4LJ8A

Clpb nbd2 r621q from t. thermophilus in complex with adp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj8A01
1KKMA 2DPXA 3UXMA 1KO5A 2W6IA 1G19A 4EJSC 2G1JA 1I2DA 4YDSA 4B6EA 4S2EA 1G3QA 2O8CA 4Q1BA 2KE5A 4DCUA 2XJ4A 2B21A 3QEJA 5G3YA 5EP2A 4EPRA 1I4LD 2D7CA 4GP7A 1W4RA 1W1WA 1GKYA 5DE3A 1VCIA 4HI0E 1KI8A 2GKSA 4I99A 4R2IA 3TVDA 1Z47A 5FOTA 4BE7B 4B3BA 1M7HA 4DEXA 4H1UA 2ZTSA 2BEJA 5EQTA 1CTQA 4RKFA 2GJAA 3H86A 4OK5A 3CX8A 4DEYA 1XD2A 1N25A 4AG6A 2ZI6A 1GKUB 5DGXA 4LDJA 2ZITA 2EVWX 2WZQA 2VEDA 1EESA 2NZ8A 2J7PD 5SZJA 4AWXA 2FOLA 5CK4A 4Z8YA 3RHFA 1ZNXA 1QHYA 3NEYA 4PPQA 5JRZA 2ZJ2A 4CEHB 2EFHB 3BRWD 4Q9IA 1T91A 2B8TA 3M0EA 2QORA 2Z5FA 4LPKA 5AJYA 2G0NA 4E07A 4EPTA 1J2JA 5TV2A 4F93B 5LD2B 1G9XA 3I8XA 1XEFA 3MWLA 4GOJA 1RZ3A 1OKKD 2G88A 4K46A 3ZIAD 1KMHA 3RC3A 1ZNZA 2GBLA 2YJTD 3EPHA 2A5GA 4PPFA 1W5TA 2ZIAA 4ZKEA 3C5HA 3QIAA 2DYKA 3LDAA 4LJ8A 1G7CA 3GLFE 1XDBA 2PT7A 4HB2A 4IKEA 4CT4B 3CRVA 5GADl 1R6BX 1QVAA 2ZVQX 5EXTA 4IHQA 4LJ5A 2ZRAA 2Q21A 1G5RA 1QDEA 1R0WA 1WDTA 1X8JA 2Z6VA 1XP8A 3A1WA 3GJ8A 3THYA 2FV8A 3KJIA 4LHWA 3W5IA 3WMEA 3ZQJA 2QMHA 4NP6A 2ZRLA 2ORVA 2Q0HA 5FI1B 2BHRA 1YVDA 1JB1A 4EPXA 3I61A 1KKLA 3W5JA 1UKVY 3KKOA 4ZCLA 3OIUA 2IHYA 2IUUA 3LLMA 1DPFA 2VQSA 5C2JB 1TNDA 2RHDA 1ZINA 1NVUQ 4HDQB 4V03A 2GTPA 3PCRB 3RS7A 3LD9A 3NBXX 1EX6A 5D3MB 1XXHE 2JIZD 4LC0A 1KIMA 4RCZA 4QGHA 4QGGA 5JWHA 2VP2A 1GILA 3KB2A 4HAYA 5B64A 1XBTA 2WWGA 2PLRA 1ESNA 4C9BA 4HLUC 1JAIA 2OEPA 3PEVA 3MHVC 2RB4A 4DSOA 2ZM5A 2C8VA 3CKLA 4U5XA 4ARZA 3LX5A 3OEHA 3AVXA 1WB9A 2GEUA 2RGEA 5KSOA 1NLFA 5HKKD 1ZC3A 2A5FA 3Q85A 1T5IA 2QAGA 2GCNA 2O52A 1W2HA 1HURA 1UKEA 3ND8A 1UBFA 1W48A 3BB3A 3QXHA 5BWMA 1QHNA 3IIJA 1G64A 4QHYA 4Y0VA 1KSFX 5IRCD 4BEJA 2CK3D 4Q4HB 1G3UA 4RD4A 4WZBE 4M1OA 4AIIA 4C0JA 2IYRA 1S1MA 2WPDD 5E3HA 5J40A 3W9YA 2ERYA 4KLNA 2J41A 4M22A 3P4XA 4A8JA 1H8HA 2PBRA 3RS4A 3L0PA 2GA8A 5A5GA 4JLVA 2FWRA 2C96A 4PTLA 3E2IA 1QG2A 4EAQA 1XZQA 4DLWA 1A1VA 1WF3A 2DR3A 2VHJA 5JSZB 1PLKA 3IBGA 3TK1A 4LRSA 2GF0A 1P9WA 1G4AE 5EXXA 1X8LA 5B2ZA 4LGMA 3MGCA 1C4OA 2IA5A 2NPFA 3KUCA 1T4GA 3ZZUA 3QSYA 2Z43A 1RKBA 4QOSA 3CX6A 4C0SA 1FP7A 2IC5A 4F4JA 3WBKA 2WWWA 4MGIR 4JL8A 3A4NA 3LQQA 2JLXA 1EFCA 4L9WA 1Z6TA 1R0XA 4Q01A 1LTQA 1P4SA 4MYTA 1VIYA 2MMCA 1S96A 2EFEB 1S8FA 2GZDA 2CLSA 2G9NA 3IDQA 2V4ZA 3HYTA 2FEOA 1E9DA 1DG1G 3U7GA 2GF9A 3RS5A 2FE4A 1Z6AA 1ZM4A 4GP6A 1A7JA 3X1DA 3L43A 5E7IA 1HYQA 3CRMA 1CXZA 1SULA 2AWNA 2IT1A 3BORA 3CRRA 1MO3A 2AD1A 5JEEA 4TMVA 1Z83A 2AR7A 4Q5IA 2NGRA 1WBDA 3C7KA 2XTNA 4DUGD 3GLHE 5GJVC 3B2EA 5ANRB 1IBRA 4P4SA 1Z3IX 3GLGB 4HUQA 3CH5A 2GRJA 3EAQA 1U0JA 3ZD6A 4MRNA 1NMXA 1EWQA 4HATA 2C9YA 1SVSA 1XTJA 5DH9A 3RSOA 4Q4LA 4A4DA 3EPLA 4CEJB 1EK0A 1NN3A 2YVUA 3KTAB 3R9IA 3O8DA 4NKRA 1OE0A 4XWOA 1F48A 4D0LB 3ZVMA 4C4PA 2AN9A 2QZ4A 1CR2A 2IS4A 3U6KA 2ZAMA 1OIWA 1QF9A 1L8QA 2BCJQ 3LVRE 4Q9HA 2C5LA 1HTWA 1VYUA 5EP3A 1Q1BA 4TWZA 2V6IA 3QQ5A 4XTCS 3EPKA 1DE0A 1P9RA 2R6AA 1G8GA 4Q7LA 2WOJA 1CR4A 1XXHB 1G21E 4PZYA 4B6FA 4ZDKA 5JCZA 2QBYB 2J46A 3FWYA 5KNCA 3EWAA 4Q7JB 4V0ME 4MUAA 4B3CA 1SXJE 4A0FA 3G5UA 2EWVA 5GJBA 5F98A 2E87A 1TTTA 3GLIE 2CLCX 1N5KA 1LV7A 1E96A 1XNJA 2CL7X 2VRWA 4M1WA 4WOPA 4DLYA 3DVLA 3AP2A 1XCMA 1AS2A 421PA 5DHAA 2WSSD 1LF5A 1VG1A 3MWKA 4FCWA 3EC1A 2P5TB 1RVDA 1Z0AA 3AV0B 1R10A 1SVLA 1T3SA 4K81B 5FPTA 4NU0A 1CLUA 4B35A 3CWQA 1XRJA 4PXAA 2CXXA 1XJCA 5AJVB 821PA 2QPOA 2RGNC 2CDNA 2VP5A 2DWZB 1AQUA 1E2HA 5KUTA 5JRJA 1US8B 4JVMA 2MMGA 2KBFA 2ZE6A 5CJ2A 4E03A 4UNSA 3B85A 5CB6A 4GRAA 2ZRJA 5EE5B 4JVSB 5EP1A 3EC2A 4D82A 3LO5A 1J70A 1P5ZB 4NZYA 2J7PA 1G3IA 4EKDA 1KDTA 4NHOA 1Z63A 4FWDA 1GRNA 1T6NA 2J9RA 5FOVA 4G0NA 4OQFA 4L5BA 3K9HA 1TL7C 2WMOB 2DB3A 3VR4A 4B3DA 1A2BA 4D4MA 5JECA 3GFPA 4BFWA 1PVOA 1L2TA 1FMJA 1OXUA 1SVMA 5TY0A 2PL3A 2GXAA 1OKKA 1EFRD 3ZIAA 4QHTA 4GMDA 2CHVA 1E79D 2Z0MA 4YMWA 3A1UA 3NC1C 2PMKA 4BFSA 2FH5B 3P20A 2HCBA 1SXJD 1U9IC 1LB1B 4S35A 1TU3A 4LSGA 2P65A 3JVUA 2BM0A 2B7BA 3VU9B 2HUPA 5FOUA 5AUOB 4URVR 3ZVRA 4DJTA 1WQ1R 1E2PA 1XJQA 2IXFA 1N6LA 1T8TA 4GITA 2QSZA 3CNOA 3LY5A 1GZSA 1G291 3K0EA 2VF7A 4II7A 1CJMA 3GLHB 2YZ2A 4PO8A 3VX3A 2O8DA 4HAXA 2C9OA 4NPHA 3F3YA 4BZPA 5FPHA 5B58C 1ZD1A 4ZIRA 2RMKA 3AUYA 2IF2A 1KO7A 3CLVA 3DL0A 4KVAA 1RRGA 3TGPA 4JYBA 4TYYA 1G6OA 2CE2X 4BLPA 5GJWC 3OIVA 3SOPA 3O8BA 3H0KA 2JIZA 1U98A 3ZVLA 4URUR 2MSCB 3W34A 4KV9A 3ZS8A 2LKCA 4B2IA 4M8NE 4DLTA 1C1KA 4I4LA 2JJ1D 3PFIA 4DKXA 3QEOA 3B1ZA 2ONJA 2REOA 2R6DA 1P2VA 2JLRA 4D4KA 2WJGA 5HKKA 1UDXA 2VF8A 4B33A 4A15A 1W0JD 1XTIA 4WIAA 2PX0A 5EXSA 1HQCA 1UADA 2VSXA 3K0FA 5J4VA 2X19A 4L8GA 3ADKA 2DY1A 4JLAA 3PV0A 5FOWA 2XTZA 2JGNA 3NHAA 4AKIA 3FB4A 3K0AB 4RD2A 3B1WA 4KFTA 3H2YA 4CEIB 3AF4A 3SDZA 1KI4A 5G53C 5BXQC 4HEJA 2BJVA 1NKSA 2WPDA 3KUDA 1NVVQ 3GLIB 4TT3D 4PSVA 1ZM3A 4TMTA 4JIMA 4V0OA 1IXZA 3DDCA 4IXNA 3CRW1 1ZMXA 5E7MA 1W4CA 1DAEA 3ONWA 4Q1EA 4RY2A 4D4JA 4DCSA 4US1R 1IONA 1LF0A 2XTMA 2Z83A 3AP3A 4IVQA 5EE1A 3GLFA 2F43B 2ZRFA 2FF7A 3UMFA 4CEJA 1KO8A 1YE8A 3UG7A 3VKGA 2JASA 3C41J 2RAPA 4P4TA 4D4LA 4M21A 5L3QA 1KNQA 2OFXA 1ZW6A 2EYQA 1T8UA 3L82B 1GFIA 3R7WA 3WYGA 4A82A 4DDWA 1KJYA 1SKQA 4Z8XA 2O8FA 3WRYC 1WP9A 3KDSE 2A7QA 1TUEA 2W58A 2D2FA 2V54A 3FDIA 4LYAA 4E22A 4OK3A 3D8BA 1N0VC 2N46A 1Z08A 2ZS8A 3R8CA 2BC9A 4HAVA 5IK2D 3AF0A 2R2AA 4DZZA 1JR3E 1KTVA 2QTHA 1XD2B 2A5JA 1R7RA 1U8AA 3EIHA 4XVQA 4D2IA 2H18A 3KJEA 3C5CA 3LRPA 3W3AA 2J7KA 4BASA 1OFHA 1GL7A 5EP4A 1A2KC 3SBEA 1G7TA 1OFIA 3LNCA 4W5WA 2FN4A 3ADBA 3MJRA 3WY9A 4A1FA 3LBNA 5LBIA 3AKCA 3SJBA 5FPYA 1KJWA 4F4CA 4UJ3A 4HB4A 4UNQA 3I73A 4RD3A 2ZRNA 3NXSA 2IYQA 3Q5EA 3U4QB 4HLQB 1P61B 4RD0A 4NCJA 2OXRA 2HLDD 3K9NA 3AVPA 4JBWA 3VKHA 1D9XA 3A1TA 4KBFA 2O5VA 1NY6A 1MRSA 3ETLA 4XVRA 1BKDR 5EE0A 4LBWA 2DFKB 3RDPA 721PA 4UNNA 3GD7A 3PUXA 1NN5A 2OLKA 2KI5A 1IAQA 3THYB 1D5CA 2ZE5A 2ZRBA 3K70D 1XD9A 2HF9A 4QGAA 4YXWD 3WBJA 2BCGY 2OCAA 4US2R 4IJMA 5F3WB 1US8A 3AF2A 4PPGA 1QHHA 3RS3A 1QHIA 2IUSA 5DO9A 4AG5A 2I4IA 4W5JA 2JLZA 1CR0A 2VSOA 4HAZA 2BDTA 4GDFA 2ZYWX 1MO6A 3MCAA 4RZ2A 1OXTA 4YMSA 3A4LA 5TMPA 2CJWA 2KBEA 4FIDA 4JLJA 4ZDJA 3ZVNA 1XTKA 3K53A 1YZKA 1GM5A 3ICEA 2D2EA 3C16C 2IBMA 1XMJA 3UK6A 1E4YA 4LYHA 3W6OA 4UXHA 3PG5A 4ARZB 1S2MA 1ZUHA 2QMEA 1JR3D 2JJ8A 1NG9A 5JMTA 2GEDA 3BH0A 3AGPA 4W9MC 5J5CA 4IFBA 2QAGB 4KLZA 4GI7A 2MSEB 4PAOA 3CF6R 3U3JA 1COWD 2W2XA 3IPYA 4QBIA 2QP9X 1LFDB 1Z6GA 4TYWA 3QOFA 1SZPA 3QF4A 2WSSA 3PUVA 5DLQC 2NIPA 3L0IB 1XEWY 1XU4A 2PEZA 1HE8B 4DLZA 2QPTA 1D6JA 3JVVA 3HR8A 1FZQA 3A4MA 3DEFA 2WMNB 4A8JB 2JAQA 4RVCA 5JWRA 3VX4A 3PQCA 4BLRA 3U6BA 1NG1A 3LVQE 3TMKA 3KXKA 2YV5A 5JCPA 2JATA 3UMSA 3Q3JB 3BIFA 5J4YA 4C2UA 5AUNB 4LHXA 1SVWA 3VLFB 1N6KA 2J3EA 1ZP6A 4QG7A 3LWNA 2W0MA 3QPUA 2ZI3A 1UEIA 1YJ5A 4UQOA 4E5UA 1AS3A 1UM8A 4Q18A 2HJVA 2VL7A 4Q9JA 3SHFA 4GPTA 3EPJA 1GIAA 1ZD9A 1Z6YA 2OAP1 4KXFB 2NO0A 1Z2AA 3K09A 2QSYA 2BBSA 4ZCMA 2WM9B 3AEZA 1U0LA 2J5XA 5KTYA 2IEZA 3PUWA 2IL1A 4G5GA 4HAWA 2FZ4A 1G6HA 2PCLA 5FTLA 3LBIA 2VHTA 2ZROA 1EFRA 2FDCA 1ZIOA 4YQFA 5KPDA 1RRCA 2ZR7A 1E79A 1Z0JA 1MO4A 4BFTA 1KHTA 5ELXA 2FPKA 2G1KA 2X2FA 2KB0A 4EPWA 1KGDA 2OXCA 4LI0A 4BZQA 1SXJA 2QUZA 3T61A 3UKDA 2QU8A 3CRQA 3HYRA 1UJ2A 4FCVA 2GVZC 1SGWA 3NHBA 4BLTA 4C0QC 2X1VA 5TXGA 3BJIC 4LZZA 2XEXA 2LCFA 4ZDWA 3TUZC 5FUXA 2RGCA 1E2MA 3B6EA 1VHTA 3BFXA 3TUJC 3PEYA 1OF1A 1ZRHA 1IJEA 1ANKA 1RIFA 4HUQB 4P4SB 4BEBA 4YMVA 2F43A 1N0UA 1CJKC 1F6BA 1MR3F 1KYIA 3MD0A 2IYWA 4B75A 4XJXA 1R5BA 3T34A 4MGZR 1G3MA 3AKEA 2QTVB 3LA6A 3O8CA 1DADA 1G7SA 3HP1A 4LBYA 2GCOA 4HUTA 3M1IA 4MITA 4PC1A 3H1TA 3EZ7A 4DWJA 4KSBA 2QP3A 5H8WA 3QENA 1IN6A 2D06A 5FTJA 2OZEA 4H9GA 4IDNA 2IXGA 4JJKA 2PMDA 2O8FB 3FMPB 1XMIA 4MRSA 3FMIA 4IVRA 4DXAA 5CB8A 2EFGA 3IGFA 4ITRC 2P2LA 3WNBA 5CM8B 1X37A 2JJ1A 4I1OA 4OHVA 4B2PA 1Q20A 3QY0A 3DZDA 1J8MF 3CR8A 4NYJR 1CF4A 2IYVA 5L3SA 2J0QA 1GTVA 3LXXA 4FWIB 1E0JA 3F8TA 4IDPA 1W0JA 2BKEA 5FPSA 5IT5A 1W4BA 1XEXA 5HR5A 1JECA 4JVLA 4MKIA 4ERNA 4A0GA 3T5DA 2MSDB 2XB4A 1FQKA 3SFZA 5JHHB 3UIEA 3ZDQA 5JHGB 4HLDA 1NMYA 4URZR 4WBSA 1E2FA 1G3RA 4RD1A 4CVNA 3WRXC 4MA4A 3RABA 3R8FA 4DSNA 3EXAA 4IOLA 2ERXA 3P26A 4BFVA 1QRAA 2ODWA 3RSLA 2ZQ5A 2OE2A 1KI9A 4WZ6A 5KDDA 4TT3A 3U4QA 1UBEA 2IYSA 1KK2A 1L7VC 4TLAA 1JJ7A 4BLSA 1XMSA 3NG1A 1OIXA 1IN4A 2O0HA 4FWHA 3RRMA 2GK7A 1BMFD 5FBQB 2WBLC 4Q7KA 2WV9A 1N5JA 1E2NA 4G5RA 3KQNA 4OI0A 3B82A 2R6FA 2WKPA 3QKTA 3ZJYA 4C0KA 4ESHA 5L3VA 4ON9A 2WIAA 3SJCA 4EFLA 3U3MA 4QHSA 1E9AA 1U94A 4D81A 2QRZA 3C14C 5KO2A 2P6NA 4GBMA 1IY0A 1DAIA 4JVNA 4RSGA 4TLEA 3BS4A 3AVUA 5JJKA 2QA5A 2YWHA 3EW9A 2ANBA 1KK1A 1GNQA 3KKMA 4JJZA 2Z4RA 1ODFA 2P6UA 4JT2A 4Y0AA 2G77B 2FSFA 5IK2A 2J59A 3EZFA 2QI9C 4LC1A 4B48A 2C03A 2F6RA 4PAQA 4MQBA 2WHXA 3D7MA 5E7JA 1R8SA 1NIJA 2ZJ5A 4E09A 1YR7A 3V4RA 2XXAA 2P67A 2CL0X 5P21A 3HDTA 5JEDA 5M04A 4A2PA 1U81A 1FMLA 5LD2C 4BUJA 5AK0A 4A36A 2BBTA 2WVJA 2F9LA 4RZ3A 4A2WA 4OJQA 3AKDA 4O2RA 3EG5A 4DBLC 1VTKA 1W0KD 3C8UA 1XX6A 2D74A 1D2NA 2DFTA 4QL3A 4TL8A 2F3RA 3P27A 2HV8A 1IQPA 5HZKA 3U2QA 1KI6B 1DO0A 2PT5A 1KO1A 2V55B 1IJFA 2BV3A 2OLJA 1OXXK 4DLUA 4V0LA 3WNDA 4B43A 1K8RA 3REGA 2IX3A 3VR3A 1W44A 3ASZA 2HLDA 1KI2A 3IIKA 3LV8A 1OH6A 1W49A 3L8ZA 3H84A 4WA7A 5J4KA 3TQFA 3LH5A 4LUCA 2IEYA 3NDBB 5JJIA 5AJZA 2CL6X 4B3GA 3GJ6A 1G41A 1R8QA 4AY2A 2IYUA 2WJIA 3BERA 4YXWA 3BE4A 3VR6A 4D26A 4ZDIA 3TUIC 4DIDA 5JS7A 2O8DB 4DLSA 4JN6A 1Y63A 2GCPA 2QMUA 4ZIRB 4HSEA 4TQAA 4O25A 3SYKA 1ZVQA 2WIBA 4JZKA 1MO5A 1E2GA 3WYFA 1P62B 4ILEA 3D31A 4A2QA 3BH7A 1FNMA 3S1AA 3KZ1E 1E2KA 2H57A 1TPZA 1KAGA 4R7ZA 4FXPA 1AK2A 1BH2A 1ZM2A 3BB1A 2TMKA 3LX8A 4F91B 5UKDA 1AQYA 1G8PA 4M9ZA 4G5QA 2XZOA 4TMWA 1YZNA 2EW1A 1EGAA 5FI0B 2HYIC 1JR3A 1X3SA 1ZUIA 4TYQA 3SYLA 1TX4B 5DI9A 4EJSA 3K0FB 4HDOB 3CR7A 1COWA 1M7GA 1NVMA 4OBEA 3MFYA 4XTRA 4ZV4A 1PV4A 3SI7A 2OESA 3DKVA 3MRSA 2XGJA 521PA 1E2JA 5FTNA 1F60A 2D62A 1Q12A 1W7AA 3F5FA 1VYTA 5FL7D 2R8RA 2ZYUX 4PFSA 4PO1A 4TLBA 4TLDA 3QKRA 4PX9A 4URWR 4BFXA 2ZRKA 3V9PA 2B6HA 1R5OA 1DG3A 1UKZA 1ZIPA 4NL4H 5DISB 4PSAA 1W36C 3P32A 1XF9A 3GLFB 4M1TA 2DFNA 2KSQA 2ZAOA 5H1YA 1Z8FA 2AWOA 1CJUC 2BMDA 2HEIA 1E1RD 5L3QB 3GFOA 4AC9A 1N3BA 2XAUA 4HZIA 4B47A 3R7WB 3WYAA 5JJLA 4KU4A 5GVSA 1Z29A 3AGQA 2ZPTX 3AVTA 4QJ3A 1VIAA 3RRZA 4KFSA 2ZRIA 1IOZA 1ZM9A 2FA9A 2QEQA 3Q8XB 2RGXA 3CO5A 1SVKA 4TTPA 1NP6A 1XZPA 2IXEA 2GXSA 4TSFD 3NWJA 5JZVA 1N6PA 2ZRHA 1YZQA 2WKQA 1GOTA 1II9A 2JEOA 4IDOA 4B32A 5KDLA 3GJ5A 4LX0A 2REXB 4A0HA 1KDRA 2QGNA 1ZAKA 4RFVA 4W7SA 3RNLA 2C78A 3HR7A 1SHZA 4TZ6A 2ZU6A 1R4AA 2XX3A 2BBWA 4M9SA 3OHMA 4KODA 1Q3TA 1SHKA 4OQMA 1KZ7B 4HB3A 4DB4A 3LBHA 5AJWA 1P2SA 1YU9A 2V6JA 2ATXA 1DS6A 1ZU4A 5J47A 4BWYA 1TQDA 4LY6A 3L0SA 1MKYA 1S1CA 3TRFA 4LJ4A 2RGBA 1TMKA 1DO2A 2J0VA 1N5LA 4JL5A 4YDHB 3X1ZA 2WTUA 4JLKA 1KDOA 5IHPA 2F1RA 2ZSDA 5JI3E 3BWDD 3ZD7A 1IN5A 3GEEA 1XPOA 1Z0IA 1F5NA 4CGZA 2H5EA 2OCBA 2OM2A 2HCJB 4LJ6A 4FMDF 1Q1EA 3NEJA 3Q9LA 4D0GA 4PC6A 6Q21A 3BD9A 2HXSA 2QAJA 3B5JA 4HLUA 1UKYA 1NL3A 3PENA 4YMUA 4C0HA 1NVWQ 2UZIR 3QKSA 4PQYA 3QKUA 1YHNA 4C7OA 1CS4C 5FOXA 2PLFA 2F1JA 2XOKD 4MGYR 2YWEA 1TQ6A 1QHHB 4DSTA 4MUBA 3QXCA 4BLQA 4X8OA 1M74A 1X1SA 3U7FB 4GZMA 4OHXA 5L3RA 4CRWB 2VTKA 2CJWB 4GOXA 2PEYA 2ZSAA 2V3CC 2FFBA 4BRUA 2EFDB 1E1QD 3VNVA 1PJRA 4PHTA 1G5TA 3MG9A 3MMPA 2QE7D 3RWOA 3VR1A 3PUYA 1QHSA 2CCJA 1KI6A 4QKQA 3WHKA 5FTKA 4QNMA 5AR1A 1SKYE 4KFUA 1F2UB 4RD6A 5TB5A 4PZZA 3FVQA 4NH0A 3CX7A 5C18A 5EJEA 2HF8A 3CBQA 5AUPB 2XZLA 3WP1B 3VMFA 4QNRA 3BC1A 1E9EA 4KI0A 3CW2A 3CPEA 3MWYW 1BMFA 3QF4B 4YMTA 3FTQA 4KBGA 3WMFA 2ZRDA 2WWHA 1NJGA 4JLBA 4TZ0A 4GSYA 5GVRA 3BGWA 2QTFA 4F92B 1PLJA 1Q57A 1VKJA 4POAA 5CK5A 3U3OA 4A6XA 4IEIA 2VP9A 2VP0A 4KAXA 4R9UC 4KSCA 3W6PA 2A5YB 1U2RA 4PSKA 4AK9A 2ASEA 3FHCB 3P4YA 4CZ2A 4C30A 2ZJAA 4OYHA 4AYXA 4C0BA 3QG5A 2JJ2D 2WJHA 3FFAA 1ZBDA 3B1YA 4Q66C 4Q02A 5G41A 2EQBA 2VP4A 2JDID 4HAUA 5FUVA 3I72A 3LW8A 4BFZA 4GL2A 3RWMB 3THXA 1JI0A 2Q3MA 5LDDC 2ZUCA 3KXIA 4OI4A 3RANA 5L8VA 2O8EA 4PQFA 2ZI4A 1HA3A 3SJZA 4JKYA 5KU1A 4LBZA 2YINC 1ESMA 1KNXA 1G4UR 5HZHA 3CM0A 5SZHB 2P3SA 4OQXA 4PHGA 1W0KA 4JS0A 1P75A 3GCGA 1UDWA 3VKWA 2XITA 3IPXA 4F7WA 2ZE8A 4MGKR 3CF0A 5EUMA 2ZXUA 1AJEA 4G5SA 4P4UA 1KK3A 1ZNYA 4US0R 2W2VA 2AL7A 1OH5A 3SU8A 3CIOA 4ACBA 4Q48A 3TW8B 1KOFA 2FSIA 2C77A 4NYIR 4B3FX 3NC0C 3ICQB 3TBKA 2ORWA 4G5OA 3CNNA 1SXJB 4LRTA 1ZCAA 4HZUA 1I2MA 4D25A 1IN8A 2OBNA 3UANA 2OG2A 1CIPA 1U8YA 3NIBA 2FFHA 1ZNWA 3KFVA 3EIEA 2JLQA 5A0FA 3CB4A 3IO5A 3ZS9A 2FPMA 2ATVA 3MJHA 3DZ8A 3SJAA 2L0XA 3AF1A 4XD7D 5K8LA 2WJJA 1X86B 3HJNA 4V0NA 4QM7A 4P31A 4RFSA 3KW6A 2FPLA 3DHWC 2XB2A 2BMJA 2REBA 4M4SA 1S4QA 1TF5A 1JAHA 3I4LA 4JSYA 4DDTA 3TR0A 2GK6A 2GCOB 4TMZA 2ZR9A 1GNPA 2BWJA 1T3LA 4I81A 4KO8A 4FCTA 1TEVA 1NSTA 4EDHA 1FW6A 4I1SA 4TQUS 3L0OA 4DDUA 8OHMA 3GJ7A 4GT1A 5DSZA 1JEEA 3O8RA 3ADCA 4AKGA 2N1BA 3GEIA 1P9NA 4C3ZA 2DWPA 2ZEJA 1FX0A 4IOMA 5BYKA 5L3SB 2K5UA 1P6XA 3PITA 1W47A 2WWFA 5AJXA 2LWIA 1XEXB 2HDNB 1BOFA 1T5LA 1N6HA 4LRWA 3CUEF 3BH6A 1P73A 1J7KA 2RGDA 5EZ5A 2OSBA 3DO6A 3QJYA 4JKIA 3DKPA 5CYPA 4ZCIA 1OIVA 4ESVA 4BPBA 2O8BA 4MKFA 3AKYA 2VSFA 3I92A 2ZJBA 3GJ3A 3JZAA 2C95A 2GZHA 5KNBA 2RGNA 1G8YA 1KSGA 3I62A 2PH1A 3KB1A 2QRNA 1GP2A 3IIMA 5E4FA 5FL7A 4O3MA 2E9SA 1P2TA 5FBLB 1SKYB 1DEKA 4FW9A 3GP8A 4EQ6A 2PJZA 3TR5A 4QGFA 4V0KA 1WRBA 3E1SA 1KAOA 4HB0A 4NYJQ 1DARA 3TQCA 4C0AC 4MDEA 1SQ5A 1VDZA 1E1RA 2VHUA 4LPSA 4XWAA 4B71A 3B1XA 3GEHA 1N6OA 3BFVA 1PZNA 3QF7A 1E9SA 3HU3A 2NG1A 3EARA 2VA8A 1OH8A 3W90A 4Z1MD 2IYZA 2J0UA 3N2EA 5BN5A 2NQ2C 1WE2A 5F2EA 2NMVA 3SQWA 5FL3A 2D7DA 1EFUA 1Z5ZA 4TSFA 3D6TB 1VECA 4DSUA 1CULC 4EUNA 5K8UA 5C1BA 1OPXA 1L4YA 2RCNA 1Z28A 3K1JA 4BLOA 4XVUA 4RZXA 1FTNA 4B76A 4JLDA 1XPRA 2XXAB 3ZLJA 2J87A 3FOZA 4ASUD 2KJQA 4B2LA 1EWRA 2YOFA 1U9IA 2QQ0A 2ONKA 2KRKA 1S3SA 2P6RA 4LCBA 2GXUA 2JLVA 3B9QA 5EZ6B 2GBLC 4AD8A 2ZYTX 3SBDA 1BO6A 2OHFA 1DOAA 2BM1A 3AB3A 1YZGA 2ZVPX 1X1RA 1I4TD 1LS6A 3IKJA 2J1LA 1PUJA 5C4MA 4FN5A 3A8TA 3T1VA 2JLUA 1LY1A 4PR0A 1F2UA 4Q4AB 4M9QA 3A1SA 3RRYA 4KJZA 3TLXA 4CYMA 1IM2A 3QVVA 3QVUA 5FBWB 1LVGA 3B7GA 5CITA 3BXZA 5FR1A 2HT1A 1NI3A 2QM7A 3HPQA 1VG9B 2NO9A 2ZJZA 4IDQA 3OAAD 2OO7A 3FMFA 4IXMA 3R9XA 4PAMA 4OL0A 2GHIA 3SR0A 1IY2A 4Z54A 2P0EA 4NCHA 3ZZ0A 1C1YA 1J8YF 3THOA 1JQJC 1TEXA 4PANA 2VPPA 4IRUB 3TSZA 1LW7A 3V00A 5J4HA 3W3ZB 2QPAA 4PC7A 1RJ9B 1NMZA 3K70B 2GETA 2G83A 2GEVA 3GJ4A 3T1OA 4L4UA 2V1XA 2DFLA 2XOKA 4FD2A 4G1UC 4WXPA 4EPVA 2GAAA 5CM9C 2AX4A 1DAKA 5HCNA 3WP0A 3AVWA 2YYZA 1KI7A 5FPKA 3IEVA 3V4FA 4ACAA 5LPNA 3SE0A 1BIFA 5F9FA 3UPUA 1VYVA 3B9PA 4NYMR 3S1AB 4PO9A 2GJ9A 1XEWX 3CWZA 2IYLD 3DMNA 1P60A 2UZ3A 2FG5A 3VR2A 1E1QA 2QAGC 3PUZA 1E6CA 2RH5A 2W0SA 5E95A 3ZQ6A 2ANCA 4QBGB 4TL9A 2QE7A 1FL9A 3IEUA 1E99A 2ZI9A 1E2IA 2V1UA 1II8A 3DOEA 4DIEA 4G01B 3X1XA 4X8LA 1U90A 3B1VA 3VQTA 3AP1A 1OYWA 2Q6TA 3R20A 4EJSB 1YRBA 4P32A 5EXPA 1RPZA 1XWIA 2KWIA 2IWRA 3PJRA 2IS1A 3TH5A 3UWKA 1XPUA 5JFGA 1D2MA 5K8IA 1F3OA 3K9LA 3KJGA 2FNAA 1RYFA 4A8JC 4OHZA 5CJPA 5DIFA 1J90A 2PZEA 4RCYA 1OV4A 3RS2A 4A3VB 3A37A 4TYNA 1E9RA 4P33A 3T35A 5BW8A 4DVGA 3AQ4A 1H8ED 4ZKDA 2AFHE 4JL6A 3QXSA 4PC2A 2BIFA 4WXRA 3QKRB 5KDOA 3RLFA 3SZRA 2CHQA 3X2SA 3SC3A 4PQRA 2IK8A 1NKTA 4DCTA 3A6PC 2F7SA 1OFUX 2JJ2A 3ZH9B 3OEED 4Q4JA 2ZRMA 1AGRA 1FNNA 1GKIA 4Q7MB 1ZD8A 4LJ7A 3G0HA 4FINA 5FBRB 2JDIA 3SNHA 1Z07A 3A58B 4U7DA 2QY9A 1M7BA 1EFTA 4GNKA 4AURA 4DLRA 3SHWA 5DYIA 2O0JA 4N3NA 5H68A 2ZETA 3B8HA 3E5HA 4ZI2A 4KCGA 2I3BA 1JNYA 2ODNA 1NBME 2R6CA 3K9GA 4RZUA 1UEJA 2I1VB 1AN0A 2FJUA 2R6GA 3MSXA 2AK3A 2DWQA 3OZXA 4QJ4A 3X1YA 2C99A 1ETUA 3TKLA 1Q21A 4N0DA 1FUUA 2D4HA 2CVHA 3THWA 2OV2A 2R44A 5FOSA 1W5SA 2OCYC 1IY1A 1LNZA 2A9KA 5EE3A 4LYFA 2ZS9A 1NVXQ 2ODEA 3WNCA 4LHZA 1G8HA 1K5GA 4TL6A 4QFMA 1GRQA 2BEKA 4URXR 2CBZA 1E0SA 5CDFE 3I32A 1DVRA 2VO1A 4ZI3A 2J0SA 2XNSA 1DAHA 1EFHA 3QE0A 4EFNA 2Z4SA 1QG4A 2A2ZA 2HT6A 2NPIA 1OXSC 3FKQA 4XD7A 2IW3A 4JLOA 2ZU0C 1M6NA 2EWWA 2WWYA 2QENA 5FTMA 1B0UA 1G7RA 3EZ6A 4JLPA 3HU1A 5CIQA 3UMRA 3QPVA 1OSNA 2CCKA 4PHFA 4DB2A 1AKEA 3OE7D 4JLMA 1KI3A 1T3HA 2ZR0A 1UAAA 1R2QA 3KKNA 3SQXA 1DELA 3QKSB 2LKDA 2BVNA 4C7OB 2PJRA 3GLGE 5DN6D 3U61B 5KSYA 4KFRA 4B73A 5A4JA 2FFQA 1X6VA 1YZLA 2CMKA 2BMFA 3VFDA 2QT1A 3QXJA 4JYCA 4PHHA 1U8ZA 3B13B 2GZAA 2QG6A 5JLJA 1MOZA 1J99A 1CJTC 4O2LA 3RYTC 4YC7A 3EA5A 2R65A 2V8OA 3QI2A 3I5XA 1AIPA 3REFA 3SEAA 2OAQ1 4R98A 3T1TA 3NH6A 3N2IA 1M2OB 1F2TA 4X8HA 4LV5B 3AH8A 1NBMD 4GFDA 1UFQA 4IW3B 3VTKA 1Q22A 3EASA 1Z0FA 3EA0A 4F4IA 4J0QA 2YWFA 2GJSA 2C04A 4P0TA 4BFYA 5IF9A 2W00A 4Q4AA 1FP6A 2W6JD 1W36D 3AM1A 1TQ4A 4NDZA 2AD5A 4NTZA 1T9HA 4FWGA 3NVAA 1G18A 2IYTA 4OHWA 4DDVA 1P72A 5KPJA 3N70A 1Q1QA 5K8TA 1M8PA 1KDPA 1IXSB 2VIIA 3BOSA 2QL6A 1UBGA 3IBYA 4AI6A 1XTQA 5DNYB 5KNDA 3R9WA 2NOAA 3H4MA 1FOEB 3LXRA 2WJVA 4MYHA 1RJ9A 4Q1CA 1Z22A 1MABA 4FMBB 4MYCA 5TARA 3T12A 1CR1A 2VHCA 1VG8A 2ORIA 2QMOA 2W83A 4MRPA 1W4AA 4Z1MA 1MT0A 2BJWA 2QT0A 4DT1A 4A0RA 1T0HB 3W8RA 1ONBA 4OJKA 4AKEA 2BMEA 1E9CA 4DCNA 2DZNB 1PUIA 1GSIA 2QN6A 1JPJA 2ZYVX 1I4DD 3UWOA 3PEUA 4NMMA 1KJZA 2FEMA 2FU5C 4IOKA 4ASUA 3THXB 2CE7A 1XJ0A 2H17A 2PCJA 3KQHA 3B78A 4N0EA 2GVDC 5HE8A 2O8EB 1HT1E 1HUQA 3I8SA 5C4GB 1CBUA 2FSGA 3NBZC 4TN1A 1S9HA 3FKSD 2JA1A 4FMCB 1ZUNB 4B3XA 4Q1FA 2IWHA 1YR6A 2IYXA 3HU2A 3M4YA 4KVGA 1W36B 1G17A 4FWTA 1GL9B 2CHGA 1UF9A 1YKSA 2VHQA 3FPAA 1OLOA 5DHFA 4LJ9A 4TMKA 4NONA 4MKHA 3RVBA 1D9ZA 3FE2A 1TAGA 5BN4A 3OAAA 2C98A 1Q0UA 2FSHA 3D3QA 4HZUB 1OFTA 1XTRA 4CT5A 1JXMA 3GFTA 3NKVA 4LBVA 2CEAA 1KZGB 1OHHD 4QBHA 2F1IA 1GDDA 2JLSA 3OFND 4B74A 3KQLA 3TJZA 2Q9BA 4Q1DA 2XNDD 1AZTA 4M1SA 4TL7A 4D6PA 3M6AA 4YLGA 3BFKA 1HE1C 3CONA 4RFSB 4C0LA 1Q44A 1ZC4A 3KFXA 4NCKA 1CKEA 2Y8EA 2XZPA 1GNRA 1QBKC 4LJYA 5DI3B 4WVFA 2OUKA 1P7CA 4HDCA 4L9SA 1KK0A 4AKHA 5B30A 2VP6A 4OQLA 1D8TA 4NYIQ 4DRZA 5FBVB 2CCGA 3EX7C 3KKPA 4OK6A 121PA 2VLIA 1VG0B 4LOAA 5JS8A 3QNUA 5BN3A 3KKQA 1Z2CA 2RGAA 1FX0B 1TF2A 1AS0A 1NJFA 1YR8A 3FHOA 1II0A 4Q9LA 1W46A 2IUTA 2ZJOA 4MDFA 3NH9A 4ABYA 1IN7A 4MRVA 1FFHA 4MH0R 5IDVA 3WMGA 2FGKA 2ZJ8A 2HYDA 3DOFA 2WWXA 3TAUA 2O8BB 3AVVA 1OH7A 5CLLA 1OXVA 3I3SR 3IO3A 3CZPA 2RKOA 4U00A 3RRNA 1H8EA 1CJVC 1TADA 3CZQA 1A5TA 4Q1AA 2WKRA 1FQJA 2QQEA 1EX7A 1OB5A 3Q7QA 4Q9KA 4EQ6B 3VAAA 1CU1A 4IEEA 1KMQA 3TW4A 4N1AA 2ZUBA 4CEHA 1R0ZA 4LWZA 4PPNA 1EXMA 1O3YA 2FMXA 3OEEA 4IFEA 4IDHA 2ZE7A 4HLCA 3FFBA 1Z06A 2BKUA 2CVFA 2GWHA 2QP4A 4F38A 2B92A 4D80A 2V9PA 2YC2C 4JBXA 1RRFA 4JMPA 2A5DA 1AKYA 1CEEA 2J0UB 1W2GA 1E9FA 4OI2A 1ZJ6A 4OHYA 2X8AA 1O87A 2AHOA 2CNWD 2ZSBA 1OT3A 4LHYA 1VCNA 4OI1A 1R0YA 4EPYA 4M53A 3K0CC 4A6PA 3ND9A 1DTSA 3IQXA 1K5DA 2DBYA 2ZSFA 5FH9A 2A3RA 2B8WA 1JR6A 4L16A 1E4VA 2ZREA 3AVYA 3KX2A 2X2EA 1BYUA 2Q3HA 3KXLA 2W2TA 1G8FA 1ZYUA 3MUFA 1N6RA 4UKDA 1JXOA 2DWOA 2GJKA 4UJ5A 3GPLA 3U44B 3AJIB 2FZLA 4G3XA 4DCVA 2ZJYA 1XMVA 2CLDX 2EYUA 2RGGA 3RS0A 1RE0A 4O0MA 1WBBA 1EG7A 1TU4A 1MRNA 3BBPA 5FR2A 1VCMA 3QBTA 3KQUA 2WSMA 5D3MA 5KYKA 2ZRPA 1FPMA 2DCUA 1YZUA 2OILA 2YKGA 4PZLA 3Q7PA 2FFAA 3VHXA 1Z0DA 2J45A 2XSZD 4X8MA 2GJ8A 5CYOA 4EFMA 3NTUA 1JEDA 3B60A 1N6IA 3PR1A 5F9HA 1DAGA 4R2HA 3AF3A 2YOGA 1M34E 2VH5R 1N5IA 1KY2A 3OE7A 4LV8B 3QUSA 3A1VA 1XD8A 2IF0A 4M2LA 2BOVA 4MKGA 1P3JA 4TTRA 4FI3C 5HE9A 3T15A 4B44A 1ZM7A 2AXPA 3DPUA 1KSHA 3U60B 1GL6A 2WICA 2WWIA 1E3MA 4ZPXA 5DN6A 5KSZA 4Q4HA 3PIRA 2AXNA 5BQ5A 4BECA 3LLUA 4M0LA 1HQYE 1AGPA 1RYHA 1BYIA 2SHKA 2V7QD 5FUYA 2A78A 4QM6A 2F3TA 3LQRA 1BS1A 5EUQB 1NLYA 1RW4A 5DYGA 2OCPA 1NRJB 2G0TA 3NBFA 5JSZA 3RAPR 4BRWA 1T0JB 4DLVA 3J81k 2W6ID 1HEIA 4BFUA 1NBMA 2GNOA 4Q19A 2C9CA 4EIWA 2QM8A 5HPYB 2ZANA 4GZLA 3WXMA 1II8B 4D0NA 4W5HA 5JWOA 3KJHA 2W6JA 1NLZA 3X1WA 2VBCA 4TMXA 5CLQA 1E98A 1HY3A 2PX3A 3L8YA 1SVIA 3C4JA 4A9AA 621PA 3AVQA 1JJVA 2ZI5A 4R71A 3ADDA 2ZRCA 1ZU5A 5C46F 5SZKB 1HT2E 2WAXA 1QVRA 4DLXA 3GJ0A 3MWJA 3IUYA 3W6NA 2F55A 4I1VA 3CF2A 2WAYA 3E70C 4KYUA 4V02A 4LHVA 1YRAA 3GJXC 4NYMQ 5CDFA 2EFCB 3TSOA 1OB2A 4CIDA 2RHMA 1HH4A 4M1MA 1IXRC 1E2DA 3EIQA 1VPLA 1OJLA 4IOJA 1XB2A 3SYNA 1S0UA 2CK3A 3ZGXA 3IILA 4JLNA 1E2QA 4WZAE 4H1VA 1A4RA 4Q4JB 5B57C 5DI3A 1HV8A 3FGNA 1KSJA 1TUIA 3K09C 1B23P 2V6ZM 1E2EA 2GAOA 1DAFA 2GESA 2ZSEA 1E9BA 1WXQA 3HWSA 1RFLA 5GJCA 1A82A 4I1UA 3EWSA 1NN0A 3GLGA 1TF7A 1G20E 3ZZTA 4BZXA 4TQ9A 1N2CE 4C2TA 3CH4B 3TIFA 3CPHA 3FKSA 3KTAA 1VCOA 2O8CB 4LV6A 3UG6A 4NCIA 1SXJC 3PEWA 1MH1A 3ZYCA 3TE6A 2IHBA 2NTYC 3EZ9A 3CPJB 4Q03A 4XOIA 3THWB 1K6MA 2BBOA 3IQWA 1QZMA 4PC3A 5LB4A 1U99A 1WA5A 4ZO4A 3OIYA 3DMDA 1KY3A 4MYUA 1S3GA 2PZFA 1NNEA 3K8YA 3P1JA 1WMSA 2B7CA 3SFVA 4RKEA 1H65A 2HJGA 1LS1A 3SS8A 1R5NA 1S9DA 2H1LA 3KQKA 3VR5A 1JQLB 1OHHA 1XXHA 3OFNA 3K0CA 2QBYA 2DHRA 2XNDA 4RJLA 1XCGB 4XSHA 3I1FA 2HXYA 1CRQA 1YZTA 3GQBA 1E69A 2G6BA 3OEHD 2H16A 4P3YA 2DVWB 1GAJA 1NN1A 2OT3B 3VHLB 5KHOC 1C9KA 2QGZA 1Y3AA 2H7VA 2H92A 4WAUA 4UNRA 1KMHB 2JCSA 4WW0A 4L15A 3LW7A 1UBCA 1Z0KA 2Q9AA 3AUXA 2GXQA 3EZ2A 5AWFC 5TVKA 4DUGA 3QG1A 1G5PA 1OW3B 2F9MA 3JZMA 3TVTA 4XSGA 1VHLA 3QBVA 3DM5A 1P2UA 4QC2A 1E0AA 1OYYA 1YR9A 5HTKA 3QPWA 4FMCF 1WCV1 3PXGA 4KHZA 3W8NA 4NBSA 3TSWA 2UVQA 3ASYA 4UXIA 1H8HD 1UPTA 2UKDA 5CIWA 5H70A 1AZSC 1Q3HA 1E94E 2NO6A 2OFWA 3U44A 4AYWA 4AYTA 4UNPA 5SZIA 1JBKA 1V5WA 1RRPA 1F2TB 2AKAB 3AVOA 3OESA 4JSTA 4Z51A 2EU8A 1G1MA 3K0SA 5FUWA 3BAFA 3BK7A 1ZCBA 2AKYA 3OIWA 4UXJA 1E32A 4BGDA 4K8OA 1ELOA 1L4UA 3IHWA 4NE2A 3I5YA 2JLWA 4OKSA 4DC9A 3CNLA 1JPNA 3T5GA 2N42A 4LK2A 2D3WA 2QNRA 3BB4A 4XIGS 3OF5A 3FYHA 1AA9A 1GRRA 2GILA 5G3ZA 1Z6XA 5AUQA 2FX3A 3Q72A 3FMOB 2OBMA 3T1QA 2H8KA 4XWKA 3TAHA 1FUKA 2JLYA 1GVNB 2OBLA 4KYIB 5D3QA 1GUAA 3TNFA 2YNMA 3U3RA 4MRRA 5KOYA 1MABB 4QRHA 3Q5DA 1G16A 2A30A 4XH9B 5G40A 4KITB 4BQSA 1QHXA 4URYR 2R9VA 2YOHA 4DT1B 3O47A 4CF7A 2R62A 4LYJA 1U0HC 2ZS7A 2CNWA 2O0KA 4TLCA 1V43A 2QROA 3A36A 3NBYC 4CDGA 1SVOA 4OQNA 3WHLA 3VU9A 3UATA 3G82C 3NDPA 3PVSA 1TQ2A 2G3YA 3ECCA 3LFUA 3GMTA 4HYYA 1E2LA 2ODBA 4DHEA 1PLLA 5BYJA 3MLEA 2VYFA 4Q47A 3QXXA 1KI1A 1IHUA 2WOOA 4QJ5A 3RC8A 3T06B 4GOKA 5TDHA 4Q21A 3GLHA 1CP2A 4QBFA 5HCIA 2E1RA 2NZJA 5LB2A 1N0WA 1KO4A 3F0TA 1M1YE 3U7EB 1XCPA 221PA 2YHSA 2DZOB 3C15C 4FMDB 2IS6A 3U7HB 2ECKA 2GDJA 1NY5A 1QHGA 3HPRA 5J4LA 5JBQA 2OFOA 4NCNA 2XJ9A 1JALA 1NVVR 3LAWA 2Q9CA 1RC8A 5FFMA 3N5CA 2XSZA 2X77A 1GWNA 2AFIE 2FGJA 4JBYA 1NSFA 2AK2A 4GMXA 4QXAA 4TTQA 4LJAA 4CW7A 3K70C 3IHLA 2ZUDA 2IS2A 2WJYA 2ZI7A 3DM9B 5EE9A 4B34A 4YONB 4M1KA 4IVPA 2I1QA 4U02A 4TYPA 5KSPA 4M9XA 1CRPA 1XTSA 2PZGA 1FTSA 1E0KA 1DBSA 2NO1A 3U5ZB 4M1YA 2F1HA 3K0AA 1YQTA 4Q00A 1AM4D 4V0MA 1NIPA 1X8KA 2P5SA 3U3KA 4CEIA 1QZXA 2NO7A 3MAAC 2YWGA 2V7QA 3FHTA 1GG2A 2C2HA 3GLIA 1NF3A 2Q3FA 1GITA 1DAMA 1N6NA 4A92A 1MV5A 1VMAA 1D2EA 3VNUA 1Q1ZA 2YC4C 3L2OB 3KL4A 4JT4A 2IYYA 2ZRGA 3SN6A 5JI2E 1XFAA
chains in the Genus database with same CATH superfamily
4JUDX 1SFRA 4E7PA 4ZFNA 4ZJYA 1AKRA 3A05A 4EO7A 1I4LD 1VCIA 5FOTA 2I9PA 1CTQA 4QU5A 4AG6A 2GLTA 4F2GA 2NZ8A 2FOLA 3SVTA 3RHFA 4L9AA 1T91A 3N6VA 2G0NA 2VAWA 4AJ4A 3I8XA 4GOJA 5KQPA 3OZDA 1W19A 2BTQB 2Q5HA 2IQIA 3NNNA 2GBLA 4C05A 5IZCC 1RKXA 3ZWKA 3BXEA 1OTRA 2HCFA 2JXNA 2Q2QA 1PTJC 1X8JA 1W94A 3GJ8A 4N3GA 5AJHA 4Z99A 5KAMA 3ROEA 1PZMA 5K20A 5B3AA 2BGUA 3DFMA 2PL5A 4YALA 3E3NA 1AK1A 2X7XA 4HDQB 4FHFA 3NBXX 3F78A 1P1BA 3KB2A 3CT6A 3M70A 2PLRA 5K3DA 2HXGA 1LBEA 2W43A 3EVFA 1NLFA 2ACWA 1ZISA 2XUKA 4L9RA 2O52A 3KKLA 4TUYB 3W2GA 2ZIEA 5JSYA 1WY7A 3HA2A 1W35A 3O94A 5J40A 1E7MA 1H6AA 5LLTA 3OOHA 4AX4A 3SMSA 2BHSA 2IPAB 3IAXA 3OUUA 3UT5B 1N2CA 3FIUA 3MGCA 3UK7A 3KV1A 4M0EA 4QDZA 2Z43A 5CT9A 2IC5A 3NWLA 3NRBA 2NQ8A 1WZIA 1N75A 4IIJB 2H4HA 4OH1A 1XR3A 1MRZA 1Y98A 5EWMB 2KPOA 1RXIA 1SD5A 1B76A 3VBEA 2PYIA 1CUDA 4Y1GA 4KAFA 4HEQA 4MS4B 4Q5IA 3SKYA 2JS7A 1WBDA 4DDMA 4DLPA 4JQSA 5GJVC 3TM5A 3B2EA 1IBRA 1CB7A 4MRNA 5I7UA 4TROA 1FQOA 3R5HA 2R7AA 3V80A 1YDHA 1OIWA 4X44A 3CIFA 2E48A 2VNIA 3DD1A 3FZEA 3B6KA 2WUGA 2LH0A 4WKOA 1DE0A 2R6AA 3HGMA 3CC8A 2KW5A 4QIHA 1P4RA 3MJEA 3CV3A 2X23A 4MUAA 1PV2A 5GJBA 2B82A 5ICEA 3GLIE 2J5BA 4DLYA 3KYCB 4P98A 4GX0A 3DFIA 5DHAA 1O97D 4J4BA 3Q15C 3L7DA 3HUDA 5ITQA 3GCWA 1Y9DA 4X62M 3NHRA 3U4DA 4NU0A 4O63O 3TTWA 4BNTA 2OBFA 1E2HA 3LU1A 3WK6A 2FOIA 1N7IA 1P5ZB 1Y5LA 4NZYA 3WAKA 1XZLA 3VR4A 4BFWA 1PR1A 3O7MA 2VJMB 2IHTA 3ORYA 1VP9A 4YMWA 4P08A 4XUDA 1N9GA 3GG2A 3OP1A 1WIWA 3CA8A 4GITA 4AM8A 1B3RA 2VUSA 1TT5A 1SUWA 3CLVA 3N0TA 3GPBA 4I55F 2HRDA 3O8BA 3R3XA 1UT8A 5IT0A 5FNZA 5DP2A 4ERXA 2ST1A 1E3IA 4ZMBA 4IDEA 5CW1A 4B33A 1QO0A 5TF4A 1S02A 3EEYA 1QF7A 3A7DA 2CJYA 4H7HA 3PE3A 2FW6A 3EVCA 4V0OA 3B1JA 4IXNA 4KGVA 3IODA 1SN7A 2AZDA 1LF0A 5MFPA 8MHTA 2FF7A 4JI1B 4F5WA 3RE1A 3WYGA 1GFIA 1GUZA 5IJAA 3F8SA 4MUYA 4E22A 5H37D 3C6YA 1Q7GA 1AUQA 1LK5A 3KT6A 2QLBA 1JR3E 3WOVA 2JIDA 1EM6A 1EU1A 4UMDA 2J7KA 2XQJA 3SBEA 1G7TA 3N8KA 3MJRA 3AEQB 4YBZA 2G1PA 3CVVA 3ANNA 2NUAA 4JUCA 1FFWA 4PN3A 1QYIA 4N5HX 4NJEB 4YJ2A 4EJ2A 5KTOA 4MMZB 1P3DA 3GD7A 3PUXA 2OLKA 2ZW9A 3CY6A 2ZRBA 4QGAA 1I14A 1YGPA 2ZTMA 2WAAA 2PMEA 4L3WA 1N5MA 2Z7JA 1MIOA 2A9VA 1USWA 5HXAA 4LXIA 5HDQA 1MO6A 5DPMA 4ZAWA 1KJ9A 3WK9A 1J23A 4WNYA 1T9DA 1NG9A 3BH0A 4AY3A 1O6FA 3VYWA 1H1TA 1KWKA 1RT9A 3VO9A 3ESZA 4N0QA 5AK4A 2HJSA 3QF4A 4L5IA 2MYUA 1QCZA 2PEZA 4IVNA 3QY9A 4RTKA 1JEYB 3FZYA 1XIVA 1TMOA 3QBJA 3BIFA 3BL5A 2QUBA 5I7EA 4G41A 2X15A 1Q0ZA 3AEZA 2EJTA 2ZGVA 1W85A 1XE3A 3HY4A 1Z0JA 5KREA 1XRMA 3WLHA 4BTEA 3O93A 1A27A 3G0GA 4DMHA 2ZT8A 2NV2B 4LRYA 2HHAA 3DBRB 2NZWA 5NULA 4HDSB 4FGJA 2Q5JA 3RPEA 3PEYA 5DCYA 4MQUA 2RE8A 1DP4A 4XGKA 3WQHA 2WE7A 3O8CA 3HMKA 1YOVA 4HUTA 3H1TA 5H8WA 2JD1A 1A5BB 1RMQA 3OCJA 4DCPA 1NYTA 3RS9A 1J0DA 1XMIA 2GGSA 1VKOA 2IZ1A 1JSXA 1HSOA 1GTVA 3F8TA 2ZYHA 3NNSA 3BCRA 4UOZA 3JAWB 1ZGGA 4MKIA 2AEJA 2JJYA 4MWZA 3OLVA 4RD1A 4MA4A 3R75A 4IOLA 1QRAA 3V8QA 1A9PA 1L7VC 1P4HA 3A6HA 2CUKA 5CT6A 3PD1A 2REQB 4NNJA 3VOAA 3B82A 5AHOA 3KUXA 1B7GO 4QHSA 2SKDA 1C9YA 4X65B 2BFBA 1H2HA 3EBLA 3N3AC 4JJZA 3DEIA 4BCCA 4MRAA 2BWEA 1NHWC 2VCHA 4LGVA 1TTQB 2HZ7A 1FQWA 3OF2A 3UAWA 2UUBB 4PYIA 3CE6A 4TL8A 2HV8A 2H1VA 3IECA 4NENB 3U2QA 4G8DA 3UJBA 2AXQA 3H84A 1BQ4A 2FQXA 3OURA 4K7JA 3CFYA 5DGCA 4NABA 4CCSA 4DDKA 2QHOB 1VI5A 3CSUA 1V9SA 2LUOA 3L0YA 4JQZA 5B6JA 1MAHA 3COVA 3NEAA 3BSSA 3WQSB 2PA3A 1VGRA 2JRLA 2B78A 3PA6A 4XTRA 3MFYA 4PS0A 1PV4A 4LJKA 2FPGB 2OESA 3DKVA 1R74A 1Q12A 3F5FA 2R8RA 3QYEA 5MGBA 1XNQM 3D2BA 1JTVA 2QTVA 1K3UB 1AKWA 1EM8B 3GFOA 5ICCA 4B47A 4RKRA 4E1AA 3JCZA 3HHWA 3CO5A 4TTPA 1XZPA 5H3LA 1Z5BA 2NADA 2ZRHA 1ACJA 1LBTA 3D1VA 2X9GA 5ITTA 2VZ0A 3FTDA 4FDAA 5GONB 3RIHA 2FW0A 3MCZA 3EQ6A 4U63A 2PIDA 5GM2A 5IYZA 5JZOA 4A73A 4PBRA 5JNSA 3BULA 4FOOA 4LJ4A 1K8YB 2G4LA 2WA2A 2VWGA 4PZUA 4X3CA 2GSDA 2A8YA 2OM2A 4FMDF 3REOA 4WJKB 4L75A 3NBIA 1RPTA 5BMVA 1UC4B 5KCMA 1AO0A 3PGJA 1HDIA 2YRFA 5I7AA 3NKLA 1Y5NA 2WY2D 4LW8A 2HSEA 3HO1A 1KEWA 2EFDB 1HOTA 3FD9A 5T4BA 3MG9A 3RWOA 3PUYA 5I48A 2FX5A 4NBWA 3UGTA 5EJEA 2XGNA 3TKAA 1T35A 3CW2A 3MWYW 5THXA 4OJMX 1IK4A 2EW8A 4R41A 5E6RA 2P0AA 1RWVA 4Z2AA 4XUCA 4PSKA 5LQCA 3LX6A 2FG7C 2EOAA 4GS5A 4IIWA 1WMBA 4LIPD 3CEPB 1QIMA 1XQ9A 1C9JA 3RWMB 4AULA 4R0MA 3FJOA 4OH7A 5IUKC 1ZGCA 3O4RA 4ENUA 2WFAA 5DX1A 4RIFA 4Z6YA 3OJXA 2JHCA 2V5UA 3PZRA 2MU1A 3NC0C 4PY2A 1C3EA 3D4LA 4AWAA 2Y05A 5IULC 4Y2RA 1NFRA 1CEQA 1XVVA 2W2NA 5JAMA 2Y99A 4YQYA 3DT8A 3I30X 4O33A 2BMJA 3MLBA 1ESEA 3OKAA 1TEVA 2BONA 3ADCA 1NUSA 1EJ2A 3B1KA 4FMPA 2WUWE 1P2BA 4DM7A 3VPSA 4YUZA 4FDMA 1WVMA 2HDNB 1Q5PA 4DZTA 3IAFA 1J1IA 2RGDA 3KFLA 5CYPA 3TLCA 8CATA 3M6LA 3ZQ4A 1P1RA 2R84A 5HILA 1G60A 4FW9A 1Y7LA 6REQA 1IZYA 2CD7A 3E1SA 4I5GA 1M76A 1RRVA 4G0WA 3AIOA 1ZHHA 2ZQZA 3QF7A 1QIHA 1YL6A 4EGCB 3OCUA 3NT4A 3RUAA 2JAOA 5IAOA 2IYFA 4N5NA 3K1JA 5HVNA 5JOQA 5C32A 4D45A 3H17A 5JAQA 1RYEA 2BM1A 3TIXB 3HCOA 3A8TA 2DZLA 3HLYA 1ZFNA 1YZ3A 2XF8A 4RF2A 4IDAA 1NV9A 1UXGA 3HA5A 2H2HA 3M6XA 2GHIA 3G68A 1BZYA 4KR9A 3ROGA 3JALA 4RW0A 2Y67A 2YRWA 2VQEM 5ALDA 4L4UA 5F4ZA 1FUYB 1P6QA 1IHXA 4JN6B 5HCNA 3EXHC 3WP0A 3AVWA 4BNDA 3I8OA 5FAKA 5LPNA 1BIFA 3B9PA 4MR9B 3C98A 2CMFA 1DI0A 2QAGC 2W0SA 3WADA 1KHHA 2PR7A 3VSBA 4DIEA 3X1XA 4MR7B 4L8YA 1FU7A 5EXPA 3A14A 2YMMA 3UWKA 1FIUA 2ZBKB 2EEZA 5BSEA 4D1YA 3O8OA 5JYDA 1YHZA 4ESEA 3TQSA 2UUAM 3VDUA 5FV7A 5KDOA 4RVDA 4BO6A 1YE9A 4WE3A 4P5EA 4ZQHA 1CDOA 3MIZA 4GP9A 4ETMA 3TWLA 1XA4A 1DBPA 5F7XA 4KQ6A 4L8RC 2ZKIA 3OZXA 2DWQA 4NZNA 4XXHA 3ZD8A 4E70A 2D4HA 2GO1A 2CVHA 2R44A 2OCYC 3NYRA 4LYFA 2D1FA 2ODEA 4CLRB 3I32A 2XH9A 4ZI3A 4QQKA 1DAHA 2G04A 2NPIA 4O8CA 3DA8A 2ALJA 5B1DA 4DB2A 1W88B 1T3HA 2ZR0A 2P9GA 1CETA 1LPOA 3QKSB 3TM4A 4C7OB 2B1QA 3U61B 1IBKM 2QLJA 3ZK9A 3UJPA 1U8ZA 1J99A 1HKUA 5JR3A 2Z1NA 3NH6A 1HZZC 4HG2A 1Z37A 4MZDA 3UB3A 3B7QA 4ZVMA 4J1TA 2E5FA 1QORA 2D59A 4O4JB 2CXHA 4L27A 1UBGA 4C5AA 2HK9A 3HACA 4RX1A 4LCEA 5HQ3B 1U2GA 1P3QQ 5BSFA 4Z1MA 4QPDA 1JLRA 1XMQB 4HEOA 1SG9A 1S8NA 3TL2A 2QN6A 1DBVO 4QRIA 3IXMA 4ASUA 2CE7A 3GVPA 3W5DA 2GVDC 2I80A 3QEKA 2EF0A 4V39A 2IWHA 2IYXA 4K6GA 1RXEA 1VLVA 4TMKA 4NONA 4MKHA 3AHJA 2FSHA 1X1AA 5KQLA 1XL1A 1IQ0A 5F5XA 2F1IA 4ISCA 2DT8A 2BGTA 2IXBA 1RNLA 2KQUA 3WWZA 4AKHA 5I9NA 4BO0A 1VCHA 1RCUA 3K1AB 4L07A 4GRDA 2C20A 4TVOA 1YA4A 2OO3A 5F1OA 1HTBA 1FRQA 5IDVA 1KZ4A 2XUIA 3G79A 1XCJA 1W5FA 1U0OC 4LF6B 3CGGA 4WURA 3P9PA 4ONEA 2ZUBA 3I1IA 3SF8B 1DGFA 3DHYA 1V6AA 4OI1A 4KG7A 3OPYA 2VT3A 5JNLA 2A3RA 2EG5A 7YASA 1BYUA 1U31A 1N6RA 4UKDA 2GJKA 3U44B 4UTRA 3AJIB 3T7CA 2CLDX 5ULLA 3G7NA 2ZJFA 4YMHA 1U63A 1XRLA 4UTPA 1ULZA 4LFCM 3R5JA 1A3CA 5DN9A 3MT0A 3U31A 1GPH1 4E31A 2UZ1A 1JLLA 3L5KA 3B60A 1MG0A 5BNWA 3Q88A 2M2IA 1I8TA 3L7MA 2NX2A 4YHHB 3WK7A 2GRAA 2LXNA 4S1PA 1RYHA 2WM8A 2F3TA 2VJDA 1RE1A 1UBUS 4ZEVA 2FDRA 1NBMA 3IUEA 1II8B 1O97C 2IOFK 4Q3NA 3X1WA 3AUAA 4MRMB 1IWPB 3SBXA 4PZPA 2WAYA 1R0KA 3E70C 3RKRA 4CF3A 2Q1UA 3RYCB 1GTSA 3PSAA 3RD5A 2RHMA 1MB4A 3EIQA 2W2KA 3OJWA 1Y48E 2Q3EA 3EZXA 4LXUA 2H1SA 3KE8A 4IIVA 4B3SM 1NC3A 1G20E 5L51A 3WGOA 2W22A 5JDCC 3ORSA 1OGIA 1TW2A 1NVTA 1CHNA 4G3OA 1TA4A 4K6KA 3DE7X 2D0PB 2HU2A 3ZYCA 2XRZA 5EZSA 2MSLA 1HYBA 1U99A 2OD9A 4C29A 1UBJS 3BGSA 1MW9X 2BFEB 1KP3A 3QK7A 1UPBA 1C5KA 1GGFA 1G71A 5TJ9A 1YZTA 1F17A 1K8ZB 4BTLA 3L7OA 3PUIA 4Z0TA 3K5PA 3AUXA 1H3FA 4B6JA 3QG1A 1KTIA 1E6WA 5AXCA 4E5MA 3ZV6A 3NWOA 1C0EA 3JWJA 4FKMA 4AUMA 3FN4A 1V7ZA 1AZSC 3MWDB 1XF1A 1DQNA 4ZICA 3SHQA 2H2GA 2AKYA 2B8JA 1L4UA 4L6AA 2MR6A 2X2PA 2D3WA 1QIKA 2GOYA 4IS2A 1AD2A 1P2DA 3GWZA 4YP5A 2H8KA 2UXBB 2I8CA 3UUFA 4ZD6A 1GVNB 4MRRA 3MOGA 4FJ0A 3COPA 3THRA 4NATA 5BR8B 2ZS7A 2O0KA 2QROA 1SVOA 2ENUA 4GPEA 1P77A 3GZ4A 1Z3CA 3TQHA 3VU0A 1HNNA 4QBFA 4M3NA 3WJ2A 4ML3A 3STXA 2OFOA 2Q9CA 1HMPA 1URPA 3V8PA 4IH4A 4RTRA 4TTQA 4LJAA 3PXBA 2WC1A 2Z3XA 5EE9A 2JKYA 4YONB 5A06A 2I1QA 2AC4A 5KSPA 2NO7A 2YWGA 2RAUA 2QD4A 3NHLA 5JI2E 1XFAA 3DAYA 2D5CA 4G5XA 5G3YA 4EPRA 5EZYB 1W1WA 1OLSA 3VNBA 2C3OA 2O57A 5F2KA 1GKUB 3WGIA 5DGXA 3R09A 4EDFA 1HDEA 4WN9B 5CG2A 4FXOA 2CLHB 4BNKA 3TTVA 4Q9IA 2B8TA 4LPKA 3M0EA 5AJYA 2G5GX 5CRIA 3RC3A 1DKQA 2YJTD 4I50F 1G7CA 2PT7A 3RHZA 3U6LA 3CZCA 3MYYA 1QDEA 3BDIA 3GFGA 2BW0A 3ZQJA 1JQDA 3MA0A 5DLDA 1ENYA 4B3MM 4C2AA 7CATA 3BTVA 1VL2A 1ZINA 3A27A 2JIZD 2AN5A 1KIMA 2QUKA 4HAYA 4KKXB 2DBQA 2H2DA 2X1MA 3M4XA 2H0AA 5IREB 2AFHB 4X6LA 5EUBA 2F5SA 1GHTA 2IEIA 4IYJA 2MJ5B 1TM1E 4NAHA 1VGVA 1CF2O 5I7SA 4PTLA 5BSTA 4YP7A 4G85A 1YQEA 4YCSA 4LRSA 1LX6A 2C8JA 3BFJA 3V55A 3WAJA 4WESB 5KJ6A 3V1TC 5GINE 5BORA 1PFGA 5A0VA 1JBEA 1ZOPA 1ZSNA 1QWSA 3JX9A 5KNDH 1VIYA 2MMCA 4RVFA 3ELYA 1GZ4A 4RNDB 4PAWA 2FEOA 3RS5A 1H69A 5JVDA 1V4VA 3LK6A 5HK8A 3OZFA 3SHOA 2IH2A 5B4VA 3HGIA 3RG2A 2NZXA 4BEVA 4DW8A 1CY6A 1Z8HA 5AW4A 4Y8VA 4UPEA 2IZZA 3RSOA 3ZCUA 4KH0A 1HNXM 2HRQA 3OEWA 2HSWA 4R2WA 3NTVA 4YCDA 3ZWCA 1MTOA 4GDMA 2ZCUA 3ZWYA 5T4EA 1L3BA 4ZOLF 4XTCS 4MINA 1ZGHA 3QA9A 1CUVA 3T41A 3B6MA 3FWYA 5M7EA 5EPUA 4YRBA 2HSJA 3CZAA 1E96A 3I2JA 4C6RA 3PDIB 3RJMA 1UMBA 4NECA 4FCWA 1U2TA 5CB0A 1YUBA 1RD4A 3JD4A 1OAIA 2XB8A 4B35A 4S04A 1QANA 4TS9A 4JI8M 5KINB 3IDZA 5JMPA 3GPDG 1US8B 5EMJA 4HD8A 2ZATA 4JVSB 2HJWA 4MJXA 5FOVA 4A1OA 4KT0F 3CUSA 1KS2A 3KU1A 3ILXA 2Z2IA 4MYSA 1NVAA 3AHIA 3X3HA 1WOYA 4BLWA 4NXNM 3DCYA 5E0KB 2FH5B 3LLCA 2WRZA 4F9EA 4QSMA 2P65A 3RTBA 2R4QA 1FVOA 2DUMA 2IXDA 4V0QA 2QSZA 5DNWA 4Q39A 4X6XA 4PW0A 2QTLA 4HQRA 4AKTA 2CE2X 1SC9A 3W1EA 4H27A 3R6GA 2MSCB 5BOSA 4B2IA 1K97A 3CVJA 1ULTA 4U7JA 4CNQA 4YEDA 3QFCA 5T41A 4DV1M 2JGNA 4C01A 1RU3A 3H2YA 4HEJA 3KUDA 3GLIB 4NG4A 1ORRA 4CMJA 4QXOA 3BDVA 2RH9B 5BSMA 5K0NA 4X9XA 2NAFA 1XLVA 4A27A 2TMDA 4OM8A 3BEOA 1FXSA 1P7WA 3K9BA 5IS2A 5AW1A 4ER0A 3OQJA 1MFPA 5I7OA 4DZZA 1NNSA 1DCKA 3SFTA 3EJWA 1L4BA 4R8RA 5EHNA 1M0WA 2IDMA 4CM7A 2JFBA 3D0OA 3WLPA 2ZBGA 2L19A 3U4QB 1O03A 1RHJA 1EIWA 5G0SA 3OZCA 1SQGA 4XDHA 1JHQA 1LVUA 2AMFA 4G5FA 5JS6A 2I5PO 1BU5A 2FPWA 2P1DA 1P7ZA 1QYDA 3ZDYB 4RCVA 1SXGA 1XQ1A 1ZK1A 2A14A 2ZYWX 3TJRA 4NCBA 1TO2E 1AE1A 5TMPA 2LW7A 2NXNA 1SU6A 3TZCA 1NXOA 1G2IA 5EWJA 1JIJA 3WLAA 2GYYA 3RQSA 4F3NA 5K09A 2EP7A 1T3GA 3HO6A 1SZPA 1A9SA 1XEWY 2HIMA 1HE8B 1T0IA 1TGYA 3DEFA 4A8JB 4BLRA 5H3HA 2DP4E 2ILTA 4YMLA 3M33A 2FWAA 4KGZA 1ODTC 2HJVA 1UZUA 2C5BA 4GM0A 1EUYA 4ENRA 2J5XA 4H35A 4LF9M 2PCLA 1I1QB 3VDPA 1H66A 1V1RA 5KPDA 1RRCA 4CR6A 1KGDA 2P9ZA 2YZMA 3CRQA 2A86A 3TUZC 3VU8A 4U3JB 4P4SB 1AKUA 5K3FA 1FS6A 4XJXA 5BOVA 1DADA 3RUDA 4LBYA 4NOOB 4DWJA 2PUHA 5JS2A 4ATNA 5CX1A 2IXGA 3FCOA 2IYPA 3P2OA 1N2XA 3Q0IA 4DM3A 1X37A 4G4NA 3CR8A 1TUBB 3ASVA 1D1PA 1VXOA 3NAGA 1B93A 2QRQA 2XB4A 4CXMA 5JPDA 5IM4F 3ZDQA 4RIIA 1E2FA 3WRXC 4OQDA 4HGYA 2EGGA 3EQ9A 4A91A 4JI7M 3HEBA 2Y6VA 3RGSA 2JGJA 2VI5A 3T94A 4PVCA 3KKKA 1C7YA 4TLEA 5JJKA 2YWHA 4L4SA 2F2TA 4JT2A 4L3OA 4Y0AA 1MENA 4GM4A 1T43A 3WLMA 3R40A 2FAXA 4GOLD 2QRUA 2GVNA 4A2PA 1IB6A 5LD2C 2BBTA 4BB0A 1KBQA 3VPGA 2P9JA 3N07A 1W0KD 1YIAA 5GZ3A 4CCYA 1B6TA 1SY7A 1BEUB 4DLUA 4B43A 2XI4A 4EEXA 2FE1A 2KXEA 1TECE 2E6KA 5HA5A 1D2RA 1X1CA 1YCHA 3CUKA 3KHKA 5KKAA 1W0CA 4XYEA 2BHLA 2XADA 1JKIA 4X60A 3OCXA 3QTLA 3GPXA 3WYFA 3KSZO 4GO1A 1HT0A 1EE8A 1KRXA 2D0OB 2EKQA 3MXTA 3QRWA 3SYLA 1ZRNA 1WXHA 1PGQA 2WYOA 2J3HA 2D5IA 4EVQA 3C8DA 1E2JA 3O4GA 5EZQA 4MOWA 2BTOA 3TPFA 1DG3A 2JEZA 3KSAC 4YRDA 4HDMA 4M1TA 1WUHS 1BMTA 4FVMA 3AZQA 1TKCA 1N3BA 1YZFA 4QJ3A 5LXTF 3F6EX 2IXEA 1UDCA 3D64A 4B7ZA 2XYPA 3TLKA 1FXWF 1KAMA 4RFVA 4TZ6A 3NTLA 4BQIA 1IOWA 3ESRA 1E59A 3EH1A 5E8JA 1TZKA 1ZO8A 4PG6A 9MHTA 2OPBA 4DEVA 3I5MA 3AKZA 4R8SA 4P7KA 1UXOA 2RGBA 2QGFA 4RWZA 2HGZA 5JI3E 4PIVA 1D04A 5EEGA 2DAMA 3N75A 3NIFB 2RK3A 2VTBB 2XKAA 4X1OA 5JTUA 3QKIA 1LTMA 4L5AA 3L02A 5KVQA 3K5HA 3RARA 1RCTE 3ZKWA 1J5EM 1JQEA 2WDPA 4YCAA 4Q93A 1ADGA 3L8HA 3C3EA 3ANLA 1GU7A 4QKQA 3VZQA 4PPYA 4PZZA 3F97A 1ZRSA 5HBGA 2B1RA 1LX7A 2Q46A 4TXHA 1NJGA 4AS3A 5E7QA 4X64M 5EIXA 4C30A 3R7SA 4I4TB 3QG5A 4EY4A 2GKGA 3I9OA 1E8NA 4WMLA 2KYRA 2WZDA 3AU9A 2YMLA 4GL2A 3NBQA 2BI4A 4BNFA 4EG7A 5IJ0B 3UHOA 3UUGA 1HA3A 3VR4H 3EZGA 3GCGA 3PA8A 4TRNA 1YA8A 3JZFA 3UV6A 1VRVA 4HXFB 1BDJA 3EBOA 3TBKA 4NC6A 3UK2A 1YR3A 2K7ZA 3UXYA 4EHBA 2XQFA 1VEKA 3NIBA 3P8ZA 3ZGLA 2ATVA 3KR9A 3AF1A 3S7ZA 2WJJA 1JXQA 2BPOA 4M4SA 1AQ6A 3PNPA 1NF9A 1TF5A 2AUMA 2BWJA 3ML1A 3KQWA 4AY5A 5CD1A 3FOWA 2E5WA 4EDHA 1BGXT 2EQ5A 2PT6A 4UOEA 2J3MA 4RV5A 4L4XA 4DMLA 1C9MA 1GV1A 1J7KA 5JPIA 4BO8A 4JGIA 2RGNA 1AXGA 3JQGB 1JEQA 1T8SA 4HB0A 2FZCA 4MDEA 4KV7A 4LPSA 4B71A 1RI5A 1DTWB 3AJ8A 2NG1A 3LWBA 3E5RA 2VA8A 1UBOS 3IHKA 5G4KB 4B5KA 1FU4A 3BYZA 3IE2A 3Q0EA 1VECA 4Y2QA 3TL6A 2AW3A 1L4YA 1XPRA 1GTZA 2BGJA 1TCAA 3A06A 2RBEA 3B7NA 1NPYA 2GXUA 1O8BA 2JLVA 3WGZA 3UPDA 5LA6B 3U9TA 2J1LA 1PUJA 5HKOA 4D0RA 2JLUA 1X7HA 1WSBA 4PTZA 3JVIA 2QVCA 1IM2A 5B58T 5CITA 4HNAA 5ENDA 3LGXA 1XTVA 1N77A 4MKRA 4TX1A 4R2MA 4OL0A 4LF4B 1J8YF 5E9JA 4DJ5X 1TEXA 5J4HA 4BV9A 4PC7A 3D7RA 2Q4OA 4YWJA 1NMZA 3VKUA 3E9MA 1SWVA 3MTDA 5C5IA 1K7YA 4ACAA 4KNWA 4EWLA 2EIXA 3DEYX 2XLCA 3IVAA 4D8TA 3FPLA 3QLEA 4UE3S 1E1QA 1N8SA 3SXUB 2ZIUB 2ANCA 4HX2A 3ZNQA 1FL9A 4G23A 2NN3C 4X8LA 3L06A 4OQEA 4RZHA 2Y71A 2BTEA 4ND6A 4GGOA 4RVGA 4DR7B 5CJPA 5HF9A 4TYNA 2X49A 3T35A 5BW8A 4DAOA 2CLMB 2YV3A 4ZKDA 2FPPB 2AFHE 4JL6A 4UTOA 3OLZA 3HDVA 4RF4A 2IK8A 4DCTA 1OFUX 4MGYE 3RFFA 1L5OA 3A9RA 5FBRB 4Y6OA 5IXJA 4QUHA 3VV2A 5KYGA 3HRIA 1EFTA 2PAAA 3CR3C 3RYFA 4P86A 2ODNA 4YGYA 1BX0A 3HCPA 3T3DA 5CA0A 2P3LA 3X1YA 3MPOA 3TKLA 2FSPA 4Y2PA 3F90A 1MX9A 5FOSA 3QVOA 2LCQA 2MROB 2YMPA 2C8KA 5CDFE 2VO1A 3UF0A 1KVUA 4TZ0A 4RVNA 1I6MA 1AUVA 3ADPA 2XT9A 3QPVA 1S2DA 1HFKA 3STVA 2E4WA 4MICA 3TDMA 3LCMA 3JQAB 1AH2A 2RARA 3K8OE 3P9ZA 5A4JA 4EYOA 2BMFA 3VFDA 3AHGA 3QXJA 3PNSA 3V7UA 4QLBA 3BIJA 1RM0A 4M60A 2FRDA 3N2IA 3IR6A 2OLEA 4MUKA 2GJSA 4P0TA 1EDZA 4BAZA 3GD5A 1IBMB 4OJTA 1JDUA 4FWGA 3NVAA 3QMMA 1IXSB 3A6LA 2DUNA 2PV0A 4W8GA 2QRKA 4OJKA 1E9CA 4PEVA 3SOZA 3NOVA 1U2DA 1AQIA 3G6KA 3NIWA 1N3LA 5DLPA 1A4XA 4IAOA 2F90A 1QIEA 3N8HA 4IGEA 5DHQA 3X44A 4OKIA 1YVRA 2I7TA 2WHPB 1YR6A 2GJ4A 3SZ3A 1G17A 3F67A 5LQDA 1NMSA 4TV8F 3CLRD 5H7XA 4W7HA 4K9SA 3GFTA 1TA0A 4Z3KA 2P9FA 2H63A 3TJZA 3RJ9A 3S2IA 2CSUA 1HE1C 1Q44A 3BJEA 3VU1A 2CV2A 5ARBA 1QDLB 4B7AA 2DM6A 1P7CA 3HBAA 3OU7A 2DUUA 4Q3LA 1NJ5A 5D1NA 3PWSA 3QNUA 1TF2A 2WI8A 1YR8A 1DIRA 3PNQA 4OJNA 3OC6A 1DG9A 4P38A 3GIWA 4X63A 3RKSA 5JATA 2EJBA 1A5TA 4CL8A 5DFLA 4ND7A 4R68A 1COZA 4WGFA 4UD6A 4LWZA 2OOSA 1EXMA 5CFOA 4NFHA 2M9MA 3NUZA 1SKMA 2TS1A 2YC2C 4HVLA 3IAM6 4IZ6A 1Y1KE 4OMUA 4OX9M 1ZJ6A 2H29A 1DIBA 1VGQA 3ZC7B 2WFLA 1JR6A 4EYKA 1QVZA 4UZFA 1NNI1 2Q07A 1ZA1A 1REQB 1ZYUA 2QD1A 1XMVA 2EBFX 3B8EA 3AZPA 1B6RA 3BBPA 3QBTA 1T4CB 1YZUA 3U1VA 3MWFA 3K6RA 3VBCA 3K8ZA 4LFBM 2HMSA 1QGYA 1ENZA 4TTJA 3PGA1 3FLBA 5L53A 3VKVA 3VDNB 5DSTA 1E3MA 2WWIA 4Q4HA 2AXNA 3GUHA 4U0KA 1BYIA 4FYYA 2SHKA 5TQ0B 3ST7A 1L5WA 4ZCTA 2G0TA 5E6SA 4PDIA 1QRDA 4BFUA 1E2BA 2QM8A 2XW6A 1XNRB 3LFTA 3L8YA 2P79A 4QU8A 5CTAA 3VJMA 5J1SB 4ZV7A 4HQKA 1E7SA 1F3LA 2R5NA 1O9GA 2I2CA 4C04A 2I4LA 2XMPA 4DNXA 3ZU5A 1GYPA 3JASA 3E7PA 2P9EA 3GEPA 1HV8A 2NM0A 2QLNA 1NN0A 2HSGA 1B4DA 5CDSA 4G0XA 4GSKA 4KRXA 4EZIA 3VNSA 3DL2A 4J07A 2NTYC 3HY6A 1RKVA 4Y2VA 5LQSA 1RYDA 3JQFC 1NAIA 1S9DA 4O2AA 3TIVA 4YRAA 4A3SA 4GHAA 1ZIYA 4FKBA 4CHGA 2XIJA 5KYUB 1WKBA 1RWXA 2VA9A 3GQBA 2G6BA 2HHHB 3HB0A 4WAUA 2Z8ZA 4Y1FA 4BX9A 2Q9AA 5JNVA 3QLVA 3ZQUA 1VHLA 4QC2A 2JLAA 1OYYA 4RC9A 4BBPA 2ZBVA 4UXIA 3KLBA 3E1KA 4F5DA 3RRBA 2X9QA 1E5TA 4ND8B 1BW9A 2IOYA 3CNLA 4TV9B 1M2VA 2LCIA 3FMOB 1FYXA 4OGKA 1F8UA 4ZOLB 2KA6B 3U3RA 3KSUA 2WQ6A 1G16A 4I66A 3O47A 2GM3A 4XJTA 3THSA 3PVSA 4WH0A 1M33A 1BOOA 4ZCQA 1IHUA 4LNAA 3TSCA 1CP2A 5LB2A 1W73A 1G20B 2Q3JA 5B12A 1NU6A 5JD5A 5C34B 4OHKA 2QF7A 1ZI6A 4EHAA 3WQRA 3B2NA 4HN9A 2WR8A 3B74A 1OLUA 1DAOA 2LVQD 3IAHA 4LXYA 4HH3C 2RJOA 4MPTA 3DWEX 4RDHA 1ORTA 3ESCA 1SVUA 3HCEA 4EUHA 2W71A 3AI3A 4U02A 1YO6A 4ENTA 1TCCA 5K0LA 5BRJA 2ATIA 3ASUA 2A9FA 3OZRA 2WEKA 1AM4D 1NM5C 1NIPA 1QZXA 5DYWA 3T7DA 1CB0A 1DEXA 2XZDA 1MV5A 5AH0A 3SIXA 2UDPA 1VLMA 1W75A 2XUOA 2ZRGA 2Y66A 1FW6A 1YB5A 4L74A 3LDFA 3C3WA 1BX3A 4ITQA 2H5JA 3AM3A 1FFAA 1GCGA 3QEAZ 5EP2A 4GP7A 3PQ5A 1W4RA 3OJOA 2WW8A 4FGWA 1EK1A 5CA1B 1HZJA 1YI1A 4B3BA 2PUFA 5AKGA 4GF5A 5COQA 3H86A 2YZGA 4GPIB 3CVOA 3AB8A 4B85A 2C92A 4BMDA 2HWWA 2A1UA 4RQTA 5K3OA 4ZVNA 3VM6A 3KKZA 3MWLA 2G88A 1KYYA 3MOIA 5KWJA 4W5QA 4PPFA 3C7CB 2BR5A 4FQ7A 4IPTA 1VJDA 2R2GA 2ZRAA 3AMVA 1QO7A 1LPMA 4J1NA 3KFUG 3LSTA 3U7JA 2AJDA 2QN1A 3HDJA 3IVMA 3DR5A 1UK8A 4P53A 1L6RA 1WO8A 3G2HA 3N53A 5FHRA 1L5VA 3RUIA 1ESNA 4C9BA 1RLJA 3PEVA 3UVEA 3SQMA 2PKQO 2AMYA 9ATCA 2GCNA 3S2FA 3T5TA 4OW0A 3N87A 1PR2A 5G0WA 4DJJA 1KSFX 4NOMA 2IPMA 1W25A 3VVCA 1M5UA 4CI0B 4Z4FA 2ERYA 2Q4RA 4M22A 4XWWA 2F62A 6PFKA 3JAMS 3E2IA 1QHFA 1PLKA 2GF0A 3GC6A 3AU8A 3ELBA 4JJGA 1H4QA 1G1AA 2FI1A 2CXSA 3KUCA 1T4GA 3M4NA 5IDXA 4F4JA 3EQ8A 2WWWA 1CT9A 1OI2A 3GRVA 3PF8A 1F1JA 1L9KA 5F73A 3RF7A 4P54A 2FE4A 4XX0B 1LV8A 4WCFB 4IILA 4TMVA 2AR7A 3E15A 1WU8A 5DNEA 4C21A 4I46A 1H3EA 3Q2IA 3WA7A 1NN3A 1T0PA 1N2IA 4B8ZA 2VYVA 3FGZA 2BCJQ 2DTEA 3ZV5A 4R83A 2JCVA 4C7MA 4RY0A 1JDPA 4JI2B 1LCIA 5JCZA 1UJ6A 2G07A 1UBSB 5HK9A 2RFLA 1E3LA 2E87A 1TTTA 4U9HS 1LEHA 2W82A 1N33B 3RJZA 3LYLA 3OUTA 4K81B 3L7IA 1EIZA 1PQYA 3C6ZA 3C6BA 3QM1A 3H8SA 2CDNA 4AZTA 5KUTA 1CRWG 2VJKA 5F7JA 4M83A 1BWQA 3ZY4A 3GROA 3PT5A 2Q8QA 3VI3B 3Q6NA 3WBBA 1TW3A 1HK7A 3C7DB 2H2AA 3FJYA 3JRNA 1W5BA 4L5BA 2FOXA 1L2TA 2GXAA 3RR2A 4YV0A 3EDRA 3GEMA 1WPGA 5JD6A 3ZW7A 1IQUA 2WVHA 4B8YA 4RK4A 3N6RA 2B61A 3P20A 1MU0A 1TU3A 3U4CA 5BQXA 4MIKA 1I13A 1O94A 1E2PA 2IXFA 1YUMA 2EX4A 3K0EA 5IYZF 1K8QA 3I5AA 1C9DB 2IF2A 1OZFA 5B37A 2Q8PA 1AUXA 4EHDA 3QHPA 3QLUA 4EJFA 4RDXA 4D8YA 4ECEA 4KV9A 1RFGE 3K2IA 2BFPA 5DJ5A 4FYPA 2JNHA 1XZMA 4DRXA 4A15A 4Z86A 5CXSA 3DZGA 4H7FA 4BWVA 2XTZA 4RD2A