  2ZTC A;  2G3Q A;  2QHO B;  1TTE A;  1G3I A;  2B3T A;  2WZJ A;  1T43 A;  2JNH A;  4F1I A;  1TR8 A;  2JZ0 A;  1AIP C;  2LVQ D;  1WIV A;  1HT1 E;  2EKF A;  1WJ7 A;  2RRU A;  3E21 A;  2QNJ A;  1PGY A;  1ZV1 A;  2DEN A;  1IFY A;  2DKL A;  1HT2 E;  2LVN C;  1JR3 E;  1OAI A;  2MGW A;  4WP2 A;  1VQ1 A;  2L2D A;  2MR9 A;  2DAK A;  1CUK A;  1VDL A;  3LCV B;  3T6P A;  3BBZ A;  1R4G A;  3FRH A;  1OTR A;  1OQY A;  2L4E A;  2JZ1 A;  2JY6 B;  1OKS A;  2R0I A;  2OO9 A;  1WGN A;  1SG9 A;  4F2L A;  2JY5 A;  5JI2 E;  2OOA A;  1YLA A;  3IEC A;  1NV9 A;  3GLG E;  3E46 A;  2CP8 A;  1T6O A;  3LCU A;  2KHH A;  2DNA A;  1GO5 A;  1XXH E;  1IXS A; 
#chains in the Genus database with same CATH topology
 2J7O A;  1HR0 M;  2L4F A;  4WW0 A;  2Z4S A;  3BOS A;  2FNA A;  3MK6 A;  2Z4R A;  2L7I A;  4AKI A;  2KEB A;  1I94 M;  2LVA A;  3E9S A;  5ITT A;  1DV0 A;  1XXH B;  3E4R A;  1R2Y A;  5EP4 A;  1HQY E;  2EJS A;  4IBB A;  1N75 A;  2JP7 A;  3FUV A;  1IN6 A;  2J5Y A;  2L09 A;  2K6B A;  1VEK A;  4RF0 A;  1T3T A;  4FCW A;  2YFQ A;  4FCT A;  4JI0 M;  4DV6 M;  1V33 A;  2F5O A;  1R5L A;  2XH9 A;  1Q02 A;  4NSO B;  2HL7 A;  3U6Q A;  3I51 A;  3GRY A;  4RF1 A;  3HU1 A;  4LF4 M;  2DWN A;  4OVZ B;  4QOZ C;  1H6U A;  3DA1 A;  3TL4 X;  5DYI A;  2QZ4 A;  1NV8 A;  2R45 A;  4QHS A;  5EXT A;  4A3V B;  2V1C A;  3J7B A;  3MHV C;  1XC8 A;  1P3Q Q;  2YQZ A;  4JI6 M;  2Z3X A;  4AI6 A;  1D0K A;  4KOD A;  3FUX A;  4KT0 F;  2Z8Y M;  3RFW A;  4I5S A;  3ZH9 B;  3A46 A;  5ITU A;  2JA2 A;  2KNZ A;  2MRO B;  4B3M M;  1HJP A;  2FE8 A;  2F5S A;  2DZL A;  1IXZ A;  2WSC F;  1JQJ C;  3D8B A;  3VK7 A;  3EIE A;  4GC9 A;  8CAT A;  3AL0 C;  4LJ8 A;  4GEW A;  4CHT B;  3HU3 A;  1F4I A;  1ZMV A;  3FRI A;  1GAB A;  4REZ A;  2ERC A;  2QP9 X;  4Y28 F;  5EQT A;  1LV7 A;  4XK8 F;  3FTF A;  3CGW A;  1GKI A;  2G3Q A;  3FUU A;  1FJG M;  3W68 A;  4X64 M;  2B3T A;  2WZJ A;  2CFO A;  4LZZ A;  3U6P A;  3VKG A;  1SXJ D;  1AIP C;  2HKJ A;  4NXN M;  4JI4 M;  2DHR A;  1HT1 E;  4GKJ M;  1JB0 F;  3CTW B;  4QOS A;  3SAS A;  1WJ7 A;  2DZO B;  2RRU A;  1TDZ A;  1NSF A;  3W0F A;  1IY2 A;  4G4R A;  2KXE A;  1ZV1 A;  2XSZ A;  5E26 A;  2R4E A;  2LH0 A;  2A5Y B;  2WSF F;  2F5Q A;  2G8L A;  3GQ3 A;  1IFY A;  2DKL A;  1PJS A;  3TE6 A;  3VLF B;  1HT2 E;  2LVN C;  1JR3 E;  1TF0 B;  2CV2 A;  1E32 A;  1Z5C A;  3UGJ A;  1VQ1 A;  4L15 A;  2R4J A;  3RGP A;  1PJQ A;  4AKG A;  3J2P B;  4B08 A;  4CIS A;  1ZQ9 A;  2Y0Q A;  4FVM A;  3SC3 A;  4PCZ A;  5C1B A;  3U61 A;  2F5P A;  2FH0 A;  2OPF A;  1OQY A;  3NBX X;  4L4U A;  4OW0 A;  4G4N A;  4CIZ A;  2UUA M;  1K3X A;  1WGN A;  2Y20 A;  2LWX A;  4DR5 M;  2UU9 M;  2EA0 A;  2O5R A;  2KDL A;  4MGK E;  4DV3 M;  1NY5 A;  3KW6 A;  4Z8X A;  5JI3 E;  3U61 B;  3L25 A;  1FNN A;  2OOA A;  2X49 A;  3GLG E;  2CP8 A;  3LCU A;  4LGM A;  2QEN A;  4BBA A;  4DR6 M;  2C98 A;  1G59 A;  4LG2 A;  2E5L M;  4P16 A;  4LJ9 A;  2KNV A;  2C96 A;  4NXM M;  3PVS A;  3ZC7 B;  4IBE A;  2H5X A;  2XFS A;  4M0D A;  4MGI E;  3FTE A;  5E6J A;  1E94 E;  3KOY E;  1TDH A;  3PXG A;  3FE3 A;  1R2Z A;  3T1Y M;  1XNQ M;  1UFZ A;  1QAM A;  2LVO C;  3HGI A;  1MJG M;  2APL A;  4KLN A;  2MJ5 B;  1PJI A;  3GLI E;  3B74 A;  4DR1 M;  4JI2 M;  4JYA M;  1N34 M;  2ZTD A;  5EP1 A;  3KXE C;  4YY3 M;  3L27 A;  2K0B X;  1SXJ C;  3SAR A;  3HHX A;  1G8P A;  1EIJ A;  4FWH A;  3B9P A;  4GIP A;  4ANR A;  2ZAN A;  1OJL A;  1TH2 A;  2LVP C;  3IG8 A;  1WGL A;  3KOW E;  5KPR A;  3SAU A;  3FYD A;  1XXH A;  3C3E A;  4NC6 A;  2HWJ A;  2XEP A;  4DBG B;  1C7Y A;  1NHW C;  2DHY A;  2EO2 A;  3LQQ A;  4IBC A;  3B7Q A;  4LFA M;  2RKO A;  2XLJ A;  1NVM A;  1QDR A;  3GLH E;  4AG5 A;  2JUJ A;  3FTC A;  4XBO A;  4IBD A;  1QAO A;  1G41 A;  1XMQ M;  2UUC M;  4DV1 M;  3L2A A;  4Q7J A;  1OIP A;  1YSY A;  3THG A;  2F5N A;  4B7G A;  1IY0 A;  1MN3 A;  4GH9 A;  3GLH B;  3TQS A;  1SXJ E;  2AHM A;  2LBC A;  1Q3B A;  2C9C A;  3U6D A;  4AZF A;  4OVZ A;  1QZE A;  2CWB A;  1TGU A;  3OTO M;  2QCU A;  1G4A E;  5ITR A;  1Y8G A;  3MJ5 A;  2UXC M;  2XZU A;  4L78 A;  3UK6 A;  1ZMU A;  1D2N A;  2EKK A;  5KQD A;  3W67 A;  2CHV A;  1Z5B A;  4MGY E;  3SHF A;  4DR3 M;  3VKH A;  2DAI A;  3NBI A;  3KS4 A;  3SYL A;  2WSE F;  2ZTC A;  4OU7 A;  1OIZ A;  5EP2 A;  3KOX E;  3Q8G A;  1IQP A;  3L26 A;  1T43 A;  2JNH A;  2LXE A;  5EXS A;  4I81 A;  3JR5 A;  3T1H M;  2H1R A;  2VQE M;  5KPZ A;  1WIV A;  3HZJ A;  4LZJ A;  3GPU A;  4JI3 M;  3TWM A;  1NHG C;  2D7G A;  4EIW A;  4X62 M;  2YR0 A;  4MM3 B;  3T15 A;  1N32 M;  4NOO B;  2QNJ A;  1PGY A;  1GJT A;  3C58 A;  3HKP A;  1HQC A;  3K8Z A;  1S3S A;  4JN6 A;  2DEN A;  3R8F A;  4NL4 H;  3PFI A;  3M7G A;  3CF6 E;  1IY1 A;  2NQ8 C;  3SHG B;  4HL4 A;  4ITQ A;  3RE8 A;  4MH0 E;  2XFT A;  4LJ5 A;  4MGZ E;  2X4A A;  3T6P A;  5EP3 A;  1UM8 A;  4KO8 A;  1OTR A;  2CUZ A;  1N78 A;  4R3D A;  4D80 A;  1L1Z A;  4WUR A;  1QZM A;  4W5W A;  2CEA A;  4LFC M;  1N33 M;  2OO9 A;  2CRU A;  3JR4 A;  1IN4 A;  3QAU A;  3QYE A;  1Q3C A;  4FW9 A;  4LF8 M;  5FTM A;  4AKH A;  2HHH M;  2R44 A;  1AUA A;  2VQF M;  1NV9 A;  4IIW A;  5ITY A;  4IBK A;  2M60 A;  5EXP A;  3W0L B;  1I4W A;  1QYR A;  4M0W A;  4Z6Y A;  1DGG A;  1GO5 A;  2LHG A;  1W5S A;  1JR3 A;  4PD2 A;  2KRK A;  2ZM6 M;  2OQ4 A;  2I7N A;  2K9D A;  3HU2 A;  4IBF A;  2VII A;  2KW0 A;  2BJW A;  2ZAM A;  3B7Z A;  3MMP A;  4FWD A;  3U5Z B;  3U60 A;  1KYI A;  1N77 A;  1XHB A;  3WHK A;  4FD2 A;  3AKZ A;  1YE9 A;  3IHP A;  4FCV A;  4HEO A;  4LF9 M;  1V34 A;  1VG5 A;  3PNV A;  4S12 A;  3U60 B;  4L16 A;  3JAM S;  4PDI A;  4BLC A;  1GLN A;  3GLG A;  3DZD A;  2QPA A;  1IM2 A;  1GVN A;  2X8A A;  1ZMW A;  1VEJ A;  3K9O A;  3L28 A;  2N35 A;  2KA6 B;  3B89 A;  4LJ6 A;  2CV1 A;  2UXD M;  3LMM A;  4OX9 M;  1PRB A;  4R7G A;  3AV0 A;  3GLG B;  1MU5 A;  4B3S M;  1GJS A;  1IXR C;  3K9P A;  4L6V 6;  4NSR A;  3SFZ A;  2JY7 A;  5LMU M;  2R65 A;  2BWB A;  1LTM A;  3T38 A;  2QQ8 A;  3AOE C;  5FTJ A;  3Q8X A;  3F92 A;  1A5T A;  5FSW A;  5EJC A;  3GLI A;  2DZN B;  2DAM A;  4X66 M;  1ZAE A;  3LW5 F;  1R7R A;  3AJI B;  5DYG A;  4AQY M;  1NNJ A;  2CHG A;  1HNW M;  3GRU A;  3KP0 E;  2OOB A;  4GKK M;  3A42 A;  2Y21 A;  3CF2 A;  5LMN M;  1WHC A;  3U6M A;  4NRV A;  1D0M A;  3GLI B;  4R71 A;  3H4J A;  4JI7 M;  3HX3 A;  2V6Z M;  1OFI A;  3FUW A;  2I7P A;  2L7H A;  4M9X A;  3I4V A;  4UN2 B;  4B3T M;  1QVR A;  2MH8 A;  2HAK A;  1NJF A;  1ORY B;  3HJ8 A;  4LY6 A;  3GLH A;  3D8L A;  2D7E A;  3K1J A;  1HNZ M;  3GLF E;  3BXW A;  2QHO B;  4P17 A;  3SMP A;  1L8Q A;  1TTE A;  5C18 A;  3QWL A;  3B7N A;  3I01 M;  4F1I A;  2YNM D;  4QNR A;  3UJN A;  1E9R A;  3HJQ A;  1TR8 A;  1SXJ A;  3I4Y A;  5GKN A;  3TPZ A;  4LJA A;  3SMS A;  3GLF B;  2LVQ D;  1KFV A;  1GL6 A;  1E9S A;  3GQ4 A;  2EKF A;  5EXX A;  2KZS A;  1VDD A;  3E21 A;  3DOA A;  1YUB A;  3KVW A;  3GO8 A;  5BPV A;  1XNR M;  2XSZ D;  3TWK A;  1SXJ B;  4LCB A;  3ZCB B;  4B3R M;  2RGH A;  1OAO C;  3TWL A;  4AG6 A;  1JR3 D;  4ZPX A;  3SBJ A;  5IZ7 D;  1IBM M;  2R62 A;  1OAI A;  1KSF X;  2BJV A;  2MGW A;  1IN8 A;  2HCB A;  2JWS A;  2D7H A;  2ZBK B;  3FKE A;  5A2Q S;  2GQF A;  1PJJ A;  2VF7 A;  1J7K A;  2GNO A;  2MR9 A;  3GRR A;  3C3D A;  1L2C A;  1VDL A;  4K0K M;  1IXS B;  1R4G A;  4RNA A;  4LRS A;  3C9P A;  4DV4 M;  3RGS A;  3VK8 A;  3FRH A;  1L1T A;  3U6O A;  3HHY A;  1OKS A;  2LHC A;  3M0E A;  4NRW A;  3HWS A;  2Q2E B;  3GPX A;  4DUZ M;  1SG9 A;  1TH3 A;  4F2L A;  4LFB M;  2KZU A;  5JI2 E;  1EE8 A;  2J7N A;  1YLA A;  3U6E A;  4G4O A;  2F4V M;  2JXN A;  3KSX A;  3J81 S;  1TH4 A;  5FTN A;  5BR8 M;  2DNA A;  4DR2 M;  4LJ4 A;  3V76 A;  4DV5 M;  4GRI A;  5KO3 A;  1K82 A;  3I04 M;  3FYC A;  1K3W A;  1PJT A;  4LF7 M;  1Q39 A;  2DVW B;  3VDU A;  4DV7 M;  1XMO M;  2CV0 A;  4LF5 M;  2UXB M;  3PNY A;  4L8R C;  2DAE A;  5IWA M;  2LTU A;  5IT9 S;  5F3W A;  3M6A A;  1V92 A;  4HLQ A;  1XB2 B;  3ILK A;  3NWL A;  3J27 B;  2O25 A;  2KNA A;  1J09 A;  2XF3 A;  2P5T A;  2W82 A;  3UZU A;  2C99 A;  2VF8 A;  4DV0 M;  3A45 A;  1QAN A;  3KP1 E;  3U6L A;  4CGY B;  3AOG A;  3QYB A;  1IBL M;  1Z59 A;  2VDB B;  4FWG A;  4IBI A;  3U5Z A;  3H4M A;  3LVV A;  4G6Z A;  5ITX A;  2G5G X;  3SAV A;  1QAQ A;  5ITX E;  1DO2 A;  1N36 M;  1VEG A;  4B7H A;  2JY8 A;  1PM5 A;  4I8O A;  1DGB A;  2Y0T A;  3WHL A;  4II7 A;  4GHA A;  2QSF X;  4KHP M;  3VFD A;  5L8R F;  4G4Q A;  3UMM A;  4IJE A;  2FFJ A;  4M9S A;  4JI1 M;  4JI8 M;  1NNU C;  2DAG A;  4GMQ A;  2DWZ B;  1BVS A;  2DI0 A;  2R46 A;  2DXI A;  3GQ5 A;  3EIH A;  5KPT A;  2K47 A;  3U6C A;  4DR4 M;  4JV5 M;  3HY5 A;  3CF0 A;  7CAT A;  2BWE A;  1NY6 A;  5IRE B;  1DO0 A;  1EFU B;  1J5E M;  1QUT A;  1DGH A;  4JXJ A;  5DNY A;  3GP1 A;  2DWL A;  3J80 S;  1WR1 B;  4GHL A;  1L2B A;  5DFL A;  2KRU A;  1IN5 A;  3LVW A;  4G3O A;  3GRV A;  1WXQ A;  2EUC A;  2DWM A;  5FTL A;  1Z6T A;  3KFU G;  1DGH B;  2BNK A;  3DFZ A;  1GL7 A;  1RU3 A;  1QQW A;  4M9Z A;  2V1U A;  3SAT A;  3GPY A;  2XGN A;  4LF6 M;  1OFH A;  3GPP A;  2CE7 A;  2Z7J A;  2CHQ A;  1G3I A;  4IBJ A;  3R9X B;  1IBK M;  3A98 B;  2JZ0 A;  3L29 A;  4DUY M;  5H37 D;  4YHH M;  1L2D A;  5ITQ A;  3FD9 A;  1DGF A;  2C9O A;  2UUB M;  3J7A S;  4I4L A;  3KS8 A;  1Z5A A;  3SYK A;  2C5R A;  2QBY A;  1NJG A;  2L6O A;  3KDS E;  4LRT A;  3ZQJ A;  4AW4 A;  4MGH A;  1R6B X;  4GIT A;  4CJ6 A;  1D0L A;  3AFH A;  4WP2 A;  4D81 A;  2QBY B;  5KQ8 A;  2RGO A;  3AOE A;  2L2D A;  3GLF A;  2DAK A;  3HJS A;  3HHW A;  1CUK A;  3K2L A;  4PT5 A;  2XZF A;  3LCV B;  4JI5 M;  3K92 A;  3BBZ A;  4IBG A;  1QUS A;  1MX0 A;  1X37 A;  4QNM A;  4B7F A;  3HHZ A;  1XWI A;  2L4E A;  1QDT A;  2JZ1 A;  2JY6 B;  2LNH C;  4IJF A;  3KSJ A;  1G71 A;  1W5T A;  3LQR A;  3FUT A;  2R0I A;  4LJ7 A;  2FOI C;  2ZAO A;  4X65 M;  5FLX S;  2O01 F;  4RKU F;  3KOZ E;  4DV2 M;  1IN7 A;  4MB7 A;  2JY5 A;  3FTD A;  2M5Z A;  3IEC A;  4XGI A;  1NO1 A;  4GC5 A;  4QHT A;  4DR7 M;  1HNX M;  2R18 A;  3E46 A;  1T6O A;  4PDG A;  2KHH A;  4LGY A;  2FS1 A;  5FTK A;  4TUW A;  3SAW A;  3IG5 A;  3U6S A;  4BB9 A;  1C1K A;  4D82 A;  2R6F A;  1XXH E;  3VDP A;  1IXS A; 
#chains in the Genus database with same CATH homology
 2KNV A;  2L4F A;  2H5X A;  2K9D A;  1E94 E;  3FE3 A;  2LVA A;  3MMP A;  1DV0 A;  2DAE A;  1HQY E;  1UFZ A;  2EJS A;  1KYI A;  2LTU A;  2LVO C;  2MJ5 B;  1V92 A;  1XB2 B;  3GLI E;  2JP7 A;  3IHP A;  4HEO A;  1VEK A;  2ZTD A;  2O25 A;  2KNA A;  1VG5 A;  2K0B X;  1Q02 A;  2LVP C;  1IM2 A;  1WGL A;  1ZMW A;  1VEJ A;  2HWJ A;  3K9O A;  4DBG B;  1C7Y A;  3B89 A;  2DHY A;  1NV8 A;  1DO2 A;  1VEG A;  2JY8 A;  3GLH E;  3K9P A;  2JUJ A;  2JY7 A;  2QSF X;  2BWB A;  1P3Q Q;  1G41 A;  2DAG A;  3F92 A;  1A5T A;  4Q7J A;  2DAM A;  1MN3 A;  1BVS A;  2DI0 A;  2LBC A;  2OOB A;  1QZE A;  2CWB A;  1WHC A;  2BWE A;  2KNZ A;  1EFU B;  1DO0 A;  2MRO B;  1HJP A;  1G4A E;  4R71 A;  2DZL A;  1Y8G A;  3H4J A;  1WR1 B;  5DFL A;  1ZMU A;  4G3O A;  4UN2 B;  2EKK A;  2HAK A;  4GEW A;  1F4I A;  1ZMV A;  2DAI A;  3FRI A;  3GLF E;  2ZTC A;  2G3Q A;  2QHO B;  1TTE A;  1G3I A;  2B3T A;  2WZJ A;  1T43 A;  2JNH A;  4F1I A;  1TR8 A;  2JZ0 A;  1AIP C;  2LVQ D;  1WIV A;  1HT1 E;  2EKF A;  1WJ7 A;  2RRU A;  3E21 A;  2QNJ A;  1PGY A;  1ZV1 A;  2DEN A;  1IFY A;  2DKL A;  1HT2 E;  2LVN C;  1JR3 E;  1OAI A;  2MGW A;  4WP2 A;  1VQ1 A;  2L2D A;  2MR9 A;  2DAK A;  1CUK A;  1VDL A;  3LCV B;  3T6P A;  3BBZ A;  1R4G A;  3FRH A;  1OTR A;  1OQY A;  2L4E A;  2JZ1 A;  2JY6 B;  1OKS A;  2R0I A;  2OO9 A;  1WGN A;  1SG9 A;  4F2L A;  2JY5 A;  5JI2 E;  2OOA A;  1YLA A;  3IEC A;  1NV9 A;  3GLG E;  3E46 A;  2CP8 A;  1T6O A;  3LCU A;  2KHH A;  2DNA A;  1GO5 A;  1XXH E;  1IXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...