4LJ8A

Clpb nbd2 r621q from t. thermophilus in complex with adp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
b'HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj8A01
2VLIA 1Z63A 1E2LA 1OFTA 2P0EA 3QVUA 2D2FA 1DARA 3BBPA 1PUJA 1M7BA 2JJ2A 1FFHA 1JXMA 2Z0MA 4Z8YA 3V00A 1ZUIA 1NKTA 2ZI5A 1VG9B 4EIWA 1KI4A 1Z0IA 1IXZA 2ZE5A 3B1VA 4B3FX 3I8SA 2CEAA 4G5OA 3AVYA 1XCGB 5LDDC 1DTSA 3FOZA 4URUR 1E2DA 4PAMA 2A5JA 4BEJA 1MV5A 2YJTD 3DM5A 1P62B 1G7CA 1GRRA 4OKSA 2FF7A 3FMPB 2JEOA 2IL1A 2OCAA 2PH1A 5L3RA 5FBLB 3SZRA 3QBVA 2YHSA 1T4GA 5CYPA 4TMXA 5DNYB 2IUTA 2NO9A 1N5JA 1ZU5A 1HA3A 1TQ6A 3JVVA 1SVOA 4MITA 3TKLA 4DLRA 3LFUA 4KSCA 5KU1A 4C3ZA 4IOJA 4NMMA 2I3BA 3Q9LA 1W5SA 1DG3A 2NQ2C 2GHIA 5FBQB 3T1TA 1MR3F 1GNQA 1NN0A 4OK5A 2JDID 1OF1A 4B3BA 1AKEA 4IFBA 4RCZA 3UXMA 2WTUA 1IN6A 5B57C 2RKOA 1YR6A 1T8TA 3GJ7A 2C8VA 2V9PA 3DEFA 3IBYA 4Q7MB 2ZAOA 1E69A 2ONKA 3R7WB 1COWA 3L0OA 2KRKA 1E1QD 2ZRAA 3VMFA 5L3QA 4EFMA 2R44A 1XEWX 1NN3A 1DELA 4L9WA 5E7JA 1ZCBA 4B43A 1QHYA 3RAPR 2CCJA 2Y8EA 3U44A 3ZYCA 1W4BA 1FL9A 2PEZA 3BB4A 1XTQA 1U2RA 2P65A 2CE2X 2FA9A 3CR7A 3LBIA 1HH4A 2P2LA 4MGYR 3CNNA 2A5GA 2WAYA 1DAMA 2VHJA 3TLXA 4XH9B 5KSYA 2WWYA 3QEOA 5BXQC 4NCNA 4UNQA 2J1LA 2PLRA 1ZCAA 3VR3A 5JZVA 2H1LA 1NLFA 2QM8A 2RGDA 3C15C 5CIWA 3FYHA 1ZJ6A 1MO4A 3KJHA 4IW3B 1Z0AA 1L4YA 3THYA 3FHTA 1JB1A 2KE5A 2YWGA 3IDQA 4Q1AA 5KDOA 2FU5C 1AQUA 1KAGA 1XMSA 1M74A 2HF9A 2NO1A 4Z54A 1NLYA 2DFTA 4Q4HB 4O3MA 4FINA 5H1YA 1OFHA 2ZSAA 4QJ5A 1NNEA 1XJCA 1GNPA 2OAQ1 1U0HC 5LPNA 1WCV1 2OLJA 3EWSA 3FMOB 3RYTC 1JQJC 1ZMXA 3FHOA 3MJHA 4KYUA 1SULA 4IJMA 2QSYA 4TTRA 3WHKA 4MQBA 3ZQ6A 3OAAA 5KOYA 2LCFA 1QG2A 1E9SA 5AJYA 2ZETA 1E94E 1IJEA 2W2TA 2IUUA 3THXB 2DHRA 4M1WA 2JLWA 4LYAA 3LXXA 2ZYWX 1SVIA 4IEEA 1VHLA 2W00A 2PBRA 2UVQA 1CTQA 3LDAA 4IKEA 3U60B 2DWPA 3SE0A 1BIFA 3QNUA 2OZEA 2ZE8A 5CLQA 3MJRA 1R6BX 3DZ8A 1RIFA 2GJ9A 4A1FA 2VP2A 5BQ5A 2H17A 2IT1A 1CR1A 4DCSA 1FNMA 3SQWA 4FD2A 2NPFA 1DO2A 2C98A 4A8JB 2PLFA 4HZUB 5FR2A 1AJEA 4M9ZA 5A5GA 4NE2A 2GZAA 5IHPA 2WVJA 3CIOA 4PSVA 1OHHD 3QF4A 1LY1A 4W5WA 1NBMA 2OILA 1DBSA 1Z8FA 2FFQA 1R7RA 1XJQA 2JGNA 4AYXA 1WBDA 3K0AA 1G3RA 1N5KA 3NVAA 2A2ZA 2O0KA 4M1YA 4XJXA 3SR0A 1AA9A 4N0EA 4IXMA 2CLDX 4XWOA 3K70C 1NBMD 4IDQA 1L7VC 2AFIE 2QTVB 4HDOB 4KCGA 1GP2A 1KYIA 1W0JD 4XWAA 4I1VA 4GSYA 2J0UB 4KVGA 1DPFA 1VYTA 3CRW1 4L8GA 4AYWA 3VAAA 1GVNB 2Q3HA 4CEJA 5LD2C 1KO1A 4BFSA 2FFHA 1X3SA 1X1SA 4MDEA 1ONBA 1P72A 2VHQA 5DI3A 1XCPA 1XDBA 1CJKC 3REFA 2QRZA 3LQRA 2YVUA 4UNRA 4JZKA 4G0NA 1IN8A 1PJRA 2GCNA 4L5BA 4QBFA 1GL6A 4A0GA 3U61B 4UNSA 3AV0B 4D4MA 2P5SA 2QE7D 1W7AA 3AF2A 4B75A 5J4HA 1W4AA 1VHTA 2E9SA 3KFXA 1D9ZA 1T0HB 3LXRA 1M8PA 3RC3A 4AC9A 1E4VA 3LY5A 3EG5A 2WOJA 1JJVA 2RHDA 3MFYA 1UBCA 3VQTA 4ARZA 2D7CA 4II7A 4TN1A 3ICEA 1HEIA 1PV4A 1S1CA 4Q4JB 1P61B 4Q21A 2BCGY 3ZH9B 4DDUA 3I92A 3AP3A 3WRXC 4E07A 4BFUA 1UKYA 3U6KA 3X1WA 1UBGA 4DIDA 1LFDB 2KB0A 4FMCF 4LV6A 4XD7A 2AL7A 2DFNA 5BN4A 3I32A 3DL0A 4JBXA 4BASA 1W48A 1MO6A 4LV5B 1X8JA 1FQJA 1KDOA 4EUNA 4QKQA 1QDEA 2A5DA 3U3RA 4RD3A 2X8AA 1F60A 4GMXA 2REXB 3B1WA 1E2MA 1E2HA 4IVPA 5JWOA 1JEEA 3WYGA 4ACAA 5K8TA 4GZMA 1W36C 5JJKA 2DBYA 1KSJA 5AUPB 4ASUD 4LYJA 2QGZA 3EW9A 1AS0A 4JVLA 4ESHA 1G17A 1RRPA 1L4UA 2CHQA 1Q0UA 5KYKA 2ZTSA 2W58A 2F1RA 3A1SA 4DHEA 1NY6A 2CE7A 2EWWA 3PEUA 1R0XA 3HWSA 4HYYA 4JJKA 1ODFA 2FSHA 1ELOA 3I4LA 3IEUA 4DLUA 2O8BA 3CPHA 2ZRFA 4C2TA 4OQFA 2HJVA 3QXCA 1N6KA 4IDHA 2CNWA 3KJIA 4E03A 1Q1BA 3IHLA 4IOKA 3WP0A 4DDTA 1NIJA 1OH6A 1OW3B 4HB4A 3S1AA 3IPYA 3E1SA 1KHTA 2V4ZA 3QBTA 4MUAA 4AG6A 3OEED 4XVUA 2FGKA 5AJXA 2RAPA 2O8FB 3Q8XB 1R8QA 4TSFA 4AYTA 4CW7A 4ZPXA 2C03A 3FGNA 3NIBA 2ZPTX 4HDQB 5D3MA 4Q18A 5CDFA 1SHKA 1FNNA 5E95A 2G6BA 2J41A 1M7HA 4QC2A 3UMFA 4DCUA 4E22A 1HQCA 2EFDB 1FUUA 3LVQE 5GADl 1N6IA 4JLOA 3EIQA 4AY2A 1UM8A 1U8AA 2ZI3A 2V6IA 1KO5A 4M9QA 4EJSC 2EW1A 2QMUA 4EFNA 2VP6A 3QKRA 3GJ4A 2ZRCA 4LJAA 5E7MA 4A0FA 4Y0AA 3T5DA 3KKMA 4Z1MD 4BRWA 5B30A 2GJKA 2CL6X 3CZPA 4JLJA 4ON9A 3B1ZA 2FX3A 2GZDA 4FMDF 4EJSA 4JKIA 2D62A 5J4KA 3U7FB 1ZD1A 1Z0JA 4YLGA 4NKRA 2WZQA 3I62A 4YMSA 2J0SA 2ZAMA 3VNVA 1Z2CA 2QP3A 1GWNA 1KTVA 2OM2A 3MD0A 1S1MA 3EPHA 1BOFA 3RNLA 1Q1QA 4OHWA 1NBME 2UKDA 3BE4A 1QVAA 1J2JA 2AXNA 2XTMA 3OESA 3JVUA 2Z6VA 5HE9A 3LNCA 4D80A 2GJAA 1T0JB 4A0RA 4HUQB 1LF0A 4S2EA 4RSGA 4DSTA 2EVWX 4XSHA 1GM5A 4RD1A 3NG1A 1IQPA 1E98A 2O8CA 2Z4SA 1Q57A 1RW4A 3OIYA 4GRAA 4PHHA 2QAGB 1T9HA 3UIEA 2G88A 1ZUHA 4EDHA 1V43A 1GFIA 1W5TA 5EZ6B 2JLQA 2GVDC 2JLZA 5DYIA 3RWOA 3UMRA 2Z83A 1G5RA 4CT5A 3H84A 1VECA 3NHAA 1OB2A 1DADA 3QXJA 1KMHB 2QRNA 1N6OA 2RCNA 3DMDA 2WWFA 4YMTA 1ZNYA 1NKSA 4EKDA 3U7EB 5BN5A 1G6HA 2HXSA 3MAAC 2YWFA 1TQDA 4B2IA 4XWKA 1A4RA 4V0KA 3SYLA 4DKXA 3T06B 1CEEA 1OIXA 4B6EA 1Z6GA 4EPWA 1I4TD 5SZIA 5CB6A 1TEXA 2BCJQ 4P31A 1ZYUA 5FTJA 1QF9A 1SVWA 2IK8A 1MOZA 1JAIA 4C9BA 3O8BA 4AWXA 2WIAA 3AF4A 3G5UA 3TW8B 3WY9A 3O47A 3QOFA 4B35A 4YC7A 2XOKD 3W5JA 2ZS8A 4IRUB 3F8TA 2ZITA 4V0MA 1NVMA 2XB4A 3C8UA 2G3YA 2NOAA 2XAUA 3KTAB 4P4SB 4PZLA 2YKGA 1II9A 5A4JA 3WXMA 4C0BA 3B85A 3V4RA 3PV0A 1Q3HA 2HYIC 1WQ1R 5EXXA 3ZZ0A 2KWIA 5DN6A 1BYIA 5KDLA 3TUJC 1XPRA 1WA5A 4Q5IA 1G9XA 3JZMA 5B2ZA 5FUXA 1Z6YA 4Q1CA 2WIBA 2CLSA 4B34A 3I5XA 2QMOA 4GPTA 3CH4B 2F43A 4MYUA 1VDZA 3PEVA 4NCIA 4FWGA 2VBCA 2WWIA 4F38A 5DN6D 5J4YA 3GLHE 1XTRA 3AVXA 3W90A 2GF0A 1IM2A 2MSDB 2F6RA 3N2EA 1R0WA 4NL4H 2W2VA 3GCGA 4LDJA 3GPLA 1UF9A 1HTWA 1VCOA 4WZ6A 4A82A 1KSHA 4PZZA 2IYVA 2WM9B 3W3AA 4URYR 3BORA 5KNBA 4DIEA 2GEVA 1G8GA 2QUZA 2ZRDA 2O8EB 1VIYA 4FW9A 4P4TA 4AKIA 3X2SA 3KQKA 3IEVA 2VTKA 5EJEA 5FH9A 3CF2A 4ZIRB 5TMPA 2C9CA 2ZR9A 2QEQA 5IK2A 2CHVA 1CS4C 2WSMA 3QIAA 1D2MA 2IYWA 5CB8A 2A3RA 4WBSA 3TR5A 3KL4A 4HLDA 4A3VB 3GFPA 1XD2B 3NH6A 3T5GA 3UATA 4M1SA 4QBIA 2O8DA 3CF6R 4LWZA 1H8HA 2IA5A 1JAHA 2FZLA 5KNDA 4ILEA 1Q21A 3L8YA 3LLMA 5L8VA 1S96A 1VCMA 3TW4A 3VU9B 1OXTA 2JLXA 3W8RA 2AR7A 4JMPA 3U3KA 5F9HA 1E32A 1WDTA 3ZJYA 4M53A 1EFRA 4WXRA 4TYWA 1J7KA 5A0FA 3ONWA 4NYIR 1NMYA 2RB4A 4TLAA 3SJBA 2QENA 1JNYA 4NYMQ 4D4KA 2VSOA 1TU3A 4MGZR 3IBGA 3KUDA 1XF9A 3C5HA 4B44A 3L0IB 4M1OA 1RRFA 3AVTA 3UMSA 1WB9A 1CF4A 5KTYA 2HF8A 1E99A 4J0QA 4WW0A 3BAFA 1GSIA 1AQYA 1XXHB 4RD4A 1UFQA 4LJ4A 3DVLA 3WNBA 1VMAA 2BKUA 2IYLD 3MHVC 3FWYA 4UKDA 5ELXA 1JPJA 4I1SA 1ZW6A 2ZS7A 1H8EA 3K0SA 1KI1A 1U8ZA 2ERYA 1I4LD 4PC1A 4LSGA 1N6HA 2G77B 4TYNA 4RFVA 5DIFA 3EPJA 1MABB 2ORWA 3AGPA 3GFOA 4GI7A 5FOWA 1TPZA 4D25A 3AH8A 5J5CA 1LTQA 2NPIA 3OFNA 2GZHA 4NCJA 421PA 1BS1A 4ACBA 1RYHA 2OUKA 3KXIA 3RS3A 2AK2A 2BDTA 3GLGE 3O8RA 1G19A 1E1RD 3D6TB 4GOJA 4LY6A 1NP6A 4TLEA 1TAGA 3K9NA 3SQXA 3NBYC 4QL3A 1KAOA 1MRSA 2R65A 4QBHA 1NI3A 3SDZA 3GLGB 3TQCA 4EPRA 4R7ZA 2H5EA 3PIRA 4Q4HA 4XSGA 1W46A 1U9IC 1P7CA 4M2LA 3C4JA 1CBUA 3L0SA 2HV8A 2BOVA 3LD9A 3NBZC 4RKEA 3RVBA 3DHWC 2NMVA 1D6JA 5M04A 4OQXA 4AURA 3W6NA 2ZRBA 5G41A 4YQFA 4ZI3A 3LAWA 2C5LA 3QG5A 4TQ9A 2OFXA 1XNJA 3GJ3A 5L3SB 4C2UA 3TRFA 2F9MA 2VF8A 4OHXA 1N2CE 2LKDA 1XD9A 5EXPA 2YC4C 4DT1B 4A8JC 1U9IA 2QBYA 4L9SA 1K8RA 1EFHA 1NVVR 1OFUX 3TE6A 3GLIE 4OHVA 1G18A 2ANBA 5CIQA 1FUKA 4DRZA 2BM0A 5HZKA 1FX0B 2Q9CA 1T3LA 4B6FA 3PG5A 3SI7A 4BZXA 4MDFA 4ZV4A 1Z06A 3EIEA 1NG1A 1P75A 3E70C 4OI1A 4GOKA 4KJZA 4BZPA 4K46A 5AK0A 4PTLA 3AEZA 2OV2A 3I5YA 4BFYA 4A8JA 3CM0A 4HZUA 3KB1A 2H57A 4F4IA 3BB3A 4YMVA 3QKUA 4KYIB 2LKCA 4NH0A 5FOUA 4CDGA 1D9XA 3QXXA 2FGJA 5BN3A 3ADBA 4LOAA 2FH5B 4LHXA 3ICQB 1CJUC 3CW2A 2IS6A 2MMCA 1I4DD 2VHCA 3UWKA 3ZIAD 2GAAA 4OJKA 2PZFA 4BFVA 1G3MA 1VG8A 3B78A 2FNAA 1C1YA 5E3HA 1N5LA 4LBYA 3KKOA 3CPJB 4Y0VA 4JYBA 1SHZA 4DSNA 5JLJA 4JVMA 1Z83A 4DSOA 1ZNWA 2ERXA 1HYQA 1SXJB 2V1UA 4JLNA 5EUQB 2ZYVX 2JIZD 2RGBA 3LO5A 4JBYA 1JPNA 1FW6A 4TQUS 3BGWA 1OXVA 2ZU0C 1YZGA 3NXSA 3REGA 1NN1A 1G3UA 2BBOA 2CMKA 1KJWA 2PEYA 4M1TA 3EC2A 4NU0A 1II8B 3I72A 2EFCB 2P6NA 2C04A 5C4MA 2PJZA 2PX0A 4WZBE 2GK7A 4PQRA 2CK3D 4BECA 2O0JA 1IOZA 3T1OA 4M8NE 1YZLA 2F1IA 3FDIA 1OXSC 1IY2A 3DPUA 1RFLA 2D4HA 2J7KA 4S35A 3SJZA 3PCRB 2IYYA 3IQXA 4RJLA 1EWRA 2CL7X 4XOIA 5HKKA 5F9FA 2P5TB 2DZOB 2X2EA 4D26A 4M1KA 4LJ5A 1W0KA 4C0LA 4D81A 5KHOC 1E2JA 3VR6A 3MG9A 4KVAA 1HE8B 4KXFB 5HKKD 1KI2A 4BFTA 1IY1A 4OQMA 3A1VA 3CRRA 2IYSA 2OHFA 3H1TA 2FSGA 2H92A 2WMOB 2ZVPX 1Q1ZA 1W0KD 1RE0A 4NYJR 3L0PA 2JDIA 3OF5A 1JR3D 4MRNA 1QVRA 2BV3A 3IIKA 1SVLA 1TTTA 1R5NA 2GBLC 1NVUQ 3QKTA 2ZJ8A 4FWIB 1TMKA 3MUFA 2XTZA 4H1VA 4Q01A 1E1QA 3NH9A 2AXPA 3O8CA 5EP4A 2I1VB 5B58C 3KUCA 1KDRA 1F2UB 2V3CC 4LJYA 2DWZB 2I1QA 4C30A 1E0AA 1GZSA 4P32A 3ZQJA 4D82A 3QG1A 5JWRA 2NO7A 2GJ8A 4DCNA 5CM8B 4BWYA 5BYJA 2GBLA 1Q1EA 1IXSB 2A5FA 3X1DA 5JS8A 4ZCIA 4Q1FA 2WWHA 3RRMA 2WJGA 2NGRA 1EK0A 1E9EA 4DLZA 4CIDA 2H7VA 2QI9C 3IO5A 3Q85A 3V9PA 3EX7C 3WHLA 5GJBA 3AF3A 1Z0KA 4WOPA 3KQNA 3T61A 1PVOA 3AGQA 5AJVB 3KB2A 1EESA 1W47A 4Q03A 1E0KA 3VR5A 1E9CA 1QHHB 1VPLA 3FKSD 1AK2A 1UEIA 3AKDA 1RJ9B 1R8SA 3CWQA 2O8FA 1H65A 2WOOA 2ZSDA 1K6MA 4LHYA 1X86B 3PJRA 3EC1A 3MLEA 5DGXA 4DZZA 2V1XA 5JJIA 4AK9A 3BXZA 3LV8A 1OKKD 4AD8A 3OEHD 3HJNA 2NZJA 3A1WA 4U02A 3KJGA 4PSKA 4QHSA 2WHXA 3BIFA 2ZYTX 4P0TA 1SZPA 3GJ6A 5LB4A 3RWMB 3D7MA 1FOEB 4YONB 2QY9A 4EFLA 3DKVA 2EYUA 4PO9A 2BM1A 1CP2A 4RFSA 3G82C 4FIDA 4C0QC 4Q9IA 3GLFE 1M2OB 1N6RA 2R6AA 1A7JA 5FPKA 2YOGA 1KI6B 4CYMA 1G3IA 1D2NA 3GLFB 2ZRHA 1E4YA 1VIAA 5J47A 1MO5A 1B23P 5JJLA 3TSZA 1KOFA 3K0FA 3LLUA 4NONA 1GRQA 1W2HA 4BLOA 2ZJBA 4PXAA 4WVFA 1KZGB 3T15A 2WJHA 4ZCLA 1OHHA 2VQSA 2RGAA 3CF0A 1OXXK 5FTLA 2QT0A 2RGXA 4HATA 4IHQA 3VNUA 2CXXA 3QXSA 2BBWA 2VF7A 2PMDA 4G5RA 3QY0A 2GCOA 4X8LA 2F1HA 1XWIA 2QAGC 2GF9A 3A4LA 3CBQA 1KK2A 4WAUA 4IOLA 3UWOA 3C5CA 3RLFA 2OAP1 2VP5A 4ZDKA 2JLUA 1JXOA 3KZ1E 1W1WA 2WKPA 4A15A 1W0JA 3A58B 4LC1A 2EFGA 4QRHA 3CRVA 1P3JA 2QAGA 3ZDQA 1BMFD 1FPMA 1G8HA 1M7GA 3OZXA 4OI4A 4DLTA 2XZOA 4N0DA 3RS7A 2IEYA 3RS2A 2BMDA 3WNCA 5EE0A 1QG4A 4BQSA 4C7OB 1E96A 1Z08A 2R6CA 2WWXA 4ZO4A 5G53C 3CO5A 2W0MA 4LJ8A 1PUIA 3PXGA 1CLUA 1Z6AA 1ZM9A 3IIMA 1YZQA 4KBFA 2QE7A 3DZDA 3CPEA 4PO1A 3T12A 4V02A 5FPYA 4I4LA 2IXFA 3K0EA 3U4QB 2IC5A 1DEKA 3B13B 2CVHA 4HSEA 2P6RA 4KITB 1G7SA 4C0JA 2QORA 4QHYA 2BBSA 4TMZA 4JVNA 3SFZA 5JFGA 2QL6A 4NHOA 2ZRIA 3L8ZA 3QEJA 1RVDA 2CLCX 3EWAA 4FI3C 1JR3E 3HPQA 1NG9A 1R0ZA 3ZS8A 2OESA 4P4SA 5IRCD 1KGDA 2QPAA 1EXMA 4CEIB 4R9UC 4TMWA 4Q9KA 5CYOA 3ADDA 3EPLA 1PLJA 1AN0A 1ZNZA 2JLRA 5H70A 5AUOB 3ZVLA 3PUYA 2QQ0A 3K9GA 4EPVA 1XMIA 2ATXA 2GXSA 2G1JA 3A1UA 4D0NA 4O25A 1DVRA 1U90A 4AIIA 2QAJA 3MSXA 1RZ3A 3A1TA 2XITA 1WRBA 1ZINA 1HUQA 1YR7A 3ND8A 2B21A 3IPXA 3PUWA 3QPWA 4ASUA 2ZRKA 5BWMA 1RPZA 1R5BA 2BHRA 4TTPA 4PHGA 3GLHA 2ZANA 3W6OA 3B2EA 2DWOA 4MRPA 1E0SA 4BGDA 2ZRJA 3A8TA 3VR2A 2O8EA 4TLCA 1ZC4A 1IN4A 3T35A 4M9XA 1FTNA 4ZIRA 3TSOA 3RRNA 4GFDA 2J0QA 3SU8A 1W49A 3OIUA 5G40A 5F2EA 3ASYA 3GEEA 1HT2E 3OEEA 2X19A 2YYZA 4TZ0A 5EE1A 1D5CA 2V7QD 2XXAA 3L2OB 4PX9A 3JZAA 2HT1A 1X8KA 2QU8A 4QGAA 5KPDA 1NY5A 2GEDA 5L3QB 3ZD7A 2F1JA 1F6BA 1CRPA 2OSBA 3I73A 3C16C 1Z6TA 4KU4A 2G0NA 3U5ZB 5E7IA 4HLUC 1M1YE 4BE7B 5FFMA 1GIAA 3LW8A 3AJIB 2QTFA 5GVSA 1UEJA 4GBMA 2DVWB 5AUQA 4B2PA 4HEJA 2YNMA 5FOSA 3WBJA 4FCWA 2FSIA 4Z1MA 4MKGA 4C0AC 1LV7A 3UG6A 2ZRPA 4ITRC 5FI0B 1W36D 4GT1A 1G64A 4U5XA 1ESMA 1D8TA 4LPKA 1KI3A 3U3OA 1J90A 3DO6A 3O8DA 2VRWA 1EX6A 5E4FA 2REBA 2ODWA 3H0KA 3RANA 1KK3A 1F2TB 1KY2A 4MRSA 1MABA 4LBZA 1US8A 3TVTA 5JS7A 3GFTA 2W0SA 2C77A 2FDCA 2CJWB 4LUCA 3WNDA 5ANRB 1U98A 1NN5A 3W34A 2WWGA 4D0GA 5JCPA 3UANA 4LYFA 2WSSD 2VL7A 5DE3A 5LBIA 1Z2AA 1XB2A 3P20A 3K9HA 2PX3A 3GLGA 2FEOA 4K81B 2IS4A 1P2UA 821PA 4CEHA 4QM6A 3CH5A 5FL7D 1JBKA 1S9DA 4JL6A 2J0VA 2BC9A 2JJ1D 1U0LA 4P4UA 4DWJA 2FOLA 4JLKA 2VIIA 1E2NA 1G5TA 1DS6A 4RKFA 3HPRA 5EE9A 3X1XA 3PUXA 4PQFA 2R9VA 5L3SA 2ZJ2A 4URWR 2G0TA 4PSAA 4P33A 3HP1A 2ZIAA 3QF4B 4FXPA 1ZBDA 3CNOA 1O3YA 121PA 3NBXX 4GP7A 2AN9A 5TVKA 1E2IA 5AWFC 4B48A 2ORIA 3FB4A 1XTKA 5EE5B 2E87A 4Q4LA 4O0MA 1KO8A 4QNRA 4M4SA 5CK5A 2B92A 3BH0A 4PZYA 3GLIA 2IHBA 3K9LA 3NC1C 3VX3A 1TUEA 2BJVA 1P73A 1IN7A 2Q9AA 4A9AA 1EG7A 3P4XA 3AUYA 3K1JA 5LB2A 4BFXA 1E3MA 4UXHA 3TK1A 2XOKA 1XEXA 4TYYA 2W83A 3WMEA 3VFDA 1G20E 2DR3A 1KDTA 2VP4A 4MH0R 1AZSC 2X2FA 1OJLA 4TL6A 2JAQA 3CLVA 4BEBA 1SXJC 721PA 5FBWB 3QKSA 3CR8A 3NEYA 4IDOA 3ZGXA 2DYKA 2YWHA 1G3QA 2KJQA 5SZKB 3GJ5A 4POAA 2G83A 3B9QA 4ZKDA 4MRVA 3KW6A 2VP9A 4ZKEA 4KLNA 1GAJA 3AVPA 5DYGA 1LVGA 3AQ4A 2I4IA 4PPFA 4TMVA 4TQAA 4JLVA 4BLQA 4R98A 4JLPA 3RHFA 3B7GA 3FMFA 3NC0C 4DLVA 1DAKA 1XRJA 1GTVA 3NKVA 1NMZA 2OFOA 4LYHA 1CKEA 4D4LA 2V8OA 1PLLA 3EA5A 1SVKA 2QP4A 3LWNA 4HLCA 1SXJD 4D6PA 4D0LB 1YR8A 2JATA 2ECKA 3NBFA 4IOMA 1VG1A 4UXJA 1UKZA 2C99A 1E9AA 2EYQA 5CJ2A 5SZJA 3RS5A 1W4RA 4WA7A 4Q1BA 4W7SA 4M0LA 1G6OA 1XP8A 2AFHE 2PCJA 4TL8A 1XBTA 5EE3A 5JCZA 3TH5A 4LHVA 3ND9A 1T5LA 5JSZB 2FWRA 3Q5EA 5KO2A 1KK1A 1OXUA 1JQLB 5IDVA 1YQTA 1YRBA 3FVQA 4O2RA 4MYHA 2OBLA 1YE8A 4PR0A 4HI0E 1QHNA 3ASZA 4QGFA 4Q47A 4PANA 1P9NA 3K09C 1P2TA 5HE8A 4OK6A 1UKVY 3OE7D 3HU1A 3AF0A 4FMDB 4B3XA 2A9KA 4L4UA 1G5PA 2D74A 1GILA 1GITA 2BBTA 2C9YA 1YRAA 5F98A 3DOEA 4DEXA 4TT3D 2IBMA 4PC2A 1II0A 2MSEB 3LW7A 1ZC3A 4DJTA 1PLKA 1YZUA 2KI5A 2EWVA 3K09A 4MYTA 2IUSA 2XTNA 2GK6A 1R0YA 2W6ID 4B3GA 4LHZA 3LA6A 1XXHE 2GRJA 1VCNA 3R8FA 1E2PA 2ORVA 3SBEA 4YMUA 4LRWA 4DLWA 4QXAA 1GKUB 1CJVC 1T5IA 1EWQA 3EIHA 4ERNA 3R7WA 2GJSA 4OQNA 3WP1B 2RGGA 4LX0A 4A0HA 2VPPA 2HLDD 1NVWQ 1VKJA 3GD7A 4IFEA 3RABA 2OEPA 5FL3A 5JHHB 1N0WA 3VR4A 4BZQA 3MCAA 3DMNA 5D3MB 5C4GB 2W6JD 3HDTA 1E79D 1IXRC 5UKDA 4P3YA 3M1IA 4GITA 4NYJQ 3KX2A 4JBWA 2MMGA 1W2GA 4US0R 1DO0A 2QPOA 2FSFA 1E1RA 2QSZA 3J81k 2J46A 3QF7A 4TMTA 3QKRB 4XIGS 4PAQA 4KI0A 1E9RA 4IXNA 2ZEJA 4PC7A 2Q3FA 4US2R 3CX6A 3PFIA 5EP3A 1FZQA 1ESNA 2IYRA 5EP1A 2QMHA 2EFEB 4F92B 4QBGB 2Q9BA 4Q66C 3ZLJA 5KDDA 4TWZA 5K8UA 2NG1A 2ZRMA 2D2EA 4N1AA 5IT5A 1XEFA 4Q19A 1KI8A 2FPLA 2VEDA 4GP6A 5FTMA 1JJ7A 5SZHB 3PENA 2GCPA 4PO8A 5FR1A 1GL7A 4A36A 1YKSA 5FBRB 4OI2A 3GJXC 3IQWA 4RZUA 4EPTA 1FTSA 3PEYA 2EU8A 3THXA 3E5HA 4NPHA 1KSGA 4IDNA 3GLFA 3FFBA 4JIMA 2YOFA 3C14C 5BYKA 3M0EA 3AVOA 2QPTA 2IYTA 1R2QA 2ZS9A 1DAEA 1SGWA 4HAVA 3R9XA 2HT6A 4KFUA 2O8CB 1GKIA 1A2KC 2WICA 3B60A 4AKEA 3BH7A 5KPJA 1ETUA 1QZMA 4PFSA 1TL7C 3N2IA 3VX4A 2XZPA 1RRCA 4YXWD 4Q48A 1CR0A 3KQHA 1OH7A 5JI3E 2DFKB 2KBEA 4HDCA 1Z3IX 4AG5A 5IF9A 1DE0A 5EXTA 4HAWA 3THWB 3ZIAA 4F4CA 1MT0A 2XNDD 5FTNA 1BYUA 4BPBA 4MKFA 2ZI7A 1EFTA 2DZNB 1AM4D 3A6PC 2AWOA 2JA1A 2AD1A 2WBLC 3PUZA 3BRWD 2J3EA 4V0NA 1YR9A 2FE4A 2FJUA 1BKDR 3NHBA 2OLKA 3RC8A 1TQ2A 1SXJE 1T3HA 4US1R 2ZU6A 4EQ6B 2JIZA 1ZUNB 1KDPA 1S0UA 3CB4A 3TAUA 2WAXA 4YMWA 1R5OA 4OL0A 4MUBA 2IXEA 1A2BA 4ZDJA 3ADKA 3FMIA 3AP2A 1P4SA 1JI0A 3CKLA 1Z0FA 2PCLA 2J0UA 1LW7A 3U3MA 4JLDA 4C7OA 1OLOA 1UDWA 2BMJA 2GVZC 2WV9A 2ZREA 2ASEA 2NZ8A 1GG2A 4I1UA 4ZCMA 4B74A 2K5UA 4FWDA 4LJ9A 2CK3A 3B1YA 1ZM7A 3VLFB 3IKJA 3QJYA 4KFTA 3EASA 4G5GA 1G1MA 1J99A 4KV9A 1OH5A 3U4QA 3AVVA 1S4QA 2IYZA 3BD9A 4W5HA 2GEUA 2W2XA 3ZVMA 4JYCA 1T8UA 1XTJA 1AS2A 2GXAA 2R62A 5FUWA 2YINC 1SVSA 2L0XA 4KFSA 1U8YA 2GNOA 3AB3A 2JLYA 1KIMA 4JT4A 1HV8A 4RY2A 3SJAA 5KUTA 2SHKA 3AVWA 4DDWA 4I99A 3EZ9A 1UDXA 2PZGA 2R6FA 4V0LA 2ZE7A 3R20A 4V0OA 4C0KA 3AF1A 3QSYA 4UXIA 2B6HA 4Q4JA 4MRRA 2QGNA 3TMKA 4CEIA 1MKYA 5DHFA 1JR3A 3P1JA 1K5GA 3MWJA 5FPHA 3CNLA 3QENA 4JVSB 1IAQA 5CITA 2FFAA 4NYMR 4KLZA 1LS6A 4LGMA 3KXKA 4M21A 1XTSA 2AK3A 3WMFA 2ZE6A 4OJQA 2ZJYA 4Q9LA 1JEDA 2WPDA 2JJ2D 4PAOA 5GJVC 2QN6A 3BFXA 4BLPA 1RYFA 2WMNB 1WF3A 3P26A 1NJGA 2O0HA 2D7DA 4PPQA 3ZZTA 4NDZA 2ODNA 1OYYA 5KSOA 1P9WA 4TYQA 4LK2A 2BMFA 3TIFA 3ZVRA 2F3RA 4OI0A 1OPXA 3BERA 1XX6A 3M6AA 2WKRA 2WPDD 3TVDA 2VYFA 2ZI4A 2QG6A 2O8DB 1TNDA 3DM9B 1ZAKA 2XSZA 1R10A 1S3SA 4Q02A 1HURA 4PPGA 1CJTC 1SQ5A 2HCJB 3V4FA 3EZ2A 3Q72A 2ZRNA 3EAQA 2GA8A 3Q5DA 4F91B 2ZR7A 2ZUDA 3IGFA 5DO9A 4IVQA 4G5SA 4JT2A 2HYDA 1KNQA 1VTKA 4QG7A 3X1ZA 1ZP6A 2XSZD 4D2IA 3G0HA 4B73A 5J40A 4JLBA 1E9BA 2FPMA 3FKSA 1TU4A 2Z5FA 2GILA 2JCSA 3TQFA 1XD8A 3A4NA 2CBZA 4BLSA 4K8OA 2WWWA 2YV5A 4X8MA 2R2AA 4IDPA 2X1VA 3K53A 1OKKA 4LPSA 3FTQA 2ZUBA 2QA5A 3OEHA 5TXGA 2CCKA 3SN6A 1XEWY 3W8NA 2GXQA 4F4JA 1HE1C 2BVNA 2HDNB 2XEXA 4RZXA 4JLAA 4OK3A 5TB5A 3RS0A 4G3XA 2REOA 3VKHA 1Z6XA 4HAZA 4GMDA 1COWD 3CX8A 1YZNA 1NJFA 1YVDA 1X6VA 2IW3A 2V55B 5FPSA 1KO4A 1L2TA 5EQTA 2HUPA 4RZ3A 1X37A 3LVRE 2C78A 1X1RA 2R6DA 4H9GA 3VKWA 2R6GA 4CT4B 2GTPA 6Q21A 2FN4A 4GOXA 2ZRLA 2IS2A 2IS1A 4DXAA 3EZFA 3IILA 5BW8A 4JL5A 2N1BA 4MKHA 5DSZA 3TNFA 4URXR 3FE2A 1N6PA 1ZU4A 4TL7A 1G291 3AUXA 1P60A 2GDJA 2RMKA 1TUIA 2XZLA 1P2SA 4ABYA 3WYAA 1XMJA 2FV8A 2JJ8A 1YJ5A 5EUMA 4D4JA 3EPKA 1F2TA 1XCMA 5HZHA 2O5VA 4W9MC 1GUAA 1DAIA 1I2MA 5HCIA 2IXGA 1MRNA 4DLSA 1BH2A 4JSYA 2CJWA 5TDHA 2IWRA 4G01B 2BIFA 5CJPA 4ZI2A 4TL9A 1DAGA 4LRTA 2QM7A 2XNSA 3PQCA 2B7BA 4B76A 3U3JA 4NBSA 2Z43A 2A30A 1OSNA 2PZEA 2NO6A 2QBYB 3UG7A 2J7PA 3AP1A 5GVRA 4UNPA 3KKNA 5FI1B 4ZDIA 1G7RA 3I1FA 4HUQA 2B7CA 3OAAD 1HQYE 1AGRA 2OG2A 4QGGA 1BMFA 1XZPA 4FN5A 4Q4AB 1KMQA 3BC1A 3SOPA 2Q3MA 1G8YA 3X1YA 4TMKA 5JWHA 2JLSA 3SHFA 4F93B 4OHYA 1QHIA 2AD5A 2VSXA 2J7PD 3MWKA 5H8WA 3SS8A 4NCHA 2XB2A 4I81A 2ZXUA 5TV2A 1G8PA 2AKYA 3FKQA 4M22A 3SJCA 1ZD8A 4E09A 4IVRA 1Z28A 4YDSA 3DKPA 3BFKA 4QJ3A 4FMBB 1KMHA 1TEVA 2BKEA 3A4MA 3GEIA 3PR1A 3IIJA 4AI6A 1E2KA 3RS4A 1VYVA 4G1UC 2QP9X 1ZD9A 1IJFA 4WXPA 4R2IA 1G21E 4A92A 2Z4RA 3A36A 2ZVQX 4Q00A 4PHTA 5TY0A 1TF5A 4PQYA 4U7DA 1P6XA 5FOXA 1XJ0A 4Q1DA 3CRMA 5EP2A 3TUIC 4WZAE 3W5IA 5J4LA 1JECA 4HB2A 2ZSEA 1TX4B 2YOHA 4Q9HA 3RSOA 4A2QA 3ZVNA 4OYHA 4M1MA 4OQLA 2QZ4A 3B82A 5J4VA 4QNMA 4DBLC 2HXYA 2ZYUX 4B47A 1OIVA 4R71A 2ODBA 5DISB 1OIWA 3NDBB 4RVCA 3KTAA 3L82B 1HY3A 3ETLA 4HAXA 2ZROA 1W44A 3VKGA 5K8LA 4UJ3A 3I61A 4MYCA 1HT1E 1Z47A 1XZQA 1C9KA 1G8FA 5AR1A 1FP6A 3K70D 1T6NA 3WRYC 2CL0X 4H1UA 4QGHA 3SEAA 2NIPA 3VHXA 5AUNB 4F7WA 1NL3A 3QUSA 1WE2A 2ZQ5A 5B64A 3U7HB 3MMPA 1RKBA 1LB1B 1IY0A 2ZSFA 1ZIPA 3QVVA 2NTYC 1TQ4A 1IBRA 3KQUA 1C4OA 2G1KA 2ZJZA 2RHMA 2FPKA 3IHWA 4Q7LA 1ZNXA 2QROA 3F3YA 3NWJA 2OBMA 4DSUA 5C18A 4EAQA 5EZ5A 3PVSA 5JSZA 2V7QA 2WJJA 4LBWA 1OFIA 4DC9A 2DY1A 1F3OA 2V54A 3BK7A 4G5QA 2BMEA 1TF2A 3LBHA 4XD7D 1AS3A 4DCVA 2DPXA 1N0VC 2QNRA 1IN5A 1XD2A 1VG0B 1KKLA 2F55A 1AZTA 5DHAA 5KSZA 1Q3TA 3FFAA 2YC2C 4L15A 2FZ4A 1OH8A 2RGCA 3TR0A 3VU9A 5C1BA 2V6JA 3EXAA 4FCVA 1KNXA 5JEDA 4FWHA 1W4CA 1E9DA 2VO1A 3U44B 1X8LA 3NDPA 1P5ZB 2ONJA 1N25A 3D31A 2P6UA 4X8OA 1N6LA 4KSBA 5FPTA 3PEWA 4HZIA 3VHLB 1XU4A 3LBNA 1ZM4A 5K8IA 4FCTA 1XTIA 3AM1A 1XXHA 4B3DA 2VP0A 4R2HA 4HLUA 4TZ6A 1FP7A 2CNWD 3THYB 3QI2A 4KAXA 2HEIA 1ZM3A 2J45A 2OXCA 4QHTA 1NRJB 2VHUA 4MKIA 4LV8B 2QTHA 3QQ5A 1B0UA 3MRSA 3TSWA 1P9RA 2GWHA 4TSFD 3IUYA 2KBFA 4TLDA 3K8YA 4UQOA 4Z51A 1Z0DA 2RGNC 3N5CA 4CZ2A 4Q1EA 1OT3A 3FPAA 1GKYA 4TLBA 3BWDD 2WSSA 2V6ZM 4RFSB 4W5JA 3BB1A 2BEJA 4CF7A 4KHZA 1IHUA 1TADA 4NYIQ 3BH6A 2GETA 1UJ2A 1YHNA 4KFRA 5FL7A 1IONA 3T1VA 2C95A 1NVXQ 3DDCA 2BWJA 1J70A 2PJRA 1Z07A 1OYWA 4URZR 3T34A 4EPXA 3D8BA 2RGNA 2JJ1A 621PA 4CGZA 3P4YA 2G9NA 4DLYA 2FMXA 1NSFA 3K0FB 1OV4A 3MWLA 2ZM5A 4DB4A 4MGKR 2F9LA 2N42A 3WYFA 4ESVA 2ZJ5A 3RRZA 4DVGA 2MSCB 5H68A 1NF3A 4UNNA 1LS1A 1D2EA 1CR2A 2P3SA 4JS0A 4PHFA 1CR4A 1E2GA 2XJ4A 5CK4A 1ANKA 3UKDA 3QXHA 5JRZA 2VSFA 1J8MF 2GAOA 2X77A 3BS4A 4Z8XA 4LJ6A 1T91A 2GCOB 1E2QA 2ZR0A 2HCBA 2ZUCA 3CRQA 3IO3A 4HLQB 3SYNA 4BFZA 4LHWA 5L3VA 1AIPA 1OE0A 2B8TA 4DT1A 4XTCS 5G3YA 4FMCB 4XVRA 2OCBA 2OE2A 3F0TA 5FOTA 1FX0A 3SYKA 3LX8A 4QJ4A 5EXSA 2P67A 1QBKC 3RSLA 3K0AB 4BRUA 1UKEA 5HR5A 2ZI9A 1XPOA 3CUEF 5FBVB 1EFCA 2XGJA 1FMLA 1F5NA 4AKHA 4BUJA 4HB3A 1G7TA 2CDNA 3OHMA 1TF7A 2PT5A 1C1KA 1QRAA 4BFWA 2A5YB 4LJ7A 2D06A 3THWA 4DUGA 521PA 2AWNA 4BLTA 2A7QA 3ADCA 4B32A 1Z22A 2TMKA 1A1VA 2IYQA 4CEJB 2ZJOA 2EFHB 4HAUA 1GNRA 1KJZA 4B2LA 3K70B 4DUGD 2JASA 2KSQA 5DI3B 2PMKA 3N70A 5CM9C 4EQ6A 2DB3A 2IX3A 4LZZA 1QHSA 2YZ2A 4XVQA 2J87A 4N3NA 3B5JA 2D3WA 1NVVQ 3CONA 3GMTA 3UK6A 4TYPA 3MGCA 3TAHA 3THOA 3W9YA 1SXJA 1GOTA 1Q44A 2J5XA 5D3QA 5P21A 4NCKA 3AKEA 5FOVA 3ZD6A 5LD2B 1L8QA 1LNZA 1E6CA 1A82A 1E2FA 2NO0A 4DLXA 4ARZB 3SFVA 2J59A 4U00A 2IYUA 2YWEA 5JMTA 3UPUA 1XPUA 1II8A 4RD6A 3KJEA 3LQQA 5JBQA 2IYXA 3HR7A 4A2PA 2JLVA 2GXUA 1N3BA 3GJ0A 4RZ2A 1YU9A 1MH1A 4NTZA 3WMGA 2AKAB 2WKQA 5CLLA 1KZ7B 1NMXA 1XFAA 2FFBA 3CX7A 4PC3A 1OB5A 1G16A 3ZS9A 3GEHA 4EPYA 3M4YA 3LRPA 1WBBA 3RRYA 2OCYC 1DAFA 1K5DA 1ZM2A 2CCGA 4JKYA 3EZ6A 5GJCA 1Y63A 3B1XA 3OE7A 5HTKA 1UAAA 1CU1A 4V03A 1VYUA 3TUZC 1CIPA 1FQKA 1R4AA 1YZTA 4JN6A 5G3ZA 3GLHB 1KJYA 1U0JA 3P32A 4TT3A 2R8RA 3SHWA 1WXQA 1VCIA 2QMEA 3H86A 2GKSA 2UZIR 4RD0A 3TJZA 4B33A 5C46F 2FEMA 2C96A 3P27A 2LWIA 3F5FA 3Q3JB 1KSFX 2PT7A 1QHGA 4CRWB 2W6IA 3A37A 4JSTA 1KI7A 4TTQA 3PUVA 2BJWA 1CRQA 2OBNA 3U6BA 4NZYA 1W36B 1LF5A 4RD2A 2HLDA 3AKYA 1ZVQA 2O52A 3GJ8A 3PITA 2O8BB 1M34E 2WJIA 2XXAB 2OFWA 3BJIC 1M6NA 1F2UA 1NLZA 3HU2A 2H8KA 3SBDA 3K0CC 5IK2D 3AVQA 2Q21A 1NIPA 5JECA 4AKGA 8OHMA 3S1AB 2W6JA 4Q7KA 1P2VA 1FMJA 4M9SA 3R9IA 1E79A 2Q6TA 5CDFE 4DDVA 2CHGA 2ODEA 3B6EA 4L16A 3TBKA 1H8HD 5HCNA 4Q7JB 1KK0A 3ZZUA 4B71A 2Q0HA 1KI9A 1GDDA 2DFLA 3SNHA 4JLMA 4FWTA 1KO7A 3I8XA 1AGPA 4A6PA 3K0CA 2FG5A 3LX5A 2N46A 1E9FA 1RRGA 3C7KA 4JJZA 1G41A 1DOAA 1EFRD 5KNCA 3VR1A 1F48A 1S2MA 2GESA 1EX7A 1WMSA 1MO3A 1QHHA 3GP8A 3QE0A 4LRSA 5JI2E 5F3WB 3R9WA 1RJ9A 5AJWA 2PL3A 4ZDWA 1I2DA 2UZ3A 4MA4A 3RDPA 3W6PA 3B9PA 3E2IA 3U7GA 1U94A 1WP9A 4A4DA 1SVMA 2HJGA 4C0HA 3Q7QA 2BEKA 4DCTA 1U99A 1S8FA 4LI0A 3VTKA 2F3TA 4GDFA 4EJSB 1CJMA 2QQEA 3B8HA 3W3ZB 5HPYB 1V5WA 1H8ED 4URVR 5KSPA 1BO6A 4A6XA 1US8B 1PZNA 3AVUA 1NSTA 4OBEA 2XX3A 5DH9A 1Y3AA 2VHTA 2VH5R 1QZXA 2IHYA 2RH5A 3CZQA 3KKQA 3LH5A 4NP6A 2ZSBA 1S9HA 1QHXA 4O2LA 2EQBA 3I3SR 2ATVA 1Q22A 2H18A 4C4PA 3H2YA 1KI6A 2OT3B 3OFND 1G4AE 221PA 2ZJAA 3DOFA 1E0JA 1J8YF 1AKYA 1SKYE 4CEHB 4JL8A 4YXWA 2C9OA 5FUYA 3BFVA 3L43A 4DEYA 3T1QA 1RC8A 4XTRA 2OCPA 3KKPA 1GL9B 4LBVA 1SKYB 5JRJA 1T3SA 2RGEA 2XNDA 5DLQC 5TARA 1O87A 1Q12A 3QPUA 3KQLA 2DWQA 3HR8A 2XJ9A 3KDSE 3EA0A 2IF0A 4QM7A 2QT1A 3U2QA 4KBGA 4KO8A 1N6NA 3CWZA 1ZRHA 2CVFA 4UJ5A 3D3QA 1Q20A 4LC0A 1EGAA 4WIAA 4Q9JA 1S3GA 3KFVA 2AX4A 4B3CA 2H16A 4Q4AA 2E1RA 2ANCA 1A5TA 1ZIOA 1JALA 1N0UA 3AKCA 4BLRA 4MGIR 3R8CA 2WJYA 3EZ7A 4PC6A 5DI9A 4A2WA 1CULC 3NEJA 3OIVA 3GLIB 3TGPA 1Z5ZA 2F7SA 3NTUA 1Z29A 1SKQA 4GL2A 3SC3A 1G4UR 1DG1G 3H4MA 1KY3A 4QFMA 2B8WA 1XEXB 1JR6A 3FHCB 1UADA 1N5IA 2OXRA 1KKMA 1E2EA 3Q7PA 4V0ME 3C41J 4CVNA 3MWYW 4X8HA 2IEZA 3ECCA 1UBEA 1GRNA 3QPVA 4GZLA 2ZI6A 4HAYA 4HUTA 4DB2A 2WJVA 3QKSB 3EARA 5C2JB 2AHOA 1UPTA 4I1OA 2IF2A 5AJZA 2A78A 2OO7A 5JEEA 3GQBA 4OHZA 3WBKA 1YZKA 4KODA 3HU3A 1EFUA 1XMVA 3BOSA 5FUVA 2DCUA 2J9RA 3HYTA 2VA8A 5FTKA 3HYRA 3OIWA 4E5UA 1DAHA 2C2HA 5JHGB 4PPNA 5GJWC 4GNKA 2F43B 3KXLA 4YDHB 4LCBA 1U81A 4HB0A 4RCYA 4C0SA 2IWHA 1CXZA 4IEIA 2ZRGA 4QOSA 1UBFA
chains in the Genus database with same CATH superfamily
4WHMA 4F84A 3WYCA 3I5UA 3OT1B 4WSOA 2X13A 4HWSA 1V37A 3AVYA 3FOZA 4UN2B 3IEXA 4PAMA 5TVGA 1TO6A 1DKQA 2H59A 5A02A 2F00A 2VQFB 3LFUA 4NMMA 4R01A 4BNGA 3G5AA 1C3OB 3VSEA 1JBQA 2JKZA 2HSJA 5HGJA 1JHAA 2CP8A 3TKAA 3O74A 1LRJA 1E69A 2Y9PB 2YW2A 1AHIA 2VKTA 1USGA 3L9XA 1H23A 4LOLA 2HEGA 4MGYR 1XDWA 1Z5PA 2PKRA 1BKYA 1VLHA 4CL3A 5DXJA 1F8XA 3L6BA 3CV3A 3KJHA 4KUEA 1Z0AA 4J1TC 3BDIA 3NUZA 1P1FA 1FUEA 1M74A 2GUWA 2BFBA 4EJFA 3K5IA 1NNEA 5FUMA 1WCV1 2OLJA 3UHAA 3DZGA 3FMOB 4W4TA 3DAHA 3WHPA 3INYA 4PLGA 5IH3A 3WKBA 1IUNA 1N8NA 1BFKA 2F5QA 5CVVA 1F4PA 1JIKA 3D7LA 3UV3A 3ZK7A 4F6RB 4HK4A 2QL7A 4NOMA 3ANMA 1THZA 4A8JB 3RIHA 5F21A 2GZAA 4EHKA 1NBMA 2JFBA 4BZZA 5KX5B 4ZT5A 1XCLA 1DQYA 4U3JB 4I1VA 4NRVA 2J0UB 4WFIA 1N75A 4A91A 5HJEA 2Q3HA 2Z9CA 5G1NA 4B7XA 1YBAA 2YVAA 2HTEA 4ZAYA 3B2QA 2GCNA 7REQB 4QBFA 1TDJA 3W1WA 1W4AA 2PGAA 3BF8A 3HHZA 1HEIA 4PYLA 3AI3A 2O57A 3E3LA 1RABA 5HRUA 4M0PA 2GBCA 2AL7A 5BN4A 1D6MA 4BASA 1W48A 2MSKA 5G4KB 4FX2A 2I62A 2Y2VA 3K15A 4IVPA 1QIDA 1KSJA 5L8RF 2OXEA 3MZ0A 2IOHA 4J6EA 4JYPA 2QE6A 3HWSA 2VYVD 3FUVA 3OCCA 4RK1A 4MJXA 2A1UB 3QXCA 5FULA 3KJIA 3S1AA 4XVUA 2FGKA 4HGPA 3Q8XB 1R8QA 4TSFA 2RGWA 4Q18A 3UMFA 1MXHA 1SKUA 2O5RA 1PBNA 4JJAA 3EIQA 1WWKA 4Y30A 3SXUB 1OKSA 3CA8A 5L4NA 1N7HA 4XFDA 4LJAA 2Q46A 1B6GA 4XYEA 2B25A 2ZT5A 4BRWA 4MGYE 4IDFA 2FX3A 2RD2A 3OC0A 2AN5A 1GDHA 2WUDA 2O59A 1HWYA 1FFDA 3U7JA 1SA0A 2I2FA 3AEXA 1RRVA 1X80A 4HX2A 1Z8HA 3ZU5A 4J3FA 4ICIA 3RUFA 2A5LA 1TH2A 4OHFA 4DSTA 1YACA 4PZUA 2QLJA 2O8CA 3DEHA 3MTIA 1V9LA 4TZKA 3M34A 5DYIA 2QJTA 4WX2B 2A0UA 1T6ZA 3LM8A 1RCTE 5F33A 3MLAA 4JA0A 1XLVA 3SNKA 3Q2OA 1CIVA 4P83A 4DZTA 2ZAIA 3VOBA 3EC7A 4I8IA 2PANA 3DVAB 2YFYA 2WSCF 4V0MA 5I9BA 3EXEA 4H77A 3WXMA 4C0BA 3M6UA 1UM9A 4ESOA 3OCJA 1G9XA 1GO2A 3JZMA 3T7KA 2UUCB 4RQAA 4UM7A 1XTRA 2HWJA 3JQ7A 1BDJA 1NM5C 4RPIA 4HEHA 1GHTA 3GRRA 3ZV6A 3LWZA 2ZR9A 2WNSA 2CHVA 1T4CA 5CB8A 3TECE 3QEMA 3UB4A 4M6WB 2ZWMA 3QOWA 2FZLA 3HY6A 5F5XA 1QR6A 3ZWXA 5EIBD 5F9HA 4YALA 5JAZA 3PWKA 2GLTA 3IUEA 5DTQA 5K3FA 3RFTA 4XGNA 1PR1A 1WSBA 1OWMA 1GSIA 3PNOA 5GTDA 1XXHB 4AZVA 3G8DA 2GFHA 1BDIA 1ZW6A 4PG8A 1KI1A 1FJ2A 1X8XA 1Y1PA 5IS2A 5EN4A 2Z95A 1WB5A 2IPXA 5BVGA 2Q41A 5AT1A 2Z6UA 1UPXA 1G19A 4GOJA 3L8HA 3K9NA 2P9TA 4POOA 1IOLA 3SDZA 5REQA 4R7ZA 1W46A 3TG8A 3C4JA 5FYDA 3E81A 1MNAA 3G8YA 1FP4B 2XCOA 1PT6A 5L3SB 1W9HA 4AJLA 1L5MA 3IR7A 1EFHA 2VBFA 2L69A 1DZIA 4J9VA 1J8QA 4B6FA 3GG9A 1A5BB 2VTBA 2CD9A 4XE5A 1XGKA 1C7RA 4OJTA 2VHEA 2VQFM 1CJUC 4FEEA 3LC7O 4OJKA 3UWMA 3DOOA 2FNAA 4B3RB 2QTVA 3H5AA 4PG5A 1PJ8A 4LMPA 5E8JA 3IX7A 3TPCA 3FRJA 3BGWA 2ID8A 1YZGA 4OW0A 4BL5A 2EFCB 5C4MA 5C1IA 1YI0A 5EZYF 3OECA 4AMVA 3GT0A 4XOIA 3U48A 4MUFA 5KC9A 3ZPXA 4TMFA 4BP9A 3I8OA 4QOJA 4MV5A 1TXGA 1ADGA 3QMWA 2IH5A 4ZCQA 1IY1A 4RTKA 3KDAA 4QBTA 4RK7A 5KX5F 4RKYA 3KUCA 2ZR8A 5AKIA 1MX0A 2RI0A 2WG1A 2NO7A 2OGZA 4YIKA 2VWGA 2WEKA 3PB3A 1Z88A 4DMMA 4Q1FA 1E9EA 2QVGA 3EX7C 1OI2A 1B6TA 3CZ4A 2PX4A 4ITQA 4HDNB 5IVKA 2RAVA 5AOCA 5ALXA 2V1XA 3R3SA 2CZQA 1JSCA 2NZJA 5JSUA 1CY6A 1UT6A 5KQ8A 2H3EA 2JGLA 4Q9IA 1M2OB 1JI3A 1UBRS 2R6AA 2I4NA 3MTDA 4OVKA 3EGDB 3OU2A 1VIAA 1MO5A 3UMBA 4UHDA 5ITXE 1W2HA 5I9SA 2WJHA 1T3TA 3PUJA 1XZFA 4OP1A 5AHRA 2ADMA 3CBQA 3C5CA 1U3GA 2LRHA 4FYIA 1UODA 4ES6A 1AUAA 4QEDA 1IHPA 1GZ3A 4NESA 2VDKB 1I14A 2WJAA 3PX2A 3SPXA 2JK1A 2L09A 5JPCA 1G9TA 4TWRA 3ZN2A 3B13B 3R4VA 1JLLB 4LKRA 2QORA 4JK3A 5JRDS 1VSTA 1IWPB 1RQPA 1YNSA 4HEA1 2R00A 5GONA 5KYXB 4Q9KA 3O75A 1L7OA 3ZVLA 4EPVA 3MCWA 3CLKA 1MHTA 1TCUA 3PNQA 3WTCA 3E23A 3W6OA 5TS3A 5EIAA 2HHAA 5HZGA 2OHJA 1UK8A 1X3LA 3DT9A 4GFDA 3K2IA 4J1QA 3ASYA 3NORA 5KWVA 1XTZA 4ZJPA 1J97A 1NQUA 1KFVA 2WTNA 4IBJA 3H99A 4OXXA 3CURA 1F6BA 2ID7A 2OSBA 1GIAA 1L1TA 5HF6A 3WBJA 1DDGA 2OD2A 1T6YA 1PZFA 3ZK9A 3QYPA 1KI3A 3GPCA 4A5SA 1E3JA 3AYZB 5LWQA 2JFPA 2PR7A 2MR5A 3CEPB 4G65A 3FCEA 5LQNA 2CJWB 2OGTA 2JCYA 4IHJF 2H2AA 5C7IO 3P5SA 3UHPA 1TUBB 2PX3A 2UUCM 4CTOA 4P4UA 5BURA 1Y3DE 2O3RA 5ICCA 4PQFA 4II2A 2XLJA 3RJZA 4YJGA 3HP1A 4XYGA 4F06A 5EE5B 1QP7A 1JHXA 1D4FA 3UPTA 4BFXA 4BVEA 1RLTA 3I6MA 2XT6A 5CFRA 2CFIA 4AJJA 1AZSC 1OJLA 4WP2A 2DH6A 2R48A 4EHAA 1XVIA 1GR1A 1Z2NX 3LE8A 4W5RA 1U1IA 2VP9A 3D4OA 2Q7OE 4Z0HO 4PZ9A 5A3VA 3PD0A 2Q4RA 1XZMA 4KX5A 3IE0A 5IANA 2P2ZA 1FNCA 4UXJA 5CCBA 4FM9A 1E9AA 1U9YA 4IKPA 5JZMA 1FVHA 5D85A 3MHTA 1KK1A 4S1NA 5DOVA 5C7OO 2ZB7A 1IPEA 1YRBA 3UB2A 5DM60 1T34A 3F6PA 4PR0A 2GPAA 3DGFC 2MROB 3NP9A 2XADA 1L5VA 1QFZA 2WY2D 2I7VA 2IOYA 5A9RA 1AX9A 2WKWA 4EITA 3B7QA 2WWTA 1NURA 1PD0A 1N78A 1CJVC 4LX0A 3T3EA 3NXKA 3W2HA 3MEQA 5IABA 4RV9A 3WV4A 3JQAB 3E4DA 1ORRA 2PRJA 1XL1A 3PPVA 4P3YA 3VK7A 3L7AA 3VNBA 4US0R 4CNQA 1A7UA 3VYUB 1M0WA 4XIGS 5DZSA 2ZUFA 4IXNA 2LWXA 1QRUA 1QV9A 1MNQA 5HYVA 4ENRA 2M1XA 3T5AA 4B3RM 5K8UA 4ND8A 1PNVA 2Y1EA 1KI8A 2P40A 1QU3A 4F11A 4KDRA 4A36A 5FBRB 4E11A 4XD2A 2UAGA 4I4IA 4IDNA 4MV9A 2GGSA 1J07A 4HYTA 5EHGA 3HKCB 3EFOA 4HRVA 1QE0A 4CKBA 5JZSA 3KQYA 4IS3A 3LYUA 3PKIA 4UDYX 4BPBA 3P97A 3RC8A 4M0WA 4LWOA 3TAUA 1A0OA 2A9JA 1YMQA 3ADKA 2OAEA 1R0RE 3KRTA 4I1UA 1NVMB 2CK3A 4RE6A 2QUAA 4QDJA 5KYGA 4P8RA 3HJFA 1T24A 1TJ5A 1SVUA 1HC7A 2KLHA 2HF2A 3HVHA 3JPWA 2R6FA 4MW2A 4JN6B 2B6HA 1UJBA 4MV3A 3V3KA 4RADA 4KIGA 1T1IA 4REQB 3SF8B 1XTSA 1U2ZA 3F2IA 2GJ4A 3I1IA 1V4VA 4Q4CA 1QGAA 2OBFA 2D7DA 4CISA 4CKWA 1YB4A 1XZLA 4QEZA 4LK2A 2BMFA 1C41A 3NMUF 4TROA 3TVDA 2A86A 4O4HA 3QITA 4UOEA 4Y1RA 3MQ4A 3O26A 4F2WA 3Q72A 3EAQA 1M6YA 1YS4A 2QD2A 2DHDA 1XVVA 4BMVA 2MHCA 1TU4A 5CT5A 3V8MA 4OLAA 2WZJA 5JNRA 3GVCA 5KTPA 2AG5A 5CB0A 1X37A 3DMRA 1BHQ1 2GTPA 5E3IA 4B5LA 2I6GA 4JL5A 3OHPA 3RT9A 1WXXA 1JKFA 2JZ0A 3AUXA 2HB6A 3ABOB 4D4JA 4YAGA 1XUOA 4CLRB 3AKZA 5LMNB 4IR7A 2V59A 2BIFA 4TL9A 2YHIA 3JR3A 2QM7A 2Z2JA 4NBSA 2Z43A 5A7FA 2QTWB 4V0SA 2H2IA 3HKBA 2OG2A 1XO1A 1YJBA 3X1YA 5HKLA 2YHBA 1N2XA 5KJEA 2AKYA 2JZ1A 2XB9A 1Z28A 1ENYA 3W05A 1CC1S 5C5IA 3CEMA 2OOAA 1ZD9A 4I9HA 3LA8A 2VRCA 3BZBA 1TF5A 3ZGOA 3D43A 4YV1A 5IYZB 1LDMA 1TX4B 1KC1A 2X40A 3WQRA 1RJGA 4OQLA 3AHGA 3NHJA 4P98A 4DIBA 4QDUA 4BKQA 3KZVA 1KFKB 1OIWA 4RVCA 3LHKA 4B3SB 4CHTA 1XMQB 1WE2A 4KQ6A 3V8EA 4XOUA 4HQ0A 1WXIA 1X13A 2H9YA 1ZG3A 1JMKC 2ZJZA 5FXMA 1KYZA 3D6UA 3LFTA 2P30A 1G5FA 2EW8A 1M1NB 4ZYXA 4BX9A 2NNWB 3JYPA 4UBNA 1DTWA 4IDGA 3C3CA 2Q29A 4ENTA 4FWHA 1V5IA 2HGSA 1OBCA 1WHTB 3SKYA 1ORIA 4YMGA 1W30A 1N25A 1FSGA 1HNWB 4AKSA 3A3PA 1DTEA 3THYB 4I50F 1NVEA 4AQDA 5DTMA 4X6UA 3OA0A 2YJGA 1GKYA 4Q05A 4QAJA 4TLBA 3BWDD 2CFOA 2V6ZM 5CXSA 2J31A 1TADA 3FPSA 5FL7A 3JALB 1EDOA 2BWJA 1JYEA 3UAOA 3FDZA 4DCMA 2FZKA 2K6BA 3NTOA 2Y0BA 4FHCA 4YQYA 4LF9B 2Q3CA 3NU1A 3H9BA 2XF2A 5FORA 4KXUA 5HFNA 2DWLA 5T3YA 3PF8A 1QIEA 3OMWA 5K99A 3ICWA 4KE7A 5B2FA 2PT5A 5GWXA 3THWA 4CKCA 3GJZA 4NMWA 1WIWA 5KWEA 4N6GA 4DRXA 3DD1A 1PZHA 1AE1A 5FCDA 5K3AA 2UUBB 4OJYA 2QM3A 5P21A 2J5XA 1F6WA 1BG6A 2PBFA 2EJUA 1QQ7A 2IYUA 5JMTA 1XPUA 2AI3A 3QU4A 5TLSA 3RVMA 5CLLA 3OY7A 2JA2A 1G16A 1SCIA 4G9BA 3GEHA 2H2FA 2XWBF 2E5LB 3EZ6A 2P6MA 1TI7A 1UZLA 3GLHB 4QTTB 3FHLA 5B36A 4H7HA 1V25A 4MW7A 4B33A 1ZI8A 3Q3JB 4TTQA 1YZ3A 3LCUA 3V42A 4H7FA 2HLDA 1ZH2A 5F1OA 1QQTA 2XFTA 1D04A 3PF9A 5EINA 3R3UA 3ZZUA 1NZFA 5AKGA 4JLMA 2GKGA 1ZMVA 2LVPC 1N9ZA 5T8KC 3PQDA 1LRKA 4ZARA 3D5QA 4DNQA 1QDUA 3V2GA 1SVMA 1TZMA 1YV9A 1UBLS 4HRAA 4LI0A 2EBFX 4RK5A 2QQEA 3W3ZB 5JV5A 1KRXA 5TF0A 4F5DA 2XX3A 3NS7A 2IFTA 4O2LA 3G5TA 3HI6A 1MOQA 2ZJAA 3DOFA 4XUEA 1FJHA 5FUYA 2DKLA 4AVYA 1NQTA 3QPUA 3AB7A 3HR8A 4ZYWA 3VU8A 3PC4A 5BWBA 5IM4A 3QWFA 4PXSA 2A0KA 2AJBA 3ONFA 1A5TA 2MYNA 2WJYA 3E7PA 4B8YA 2A0XA 1E2EA 1FNSA 3PHLA 3HY5A 3KZOA 3M6FA 4FK8A 3WBKA 2P2CA 3BOSA 2O06A 5EHNA 2HRQA 4OHPA 2EA0A 1J42A 4O4IA 5IAAA 4BQPA 3VDUA 5H82A 1PP4A 2DBVO 4MR9B 3DOIA 1BX1A 1KARA 2SNIE 4Z8YA 4HRYA 3V00A 2I71A 2PM8A 2WB2A 2OOKA 2CEAA 3GNQA 3WDMA 2EKQA 5TMBA 2ACWA 3DM5A 3VTAA 1G7CA 1LTKA 3ENWA 3D3WB 2GPJA 4JODA 2OMEA 5WRFA 3DBHB 3LSTA 5DNYB 2IUTA 5IW8A 2BTQA 4PD2A 5LMNM 4LZLA 2PWPA 1RBZA 4OK5A 5IYZF 2XQIA 5E26A 4ALLA 2V9PA 4QPDA 2E4WA 3KZNA 4F9FA 4LZPA 2JLBA 1JDBB 4CM6A 1XHEA 2Y8EA 3N2GA 5AVRA 5LQDA 3W8DA 1Y3BE 1KFEB 4GI2A 1S02A 5TF4A 1NLFA 1PDWA 2BHTA 3QX9A 1J5XA 4X61A 1GGEA 1KHHA 4JB3A 1XRLA 4LG1A 4PYIA 1ZZGA 2GQ0A 3C8ZA 4Y2UA 3VZSA 3CUTA 1BCRB 3TTTA 1SULA 1OZAA 1C80A 1PN3A 4YRJA 4LYAA 1DGHB 3N2KA 3QX3A 4B3SM 3HCEA 4M54A 5C8DA 2Y76A 3NW9A 1YQDA 1XMQM 4CQNA 2RHBA 1FNMA 3K9CA 5BVHB 1M0EA 4M9ZA 1HKUA 2XMDA 5IHPA 1K7YA 3PGLA 5LC1A 3AEUB 1N5KA 2ACKA 3ND5A 3J80A 3A14A 2G5TA 3E9DA 3EVBA 4X3OA 5DX8A 2ES4A 2Y9MB 4L6V6 3CH7A 2H9AA 1E6LA 3IJ5A 4YAUA 1KO1A 1SRRA 1MAWA 1X3SA 5AJUA 3F90A 2L42A 4OMFG 2P5SA 4MV0A 1VHTA 1HNWM 4FKMA 3JY6A 5E4TA 4ARZA 4II7A 5LZ2A 3MTGA 5D3KA 2EV9A 4NJMA 1O96A 2HSWA 1OWNA 4LV6A 3FFWA 5A3SA 1L4EA 3V34A 3PA6A 2LH0A 3DE3X 1VG5A 3V46A 1ENPA 3HXOA 4J29A 3T1YB 4GI5A 3TBFA 1HR0B 3AONB 1RQ7A 3PXXA 4ESHA 1RM5A 1NY6A 1XPJA 3L8MA 4PNPA 2RCYA 5EA2A 4BNJA 4LF9M 4AY5A 3R7LA 4AB1A 4IDHA 1Q1BA 3ER6A 4MUAA 2V4ZA 2RAPA 3Q8WA 3PDWA 1V8OA 3MYRA 1GNSA 1ZOLA 1OIPA 5LA6B 4HXGA 5GADl 2G36A 2LW7A 5DNWA 4CHGA 1J0EA 5EHXA 1Z7BA 4OXKA 1OA0A 3V4PB 2R6R1 3QUTA 1W9MA 4L5JA 5B3JA 4LYGA 2UUBM 1I2CA 4J07A 4UATA 3MUEA 3WWEA 2J0SA 4MW5A 3TTVA 1Q1QA 1SCQA 4LXIA 3B3FA 3BCUA 4XX1A 2E5LM 1Y7IA 1YDWA 5JU6A 1ZUHA 5KQGA 1FFBA 1A9PA 1TTPB 3RVDA 3ILHA 1PQYA 4NE9A 3OX3A 3QXJA 1KMHB 3QLEA 3FVRA 3PC3A 2VQEB 4QUIA 3H13A 2VRBA 4RJJA 1Z75A 2C84A 3G88A 2Y0DA 4U0KA 4P4SB 5H37D 2XAUA 1EP9A 2YW9A 1II9A 2PQMA 3PV0A 2OXIA 5DNUA 1FE8A 3YASA 1RJWA 4PG4A 1L5LA 2CHEA 2CLSA 1E1MA 4YBZA 4M9CA 4DBVO 3GMSA 4KQ2A 3FD8A 2HMSA 5DBGA 3N2EA 1XHBA 3BIWA 3S1LA 5EIBC 4GMQA 2VJPA 2R2GA 4CM1A 4TGLA 4FC6A 2EZUA 5I6DA 2V7TA 3NRBA 1G8GA 3X2SA 3GA0A 2X8BA 3RBXA 1CS4C 2D2VA 5IWCA 3D1LA 4LWZA 2IA5A 2QNJA 3DAYA 4LXYA 1VCMA 3EQ6A 2JLXA 3W8RA 4V1CB 1LDGA 2OCLA 1S2GA 2B34A 4MUNA 1B8UA 2QQ5A 1JKXA 1RYBA 2Q1WA 2HAKA 3J81S 2Z2XA 3EXFB 1Z0SA 1KEKA 2VNSA 5EMMA 4D25A 1PE0A 4ZVPA 4HBGA 1NI3A 3PIRA 4LOIA 1P7CA 2XDQA 1TIKA 1RZRD 3LD9A 3CW8X 3V8QA 2OK8A 4QWWA 5DYWA 2QM0A 3NYWA 2LVBA 1TCAA 2F9MA 2VF8A 4E08A 3THRA 3UAGA 3HX3A 5CIQA 4NK4A 4HL6A 4YROA 5BMOA 1F51E 4BZPA 3OJXA 2OV2A 2AEJA 4AO8A 1XKXA 3MIZA 5CVTA 5KQPA 4KYIB 4DLBA 4ZQHA 4GZ5A 4EHIA 1M10A 4B83A 2X9NA 1WKBA 2VOEA 2G1PA 3QLUC 3P2MA 2A4KA 1PFKA 3HLKA 1HYQA 1JTFA 2JIZD 1R5LA 3IRVA 1OXMA 4F4FA 4X84A 4UBJA 3SGLA 5TJ9A 1EK6A 4MYSA 5DBIA 3AFIA 3WNQA 3EOBI 3HKDB 4UM9D 1MEJA 1YZLA 4ZHQB 1RFLA 1N2BA 3SJZA 4ZI7B 2WJZB 1PQPA 3BMQB 2JD1A 5KPRA 2X2EA 3KTFA 2ZPAA 2FDXA 2PD6A 3VNRA 2CNKA 5HKKD 1WHSA 3L0PA 1JR3D 3C3XA 1VDDA 4PF1A 5DF1A 1QVRA 4CM5A 3QKTA 1L3CA 3MUFA 2YQZA 3QQPA 1CQWA 1ZJWA 4FUTA 2I1QA 2AXEA 4P32A 3J7TA 4QE3A 2P41A 3QHPA 5CM8B 4ZV7A 2YV3A 2IE0A 3RCBA 4N82A 2A59A 4WOPA 5BRAA 2H2GA 4NOJA 3J2PB 4BEVA 2PUTA 2YJZA 4KQFA 5CFOA 4GECA 5CX1A 3K05A 2X1MA 3HJNA 5FYQA 4IBCA 4OU4A 1RQRA 3G49A 1X2BA 5IBCA 1QIKA 4GHLA 2PS0A 3NTLA 5BO5A 5B1EA 1B14A 3GCDA 2QTMA 1A9QA 2FOXA 2WJ3A 4MAFA 1QBGA 1N77A 3DV0B 4AW9A 2IH4A 5JJLA 3OJ0A 2VHVA 4NABA 3SR3A 3QWIA 4NONA 3ZWMA 1EK5A 3BGOS 4UASA 1KZGB 1SOUA 1ISFA 1OXXK 1Z5VA 2BBWA 3ESQA 1SKMA 2EJWA 5TQJA 2UVPA 3H9EO 1AGXA 4A15A 1T25A 3A58B 2XXJA 4RORA 3QU5A 2L17A 1L5NA 1JWBB 4N49A 5LA6F 3RT7A 2VUTA 1ESDA 2C8JA 3T1YM 1EVEA 1HR0M 4LJKA 4PO1A 3IQIX 4II3A 2UXDB 4HSEA 4C0JA 4K6HA 4XSVA 4JA2A 1XQ6A 2IXDA 5IRCD 1UZNA 2MSWA 4L8LA 3CU5A 1EXMA 1NNLA 3EPLA 4GD3Q 4QO8A 5KWSA 2D0PB 2QQ0A 2GXSA 2G1JA 1B4DA 3MSXA 3JAMS 2QN3A 3GH1A 3PUWA 1UZUA 4MP3A 4DG5A 1YOVA 2YZNA 4AXBA 4Z53A 1IXKA 2VYVA 3JR5A 4KXWA 3R0JA 1IN4A 4LYYA 1TF0B 4S12A 3OIUA 3K4PA 2VDQB 1IEWA 3EN0A 2J5QA 4QGAA 4UUMA 5L3QB 2V7WA 1PWYE 2PKQP 4L57A 4C7XA 1UEJA 3KO8A 4PFQA 1CPYA 4FCWA 1FU7A 5C1OA 4XX0B 1UMKA 2FH0A 1FY2A 1JVBA 4KHPB 3IAEA 2TS1A 2VQEM 4RVSA 4QA9A 1ZD3A 1KYWA 2G28A 3VA7A 4OQDA 5KVCA 5IKPA 3FAZA 3WNDA 4TWIA 2AJDA 1IIRA 4LRTB 4UFPA 2WAOA 3FG9A 3GLGA 2CD7A 4JOSA 2KW0A 2XUQA 5ED0A 2UYOA 1ZCFA 4EW1A 5ALDA 4OTZA 1RHKA 3X43A 4QT0A 1AXEA 4QARA 4HC4A 1H5UA 4B48A 3HVRA 3VO2A 1N2CA 3C7TA 3DDNA 4FFVA 5J59A 3P4XA 1E3DA 1WO8A 4UQPA 4TL6A 2JAQA 4BEBA 1I1HA 4MRVA 2YXNA 4JLVA 4R98A 1NW7A 1K7FB 3NC0C 3IYLW 1R6UA 2OFOA 4LK3A 2C4HA 1L8OA 1V48A 3PQ3A 1EUCA 3NB0A 4WA7A 4FSDA 1SUBA 5EE3A 4DSAA 3S6JA 4OQQA 3OKCA 4RQTA 5KO2A 5AW0A 4HWKA 3OX1A 4FP9A 1YCGA 3KKLA 2FKNA 1QHNA 3GRCA 2IRWA 4B3XA 3GXBA 4L27A 3MK31 4MW6A 5DYYA 1QPBA 3S70A 3DO8A 5ALNA 2EZ8A 5CHYA 2RGGA 5DKFA 4KIJA 2OEPA 5KAPA 1NLUA 2ZT7A 5GIOE 2Y0CA 4J9UE 4OLBA 1ZKMA 3BTVA 1ZK2A 1Y7TA 1DO0A 5H3CA 4DY4A 4ZHQF 1GU0A 2XODA 4PBTA 4TPKA 4TWZA 3LYHA 2DAPA 1FU4A 2GRAA 1UC8A 3TLYA 5BUSA 2HU7A 3INRA 1BE6A 3ETHA 1KQOA 4MXDA 3M0EA 2XH8A 2ZS9A 4ETWA 4EW6A 1VJTA 2HT6A 3KHSA 3M6WA 3B60A 3U13A 2QLFA 1H9BA 4PFSA 4M8LA 3VX4A 2XZPA 1BJKA 3FPHA 3I2YX 2C92A 1PDVA 2KBEA 3CT4A 1HMYA 5A3JA 3ZE7A 5IKOA 2WBLC 2V6GA 1B42A 4KKVA 2FE4A 3T1NA 5FT9A 2RC6A 1D5WA 4IL5A 1QGOA 3JARB 1U7ZA 2H1HA 1I0LA 2ZREA 2R85A 1KP2A 1GG2A 1EE8A 1WGLA 3QLUA 4KV9A 3ZVMA 4XGIA 1KIMA 4JT4A 3LCMA 3UCEA 3ZX4A 3A42A 1VKNA 4JI6B 4WN9A 5ALPA 3MTBA 1FXUA 2J6BA 3QOYA 3IG8A 5CITA 1IG0A 3FWKA 4Q9LA 1VHQA 4MRMB 4PAOA 3BFXA 3NBUA 2I1WA 3HDYA 1PJIA 3FFXA 2ODNA 3L7YA 3M6AA 2WPDD 2VYFA 2QPLA 3OOJA 2GCIA 3HH8A 3NM5A 1N9KA 1XV5A 2ZR7A 4KMOA 1MRZA 3KJZA 4YRSA 3R0IA 3GDWA 4LY3A 2CBZA 5BWOA 4BLSA 3P9XA 4S1TA 1JG4A 1OLUA 2BVNA 1KVUA 4OK3A 1SIWA 1MIOA 1L1FA 1M6WA 4CT4B 3GGDA 3M5PA 1UJ6A 3KVWA 2FN4A 3G2IA 1M2NA 2AUNA 3E4CA 1Z2EA 1A9YA 1NJ8A 4MKHA 5DSZA 2JAOA 1YVRA 1E3LA 1P60A 2DHYA 2UXDM 1DQZA 1D6SA 3EQ7A 4DBGB 4PONA 4ENWA 4A0SA 2YV4A 2PZ8A 1Z8NA 2PZEA 4UNPA 5EZYB 3LK6A 4F93B 2WM2A 2XRFA 4IJ5A 4HVTA 1S2DA 3WBBA 3CPSA 3IHPA 3FJ1A 5EWLB 4GMGA 3FPBA 2VZEA 2Z4RA 3D0OA 3HHYA 3ELYA 3DJFA 3FPEA 4X6XA 5J4LA 4DM3A 1KEUA 2ZSEA 2YOHA 4AX8A 5DEOA 4RS3A 4MQFA 1EUDA 4EK9A 2JKVA 4R71A 4ZXFA 3OCZA 3HY4A 3W2EA 3VKGA 1YS9A 4KRFA 4ZAXA 3EQZA 2O1SA 1A88A 3IQDB 4KHPM 3RQSA 2OKCA 2WYIA 1GDTA 3V1MA 4LYDA 1IVNA 1UKCA 1A77A 3EUAA 3PBKA 1U1DA 4LBWA 2GYVA 3BK7A 3H2IA 5HF5A 3FRHA 1H3NA 3LT5A 5HGXA 2RGYA 4FCVA 3GLUA 1W4CA 1THGA 3U44B 3NDPA 1Y8ZA 4LWPA 4Y6LA 4HNAA 1P5ZB 1OREA 1N6LA 4KSBA 3VC7A 3VHLB 1JU4A 5CBPB 1Z7WA 2VP0A 3CT6A 3RTAA 4HN9A 2HEIA 1Q77A 4QHTA 4H1WA 4MKIA 2QTHA 1BN6A 3JQAD 3AU8A 4FFRA 3IT2A 1DIBA 2AE2A 2G80A 4EFKA 1C0KA 2UZ1A 1KIFA 1XQWA 3OIGA 4FKBA 1VFPA 3E46A 5JE8A 3P4YA 1MMFB 2HQOA 1NI4A 1OX6A 1LS1A 2H9IA 2P3SA 4PHFA 3FW1A 1NUHA 5BQOA 1T91A 2IX9A 5KOHA 4HNRA 3LLSA 2PJUA 3F73A 1U7XA 4YP1A 3HGQA 1NAIA 3ZY5A 3ZGNA 1XMOB 3K0AB 4A8PA 2POQX 4YQZA 4XVCA 3Q7TA 1G7TA 13PKA 4OAQA 1L3IA 2A7QA 4B32A 4BMCA 2ZJOA 2G8NA 4FHGA 4E33A 1T2EA 4MQEA 1SBZA 3ZBUA 2CVZA 5FD8A 4R6WA 3OPXA 3WL5A 3OPYB 3AKEA 1OIZA 3C3WA 3PVZA 2J5YA 4RZIA 1GRCA 4J0DA 3OZTA 2AGVA 1LLFA 2GXUA 3GJ0A 3VR6H 1AMUA 2GN6A 2FFBA 1JHQA 2MYUA 4B40A 1WP4A 1CU1A 4H27A 4V03A 3HNRA 5IX8A 4MV4A 4Z6YA 4FJ1A 3SHWA 5BR7A 3NIWA 3P27A 2DHCA 3BF7A 3F5FA 4Y2SA 1M2VB 3Q3HA 1U2GC 4EY7A 2OBNA 4IHJB 2ZAGA 2IZ6A 4DMCA 1M34B 3UXYA 1ZCZA 2XUDA 1QKKA 3VPBA 4MO9A 2ONCA 4OHCA 1V7ZA 3L79A 1E9FA 3S44A 1J1ZA 4NZZA 2GN0A 1Q0PA 5JAUA 5CFNA 1MO3A 3GP8A 1CUXA 4MS3A 2BNKA 3E2IA 4OATA 4XWGA 4B84A 3ZHCA 4N48A 2VZ9A 3VO9A 2XUHA 3QWBA 3H04A 1PZNA 3KKQA 2K6GA 1T5HX 1ODTC 1OAIA 4ZEVA 1Y1QA 1Q22A 1KI6A 2CVOA 1SB8A 3KQWA 4X71A 1PD1A 3LYLA 1X1TA 1P3QQ 2PGLA 4JI6M 3OZGA 4DJEC 4AJKA 1UZMA 2COEA 2RHJA 1ZRHA 3UGJA 4WOJA 4BQIA 1FXSA 2H5IA 1S3GA 1TM4E 3V48A 3TDKA 4IZOA 2QXUA 3FDJA 5DSXA 1KVRA 2F7SA 3N3AC 1N57A 4UTVA 1AKUA 3AHDA 4ETMA 4ESEA 4X8HA 3VVMA 1H0KA 1DIRA 1V7CA 2WJVA 3EARA 3HA2A 5JEEA 4K9OA 3D54D 1WB4A 3DLHA 3U7QB 2FE8A 2O2GA 4K86A 4PM4A 4E5UA 3WWCA 2F43B 3HM9A 4ANRA 3TYXA 1KXJA 1BH6A 1T1EA 2H06A 3VAYA 4LDPA 5P8WA 4CG2A 4H6VA 1J56A 2ZXEA 5LDDC 3HFJA 3CUSA 4HQRA 4X7MA 1WEHA 3AR4A 1NW9B 4EAAA 1XYGA 5D51S 2C29D 1N5JA 3N59A 2JWSA 2GHIA 2FCAA 2RAFA 1GNQA 3JTEA 4AZ0A 1ZV1A 4RCZA 4GBJA 2VBGA 4BC0A 3ETEA 2HA5A 2GD0A 5J2UB 4ZAZA 4BV8A 2RG7A 2XUGA 4O3FA 3SARA 2H7YA 2HNKA 5CRIA 4BUZA 2NW6A 2QW8A 3UMVA 5HM6A 2RGDA 3O2JA 1ZJ6A 1UBTS 4WRRA 4L8RC 4Q1AA 3HA5A 1XMSA 2NO1A 4EYGA 2D6FA 5LSAA 4O3MA 1RWQA 3Q3GE 1ZMXA 3JU3A 4FCCA 4J1TA 2FEPA 2YWXA 2ZSJA 4TTRA 2UZ4A 1P1HA 2IZ1A 1SVIA 1VHLA 5FWAA 4B3JA 3R9XB 1R6BX 4WCFB 4GRIA 1U8TA 2CDAA 4FFNA 3ZWNA 4RVHA 2ST1A 3ENNA 5HMMA 1OHHD 4Z7QB 4W5WA 1DBSA 4GDMA 1TC1A 3GRAA 3DUFA 5CTAA 1BDBA 3G0DA 2EGHA 4OYYA 4COKA 4ZQBA 2EP7A 3FI9A 3EVTA 3NOVA 4NAVA 2AYYA 2MWMA 5DI3A 1XDBA 1CJKC 3REFA 2BE7A 1YBHA 4A0GA 2MTBA 2WIJA 1RXVA 1GCUA 4QXQA 1X2EA 5HFAA 2HHCA 1P61B 3ZH9B 3RBZA 5B4TA 1R6TA 4BKPA 2FMUA 4AZWA 1T10A 3ND6A 2LVAA 1QAMA 2G7MC 1NQWA 1QDEA 5FI5A 1RAFA 4TKMA 5HJ5A 2REXB 1E2HA 1WNFA 1KEVA 3VVBA 4NNJA 1O7JA 4FMPA 2DWNA 3MILA 4PO3X 4DHEA 4U63A 1LDNA 4JJKA 1ZRMA 3HHPA 2OTCA 3UBMA 1AC5A 4DDTA 1IPHA 3UICA 3RG8A 1H2RS 3L0BA 1TZCA 2IY7A 1XMOM 4KSYA 5CDFA 3BIXA 3OM9A 4DCUA 3EEYA 3Q6IA 5IU6A 4UOQA 3TZCA 4L8FA 5CB4B 1M1YB 2UYQA 1F8UA 1NJ6A 3VVLA 3ABRB 4DYVA 4HFNA 2CUTA 2LGJA 1Q02A 3PE4A 4TYMA 1Z2CA 2ARKA 4B82A 3W2TA 1KTVA 1EXVA 1BOFA 4ZOLF 1C7IA 4E4TA 2G1UA 2QZSA 4F6LA 1W88B 4MJ7A 1PJ4A 3L7IA 1H66A 2L7HA 2Z4SA 5LKRA 1R37A 1V43A 4KREA 2JLZA 3N87A 1YDHA 1H4VB 2D1RA 2XHZA 1I32A 2CSUA 4JIGA 4YMTA 5CDUA 3HMKA 2W6CX 3A26A 4KGVA 5SZIA 3X1KA 1V71A 4IG9A 2ZB4A 3W8FA 2GKOA 3Q0EA 4BWFB 2G3YA 2DWUA 1UDAA 2BUCA 1A8PA 1UC9A 5FOQA 4CIXA 3GPXA 2KWIA 1V4BA 2CWBA 7MHTA 5FFNA 5G0WA 2VF4X 4FONA 1ZOPA 5J4YA 1XKLA 3AVXA 2RIPA 1UMDB 4G0OA 2PMWB 4I50B 1Z2PX 5CXUA 3KXPA 1KSHA 2WM9B 1K2VN 4DA9A 2VTKA 1NM5A 1MTZA 5KYTA 4C07A 1D2MA 3O0TA 2NZYA 3GFPA 2QHOB 4PGHA 4C7JA 1OXTA 4TXHA 4JOCA 2M60A 4JDUA 1WDTA 3HSSA 2TMDA 4P54A 1J00A 5A0FA 4WDQA 3O38A 4Q24A 1ZD5A 3T0IA 1XF9A 5AD1A 4B44A 1TQHA 2PX6A 3A9RA 4YGYA 1UFQA 5FNVA 1G1AA 3WIBA 2A94A 4QPJC 3PCTA 1GFZA 4YMHA 3IEPA 2XA1A 4OX9B 2QDXA 4IG4A