2JY5A

Nmr structure of ubiquilin 1 uba domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquilin-1
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy5A00
4DBGB 2DNAA 3GLHE 3E46A 1ZMVA 2DKLA 3H4JA 3K9OA 3K9PA 1WGLA 2LVAA 1A5TA 3GLGE 1OKSA 1YLAA 1T6OA 2MR9A 2B3TA 1HT1E 1SG9A 2EKFA 3FRHA 3GLFE 4WP2A 1JR3E 4HEOA 2L4FA 1VQ1A 2O25A 5DFLA 1DO2A 3T6PA 2JNHA 2JY6B 1WJ7A 1F4IA 1KYIA 1G3IA 2ZTDA 2DAIA 1QZEA 1Q02A 2BWEA 2ZTCA 3FRIA 2LBCA 2LVNC 1DO0A 2JUJA 3B89A 1TTEA 1XXHE 2MJ5B 1V92A 3IHPA 1Y8GA 1MN3A 1OQYA 2DAGA 2LVQD 2K9DA 1IFYA 2WZJA 1HT2E 2K0BX 4R71A 1T43A 1C7YA 1OTRA 1E94E 2OOAA 2HWJA 3F92A 2LVPC 2DENA 3MMPA 2L2DA 1VEGA 2HAKA 1IXSA 2DI0A 3LCVB 2JY8A 1OAIA 4F1IA 1UFZA 2CWBA 2KNZA 2BWBA 2MROB 2L4EA 2QHOB 2JY7A 2G3QA 1ZMUA 1BVSA 2KNAA 2OOBA 3E21A 1IM2A 1VEJA 1VDLA 1TR8A 3GLIE 2DZLA 2R0IA 1WHCA 2MGWA 3FE3A 4Q7JA 2JZ1A 2LTUA 4F2LA 1DV0A 1G41A 2DHYA 1GO5A 3BBZA 2H5XA 2OO9A 1VG5A 4G3OA 1HJPA 1WR1B 1ZMWA 1XB2B 2RRUA 2KNVA 1PGYA 1ZV1A 5JI2E 2QNJA 1CUKA 1NV9A 1AIPC 1EFUB 1WIVA 1NV8A 3IECA 2EKKA 1HQYE 1P3QQ 2JP7A 1G4AE 3LCUA 2DAMA 2JZ0A 1R4GA 2QSFX 2DAKA 2JY5A 4GEWA 2LVOC 1WGNA 2DAEA 2EJSA 2KHHA 1VEKA 4UN2B 2CP8A
chains in the Genus database with same CATH superfamily
4DBGB 4YHHM 2WSFF 3U61B 1N77A 2DKLA 2L09A 1K3WA 4GKJM 3K9PA 3R9XB 1TH3A 1IN6A 4QHSA 2EA0A 2XZUA 3AV0A 4FVMA 3L29A 1OKSA 5EXPA 3GRUA 4Z8XA 3HY5A 3AOEA 1FNNA 3VK7A 5FTJA 1MU5A 1DGHA 1HT1E 1SG9A 3SARA 2EKFA 3GLFE 4WP2A 1E9RA 1QAMA 4XBOA 1HR0M 2DWZB 3FUXA 1K3XA 3A46A 2FS1A 2O25A 4IJFA 5DFLA 3KS8A 3T6PA 4KHPM 3GQ3A 2JA2A 2LHGA 3GRVA 2CV2A 2ZTDA 2UUBM 1QZEA 1IN7A 1Q02A 1L8QA 4KLNA 2DWLA 2VF8A 2OPFA 3WHKA 2LVNC 2UUAM 2D7GA 3FKEA 3DFZA 3A45A 1TTEA 5LMUM 1QAQA 1NJFA 3LMMA 2GNOA 4EIWA 1L2BA 2DZNB 1VDDA 3QWLA 2R65A 2R4EA 2WZJA 4DV6M 4PCZA 1GKIA 1GL6A 2D7EA 4BLCA 2KZSA 4DV5M 3U61A 1C7YA 5DYIA 1IY2A 3UJNA 2LVPC 1GLNA 2DENA 4REZA 5A2QS 1VEGA 2HAKA 3CF6E 2DI0A 2M60A 4IBIA 3LCVB 3GRYA 2CFOA 2J5YA 2ZANA 2CHGA 4ANRA 3PFIA 2ZBKB 1TDZA 2BWBA 2XF3A 1L1ZA 3K1JA 2K47A 4LJ6A 4M0WA 3J27B 4OVZA 1TDHA 1ZMUA 4DV2M 4PDGA 1PJJA 2KXEA 1VEJA 3D8BA 1WXQA 2KRKA 3MK6A 2DZLA 1E9SA 3ZC7B 4JI2M 3FE3A 2LH0A 3TWLA 4X64M 2LTUA 4F2LA 3FTEA 1QQWA 3AKZA 3VDPA 1ZQ9A 4S12A 4FCVA 3HX3A 4LJ5A 4A3VB 4RF0A 4D80A 4QNRA 1ZMWA 3SAWA 1XB2B 2RGHA 3Q8XA 3L26A 2P5TA 1OIPA 4FWGA 1PGYA 3SHGB 2R6FA 3T15A 1H6UA 2J7NA 3GPUA 1AIPC 4II7A 4FD2A 5FSWA 2BJVA 3GLFB 3FYDA 3KSXA 1OFHA 3KS4A 3L27A 3MHVC 3U5ZB 2JP7A 3KOWE 1Z59A 3GLGA 1HNWM 4CHTB 4B3SM 1HNZM 4CIZA 4I5SA 1R4GA 1V33A 4RF1A 1FJGM 3KW6A 3J81S 3C9PA 3Q8GA 2JY5A 4DV4M 2UUCM 4AW4A 1NO1A 5KPTA 2UXCM 1J7KA 2L6OA 2UXDM 5FTNA 2R46A 3SASA 4DR7M 2Z8YM 3F92A 4AI6A 4UN2B 2CP8A 3WHLA 4WURA 1DGHB 4NL4H 1OJLA 2DNAA 1W5TA 1IXRC 1TH2A 4QNMA 2Y21A 2ZAOA 3HHYA 4PD2A 1PJSA 4G4OA 1E32A 1JB0F 3H4JA 4MGZE 1N75A 4DV7M 2UXBM 4FCWA 1A5TA 3U6OA 2C9OA 2XLJA 3GLGE 1K82A 2AHMA 1DGFA 2DHRA 2NQ8C 2J7OA 3FUTA 4ZPXA 4X62M 1IY1A 1YLAA 2O01F 3KSJA 2F5SA 2I7PA 1Z5BA 1AUAA 3TL4X 3FRHA 4IBDA 4DR6M 2KA6B 3IG8A 3FUVA 3KOXE 4HEOA 2ERCA 4Y28F 2L4FA 1J09A 2GQFA 1VQ1A 2D7HA 3UK6A 4DR1M 4JYAM 4JI7M 1DGGA 1F4IA 1G3IA 3HWSA 2DAIA 1D2NA 1QUTA 4QHTA 3J80S 3UMMA 1GJTA 3FYCA 1XC8A 4PDIA 3AL0C 4AKIA 4P17A 3KFUG 3B7QA 3HU3A 4FCTA 3U6SA 5H37D 4XK8F 4KT0F 4GRIA 2LVQD 3LVVA 3T1YM 2JXNA 2WSEF 4BB9A 4TUWA 2O5RA 2LXEA 4LJ4A 1RU3A 1T43A 5EJCA 2HCBA 3SYLA 4R71A 4DV0M 1OTRA 4R3DA 3HJSA 3TE6A 1XNQM 2YQZA 4OVZB 3MMPA 2KDLA 1IXSA 2XFTA 5FTKA 1NSFA 4YY3M 4MGKE 4F1IA 1UFZA 4OU7A 4NXMM 2CWBA 3BOSA 3U6LA 3NWLA 4NRVA 5ITRA 1YUBA 2YNMD 1D0LA 1NY5A 2G3QA 3B74A 4LJ7A 2KNAA 4LFAM 3JR5A 3E21A 4AKGA 3L25A 1IQPA 4LF6M 3R8FA 1L2DA 3HHWA 3EIEA 2MGWA 3L2AA 3SAUA 3M6AA 1Z5AA 4Q7JA 5F3WA 2HL7A 2I7NA 2C5RA 4Z6YA 2HHHM 5KQDA 4OX9M 1DV0A 4MB7A 5KO3A 3JAMS 2VF7A 3NBIA 3BXWA 2FE8A 2E5LM 5FTMA 4GMQA 3GQ5A 2C98A 1YE9A 2DVWB 2RRUA 3A98B 4JI1M 3IG5A 3GLGB 5JI2E 3SHFA 2QNJA 2XSZA 1R2ZA 3CTWB 3LQRA 3GPPA 4FW9A 1EFUB 2QQ8A 2N35A 2CHVA 3VLFB 3W0LB 3U6EA 1ORYB 2EKKA 1T3TA 2G8LA 5KQ8A 3NBXX 4LF9M 1NVMA 1P3QQ 2QBYA 1XXHA 1N32M 2Z4SA 5IT9S 3UZUA 4MM3B 2LWXA 4NSOB 2QSFX 1G59A 1EE8A 2XZFA 4K0KM 1QANA 1J5EM 5ITXA 4AKHA 3M7GA 3THGA 1NHGC 1NY6A 3LVWA 4IBBA 3DZDA 3RGSA 1D0MA 2F5OA 3M0EA 2FFJA 3U6PA 3TPZA 2EO2A 2VIIA 3U6DA 1N36M 4LF7M 3GO8A 1ZMVA 2VQEM 4G6ZA 3HU1A 4GHAA 3KVWA 3CGWA 3K9OA 5ITYA 3VFDA 4DR5M 2MH8A 5C1BA 4LZZA 4NXNM 4IBJA 1V34A 1IBLM 3I01M 1PJTA 3HJQA 1QVRA 3LQQA 1LTMA 3SC3A 4IBKA 4D82A 3UGJA 1XNRM 1T6OA 5ITUA 1C1KA 2B3TA 3ILKA 2A5YB 3RGPA 2CRUA 5ITXE 2XEPA 4DV3M 1SXJC 3K2LA 3VKGA 2K6BA 1PJQA 1GABA 1R7RA 3KDSE 1XMOM 1HQCA 2JNHA 4L16A 5IWAM 2QPAA 3GPXA 4IBEA 2JY6B 4AG5A 1WJ7A 2CUZA 3I51A 1DGBA 2Y20A 2BWEA 3AOGA 3L28A 4L15A 2ZTCA 4M0DA 4GHLA 2DZOB 2RKOA 2LBCA 2FOIC 1DO0A 4I8OA 3U6MA 3FTDA 4X65M 2JUJA 3B89A 4HLQA 4R7GA 2YR0A 3MJ5A 2MJ5B 4IBGA 1JQJC 2CV0A 1QAOA 4LZJA 3IHPA 1D0KA 3I4YA 1I4WA 4B7FA 5ITTA 3FUWA 1Y8GA 1IXSB 4IBCA 4LF8M 1R5LA 3FTFA 1QYRA 1IBMM 1IFYA 1HT2E 3B7ZA 3FD9A 2K0BX 3HU2A 3GLIA 1SXJA 3GRRA 2KZUA 1GL7A 3AJIB 4P16A 1L2CA 3PVSA 4HL4A 2W82A 2L2DA 2R4JA 2Y0QA 2JY8A 4L78A 3U6CA 4M9XA 2CEAA 3E9SA 2F5PA 2LNHC 2Z7JA 1QUSA 4L6V6 2KNZA 1XHBA 2XFSA 2XH9A 1Q39A 2L4EA 4IIWA 2UU9M 2QHOB 1HNXM 4QOSA 4NC6A 2OOBA 5BR8M 2LHCA 3GP1A 1VDLA 4LG2A 1TR8A 2C9CA 5EQTA 1KSFX 2Z3XA 3GLIE 4JV5M 1G8PA 2Q2EB 3T38A 2R0IA 1QDTA 1WHCA 4G4RA 2JZ1A 1G41A 2DHYA 2XSZD 3BBZA 4JI8M 4B7GA 2R18A 2H5XA 2OO9A 4L4UA 4JI3M 3SAVA 4B3RM 3B7NA 1YSYA 4LF4M 4OW0A 1N33M 4QOZC 2CV1A 1HJPA 3T1HM 7CATA 1XXHB 2G5GX 2DWMA 2QBYB 2XGNA 4CISA 1N78A 3SBJA 3AFHA 4LRSA 1IBKM 3SATA 3VDUA 1XMQM 1R2YA 1NV9A 1ZAEA 5EP3A 1WIVA 3I04M 3GLHA 4WW0A 5KPZA 5DNYA 2YFQA 3J7AS 3CF0A 5L8RF 3HJ8A 1LV7A 5IZ7D 3ZCBB 3H4MA 4ITQA 1G4AE 4DR4M 4JXJA 3PNYA 2DAMA 4M9SA 2JZ0A 1W5SA 4I4LA 2V6ZM 2F5NA 5EP1A 5E6JA 4CGYB 1JR3A 4AG6A 1X37A 3CF2A 2JWSA 2EJSA 2KHHA 3W67A 3HHZA 4LFBM 5IREB 3ZH9B 4AQYM 1TGUA 3GLHE 3E46A 1QZMA 3TWKA 4W5WA 3U60A 1N34M 2VQFM 4GKKM 3W0FA 3K92A 1WGLA 3TWMA 4I81A 4GIPA 2LVAA 2X49A 3A42A 5DYGA 5ITQA 1MJGM 4CJ6A 2MR9A 1IN5A 1G71A 2M5ZA 3KOYE 4NOOB 2ZM6M 4LGYA 1OAOC 3DOAA 3SYKA 2QP9X 4BBAA 1JR3E 4MGYE 3KP0E 1EIJA 1S3SA 2EUCA 2V1UA 1IN8A 4JI0M 4B3TM 1GVNA 3C58A 1DO2A 4B7HA 3GPYA 5EXSA 2Z4RA 3KOZE 1Z5CA 2ZAMA 5EXTA 5JI3E 2F5QA 1KYIA 2APLA 5EXXA 2DXIA 1KFVA 5EP2A 5EP4A 3K8ZA 1NHWC 1L1TA 3FRIA 3B9PA 3V76A 3D8LA 3GLIB 4DUYM 4LJ8A 4G4QA 1OIZA 2R44A 1SXJB 1XXHE 4DR3M 4M9ZA 4MGIE 1V92A 5C18A 3JR4A 4JN6A 2QZ4A 1SXJD 4B08A 1MN3A 2RGOA 4LF5M 1OQYA 2DAGA 2FNAA 2K9DA 2X4AA 2R45A 4GC5A 5GKNA 4FWHA 3GQ4A 1XWIA 2VDBB 3QYBA 3W68A 3SMSA 3RFWA 3I4VA 4AZFA 1TF0B 1IN4A 2QENA 5FTLA 1E94E 2HKJA 2OOAA 1PM5A 3HGIA 2F4VM 2HWJA 3J7BA 2OQ4A 3SFZA 3DA1A 3C3DA 4LJAA 1OFIA 2V1CA 1QDRA 3EIHA 1Z6TA 4X66M 3OTOM 4JI6M 1Q3BA 3HZJA 1IXZA 1OAIA 2L7IA 2Y0TA 4KO8A 2DWNA 4LFCM 2MROB 1I94M 4LGMA 2CE7A 4G4NA 2CHQA 1MX0A 2JY7A 2C99A 4PT5A 1BVSA 5BPVA 3QYEA 2R62A 2KEBA 3HKPA 2C96A 1IM2A 1R6BX 4DV1M 1NNUC 2BNKA 2KW0A 1NJGA 4LCBA 5KPRA 4RNAA 4B3MM 2KRUA 1NNJA 3FTCA 4IJEA 3J2PB 3GLHB 4L8RC 1GO5A 4DR2M 4IBFA 1VG5A 4G3OA 8CATA 1WR1B 3U6QA 2KNVA 4FWDA 1ZV1A 3QAUA 1PJIA 1GJSA 1IY0A 3PNVA 4DUZM 4D81A 1Q3CA 1CUKA 3VK8A 3TQSA 3KXEC 4GC9A 4MGHA 2L7HA 4MH0E 1UM8A 3AOEC 1NV8A 3IECA 4XGIA 5FLXS 3C3EA 1HQYE 2H1RA 3SMPA 3HHXA 2QCUA 5E26A 4JI4M 3LW5F 4KODA 3KP1E 5LMNM 1JR3D 3ZQJA 3LCUA 3PXGA 1PRBA 4RKUF 3U60B 4LRTA 4NRWA 3FUUA 2BJWA 3GLFA 1SXJE 3E4RA 4JI5M 2FH0A 1TH4A 2DAKA 4LY6A 4NSRA 4GEWA 3RE8A 4GITA 3VKHA 2LVOC 3U5ZA 1WGNA 2DAEA 4GH9A 2X8AA 4LJ9A 2WSCF 1VEKA
chains in the Genus database with same CATH topology
4DBGB 2DNAA 3GLHE 3E46A 1ZMVA 2DKLA 3H4JA 3K9OA 3K9PA 1WGLA 2LVAA 1A5TA 3GLGE 1OKSA 1YLAA 1T6OA 2MR9A 2B3TA 1HT1E 1SG9A 2EKFA 3FRHA 3GLFE 4WP2A 1JR3E 4HEOA 2L4FA 1VQ1A 2O25A 5DFLA 1DO2A 3T6PA 2JNHA 2JY6B 1WJ7A 1F4IA 1KYIA 1G3IA 2ZTDA 2DAIA 1QZEA 1Q02A 2BWEA 2ZTCA 3FRIA 2LBCA 2LVNC 1DO0A 2JUJA 3B89A 1TTEA 1XXHE 2MJ5B 1V92A 3IHPA 1Y8GA 1MN3A 1OQYA 2DAGA 2LVQD 2K9DA 1IFYA 2WZJA 1HT2E 2K0BX 4R71A 1T43A 1C7YA 1OTRA 1E94E 2OOAA 2HWJA 3F92A 2LVPC 2DENA 3MMPA 2L2DA 1VEGA 2HAKA 1IXSA 2DI0A 3LCVB 2JY8A 1OAIA 4F1IA 1UFZA 2CWBA 2KNZA 2BWBA 2MROB 2L4EA 2QHOB 2JY7A 2G3QA 1ZMUA 1BVSA 2KNAA 2OOBA 3E21A 1IM2A 1VEJA 1VDLA 1TR8A 3GLIE 2DZLA 2R0IA 1WHCA 2MGWA 3FE3A 4Q7JA 2JZ1A 2LTUA 4F2LA 1DV0A 1G41A 2DHYA 1GO5A 3BBZA 2H5XA 2OO9A 1VG5A 4G3OA 1HJPA 1WR1B 1ZMWA 1XB2B 2RRUA 2KNVA 1PGYA 1ZV1A 5JI2E 2QNJA 1CUKA 1NV9A 1AIPC 1EFUB 1WIVA 1NV8A 3IECA 2EKKA 1HQYE 1P3QQ 2JP7A 1G4AE 3LCUA 2DAMA 2JZ0A 1R4GA 2QSFX 2DAKA 2JY5A 4GEWA 2LVOC 1WGNA 2DAEA 2EJSA 2KHHA 1VEKA 4UN2B 2CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DBG B;  2DNA A;  3GLH E;  3E46 A;  1ZMV A;  2DKL A;  3H4J A;  3K9O A;  3K9P A;  1WGL A;  2LVA A;  1A5T A;  3GLG E;  1OKS A;  1YLA A;  1T6O A;  2MR9 A;  2B3T A;  1HT1 E;  1SG9 A;  2EKF A;  3FRH A;  3GLF E;  4WP2 A;  1JR3 E;  4HEO A;  2L4F A;  1VQ1 A;  2O25 A;  5DFL A;  1DO2 A;  3T6P A;  2JNH A;  2JY6 B;  1WJ7 A;  1F4I A;  1KYI A;  1G3I A;  2ZTD A;  2DAI A;  1QZE A;  1Q02 A;  2BWE A;  2ZTC A;  3FRI A;  2LBC A;  2LVN C;  1DO0 A;  2JUJ A;  3B89 A;  1TTE A;  1XXH E;  2MJ5 B;  1V92 A;  3IHP A;  1Y8G A;  1MN3 A;  1OQY A;  2DAG A;  2LVQ D;  2K9D A;  1IFY A;  2WZJ A;  1HT2 E;  2K0B X;  4R71 A;  1T43 A;  1C7Y A;  1OTR A;  1E94 E;  2OOA A;  2HWJ A;  3F92 A;  2LVP C;  2DEN A;  3MMP A;  2L2D A;  1VEG A;  2HAK A;  1IXS A;  2DI0 A;  3LCV B;  2JY8 A;  1OAI A;  4F1I A;  1UFZ A;  2CWB A;  2KNZ A;  2BWB A;  2MRO B;  2L4E A;  2QHO B;  2JY7 A;  2G3Q A;  1ZMU A;  1BVS A;  2KNA A;  2OOB A;  3E21 A;  1IM2 A;  1VEJ A;  1VDL A;  1TR8 A;  3GLI E;  2DZL A;  2R0I A;  1WHC A;  2MGW A;  3FE3 A;  4Q7J A;  2JZ1 A;  2LTU A;  4F2L A;  1DV0 A;  1G41 A;  2DHY A;  1GO5 A;  3BBZ A;  2H5X A;  2OO9 A;  1VG5 A;  4G3O A;  1HJP A;  1WR1 B;  1ZMW A;  1XB2 B;  2RRU A;  2KNV A;  1PGY A;  1ZV1 A;  5JI2 E;  2QNJ A;  1CUK A;  1NV9 A;  1AIP C;  1EFU B;  1WIV A;  1NV8 A;  3IEC A;  2EKK A;  1HQY E;  1P3Q Q;  2JP7 A;  1G4A E;  3LCU A;  2DAM A;  2JZ0 A;  1R4G A;  2QSF X;  2DAK A;  2JY5 A;  4GEW A;  2LVO C;  1WGN A;  2DAE A;  2EJS A;  2KHH A;  1VEK A;  4UN2 B;  2CP8 A; 
#chains in the Genus database with same CATH topology
 4DBG B;  4YHH M;  2WSF F;  3U61 B;  1N77 A;  2DKL A;  2L09 A;  1K3W A;  4GKJ M;  3K9P A;  3R9X B;  1TH3 A;  1IN6 A;  4QHS A;  2EA0 A;  2XZU A;  3AV0 A;  4FVM A;  3L29 A;  1OKS A;  5EXP A;  3GRU A;  4Z8X A;  3HY5 A;  3AOE A;  1FNN A;  3VK7 A;  5FTJ A;  1MU5 A;  1DGH A;  1HT1 E;  1SG9 A;  3SAR A;  2EKF A;  3GLF E;  4WP2 A;  1E9R A;  1QAM A;  4XBO A;  1HR0 M;  2DWZ B;  3FUX A;  1K3X A;  3A46 A;  2FS1 A;  2O25 A;  4IJF A;  5DFL A;  3KS8 A;  3T6P A;  4KHP M;  3GQ3 A;  2JA2 A;  2LHG A;  3GRV A;  2CV2 A;  2ZTD A;  2UUB M;  1QZE A;  1IN7 A;  1Q02 A;  1L8Q A;  4KLN A;  2DWL A;  2VF8 A;  2OPF A;  3WHK A;  2LVN C;  2UUA M;  2D7G A;  3FKE A;  3DFZ A;  3A45 A;  1TTE A;  5LMU M;  1QAQ A;  1NJF A;  3LMM A;  2GNO A;  4EIW A;  1L2B A;  2DZN B;  1VDD A;  3QWL A;  2R65 A;  2R4E A;  2WZJ A;  4DV6 M;  4PCZ A;  1GKI A;  1GL6 A;  2D7E A;  4BLC A;  2KZS A;  4DV5 M;  3U61 A;  1C7Y A;  5DYI A;  1IY2 A;  3UJN A;  2LVP C;  1GLN A;  2DEN A;  4REZ A;  5A2Q S;  1VEG A;  2HAK A;  3CF6 E;  2DI0 A;  2M60 A;  4IBI A;  3LCV B;  3GRY A;  2CFO A;  2J5Y A;  2ZAN A;  2CHG A;  4ANR A;  3PFI A;  2ZBK B;  1TDZ A;  2BWB A;  2XF3 A;  1L1Z A;  3K1J A;  2K47 A;  4LJ6 A;  4M0W A;  3J27 B;  4OVZ A;  1TDH A;  1ZMU A;  4DV2 M;  4PDG A;  1PJJ A;  2KXE A;  1VEJ A;  3D8B A;  1WXQ A;  2KRK A;  3MK6 A;  2DZL A;  1E9S A;  3ZC7 B;  4JI2 M;  3FE3 A;  2LH0 A;  3TWL A;  4X64 M;  2LTU A;  4F2L A;  3FTE A;  1QQW A;  3AKZ A;  3VDP A;  1ZQ9 A;  4S12 A;  4FCV A;  3HX3 A;  4LJ5 A;  4A3V B;  4RF0 A;  4D80 A;  4QNR A;  1ZMW A;  3SAW A;  1XB2 B;  2RGH A;  3Q8X A;  3L26 A;  2P5T A;  1OIP A;  4FWG A;  1PGY A;  3SHG B;  2R6F A;  3T15 A;  1H6U A;  2J7N A;  3GPU A;  1AIP C;  4II7 A;  4FD2 A;  5FSW A;  2BJV A;  3GLF B;  3FYD A;  3KSX A;  1OFH A;  3KS4 A;  3L27 A;  3MHV C;  3U5Z B;  2JP7 A;  3KOW E;  1Z59 A;  3GLG A;  1HNW M;  4CHT B;  4B3S M;  1HNZ M;  4CIZ A;  4I5S A;  1R4G A;  1V33 A;  4RF1 A;  1FJG M;  3KW6 A;  3J81 S;  3C9P A;  3Q8G A;  2JY5 A;  4DV4 M;  2UUC M;  4AW4 A;  1NO1 A;  5KPT A;  2UXC M;  1J7K A;  2L6O A;  2UXD M;  5FTN A;  2R46 A;  3SAS A;  4DR7 M;  2Z8Y M;  3F92 A;  4AI6 A;  4UN2 B;  2CP8 A;  3WHL A;  4WUR A;  1DGH B;  4NL4 H;  1OJL A;  2DNA A;  1W5T A;  1IXR C;  1TH2 A;  4QNM A;  2Y21 A;  2ZAO A;  3HHY A;  4PD2 A;  1PJS A;  4G4O A;  1E32 A;  1JB0 F;  3H4J A;  4MGZ E;  1N75 A;  4DV7 M;  2UXB M;  4FCW A;  1A5T A;  3U6O A;  2C9O A;  2XLJ A;  3GLG E;  1K82 A;  2AHM A;  1DGF A;  2DHR A;  2NQ8 C;  2J7O A;  3FUT A;  4ZPX A;  4X62 M;  1IY1 A;  1YLA A;  2O01 F;  3KSJ A;  2F5S A;  2I7P A;  1Z5B A;  1AUA A;  3TL4 X;  3FRH A;  4IBD A;  4DR6 M;  2KA6 B;  3IG8 A;  3FUV A;  3KOX E;  4HEO A;  2ERC A;  4Y28 F;  2L4F A;  1J09 A;  2GQF A;  1VQ1 A;  2D7H A;  3UK6 A;  4DR1 M;  4JYA M;  4JI7 M;  1DGG A;  1F4I A;  1G3I A;  3HWS A;  2DAI A;  1D2N A;  1QUT A;  4QHT A;  3J80 S;  3UMM A;  1GJT A;  3FYC A;  1XC8 A;  4PDI A;  3AL0 C;  4AKI A;  4P17 A;  3KFU G;  3B7Q A;  3HU3 A;  4FCT A;  3U6S A;  5H37 D;  4XK8 F;  4KT0 F;  4GRI A;  2LVQ D;  3LVV A;  3T1Y M;  2JXN A;  2WSE F;  4BB9 A;  4TUW A;  2O5R A;  2LXE A;  4LJ4 A;  1RU3 A;  1T43 A;  5EJC A;  2HCB A;  3SYL A;  4R71 A;  4DV0 M;  1OTR A;  4R3D A;  3HJS A;  3TE6 A;  1XNQ M;  2YQZ A;  4OVZ B;  3MMP A;  2KDL A;  1IXS A;  2XFT A;  5FTK A;  1NSF A;  4YY3 M;  4MGK E;  4F1I A;  1UFZ A;  4OU7 A;  4NXM M;  2CWB A;  3BOS A;  3U6L A;  3NWL A;  4NRV A;  5ITR A;  1YUB A;  2YNM D;  1D0L A;  1NY5 A;  2G3Q A;  3B74 A;  4LJ7 A;  2KNA A;  4LFA M;  3JR5 A;  3E21 A;  4AKG A;  3L25 A;  1IQP A;  4LF6 M;  3R8F A;  1L2D A;  3HHW A;  3EIE A;  2MGW A;  3L2A A;  3SAU A;  3M6A A;  1Z5A A;  4Q7J A;  5F3W A;  2HL7 A;  2I7N A;  2C5R A;  4Z6Y A;  2HHH M;  5KQD A;  4OX9 M;  1DV0 A;  4MB7 A;  5KO3 A;  3JAM S;  2VF7 A;  3NBI A;  3BXW A;  2FE8 A;  2E5L M;  5FTM A;  4GMQ A;  3GQ5 A;  2C98 A;  1YE9 A;  2DVW B;  2RRU A;  3A98 B;  4JI1 M;  3IG5 A;  3GLG B;  5JI2 E;  3SHF A;  2QNJ A;  2XSZ A;  1R2Z A;  3CTW B;  3LQR A;  3GPP A;  4FW9 A;  1EFU B;  2QQ8 A;  2N35 A;  2CHV A;  3VLF B;  3W0L B;  3U6E A;  1ORY B;  2EKK A;  1T3T A;  2G8L A;  5KQ8 A;  3NBX X;  4LF9 M;  1NVM A;  1P3Q Q;  2QBY A;  1XXH A;  1N32 M;  2Z4S A;  5IT9 S;  3UZU A;  4MM3 B;  2LWX A;  4NSO B;  2QSF X;  1G59 A;  1EE8 A;  2XZF A;  4K0K M;  1QAN A;  1J5E M;  5ITX A;  4AKH A;  3M7G A;  3THG A;  1NHG C;  1NY6 A;  3LVW A;  4IBB A;  3DZD A;  3RGS A;  1D0M A;  2F5O A;  3M0E A;  2FFJ A;  3U6P A;  3TPZ A;  2EO2 A;  2VII A;  3U6D A;  1N36 M;  4LF7 M;  3GO8 A;  1ZMV A;  2VQE M;  4G6Z A;  3HU1 A;  4GHA A;  3KVW A;  3CGW A;  3K9O A;  5ITY A;  3VFD A;  4DR5 M;  2MH8 A;  5C1B A;  4LZZ A;  4NXN M;  4IBJ A;  1V34 A;  1IBL M;  3I01 M;  1PJT A;  3HJQ A;  1QVR A;  3LQQ A;  1LTM A;  3SC3 A;  4IBK A;  4D82 A;  3UGJ A;  1XNR M;  1T6O A;  5ITU A;  1C1K A;  2B3T A;  3ILK A;  2A5Y B;  3RGP A;  2CRU A;  5ITX E;  2XEP A;  4DV3 M;  1SXJ C;  3K2L A;  3VKG A;  2K6B A;  1PJQ A;  1GAB A;  1R7R A;  3KDS E;  1XMO M;  1HQC A;  2JNH A;  4L16 A;  5IWA M;  2QPA A;  3GPX A;  4IBE A;  2JY6 B;  4AG5 A;  1WJ7 A;  2CUZ A;  3I51 A;  1DGB A;  2Y20 A;  2BWE A;  3AOG A;  3L28 A;  4L15 A;  2ZTC A;  4M0D A;  4GHL A;  2DZO B;  2RKO A;  2LBC A;  2FOI C;  1DO0 A;  4I8O A;  3U6M A;  3FTD A;  4X65 M;  2JUJ A;  3B89 A;  4HLQ A;  4R7G A;  2YR0 A;  3MJ5 A;  2MJ5 B;  4IBG A;  1JQJ C;  2CV0 A;  1QAO A;  4LZJ A;  3IHP A;  1D0K A;  3I4Y A;  1I4W A;  4B7F A;  5ITT A;  3FUW A;  1Y8G A;  1IXS B;  4IBC A;  4LF8 M;  1R5L A;  3FTF A;  1QYR A;  1IBM M;  1IFY A;  1HT2 E;  3B7Z A;  3FD9 A;  2K0B X;  3HU2 A;  3GLI A;  1SXJ A;  3GRR A;  2KZU A;  1GL7 A;  3AJI B;  4P16 A;  1L2C A;  3PVS A;  4HL4 A;  2W82 A;  2L2D A;  2R4J A;  2Y0Q A;  2JY8 A;  4L78 A;  3U6C A;  4M9X A;  2CEA A;  3E9S A;  2F5P A;  2LNH C;  2Z7J A;  1QUS A;  4L6V 6;  2KNZ A;  1XHB A;  2XFS A;  2XH9 A;  1Q39 A;  2L4E A;  4IIW A;  2UU9 M;  2QHO B;  1HNX M;  4QOS A;  4NC6 A;  2OOB A;  5BR8 M;  2LHC A;  3GP1 A;  1VDL A;  4LG2 A;  1TR8 A;  2C9C A;  5EQT A;  1KSF X;  2Z3X A;  3GLI E;  4JV5 M;  1G8P A;  2Q2E B;  3T38 A;  2R0I A;  1QDT A;  1WHC A;  4G4R A;  2JZ1 A;  1G41 A;  2DHY A;  2XSZ D;  3BBZ A;  4JI8 M;  4B7G A;  2R18 A;  2H5X A;  2OO9 A;  4L4U A;  4JI3 M;  3SAV A;  4B3R M;  3B7N A;  1YSY A;  4LF4 M;  4OW0 A;  1N33 M;  4QOZ C;  2CV1 A;  1HJP A;  3T1H M;  7CAT A;  1XXH B;  2G5G X;  2DWM A;  2QBY B;  2XGN A;  4CIS A;  1N78 A;  3SBJ A;  3AFH A;  4LRS A;  1IBK M;  3SAT A;  3VDU A;  1XMQ M;  1R2Y A;  1NV9 A;  1ZAE A;  5EP3 A;  1WIV A;  3I04 M;  3GLH A;  4WW0 A;  5KPZ A;  5DNY A;  2YFQ A;  3J7A S;  3CF0 A;  5L8R F;  3HJ8 A;  1LV7 A;  5IZ7 D;  3ZCB B;  3H4M A;  4ITQ A;  1G4A E;  4DR4 M;  4JXJ A;  3PNY A;  2DAM A;  4M9S A;  2JZ0 A;  1W5S A;  4I4L A;  2V6Z M;  2F5N A;  5EP1 A;  5E6J A;  4CGY B;  1JR3 A;  4AG6 A;  1X37 A;  3CF2 A;  2JWS A;  2EJS A;  2KHH A;  3W67 A;  3HHZ A;  4LFB M;  5IRE B;  3ZH9 B;  4AQY M;  1TGU A;  3GLH E;  3E46 A;  1QZM A;  3TWK A;  4W5W A;  3U60 A;  1N34 M;  2VQF M;  4GKK M;  3W0F A;  3K92 A;  1WGL A;  3TWM A;  4I81 A;  4GIP A;  2LVA A;  2X49 A;  3A42 A;  5DYG A;  5ITQ A;  1MJG M;  4CJ6 A;  2MR9 A;  1IN5 A;  1G71 A;  2M5Z A;  3KOY E;  4NOO B;  2ZM6 M;  4LGY A;  1OAO C;  3DOA A;  3SYK A;  2QP9 X;  4BBA A;  1JR3 E;  4MGY E;  3KP0 E;  1EIJ A;  1S3S A;  2EUC A;  2V1U A;  1IN8 A;  4JI0 M;  4B3T M;  1GVN A;  3C58 A;  1DO2 A;  4B7H A;  3GPY A;  5EXS A;  2Z4R A;  3KOZ E;  1Z5C A;  2ZAM A;  5EXT A;  5JI3 E;  2F5Q A;  1KYI A;  2APL A;  5EXX A;  2DXI A;  1KFV A;  5EP2 A;  5EP4 A;  3K8Z A;  1NHW C;  1L1T A;  3FRI A;  3B9P A;  3V76 A;  3D8L A;  3GLI B;  4DUY M;  4LJ8 A;  4G4Q A;  1OIZ A;  2R44 A;  1SXJ B;  1XXH E;  4DR3 M;  4M9Z A;  4MGI E;  1V92 A;  5C18 A;  3JR4 A;  4JN6 A;  2QZ4 A;  1SXJ D;  4B08 A;  1MN3 A;  2RGO A;  4LF5 M;  1OQY A;  2DAG A;  2FNA A;  2K9D A;  2X4A A;  2R45 A;  4GC5 A;  5GKN A;  4FWH A;  3GQ4 A;  1XWI A;  2VDB B;  3QYB A;  3W68 A;  3SMS A;  3RFW A;  3I4V A;  4AZF A;  1TF0 B;  1IN4 A;  2QEN A;  5FTL A;  1E94 E;  2HKJ A;  2OOA A;  1PM5 A;  3HGI A;  2F4V M;  2HWJ A;  3J7B A;  2OQ4 A;  3SFZ A;  3DA1 A;  3C3D A;  4LJA A;  1OFI A;  2V1C A;  1QDR A;  3EIH A;  1Z6T A;  4X66 M;  3OTO M;  4JI6 M;  1Q3B A;  3HZJ A;  1IXZ A;  1OAI A;  2L7I A;  2Y0T A;  4KO8 A;  2DWN A;  4LFC M;  2MRO B;  1I94 M;  4LGM A;  2CE7 A;  4G4N A;  2CHQ A;  1MX0 A;  2JY7 A;  2C99 A;  4PT5 A;  1BVS A;  5BPV A;  3QYE A;  2R62 A;  2KEB A;  3HKP A;  2C96 A;  1IM2 A;  1R6B X;  4DV1 M;  1NNU C;  2BNK A;  2KW0 A;  1NJG A;  4LCB A;  5KPR A;  4RNA A;  4B3M M;  2KRU A;  1NNJ A;  3FTC A;  4IJE A;  3J2P B;  3GLH B;  4L8R C;  1GO5 A;  4DR2 M;  4IBF A;  1VG5 A;  4G3O A;  8CAT A;  1WR1 B;  3U6Q A;  2KNV A;  4FWD A;  1ZV1 A;  3QAU A;  1PJI A;  1GJS A;  1IY0 A;  3PNV A;  4DUZ M;  4D81 A;  1Q3C A;  1CUK A;  3VK8 A;  3TQS A;  3KXE C;  4GC9 A;  4MGH A;  2L7H A;  4MH0 E;  1UM8 A;  3AOE C;  1NV8 A;  3IEC A;  4XGI A;  5FLX S;  3C3E A;  1HQY E;  2H1R A;  3SMP A;  3HHX A;  2QCU A;  5E26 A;  4JI4 M;  3LW5 F;  4KOD A;  3KP1 E;  5LMN M;  1JR3 D;  3ZQJ A;  3LCU A;  3PXG A;  1PRB A;  4RKU F;  3U60 B;  4LRT A;  4NRW A;  3FUU A;  2BJW A;  3GLF A;  1SXJ E;  3E4R A;  4JI5 M;  2FH0 A;  1TH4 A;  2DAK A;  4LY6 A;  4NSR A;  4GEW A;  3RE8 A;  4GIT A;  3VKH A;  2LVO C;  3U5Z A;  1WGN A;  2DAE A;  4GH9 A;  2X8A A;  4LJ9 A;  2WSC F;  1VEK A; 
#chains in the Genus database with same CATH homology
 4DBG B;  2DNA A;  3GLH E;  3E46 A;  1ZMV A;  2DKL A;  3H4J A;  3K9O A;  3K9P A;  1WGL A;  2LVA A;  1A5T A;  3GLG E;  1OKS A;  1YLA A;  1T6O A;  2MR9 A;  2B3T A;  1HT1 E;  1SG9 A;  2EKF A;  3FRH A;  3GLF E;  4WP2 A;  1JR3 E;  4HEO A;  2L4F A;  1VQ1 A;  2O25 A;  5DFL A;  1DO2 A;  3T6P A;  2JNH A;  2JY6 B;  1WJ7 A;  1F4I A;  1KYI A;  1G3I A;  2ZTD A;  2DAI A;  1QZE A;  1Q02 A;  2BWE A;  2ZTC A;  3FRI A;  2LBC A;  2LVN C;  1DO0 A;  2JUJ A;  3B89 A;  1TTE A;  1XXH E;  2MJ5 B;  1V92 A;  3IHP A;  1Y8G A;  1MN3 A;  1OQY A;  2DAG A;  2LVQ D;  2K9D A;  1IFY A;  2WZJ A;  1HT2 E;  2K0B X;  4R71 A;  1T43 A;  1C7Y A;  1OTR A;  1E94 E;  2OOA A;  2HWJ A;  3F92 A;  2LVP C;  2DEN A;  3MMP A;  2L2D A;  1VEG A;  2HAK A;  1IXS A;  2DI0 A;  3LCV B;  2JY8 A;  1OAI A;  4F1I A;  1UFZ A;  2CWB A;  2KNZ A;  2BWB A;  2MRO B;  2L4E A;  2QHO B;  2JY7 A;  2G3Q A;  1ZMU A;  1BVS A;  2KNA A;  2OOB A;  3E21 A;  1IM2 A;  1VEJ A;  1VDL A;  1TR8 A;  3GLI E;  2DZL A;  2R0I A;  1WHC A;  2MGW A;  3FE3 A;  4Q7J A;  2JZ1 A;  2LTU A;  4F2L A;  1DV0 A;  1G41 A;  2DHY A;  1GO5 A;  3BBZ A;  2H5X A;  2OO9 A;  1VG5 A;  4G3O A;  1HJP A;  1WR1 B;  1ZMW A;  1XB2 B;  2RRU A;  2KNV A;  1PGY A;  1ZV1 A;  5JI2 E;  2QNJ A;  1CUK A;  1NV9 A;  1AIP C;  1EFU B;  1WIV A;  1NV8 A;  3IEC A;  2EKK A;  1HQY E;  1P3Q Q;  2JP7 A;  1G4A E;  3LCU A;  2DAM A;  2JZ0 A;  1R4G A;  2QSF X;  2DAK A;  2JY5 A;  4GEW A;  2LVO C;  1WGN A;  2DAE A;  2EJS A;  2KHH A;  1VEK A;  4UN2 B;  2CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...