2JY5A

Nmr structure of ubiquilin 1 uba domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquilin-1
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy5A00
2MJ5B 2MR9A 2R0IA 2KNAA 1V92A 1OAIA 1G41A 1WHCA 1PGYA 2DAIA 2DI0A 1ZV1A 3E46A 1HT2E 2L4FA 2LTUA 1TR8A 1IFYA 2KNVA 5DFLA 1IM2A 1DO2A 2KNZA 1T6OA 4HEOA 2K0BX 1BVSA 4WP2A 1VEGA 1QZEA 2MGWA 1R4GA 1UFZA 1WR1B 2JY6B 2DAGA 2LBCA 3IHPA 1KYIA 1Q02A 2JNHA 2OOAA 4GEWA 1P3QQ 2L4EA 2LVAA 1ZMWA 2JP7A 1F4IA 2ZTCA 3K9OA 2K9DA 3E21A 2HWJA 1DO0A 4UN2B 2JZ0A 1HQYE 2JY7A 2ZTDA 5JI2E 1GO5A 2CP8A 4G3OA 1OTRA 1T43A 3F92A 3GLHE 1EFUB 3IECA 1SG9A 3FRHA 1VQ1A 2CWBA 1G3IA 1JR3E 1TTEA 2DAEA 1VG5A 2DAKA 1VEKA 2H5XA 2BWBA 2DNAA 2MROB 2OO9A 1G4AE 3B89A 1ZMUA 2QNJA 1NV8A 2DHYA 1WJ7A 2EJSA 1IXSA 4R71A 1DV0A 2EKKA 2JY5A 4F2LA 1C7YA 4F1IA 1ZMVA 1NV9A 1Y8GA 1E94E 1HT1E 1WIVA 2KHHA 2JUJA 3T6PA 2BWEA 2JZ1A 1YLAA 2QSFX 3FRIA 2RRUA 3MMPA 1CUKA 2JY8A 1WGLA 2LVQD 3BBZA 3FE3A 3GLIE 2L2DA 1OKSA 2OOBA 2WZJA 1OQYA 2LVOC 1VEJA 2DZLA 2QHOB 1VDLA 2LVNC 1XXHE 1HJPA 2EKFA 2LVPC 3LCVB 3GLFE 2HAKA 1A5TA 2G3QA 4Q7JA 2O25A 3H4JA 2DAMA 4DBGB 1MN3A 1XB2B 2DENA 3GLGE 1WGNA 3LCUA 1AIPC 3K9PA 2DKLA 2B3TA
chains in the Genus database with same CATH superfamily
3QYEA 3U60B 1XNQM 2XFTA 2KNAA 1AUAA 3HU2A 3GRVA 3HJQA 3K92A 4QHSA 4FW9A 4G6ZA 1OAIA 3GRRA 4R7GA 2VQFM 5KPRA 1NJFA 3U6DA 3DA1A 4IBCA 3LVWA 4KODA 4YY3M 4AQYM 3FTEA 2QP9X 3KSXA 1HT2E 2L4FA 4LY6A 3RE8A 1QAOA 1TR8A 2UXBM 2J5YA 1K3WA 1IBMM 1IM2A 4M0DA 2V6ZM 4LF9M 4L4UA 1T6OA 1GLNA 1NVMA 1R6BX 4B7HA 1N78A 2XZUA 2DAGA 2ZAOA 3TQSA 3KFUG 2CFOA 1NHWC 2HL7A 1C1KA 2A5YB 2JNHA 4CJ6A 4GEWA 4DR4M 2E5LM 3FKEA 5DNYA 4K0KM 4G4NA 2ZBKB 3B7ZA 5E26A 2K9DA 1TF0B 3GLHB 2UU9M 1Z5CA 5BPVA 2JA2A 3QWLA 4G3OA 3FTFA 2UUAM 1SXJC 2LH0A 3KS4A 3HY5A 1EFUB 4GC5A 3LW5F 3VDUA 2F5QA 4AKGA 4XBOA 3DZDA 3RFWA 3GLFA 3KS8A 4LCBA 4B3TM 4JI4M 2DWNA 2CUZA 1G3IA 4AKIA 3Q8XA 3I4VA 2WSFF 1TTEA 5A2QS 4DR1M 2DAKA 2H5XA 1NSFA 3SHGB 1L2DA 5EP3A 3GPUA 4JI6M 4MGHA 1EE8A 3SASA 1GJTA 2R46A 1YE9A 2OO9A 1G59A 4LF8M 2W82A 2V1UA 3R8FA 5EXXA 2D7EA 1ZMUA 2D7HA 4NSOB 1FJGM 3V76A 2KA6B 1IXSA 2Q2EB 2LHCA 3E4RA 2EKKA 3HU1A 2EUCA 5EJCA 3VDPA 4JN6A 4Z6YA 4HLQA 5KPZA 1C7YA 3UGJA 4NXNM 1HNZM 4S12A 3VFDA 4LFCM 2BNKA 2ZAMA 3KOXE 4FVMA 3U60A 3U6QA 4IBJA 3BXWA 1QDTA 4B7GA 2L09A 1E94E 1HT1E 3B7NA 1XNRM 2BJVA 2GNOA 1XMOM 2JUJA 4ANRA 3T6PA 2CE7A 2C9OA 4FWGA 4QOSA 1HR0M 4DUZM 4D81A 1G8PA 3VK7A 3FRIA 3J2PB 4REZA 4B3RM 1LTMA 2DWZB 4NL4H 3HHZA 3SFZA 2R4JA 3GRUA 1LV7A 4FCTA 1W5TA 1WGLA 2JY8A 2LVQD 3FE3A 3GLIE 1XXHB 3LQQA 3U6EA 2Z7JA 1R2YA 3MHVC 3SBJA 2MH8A 1OQYA 2LVOC 1N75A 1VEJA 2DZLA 3AFHA 1XWIA 2VF8A 4DV3M 4B3SM 4AZFA 3L25A 4LG2A 3GLHA 3LCVB 3GLGB 1H6UA 2M5ZA 4IBFA 2G3QA 1J09A 2Z3XA 2CEAA 4LJ7A 2JXNA 3J7BA 4FWDA 4R3DA 3PNVA 2WSCF 3ZH9B 4DBGB 2HCBA 4DR2M 3TWLA 1VDDA 2CRUA 4OX9M 3LCUA 3LMMA 1IXRC 3SYLA 4B7FA 4M9XA 4RF0A 3DFZA 4GMQA 4JV5M 4GITA 2B3TA 4WW0A 1IN8A 4P17A 5ITXA 3W0FA 4LF4M 1SXJB 1V92A 3HHYA 4X64M 1E32A 2C9CA 3R9XB 1G41A 3FUXA 1TH2A 4IJFA 3ZC7B 4EIWA 1SXJD 1WHCA 2V1CA 3IG8A 2J7NA 2ZANA 4XK8F 1ZV1A 4GKKM 2I7NA 3K1JA 2KNVA 4LF7M 5DFLA 4NRWA 1I94M 4GKJM 4X65M 2CV0A 1DGBA 2FOIC 4G4QA 3CF6E 1NHGC 2XSZA 4KT0F 1QZEA 4LZJA 5LMUM 2MGWA 4LF6M 1WR1B 4JXJA 4BLCA 4A3VB 2LBCA 3IHPA 3M6AA 1Z59A 1Q02A 1L1ZA 3TPZA 5C1BA 2OOAA 2YQZA 4NRVA 4IBBA 3TE6A 1QDRA 4PD2A 2L4EA 4II7A 2LVAA 4LFAM 1ZMWA 1IN6A 3D8BA 4FWHA 3VKHA 2ZTCA 3M7GA 3T15A 3C58A 1QANA 1L2BA 2R18A 2C99A 1DGHB 4NSRA 3HJSA 2WSEF 2JZ0A 4JI3M 4OVZB 1GO5A 2CP8A 5FLXS 4GHLA 3B7QA 3THGA 1N33M 1OTRA 3F92A 1ZQ9A 1N77A 4L16A 3GPYA 4B08A 1J7KA 3U5ZA 1MX0A 1XXHA 2H1RA 2D7GA 1JR3D 4PCZA 2F5SA 1HNWM 3AOEC 2CWBA 3RGSA 5LMNM 2GQFA 3MJ5A 4FCWA 3UMMA 3FUVA 5EXTA 3FD9A 1Q39A 2CHQA 1L2CA 2QENA 2J7OA 1PJSA 5ITYA 3GLIB 3GLGA 3TWMA 2DNAA 4AKHA 1IY2A 2Y21A 2MROB 1EIJA 5FSWA 1YSYA 3A98B 3B89A 2XFSA 1NV8A 1W5SA 3KSJA 4R71A 2FS1A 4MGIE 1QQWA 4D80A 2JY5A 3GPXA 4DUYM 4F2LA 2HHHM 4F1IA 4GRIA 4FD2A 1S3SA 1ZMVA 2DZNB 4AW4A 1QZMA 1TDHA 3KOWE 4MGKE 4Z8XA 2QBYA 1SXJA 5EP1A 4X66M 2DHRA 2QZ4A 3PFIA 3J27B 2KRUA 4JI1M 3HU3A 3J81S 3SHFA 4KHPM 2JWSA 1IXZA 3EIEA 1D0KA 1Q3CA 2QSFX 4PT5A 5L8RF 1XC8A 3CTWB 2KEBA 3UK6A 3NBXX 2QCUA 4RKUF 1UM8A 3ZQJA 3GO8A 1J5EM 1JB0F 3BBZA 2F5OA 2L2DA 3C9PA 3M0EA 1YUBA 1IN5A 2OOBA 2CHGA 4L78A 2WZJA 5JI3E 1PJJA 4ITQA 2X8AA 3ILKA 4LRSA 2QHOB 2LVNC 3CF2A 3E9SA 1Z5BA 2R4EA 2C98A 3GLFE 3FUUA 1DGHA 2XSZD 3GQ4A 2L6OA 2O25A 2DAMA 1QVRA 3WHKA 2R45A 2DWLA 5FTNA 1JR3A 1X37A 2XGNA 4QHTA 3T38A 5GKNA 2K6BA 3GPPA 4DV5M 2XH9A 1TGUA 2UUCM 2KDLA 3U6CA 4IBIA 2MJ5B 1IY0A 3NBIA 3C3DA 5KPTA 3U6LA 3U6MA 5FTLA 2F4VM 2KRKA 1TH3A 4LJ4A 4Y28F 4QNRA 4LZZA 4X62M 2Y0QA 1IQPA 1PGYA 2DI0A 2R44A 3E46A 5DYGA 1PJQA 2XEPA 5IREB 3PNYA 4AG5A 4MH0E 1E9RA 4DR7M 3AJIB 3SMSA 1DO2A 1GL6A 4L15A 2K0BX 4WP2A 5KQ8A 2ZM6M 1VEGA 2X4AA 3DOAA 3VK8A 2DXIA 1R4GA 1UFZA 4GC9A 2FE8A 3VLFB 1L1TA 3L2AA 1PJIA 2EO2A 3UJNA 4JI5M 3ZCBB 4CISA 4JI7M 3AV0A 1NJGA 4QNMA 8CATA 4AI6A 1WXQA 3KP0E 1Z5AA 3K9OA 3VKGA 4JI2M 2HWJA 5ITTA 2XLJA 5JI2E 2Y20A 5FTJA 2CV2A 2AHMA 3A46A 4I8OA 2X49A 3GLHE 4FCVA 4RNAA 3IECA 4NC6A 1SG9A 3FRHA 5EQTA 1IY1A 1HQCA 3KOZE 2R6FA 2OQ4A 3SMPA 3NWLA 3B9PA 1NO1A 4DV7M 1VEKA 4JYAM 1ZAEA 3I04M 3K8ZA 4IIWA 3EIHA 2BWBA 1Q3BA 2UXDM 3IG5A 4TUWA 4LJ9A 3HHXA 5ITXE 2LNHC 3T1HM 5EXPA 1DV0A 1XMQM 5IT9S 3GLFB 4IBGA 2UUBM 4KO8A 4DR6M 2ERCA 4CIZA 4I5SA 4OU7A 1JQJC 2YR0A 5E6JA 4CHTB 4JI8M 2DZOB 1NV9A 4PDGA 3FUTA 3I51A 4YHHM 2C5RA 4LF5M 4PDIA 2RKOA 1GABA 1I4WA 2G8LA 2L7IA 1D2NA 1R2ZA 2R62A 3PXGA 3MK6A 5EP4A 4D82A 1NY6A 2KHHA 4BB9A 1G71A 2LWXA 3LVVA 2APLA 3HWSA 3T1YM 4JI0M 2EA0A 2BWEA 2JZ1A 2VQEM 1IXSB 1KSFX 3SYKA 5ITUA 1IN7A 1OAOC 2UXCM 5IWAM 5EP2A 3HGIA 5EXSA 2RRUA 1DGGA 3HJ8A 3SC3A 1R5LA 2F5NA 3KP1E 3CGWA 5KO3A 1GKIA 1PJTA 2KZUA 2XF3A 3KVWA 4L8RC 3CF0A 1OKSA 1PM5A 3SARA 3D8LA 3FTDA 2KW0A 4LGMA 4M9SA 4LJ5A 4AG6A 1XXHE 2HAKA 1A5TA 3SAVA 3JAMS 4Q7JA 3QYBA 2XZFA 2QQ8A 3H4JA 3FTCA 4XGIA 1MN3A 1XB2B 2DENA 3BOSA 4GIPA 1N36M 3RGPA 4LFBM 3GLGE 1WGNA 1TH4A 4IJEA 3K9PA 4RF1A 4DR5M 3QAUA 1OFIA 4DV1M 4DV0M 3GQ3A 2MR9A 2R0IA 5F3WA 2VF7A 3FYDA 1OFHA 3W68A 3A45A 3B74A 2CV1A 3SATA 2K47A 2CHVA 2YNMD 2LXEA 2DVWB 1D0LA 1TDZA 2DAIA 1V33A 1SXJE 2LTUA 3AKZA 3TWKA 2FFJA 1IFYA 2RGOA 4P16A 4KLNA 1E9SA 1V34A 2KNZA 3KOYE 2N35A 4HEOA 3L26A 1BVSA 4OVZA 2Y0TA 4DV2M 1D0MA 2JY6B 3J80S 3PVSA 1IBLM 1KYIA 5FTMA 1GVNA 5ITRA 1DGFA 1MU5A 2KXEA 2O01F 4W5WA 1P3QQ 4MM3B 3TL4X 1QUSA 4DR3M 1NY5A 4CGYB 2DWMA 2JP7A 1F4IA 1R7RA 5KQDA 1HNXM 2R65A 3E21A 1GJSA 4WURA 1QAMA 1DO0A 3GLIA 4UN2B 2ZTDA 1HQYE 2JY7A 2OPFA 3SAUA 4DV6M 3KW6A 3HZJA 3JR5A 1T43A 3J7AS 1OIZA 3U61B 2RGHA 3L27A 3W67A 1VQ1A 3WHLA 4LJ8A 2VDBB 1K3XA 3HHWA 1JR3E 2BJWA 2O5RA 1VG5A 2DAEA 4OW0A 4IBDA 4NXMM 4I81A 2M60A 4M0WA 1FNNA 2QPAA 3GQ5A 1NNJA 1G4AE 4QOZC 1NNUC 3JR4A 1XHBA 2L7HA 5C18A 3U5ZB 2QNJA 5DYIA 2DHYA 2EJSA 1WJ7A 1L8QA 4BBAA 3A42A 1IBKM 2KZSA 3FYCA 3W0LB 4DV4M 4B3MM 4I4LA 4IBKA 4MB7A 2FH0A 3HKPA 3U6SA 4MGYE 3I01M 1Y8GA 5IZ7D 4LRTA 2C96A 5H37D 4NOOB 1WIVA 1PRBA 3Q8GA 4IBEA 2VIIA 2Z4RA 2G5GX 2LHGA 3H4MA 3L29A 3GP1A 1KFVA 1YLAA 3K2LA 2NQ8C 3LQRA 1QAQA 1QUTA 2Z4SA 4GHAA 3U6OA 3MMPA 5FTKA 4ZPXA 1CUKA 1IN4A 1K82A 2QBYB 3C3EA 1N32M 3I4YA 3L28A 4M9ZA 4G4OA 3AL0C 2FNAA 2P5TA 1GL7A 1N34M 4LGYA 1MJGM 2I7PA 3HX3A 1VDLA 4HL4A 4LJ6A 3AOGA 4LJAA 1HJPA 2EKFA 7CATA 2LVPC 1T3TA 1RU3A 3UZUA 4G4RA 1ORYB 1Z6TA 3SAWA 2F5PA 5BR8M 3KXEC 3GRYA 4L6V6 5ITQA 3AOEA 3U61A 3OTOM 4GH9A 4MGZE 1QYRA 1AIPC 2YFQA 3KDSE 2HKJA 3U6PA 1OIPA 1OJLA 2DKLA 3FUWA 2Z8YM
chains in the Genus database with same CATH topology
2MJ5B 2MR9A 2R0IA 2KNAA 1V92A 1OAIA 1G41A 1WHCA 1PGYA 2DAIA 2DI0A 1ZV1A 3E46A 1HT2E 2L4FA 2LTUA 1TR8A 1IFYA 2KNVA 5DFLA 1IM2A 1DO2A 2KNZA 1T6OA 4HEOA 2K0BX 1BVSA 4WP2A 1VEGA 1QZEA 2MGWA 1R4GA 1UFZA 1WR1B 2JY6B 2DAGA 2LBCA 3IHPA 1KYIA 1Q02A 2JNHA 2OOAA 4GEWA 1P3QQ 2L4EA 2LVAA 1ZMWA 2JP7A 1F4IA 2ZTCA 3K9OA 2K9DA 3E21A 2HWJA 1DO0A 4UN2B 2JZ0A 1HQYE 2JY7A 2ZTDA 5JI2E 1GO5A 2CP8A 4G3OA 1OTRA 1T43A 3F92A 3GLHE 1EFUB 3IECA 1SG9A 3FRHA 1VQ1A 2CWBA 1G3IA 1JR3E 1TTEA 2DAEA 1VG5A 2DAKA 1VEKA 2H5XA 2BWBA 2DNAA 2MROB 2OO9A 1G4AE 3B89A 1ZMUA 2QNJA 1NV8A 2DHYA 1WJ7A 2EJSA 1IXSA 4R71A 1DV0A 2EKKA 2JY5A 4F2LA 1C7YA 4F1IA 1ZMVA 1NV9A 1Y8GA 1E94E 1HT1E 1WIVA 2KHHA 2JUJA 3T6PA 2BWEA 2JZ1A 1YLAA 2QSFX 3FRIA 2RRUA 3MMPA 1CUKA 2JY8A 1WGLA 2LVQD 3BBZA 3FE3A 3GLIE 2L2DA 1OKSA 2OOBA 2WZJA 1OQYA 2LVOC 1VEJA 2DZLA 2QHOB 1VDLA 2LVNC 1XXHE 1HJPA 2EKFA 2LVPC 3LCVB 3GLFE 2HAKA 1A5TA 2G3QA 4Q7JA 2O25A 3H4JA 2DAMA 4DBGB 1MN3A 1XB2B 2DENA 3GLGE 1WGNA 3LCUA 1AIPC 3K9PA 2DKLA 2B3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ5 B;  2MR9 A;  2R0I A;  2KNA A;  1V92 A;  1OAI A;  1G41 A;  1WHC A;  1PGY A;  2DAI A;  2DI0 A;  1ZV1 A;  3E46 A;  1HT2 E;  2L4F A;  2LTU A;  1TR8 A;  1IFY A;  2KNV A;  5DFL A;  1IM2 A;  1DO2 A;  2KNZ A;  1T6O A;  4HEO A;  2K0B X;  1BVS A;  4WP2 A;  1VEG A;  1QZE A;  2MGW A;  1R4G A;  1UFZ A;  1WR1 B;  2JY6 B;  2DAG A;  2LBC A;  3IHP A;  1KYI A;  1Q02 A;  2JNH A;  2OOA A;  4GEW A;  1P3Q Q;  2L4E A;  2LVA A;  1ZMW A;  2JP7 A;  1F4I A;  2ZTC A;  3K9O A;  2K9D A;  3E21 A;  2HWJ A;  1DO0 A;  4UN2 B;  2JZ0 A;  1HQY E;  2JY7 A;  2ZTD A;  5JI2 E;  1GO5 A;  2CP8 A;  4G3O A;  1OTR A;  1T43 A;  3F92 A;  3GLH E;  1EFU B;  3IEC A;  1SG9 A;  3FRH A;  1VQ1 A;  2CWB A;  1G3I A;  1JR3 E;  1TTE A;  2DAE A;  1VG5 A;  2DAK A;  1VEK A;  2H5X A;  2BWB A;  2DNA A;  2MRO B;  2OO9 A;  1G4A E;  3B89 A;  1ZMU A;  2QNJ A;  1NV8 A;  2DHY A;  1WJ7 A;  2EJS A;  1IXS A;  4R71 A;  1DV0 A;  2EKK A;  2JY5 A;  4F2L A;  1C7Y A;  4F1I A;  1ZMV A;  1NV9 A;  1Y8G A;  1E94 E;  1HT1 E;  1WIV A;  2KHH A;  2JUJ A;  3T6P A;  2BWE A;  2JZ1 A;  1YLA A;  2QSF X;  3FRI A;  2RRU A;  3MMP A;  1CUK A;  2JY8 A;  1WGL A;  2LVQ D;  3BBZ A;  3FE3 A;  3GLI E;  2L2D A;  1OKS A;  2OOB A;  2WZJ A;  1OQY A;  2LVO C;  1VEJ A;  2DZL A;  2QHO B;  1VDL A;  2LVN C;  1XXH E;  1HJP A;  2EKF A;  2LVP C;  3LCV B;  3GLF E;  2HAK A;  1A5T A;  2G3Q A;  4Q7J A;  2O25 A;  3H4J A;  2DAM A;  4DBG B;  1MN3 A;  1XB2 B;  2DEN A;  3GLG E;  1WGN A;  3LCU A;  1AIP C;  3K9P A;  2DKL A;  2B3T A; 
#chains in the Genus database with same CATH topology
 3QYE A;  3U60 B;  1XNQ M;  2XFT A;  2KNA A;  1AUA A;  3HU2 A;  3GRV A;  3HJQ A;  3K92 A;  4QHS A;  4FW9 A;  4G6Z A;  1OAI A;  3GRR A;  4R7G A;  2VQF M;  5KPR A;  1NJF A;  3U6D A;  3DA1 A;  4IBC A;  3LVW A;  4KOD A;  4YY3 M;  4AQY M;  3FTE A;  2QP9 X;  3KSX A;  1HT2 E;  2L4F A;  4LY6 A;  3RE8 A;  1QAO A;  1TR8 A;  2UXB M;  2J5Y A;  1K3W A;  1IBM M;  1IM2 A;  4M0D A;  2V6Z M;  4LF9 M;  4L4U A;  1T6O A;  1GLN A;  1NVM A;  1R6B X;  4B7H A;  1N78 A;  2XZU A;  2DAG A;  2ZAO A;  3TQS A;  3KFU G;  2CFO A;  1NHW C;  2HL7 A;  1C1K A;  2A5Y B;  2JNH A;  4CJ6 A;  4GEW A;  4DR4 M;  2E5L M;  3FKE A;  5DNY A;  4K0K M;  4G4N A;  2ZBK B;  3B7Z A;  5E26 A;  2K9D A;  1TF0 B;  3GLH B;  2UU9 M;  1Z5C A;  5BPV A;  2JA2 A;  3QWL A;  4G3O A;  3FTF A;  2UUA M;  1SXJ C;  2LH0 A;  3KS4 A;  3HY5 A;  1EFU B;  4GC5 A;  3LW5 F;  3VDU A;  2F5Q A;  4AKG A;  4XBO A;  3DZD A;  3RFW A;  3GLF A;  3KS8 A;  4LCB A;  4B3T M;  4JI4 M;  2DWN A;  2CUZ A;  1G3I A;  4AKI A;  3Q8X A;  3I4V A;  2WSF F;  1TTE A;  5A2Q S;  4DR1 M;  2DAK A;  2H5X A;  1NSF A;  3SHG B;  1L2D A;  5EP3 A;  3GPU A;  4JI6 M;  4MGH A;  1EE8 A;  3SAS A;  1GJT A;  2R46 A;  1YE9 A;  2OO9 A;  1G59 A;  4LF8 M;  2W82 A;  2V1U A;  3R8F A;  5EXX A;  2D7E A;  1ZMU A;  2D7H A;  4NSO B;  1FJG M;  3V76 A;  2KA6 B;  1IXS A;  2Q2E B;  2LHC A;  3E4R A;  2EKK A;  3HU1 A;  2EUC A;  5EJC A;  3VDP A;  4JN6 A;  4Z6Y A;  4HLQ A;  5KPZ A;  1C7Y A;  3UGJ A;  4NXN M;  1HNZ M;  4S12 A;  3VFD A;  4LFC M;  2BNK A;  2ZAM A;  3KOX E;  4FVM A;  3U60 A;  3U6Q A;  4IBJ A;  3BXW A;  1QDT A;  4B7G A;  2L09 A;  1E94 E;  1HT1 E;  3B7N A;  1XNR M;  2BJV A;  2GNO A;  1XMO M;  2JUJ A;  4ANR A;  3T6P A;  2CE7 A;  2C9O A;  4FWG A;  4QOS A;  1HR0 M;  4DUZ M;  4D81 A;  1G8P A;  3VK7 A;  3FRI A;  3J2P B;  4REZ A;  4B3R M;  1LTM A;  2DWZ B;  4NL4 H;  3HHZ A;  3SFZ A;  2R4J A;  3GRU A;  1LV7 A;  4FCT A;  1W5T A;  1WGL A;  2JY8 A;  2LVQ D;  3FE3 A;  3GLI E;  1XXH B;  3LQQ A;  3U6E A;  2Z7J A;  1R2Y A;  3MHV C;  3SBJ A;  2MH8 A;  1OQY A;  2LVO C;  1N75 A;  1VEJ A;  2DZL A;  3AFH A;  1XWI A;  2VF8 A;  4DV3 M;  4B3S M;  4AZF A;  3L25 A;  4LG2 A;  3GLH A;  3LCV B;  3GLG B;  1H6U A;  2M5Z A;  4IBF A;  2G3Q A;  1J09 A;  2Z3X A;  2CEA A;  4LJ7 A;  2JXN A;  3J7B A;  4FWD A;  4R3D A;  3PNV A;  2WSC F;  3ZH9 B;  4DBG B;  2HCB A;  4DR2 M;  3TWL A;  1VDD A;  2CRU A;  4OX9 M;  3LCU A;  3LMM A;  1IXR C;  3SYL A;  4B7F A;  4M9X A;  4RF0 A;  3DFZ A;  4GMQ A;  4JV5 M;  4GIT A;  2B3T A;  4WW0 A;  1IN8 A;  4P17 A;  5ITX A;  3W0F A;  4LF4 M;  1SXJ B;  1V92 A;  3HHY A;  4X64 M;  1E32 A;  2C9C A;  3R9X B;  1G41 A;  3FUX A;  1TH2 A;  4IJF A;  3ZC7 B;  4EIW A;  1SXJ D;  1WHC A;  2V1C A;  3IG8 A;  2J7N A;  2ZAN A;  4XK8 F;  1ZV1 A;  4GKK M;  2I7N A;  3K1J A;  2KNV A;  4LF7 M;  5DFL A;  4NRW A;  1I94 M;  4GKJ M;  4X65 M;  2CV0 A;  1DGB A;  2FOI C;  4G4Q A;  3CF6 E;  1NHG C;  2XSZ A;  4KT0 F;  1QZE A;  4LZJ A;  5LMU M;  2MGW A;  4LF6 M;  1WR1 B;  4JXJ A;  4BLC A;  4A3V B;  2LBC A;  3IHP A;  3M6A A;  1Z59 A;  1Q02 A;  1L1Z A;  3TPZ A;  5C1B A;  2OOA A;  2YQZ A;  4NRV A;  4IBB A;  3TE6 A;  1QDR A;  4PD2 A;  2L4E A;  4II7 A;  2LVA A;  4LFA M;  1ZMW A;  1IN6 A;  3D8B A;  4FWH A;  3VKH A;  2ZTC A;  3M7G A;  3T15 A;  3C58 A;  1QAN A;  1L2B A;  2R18 A;  2C99 A;  1DGH B;  4NSR A;  3HJS A;  2WSE F;  2JZ0 A;  4JI3 M;  4OVZ B;  1GO5 A;  2CP8 A;  5FLX S;  4GHL A;  3B7Q A;  3THG A;  1N33 M;  1OTR A;  3F92 A;  1ZQ9 A;  1N77 A;  4L16 A;  3GPY A;  4B08 A;  1J7K A;  3U5Z A;  1MX0 A;  1XXH A;  2H1R A;  2D7G A;  1JR3 D;  4PCZ A;  2F5S A;  1HNW M;  3AOE C;  2CWB A;  3RGS A;  5LMN M;  2GQF A;  3MJ5 A;  4FCW A;  3UMM A;  3FUV A;  5EXT A;  3FD9 A;  1Q39 A;  2CHQ A;  1L2C A;  2QEN A;  2J7O A;  1PJS A;  5ITY A;  3GLI B;  3GLG A;  3TWM A;  2DNA A;  4AKH A;  1IY2 A;  2Y21 A;  2MRO B;  1EIJ A;  5FSW A;  1YSY A;  3A98 B;  3B89 A;  2XFS A;  1NV8 A;  1W5S A;  3KSJ A;  4R71 A;  2FS1 A;  4MGI E;  1QQW A;  4D80 A;  2JY5 A;  3GPX A;  4DUY M;  4F2L A;  2HHH M;  4F1I A;  4GRI A;  4FD2 A;  1S3S A;  1ZMV A;  2DZN B;  4AW4 A;  1QZM A;  1TDH A;  3KOW E;  4MGK E;  4Z8X A;  2QBY A;  1SXJ A;  5EP1 A;  4X66 M;  2DHR A;  2QZ4 A;  3PFI A;  3J27 B;  2KRU A;  4JI1 M;  3HU3 A;  3J81 S;  3SHF A;  4KHP M;  2JWS A;  1IXZ A;  3EIE A;  1D0K A;  1Q3C A;  2QSF X;  4PT5 A;  5L8R F;  1XC8 A;  3CTW B;  2KEB A;  3UK6 A;  3NBX X;  2QCU A;  4RKU F;  1UM8 A;  3ZQJ A;  3GO8 A;  1J5E M;  1JB0 F;  3BBZ A;  2F5O A;  2L2D A;  3C9P A;  3M0E A;  1YUB A;  1IN5 A;  2OOB A;  2CHG A;  4L78 A;  2WZJ A;  5JI3 E;  1PJJ A;  4ITQ A;  2X8A A;  3ILK A;  4LRS A;  2QHO B;  2LVN C;  3CF2 A;  3E9S A;  1Z5B A;  2R4E A;  2C98 A;  3GLF E;  3FUU A;  1DGH A;  2XSZ D;  3GQ4 A;  2L6O A;  2O25 A;  2DAM A;  1QVR A;  3WHK A;  2R45 A;  2DWL A;  5FTN A;  1JR3 A;  1X37 A;  2XGN A;  4QHT A;  3T38 A;  5GKN A;  2K6B A;  3GPP A;  4DV5 M;  2XH9 A;  1TGU A;  2UUC M;  2KDL A;  3U6C A;  4IBI A;  2MJ5 B;  1IY0 A;  3NBI A;  3C3D A;  5KPT A;  3U6L A;  3U6M A;  5FTL A;  2F4V M;  2KRK A;  1TH3 A;  4LJ4 A;  4Y28 F;  4QNR A;  4LZZ A;  4X62 M;  2Y0Q A;  1IQP A;  1PGY A;  2DI0 A;  2R44 A;  3E46 A;  5DYG A;  1PJQ A;  2XEP A;  5IRE B;  3PNY A;  4AG5 A;  4MH0 E;  1E9R A;  4DR7 M;  3AJI B;  3SMS A;  1DO2 A;  1GL6 A;  4L15 A;  2K0B X;  4WP2 A;  5KQ8 A;  2ZM6 M;  1VEG A;  2X4A A;  3DOA A;  3VK8 A;  2DXI A;  1R4G A;  1UFZ A;  4GC9 A;  2FE8 A;  3VLF B;  1L1T A;  3L2A A;  1PJI A;  2EO2 A;  3UJN A;  4JI5 M;  3ZCB B;  4CIS A;  4JI7 M;  3AV0 A;  1NJG A;  4QNM A;  8CAT A;  4AI6 A;  1WXQ A;  3KP0 E;  1Z5A A;  3K9O A;  3VKG A;  4JI2 M;  2HWJ A;  5ITT A;  2XLJ A;  5JI2 E;  2Y20 A;  5FTJ A;  2CV2 A;  2AHM A;  3A46 A;  4I8O A;  2X49 A;  3GLH E;  4FCV A;  4RNA A;  3IEC A;  4NC6 A;  1SG9 A;  3FRH A;  5EQT A;  1IY1 A;  1HQC A;  3KOZ E;  2R6F A;  2OQ4 A;  3SMP A;  3NWL A;  3B9P A;  1NO1 A;  4DV7 M;  1VEK A;  4JYA M;  1ZAE A;  3I04 M;  3K8Z A;  4IIW A;  3EIH A;  2BWB A;  1Q3B A;  2UXD M;  3IG5 A;  4TUW A;  4LJ9 A;  3HHX A;  5ITX E;  2LNH C;  3T1H M;  5EXP A;  1DV0 A;  1XMQ M;  5IT9 S;  3GLF B;  4IBG A;  2UUB M;  4KO8 A;  4DR6 M;  2ERC A;  4CIZ A;  4I5S A;  4OU7 A;  1JQJ C;  2YR0 A;  5E6J A;  4CHT B;  4JI8 M;  2DZO B;  1NV9 A;  4PDG A;  3FUT A;  3I51 A;  4YHH M;  2C5R A;  4LF5 M;  4PDI A;  2RKO A;  1GAB A;  1I4W A;  2G8L A;  2L7I A;  1D2N A;  1R2Z A;  2R62 A;  3PXG A;  3MK6 A;  5EP4 A;  4D82 A;  1NY6 A;  2KHH A;  4BB9 A;  1G71 A;  2LWX A;  3LVV A;  2APL A;  3HWS A;  3T1Y M;  4JI0 M;  2EA0 A;  2BWE A;  2JZ1 A;  2VQE M;  1IXS B;  1KSF X;  3SYK A;  5ITU A;  1IN7 A;  1OAO C;  2UXC M;  5IWA M;  5EP2 A;  3HGI A;  5EXS A;  2RRU A;  1DGG A;  3HJ8 A;  3SC3 A;  1R5L A;  2F5N A;  3KP1 E;  3CGW A;  5KO3 A;  1GKI A;  1PJT A;  2KZU A;  2XF3 A;  3KVW A;  4L8R C;  3CF0 A;  1OKS A;  1PM5 A;  3SAR A;  3D8L A;  3FTD A;  2KW0 A;  4LGM A;  4M9S A;  4LJ5 A;  4AG6 A;  1XXH E;  2HAK A;  1A5T A;  3SAV A;  3JAM S;  4Q7J A;  3QYB A;  2XZF A;  2QQ8 A;  3H4J A;  3FTC A;  4XGI A;  1MN3 A;  1XB2 B;  2DEN A;  3BOS A;  4GIP A;  1N36 M;  3RGP A;  4LFB M;  3GLG E;  1WGN A;  1TH4 A;  4IJE A;  3K9P A;  4RF1 A;  4DR5 M;  3QAU A;  1OFI A;  4DV1 M;  4DV0 M;  3GQ3 A;  2MR9 A;  2R0I A;  5F3W A;  2VF7 A;  3FYD A;  1OFH A;  3W68 A;  3A45 A;  3B74 A;  2CV1 A;  3SAT A;  2K47 A;  2CHV A;  2YNM D;  2LXE A;  2DVW B;  1D0L A;  1TDZ A;  2DAI A;  1V33 A;  1SXJ E;  2LTU A;  3AKZ A;  3TWK A;  2FFJ A;  1IFY A;  2RGO A;  4P16 A;  4KLN A;  1E9S A;  1V34 A;  2KNZ A;  3KOY E;  2N35 A;  4HEO A;  3L26 A;  1BVS A;  4OVZ A;  2Y0T A;  4DV2 M;  1D0M A;  2JY6 B;  3J80 S;  3PVS A;  1IBL M;  1KYI A;  5FTM A;  1GVN A;  5ITR A;  1DGF A;  1MU5 A;  2KXE A;  2O01 F;  4W5W A;  1P3Q Q;  4MM3 B;  3TL4 X;  1QUS A;  4DR3 M;  1NY5 A;  4CGY B;  2DWM A;  2JP7 A;  1F4I A;  1R7R A;  5KQD A;  1HNX M;  2R65 A;  3E21 A;  1GJS A;  4WUR A;  1QAM A;  1DO0 A;  3GLI A;  4UN2 B;  2ZTD A;  1HQY E;  2JY7 A;  2OPF A;  3SAU A;  4DV6 M;  3KW6 A;  3HZJ A;  3JR5 A;  1T43 A;  3J7A S;  1OIZ A;  3U61 B;  2RGH A;  3L27 A;  3W67 A;  1VQ1 A;  3WHL A;  4LJ8 A;  2VDB B;  1K3X A;  3HHW A;  1JR3 E;  2BJW A;  2O5R A;  1VG5 A;  2DAE A;  4OW0 A;  4IBD A;  4NXM M;  4I81 A;  2M60 A;  4M0W A;  1FNN A;  2QPA A;  3GQ5 A;  1NNJ A;  1G4A E;  4QOZ C;  1NNU C;  3JR4 A;  1XHB A;  2L7H A;  5C18 A;  3U5Z B;  2QNJ A;  5DYI A;  2DHY A;  2EJS A;  1WJ7 A;  1L8Q A;  4BBA A;  3A42 A;  1IBK M;  2KZS A;  3FYC A;  3W0L B;  4DV4 M;  4B3M M;  4I4L A;  4IBK A;  4MB7 A;  2FH0 A;  3HKP A;  3U6S A;  4MGY E;  3I01 M;  1Y8G A;  5IZ7 D;  4LRT A;  2C96 A;  5H37 D;  4NOO B;  1WIV A;  1PRB A;  3Q8G A;  4IBE A;  2VII A;  2Z4R A;  2G5G X;  2LHG A;  3H4M A;  3L29 A;  3GP1 A;  1KFV A;  1YLA A;  3K2L A;  2NQ8 C;  3LQR A;  1QAQ A;  1QUT A;  2Z4S A;  4GHA A;  3U6O A;  3MMP A;  5FTK A;  4ZPX A;  1CUK A;  1IN4 A;  1K82 A;  2QBY B;  3C3E A;  1N32 M;  3I4Y A;  3L28 A;  4M9Z A;  4G4O A;  3AL0 C;  2FNA A;  2P5T A;  1GL7 A;  1N34 M;  4LGY A;  1MJG M;  2I7P A;  3HX3 A;  1VDL A;  4HL4 A;  4LJ6 A;  3AOG A;  4LJA A;  1HJP A;  2EKF A;  7CAT A;  2LVP C;  1T3T A;  1RU3 A;  3UZU A;  4G4R A;  1ORY B;  1Z6T A;  3SAW A;  2F5P A;  5BR8 M;  3KXE C;  3GRY A;  4L6V 6;  5ITQ A;  3AOE A;  3U61 A;  3OTO M;  4GH9 A;  4MGZ E;  1QYR A;  1AIP C;  2YFQ A;  3KDS E;  2HKJ A;  3U6P A;  1OIP A;  1OJL A;  2DKL A;  3FUW A;  2Z8Y M; 
#chains in the Genus database with same CATH homology
 2MJ5 B;  2MR9 A;  2R0I A;  2KNA A;  1V92 A;  1OAI A;  1G41 A;  1WHC A;  1PGY A;  2DAI A;  2DI0 A;  1ZV1 A;  3E46 A;  1HT2 E;  2L4F A;  2LTU A;  1TR8 A;  1IFY A;  2KNV A;  5DFL A;  1IM2 A;  1DO2 A;  2KNZ A;  1T6O A;  4HEO A;  2K0B X;  1BVS A;  4WP2 A;  1VEG A;  1QZE A;  2MGW A;  1R4G A;  1UFZ A;  1WR1 B;  2JY6 B;  2DAG A;  2LBC A;  3IHP A;  1KYI A;  1Q02 A;  2JNH A;  2OOA A;  4GEW A;  1P3Q Q;  2L4E A;  2LVA A;  1ZMW A;  2JP7 A;  1F4I A;  2ZTC A;  3K9O A;  2K9D A;  3E21 A;  2HWJ A;  1DO0 A;  4UN2 B;  2JZ0 A;  1HQY E;  2JY7 A;  2ZTD A;  5JI2 E;  1GO5 A;  2CP8 A;  4G3O A;  1OTR A;  1T43 A;  3F92 A;  3GLH E;  1EFU B;  3IEC A;  1SG9 A;  3FRH A;  1VQ1 A;  2CWB A;  1G3I A;  1JR3 E;  1TTE A;  2DAE A;  1VG5 A;  2DAK A;  1VEK A;  2H5X A;  2BWB A;  2DNA A;  2MRO B;  2OO9 A;  1G4A E;  3B89 A;  1ZMU A;  2QNJ A;  1NV8 A;  2DHY A;  1WJ7 A;  2EJS A;  1IXS A;  4R71 A;  1DV0 A;  2EKK A;  2JY5 A;  4F2L A;  1C7Y A;  4F1I A;  1ZMV A;  1NV9 A;  1Y8G A;  1E94 E;  1HT1 E;  1WIV A;  2KHH A;  2JUJ A;  3T6P A;  2BWE A;  2JZ1 A;  1YLA A;  2QSF X;  3FRI A;  2RRU A;  3MMP A;  1CUK A;  2JY8 A;  1WGL A;  2LVQ D;  3BBZ A;  3FE3 A;  3GLI E;  2L2D A;  1OKS A;  2OOB A;  2WZJ A;  1OQY A;  2LVO C;  1VEJ A;  2DZL A;  2QHO B;  1VDL A;  2LVN C;  1XXH E;  1HJP A;  2EKF A;  2LVP C;  3LCV B;  3GLF E;  2HAK A;  1A5T A;  2G3Q A;  4Q7J A;  2O25 A;  3H4J A;  2DAM A;  4DBG B;  1MN3 A;  1XB2 B;  2DEN A;  3GLG E;  1WGN A;  3LCU A;  1AIP C;  3K9P A;  2DKL A;  2B3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...