2JY5A

Nmr structure of ubiquilin 1 uba domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
b'GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquilin-1
publication title Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy5A00
2MROB 2K0BX 2DHYA 1WHCA 2HWJA 2RRUA 3GLGE 1ZMWA 1T6OA 2LBCA 1WIVA 2BWBA 2EKFA 2LVAA 1MN3A 3GLFE 3F92A 2QSFX 3FE3A 1HQYE 1QZEA 1OKSA 3IHPA 1OQYA 2L2DA 1VG5A 1NV8A 1VQ1A 1E94E 2O25A 2DAMA 1SG9A 2JUJA 1OAIA 2DAEA 2L4EA 3T6PA 1P3QQ 1F4IA 2ZTCA 1WGNA 2KNAA 3LCUA 2H5XA 1WGLA 1IFYA 4GEWA 2G3QA 1G41A 1WR1B 2DI0A 2LVOC 1YLAA 2JZ1A 1XB2B 1Y8GA 1CUKA 2LVQD 4HEOA 3FRHA 2KNZA 4G3OA 2JZ0A 1T43A 4Q7JA 1UFZA 2JY7A 2LTUA 5DFLA 5JI2E 2JY6B 1HJPA 1R4GA 3LCVB 1XXHE 2JNHA 1IM2A 3BBZA 3MMPA 1DO0A 1WJ7A 2OO9A 2MGWA 2OOAA 1ZMUA 3E46A 2B3TA 3K9OA 2DKLA 2DZLA 1JR3E 2CP8A 1BVSA 1VEGA 1TR8A 2OOBA 1KYIA 2EJSA 2LVPC 1V92A 4UN2B 2KHHA 1EFUB 2CWBA 1A5TA 2JY5A 4F1IA 3K9PA 2R0IA 2BWEA 2L4FA 1C7YA 2HAKA 2JP7A 2K9DA 2DENA 1G3IA 4F2LA 1VEJA 4R71A 1HT2E 2MR9A 1TTEA 1NV9A 2DAKA 2EKKA 3B89A 4DBGB 1PGYA 2QHOB 3E21A 1OTRA 1VDLA 3H4JA 1GO5A 1G4AE 2LVNC 1ZV1A 1IXSA 4WP2A 2JY8A 3GLIE 3IECA 2MJ5B 1ZMVA 3FRIA 1HT1E 2DAIA 2DNAA 3GLHE 1DV0A 1AIPC 1DO2A 1VEKA 2DAGA 1Q02A 2QNJA 2WZJA 2KNVA 2ZTDA
chains in the Genus database with same CATH superfamily
2EA0A 2LH0A 4DV4M 1IBKM 4I4LA 4FVMA 4KLNA 2DHYA 2DZOB 3E4RA 3GLGE 2J7OA 1I4WA 4Z6YA 4PD2A 1ORYB 1SXJD 4M9XA 4B3MM 5C1BA 4OVZB 3LMMA 3V76A 3B9PA 3F92A 5EP3A 2CV1A 4LF6M 1GL7A 1QZEA 3C3DA 3IHPA 2Y21A 4DR4M 3NBIA 4LRTA 1ZAEA 2RGHA 4PDIA 3E9SA 5LMUM 1IXSB 1K82A 1SG9A 4DR1M 4JN6A 3HJ8A 1OAIA 3GQ4A 3GPYA 4LFAM 4NRWA 1SXJC 4IBBA 2CHQA 2L4EA 4PT5A 1R5LA 1Z59A 3Q8GA 3TWLA 3B74A 3HKPA 1MX0A 4KODA 4OW0A 3SAUA 1P3QQ 3GLIA 3U5ZB 4JI7M 4I81A 1PJIA 1WGNA 5EP2A 3HX3A 2QENA 3GLHA 2DWLA 2K47A 3HY5A 2ZBKB 1G41A 2X8AA 1HNWM 3U61B 1YLAA 2FOIC 2UUBM 2JZ1A 2ZM6M 1NY5A 3U6LA 1GABA 3MHVC 5KQDA 4GKJM 2F5QA 3MK6A 2HCBA 1D0LA 2KDLA 2VDBB 3LQRA 2QP9X 3AOGA 2L7HA 3U60B 3PNVA 4II7A 3FTCA 2JZ0A 2QPAA 5EJCA 4Q7JA 4FWGA 3J81S 2LTUA 2KW0A 5DFLA 3KOXE 4RF0A 2JNHA 1IXRC 5FTMA 3HU2A 1IM2A 3MMPA 2OO9A 4LF5M 1ZMUA 3E46A 2B3TA 3I4YA 4JI2M 4NXNM 3I4VA 2CP8A 1BVSA 3A45A 4JI0M 1GJTA 4JI5M 3RGSA 1J5EM 4TUWA 3SC3A 1TR8A 3GRRA 1PJTA 5EP4A 3CF0A 5BR8M 2DXIA 2FFJA 3K8ZA 1QDTA 1IN8A 1LTMA 5EXTA 5H37D 1KYIA 5IREB 4UN2B 1NSFA 1OFHA 1N77A 3PVSA 4M0DA 2Z7JA 2XGNA 1Q3BA 1QZMA 4KT0F 3KOZE 2CFOA 2G8LA 3LQQA 2BJVA 1C7YA 4MGHA 2K9DA 3DA1A 2C96A 2DENA 4RF1A 2R65A 1LV7A 3J27B 4F2LA 4K0KM 3VKGA 1NV9A 2BJWA 3GLFB 1L2DA 1DGBA 2D7HA 3KFUG 4L6V6 4JI3M 4YY3M 1OTRA 3W67A 1GO5A 3ZQJA 4LF9M 2HL7A 1NY6A 3D8BA 1HQCA 2VQFM 2LVNC 1GVNA 1ZV1A 4NRVA 1TH4A 2CUZA 4OU7A 4M9SA 5FTKA 5ITQA 3IECA 1XC8A 3BXWA 2QZ4A 1ZMVA 2ZAMA 3GPPA 1YUBA 1DV0A 1JB0F 3ZCBB 4AKGA 1WXQA 1DO2A 2DAGA 3UMMA 4PCZA 2WZJA 2C5RA 4GMQA 4AW4A 3AL0C 3CGWA 3K92A 2O01F 2L6OA 2RRUA 1XHBA 4PDGA 3SHGB 1ZMWA 2J5YA 1XNRM 2EKFA 4IBJA 4LF4M 2LVAA 4L16A 4LJAA 2CRUA 4QNRA 3T15A 3U6OA 1HQYE 3WHLA 1N32M 3IG5A 1OKSA 2UUAM 2Z8YM 1SXJB 1NHGC 3KDSE 5EP1A 2KEBA 3CF6E 1NV8A 1VQ1A 1K3WA 3SARA 3HJQA 1TH3A 1E32A 3L2AA 3CF2A 3FUUA 4IIWA 4NL4H 1V34A 2C98A 3UZUA 3LVVA 1YSYA 4GHAA 1NJFA 5DYGA 4AZFA 4IBCA 2XEPA 3AKZA 2R62A 2Z3XA 1F4IA 4RNAA 5KQ8A 3LCUA 2H5XA 4Z8XA 3SHFA 3SATA 1KSFX 1DGHB 2UXDM 2Z4SA 4JI6M 1XMQM 1PRBA 2NQ8C 3U6EA 2CHGA 1ZQ9A 2GQFA 4LF7M 2DWNA 1RU3A 2CE7A 2XFSA 4LJ6A 3HHXA 2Y20A 5FTLA 5LMNM 3C3EA 3U6QA 1XMOM 3RE8A 3KOYE 4LCBA 2KNZA 1OJLA 3GLGA 2M5ZA 8CATA 1J09A 2I7NA 2HKJA 3FUWA 4RKUF 4X64M 4YHHM 2APLA 1GJSA 4LJ7A 4S12A 1IN6A 1R4GA 2QBYB 3LCVB 4NSRA 2OPFA 2E5LM 4ITQA 4QNMA 3FUVA 3PNYA 4B3SM 4LGYA 1DO0A 1WJ7A 2VQEM 4DR2M 2G5GX 1PJJA 4CJ6A 1Z6TA 2DKLA 2V1UA 2JWSA 3DZDA 4AG5A 4GIPA 2H1RA 3PXGA 5L8RF 3GLIB 1OAOC 4OX9M 4FWHA 4DV6M 3U6MA 1VEGA 4NOOB 2HHHM 3B7NA 4NXMM 3H4MA 4AG6A 3KW6A 3GLHB 1NNUC 1OIZA 2RGOA 2OOBA 1NNJA 1G59A 1IBMM 4JI8M 4DR6M 4DR3M 2EJSA 2VF8A 1L1TA 2KRKA 2KHHA 1EFUB 1S3SA 2CWBA 3LVWA 3FKEA 1L2CA 1OIPA 3GQ3A 3SASA 3U5ZA 4F1IA 2DZNB 4JV5M 4LJ5A 1Z5BA 1VDDA 3HJSA 3L27A 2GNOA 3KXEC 1TGUA 1R2ZA 3GRYA 3KP1E 1XNQM 4LRSA 1HT2E 2MR9A 4DV0M 3MJ5A 4DBGB 3TWMA 3QYEA 3E21A 1Q3CA 2DWZB 2MH8A 3SBJA 1VDLA 2VF7A 3K2LA 2UU9M 1MJGM 1QQWA 1NVMA 4IBGA 3FTFA 4IBIA 4WP2A 1IY0A 3AFHA 3L29A 2FNAA 3LW5F 1Z5AA 2Y0QA 3B7QA 2CEAA 3NBXX 3NWLA 3RGPA 4DV3M 5ITTA 3FRIA 2DAIA 4M9ZA 4MM3B 4B3TM 2X49A 4LF8M 1QAMA 2CHVA 4LJ8A 1AIPC 4G4NA 1L1ZA 3QAUA 4MGKE 3GPXA 5BPVA 3HU3A 2XSZD 2QNJA 1TF0B 3GQ5A 1QDRA 3SFZA 4LG2A 1J7KA 4QOSA 2ZAOA 4DV5M 2KA6B 2MROB 4AKHA 3AJIB 4B3RM 2F5PA 4IBKA 1WHCA 3VFDA 2LHGA 5F3WA 1E9RA 4R7GA 1G8PA 2BWBA 3M6AA 4L78A 1HNZM 4B7GA 5IZ7D 3TL4X 5ITXE 1AUAA 1MN3A 3GLFE 2JA2A 2KZSA 2X4AA 4QHSA 3GRUA 1PM5A 4FD2A 1OQYA 3UJNA 1XXHB 2DAMA 3UK6A 2EUCA 3C9PA 1QANA 2JUJA 4REZA 4FCTA 3THGA 3L28A 2DAEA 3KS4A 3I04M 5ITXA 4AKIA 3J2PB 5FLXS 4G4QA 2KRUA 2LHCA 2WSCF 4X65M 3TWKA 4XK8F 3T38A 4CGYB 4I5SA 1W5SA 2ZTCA 3KP0E 4B7FA 3L25A 3T1YM 2F5OA 1IFYA 1N34M 2N35A 3T1HM 1TDZA 2QQ8A 4P17A 5GKNA 4GHLA 4GC9A 3TE6A 1WR1B 3L26A 2DI0A 4FCWA 2C9OA 2CV2A 1HNXM 1XB2B 1CUKA 1PJQA 2LWXA 2LVQD 3M0EA 5FTJA 4XGIA 5FSWA 1NJGA 4CISA 2A5YB 2LXEA 4LJ9A 2F5SA 4G3OA 2FS1A 4A3VB 7CATA 1HR0M 1EE8A 3JR5A 1UFZA 3FUTA 2JY7A 1N78A 2DHRA 1HJPA 1V33A 3WHKA 4GITA 4MGYE 3KSJA 4L15A 1EIJA 4GKKM 3B7ZA 4G4OA 4QOZC 2YFQA 2MGWA 2OOAA 1K3XA 4D82A 1JR3E 2I7PA 2P5TA 2R46A 4Y28F 1I94M 2FH0A 1DGFA 1TDHA 5KO3A 4AQYM 3TPZA 2WSEF 3EIHA 3GP1A 2XZFA 1PJSA 1R2YA 5E26A 3UGJA 2LVPC 2FE8A 4HLQA 4XBOA 4HL4A 3R9XB 1KFVA 3FTDA 3VLFB 3QYBA 4FCVA 1NO1A 3PFIA 2Q2EB 1A5TA 3DOAA 3GPUA 4LGMA 3K9PA 5KPTA 1FNNA 3U6SA 2BWEA 3GLGB 2L4FA 1R7RA 2V6ZM 1X37A 1YE9A 4LZZA 2KXEA 1G3IA 2XLJA 4FW9A 2DAKA 2XH9A 3B89A 2QCUA 4IJFA 4M0WA 4OVZA 3I01M 1PGYA 5EXXA 1H6UA 5EQTA 4QHTA 4BLCA 4JI1M 2J7NA 3Q8XA 2BNKA 4LZJA 4NC6A 3FTEA 1JQJC 4LY6A 3VK7A 1L8QA 4DV2M 1IXSA 3SAWA 4DV1M 3R8FA 4IJEA 3GLIE 3U6DA 1JR3D 3U6PA 1IQPA 1HT1E 3HGIA 2QBYA 3A98B 3GLHE 3VDUA 4MGIE 5JI3E 5ITUA 1D0KA 1MU5A 1Q02A 4BBAA 2ZTDA 4GH9A 2XSZA 4LFBM 1GLNA 4FWDA 2D7GA 5EXSA 2K0BX 2XFTA 3GO8A 3W68A 2M60A 3A46A 2HWJA 5A2QS 3U61A 4LJ4A 2XF3A 2LBCA 1T6OA 2K6BA 1WIVA 2O5RA 3J7AS 3KS8A 3HHZA 1W5TA 3VDPA 2D7EA 2YNMD 3M7GA 4P16A 3HHYA 3SMPA 4X62M 3HU1A 2QSFX 2R4JA 3FE3A 3KVWA 4LFCM 1N33M 3U60A 2L2DA 3AV0A 1VG5A 3FUXA 5ITRA 2OQ4A 2EO2A 1E94E 2O25A 4WW0A 2Z4RA 5EXPA 2Y0TA 3FYDA 5C18A 2UUCM 1IN5A 1E9SA 2C9CA 1T3TA 3BOSA 3OTOM 4JI4M 3I51A 1C1KA 1IBLM 3T6PA 1IY1A 3KOWE 4JYAM 3ILKA 2KNAA 1WGLA 1G71A 4ZPXA 4X66M 3VK8A 3AOEA 3U6CA 3J7BA 4GEWA 2G3QA 2YR0A 1TH2A 1GL6A 2LVOC 2R18A 3EIEA 4DR7M 1XWIA 1IN4A 2V1CA 1R6BX 3ZC7B 1Y8GA 1QVRA 5KPZA 2UXCM 3DFZA 3W0FA 4BB9A 4MB7A 1L2BA 3QWLA 4HEOA 3FRHA 3JR4A 4DR5M 4NSOB 4GRIA 4R3DA 4MGZE 3SYKA 5DNYA 5FTNA 5IT9S 1T43A 2DVWB 3RFWA 1QUTA 3IG8A 3HHWA 5JI2E 4DV7M 1IY2A 2JY6B 1XXHE 3GLFA 2CV0A 3BBZA 4IBDA 1QUSA 3J80S 3CTWB 2AHMA 3K9OA 2L7IA 2DZLA 2C99A 3KSXA 3GRVA 5E6JA 4ANRA 5IWAM 4DUZM 2W82A 2UXBM 3VKHA 4IBEA 2ERCA 3FD9A 2RKOA 4WURA 1XXHA 1Z5CA 3SAVA 1QAOA 1UM8A 1OFIA 2ZANA 4G4RA 3TQSA 4KO8A 1GKIA 2KZUA 2DWMA 4DUYM 3JAMS 1N75A 1QAQA 1V92A 4IBFA 3C58A 3D8LA 1IN7A 2WSFF 3HWSA 4EIWA 2JY5A 3K1JA 3AOEC 2R0IA 2R4EA 1DGGA 1SXJE 2HAKA 4B7HA 2JP7A 3A42A 2R6FA 1D2NA 1VEJA 4R71A 2XZUA 1TTEA 4D80A 2EKKA 2JXNA 3W0LB 5DYIA 2QHOB 4JXJA 4AI6A 3FYCA 1D0MA 3H4JA 3ZH9B 1IXZA 1SXJA 4CHTB 1G4AE 2YQZA 3SYLA 2L09A 2R45A 4L4UA 2JY8A 5ITYA 3HZJA 4W5WA 1N36M 1NHWC 4CIZA 2MJ5B 4D81A 2F5NA 2DNAA 2R44A 3SMSA 5KPRA 1JR3A 4GC5A 1FJGM 1Q39A 1QYRA 4G6ZA 4L8RC 4KHPM 1VEKA 4MH0E 2KNVA 2VIIA 4B08A 2LNHC 4I8OA 2F4VM 1DGHA
chains in the Genus database with same CATH topology
2MROB 2K0BX 2DHYA 1WHCA 2HWJA 2RRUA 3GLGE 1ZMWA 1T6OA 2LBCA 1WIVA 2BWBA 2EKFA 2LVAA 1MN3A 3GLFE 3F92A 2QSFX 3FE3A 1HQYE 1QZEA 1OKSA 3IHPA 1OQYA 2L2DA 1VG5A 1NV8A 1VQ1A 1E94E 2O25A 2DAMA 1SG9A 2JUJA 1OAIA 2DAEA 2L4EA 3T6PA 1P3QQ 1F4IA 2ZTCA 1WGNA 2KNAA 3LCUA 2H5XA 1WGLA 1IFYA 4GEWA 2G3QA 1G41A 1WR1B 2DI0A 2LVOC 1YLAA 2JZ1A 1XB2B 1Y8GA 1CUKA 2LVQD 4HEOA 3FRHA 2KNZA 4G3OA 2JZ0A 1T43A 4Q7JA 1UFZA 2JY7A 2LTUA 5DFLA 5JI2E 2JY6B 1HJPA 1R4GA 3LCVB 1XXHE 2JNHA 1IM2A 3BBZA 3MMPA 1DO0A 1WJ7A 2OO9A 2MGWA 2OOAA 1ZMUA 3E46A 2B3TA 3K9OA 2DKLA 2DZLA 1JR3E 2CP8A 1BVSA 1VEGA 1TR8A 2OOBA 1KYIA 2EJSA 2LVPC 1V92A 4UN2B 2KHHA 1EFUB 2CWBA 1A5TA 2JY5A 4F1IA 3K9PA 2R0IA 2BWEA 2L4FA 1C7YA 2HAKA 2JP7A 2K9DA 2DENA 1G3IA 4F2LA 1VEJA 4R71A 1HT2E 2MR9A 1TTEA 1NV9A 2DAKA 2EKKA 3B89A 4DBGB 1PGYA 2QHOB 3E21A 1OTRA 1VDLA 3H4JA 1GO5A 1G4AE 2LVNC 1ZV1A 1IXSA 4WP2A 2JY8A 3GLIE 3IECA 2MJ5B 1ZMVA 3FRIA 1HT1E 2DAIA 2DNAA 3GLHE 1DV0A 1AIPC 1DO2A 1VEKA 2DAGA 1Q02A 2QNJA 2WZJA 2KNVA 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRO B;  2K0B X;  2DHY A;  1WHC A;  2HWJ A;  2RRU A;  3GLG E;  1ZMW A;  1T6O A;  2LBC A;  1WIV A;  2BWB A;  2EKF A;  2LVA A;  1MN3 A;  3GLF E;  3F92 A;  2QSF X;  3FE3 A;  1HQY E;  1QZE A;  1OKS A;  3IHP A;  1OQY A;  2L2D A;  1VG5 A;  1NV8 A;  1VQ1 A;  1E94 E;  2O25 A;  2DAM A;  1SG9 A;  2JUJ A;  1OAI A;  2DAE A;  2L4E A;  3T6P A;  1P3Q Q;  1F4I A;  2ZTC A;  1WGN A;  2KNA A;  3LCU A;  2H5X A;  1WGL A;  1IFY A;  4GEW A;  2G3Q A;  1G41 A;  1WR1 B;  2DI0 A;  2LVO C;  1YLA A;  2JZ1 A;  1XB2 B;  1Y8G A;  1CUK A;  2LVQ D;  4HEO A;  3FRH A;  2KNZ A;  4G3O A;  2JZ0 A;  1T43 A;  4Q7J A;  1UFZ A;  2JY7 A;  2LTU A;  5DFL A;  5JI2 E;  2JY6 B;  1HJP A;  1R4G A;  3LCV B;  1XXH E;  2JNH A;  1IM2 A;  3BBZ A;  3MMP A;  1DO0 A;  1WJ7 A;  2OO9 A;  2MGW A;  2OOA A;  1ZMU A;  3E46 A;  2B3T A;  3K9O A;  2DKL A;  2DZL A;  1JR3 E;  2CP8 A;  1BVS A;  1VEG A;  1TR8 A;  2OOB A;  1KYI A;  2EJS A;  2LVP C;  1V92 A;  4UN2 B;  2KHH A;  1EFU B;  2CWB A;  1A5T A;  2JY5 A;  4F1I A;  3K9P A;  2R0I A;  2BWE A;  2L4F A;  1C7Y A;  2HAK A;  2JP7 A;  2K9D A;  2DEN A;  1G3I A;  4F2L A;  1VEJ A;  4R71 A;  1HT2 E;  2MR9 A;  1TTE A;  1NV9 A;  2DAK A;  2EKK A;  3B89 A;  4DBG B;  1PGY A;  2QHO B;  3E21 A;  1OTR A;  1VDL A;  3H4J A;  1GO5 A;  1G4A E;  2LVN C;  1ZV1 A;  1IXS A;  4WP2 A;  2JY8 A;  3GLI E;  3IEC A;  2MJ5 B;  1ZMV A;  3FRI A;  1HT1 E;  2DAI A;  2DNA A;  3GLH E;  1DV0 A;  1AIP C;  1DO2 A;  1VEK A;  2DAG A;  1Q02 A;  2QNJ A;  2WZJ A;  2KNV A;  2ZTD A; 
#chains in the Genus database with same CATH topology
 2EA0 A;  2LH0 A;  4DV4 M;  1IBK M;  4I4L A;  4FVM A;  4KLN A;  2DHY A;  2DZO B;  3E4R A;  3GLG E;  2J7O A;  1I4W A;  4Z6Y A;  4PD2 A;  1ORY B;  1SXJ D;  4M9X A;  4B3M M;  5C1B A;  4OVZ B;  3LMM A;  3V76 A;  3B9P A;  3F92 A;  5EP3 A;  2CV1 A;  4LF6 M;  1GL7 A;  1QZE A;  3C3D A;  3IHP A;  2Y21 A;  4DR4 M;  3NBI A;  4LRT A;  1ZAE A;  2RGH A;  4PDI A;  3E9S A;  5LMU M;  1IXS B;  1K82 A;  1SG9 A;  4DR1 M;  4JN6 A;  3HJ8 A;  1OAI A;  3GQ4 A;  3GPY A;  4LFA M;  4NRW A;  1SXJ C;  4IBB A;  2CHQ A;  2L4E A;  4PT5 A;  1R5L A;  1Z59 A;  3Q8G A;  3TWL A;  3B74 A;  3HKP A;  1MX0 A;  4KOD A;  4OW0 A;  3SAU A;  1P3Q Q;  3GLI A;  3U5Z B;  4JI7 M;  4I81 A;  1PJI A;  1WGN A;  5EP2 A;  3HX3 A;  2QEN A;  3GLH A;  2DWL A;  2K47 A;  3HY5 A;  2ZBK B;  1G41 A;  2X8A A;  1HNW M;  3U61 B;  1YLA A;  2FOI C;  2UUB M;  2JZ1 A;  2ZM6 M;  1NY5 A;  3U6L A;  1GAB A;  3MHV C;  5KQD A;  4GKJ M;  2F5Q A;  3MK6 A;  2HCB A;  1D0L A;  2KDL A;  2VDB B;  3LQR A;  2QP9 X;  3AOG A;  2L7H A;  3U60 B;  3PNV A;  4II7 A;  3FTC A;  2JZ0 A;  2QPA A;  5EJC A;  4Q7J A;  4FWG A;  3J81 S;  2LTU A;  2KW0 A;  5DFL A;  3KOX E;  4RF0 A;  2JNH A;  1IXR C;  5FTM A;  3HU2 A;  1IM2 A;  3MMP A;  2OO9 A;  4LF5 M;  1ZMU A;  3E46 A;  2B3T A;  3I4Y A;  4JI2 M;  4NXN M;  3I4V A;  2CP8 A;  1BVS A;  3A45 A;  4JI0 M;  1GJT A;  4JI5 M;  3RGS A;  1J5E M;  4TUW A;  3SC3 A;  1TR8 A;  3GRR A;  1PJT A;  5EP4 A;  3CF0 A;  5BR8 M;  2DXI A;  2FFJ A;  3K8Z A;  1QDT A;  1IN8 A;  1LTM A;  5EXT A;  5H37 D;  1KYI A;  5IRE B;  4UN2 B;  1NSF A;  1OFH A;  1N77 A;  3PVS A;  4M0D A;  2Z7J A;  2XGN A;  1Q3B A;  1QZM A;  4KT0 F;  3KOZ E;  2CFO A;  2G8L A;  3LQQ A;  2BJV A;  1C7Y A;  4MGH A;  2K9D A;  3DA1 A;  2C96 A;  2DEN A;  4RF1 A;  2R65 A;  1LV7 A;  3J27 B;  4F2L A;  4K0K M;  3VKG A;  1NV9 A;  2BJW A;  3GLF B;  1L2D A;  1DGB A;  2D7H A;  3KFU G;  4L6V 6;  4JI3 M;  4YY3 M;  1OTR A;  3W67 A;  1GO5 A;  3ZQJ A;  4LF9 M;  2HL7 A;  1NY6 A;  3D8B A;  1HQC A;  2VQF M;  2LVN C;  1GVN A;  1ZV1 A;  4NRV A;  1TH4 A;  2CUZ A;  4OU7 A;  4M9S A;  5FTK A;  5ITQ A;  3IEC A;  1XC8 A;  3BXW A;  2QZ4 A;  1ZMV A;  2ZAM A;  3GPP A;  1YUB A;  1DV0 A;  1JB0 F;  3ZCB B;  4AKG A;  1WXQ A;  1DO2 A;  2DAG A;  3UMM A;  4PCZ A;  2WZJ A;  2C5R A;  4GMQ A;  4AW4 A;  3AL0 C;  3CGW A;  3K92 A;  2O01 F;  2L6O A;  2RRU A;  1XHB A;  4PDG A;  3SHG B;  1ZMW A;  2J5Y A;  1XNR M;  2EKF A;  4IBJ A;  4LF4 M;  2LVA A;  4L16 A;  4LJA A;  2CRU A;  4QNR A;  3T15 A;  3U6O A;  1HQY E;  3WHL A;  1N32 M;  3IG5 A;  1OKS A;  2UUA M;  2Z8Y M;  1SXJ B;  1NHG C;  3KDS E;  5EP1 A;  2KEB A;  3CF6 E;  1NV8 A;  1VQ1 A;  1K3W A;  3SAR A;  3HJQ A;  1TH3 A;  1E32 A;  3L2A A;  3CF2 A;  3FUU A;  4IIW A;  4NL4 H;  1V34 A;  2C98 A;  3UZU A;  3LVV A;  1YSY A;  4GHA A;  1NJF A;  5DYG A;  4AZF A;  4IBC A;  2XEP A;  3AKZ A;  2R62 A;  2Z3X A;  1F4I A;  4RNA A;  5KQ8 A;  3LCU A;  2H5X A;  4Z8X A;  3SHF A;  3SAT A;  1KSF X;  1DGH B;  2UXD M;  2Z4S A;  4JI6 M;  1XMQ M;  1PRB A;  2NQ8 C;  3U6E A;  2CHG A;  1ZQ9 A;  2GQF A;  4LF7 M;  2DWN A;  1RU3 A;  2CE7 A;  2XFS A;  4LJ6 A;  3HHX A;  2Y20 A;  5FTL A;  5LMN M;  3C3E A;  3U6Q A;  1XMO M;  3RE8 A;  3KOY E;  4LCB A;  2KNZ A;  1OJL A;  3GLG A;  2M5Z A;  8CAT A;  1J09 A;  2I7N A;  2HKJ A;  3FUW A;  4RKU F;  4X64 M;  4YHH M;  2APL A;  1GJS A;  4LJ7 A;  4S12 A;  1IN6 A;  1R4G A;  2QBY B;  3LCV B;  4NSR A;  2OPF A;  2E5L M;  4ITQ A;  4QNM A;  3FUV A;  3PNY A;  4B3S M;  4LGY A;  1DO0 A;  1WJ7 A;  2VQE M;  4DR2 M;  2G5G X;  1PJJ A;  4CJ6 A;  1Z6T A;  2DKL A;  2V1U A;  2JWS A;  3DZD A;  4AG5 A;  4GIP A;  2H1R A;  3PXG A;  5L8R F;  3GLI B;  1OAO C;  4OX9 M;  4FWH A;  4DV6 M;  3U6M A;  1VEG A;  4NOO B;  2HHH M;  3B7N A;  4NXM M;  3H4M A;  4AG6 A;  3KW6 A;  3GLH B;  1NNU C;  1OIZ A;  2RGO A;  2OOB A;  1NNJ A;  1G59 A;  1IBM M;  4JI8 M;  4DR6 M;  4DR3 M;  2EJS A;  2VF8 A;  1L1T A;  2KRK A;  2KHH A;  1EFU B;  1S3S A;  2CWB A;  3LVW A;  3FKE A;  1L2C A;  1OIP A;  3GQ3 A;  3SAS A;  3U5Z A;  4F1I A;  2DZN B;  4JV5 M;  4LJ5 A;  1Z5B A;  1VDD A;  3HJS A;  3L27 A;  2GNO A;  3KXE C;  1TGU A;  1R2Z A;  3GRY A;  3KP1 E;  1XNQ M;  4LRS A;  1HT2 E;  2MR9 A;  4DV0 M;  3MJ5 A;  4DBG B;  3TWM A;  3QYE A;  3E21 A;  1Q3C A;  2DWZ B;  2MH8 A;  3SBJ A;  1VDL A;  2VF7 A;  3K2L A;  2UU9 M;  1MJG M;  1QQW A;  1NVM A;  4IBG A;  3FTF A;  4IBI A;  4WP2 A;  1IY0 A;  3AFH A;  3L29 A;  2FNA A;  3LW5 F;  1Z5A A;  2Y0Q A;  3B7Q A;  2CEA A;  3NBX X;  3NWL A;  3RGP A;  4DV3 M;  5ITT A;  3FRI A;  2DAI A;  4M9Z A;  4MM3 B;  4B3T M;  2X49 A;  4LF8 M;  1QAM A;  2CHV A;  4LJ8 A;  1AIP C;  4G4N A;  1L1Z A;  3QAU A;  4MGK E;  3GPX A;  5BPV A;  3HU3 A;  2XSZ D;  2QNJ A;  1TF0 B;  3GQ5 A;  1QDR A;  3SFZ A;  4LG2 A;  1J7K A;  4QOS A;  2ZAO A;  4DV5 M;  2KA6 B;  2MRO B;  4AKH A;  3AJI B;  4B3R M;  2F5P A;  4IBK A;  1WHC A;  3VFD A;  2LHG A;  5F3W A;  1E9R A;  4R7G A;  1G8P A;  2BWB A;  3M6A A;  4L78 A;  1HNZ M;  4B7G A;  5IZ7 D;  3TL4 X;  5ITX E;  1AUA A;  1MN3 A;  3GLF E;  2JA2 A;  2KZS A;  2X4A A;  4QHS A;  3GRU A;  1PM5 A;  4FD2 A;  1OQY A;  3UJN A;  1XXH B;  2DAM A;  3UK6 A;  2EUC A;  3C9P A;  1QAN A;  2JUJ A;  4REZ A;  4FCT A;  3THG A;  3L28 A;  2DAE A;  3KS4 A;  3I04 M;  5ITX A;  4AKI A;  3J2P B;  5FLX S;  4G4Q A;  2KRU A;  2LHC A;  2WSC F;  4X65 M;  3TWK A;  4XK8 F;  3T38 A;  4CGY B;  4I5S A;  1W5S A;  2ZTC A;  3KP0 E;  4B7F A;  3L25 A;  3T1Y M;  2F5O A;  1IFY A;  1N34 M;  2N35 A;  3T1H M;  1TDZ A;  2QQ8 A;  4P17 A;  5GKN A;  4GHL A;  4GC9 A;  3TE6 A;  1WR1 B;  3L26 A;  2DI0 A;  4FCW A;  2C9O A;  2CV2 A;  1HNX M;  1XB2 B;  1CUK A;  1PJQ A;  2LWX A;  2LVQ D;  3M0E A;  5FTJ A;  4XGI A;  5FSW A;  1NJG A;  4CIS A;  2A5Y B;  2LXE A;  4LJ9 A;  2F5S A;  4G3O A;  2FS1 A;  4A3V B;  7CAT A;  1HR0 M;  1EE8 A;  3JR5 A;  1UFZ A;  3FUT A;  2JY7 A;  1N78 A;  2DHR A;  1HJP A;  1V33 A;  3WHK A;  4GIT A;  4MGY E;  3KSJ A;  4L15 A;  1EIJ A;  4GKK M;  3B7Z A;  4G4O A;  4QOZ C;  2YFQ A;  2MGW A;  2OOA A;  1K3X A;  4D82 A;  1JR3 E;  2I7P A;  2P5T A;  2R46 A;  4Y28 F;  1I94 M;  2FH0 A;  1DGF A;  1TDH A;  5KO3 A;  4AQY M;  3TPZ A;  2WSE F;  3EIH A;  3GP1 A;  2XZF A;  1PJS A;  1R2Y A;  5E26 A;  3UGJ A;  2LVP C;  2FE8 A;  4HLQ A;  4XBO A;  4HL4 A;  3R9X B;  1KFV A;  3FTD A;  3VLF B;  3QYB A;  4FCV A;  1NO1 A;  3PFI A;  2Q2E B;  1A5T A;  3DOA A;  3GPU A;  4LGM A;  3K9P A;  5KPT A;  1FNN A;  3U6S A;  2BWE A;  3GLG B;  2L4F A;  1R7R A;  2V6Z M;  1X37 A;  1YE9 A;  4LZZ A;  2KXE A;  1G3I A;  2XLJ A;  4FW9 A;  2DAK A;  2XH9 A;  3B89 A;  2QCU A;  4IJF A;  4M0W A;  4OVZ A;  3I01 M;  1PGY A;  5EXX A;  1H6U A;  5EQT A;  4QHT A;  4BLC A;  4JI1 M;  2J7N A;  3Q8X A;  2BNK A;  4LZJ A;  4NC6 A;  3FTE A;  1JQJ C;  4LY6 A;  3VK7 A;  1L8Q A;  4DV2 M;  1IXS A;  3SAW A;  4DV1 M;  3R8F A;  4IJE A;  3GLI E;  3U6D A;  1JR3 D;  3U6P A;  1IQP A;  1HT1 E;  3HGI A;  2QBY A;  3A98 B;  3GLH E;  3VDU A;  4MGI E;  5JI3 E;  5ITU A;  1D0K A;  1MU5 A;  1Q02 A;  4BBA A;  2ZTD A;  4GH9 A;  2XSZ A;  4LFB M;  1GLN A;  4FWD A;  2D7G A;  5EXS A;  2K0B X;  2XFT A;  3GO8 A;  3W68 A;  2M60 A;  3A46 A;  2HWJ A;  5A2Q S;  3U61 A;  4LJ4 A;  2XF3 A;  2LBC A;  1T6O A;  2K6B A;  1WIV A;  2O5R A;  3J7A S;  3KS8 A;  3HHZ A;  1W5T A;  3VDP A;  2D7E A;  2YNM D;  3M7G A;  4P16 A;  3HHY A;  3SMP A;  4X62 M;  3HU1 A;  2QSF X;  2R4J A;  3FE3 A;  3KVW A;  4LFC M;  1N33 M;  3U60 A;  2L2D A;  3AV0 A;  1VG5 A;  3FUX A;  5ITR A;  2OQ4 A;  2EO2 A;  1E94 E;  2O25 A;  4WW0 A;  2Z4R A;  5EXP A;  2Y0T A;  3FYD A;  5C18 A;  2UUC M;  1IN5 A;  1E9S A;  2C9C A;  1T3T A;  3BOS A;  3OTO M;  4JI4 M;  3I51 A;  1C1K A;  1IBL M;  3T6P A;  1IY1 A;  3KOW E;  4JYA M;  3ILK A;  2KNA A;  1WGL A;  1G71 A;  4ZPX A;  4X66 M;  3VK8 A;  3AOE A;  3U6C A;  3J7B A;  4GEW A;  2G3Q A;  2YR0 A;  1TH2 A;  1GL6 A;  2LVO C;  2R18 A;  3EIE A;  4DR7 M;  1XWI A;  1IN4 A;  2V1C A;  1R6B X;  3ZC7 B;  1Y8G A;  1QVR A;  5KPZ A;  2UXC M;  3DFZ A;  3W0F A;  4BB9 A;  4MB7 A;  1L2B A;  3QWL A;  4HEO A;  3FRH A;  3JR4 A;  4DR5 M;  4NSO B;  4GRI A;  4R3D A;  4MGZ E;  3SYK A;  5DNY A;  5FTN A;  5IT9 S;  1T43 A;  2DVW B;  3RFW A;  1QUT A;  3IG8 A;  3HHW A;  5JI2 E;  4DV7 M;  1IY2 A;  2JY6 B;  1XXH E;  3GLF A;  2CV0 A;  3BBZ A;  4IBD A;  1QUS A;  3J80 S;  3CTW B;  2AHM A;  3K9O A;  2L7I A;  2DZL A;  2C99 A;  3KSX A;  3GRV A;  5E6J A;  4ANR A;  5IWA M;  4DUZ M;  2W82 A;  2UXB M;  3VKH A;  4IBE A;  2ERC A;  3FD9 A;  2RKO A;  4WUR A;  1XXH A;  1Z5C A;  3SAV A;  1QAO A;  1UM8 A;  1OFI A;  2ZAN A;  4G4R A;  3TQS A;  4KO8 A;  1GKI A;  2KZU A;  2DWM A;  4DUY M;  3JAM S;  1N75 A;  1QAQ A;  1V92 A;  4IBF A;  3C58 A;  3D8L A;  1IN7 A;  2WSF F;  3HWS A;  4EIW A;  2JY5 A;  3K1J A;  3AOE C;  2R0I A;  2R4E A;  1DGG A;  1SXJ E;  2HAK A;  4B7H A;  2JP7 A;  3A42 A;  2R6F A;  1D2N A;  1VEJ A;  4R71 A;  2XZU A;  1TTE A;  4D80 A;  2EKK A;  2JXN A;  3W0L B;  5DYI A;  2QHO B;  4JXJ A;  4AI6 A;  3FYC A;  1D0M A;  3H4J A;  3ZH9 B;  1IXZ A;  1SXJ A;  4CHT B;  1G4A E;  2YQZ A;  3SYL A;  2L09 A;  2R45 A;  4L4U A;  2JY8 A;  5ITY A;  3HZJ A;  4W5W A;  1N36 M;  1NHW C;  4CIZ A;  2MJ5 B;  4D81 A;  2F5N A;  2DNA A;  2R44 A;  3SMS A;  5KPR A;  1JR3 A;  4GC5 A;  1FJG M;  1Q39 A;  1QYR A;  4G6Z A;  4L8R C;  4KHP M;  1VEK A;  4MH0 E;  2KNV A;  2VII A;  4B08 A;  2LNH C;  4I8O A;  2F4V M;  1DGH A; 
#chains in the Genus database with same CATH homology
 2MRO B;  2K0B X;  2DHY A;  1WHC A;  2HWJ A;  2RRU A;  3GLG E;  1ZMW A;  1T6O A;  2LBC A;  1WIV A;  2BWB A;  2EKF A;  2LVA A;  1MN3 A;  3GLF E;  3F92 A;  2QSF X;  3FE3 A;  1HQY E;  1QZE A;  1OKS A;  3IHP A;  1OQY A;  2L2D A;  1VG5 A;  1NV8 A;  1VQ1 A;  1E94 E;  2O25 A;  2DAM A;  1SG9 A;  2JUJ A;  1OAI A;  2DAE A;  2L4E A;  3T6P A;  1P3Q Q;  1F4I A;  2ZTC A;  1WGN A;  2KNA A;  3LCU A;  2H5X A;  1WGL A;  1IFY A;  4GEW A;  2G3Q A;  1G41 A;  1WR1 B;  2DI0 A;  2LVO C;  1YLA A;  2JZ1 A;  1XB2 B;  1Y8G A;  1CUK A;  2LVQ D;  4HEO A;  3FRH A;  2KNZ A;  4G3O A;  2JZ0 A;  1T43 A;  4Q7J A;  1UFZ A;  2JY7 A;  2LTU A;  5DFL A;  5JI2 E;  2JY6 B;  1HJP A;  1R4G A;  3LCV B;  1XXH E;  2JNH A;  1IM2 A;  3BBZ A;  3MMP A;  1DO0 A;  1WJ7 A;  2OO9 A;  2MGW A;  2OOA A;  1ZMU A;  3E46 A;  2B3T A;  3K9O A;  2DKL A;  2DZL A;  1JR3 E;  2CP8 A;  1BVS A;  1VEG A;  1TR8 A;  2OOB A;  1KYI A;  2EJS A;  2LVP C;  1V92 A;  4UN2 B;  2KHH A;  1EFU B;  2CWB A;  1A5T A;  2JY5 A;  4F1I A;  3K9P A;  2R0I A;  2BWE A;  2L4F A;  1C7Y A;  2HAK A;  2JP7 A;  2K9D A;  2DEN A;  1G3I A;  4F2L A;  1VEJ A;  4R71 A;  1HT2 E;  2MR9 A;  1TTE A;  1NV9 A;  2DAK A;  2EKK A;  3B89 A;  4DBG B;  1PGY A;  2QHO B;  3E21 A;  1OTR A;  1VDL A;  3H4J A;  1GO5 A;  1G4A E;  2LVN C;  1ZV1 A;  1IXS A;  4WP2 A;  2JY8 A;  3GLI E;  3IEC A;  2MJ5 B;  1ZMV A;  3FRI A;  1HT1 E;  2DAI A;  2DNA A;  3GLH E;  1DV0 A;  1AIP C;  1DO2 A;  1VEK A;  2DAG A;  1Q02 A;  2QNJ A;  2WZJ A;  2KNV A;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...