4LJ8A

Clpb nbd2 r621q from t. thermophilus in complex with adp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj8A01
2UVQA 2BOVA 4PANA 3SOPA 4IHQA 1G5PA 4Q7JB 3GJ6A 2QZ4A 2ZQ5A 3T1TA 4BECA 3NIBA 2QROA 621PA 2HCBA 1E2MA 2BWJA 1JPNA 1C1YA 2C99A 1DAHA 3DM5A 2WPDA 3LV8A 3Q9LA 3RS2A 2VP2A 1X3SA 4RD4A 1XEFA 3GJ5A 2ASEA 4D0NA 2EVWX 1GNQA 3NBYC 4B6FA 2DFNA 2RCNA 2R6FA 3NWJA 4MQBA 2GK6A 2Q3HA 3CRVA 3CWQA 1BH2A 4EPVA 3GFTA 1J8MF 2AFHE 2WMOB 1AJEA 1CR0A 2ZRMA 3AF1A 1NVWQ 3C5CA 4NU0A 1D2EA 3ZZ0A 1N5JA 2OCAA 1XP8A 3NH6A 2IXFA 3CRRA 4NCJA 4RD1A 3SNHA 3AQ4A 2BEJA 3THWA 5FPHA 1R0XA 1NSFA 2QAGC 2RGAA 3AP3A 5TVKA 1DE0A 2V9PA 4JLJA 2H7VA 5IT5A 1SHZA 4BEJA 3QENA 3EC1A 2D4HA 2AK2A 1YE8A 2ORVA 2C5LA 4TL7A 5L3VA 1XTSA 3WHKA 3DOEA 2BV3A 5K8IA 2JCSA 2JLRA 3QPUA 4QM6A 4KBGA 1UFQA 3ND9A 4P4SA 4URVR 4IRUB 4LRWA 4RZXA 2XSZD 2IWHA 1W44A 4ZPXA 4Z51A 4B48A 2HJVA 3QUSA 1P6XA 1II0A 1S8FA 4Q21A 2P5SA 1AKYA 4RZUA 1KO4A 2GEVA 2MSDB 4G5GA 4LBVA 1AGPA 4JL5A 3LRPA 1ZMXA 1JJ7A 4PR0A 2ZRIA 3LAWA 4N0DA 5KSYA 4AWXA 4K46A 1IN7A 3KQKA 3IO5A 2BBSA 2C2HA 3AVPA 3CZPA 1BS1A 2ODWA 3PV0A 1G19A 2W6ID 1GM5A 4QM7A 2Z83A 1FX0B 3SS8A 2C9CA 1OXVA 3Q7PA 1GRNA 1M8PA 3EZ6A 2HXSA 3G82C 3IBYA 1G4AE 1S1CA 4M9SA 1VG9B 3SJAA 4B32A 5JZVA 2D7CA 3VQTA 2OXCA 3KQLA 1WE2A 1CULC 4D82A 1ONBA 2OAQ1 2ZSEA 2A5FA 3WYFA 2ONJA 1XRJA 3O8CA 3LXRA 4US1R 2RHDA 3A8TA 1Q1ZA 2NQ2C 3UMFA 4QJ3A 3CO5A 3W34A 1OV4A 4B2IA 4HDCA 3GD7A 2B7CA 3OESA 2ZEJA 5CJ2A 1RC8A 1P9NA 1ZAKA 5CDFA 4TYNA 2QGNA 1S96A 1U8ZA 1FL9A 4O2LA 3LD9A 2GCNA 2X8AA 4XD7D 1IXSB 2RGGA 2YINC 3ZD6A 4N3NA 1Z47A 2IYSA 2ZROA 2WAXA 4PSAA 1GAJA 3EIHA 2QT0A 1Z0AA 3T1QA 1W36B 3R7WB 1JAHA 4PTLA 3SHFA 3QXHA 2IEZA 4LZZA 1GKIA 5DN6D 2VLIA 2XNDD 1IJEA 4C0HA 4JLVA 2PBRA 1AS2A 1NG9A 4FI3C 1Z08A 2F7SA 2G1KA 3BB3A 1YR6A 3DVLA 4IOLA 4PX9A 5CK4A 3RS0A 1ZBDA 3CNLA 2XJ9A 4MDEA 3PXGA 1NMZA 2ZAOA 4BFYA 1F3OA 3AB3A 2EW1A 2DWZB 2A5DA 4V0LA 1E9SA 5JBQA 4TSFA 1Q1EA 3EA0A 1WDTA 1DOAA 1P4SA 2O0HA 1EFUA 2FEMA 1SZPA 2O52A 2NO1A 5J4VA 2A3RA 4URUR 1AQUA 1EFCA 1XU4A 2RH5A 4Q7LA 2RHMA 4BFWA 1YZQA 3U7GA 3UWKA 3IUYA 3W6OA 3K53A 4C7OA 3SZRA 4NYIQ 1MRNA 4NMMA 1ZU4A 1K6MA 3GLIB 1XMJA 3NC1C 3QBTA 3IHWA 5FL7A 3Q8XB 4LHXA 4EDHA 2GNOA 4C3ZA 3ZS8A 1E0AA 4POAA 1G1MA 2WJVA 2GDJA 4BGDA 2QQEA 4PC3A 4FD2A 1KOFA 2YWGA 4PSKA 1YKSA 1P7CA 2QBYA 4QBIA 2QNRA 2WWFA 5CK5A 2IHYA 1FQJA 3TK1A 4C2TA 1P2VA 1SKYB 3NXSA 1W5TA 1E2GA 2BBWA 2LCFA 2ZSAA 4LC1A 5HKKA 3CW2A 4PAQA 2ZRCA 2ZUBA 3CH4B 4F7WA 1N6KA 4A92A 4U7DA 1U8AA 1JALA 1EFHA 4QRHA 2D7DA 1EFRD 1C1KA 1MH1A 4IOMA 4YXWD 5FH9A 1VYTA 2ZVPX 2O8CB 2H17A 3U61B 1SULA 3BFXA 3L8ZA 1KNXA 3QKUA 3PEVA 4XTRA 1SXJD 2V7QA 3RANA 4Q7MB 4OHYA 1T5IA 3AP2A 5L8VA 4B74A 3EPHA 3AKYA 5GVSA 5FTLA 2E87A 3K9LA 1XEXA 4L8GA 4JLMA 4W5WA 1NJGA 1MO6A 3REFA 1RKBA 1KSGA 1ZNYA 2BHRA 4UNQA 1N6RA 1MKYA 5FI0B 3ND8A 2JLZA 1J70A 3DDCA 1KAGA 5H68A 2DWOA 3T1VA 2ZRLA 3GLFB 2ZJZA 2Q9BA 1VECA 3IKJA 4RD3A 1FPMA 1CXZA 1DTSA 3W8RA 1R0WA 4YONB 4I1UA 3EX7C 1D2MA 1GILA 1Z2AA 4RY2A 4M1KA 4H9GA 4UKDA 1OYWA 1KI4A 4KFTA 1YZLA 3PIRA 4YDSA 5BXQC 1R0ZA 5FPYA 4DLWA 3CLVA 1DVRA 2GTPA 3C8UA 4XTCS 3OEHA 3HU3A 1YR8A 5DGXA 5EUMA 1Z0KA 1TEVA 4JIMA 4HAXA 1Q44A 1ZINA 3TUIC 1LTQA 3FMIA 5FPSA 2PX0A 1E4YA 2IYLD 3DOFA 2QTVB 4MYTA 1Z6XA 1GRRA 1XXHA 5J40A 3I8SA 1M7HA 2GF0A 1HT2E 2ZYUX 4BPBA 4RSGA 2V1XA 4LWZA 1UDXA 4FWHA 3NBZC 121PA 3PG5A 4DLUA 2ZITA 2P0EA 2F1JA 1US8A 4D0LB 4LJ9A 4OK3A 1KI1A 5AWFC 1HA3A 2YOHA 1X8KA 1G17A 3PITA 1AZSC 3OZXA 3CPEA 2F6RA 3U7HB 3GLGB 3UWOA 2F55A 5BW8A 4KFUA 5L3SB 3I62A 4A8JA 1K5GA 1LS1A 1P9WA 4CEHB 3AP1A 3ICQB 1E2EA 4IDNA 2QL6A 1VG1A 4EQ6A 2CHVA 2CJWA 4DCTA 1XCGB 1M7GA 1MO5A 1MABB 3FB4A 3MUFA 1TMKA 3W3AA 4GRAA 2IHBA 1ZW6A 5G3ZA 4S2EA 1KI9A 5CLQA 1YZUA 1NIJA 4OHZA 4S35A 2IWRA 2C04A 4LV8B 2B8TA 1U9IC 4MUBA 4TYYA 5J4LA 2DHRA 3U4QB 2XZLA 2O8DB 2VP6A 3KZ1E 4MGZR 4BZXA 4A0FA 1E9FA 5CYPA 4BFUA 3UANA 3LX8A 2ZAMA 2FPMA 4Q66C 1II8B 2IS1A 4M1OA 3IQWA 5DI3B 3TW8B 5B57C 2BDTA 1IJFA 3NBXX 1NKTA 2IBMA 3SYLA 2QMHA 2ZS8A 2AL7A 3B1XA 3S1AB 1S9DA 5EP3A 3BXZA 2IK8A 4CDGA 3EWAA 3QY0A 3WBJA 2VO1A 3L2OB 2G0NA 4OQLA 1OB2A 2DWPA 1QZMA 5FTMA 1G9XA 2Z4SA 2QA5A 1JBKA 5EZ5A 4DLRA 4F4IA 3FKSD 3PVSA 1T5LA 2G1JA 2OBMA 4UNSA 3ZZTA 3GLHE 4EUNA 1NL3A 1Z0IA 2ZRAA 2K5UA 1C9KA 4GSYA 4WAUA 1G291 3BB4A 5IK2D 1NBMD 2A2ZA 1T91A 2GJ9A 1ZNZA 2HLDD 2WWHA 2AD5A 2EFGA 2BBTA 3AGPA 3WHLA 1OH8A 3NHAA 3ZIAA 3CR8A 1MR3F 1LW7A 2ZSBA 3K0AB 2KWIA 2ZJYA 1E1QA 2EFDB 3TQFA 1NN3A 1OXXK 1U98A 2R8RA 3RRNA 2FN4A 2OILA 3C15C 1GDDA 1E1RD 1OB5A 4A1FA 1G7RA 5DE3A 3PEYA 1F2TB 2AX4A 1KK3A 2WOJA 4DB4A 1ZM9A 4LBYA 1LV7A 2G6BA 2FOLA 4HLDA 4QBGB 2JAQA 1J99A 3QF4A 4KXFB 4RVCA 2RAPA 2NPFA 4C4PA 3G5UA 2G88A 2AN9A 5FFMA 4J0QA 2IS2A 2ZYWX 1MRSA 3U3MA 3UMSA 4UNRA 1CJTC 3RWOA 2PEZA 1OW3B 3I92A 4PPGA 4TN1A 1AZTA 1G16A 1W0JD 4NYIR 1SXJC 1D5CA 2QM7A 2GAAA 3GJ4A 4IXMA 5L3QA 4LGMA 1JB1A 1N6HA 3U7FB 2AR7A 2J0UB 2YOGA 3AVTA 1OIWA 2ATXA 1IM2A 1QHHB 1P2SA 2VP4A 3TVTA 4TMVA 4HLUC 1X8JA 4BE7B 3IPYA 3WP1B 5LPNA 2QP9X 3W90A 3A1SA 5DO9A 5FTJA 2VH5R 2JA1A 4D2IA 4M4SA 5SZHB 2WJHA 1TQ2A 1EWQA 1E2HA 4PQYA 4Z8XA 3ETLA 3K9GA 4P31A 3KJGA 4A6PA 3VKHA 1NJFA 2IXGA 2ZJOA 3JVVA 4MKGA 3CX7A 1RJ9B 3MG9A 3AF3A 3LXXA 2E9SA 2QAGA 4TYQA 1KO7A 2VP0A 3RS4A 3BERA 5IF9A 1OIXA 2XXAA 3CR7A 4JLAA 1G3RA 3GJ8A 1CBUA 4HAYA 4JSYA 4TTQA 2LKCA 1G8GA 1SKQA 4XJXA 4FCWA 5JFGA 3ZVRA 1QHYA 1XFAA 1TF7A 4A6XA 3RDPA 5FOXA 4FWTA 4PC6A 5HE9A 4RD2A 1G7TA 1XZQA 4KV9A 1ODFA 2BM0A 2NIPA 1ZVQA 4XVQA 3X1WA 4A82A 2WWWA 1QZXA 4JVNA 2IT1A 3FVQA 5CB6A 4DDVA 5KSOA 3U7EB 5JRJA 2GVDC 3LH5A 4XIGS 3CX6A 4HEJA 1E9EA 5DI9A 1AIPA 1UBEA 2RGNC 5JSZA 1WB9A 3UPUA 1E9BA 4YLGA 1W0KA 2ZVQX 3QG5A 3N2EA 3PR1A 3B13B 4RKEA 1KSHA 2A5JA 2YYZA 3LW8A 3FTQA 2J41A 2KBFA 4L15A 1OSNA 2Z5FA 4EIWA 2JIZA 3X2SA 5KU1A 3QSYA 2HF9A 4B35A 4D26A 4GMDA 1II9A 3BBPA 3I5YA 3TGPA 1QF9A 1XD2A 2P6NA 1XMVA 4B3CA 4TL6A 5FUYA 3A36A 3DM9B 1P60A 1L8QA 2DR3A 4O3MA 3LY5A 3KJHA 4XWAA 2O8FB 1ZNXA 3CNOA 1KY2A 1U90A 3E5HA 2XITA 4AC9A 2XTNA 4ARZB 1UAAA 4M0LA 2JJ2D 3ADDA 4PAOA 1Q20A 4QXAA 4K8OA 3SR0A 4UXIA 3LW7A 2FSIA 3THYB 3NG1A 1ZUNB 2HV8A 1DELA 3P27A 1TNDA 5TY0A 5JS8A 5D3MA 3KDSE 1JR3A 1OXSC 4NYMQ 3L43A 1E2FA 3KKMA 4Z54A 2JLQA 4F4JA 5FUVA 1YVDA 2QY9A 4BFSA 1IAQA 1TEXA 4DDTA 1OFTA 1Z83A 4V0ME 4RJLA 3TKLA 4EPYA 1ZD9A 3VMFA 4DIEA 4M1TA 3IO3A 2BEKA 3V00A 3NDBB 2NTYC 4A2PA 721PA 4DSOA 1CRPA 4DJTA 1KAOA 1DAKA 3IEVA 2GK7A 1G41A 3I61A 2CE7A 5HZKA 2F43B 2IYYA 4KAXA 4C0QC 1F6BA 1OHHA 1T8TA 1N25A 4OL0A 1ZM7A 1AK2A 3AEZA 2WSSD 5HZHA 1ZCAA 3IBGA 4OK5A 3SJZA 2G77B 2ZYTX 2J3EA 4HUQA 2W6JA 4IDOA 2OT3B 1NLFA 3BE4A 1FFHA 2QT1A 4LHZA 3B6EA 3TE6A 1IBRA 5C1BA 2O8BA 4LY6A 3BC1A 1K5DA 3K9HA 1X1RA 1T9HA 2DBYA 4PHHA 1WF3A 3ADCA 1XJ0A 4DUGA 4ACAA 4LRSA 4BFZA 4HZIA 3VHXA 1DS6A 1FNMA 2C95A 4Q47A 2CHQA 2IX3A 1FZQA 4URYR 1VCMA 1X86B 3BD9A 3O8DA 2IYRA 4F93B 4TTPA 4RFSB 2DVWB 1COWA 1G18A 4H1VA 4UQOA 3WYGA 4JBWA 4LJAA 2IYUA 3PCRB 1S0UA 1WBBA 3QEJA 1XJCA 5FOWA 3RS3A 3QKSA 1EWRA 1M1YE 1JEDA 4I99A 4W5HA 2KBEA 4LC0A 3Q3JB 1YR7A 2AFIE 3LBHA 2ZJ2A 4A4DA 3W6PA 1BMFA 4C7OB 1X6VA 3QXJA 3B1YA 3SHWA 1NSTA 2JDIA 1CIPA 2DPXA 4I81A 4NKRA 4LJ4A 4HI0E 1GIAA 1SXJB 1X1SA 3UATA 8OHMA 2EYUA 1S3SA 2FZLA 2GESA 3PUXA 3MJHA 3EPLA 1R8QA 3OE7D 1TTTA 3ZVMA 4CW7A 4NCKA 3CWZA 2CBZA 4YC7A 4YMTA 4PXAA 3IHLA 2J7PD 3FKQA 4GZLA 3WXMA 3AUYA 2ZS9A 1IN6A 2GVZC 3QNUA 3VAAA 2F3RA 1E6CA 1AA9A 5FR2A 3A1TA 1TQ6A 2F1HA 1PJRA 2F9LA 2QRNA 1C4OA 3KUCA 4DCVA 3HJNA 4NCHA 2R2AA 5CIWA 2HEIA 3C16C 3KXKA 2GJSA 4FWIB 5HTKA 1PLJA 3QPWA 3TQCA 2G3YA 4B2LA 2FFAA 2FGJA 1NG1A 4JVMA 3VHLB 4TQAA 2FX3A 3H4MA 2YZ2A 4Q01A 3X1DA 4L9SA 2GCOB 3KKPA 4AG5A 4HLQB 4FMDB 3WNBA 2I1QA 2VHQA 1ZRHA 2GBLC 4AYTA 2FSFA 2QQ0A 1HYQA 4B75A 2FPKA 4TLCA 2AKYA 5KNDA 4JT2A 1FUUA 1E79D 1A1VA 4ZDJA 1XPOA 1HV8A 1XEXB 2AHOA 2FNAA 5J4YA 2H8KA 2B6HA 1SVLA 4HB2A 1RE0A 5TMPA 4M9XA 3GLHA 1KDPA 2AK3A 3MJRA 1OT3A 3HR7A 3CPJB 3K0FA 4HYYA 1RYHA 3WY9A 3LNCA 1I2MA 2ZJAA 4DSNA 1KDOA 2D74A 2GAOA 2R6DA 2XTZA 2KE5A 1JR6A 2YWFA 3QKTA 3SBEA 4WZ6A 4GL2A 2JATA 2R62A 1DBSA 4Q4JA 2WPDD 4C0LA 1Q1QA 4TQ9A 1J90A 1IN5A 1S9HA 4P3YA 3PQCA 1QHIA 4JLKA 3CBQA 4KJZA 1QVAA 2F3TA 2W6IA 2C78A 3FMOB 3ZH9B 3T5GA 2DFLA 4LUCA 4B47A 3UKDA 1CJVC 4PC7A 1CP2A 2WM9B 1G21E 4IKEA 2RGEA 3U44B 2ZS7A 4ILEA 4TT3A 3TNFA 4ESHA 3TW4A 2ZI6A 2EYQA 3D7MA 4C0AC 3U60B 1M7BA 1DEKA 1XXHB 1XTJA 1U94A 3LVRE 3FFAA 5EXXA 2R6AA 1EFTA 1KI2A 3CNNA 2RMKA 4Q1DA 4IFEA 3TUJC 2Q21A 3MWKA 3EASA 4GFDA 1SHKA 1TUIA 4LYJA 2ZTSA 4PPQA 4Q7KA 2CNWD 3U6KA 3FMPB 2GJKA 3R20A 1WP9A 2PLFA 5GVRA 2OCPA 4LJ7A 4C0KA 4V02A 5JEEA 1GRQA 4U5XA 4GDFA 3K1JA 5H70A 4IVQA 2ZRNA 5DISB 3GLIE 2IEYA 4UJ5A 3ZDQA 4M1MA 1W4CA 5E7MA 3BH7A 3TR5A 4AKIA 4BLQA 1KSFX 2WMNB 2YC4C 4Q4HB 3X1ZA 2CDNA 3B1WA 4G01B 2QU8A 4A8JB 1OYYA 1KJWA 3FOZA 4B76A 4LRTA 1CRQA 1U9IA 2XNDA 4JS0A 1F2UB 2J7KA 2C98A 2VHTA 4Q1FA 2VP5A 1SKYE 1PV4A 2FA9A 3D3QA 2ZI5A 1R6BX 3NVAA 3RLFA 2C9YA 2B92A 2H16A 5FUXA 3DHWC 2WJIA 2SHKA 5K8LA 4PZLA 1SVWA 4X8HA 5LDDC 2ZU0C 2O5VA 2WICA 3B1VA 3B2EA 1T4GA 5EJEA 3THXA 3T61A 1KZ7B 5IRCD 4LPSA 3I72A 2PCLA 2XX3A 3BH0A 4N1AA 4B34A 3R9XA 3HWSA 4CF7A 4A0RA 1ESMA 4X8LA 1VPLA 2XAUA 2IXEA 4ZCLA 3EIEA 1H8HD 1KI6A 3KJEA 4V0NA 1SVKA 2ZJBA 4WZAE 1NVVQ 2ODNA 1G6OA 4HAVA 2J59A 3GFPA 1G3UA 3TR0A 1TQ4A 1YZKA 2IYXA 3V4FA 2B21A 1E2LA 3TAHA 4IEIA 1UF9A 2FG5A 3B9QA 4LYAA 4PSVA 3CF6R 4DWJA 3AKEA 5J5CA 2ZI7A 4MRRA 1HH4A 1KK0A 3U3OA 3GLFE 5FI1B 5C2JB 2ONKA 2F9MA 2ZANA 1ESNA 4GP6A 4ESVA 4TMKA 4BQSA 1UPTA 1DPFA 1HURA 3VTKA 1H8ED 4II7A 2MMCA 4CEJB 3DO6A 4CEIA 2DFKB 5EP2A 2QP3A 2I3BA 4KFSA 421PA 4Z1MD 1WMSA 4CT5A 1G8PA 1B0UA 1J8YF 4MUAA 4DZZA 1W49A 4Q4LA 2H5EA 4FMBB 4IEEA 4Q4AB 1GFIA 4NBSA 4JLOA 4EJSC 4PQRA 4H1UA 2QG6A 3BJIC 4TSFD 4DT1B 3IILA 1ZC3A 2BMEA 1Z6GA 2J46A 2JLSA 2O8EB 3LFUA 2PH1A 1EX6A 4V0MA 1GL9B 2JLWA 1KI3A 5FTNA 1IXRC 4L16A 2PEYA 1EXMA 3CUEF 2R9VA 2ZPTX 3M0EA 2XB4A 2V4ZA 1XD8A 3HU1A 1ZD1A 1FUKA 2GCPA 1ZU5A 1CLUA 1KY3A 4NDZA 1JI0A 2YC2C 3Q72A 1KNQA 3LDAA 2DZOB 2F1IA 2QGZA 5EP1A 4QJ5A 4LHWA 3GMTA 4ZI2A 3NEJA 1UKEA 3ZZUA 2AKAB 1G3MA 3RWMB 2FMXA 4DRZA 4B44A 3GLGE 2GILA 4HDOB 4L9WA 2QM8A 3QKRB 5B58C 1RZ3A 1Z06A 2QE7D 3RS5A 5SZKB 5A0FA 5CLLA 1O87A 3J81k 2ZREA 3CF2A 1KMQA 3PEUA 1XTKA 3AGQA 3Q5DA 3F0TA 5TV2A 1CTQA 5KSZA 1Q57A 3P20A 5HKKD 5JI3E 1UJ2A 3OEED 1NIPA 3M1IA 1CR2A 1PLKA 2GRJA 4P4UA 1Z29A 1Q0UA 4A2WA 3KTAB 3K09C 1UEJA 4NTZA 2ZRHA 1XEWY 4PPFA 3TRFA 1ZIOA 3B78A 1HQCA 1AQYA 4QG7A 2ZI9A 3QVUA 5LD2C 4Q9KA 3EPJA 3QE0A 2ANCA 1TQDA 4ITRC 4MA4A 2XGJA 4EAQA 3DPUA 2Q6TA 4WW0A 3KXIA 2IF0A 3CB4A 5DH9A 4HAZA 4GPTA 4A3VB 4CVNA 5G3YA 5H8WA 5BYKA 3PFIA 1DARA 3ADBA 2DFTA 2H1LA 5JSZB 4RFVA 1F5NA 1G8YA 4DLVA 3KB1A 3LVQE 3MSXA 4G5QA 4KI0A 3RAPR 5C4GB 3WMGA 1ZP6A 5AJYA 4ABYA 2NGRA 2NO7A 5TARA 1KIMA 5KDOA 1TF2A 2BC9A 3C41J 1D9ZA 3NC0C 1I4LD 2QPOA 3TSWA 3FHCB 2PL3A 1SVMA 2J9RA 2RGBA 1M2OB 2FJUA 2XTMA 5DIFA 5K8TA 2CCJA 1CJUC 3FPAA 4D4KA 1WXQA 1XPUA 2IS4A 4OQXA 5JEDA 1FX0A 1AS3A 4KSCA 3K8YA 3C5HA 2CLCX 2ZI3A 5F98A 1X8LA 4B33A 4QGGA 5FBLB 1RPZA 4D4JA 4QHSA 4QNMA 2QPTA 3Q85A 4CZ2A 3W3ZB 3QXSA 5C18A 1VCOA 4LHYA 4TLBA 1XJQA 2HT1A 2FWRA 1S4QA 4B6EA 4GOXA 2W00A 2PX3A 2G0TA 2VEDA 4JSTA 1Y63A 1T3SA 2GJAA 2P65A 1GKYA 3AF0A 3EAQA 1P61B 1GSIA 4U00A 2FE4A 3BORA 5F2EA 1IONA 3DMNA 1A2KC 3EA5A 2GA8A 4ZV4A 4G5SA 4WIAA 2WIAA 4JJKA 3ZLJA 5EE1A 3WYAA 4EPXA 3KL4A 4JKIA 1B23P 4I1OA 3LX5A 2YKGA 4JN6A 2NMVA 1RW4A 2HF8A 4AG6A 1P73A 1RFLA 4UXHA 3FGNA 2OBNA 2ZE7A 4PZZA 4C0JA 3NDPA 1E0SA 3FKSA 1E9CA 3MHVC 4FXPA 4PHFA 3VFDA 1MT0A 3OIWA 4Q00A 3U5ZB 2ZJ8A 4XSGA 5EE3A 2AWNA 1PUJA 1R5OA 3R7WA 4DLSA 3HYTA 2ERXA 1VCNA 4RCYA 2ZSDA 4BRUA 1OFIA 4LJYA 3MD0A 1VKJA 3MRSA 4MRPA 2IF2A 4W7SA 3AM1A 4OI4A 5LB2A 2PJZA 1KMHA 2ZE8A 3W8NA 4NONA 4PC2A 3H1TA 2ZRJA 2Q3FA 2QMUA 3RS7A 5D3QA 1KO8A 1E9AA 1N5LA 4GNKA 4B43A 4W9MC 1QHNA 4LJ6A 4IOJA 2ZE6A 4HZUB 3JZMA 2PMDA 1WRBA 3EZ9A 3BAFA 1KYIA 3BFVA 1XZPA 2YWEA 3KKQA 4BFTA 1E1RA 1IY2A 1Q21A 4D80A 1Y3AA 2V6ZM 4BLTA 2GJ8A 4IDPA 4YMSA 1RRPA 1XEWX 2Q9CA 3F8TA 3QJYA 5KPJA 1IY1A 1W4AA 2FU5C 4KYIB 5KUTA 5E4FA 1ZM3A 4EJSB 3PUYA 5HR5A 1TPZA 2A5GA 3U3RA 2ZRFA 3HP1A 2W2XA 1OFHA 3VR2A 3WNCA 1PVOA 1G7CA 4AKHA 1FTSA 2YVUA 4FMCB 4R7ZA 4OI1A 4URZR 1T3HA 2CXXA 3SC3A 1ZJ6A 1MV5A 2R6GA 1XTRA 2GZDA 3IQXA 1SGWA 2OXRA 4QOSA 2HYIC 3VLFB 4TZ0A 3RYTC 3BGWA 2ECKA 4DDWA 1XBTA 2ZE5A 4EPRA 1XD9A 4JYBA 5FBQB 3KXLA 4AD8A 2P6UA 3DZ8A 3X1YA 2E1RA 3QBVA 5JRZA 4AY2A 3MGCA 1EESA 1Q3HA 1WCV1 2ZUDA 1NN1A 2IYTA 2VRWA 3PUZA 4QFMA 4JLDA 2ZR9A 2BJVA 1KJZA 3NBFA 1E1QD 1ZNWA 2QMEA 4JL6A 5EXPA 4NPHA 1A7JA 3VR3A 1YZTA 2WWIA 5G41A 2X1VA 1U99A 2CLSA 4B3FX 1FTNA 3CF0A 1VIAA 2O8CA 4URXR 2UKDA 5AJZA 4M9QA 4B3DA 4LYHA 2WKPA 2WKRA 1AM4D 2IYVA 3ZVNA 5LD2B 4HSEA 1LS6A 2EU8A 2HDNB 2VHCA 1ETUA 1JQLB 3I32A 5AUOB 3THWB 4GOKA 4TYWA 1BOFA 3SU8A 1Z8FA 2HCJB 3QG1A 1R4AA 2JGNA 4FMDF 3AF2A 2CK3A 3DL0A 3U6BA 3GLFA 1YQTA 1CJKC 1NVMA 4MRNA 2KSQA 5GJCA 4ZCMA 3ASZA 4ZDKA 5AR1A 3UK6A 3OIVA 1JEEA 1CEEA 5TDHA 4LX0A 1KJYA 4P4SB 3OFNA 4YDHB 3ONWA 2WIBA 1Z5ZA 2ZUCA 3VX3A 3IGFA 3R8CA 4BZQA 3KQNA 2PT7A 3IEUA 3SN6A 3VKWA 3QOFA 3K70B 1CU1A 1NVXQ 2OAP1 4JBYA 3MCAA 3FHOA 4FINA 3GEIA 5E7IA 3A6PC 1M6NA 4KO8A 4F91B 1FP6A 2OUKA 4QNRA 2JJ2A 2REXB 2JLVA 5GADl 3SQXA 1PUIA 2F1RA 1G64A 3KQHA 1IHUA 1KHTA 5CYOA 5GJBA 4JBXA 4M21A 2VSXA 3RRZA 2NG1A 3V4RA 3I73A 2BVNA 2OO7A 5AK0A 1J2JA 1N0WA 4DLXA 5DSZA 1RVDA 4IDQA 1VG8A 4HB4A 5CJPA 1QRAA 4LDJA 5KPDA 1XNJA 3WRXC 2O0KA 1E2KA 1H65A 3LLMA 1E4VA 3K9NA 4NL4H 4CYMA 5C46F 3RC3A 1GTVA 2QI9C 5HCNA 1OH5A 2PMKA 4C0BA 4WVFA 4M1YA 1OPXA 3GLGA 2VF8A 3SDZA 2FH5B 3JVUA 4CEHA 1SXJE 2G83A 1WA5A 2IL1A 5CM9C 2JIZD 5KDLA 1AKEA 2N46A 5AUQA 1MABA 3DZDA 4DCNA 5JCPA 4LV6A 1OXUA 2ZRPA 3LBIA 3WP0A 4A8JC 3OAAD 3KKOA 4TQUS 2OFOA 1CJMA 4LOAA 5TXGA 4D25A 1SVOA 1ZC4A 4EKDA 2JJ8A 3I8XA 3W5IA 3R9WA 3U4QA 1ZD8A 3I1FA 1E98A 2FF7A 4US0R 2O8DA 3KB2A 1PLLA 1LF5A 3GCGA 3DEFA 1YU9A 1UDWA 3IIKA 4OJKA 4HLCA 1G4UR 1OKKA 1LVGA 4IFBA 1II8A 3NHBA 4GZMA 1XMSA 2RB4A 4PPNA 5DI3A 2QMOA 1NNEA 4NP6A 2I4IA 3EG5A 1JR3D 1ZUHA 1NMXA 3K0SA 4P33A 521PA 3S1AA 1Z22A 3SFZA 1NLZA 1Z0JA 3LLUA 4O2RA 2QN6A 4P32A 2P2LA 3U2QA 3V9PA 1RYFA 4NH0A 2WKQA 4HAWA 4DXAA 2RGCA 2WHXA 4LK2A 2A7QA 2XB2A 4B2PA 4HUTA 2ZI4A 5CIQA 4DLTA 1TL7C 2IUTA 4LHVA 3ZGXA 4ERNA 3EWSA 2R44A 2ZRGA 4EFMA 1OHHD 4JYCA 1VYUA 3W5JA 3G0HA 2TMKA 4UNNA 2FDCA 1PZNA 4JVLA 1XPRA 4L5BA 4ACBA 2YV5A 3VR1A 3EPKA 4BLRA 4GI7A 1HEIA 2W6JD 5JECA 1L4YA 3RVBA 4OHVA 4KODA 2ATVA 3O47A 3ZS9A 3EARA 4NYJQ 2MSCB 3RHFA 4R2IA 3SYNA 4R2HA 4DBLC 3B85A 2A30A 5BN4A 1P75A 2BM1A 4WOPA 5BYJA 1Q1BA 2WV9A 1EG7A 4WXPA 5EP4A 2QBYB 1COWD 1E99A 1F2TA 2KI5A 2OCBA 2OZEA 3RNLA 4ZIRA 6Q21A 1OJLA 3BK7A 3CX8A 2AD1A 4R71A 3K0CC 2V1UA 4LV5B 3NKVA 3PJRA 2BMFA 2BCJQ 2WWGA 4W5JA 1YRBA 4F38A 2Z4RA 1VDZA 1XXHE 5GJVC 4AI6A 4ASUD 4F4CA 4X8OA 1E79A 2QSYA 3L0OA 1DAFA 1U81A 4DB2A 2H92A 2W83A 3H84A 2OE2A 1VYVA 4M2LA 4TTRA 3VU9A 4I1VA 4TLEA 4DKXA 3GP8A 1Z6AA 1Q12A 2OEPA 2DB3A 4P4TA 3EXAA 1P2UA 3P4XA 2J0UA 2MMGA 2VA8A 2JDID 4HDQB 5BQ5A 3A1VA 1QVRA 3WMEA 1QHHA 2JJ1D 1NP6A 2VHUA 3P1JA 4TL9A 1OH7A 5LBIA 2WTUA 2D2EA 1W5SA 4KSBA 4BLSA 4ZO4A 1I4TD 5JWOA 1Z63A 3KFVA 2QP4A 2EWWA 2ZSFA 3TUZC 2GZHA 5F3WB 3AUXA 1JXMA 2XSZA 1SVIA 3ADKA 2XOKD 2IYQA 1JAIA 2NO9A 3ZYCA 4AKGA 2QTHA 1G7SA 3C14C 5E7JA 2JLYA 1E2PA 1N6IA 3RRYA 1RJ9A 1NI3A 1VHTA 3K09A 4QGFA 4A0HA 2VIIA 3B7GA 4CT4B 3E1SA 5EXTA 1E0JA 4D4LA 2PZGA 4MKFA 4LCBA 2VBCA 2J5XA 4A0GA 4JT4A 2XEXA 1ELOA 3KFXA 4TWZA 1ZUIA 2VHJA 3C4JA 4PQFA 3TJZA 1NBME 5DYGA 1TAGA 5AUNB 2ZETA 5FPTA 4FWGA 3AVOA 3NTUA 4AYWA 3VNVA 5KSPA 4PO1A 3FWYA 2NO6A 2I1VB 1FOEB 3BIFA 5KNCA 2ZJ5A 2IUUA 4PFSA 3TIFA 3GEEA 4FN5A 4BEBA 1VTKA 3AKCA 4E09A 2GF9A 2EFCB 1UBCA 2CNWA 4RZ3A 1A4RA 1M34E 4BLOA 3BOSA 1O3YA 4M1WA 4DSUA 4FCTA 2C8VA 1KK1A 2BMJA 3QIAA 5JJLA 1T0HB 2CL0X 1L7VC 1E2JA 4Q03A 5FBRB 4C30A 3NH9A 4GMXA 1UBGA 1US8B 1CKEA 1GP2A 4Q1CA 1E94E 1ZM2A 4OYHA 4WZBE 2A78A 3U3KA 2OESA 3SI7A 4YMVA 2CEAA 1G8FA 1ZIPA 4Q02A 4XD7A 4R98A 2OHFA 4P0TA 5DLQC 5EUQB 2O8FA 2GEDA 3K70D 4BASA 1KK2A 2MSEB 5CB8A 4ARZA 3AVWA 1QG4A 4QHTA 3B5JA 3WBKA 4OI2A 4TMZA 4AYXA 4MRVA 1JPJA 3IDQA 4PO8A 3TAUA 1W2GA 4EFNA 4I1SA 2QSZA 3D31A 3QQ5A 4TT3D 4JMPA 5EE0A 4EQ6B 2CJWB 1WBDA 4N0EA 5DN6A 2V3CC 1LY1A 1Z2CA 1E2NA 2REBA 3THYA 1Z0FA 3L82B 1MO4A 2YHSA 1QHSA 1RRGA 2LKDA 3QF7A 4A2QA 3AV0B 4D81A 2Z6VA 3N2IA 5SZJA 4OJQA 4RCZA 5AJVB 3PUVA 3T1OA 2IYZA 1E2DA 1H8HA 3ASYA 2WZQA 3R9IA 5JCZA 3UG6A 2X19A 5LB4A 5DHFA 3TSOA 3VR4A 4XWOA 3QVVA 3MFYA 2J1LA 4Q19A 3HPQA 5J47A 2PCJA 1KZGB 5EZ6B 2GXAA 3LWNA 5FL3A 2F43A 4FIDA 2JLUA 1T6NA 4NYMR 4B3GA 3SBDA 2C9OA 3B8HA 3HDTA 5K8UA 4TL8A 2L0XA 4QBHA 5HPYB 2FV8A 1N6OA 2KRKA 3D8BA 1S3GA 3ECCA 3H0KA 3H2YA 1QDEA 1MOZA 3P32A 3KKNA 4XOIA 3B82A 4OK6A 1NMYA 3FFBA 1D6JA 1FMJA 3W9YA 3ICEA 1F48A 2BIFA 1H8EA 3TBKA 2VPPA 4QJ4A 3BWDD 4PO9A 1KMHB 4TLDA 4Z1MA 1BKDR 3AVXA 1R0YA 1FNNA 4RFSA 1DG3A 1EX7A 3FDIA 1G3QA 1XWIA 1YZNA 4DLZA 1P62B 3CZQA 1N2CE 4GT1A 4NCIA 1RRFA 2ERYA 4JL8A 4O0MA 3ZQJA 4M8NE 5L3RA 5FOVA 2VTKA 4NZYA 1VCIA 3MMPA 3TLXA 4AK9A 1GWNA 1KO5A 5SZIA 3CONA 3I5XA 1EFRA 4YXWA 2Z0MA 1KSJA 1L2TA 4M22A 5HE8A 1RRCA 1V43A 5B2ZA 1KI7A 2CCKA 3B60A 4US2R 3KW6A 2PZFA 4Q48A 3OF5A 4Q9JA 2WJYA 4TMXA 3WMFA 2DWQA 1SXJA 3WRYC 4ZKDA 2OLJA 4BRWA 2A9KA 3QF4B 1P3JA 4LBWA 1P72A 1KKLA 2QAJA 1IN8A 4E5UA 1DO0A 2ZU6A 2Z43A 5CM8B 5A4JA 2IW3A 1F60A 5G40A 4HLUA 5F9FA 2OFXA 4FMCF 2QE7A 3BS4A 4JVSB 5L3QB 5J4KA 1D8TA 3MWLA 2HT6A 5FL7D 5M04A 1OE0A 5JI2E 2EFHB 4NYJR 1CR4A 3CRW1 3L0PA 4QBFA 3FMFA 4UNPA 2ZM5A 2JLXA 1N6NA 1N0UA 3UIEA 2CCGA 5DHAA 3Q7QA 3OEEA 2J87A 2WAYA 4ZI3A 2C03A 4D6PA 4FWDA 3SJBA 2GCOA 3DKVA 4Q1EA 4PZYA 2HYDA 4Y0VA 1IOZA 5IHPA 1DAIA 1YRAA 2WVJA 4XSHA 1N5KA 3T5DA 4LJ8A 1QBKC 1XB2A 4DC9A 2GKSA 1VMAA 1XCMA 5F9HA 3LBNA 2QAGB 2REOA 1S2MA 2V6IA 2XXAB 1BYIA 2ZYVX 1XF9A 3PUWA 4MITA 4XH9B 3PEWA 3A58B 3DMDA 4M1SA 1U0JA 5DNYB 1JR3E 1KKMA 1Z3IX 2WOOA 2GXUA 2NOAA 1TUEA 2V8OA 5A5GA 1JJVA 4OQMA 1G6HA 2PT5A 3AVUA 2N42A 3AVQA 2RGNA 2RKOA 3EZFA 4IVRA 4MKHA 2B7BA 4ZCIA 2V7QD 5B30A 5KOYA 2FZ4A 3AVVA 3N70A 4KVAA 1SQ5A 3EW9A 2XJ4A 2PZEA 5BN3A 2LWIA 3RC8A 2JEOA 1YR9A 2CVHA 4QL3A 2CL6X 5FOTA 3TVDA 3VR6A 5B64A 1IN4A 3HU2A 1Z6TA 4BWYA 2ZXUA 4RD0A 1R10A 4D0GA 2DZNB 3N5CA 5TB5A 2WSMA 1E9RA 5P21A 3FHTA 4KYUA 2ODBA 4Q9LA 3T15A 3T06B 4LJ5A 4KFRA 1E3MA 1DAGA 3IIJA 1I4DD 2ORWA 5GJWC 4QGAA 5FUWA 4KHZA 2EWVA 4DCSA 3GJ3A 4DDUA 4QKQA 3GJ7A 4MYHA 3U44A 2OFWA 4ON9A 4TLAA 1TU3A 4G0NA 3K70C 1XD2B 1W1WA 2J0VA 3QI2A 3A1WA 3AF4A 3MLEA 5DYIA 2OM2A 4O25A 3GEHA 3IIMA 1EGAA 2V55B 1XTQA 3OEHD 4OHXA 3DKPA 2P6RA 4D4MA 2Q3MA 3CRMA 4YMWA 1T3LA 2FEOA 1R7RA 1AGRA 2CE2X 4XVUA 2QRZA 4C9BA 4JJZA 4OKSA 3MAAC 5FTKA 3E70C 5ELXA 4TMTA 2IUSA 4WBSA 4WA7A 4MRSA 4HB3A 4JKYA 3RSOA 1FP7A 1UBFA 3OHMA 2IC5A 5D3MB 1KGDA 5HCIA 5KO2A 1GG2A 1T0JB 2C96A 3RSLA 1Z6YA 3AKDA 2V54A 2AXNA 5CITA 1OLOA 4Q4HA 4QGHA 3TH5A 4KLZA 4E22A 5KHOC 1KDRA 1KI8A 2KB0A 3EZ7A 4LPKA 2J0QA 1ZYUA 3ZQ6A 3LO5A 4KITB 2FSHA 2GZAA 5KDDA 2NZJA 1F2UA 5KYKA 1BYUA 2PLRA 1W2HA 3NEYA 1NVUQ 4JZKA 1A5TA 2VP9A 2WBLC 1QHXA 1ANKA 1R5NA 1R5BA 2DYKA 2ZRKA 3BFKA 3IPXA 4PAMA 5IK2A 4ZKEA 1NBMA 3MWJA 4NE2A 2HLDA 3M4YA 4HUQB 2AXPA 2GXQA 4Q9HA 4KBFA 2O8BB 2BMDA 2QENA 3O8RA 5E3HA 1P5ZB 2W2TA 2BKUA 3A4LA 2X2FA 2VSFA 2BKEA 2VL7A 1DO2A 3GJXC 3GPLA 1KTVA 5AJWA 3H86A 3UXMA 1OH6A 2UZIR 2DY1A 4DSTA 2VQSA 2GXSA 1HE8B 1K8RA 4GBMA 1AN0A 3SYKA 2IA5A 1NY5A 2XZPA 2NPIA 1M74A 1HE1C 1JXOA 3HR8A 3HYRA 1W4BA 1J7KA 2OBLA 3ZJYA 4CGZA 2FFBA 2Q9AA 1LF0A 2D3WA 2J45A 4AIIA 1HT1E 3QKSB 4G5OA 1Q22A 3BH6A 3LQRA 2FGKA 4B71A 1XX6A 4DIDA 2W0SA 1W36D 1TU4A 1S1MA 1JECA 1W0JA 3SE0A 3GLIA 1NVVR 1QG2A 2GEUA 821PA 1UKYA 2ORIA 4G1UC 3AJIB 1U8YA 4XWKA 3RRMA 2B8WA 3CM0A 1I2DA 1DAEA 3FYHA 1G5TA 4CEJA 4HAUA 1LNZA 1N6LA 4TYPA 5J4HA 3K0CA 5E95A 2D06A 4ZDWA 2KJQA 3VKGA 3KX2A 2H57A 1XDBA 5ANRB 2OG2A 1RIFA 2OCYC 4Q4AA 4GITA 1KDTA 1R2QA 2D62A 4ZIRB 4G3XA 4Q1BA 2O8EA 4DT1A 4IDHA 2NO0A 4EPTA 4WXRA 3T34A 1XMIA 2QORA 3ZIAD 2QPAA 2Y8EA 2EFEB 2RGXA 1HUQA 1NKSA 3CIOA 3KUDA 3BRWD 4LYFA 1DG1G 4OQFA 3RABA 2X77A 2GBLA 4A15A 3F5FA 1G5RA 3QEOA 4MYCA 5BN5A 2HJGA 2FFQA 1W4RA 3VU9B 4KLNA 2QUZA 1CR1A 5AJXA 2GWHA 2YOFA 4Q9IA 2G9NA 3M6AA 1TADA 1UEIA 2PJRA 5UKDA 1G3IA 3A4MA 4URWR 1UADA 2ZR7A 1N6PA 4C0SA 2OSBA 2CMKA 2A5YB 3SQWA 4TZ6A 2ODEA 1TX4B 2P67A 2W2VA 3QKRA 4OHWA 5FR1A 4GOJA 1VHLA 3GLHB 3QXCA 4CIDA 221PA 3K0FB 1YZGA 1OIVA 3ZVLA 5FBVB 5CDFE 4NCNA 5FOUA 2CLDX 4I4LA 2D2FA 4JLNA 4BUJA 4OI0A 1NF3A 4R9UC 1GKUB 2CHGA 1OFUX 3F3YA 4PHGA 4QHYA 3VNUA 2GHIA 2JASA 3E2IA 4Q4JB 2OLKA 5JWRA 2ANBA 2QTFA 2YNMA 3KTAA 2BJWA 4NHOA 4IVPA 5JMTA 4MKIA 5JJKA 2UZ3A 1E0KA 1X37A 1TF5A 1VG0B 4F92B 3ZD7A 2P3SA 4IW3B 3AH8A 2R6CA 4MH0R 1IXZA 4L4UA 4IOKA 5EQTA 1Z28A 1GZSA 1G20E 2HXYA 5KTYA 3I4LA 1V5WA 2XZOA 1W47A 4QC2A 4Q1AA 3Q5EA 1CS4C 1HQYE 1D9XA 2N1BA 2NZ8A 4HB0A 2ZRBA 3BB1A 3T35A 5FBWB 5FPKA 1OXTA 1U0LA 1WQ1R 3GQBA 5BWMA 5JWHA 5G53C 2Q0HA 4UXJA 3B1ZA 2ZIAA 4FW9A 3AVYA 1YHNA 1HY3A 4Q18A 1LFDB 2CK3D 3CPHA 3SFVA 3SJCA 4YMUA 2ZR0A 4V0OA 4LBZA 1BO6A 3JZAA 4PC1A 1KO1A 5JJIA 1E2IA 2H18A 5IDVA 3WNDA 4DEYA 4BZPA 1GL6A 4RKFA 4V0KA 1GITA 3OFND 3THOA 2YJTD 4G5RA 3K0EA 4GP7A 5EE9A 1JQJC 2EQBA 4KU4A 4XVRA 5FOSA 2X2EA 4JLBA 1P9RA 3OAAA 1U2RA 1W0KD 2XNSA 1ZM4A 2WSSA 5AUPB 4K81B 5L3SA 3QXXA 4KCGA 3R8FA 4B73A 3GJ0A 1GL7A 1DADA 1GNRA 1GVNB 3OIYA 5H1YA 1E96A 2VSOA 4MGIR 4OBEA 3O8BA 4Y0AA 2AWOA 2WJJA 3U3JA 1E9DA 4DHEA 5EE5B 2V6JA 1GNPA 4RD6A 3FE2A 2VF7A 1E2QA 1W48A 2FFHA 1QHGA 1W7AA 2OV2A 4A36A 3MWYW 2CL7X 4EFLA 1P2TA 4LSGA 1HTWA 3D6TB 3W6NA 4DCUA 5C4MA 1NN5A 3EIQA 4V03A 3REGA 1BIFA 1Q3TA 3I3SR 4Q5IA 3EC2A 3L0IB 4MYUA 3KQUA 3LQQA 3SEAA 4YQFA 1SVSA 2RGDA 4BFXA 1NY6A 5JLJA 1CF4A 2ZRDA 3HPRA 2WWYA 3THXB 1GUAA 3VR5A 3KJIA 5KNBA 1MO3A 4RZ2A 4C2UA 4X8MA 4AKEA 5EXSA 1E32A 1FQKA 2J0SA 2WWXA 1KI6B 4M53A 1FW6A 1G8HA 2P5TB 2YWHA 1ZCBA 1AS0A 1R8SA 2R65A 2VYFA 4UJ3A 1GOTA 2FPLA 1T8UA 1W36C 2W58A 1NLYA 1N3BA 4KVGA 2IYWA 3UMRA 5JHGB 1Z07A 4HZUA 3OE7A 1IY0A 1Z0DA 4MGKR 3P26A 4LI0A 4MGYR 3X1XA 4EPWA 2W0MA 1E69A 2J7PA 1IQPA 1DAMA 1OF1A 1YJ5A 2CVFA 1FMLA 1VIYA 1W46A 4JLPA 4OQNA 3C7KA 1N5IA 4DVGA 1UKVY 4IXNA 2C77A 1OKKD 3K0AA 3VX4A 2QEQA 3EZ2A 3P4YA 4HATA 1EK0A 3TMKA 3A37A 4DUGD 3A4NA 3PENA 1N0VC 1A2BA 1JNYA 3A1UA 4EJSA 4BFVA 4ASUA 2DCUA 2IS6A 2BBOA 1NN0A 4CEIB 4Z8YA 1U0HC 3L8YA 4BLPA 1UKZA 4PHTA 1XTIA 3CRQA 2FSGA 2HUPA 3CKLA 5JS7A 1L4UA 2O0JA 1XCPA 2BCGY 4FCVA 4IJMA 3GFOA 1LB1B 3T12A 5JHHB 2JJ1A 1A82A 4DLYA 4DEXA 2WJGA 4CRWB 3UG7A 4AURA 4B3XA 3CH5A 4E07A 3LA6A 4MDFA 3TSZA 2GETA 3QPVA 4M9ZA 3B9PA 4U02A 4E03A 3OIUA 4TMWA 2XOKA 1BMFD 4ZDIA 4A9AA 1UM8A 4B3BA 3L0SA 1D2NA 1NRJB
chains in the Genus database with same CATH superfamily
2UVQA 3KVOA 3B6IA 4X1KB 1QQ7A 1JPNA 4X7RA 4QUEA 3P2JA 4DMLA 2FWNA 2ZTVA 2C3YA 2ASEA 4QXMA 4D0NA 3ISVA 2WT4A 3NS7A 2HGZA 4YCSA 4FHDA 4BB5A 2Z1NA 1NNI1 3AQ4A 1BEZA 4XCQA 3HKPA 1L4NA 4G81A 1EFVB 4MB0A 1CG6A 1JYSA 3E1KA 5C7IO 1W44A 5G4KA 1T25A 2GEVA 3AIIA 3HCCA 1FNBA 5F5XA 2O0MA 1ZMXA 2P9GA 3LHIA 2JD2A 3AVPA 2PX2A 2OY0A 2Y20A 1GM5A 4UD2A 4PCUA 4M9SA 2P62A 3ELBA 5KWIA 1DHTA 4D82A 1TZ2A 2EAUA 2TMGA 2B8NA 1X7HA 1OFGA 2CMDA 1T5TA 5BNTA 4QXPA 3V80A 3GD7A 2TYSB 5EIBD 3FRIA 3CF4G 1XHLA 2VPWA 3CRZA 1JH9A 4I5DA 3ZD6A 2HREA 5IPFA 3PC2A 4HO1X 3OFSA 4ABTA 1GKIA 1HBJA 2FJ0A 1B8NA 7YASA 2P9FA 1NG9A 2W70A 4YRBA 4RL6A 3ZGOA 3N6XA 2VVTA 1JV2B 3SGLA 5JBQA 4A26A 2FEMA 4EY5A 2WTBA 3ZDFA 4HLNA 2PWBA 1E3SA 1MIOB 1RDFA 1Y8CA 3ZKWA 2WIFA 4LZNA 5CLJA 1DAOA 4PC3A 2AYXA 4QBIA 5EKSA 3L1UA 2C4HA 3W4KA 3AM5A 3NHPA 4A92A 2NQ8A 1YIDA 1U8AA 4QRHA 1EFRD 2I78A 4UHJA 5FH9A 3VR5H 2VQEB 3WLIA 3TCNA 5KNBH 4XTRA 1YUBA 2XXBA 1N9ZA 1M76A 2NZXA 5LZ7A 5KYTA 4OOEA 4AJEA 2YS6A 3NTLA 1R0CA 4EW6A 2YVAA 1FPMA 1CE8B 3EX7C 4TXMA 3UC9A 4EWLA 1IMJA 1ZCZA 5B3JA 1R0ZA 3JQ7A 5JIBA 2WR8A 1DBVO 1U04A 4RDXA 1ZN8A 1C7FA 4I1IA 2WM3A 4FYVA 5DX8A 4EHDA 2GF0A 1GQRA 2Y1CA 1BHJA 5D7BA 3K5WA 5C51B 1D4FA 2P2CA 3FNHA 3CSUA 4L74A 4LJ9A 4MIOA 3N0XA 2H1RA 3TD9A 4DSZA 1CS0A 4YAIA 1LS1A 4CEHB 3EYWA 3AI2A 2BGIA 1ND6A 1XMQM 3SQMA 5G3ZA 3REOA 3MINB 4GPBA 5B6IA 1CF9A 3KZ1E 5CYPA 2RG7A 4DRYA 3SBOA 3A06A 4MI9A 4WPGA 1Q92A 3IULA 3TLBA 1SUFA 2W6QA 2ZS8A 3O0TA 2IK8A 4CDGA 3UPTA 2DWPA 4B79A 3O4RA 2Z4SA 4UNSA 1OAOA 1I33A 1G291 4NBKA 1SQ6A 1RABA 2BBTA 3AGPA 1O58A 3IOBA 3NHRA 3K6JA 2KWIA 2JVKA 3ETEA 5COQA 2J9YB 1Y9DA 3I6IA 1L1QA 1H69A 2EX4A 3LT4A 1RYYA 1HL3A 3B7WA 3QU4A 4LF6M 1D03A 1NV9A 3Q87B 5FLXA 4ZI7A 4NYIR 1NATA 4AXBA 4OXYA 1GZ5A 5ER9A 4E4YA 5BQ3A 3O4FA 3SVZA 5SZHB 1TQ2A 3K9GA 4P31A 1RJ9B 3DVQX 3RJ9A 4LNUA 4GX2A 1M5RA 4L3WA 4HAYA 3N9IA 2Q3DA 1Z5GA 1QHYA 4RKQA 4FYIA 4HXFB 2Y0DA 3SKYA 1W6UA 2ZUSA 2MIIA 1K9VF 2OBBA 4DNXA 1HLDA 3V9AA 2A5JA 2YYZA 3V34A 5HW0A 3X2SA 3IV6A 5B2FA 2VUIB 3G6KA 5FUYA 3DM9B 1FS5A 5CA1F 1H4QA 4G8JA 1XRPA 3HZOA 3E5HA 3BWCA 1IQRA 1C0IA 2WYUA 1ZVKA 3AJ8A 3S2SA 3SR0A 3E7PA 4R9SA 1XPJA 3C8DA 4WEQA 1YI8A 3GDHA 2VDUE 2JLQA 4BFSA 4GOND 1JIJA 2PO7A 1C7EA 4M1TA 2OLEA 3IO3A 1UM9A 4EB8A 4WESB 5B3AA 3ZNNA 1CIVA 4AS1A 2I6SA 2GQ0A 1V6CA 1K2VN 3URKA 2CWBA 1KJ8A 2QL7A 2GN9A 2O8BA 3BC1A 4GHAA 1EJ0A 3EEBA 2DLDA 1ORYB 1X86B 3H6GA 3O8DA 2IU0A 2DUUA 1Y6JA 4H1VA 2IOYA 1YASA 3M2PA 1QPZA 2AJLI 3QU7A 3R6WA 3NIGB 4NXNB 2L2DA 1U7TA 4BX3A 3KJQA 1QH1A 5IANA 2WIGA 4DY4A 5ECWA 1NE7A 1OXBB 1GIAA 1SXJB 4LF7B 1KVUA 2FZLA 4UM9B 3MJHA 3T7CA 1R8QA 3ZVMA 3VM6A 3K2IA 3RTGA 2GVZC 3U19A 2BDEA 1AA9A 2O4CA 1VL5A 5CIWA 1P4JA 4QLOA 1AKMA 4BO3A 2QQ0A 3U80A 3LZDA 1E79D 2LZ0A 4HDAA 4DMFA 1NYTA 1RE0A 2OTCA 3GFGA 3L7DA 1QONA 3JU3A 3FCUB 3WB9A 3ZLUA 1TOAA 3T1HM 3LKDA 4TQ9A 1LX7A 3PHJA 1ISJA 1V16A 2JY8A 3U44B 3R77A 1TJPB 2Z2JA 3WQRA 4E5NA 3QLUA 1VRVA 4XFKA 1TPYA 5DK4A 2Q99A 1JHUA 3EPPA 3NNSA 3S6JA 3ZTWA 2VK4A 3HSKA 4OBXA 1U7DA 3LBAA 1WP9A 5JEEA 2OCPA 1GRQA 1J21A 2ZRNA 1CUIA 2PZJA 1N33M 2Q27A 5JY6A 3INRA 4F21A 3B1WA 3LKVA 1KJWA 2RJ3A 1DIAA 1U3WA 1CRQA 4KAAA 5H4HA 4ARAA 5FTWA 2WJIA 2PNFA 2JHCA 2AOTA 5DFAA 3GG2A 3A0UA 3KLNA 2ZWIA 1VPLA 4GKJB 4ZAGA 2Z08A 2ZJBA 2V6GA 2I6TA 1ZONA 1PG0A 3V4FA 2BF7A 4UUNA 3GPXA 4MRRA 1P7PA 4DSAA 1EGHA 1N92A 1U0OC 3QYAA 1ESNA 1UPTA 2LW7A 1GPWB 2AT1A 4CT5A 3LT1A 1J8YF 4R2XA 3RYHB 3AWDA 1GFIA 3JPYA 4NBSA 3BJIC 2O8EB 2FPUA 3LFUA 2I6QA 2PEYA 2HAEA 2AMFA 2V4ZA 1U6KA 3EGWA 4DV2B 3EZGA 3IKMB 1ZMBA 4MR8A 3LDAA 1EXVA 3AJAA 1WHCA 2QE7D 4UAJA 3P20A 1UJ2A 4FEAA 2ZR8A 3FNQA 4P80A 1SAYA 4EF6A 4PM4A 2Q1WA 1FFAA 2EFYA 2AFIA 4HGPA 4U6QA 4MA4A 1UXIA 1EFKA 1RWWA 3W5BA 5EYPA 4Z7QB 4OTZA 4CR7A 2IOFA 3ZDCA 4RX1A 5KDOA 4MVYA 4CM3A 3C41J 2H48A 5BWCA 4G1FA 2EBWA 3ENVA 3KXEC 1DG9A 3DEAA 2LNHC 2VAVA 1X74A 3QXSA 4OHFA 4GOXA 2VEDA 1B2LA 4ZV4A 2GD2A 5I7FA 2J6HA 2WIAA 5TLSA 1PR3A 3FSGD 4MLZA 3AL3A 5MN6A 2OBNA 1E0SA 1D4AA 2NUAA 2HIMA 4G0ZA 3W1VA 1CQWA 5KMGB 2QVBA 4IHJB 3MGAA 4MRPA 4F8YA 2JGDA 4LJ6A 1RWQA 4HZUB 1XZPA 1RRVA 1IY2A 3ROEA 4YMSA 1XEWX 1M73E 1W4AA 3SIXA 2DGDA 2Z6QA 1MD9A 3FWNA 1N34B 4RJ2A 1W9HA 5F52A 2OXRA 2Q4DA 2QG9A 4LCJA 1XBTA 1CUXA 4I0WB 4DV7M 3V97A 1TVKA 3NBFA 1MTZA 5EXPA 2Q46A 1U99A 4ZOLF 3BSFA 4C6TB 2GN4A 6PFKA 4WZAA 1H1TA 3PX3A 4F4DA 2EU8A 3ZPXA 1K89A 3PGJA 4RKWA 1IHDA 3MD9A 1ISFA 3I9FA 2DAPA 4MV4A 1I5OA 3UY4A 2ZJ6A 1CJKC 2W2KA 4WZZA 1GA6A 3S2IA 4MGYE 1MENA 3CH6A 3ONWA 3LTNC 3VKWA 3CZMA 1UAGA 3T7EA 4S3MA 4MW0A 2JJ2A 1U3CA 3WLRA 2XODA 5KJCA 4G24A 3GCDA 4HG2A 4ZCTA 3LS2A 3WGVA 1PZGA 1A96A 3EVFA 3OQPA 2O1EA 4MUNA 3Q7RA 4NSOB 4AJHA 4L2IB 4ZAWA 3SAWA 4M1YA 4AUMA 4BCDA 1YUNA 2FH5B 2GYWA 2QNBA 5ALIA 1J06A 4YJ3F 1IY9A 2QG4A 2VZ9A 1SCDA 3DYBA 1CJMA 3PPWA 1JW9B 1OA0A 4EKDA 2R0QC 4BYGA 3LK7A 3T1YM 4YRDA 4XIJA 4M0PA 4NP6A 4M9UA 3LLUA 1DRVA 2CDCA 2E4ZA 4HWPA 5KPZA 3R4CA 4RGBA 4L27A 3SF8B 3N76A 4JYCA 4HS9A 3A6KA 1PGOA 2QZSA 1VOTA 4UULA 4BLRA 3JARB 3O47A 3JZFA 3HJGA 4XBOA 2A30A 4JA0A 3L2AA 4CM5A 3E4CA 4PDGA 1Y9EA 1Q1BA 1T9ZA 1E99A 4ML3A 4RYLA 4ZIRA 1OJLA 4JR1A 2V1UA 1KEEB 1Y6ZA 5DLDA 5J2UA 3NR2A 1DAFA 1D6NA 1X92A 1I51A 4P9NA 4NU5A 3O4VA 1A9XA 2AFVA 2PPLA 2EKZA 4ZO4A 5COAA 1S2LA 4OX9Y 1JXMA 2C5AA 4WFKA 5FULA 1E0JA 2J5XA 4M8IA 2CKDA 2Y1LA 3AUJB 3SSAA 4C78A 3FWYA 1NE2A 2R00A 5AM1A 2IKSA 3ZWBA 1UBCA 2WSEF 4LMBA 4DNOA 1A4RA 1AUPA 1JSZA 3I5MA 1HNXB 5CXXA 1Z88A 4MW9A 5EMKA 3PC8A 4XWTA 1K3WA 1A4UA 3Q0TA 1B41A 3ZNQA 1RR6A 1X19A 4R98A 3BJZA 4ZAVA 2JNWA 3ROZA 3LPDA 4TMZA 4FYKA 3Q6MA 1QORA 4JMPA 4E51A 1Z0FA 3BQNB 4PBTA 3NASA 2BSXA 1CZNA 2MOKA 4UVHA 2GLTA 3JQ6A 4JI2M 1LGYA 3AMVA 2IQIA 3LCUA 3ASYA 3GJTA 4UEKA 3K2BA 4CLDA 4XWOA 2V5UA 3LECA 2YJ6A 1FVHA 1T6NA 4B6RA 1IWPB 2L7IA 4IGFA 3V8EA 2ZDGA 1MOZA 3TLGA 3CGWA 3TRKA 1D6JA 2JFHA 3WZ2A 1OI7A 2VPPA 2E85A 4LDRA 2BUCA 4YRRA 1KH3A 4FGLA 5KOHB 1EVLA 3AX6A 4JL8A 4OAOA 3L6EA 1MDFA 4QX6A 3MMPA 3HADA 1GWNA 4FZRA 3PHGA 4RKYA 2ZUFA 3DT8A 4NOMA 1KI7A 4Q48A 1VFNA 3WRYC 3B8EA 1QIIA 1B6RA 2HW8A 1I4EB 4K0KB 1HWYA 1T4CA 1CR4A 4IJWA 3WXBA 4E5MA 5J5VA 4JODA 1RPJA 4EW1A 1DAIA 1R0LA 3U0BA 4D43A 3OE4A 4DC9A 5F9HA 4WY5A 3LBNA 3AI7A 2N3ZA 2XXAB 1DCFA 3R40A 4O4IA 1KKMA 3KZOA 3DE1X 2GXUA 3AVVA 2J9FA 4WOBA 3B9RA 1SOWA 5HXAA 1LI5A 1GTMA 4KFCA 1TFRA 4MVWA 2ORWA 1NJ1A 2F3UA 1PK8A 4DDUA 3ABZA 4QOFA 4PNPA 1T29A 1KVSA 1LDYA 3WOHA 1RQGA 4R1MA 3CRMA 4NK4A 5AW7A 4OV6B 3DUWA 5FIUA 5LZ5A 5KX5A 3MAAC 2I8AA 1UBFA 1IHYA 1L4GA 3GAMA 1AURA 3NHWA 3VNQA 3AYZB 3LO5A 3WAKA 1ANKA 3SHTA 1Q84A 4TV8A 1YV9A 1A8UA 5ES3A 1DJLA 3FTNA 3B3JA 3WWZA 5KWEA 2YVQA 3ICVA 1TRHA 3D3JA 1XELA 1TUBB 3LOPA 3MYYA 5JDIC 1YQWA 3GT7A 4UM5A 4B5LA 1GLGA 1LF0A 3FA2A 4S2UA 3IAHA 3BH6A 1QE0A 1TU4A 3VTZA 2D5BA 4P2GA 2Z5GA 1QV7A 4K40A 1PN3A 4JXKA 1A9PA 3W77A 2DUMA 3ZD9A 1JHPA 3DYVA 4FVMA 1KDTA 2HMTA 5M29A 1ZZEA 1R6XA 3C7TA 1XMIA 1HYHA 4P6VF 4LYFA 1DB3A 4RIGA 3TW0A 3AXTA 5C7YA 3I2JA 3KDAA 3TZBA 4RTKA 4E1BA 2PJRA 2OSBA 1WHSA 5AHKA 4EUFA 3QKRA 2PU5A 1VHLA 1I3MA 2Q1UA 2E2WA 2JGEA 1KJIA 3V8NA 2Y71A 1G5FA 2C97A 1ZEJA 3BSYA 3L8HA 2X5NA 3ZV3A 1Y82A 1PFKA 1BX3A 3T5CA 1TF5A 1X37A 3BIOA 4L78A 3HSSA 3B52X 3VK8A 4R2KA 1U9YA 4DJDC 5CP8A 3D7RA 4YT2A 3E8XA 4D57A 4FW9A 1HY3A 2WU4A 2H54A 1Z5CA 3WL8A 2QM3A 2VJAA 5TGTA 2RFLA 1N8TA 3KQMA 1N1EA 2J30A 2J3QA 2WB2A 3OE5A 2OMEA 1P9RA 3OAAA 4MCAA 5JZBA 4REQB 3K16A 2C4UA 2X8BA 4LMAA 4MGIR 2R46A 4OBEA 3OZFA 4Y0AA 3U3JA 1SEVA 2XHZA 4DHEA 1E1DA 3FE2A 4F9FA 4PYNA 3QVWA 3ANSA 4JEUA 3V7WA 1NBHA 4JC0A 1SVSA 1UZNA 3HGQA 4MW4A 1A4XA 3RVLA 4RZ2A 2X5XA 1RAEA 4X8MA 4MRMB 2LE0A 1HG1A 4QYTA 4JYZA 1NLYA 5JHGB 3RC1A 4N01A 4ZOAA 4BKMA 2YYYA 1FYVA 4OQNA 1OKKD 2V6MA 5FSWA 3KQVA 3FZEA 1JNYA 3PE6A 4BFVA 4LJLA 2JGFA 4PHTA 3TB4A 2B8JA 3FDZA 2O0JA 1RHRA 4IJMA 4W6QA 1NWHA 3ESDA 1HTBA 4IF6A 3D2LA 1K6IA 3LA6A 2GETA 2J4DA 3B9PA 2IVFA 3WO0A 1SWVA 3L0SA 4LDAA 3LVWA 1G5PA 4KEAA 2HCBA 3EFEA 1CZOA 4K87A 3NUZA 1X3SA 3VKUA 2B5OA 2GK6A 2Q3HA 4Z7OB 3CRVA 1NYQA 4EPVA 3QKWA 1H2EA 1UL1X 1L1ZA 1YONA 1Y4ZA 1A9TA 1IOLA 5CNIA 3HDHA 4GL4A 4TL7A 3ZUGA 3GGDA 4MV0A 4QM6A 5HIAA 2E4UA 2R86A 2FSUA 1Q2UA 1OI2A 1S8FA 2B7LA 1U8UA 4LBVA 2VQFB 3ZWPA 2VHWA 1J00A 3G0IA 1C7JA 1JI3A 3R4VA 1IN7A 3A98B 2ZBKB 1C3VA 4QM7A 5CNKA 4K1LA 3SS8A 1YCHA 3SJAA 1VG9B 5KNCD 5KVCA 4BLVA 3KYCA 1ZMRA 1YF3A 1K6XA 4P7FA 4RVGA 5LBTA 5T4BA 4MWSA 4GMKA 2X8AA 4S12A 4EARA 3NEAA 4HGQA 4QULA 4TSKA 1EVQA 3A10A 4TXHA 4UD6A 4RJJA 4DM3A 1UMBA 4BP9A 4DG9A 2VLIA 3ER6A 5K3FB 1IJEA 2PBRA 3BB3A 4OSOA 2RK3A 5KIAA 3RB8A 3CNLA 1USUA 4BFYA 1F3OA 4YRNA 3EA0A 1AMNA 1P4SA 4BNWA 2NO1A 2RH5A 5HJEA 1R4NB 1A8HA 2LIVA 3MNFA 1H3NA 1LW6E 1E1CA 2SKDA 2IDKA 2V7XA 5A3RA 4LF5M 3P0IA 1N2SA 1ZGBA 4NZ9A 2WWFA 2OC9A 1SKYB 4LJRA 1V5EA 3IT1A 4E0BA 4BO6A 2C5SA 2P3QA 1YKGA 3V42A 4B74A 4IQ4A 3K9LA 3IVXA 1MO6A 4LFCM 3WYCA 3DDCA 4D9NA 1WR8A 1J1UA 1R0WA 4HFJA 1D2MA 1NR5A 4KC0A 4FLEA 4CLRA 1L1RA 5KYWB 1HQDA 4F11A 4KQ2A 2EL7A 3K9BA 2WC1A 5FPYA 4EHHA 2YY6A 2YN2A 1K6JA 1QX3A 3E05A 1NU8A 1Z6XA 1Y5LA 5FWAA 3AI3A 5CD9A 1Y7PA 4FWHA 4DLUA 4P92A 2YYAA 1G59A 2I03A 1QFZA 1QSGA 2DT5A 2MSWA 4UM7A 5KC9A 1YTLA 4I50A 3AP1A 3ESCA 4X90A 2PRJA 3FYUB 3HO8A 1B1AA 4AECA 4OHZA 5U4XA 3VJMA 2JLAA 1NU6A 5AT1A 5CX1A 2JY6B 4BCCA 1WB6A 1Y4AE 4KPUA 3BXZA 4F5ZA 4R0MA 3PKJA 4QYSA 1QZMA 4L4XA 4BO9A 3C8MA 1GU0A 4HYTA 4K9RA 4BEVA 3SD7A 1EAMA 5TGDA 2G7ZA 1GAWA 2NP7A 1FPQA 1E66A 1XVIA 3UQYS 1W9MA 3TQFA 1EUCB 1GAQA 4HADA 1K7FB 5AKXA 5AK5A 2XYGA 3OHSX 2GQFA 1CFJA 5TF4A 2D7JA 2ZYWX 4RTOA 5MGNA 3MQ4A 4KN6A 1G16A 2HGSA 3GJ4A 1L7DA 4CTMA 2P9CA 3S55A 2C58A 1LPBB 4PCLA 4S1OA 2BGTA 1DQRA 2XAAA 3UTCA 4TUWA 1XZGA 4A6PA 4I4IA 4WKPA 4P7JA 4FKMA 1Z12A 1ZWKA 1TT5B 3I12A 3HCDA 1HDYA 1V33A 5C5CA 2AW3A 1XHFA 5LZ9A 1AQNA 3O3NB 2CGEA 1YOVB 4RTLA 3MK6A 1UBEA 3P9KA 3WADA 2NZVG 4KTTE 3BBPA 2QF7A 1O89A 1O54A 4BNXA 2PUFA 2DR3A 4KP7A 3N2YA 4I1YA 4MQMA 1WDKA 1KY2A 3JQAD 4AC9A 4PVCA 4O4JA 1SUBA 1Y5MA 2XYPA 1MQSA 1K9SA 4UXIA 3THYB 1BQEA 4XLTA 2ZUVA 1E2FA 2A9RA 4Z99A 1SHTX 2PL5A 3OKCA 1M1NB 1GNSA 4LJKA 4OB8A 2GZ2A 1AK2A 1UDAA 5IX8A 4IIJB 5KTTA 5C1BA 1X1RA 1XJ0A 1CZRA 2G28A 3WRWA 2CHQA 5BR4A 4DIOA 2X9QA 3OQHA 3KPWA 3SYTA 1Z4KA 1GTRA 3WRYA 4JENA 1QO0A 5JG7A 2CFSA 1X6VA 3QXJA 3RFCA 1CIPA 5BWOA 3UXHA 4XPZA 1X1SA 1ES9A 3Q2OA 5IDYA 2AEMA 4Y6PA 1G2OA 2DFDA 2HN9A 4II3A 3DEYX 1MVNA 1YJ8A 4NCHA 2IZ7A 2GJSA 1XZCA 1NG1A 4YRSA 4XW2A 1C9JA 2I1QA 2ZJ1A 1T5SA 1NDQA 3B74A 5JCJA 4AX4A 2C2XA 1GZ4A 1XMQB 2QMQA 5AK4A 3H8JA 2XCQA 2P6MA 4CF3A 2C2OA 2FEXA 3CVXA 3HGIA 3LT0A 3KQWA 3GDGA 3FMOB 3T5GA 1CJVC 3NT4A 1CP2A 2PUCA 5K0CA 3UW1A 5I47A 3LVRE 1HNZM 4DZRA 1EFTA 1WP4A 4IFEA 3TUJC 4GRIA 4PPQA 3G2HA 2XDWA 2PLFA 1YJAA 4AZSA 4W1SA 4CMIA 3GGCA 4NBNA 4QTZA 5CG1A 3URMA 1FU7A 1Z0UA 3ELYA 3TFOA 2C98A 4JP5A 4JOCA 3D3QA 2VS1A 4YI3A 4LF6B 2PNJA 3H2JA 3TTXA 1SVWA 5IJ9A 4DMGA 5EJEA 3HV2A 2XF3A 2BE7A 5CGQB 3WR5A 3I72A 4MW2A 2XX3A 3HYSA 4U2BA 1GCAA 1J9GA 3Q0EA 4MYRA 3RUPA 2ZIUB 5LLDA 4KKXB 3LSYA 2A33A 3E2PA 2ZDHA 4IEIA 2X0FA 5IKMA 3SZGA 2JFYA 2G8NA 1O94C 1MHTA 4Q15A 3ZU4A 3VTKA 1UP6A 3BZWA 2QWXA 3ZU3A 3QUTA 2IBTA 3PWKA 1YDHA 1QHFA 4DZZA 3M5PA 4Q4LA 4M0MA 4FMBB 3H9EO 1DLJA 4EJSC 4G9EA 2PH1A 4UDNA 3UWSA 3OQ6A 3TTSA 3CUEF 2R9VA 1ZHFA 2LUOA 5EJIA 1SXHA 4BGVA 5ERXA 5EP1A 1C8KA 2YVLA 5B58C 3JQ8A 4K0RA 3JQRA 5CA0F 4ZCRA 3OEED 1NR1A 1UEJA 2EKBA 2ZJ0A 4NZMA 1C8VB 4PX3A 4QG7A 4Q9KA 4RPJA 2ANCA 3TXAA 3C85A 3ZV5A 1YA8A 1O9HA 2M1XA 2H1LA 2LVBA 4DYHA 4RFVA 4DUPA 1ZEMA 3KB1A 4QASA 1AKQA 5LQUA 5TARA 1UQUA 3QX7A 3BGOS 4Z0PA 4KOEC 3FJOA 2QUHA 2R4TA 4IWYA 2YHIB 3OM0A 3U6OA 2KW0A 2QX8A 3KIPA 1B4DA 4QRDA 4LK3A 4B33A 3Q85A 4CKBB 1QWSA 4R9NA 1HORA 3F4LA 1Y1TA 3AF0A 2VBIA 3KL4A 1IYZA 4XASA 1XWFA 3GD5A 1I3OA 2ZIWB 4PHCA 1IXSA 3I23A 3MHVC 2IEDA 2Y9PB 3U5ZB 4PCAA 3ES9A 4GPEA 3HYTA 5CRIA 4I14A 3GQ4A 1RKUA 3RYFB 1H23A 1UPFA 3EUEA 1V92A 5MDHA 3NFYA 5B1DA 4E5DA 3JZMA 1KYIA 5ICFA 2H5JA 1E1RA 3E21A 4CUZA 2XYVA 1RRPA 3QJYA 3OJFA 2QUKA 4KYIB 4OATA 3U3RA 5IU6A 3T1HB 3JRXA 2IPXA 3DPIA 1MQ9A 4ND4A 5CFMA 1M9NA 2QTLA 1CQJB 2NXEA 4OHPA 1SGWA 2HYIC 1WZCA 1HMYA 1DWQA 4HDSA 4RE5A 3ZVKA 2E1RA 5A4MS 1B26A 3PF9A 4RLHA 2FWJA 2WSFF 2DU8A 1A7JA 3VR3A 5CVEA 4YACA 3OWXA 3V2HA 1Y8QA 3C45A 4YPFA 3B1FA 3ZCSA 4DA8A 1N33B 4YP6A 3ZVNA 3UB4A 4L8YA 3GCWA 3U0VA 4J8PA 4FMDF 2BTEA 1WUKS 1O7JA 3NRCA 5KZMB 1G71A 3B36A 2OR3A 5LUAA 2EKQA 3AI1A 1B0ZA 4BKOA 2QGFA 3VX3A 2C2KA 2AC4A 4HDRA 4OFXA 1NVXQ 4MR7A 4MUMA 3A1DA 1C3XA 2JLVA 5JS6A 4JJ6A 3WGQA 3L6OO 2DBQA 1FLVA 1RBYA 1YR1A 2QRMA 1KBQA 4F84A 3I73A 2AYZA 4OAQA 5KPDA 1TCBA 2N9UA 4R1QA 2A94A 4DCCA 1YRQA 3WWEA 5AUQA 4DCNA 3BF8A 4AP6A 3FNFA 4YCNA 2N47A 2QTWB 5DCLA 3TQHA 1OZHA 4RWZA 1M8KA 2O0LA 1N36M 1NNEA 3EG5A 5K2MA 4P33A 1NLZA 3CTWB 5ALXA 4Z4GA 2RGCA 3DOHA 4RIIA 5CIQA 2FETA 1AO0A 3L92A 2C1ZA 4PWYA 1XPRA 4YAKA 4C6HA 5JECA 4DR2B 5JVDB 3EXFA 3L25A 4AQ7A 3COZA 3GNQA 3D6HA 4H6VA 2UUOA 5FWXB 1IATA 2WJ3A 4AI6A 3ZU6A 5AJUA 1VYVA 3DO8A 2YXEA 1XL0A 1G9TA 1GCOA 4NQZA 3G7NA 4A91A 3TUZC 5F3WB 3LUJA 3MWGA 1RHJA 2JLYA 4R1SA 4B6OA 2B1GA 1Z59A 4YDRA 1NI3A 1S2NA 1MB3A 3G2OA 2VHJA 1EA7A 1A8PA 4EHKA 3QVMA 3S0JA 4AYWA 5T6BA 4IMJB 2W4QA 1DWPA 1R4ZA 3FOBA 4LRXA 5HFJA 4RXMA 2BFBB 3TOXA 5B53A 2DBRA 1NTRA 2GARA 5BN1A 5K3DA 5CAEB 3DVAA 1L7VC 2XDQA 2SCUB 4AO8A 2LVNC 1UBGA 3ZXUB 1E94E 1AA6A 1Z7YA 2BEUA 1BCRB 2OHFA 3FPLA 5DLQC 2G9ZA 4NV3A 4UBNA 5IJ0A 2O5CA 1YHZA 1RRGA 4JUFA 4LHSA 3AV0B 5SZJA 2AQ8A 5ECGC 4G1CA 1IC6A 3HGMA 3R9IA 2P1DA 3BWEA 4DV7B 3LWNA 4BY9E 4B3GA 5AICA 2FX5A 3H3XA 1Y6QA 1KZ1A 4UU1A 1FMJA 4UQLA 1YC2A 5NLLA 5I7VA 4R0NA 1T9DA 5G0VA 4FDLA 1QOZA 4LY0A 2F59A 4CXMA 5AW0A 4F85A 2VRCD 1KZYC 1DX4A 1GGEA 3VI4B 4K9MA 3FOCA 4IQ8A 1JEQB 1AH2A 5B2ZA 4I9UA 4TMXA 4N49A 3ZQUA 1DFHA 1W4LA 3NUGA 2P4UA 4B08A 6YASA 1IEVA 5L40A 1RQPA 1E59A 1N0UA 1FDUA 2OORC 1M2KA 5IAEA 2GM9A 1NKVA 3T5BA 4PZYA 4Y0VA 2H9AA 2WZDA 5CFLA 5DHPA 5JATA 3C7CB 3Q10A 1SIWA 3BXOA 1BDHA 2XCSB 2HBRA 3BMNA 2QJTA 1B8PA 2WSYB 1TYBE 5CR9A 2N42A 2NSHA 3DUFA 3UK7A 5JY1A 3SZOA 4ZICA 2WSMA 4GKKM 3NIWA 1WCIA 3T1YB 3ZK7A 5I4CA 1BXGA 3VPFA 3ADPA 3CG4A 1I4DD 1N75A 5IM5A 4JY7A 2ZVJA 2J0VA 3K72B 4BLUA 3O8OB 4O25A 1C1DA 3AFMA 2GZMA 2IELA 4KE8A 4YUWA 1FLNA 3N3BC 3EHEA 1JHAA 4MRSA 2L09A 3FLMA 1E6LA 3KT6A 1UBRS 4WY2A 4KLZA 1LSJA 4Y6GB 4DMKA 4E22A 1QDRA 2O50A 5AESA 4ZT4A 5J2TF 4X20A 1NVUQ 1V3QE 2QMYA 3K73O 3BFKA 3H1PA 4OSEA 4A8PA 5KYXB 1ZESA 2A67A 1JR4A 5JZOA 2QENA 1M2WA 2PANA 1FQOA 4ZMRA 2C5HA 1KH1A 5ARDA 3IAM6 3ZJVA 2ZYRA 1GABA 3C5VA 1NY5A 2ECFA 3HR8A 1V1RA 4GU5A 4PXSA 4G4QA 2Q9AA 2OD7A 1JT9A 1Q22A 1ADFA 4DIDA 1QG2A 2XLBA 1T2FA 4G1UC 1H2XA 2IYOA 7CATA 3M3HA 3KBOA 3UENA 2BGRA 3VKGA 4CLXA 1T3TA 1XDBA 4MHSA 1CRWG 4GITA 1R2QA 2ISCA 4IDHA 3HHXA 2VCEA 3H7IA 2Y8EA 4UTXA 3SP1A 4MS3B 4N5DA 1SA0B 3N7TA 5FLEX 3HBFA 5AM4A 1CWUA 3I9V6 1JLMA 5UKDA 4ZAXA 2XD9A 4N3GA 2A5YB 2YZ7A 3ZE0B 3HP7A 3LVFO 2X41A 3DOOA 1TZKA 4ZREA 5FOUA 2CLDX 4WBNB 4I4LA 4I55B 4JR2A 4NOKA 4JI2B 5HX7A 2OLKA 1DX6A 3HCEA 5JMTA 4B3RM 2ZIFA 3QBJA 5L7TA 1GDHA 3A3YA 5H7XA 4FFSA 1EUDA 4OHMA 1ONNA 2E89A 4J7CA 5BSMA 4Q1AA 3OX4A 3LMKA 1RZVA 3LF1A 3V3TA 5JWHA 1C3EA 3LOQA 2JD1A 2XMQA 4X66B 4MK4A 4IIEA 1YS1X 5D5PA 4XDYA 1G8SA 2EQBA 5FOSA 4C87A 1W0KD 2X86A 5L3SA 3QXXA 4EG6A 3W7AA 3FJYA 3HCNA 4HRYA 1EJBA 2Z8XA 2IUYA 4F4UA 5I3ZA 3C3CA 1CVLA 4MP6A 1UP7A 3L0IB 5CPBA 2RGDA 2WG2A 3C5WP 1GU7A 2B3DA 1VE9A 3HWRA 2NX2A 4LZPA 1SG6A 2JIBA 5L8RF 1T8UA 4FFDA 1O94A 1LVHA 1EB8A 4LI0A 2DAKA 5BPHA 3G2NA 4DM7A 5K6AA 1X0VA 5AW1A 4EJSA 1A2BA 3QOYA 3DNMA 4M0UA 1NN0A 1HNNA 3OPYA 3WGYA 1VRWA 3M6IA 4P7BA 3HVKA 4QEDA 1F8XA 1VKZA 4CV2A 1QUFA 1MAAA 1YH3A 1RJEA 1D1SA 2OZLA 4CRWB 2XMRA 4LDQA 4RKUF 4M9ZA 1YB2A 4I3GA 4ZDIA 4A9AA 2Y1OA 1Y8RA 4BECA 3NCTA 1A88A 3CO0S 1L7NA 4RD4A 5CH8A 4U39A 1THGA 4DA0A 2R6FA 1KH2A 2FOXA 4CM4A 1A9RA 3THRA 5INTA 4URFA 1SOAA 4KXNA 3GFTA 3UGKA 3ONFA 4CHTB 3OCZA 1R0XA 4PBRA 1I3NA 5K8IA 2AZXA 2JLRA 2P9BA 2I76A 4URVR 4R6WA 4FDVA 2XSZD 2IWHA 2HJVA 3QUSA 2GB4A 4XIFA 2FW1A 2DY0A 4U2GA 4K46A 3O92A 1G63A 1BS1A 4EGQA 3UH1A 3R5XA 3EZYA 1KEKA 2MSNA 1DRUA 2ILTA 4EL5A 1OR8A 4PS1A 5HF9A 1FK8A 1YBMA 4OXQA 3KHKA 4PZEA 4B2IA 1P7VA 3ZCRA 5CJ2A 2ZEJA 3WBBA 2QGNA 4WKBA 3I8OA 3DOAA 3PZRA 3J81S 4LZZA 4FFBB 2JZOA 1T10A 1Z08A 4IOLA 4PX9A 4MUHA 4MDEA 3T5PA 4WLVA 1JLLB 1EFUA 1BX0A 3D6AA 5J4VA 2RE8A 1PSDA 4N9WA 5EKDA 1RLTA 4C7OA 4P17A 2W22A 3A2NA 5LSAA 2JWSA 3D8HA 2VEOA 4MV8A 2J3HA 1YMUA 4C4OA 2R84A 3PA8A 2QQEA 4FD2A 4WJKB 1AB6A 4BAZA 4KXXA 1FFDA 1BHQ1 4M38A 3FY4A 5DCWA 2D7DA 4RMIA 2FE1A 3QFHA 3RTAA 1U8TA 2H17A 3JALB 5EZYA 4BDSA 1T5IA 5L8VA 5REQA 1XEXA 1VSBA 4UNQA 4DEVA 4JASB 3ND8A 3RYIB 2O2IA 4G4RA 3KU4A 1DKMA 2Q9BA 1U2GC 1E6MA 4YUYA 3RGPA 3UEOA 1Q3BA 4I9NA 5EHQA 2PLAA 5DGXA 4GI5A 2Q8PA 2QX7A 2QTVB 1AY0A 1RM4A 2EZ9A 3AU9A 3IURA 2GS9A 3S40A 4LWZA 1O5TA 3DDOA 1CC1S 5GP1A 5E6RB 1SUIA 1UOQA 3CHYA 2PRSA 5CM2Z 4EYGA 1G17A 1C8BA 3TQTA 1G2QA 2EF1A 1P9WA 3QWFA 4DAOA 5TQ2A 5JBNA 4J94A 1HSOA 5HVNA 4NECA 1KI9A 4Y6RA 4RPGA 1U0GA 5ALSA 4BZXA 3QGMA 1QDTA 4DV3M 2ZAMA 3KYDB 2YX1A 4M1OA 2YN4A 2WHYA 1KS9A 4WXMA 4D98A 2PD3A 5EP3A 1FMCA 8CATA 1HOXA 4GWGA 2PT9A 3PNKA 5DV9A 3JQFC 3SQOA 4D8WA 4GSYA 3IHPA 5IYZB 3PU6A 6GPBA 2GJ9A 1PWYE 1WO8A 2IDMA 1EH5A 2IUEA 1MR3F 2WTNA 3T4XA 4IYJA 4I5GA 4DARA 2EARA 1PWEA 2PH5A 2UZ0A 1TLLA 3VUEA 2H85A 4YJ2A 1LCIA 3LUDA 4QDXA 1S2IA 3EN0A 1OW3B 1A7AA 3B1KA 3RODA 1K82A 2J0UB 4GC9A 4AVYA 5HILA 5DLPA 1JJFA 4YS6A 2C8KA 2G3QA 4KX5A 2XIQA 8ABPA 4XM1A 4Z8XA 5JSKA 5A4KA 2ZJOA 3DTYA 4LW8A 3KEOA 1UK9A 3TDMA 4WERA 4O63O 5D01A 3ZVRA 4FB5A 1QJCA 4DRXA 2XMZA 3PPYA 3X1WA 1BGWA 4DDVA 5JRJA 4K28A 4TS9A 1E9EA 5JSZA 4DS3A 4MB6A 4REOA 1SNYA 2XZDA 3R6DA 4E1AA 1MQ8B 2B78A 4B35A 1XMVA 1ODCA 5A4AA 4KO1S 1K98A 4L8RC 4YTEA 2ZWMA 4GHWA 2WTAA 4ARZB 1S2GA 2W8ZA 5A0TA 1LFAA 5BW6B 1JFVA 1JH8A 2Q28A 4EG1A 1IM8A 4YGXB 2FHSA 4GX1A