4LJ8A

Clpb nbd2 r621q from t. thermophilus in complex with adp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj8A01
3KJHA 2YZ2A 4QG7A 3QSYA 1YZGA 3LX5A 2F1IA 2O8FB 1LW7A 4NCNA 1MV5A 3BXZA 3FOZA 3CRW1 4QJ3A 3K09C 3SQXA 4FMCF 5FOVA 1L8QA 3QEJA 2P67A 1S1CA 2G0TA 1KO5A 1HT2E 3P1JA 2FGJA 2MSCB 1OKKD 2KSQA 3KKQA 3AVVA 2ZYUX 3OAAA 4LWZA 3SOPA 3LDAA 2J46A 3RANA 4R71A 5HR5A 1TU3A 4C3ZA 4QL3A 4V0KA 3AVPA 2AHOA 5EXXA 1DAKA 1YHNA 4PTLA 4QJ5A 2Z4RA 2XJ9A 2J0QA 2YC4C 4ZDWA 1I4TD 2QPTA 4PSAA 4Q1DA 2ZI5A 2FFQA 3IIJA 1P62B 1JR3D 4DDWA 3RS0A 4KITB 2C8VA 3K0SA 3C7KA 2ZRJA 3B2EA 4WW0A 1NMXA 4DCSA 1NLFA 3B1WA 1MKYA 4N3NA 4B3XA 4B33A 2JDID 1WXQA 4Z54A 5FTLA 3NWJA 3TAHA 1SVOA 4MYTA 4BZPA 2KWIA 1XPRA 2HJVA 4BGDA 1SZPA 2CHVA 1J99A 4Q1EA 1E0SA 1TQDA 4TMVA 1NVXQ 2H5EA 1XXHB 2ZE8A 4ASUA 2R8RA 1GL6A 1Z0FA 4AG5A 2CLDX 4J0QA 4YMWA 3R9XA 3FFBA 3PR1A 4OHXA 2GA8A 2WVJA 1ZC3A 4BE7B 1IBRA 2QRZA 3CKLA 3OFNA 5BYJA 3A37A 1CKEA 5AUOB 2PJZA 3CF2A 3K0CA 4KSCA 4AYXA 4IJMA 3FMIA 3T61A 1XX6A 5J4KA 1ZCBA 3HWSA 3QBVA 1RC8A 3KB1A 3CPEA 2JAQA 3CRQA 1KDPA 4PAOA 1G5PA 1TTTA 3C5HA 3EA5A 5J4YA 1RYFA 3H2YA 3TH5A 1ZUIA 4P4TA 1IONA 1VCNA 1PLJA 5TMPA 1BOFA 2XOKA 1G41A 3QY0A 4IOJA 4D4JA 1COWA 1E2JA 4B32A 4C0SA 2KRKA 3D31A 3TW4A 2PX3A 1OV4A 2B6HA 4G1UC 4US1R 1T8UA 4CF7A 4PQYA 3OEHA 4IDPA 4JBXA 2XXAA 2ANCA 4GNKA 2ZUBA 3QG5A 1SXJA 2NO0A 4JVLA 2WJYA 1OPXA 4GT1A 1OJLA 1DE0A 1K5DA 1SVWA 1CJKC 2E87A 3SJBA 2ANBA 4HZUB 2Q0HA 2ZR7A 3VTKA 3GLHE 3OIUA 4FMDB 5JJKA 1E99A 4PZZA 2QP4A 4RFSB 3N5CA 3GQBA 4QOSA 3C4JA 5L3RA 1ZD8A 3BOSA 3BC1A 3CR7A 3ZZUA 2QY9A 1KSFX 3JVUA 4BECA 4AKGA 2KE5A 1EESA 4ZCLA 1ZVQA 2XNDA 2PL3A 1QF9A 2O8BA 3CH4B 3EA0A 1Q12A 1AJEA 1Z0DA 5IRCD 2OFOA 2PCLA 3F0TA 4LJ8A 1Q1ZA 5FR1A 4D0GA 1TF7A 1ZIOA 4DRZA 1DELA 2JJ1A 4CEJA 3DOEA 2V8OA 3W3ZB 3X1ZA 1VCMA 2GJ8A 4YC7A 4XWKA 2R44A 3Q9LA 1E0JA 3WBJA 2HLDD 5AJZA 2NO1A 4WZBE 1U8YA 3AV0B 4NE2A 3VR1A 4YMVA 1FQJA 2QAGB 1ZM9A 3ICEA 3LW7A 3I5XA 3REFA 1OXTA 2BWJA 1XCGB 4E09A 4V02A 4TMXA 2O0KA 2RGNC 1SXJC 5HKKA 2BJWA 3CLVA 5LD2C 4BLSA 4MRSA 2XNSA 1QHXA 1US8A 5C46F 4MDEA 5HZKA 3AF1A 1Q0UA 3KB2A 1UBFA 1TPZA 1W0JA 3U3RA 1GIAA 3IHLA 4B43A 4PQFA 3SEAA 2FNAA 4EIWA 4KO8A 2FZLA 4E07A 2JIZA 5DI3A 3MLEA 3G0HA 4TLBA 1RIFA 2XEXA 1LFDB 2QPOA 3QVVA 4YDSA 5HCIA 3EPHA 3BFXA 5DE3A 5H68A 4MDFA 2PX0A 1TAGA 4PHGA 1P72A 1FX0B 2ZRIA 3P4YA 4JLPA 1Z63A 4HAVA 3HU3A 2IC5A 1T5IA 4RCZA 4AG6A 4JYCA 4D2IA 3THWB 4W5JA 3MJRA 3U4QA 3KKOA 5L3QB 3RYTC 4R9UC 4BLQA 3H0KA 2WMOB 4JL5A 1NI3A 1IN6A 1XB2A 1E2KA 2WPDA 4NYIR 1NN3A 1JEEA 3VAAA 4DVGA 3AVYA 3ZZ0A 4QNMA 4ZV4A 1Q3TA 3RNLA 1GG2A 4H1UA 1TEVA 2WAYA 3TSOA 3EAQA 2IHBA 3VR5A 1LNZA 1FX0A 2EYUA 3UK6A 2ERYA 5FUXA 5AUQA 2FN4A 5B2ZA 3KKNA 1IJFA 5FR2A 1CBUA 2QE7D 4PAMA 1FFHA 4KJZA 3V9PA 1TX4B 3BH7A 5L3QA 3DM5A 3CZQA 4DLVA 3FMPB 2H57A 4NCJA 1ZINA 2FV8A 3OESA 3BAFA 4EDHA 4DLXA 4X8MA 2GZAA 3ZVRA 2IYWA 4KHZA 5BQ5A 4L4UA 1EFRD 3WP1B 4ARZB 5CB8A 1HY3A 3NKVA 3VHXA 4TZ0A 4LRTA 1GITA 1KDRA 3EXAA 2FA9A 3SJCA 1NY6A 2GRJA 3W34A 3QENA 2P6RA 2RMKA 1U8AA 1FZQA 4HB2A 3QXJA 1XXHE 3K70D 2OEPA 1GKYA 3EC2A 4DLZA 1TEXA 4A15A 2QN6A 4LJ7A 2JDIA 4TL8A 4FWTA 5AJXA 2XSZD 4HLQB 2ZIAA 3MSXA 2GHIA 3L0OA 2OESA 3IPXA 4JJZA 3B9QA 3TQFA 3K70B 4ACAA 1E2LA 4DBLC 1P5ZB 2R6FA 3CRMA 2ZYTX 3DDCA 4BLOA 2Q9AA 4HATA 3BS4A 4YDHB 4KAXA 3PCRB 1MH1A 2VSXA 1CS4C 4QHTA 5FTNA 3H86A 3CPHA 2WTUA 2RCNA 3TUJC 5D3QA 4ARZA 4M1SA 4ITRC 2GCOA 2FZ4A 1P2TA 2G3YA 1GL7A 3NVAA 4XVRA 5CK4A 2ZS9A 2TMKA 1NSFA 2WOJA 3C41J 2CCKA 4V0MA 1WA5A 1X8LA 2ZSAA 821PA 2BV3A 5IDVA 2AD1A 2J0VA 1GZSA 2VQSA 4HYYA 1XCMA 3IIMA 4NBSA 3K8YA 5KPDA 3EG5A 1D5CA 1D6JA 3RWOA 3WXMA 1F48A 1ZM4A 1KMHA 2XB2A 3NBXX 3I73A 3Q8XB 5F3WB 4BWYA 1ZBDA 2EWVA 3ETLA 5F2EA 4C0KA 1UKEA 4F91B 3PEVA 2CL0X 3TSWA 4ESHA 4KFRA 1N0VC 2WIBA 3DKVA 1WRBA 5KPJA 3QKTA 4EQ6A 3I32A 4DLSA 5CIQA 2XZPA 2DWQA 2QBYA 4RZ3A 3K9NA 3TRFA 4DLWA 3HU1A 4Q7KA 1G8GA 5AWFC 2RGAA 4ACBA 3CB4A 4B3BA 1K6MA 1ZMXA 1F2TB 4HAUA 3MJHA 1SGWA 1T3SA 1U0JA 3DVLA 3QOFA 4DDTA 1KMHB 3W8NA 3LBHA 3TGPA 3TJZA 2ECKA 5BN3A 3Q7QA 2ZUCA 3GJ7A 3PQCA 1LY1A 3DMDA 1CIPA 1VHLA 4ZKEA 3QF4B 3TE6A 3PXGA 2RHDA 2JA1A 2QORA 2E1RA 2D62A 2GF0A 2F43B 4XWOA 2BBWA 3FDIA 5L8VA 3ICQB 1LF0A 4A4DA 2P2LA 2NO7A 2FOLA 3MD0A 4Q9IA 5FBRB 4GDFA 2VTKA 3WNCA 1E9SA 2B8WA 1SHKA 1WMSA 1E2EA 2IYQA 1M6NA 2A5FA 4WOPA 3TUIC 2FWRA 2RKOA 1JR3A 4OQMA 2RGNA 2QMOA 1NBMA 1F2TA 1Z47A 2WKPA 1D2NA 3SJAA 1NJFA 1TUEA 5FOTA 5FL7A 1AZSC 3LFUA 3HR8A 2BEJA 4TZ6A 2IHYA 3QF4A 4FW9A 5L3SB 2X2FA 1T0JB 2AFIE 4Q7JB 2OSBA 5CJ2A 2F43A 2IYLD 4RFVA 2B7CA 4URVR 4Q02A 4ASUD 1Q21A 4KYIB 4KVAA 4L8GA 4WZAE 3VR2A 2BHRA 5HPYB 4OK6A 1N6NA 3NHBA 4RD0A 3THOA 4ABYA 2V7QD 3FHOA 3QKRA 3GEIA 4KCGA 2JLSA 3I61A 3F3YA 2PLRA 4KVGA 3ECCA 1E98A 1U8ZA 2ZRMA 4MITA 3NEJA 3KKPA 1XTQA 4B34A 2R6AA 3E2IA 2EVWX 4UQOA 3AVWA 1DAGA 5KSPA 3JVVA 5JMTA 5EXTA 1XTSA 4P3YA 3PENA 4B44A 2ZS7A 4OI2A 2PMKA 1G3QA 2PLFA 3RLFA 1X1RA 3KQLA 3AVOA 4LHZA 3GFOA 3OEHD 3KJGA 1OFIA 1N5LA 3W3AA 3AF2A 1CEEA 1II8A 1KDOA 2NPIA 3A1VA 3SI7A 5FTJA 2A7QA 2ZAMA 1P9RA 2NQ2C 2MMCA 2VF8A 3QKRB 5SZHB 4EPRA 3I62A 3U7EB 2ZJAA 1BKDR 1R8QA 4UXJA 4H1VA 2CLSA 4LV5B 3UXMA 1MO5A 2CNWA 4O0MA 2VP6A 3HDTA 4FMBB 1OIVA 3AVQA 4LYFA 1M1YE 1GNQA 4M9XA 3S1AB 3U3OA 1OB5A 1OFUX 2MSEB 1IY2A 3NTUA 4GZMA 4I4LA 4XTRA 3DZDA 2I1QA 4MKFA 5JEDA 2I1VB 2OZEA 1KI1A 2GEUA 1OF1A 1T9HA 4BLPA 1NVVR 1PJRA 3QVUA 3QXSA 2QG6A 2IWHA 4DSUA 4US0R 5BN4A 4R7ZA 1JALA 2P6NA 3L8ZA 2Q3FA 1II8B 2W6JD 4F93B 2AN9A 2PJRA 5CYOA 4M9QA 2BM0A 1FNNA 2ZITA 3DL0A 1P75A 2OXCA 3MWYW 1RW4A 4LHWA 5FBWB 5EXPA 5LB4A 2YOGA 1SVLA 4Z51A 2OT3B 2ZJ8A 2IBMA 1ZNZA 3CONA 1OLOA 2XX3A 1KKMA 1N0WA 2OXRA 1HUQA 2VYFA 2J41A 2XXAB 3PEUA 3RRMA 2CHQA 3GLHA 2J0UA 4QJ4A 1E4VA 1I2MA 3GLFB 4I1VA 1YJ5A 1XZPA 3K09A 4NYMR 4URUR 3SFVA 1MABB 1G7CA 3ZS9A 3W90A 1U94A 4X8HA 3UKDA 1XNJA 4CT5A 5CIWA 1R5NA 1T3HA 1VECA 4JVSB 1WB9A 4L15A 2ZI3A 1G291 4QGHA 1EK0A 5JWRA 4PPGA 3CNNA 2C9CA 1ZUNB 1GTVA 2B7BA 4X8OA 2VLIA 3E70C 4LBWA 3DMNA 2JIZD 4GP6A 2VP0A 1DAEA 1AS2A 2D7DA 1FL9A 5CLLA 3I1FA 4DIEA 2GZHA 5FH9A 4P4SA 4TMZA 1G3RA 2R62A 3AP1A 1X8KA 3LNCA 4UNNA 4FWIB 5SZJA 3V4FA 3GLFA 4F92B 3THYA 4IOMA 1E1QD 2IS6A 1UKYA 3LQRA 4LYAA 1NKTA 1F2UB 5FPHA 1J7KA 4Q9KA 3ZGXA 3M1IA 3T15A 4JBYA 4PC6A 2WJHA 3B1YA 1P60A 3KFXA 4OHWA 3C5CA 3U7GA 2Q3MA 3FE2A 2FPMA 5G3ZA 3KQNA 4I99A 2CE7A 1PUIA 3R9WA 1MO6A 2GK6A 3SYKA 2CVHA 1G8YA 4GOXA 3AQ4A 5KU1A 2VL7A 2ODWA 1CXZA 2V1XA 3DPUA 4CYMA 2W00A 3LAWA 1G21E 1ZC4A 2AD5A 2D74A 4P4SB 3U3JA 2Z5FA 3LRPA 1W44A 1GAJA 2HDNB 5B58C 1RFLA 2GCPA 2DWPA 1XPUA 1F2UA 1DVRA 3P4XA 2J7KA 5ANRB 3DHWC 5HTKA 1E9CA 1XP8A 3U3MA 1OB2A 3BFKA 2H8KA 1M7BA 4Q19A 3TMKA 4G0NA 5JFGA 2BBOA 4NYJR 4FD2A 1KZ7B 1Z6AA 4KODA 3BWDD 1ZD9A 3DZ8A 3FMOB 4RVCA 2O5VA 3QIAA 4BLRA 2OBLA 2GXAA 1ZJ6A 4QGFA 4NYIQ 4KU4A 2IYVA 3JZMA 2Z43A 3I92A 4EPWA 3F8TA 1KJZA 4LC1A 1U0HC 1W47A 2CK3A 5B30A 1DEKA 3VLFB 5AUNB 2ZM5A 2ZJ2A 3U4QB 2QAGC 3WRYC 1G7TA 3HYTA 3EX7C 3WYAA 1CR1A 1G18A 1XFAA 2FJUA 5AUPB 4XSHA 2AK2A 4EJSA 1UDXA 2A5GA 1QVAA 4UNSA 5EE0A 1N25A 3W5IA 1W4BA 4XH9B 4IVQA 5GJWC 4NHOA 3EIEA 1FW6A 2N1BA 4HB4A 2W6ID 3A4LA 4URZR 1W4AA 2FDCA 1U98A 1G20E 1YZNA 5KDDA 1MRSA 1Q1BA 4HZIA 2LCFA 1YR7A 3W6OA 3TW8B 1CJUC 3QKUA 5FOSA 1HURA 4BFWA 4LUCA 4RZXA 5CDFA 2DBYA 3KFVA 4BFTA 4BZQA 2W2XA 1SVMA 4RKFA 4ZDJA 1S9HA 2A2ZA 3W6PA 3QPWA 2BJVA 3L0PA 4RKEA 4C4PA 4FN5A 4EPVA 3CWQA 4B73A 1UF9A 2ODBA 3E1SA 2E9SA 2ZETA 4CDGA 1ZUHA 3LVQE 3MG9A 2DZNB 4DT1A 1G3IA 4TMWA 4F4CA 1TNDA 4P32A 2CVFA 2GZDA 3SHFA 3NBFA 2V7QA 2WJIA 3MWJA 2C9OA 2OBNA 4KLZA 1FOEB 5FOWA 2HT1A 3P27A 5JZVA 1LF5A 4DXAA 5DNYB 2WSSD 3NXSA 2RGEA 2N46A 5TV2A 2CEAA 2OLJA 2IYZA 2WWYA 3TLXA 3K0FA 2GNOA 2Y8EA 3A1SA 1HE1C 1YZUA 2R6DA 3G5UA 4LK2A 5KUTA 2GAAA 4LCBA 1SXJE 1KTVA 4FMCB 1G7SA 3TBKA 4N0EA 1P4SA 4GPTA 3BB1A 4HLCA 4B76A 2GEVA 1R0YA 1W49A 2WV9A 4DLTA 1JAHA 2WAXA 2SHKA 4UKDA 4RCYA 4QRHA 1KO8A 4DJTA 4PHHA 4BFYA 2CL6X 3EW9A 4QHSA 3VX3A 4LSGA 3VNUA 4OQXA 2ZRHA 2A5DA 4V0ME 1GVNB 1JXOA 3QKSB 1XTJA 4A8JA 1VG9B 4UJ5A 3BB4A 5JHHB 4MYUA 3KDSE 2FG5A 4B3GA 5JRJA 3VR6A 5D3MB 4Q4LA 2VHQA 2QPAA 3KXIA 4B3FX 3OFND 2OAQ1 2ZE5A 5EE9A 5BYKA 2FFBA 1Q57A 5HZHA 1XDBA 4PC1A 1E1RD 2OILA 2CL7X 1U81A 2ZRAA 3NC1C 1S3GA 4W9MC 1DARA 3LW8A 3QPUA 4XSGA 4EKDA 3QJYA 1LS6A 5SZIA 5FBVB 3UMRA 3DEFA 1NMYA 4ZI3A 4CEIA 2QM7A 4HDOB 1II0A 2IUUA 1YZLA 4U5XA 2QQ0A 2WWGA 2P5TB 2RGDA 3BERA 4IOKA 2CE2X 2H92A 4MRNA 3LH5A 3QQ5A 3FHCB 5C4GB 4DC9A 1VTKA 2W0SA 3GPLA 2PBRA 3SQWA 4JZKA 5DI9A 2OAP1 1BH2A 2QSYA 3O8BA 4LHXA 4HAZA 2FEOA 4TLDA 1JPJA 1Z06A 4UXHA 1M7HA 2ZE7A 5D3MA 4TSFD 4LI0A 5KDOA 4QXAA 3KXLA 2QTFA 4LX0A 1BYIA 3AGQA 1OH6A 2UKDA 1G4UR 4GBMA 3B1VA 4OJQA 2F7SA 2GTPA 1ZM3A 2ZJBA 2QMEA 5FL3A 2AWNA 1TQ2A 3B13B 1ZM7A 4FXPA 3SYLA 2ZVQX 4E03A 1VYUA 4MRVA 4Q01A 4QKQA 1ZP6A 1H65A 5FPKA 1MR3F 2RAPA 1Z6GA 4TTQA 4Q21A 2Q9CA 4Y0AA 5G41A 5EUQB 2B8TA 1ZD1A 1P2SA 4CGZA 1D2EA 3W6NA 2NMVA 3F5FA 1ZNWA 1H8ED 5DYIA 2ASEA 2QT1A 1D8TA 4MYHA 2QEQA 5LDDC 1P9WA 1H8HA 1Q22A 4A9AA 1JJVA 3IQXA 4O3MA 1NVMA 5DSZA 8OHMA 3EPKA 4UXIA 3UWOA 1JQLB 5FOXA 5HE8A 1OXVA 2DY1A 2H7VA 3OE7D 4F4JA 3LO5A 1L4YA 1NY5A 1U99A 3AM1A 1F6BA 2AXNA 1KNXA 4QBFA 3SZRA 4Q9HA 4UNRA 1L4UA 4G01B 2FMXA 1K8RA 1UBEA 1JECA 2KB0A 3RABA 4TYWA 4E5UA 5CM9C 2Q3HA 1G8FA 3D3QA 2QL6A 2VBCA 4GMDA 4DKXA 3KTAA 1OXUA 4OQNA 3QI2A 1JXMA 5G3YA 3B8HA 4YMUA 2JLZA 1W0KD 4E22A 1RPZA 4NP6A 5JBQA 4TMTA 4Q4HA 4Q9JA 2QP3A 3NH6A 4A0HA 1GUAA 1TQ4A 4B6EA 4DHEA 1KK3A 4CEHB 1TUIA 1UADA 1EWRA 4EUNA 4YXWD 1FP7A 5KOYA 1XD9A 4NDZA 1IN7A 5H8WA 3ZIAA 1T4GA 2VHJA 1YR9A 3FB4A 3FFAA 4HB0A 4POAA 4UNPA 4IDOA 1G3UA 4JJKA 2ONJA 3EASA 4DSOA 1IN8A 3VFDA 1G3MA 1Y3AA 3O8DA 5J47A 2GCNA 2P5SA 4HB3A 2GETA 1F5NA 3GJ4A 3KTAB 2J59A 5GVRA 2BMFA 3OEEA 4UNQA 5DN6A 1XXHA 5GVSA 2HEIA 1DO0A 2F6RA 1Z28A 3LX8A 5C4MA 1YR8A 1KJYA 4P0TA 1TQ6A 1HE8B 3WYFA 2L0XA 4HAWA 1NN1A 4P31A 1AGPA 2EYQA 2YNMA 4AI6A 3CZPA 1JB1A 3NG1A 1M2OB 2QENA 2BBSA 3LLMA 3X1DA 3L82B 2CMKA 2CJWA 2W2TA 2WPDD 1PLLA 5CYPA 2V6JA 4Q1AA 1G19A 2IL1A 2WZQA 1OFTA 4HSEA 1E9AA 5DH9A 3S1AA 1G16A 3MWKA 2JLXA 3PUZA 1KGDA 2DR3A 2FPLA 4B2IA 5AR1A 2YHSA 4LDJA 2J5XA 5KYKA 4MRPA 2VIIA 4I1OA 1Z07A 3AUXA 3RS2A 4OQLA 5P21A 3IILA 3AP2A 3CM0A 5J4LA 3IO3A 2AXPA 2QI9C 1W36B 4W5HA 3A58B 4OK3A 1XTKA 4Q18A 2QE7A 1XMSA 1XMJA 4O2RA 1KO4A 5K8IA 2VPPA 4PFSA 3BBPA 4II7A 3FTQA 4EPXA 2VP4A 1A2KC 1KZGB 3K0EA 4BZXA 4WAUA 1GSIA 2RB4A 1KY2A 4D0LB 3QPVA 2VEDA 3TVTA 4MH0R 4NONA 2I4IA 2HYIC 1HQYE 2XAUA 2D2EA 3MUFA 5J4HA 2AR7A 2GWHA 1I2DA 1CP2A 3T1TA 4KLNA 1GILA 2DHRA 2C99A 1RJ9A 2DWZB 1WDTA 5JCZA 4OHYA 1VMAA 1JAIA 2NTYC 4M1YA 2IS2A 2QM8A 2JJ2D 1WBDA 2XOKD 2WJGA 3T34A 4TYYA 1UM8A 1LB1B 2QAJA 4PHTA 2DFKB 1Z83A 1AS3A 1R2QA 3KUCA 2OCBA 2ZI6A 2HXYA 5JWHA 5JLJA 1N6IA 1KI8A 2V6IA 4JLAA 3MGCA 4PO8A 4IFEA 3PFIA 2P65A 1O87A 2IYSA 3PG5A 4PPFA 3CO5A 3N2EA 2W2VA 3MWLA 4AK9A 2IS4A 2FPKA 4K8OA 5L3VA 1IM2A 1KYIA 1OHHA 5TDHA 2DVWB 2ZQ5A 4YQFA 1E2HA 1EFHA 1P2VA 2YOFA 4JKYA 4KBGA 4GL2A 1CF4A 3ZS8A 1C4OA 4AYWA 4G5RA 4MRRA 1A1VA 4FWHA 1G64A 5JJLA 4LY6A 4DDVA 4IOLA 1W5TA 3B7GA 4M22A 4TT3A 2BCJQ 4FMDF 4LBZA 5TVKA 3BB3A 1KI3A 4Z8XA 1XD8A 3NH9A 1JR3E 1ZRHA 4NCHA 1S96A 2WHXA 1US8B 1EGAA 2R2AA 2NGRA 4JVMA 5FI1B 5UKDA 2IYXA 4DEYA 3T1OA 2GEDA 2BBTA 3PUYA 1E0AA 2ZRLA 1E1RA 5JI3E 5E3HA 5F98A 2D3WA 3IBGA 2HLDA 1W2GA 3CX7A 1XEXA 4L5BA 1ZYUA 1XD2B 2DYKA 4FIDA 1AGRA 5EE5B 1Q44A 3EZ2A 4JLBA 3BFVA 5HKKD 4IXMA 1VYTA 1J8YF 4B48A 3DKPA 2Z6VA 3LLUA 3KW6A 4MUBA 4KV9A 3TSZA 4Q9LA 2IYYA 2NG1A 3GEEA 1K5GA 2ZROA 4JL6A 5GJBA 3THWA 1VPLA 4FWDA 1Q1QA 4Q4AB 4A1FA 5AJWA 1G17A 3Q5EA 2REBA 5FBQB 2VHUA 3QNUA 4D4KA 3HU2A 1OYYA 3GLGB 1SKYE 1X6VA 4NCIA 4QHYA 4V0NA 2YKGA 1O3YA 1QHSA 2XTNA 2IK8A 4HLUA 4JSTA 4TL7A 2EFEB 4Z8YA 4LGMA 1OSNA 3U6BA 3GLGE 1P73A 3JZAA 4XTCS 3ND8A 2VP9A 2G77B 2WSSA 2ZSBA 3BJIC 2IYUA 4TYQA 1KSHA 3PITA 3SDZA 3OE7A 4EFMA 4W7SA 5BN5A 2Z0MA 2CBZA 3SN6A 2RHMA 2VH5R 3IBYA 1G8HA 4KI0A 4KSBA 2GXSA 1W36C 2H1LA 1HT1E 1DPFA 1R4AA 3OIVA 4EJSB 5DIFA 4M21A 3LA6A 4PO1A 3X1YA 5FOUA 4A0FA 1LV7A 1KI4A 3KQKA 4HLDA 5CDFE 1ETUA 3SFZA 5EZ6B 4W5WA 3KQHA 4IXNA 3EWSA 4TYPA 2BKEA 4CRWB 2IF2A 2ZREA 1GL9B 4RZ2A 2DB3A 2YOHA 4ZCMA 2NZJA 4PX9A 1GKUB 3GEHA 1X3SA 2EFCB 5FTMA 4JLVA 5BWMA 2VHCA 4ZDIA 5A0FA 1NG1A 4M1KA 1W36D 2H16A 2QBYB 3HP1A 2EQBA 2FSHA 5EE1A 2YYZA 1F3OA 1DAFA 4DLRA 4US2R 2X2EA 4EFLA 2AKYA 1MRNA 1A82A 1Z6XA 1E2DA 5LPNA 3UPUA 2JLYA 1R0WA 2WJVA 1HH4A 2A5YB 4OI4A 3AJIB 2ZI9A 3SS8A 1I4LD 3C15C 3KXKA 1VIAA 3ZVNA 2WBLC 4DSTA 3GD7A 3K1JA 2IS1A 1J70A 4PZYA 4BEBA 1N5IA 2A78A 1Z6TA 3R7WB 4XD7A 4C2TA 2UZIR 3R8CA 2A5JA 3QEOA 1TF2A 1BMFA 3PIRA 4QM6A 1EFCA 2GCOB 1EFRA 4HLUC 5JHGB 3NDPA 4TQAA 3W8RA 4BUJA 4TN1A 3U3KA 1YKSA 2FSGA 1G8PA 4RD2A 3P20A 4G3XA 4P33A 4KXFB 3MFYA 2EU8A 2Q9BA 1Z22A 2IA5A 4RSGA 4A2QA 2NOAA 3FKSA 1Z2AA 1RRFA 4TMKA 5EJEA 4GI7A 1NVVQ 3CF6R 3QKSA 1N6KA 1P7CA 1Z0AA 1MT0A 4N0DA 5CJPA 3SE0A 2C96A 2ZS8A 2JLVA 2Z4SA 3LWNA 1HTWA 3IDQA 3Q7PA 4V0LA 3TVDA 5JS7A 3T35A 4Q1BA 2F3TA 1S4QA 2WWXA 5GJVC 3ZQ6A 1M74A 3FWYA 3T1VA 3CX6A 3NBZC 3MMPA 4ZKDA 5A5GA 2J45A 3A36A 3B85A 3VX4A 1NP6A 3VNVA 2YWGA 3RS7A 4F7WA 4D81A 4R2HA 3L8YA 1UKVY 2QTVB 3LY5A 4PPQA 2W6JA 4QBHA 3THXA 2GJAA 1CR4A 5EP1A 4DWJA 2O8DA 1U9IC 3KZ1E 5H70A 3SYNA 5FPTA 1SKYB 1XPOA 4D6PA 2QRNA 4PXAA 3ND9A 2ZRPA 1Z6YA 5KNDA 2ZJ5A 2ZUDA 1LS1A 4HAYA 4G5GA 4OYHA 4QC2A 1E96A 1KKLA 1TMKA 3BE4A 4DCUA 3A1UA 2I3BA 3N70A 3RRNA 3U44A 3RDPA 1DOAA 4Q66C 1BS1A 2GESA 1Q20A 4LZZA 1VG1A 2GBLC 4HEJA 1VYVA 2CDNA 4IHQA 2IXFA 1GM5A 1D9ZA 3AVUA 2Q6TA 5FUWA 3R8FA 2G88A 3M0EA 2IUTA 1KAGA 4PANA 3PUVA 2W0MA 4LV8B 4ILEA 2C03A 3GJ8A 4NYJQ 1OYWA 4A2PA 1ZM2A 3OZXA 4B71A 4CW7A 5L3SA 1HEIA 1UEJA 5GJCA 1DAIA 5FI0B 1TU4A 4A82A 4TT3D 1ANKA 3AF0A 3RVBA 1UJ2A 1I4DD 1S8FA 1W4RA 3GMTA 3B1XA 5HCNA 1E3MA 4OKSA 3U2QA 3EPJA 3ADKA 1COWD 1D2MA 3ZLJA 4Q7LA 3T5GA 2JASA 3EWAA 4LPKA 1WBBA 2ZR0A 2OO7A 1CRQA 2ZSDA 2X8AA 3LBNA 4HUTA 2F1JA 4DUGD 3AGPA 4C7OA 1NKSA 4LHYA 1LVGA 2C77A 2ZJOA 2OLKA 3K9GA 1OH5A 1CRPA 3RRZA 2LKCA 3GLHB 1PUJA 1VG0B 2J0UB 221PA 2BKUA 4GFDA 3FPAA 3B9PA 1QVRA 2C2HA 5H1YA 1DADA 5EZ5A 3I72A 4PC3A 3RAPR 3SNHA 1P6XA 2GILA 4EPYA 2C95A 1ZNXA 4A3VB 2QQEA 1E32A 5TB5A 2WWIA 1BYUA 2XNDD 4PQRA 5J40A 3A1WA 1JJ7A 3L0SA 1DO2A 1J8MF 1PV4A 5K8UA 2ATVA 1MOZA 1DAHA 3QF7A 3U7FB 1Z3IX 4LV6A 2A30A 4L16A 1R5BA 1TADA 4WBSA 3CIOA 1JI0A 4B3CA 4Q48A 4QFMA 5FPSA 4IVPA 4ZI2A 3ADBA 1W7AA 3GJ0A 1AKEA 1YRBA 4OQFA 4BRWA 3GJ5A 4IDHA 2XGJA 1GKIA 4JLKA 1VHTA 3IKJA 4JBWA 4A36A 2HJGA 4EJSC 2YJTD 1B0UA 1NIPA 5M04A 2JLQA 4HUQA 1WCV1 4JLDA 3GP8A 2H18A 2R65A 2F3RA 2G1KA 2OM2A 1AS0A 2ORVA 3D6TB 3PEWA 2O8EB 1R6BX 2JLRA 1WQ1R 4FCTA 1W4CA 1GRRA 2BM1A 1AZTA 4TYNA 1XZQA 1AIPA 3KQUA 4LJAA 1CR0A 2PEYA 1S0UA 2F9LA 1P61B 1XCPA 3NEYA 4TSFA 4EAQA 4HDQB 5LB2A 2JLWA 4JLOA 5IT5A 2V9PA 3AB3A 3HPQA 1T6NA 3TKLA 2HXSA 3WYGA 3Q72A 1OW3B 1VKJA 4A0RA 2PCJA 2O8BB 1TL7C 3CPJB 4JSYA 3KX2A 1NN5A 3ZDQA 2FSIA 2PEZA 1OT3A 3RS4A 4NPHA 4LHVA 2MSDB 4L9WA 1KK2A 1GNRA 1IHUA 4YMSA 3WRXC 1UBGA 3T06B 4GITA 1UKZA 5E95A 4NH0A 2J9RA 3CRVA 5K8LA 1MABA 4NCKA 1QHGA 1KI6A 3EC1A 2PZEA 4IFBA 3RS5A 2RGGA 4ZIRB 4TLCA 1ESMA 2FU5C 1EG7A 1IN4A 4RD1A 3EZ7A 2FH5B 3B6EA 2GXQA 3PJRA 5CITA 4XJXA 1H8HD 1MO4A 1T8TA 4B74A 2VP5A 4AKHA 2X19A 3HPRA 2ODNA 2WOOA 3GFPA 4NYMQ 3D7MA 2WWHA 3I3SR 4LJ6A 3OIWA 4U00A 3CUEF 1DAMA 3AKEA 2CK3D 3HYRA 4TLAA 2C78A 2QSZA 1XRJA 4D80A 2BVNA 3CW2A 1NLYA 3P32A 3O8CA 2YVUA 1SXJB 5C18A 5TXGA 2HCBA 3AKDA 4OL0A 1FP6A 2HCJB 421PA 4OHVA 1C9KA 4HZUA 1KI6B 5KTYA 2PMDA 2OG2A 2ZPTX 5AJYA 4BPBA 3DM9B 4ZIRA 3MHVC 4RFSA 4C0BA 4FI3C 3CBQA 1A4RA 1SQ5A 1ZU5A 4IDQA 4PHFA 3A4MA 4Q00A 4OI1A 4K46A 1KI9A 3E5HA 3OF5A 1UFQA 1XJ0A 1VIYA 2GK7A 3V4RA 5JSZA 4OBEA 2YV5A 3GJ6A 2PT7A 5KDLA 1E1QA 2W83A 4C0JA 5KSOA 2BIFA 4Q47A 4AKIA 3GLIE 1E9EA 4MYCA 4QBGB 4C30A 1QHYA 1SKQA 3N2IA 2N42A 3A1TA 3ZZTA 3QG1A 3C8UA 2OCPA 3MRSA 3VKWA 2UVQA 2ZU0C 1RZ3A 2H17A 4MGZR 4MKIA 1OE0A 2AK3A 1DG1G 5JCPA 1E69A 2P3SA 2B92A 2G83A 2QZ4A 3IEUA 1X37A 4F4IA 1XEXB 4JL8A 1XD2A 2NO6A 2ZSFA 3LBIA 1XEFA 2QGNA 3CNLA 1ZU4A 2ZRGA 5EUMA 2BCGY 4N1AA 3UATA 3KUDA 5E4FA 1RKBA 1AKYA 1XMVA 2NPFA 1BIFA 5JSZB 1KNQA 3FGNA 3K0FB 4DZZA 1R0ZA 2MMGA 2F55A 2NIPA 1DTSA 1QHIA 2AKAB 2ZR9A 4Q5IA 2G9NA 3GJXC 1ZCAA 1DS6A 2BDTA 5FBLB 1EX6A 3GLGA 1VCIA 4U7DA 2HYDA 4AWXA 4RJLA 4Q4JA 1YZQA 2BMDA 2XSZA 1KI7A 3WMFA 5DI3B 1G6HA 4Q1FA 1S2MA 1EFUA 2EWWA 2NO9A 3I8XA 4BASA 1FUKA 1G4AE 3ASYA 1A5TA 2DCUA 1GFIA 2GKSA 1KK0A 3A4NA 5DYGA 1AA9A 4DCNA 3ZYCA 2PZFA 4TTRA 1YZKA 1CR2A 3K53A 3VU9A 1CLUA 2ZVPX 1P2UA 4TQUS 1ESNA 2JCSA 5DHFA 1R5OA 4D4MA 2FX3A 2YWEA 4C0QC 3X1WA 4I81A 4M9SA 2BMJA 3ZH9B 3J81k 3O8RA 1XTRA 2BOVA 3A8TA 4GOJA 2JATA 2QMUA 4IVRA 3PUXA 4CEIB 1N3BA 2HF8A 1YZTA 4B6FA 3M4YA 2ORIA 2P6UA 1IOZA 1CJTC 4Q4JB 1UAAA 4NMMA 4DT1B 3TIFA 5KNCA 3WNBA 3ASZA 2XZOA 1NN0A 5A4JA 3K0CC 4PC2A 5G40A 1Y63A 4DEXA 3WMEA 3IUYA 1GRNA 3ZVMA 2IT1A 4B2LA 4BFSA 5C1BA 5JECA 2ZAOA 4IEEA 4S2EA 2ZI4A 3VU9B 5JEEA 4R2IA 3EZFA 2EW1A 3EIHA 2W6IA 4DUGA 5EP3A 4KBFA 4P4UA 4DLUA 4YXWA 1KY3A 1KSGA 4C0LA 2ZYWX 3D8BA 5B57C 2VRWA 2VF7A 3CR8A 5C2JB 3VHLB 1N5JA 1NIJA 5CLQA 4JVNA 1ZNYA 4B75A 3BIFA 3PV0A 1A2BA 3LD9A 4KFTA 4WA7A 4BRUA 3WHKA 1NRJB 2VSOA 1U9IA 4IRUB 4OI0A 1T91A 2DFTA 3QXHA 1D9XA 4Q7MB 3VR4A 2EFHB 3CF0A 3T12A 1YU9A 3R7WA 4HI0E 2C98A 1B23P 4PSVA 3B78A 3SBDA 1P3JA 2YINC 3EZ6A 1IXSB 3K9HA 4KYUA 4EQ6B 5DN6D 2ZANA 1Z0IA 2FFHA 4DIDA 1VG8A 1W5SA 1M7GA 4DB2A 3IGFA 4XVQA 4QBIA 1JR6A 4MA4A 721PA 2ZRDA 1TF5A 4M4SA 5E7MA 4BFVA 1BMFD 4JLMA 5CK5A 1U0LA 1E2MA 3K0AB 2OBMA 2REXB 3I8SA 3QXXA 4YLGA 1J2JA 1NG9A 1N6LA 2GBLA 5EE3A 3AF3A 3AEZA 1Z8FA 1E9FA 1L7VC 4Z1MD 1PLKA 4V0OA 2VHTA 2OUKA 1Z5ZA 1WF3A 2AWOA 2OFWA 4C0AC 4ZO4A 3BORA 2A9KA 1HYQA 2RH5A 5ELXA 1KI2A 4AYTA 2UZ3A 3U7HB 1F60A 5DISB 1XF9A 2GJ9A 2ZRFA 1UBCA 1FQKA 1NVWQ 1M34E 1CULC 4M9ZA 4Q4HB 1HV8A 4RD3A 1Z2CA 1KSJA 1V5WA 2J7PA 4PC7A 1G1MA 5F9FA 2ZU6A 2V3CC 1HQCA 1QHNA 4M8NE 4ZDKA 4CEHA 1QRAA 1GNPA 1JEDA 1KAOA 2QT0A 5KSYA 3K0AA 2IF0A 2O8DB 1FTSA 4D0NA 3C16C 2ZRBA 1OH7A 4A0GA 1C1YA 5JRZA 1OXSC 2QTHA 4NKRA 5EP2A 1E4YA 3O47A 4MGIR 5KHOC 1FNMA 1VDZA 3AP3A 3SBEA 4M2LA 3I5YA 4D82A 1E2PA 3IIKA 1KOFA 1N6RA 2OE2A 1QZMA 3L43A 3Q85A 4PSKA 1SHZA 1T5LA 1OXXK 3IQWA 3IPYA 4Y0VA 3AVXA 2GVZC 2IYTA 1Z29A 3SHWA 3VR3A 2CNWD 2GJSA 1U2RA 2WJJA 3LXRA 1OHHD 1E79D 1ELOA 1L2TA 4JT2A 4Q03A 3SJZA 4EFNA 4EPTA 1NMZA 3LVRE 4G5QA 1ODFA 1NF3A 1JQJC 2CHGA 4FCWA 1KJWA 4WXRA 4TWZA 1NVUQ 2CJWB 2KBFA 2J1LA 4Z1MA 121PA 2G6BA 1QDEA 4RD6A 4B35A 5K8TA 4LJ5A 2A3RA 1QG2A 1UEIA 4OJKA 2D2FA 4URWR 3RS3A 1H8EA 4M1TA 5B64A 3B60A 4G5SA 1CJVC 2Q21A 3ZVLA 2XITA 3BH6A 2DZOB 3C14C 1WE2A 3WHLA 1E94E 4LYHA 4TLEA 5IK2A 3B1ZA 1XBTA 1S3SA 1XMIA 2GDJA 2X1VA 3REGA 3TQCA 4K81B 2WIAA 4O2LA 2CCJA 1XWIA 2JGNA 1OH8A 1XJCA 4XVUA 3X2SA 2K5UA 1G5RA 3WBKA 6Q21A 1V43A 5DLQC 2C04A 1RRCA 4LOAA 2PZGA 2RGCA 1KIMA 2FE4A 2YWHA 1XEWX 1DG3A 4IW3B 1E79A 4C7OB 4IDNA 2FFAA 5KNBA 2O8CA 1EX7A 3UMFA 1W0KA 2OHFA 2WICA 4LRWA 4WZ6A 3RWMB 5KO2A 3NC0C 1YQTA 1QBKC 4JMPA 2P0EA 4ESVA 1LTQA 2AFHE 1ZW6A 4BEJA 1G7RA 1JBKA 2ZJYA 3U6KA 1Q3HA 3UG6A 1KHTA 4X8LA 1N5KA 3RRYA 4B47A 2HV8A 2OCAA 5JI2E 2WKRA 3LXXA 1RYHA 4URXR 3QXCA 2V6ZM 4WXPA 1E6CA 2IEZA 4PR0A 5HE9A 3WP0A 5IF9A 1X1SA 3U5ZB 2D7CA 4D4LA 1ZAKA 3LV8A 2ODEA 4MKHA 2O8CB 3IO5A 3P26A 4G5OA 2R9VA 2F1HA 3ZIAD 1IAQA 2C5LA 1R7RA 1SULA 521PA 3R9IA 1OFHA 1G6OA 2QROA 2JJ1D 2ZRNA 5IK2D 3A6PC 5JS8A 4MKGA 4PAQA 4QM7A 3ADCA 4HUQB 1CU1A 4O25A 1FUUA 1JPNA 2O0JA 4ZCIA 5E7IA 2QMHA 1NLZA 4URYR 4LJ4A 2O8EA 4BLTA 1AN0A 1QHHB 2QUZA 4WIAA 3HJNA 3QE0A 2GAOA 4PZLA 3EPLA 4CEJB 2G1JA 1HA3A 3NIBA 1R10A 2ZI7A 4FCVA 4QGAA 3MAAC 4JIMA 3H1TA 4HAXA 3CNOA 4JLJA 1G5TA 2ZEJA 1E2NA 2OFXA 2VA8A 2EFDB 4FWGA 1Z0KA 1X8JA 1SVKA 2GJKA 3RC8A 2QAGA 3UG7A 1BO6A 2QGZA 1RJ9B 2DWOA 2VSFA 3H84A 2F1RA 3ADDA 2CXXA 4TL6A 1W46A 1T0HB 2GVDC 1XJQA 1E2GA 1SXJD 1IJEA 2XZLA 3EARA 4DDUA 3ZJYA 4A6PA 1J90A 4BFZA 2V1UA 1EXMA 4XWAA 5J4VA 4Q4AA 4AY2A 1QHHA 5JJIA 2WSMA 3BH0A 4JS0A 3L0IB 4M1WA 1R0XA 4A6XA 1KO7A 4LC0A 1E2FA 1RE0A 1P9NA 2XTMA 4RZUA 4TQ9A 5FPYA 1X86B 2ZRKA 3TR5A 1ONBA 1N2CE 3EZ9A 1XEWY 4U02A 3GLIB 2RGXA 3CH5A 3FYHA 4XD7D 4D25A 3IHWA 4OK5A 1M8PA 1E2QA 5E7JA 3RC3A 4LRSA 3GCGA 3FKSD 3MCAA 3AKYA 3OAAD 3RSOA 4V03A 1OKKA 1Z08A 5CM8B 3AH8A 4CIDA 4GMXA 2WWFA 1W1WA 4PPNA 4NTZA 3BGWA 2JJ2A 1YR6A 2HT6A 3EIQA 4GRAA 3IEVA 4JYBA 5EP4A 2V4ZA 3I4LA 5KSZA 4S35A 1JNYA 5F9HA 4CZ2A 2DFNA 4AIIA 5FFMA 2VP2A 5DHAA 3VKHA 3LQQA 2R6CA 1NBME 4C2UA 2AL7A 1IQPA 4XIGS 2F9MA 2KI5A 4YONB 4A92A 2CLCX 2HUPA 4ERNA 3NDBB 3GLIA 5GADl 1RRPA 3SU8A 3AKCA 2O0HA 1KDTA 3UWKA 4BFUA 3VQTA 4LYJA 1T3LA 5IHPA 4LBYA 5JWOA 3THYB 1W48A 3K9LA 2W58A 4JT4A 5CB6A 5FUYA 3UIEA 1A7JA 2B21A 3L2OB 4TTPA 2ZE6A 1PVOA 3W5JA 4GZLA 2J87A 2V54A 3BK7A 2J7PD 3DO6A 1MO3A 2IUSA 1KK1A 2RGBA 3PVSA 4QGGA 5J5CA 1G9XA 4B3DA 4NZYA 5G53C 1R8SA 2ATXA 2HF9A 3QUSA 4H9GA 3TK1A 3UMSA 5EQTA 4JKIA 4R98A 1DBSA 3ONWA 1WP9A 4ON9A 4XOIA 2WKQA 5AJVB 1AK2A 4CT4B 4DCVA 4MGYR 621PA 2OV2A 1S9DA 2WWWA 4NU0A 1II9A 1N6HA 1UPTA 3Q3JB 4DLYA 4JLNA 4TL9A 5BW8A 2YC2C 5TY0A 5AK0A 2R6GA 2GF9A 5FL7D 3K70C 4I1UA 2QU8A 1OIXA 4RY2A 1E9DA 2XTZA 3T1QA 1CJMA 4A2WA 3GFTA 3CWZA 2LWIA 1ZIPA 4AC9A 1IY0A 3TUZC 4L9SA 3FKQA 2ZSEA 3FVQA 5LBIA 1IN5A 2XB4A 5TARA 2WMNB 3T5DA 2JLUA 2V55B 3WMGA 1QZXA 1KO1A 1CTQA 2QP9X 1N6PA 2O52A 3RSLA 2VO1A 1Z0JA 1E9RA 2LKDA 1NL3A 4M1MA 2WM9B 1GDDA 1RVDA 4B2PA 2ZRCA 1IXRC 4ZPXA 4IEIA 3CX8A 1GRQA 1SVSA 1GOTA 4JN6A 1NSTA 1Q1EA 5EXSA 4RD4A 2PT5A 1KMQA 4WVFA 3THXB 4NL4H 2IWRA 2CCGA 4HDCA 4LJYA 3NBYC 2G0NA 4DSNA 2J0SA 5FUVA 3TAUA 3TR0A 2X77A 1C1KA 2DPXA 3TNFA 4LBVA 2KBEA 2QA5A 3KJEA 1RRGA 3VKGA 3KL4A 3FMFA 3KJIA 1IXZA 2IYRA 3BD9A 5DGXA 3V00A 4BQSA 3OEED 4F38A 2IXEA 5LD2B 2D06A 3PUWA 3FHTA 1GP2A 1EWQA 2C9YA 2ZYVX 2J3EA 2IXGA 3KKMA 3AF4A 2REOA 2FF7A 4Q1CA 1GWNA 2Z83A 1FTNA 4M0LA 3U44B 3B5JA 2ERXA 3WNDA 3GJ3A 1FMLA 2IX3A 3M6AA 2PH1A 3Q5DA 1NNEA 3DOFA 3R20A 1AQUA 1VCOA 2QNRA 4MQBA 1N6OA 2ZJZA 2JJ8A 5FTKA 2ONKA 3G82C 3HR7A 3NHAA 3OHMA 2BC9A 3SC3A 4BFXA 4DB4A 1EFTA 1AM4D 4LPSA 1UDWA 4AURA 4QNRA 1W0JD 2AX4A 4KFSA 4YMTA 3CRRA 3U61B 3ZD7A 4GP7A 4OHZA 4GSYA 1FPMA 2JEOA 2BEKA 2BMEA 2OCYC 4IKEA 4M53A 3W9YA 1SVIA 1PZNA 4CVNA 1AQYA 1U90A 2ORWA 3SR0A 4AKEA 3RHFA 1IY1A 1N0UA 4D26A 3GLFE 2KJQA 1OIWA 1NBMD 1XU4A 4GOKA 1YRAA 1E2IA 4DCTA 1YVDA 1W2HA 4UJ3A 4I1SA 2XJ4A 2O8FA 2FGKA 5SZKB 2FSFA 3AVTA 2YWFA 4LJ9A 4PO9A 1NJGA 3ZD6A 4MGKR 3ZQJA 3PEYA 3BRWD 4A8JB 1E0KA 3B82A 3VMFA 2IW3A 2DFLA 3U60B 1XTIA 2ZXUA 2NZ8A 3OIYA 4KFUA 3WY9A 3H4MA 2D4HA 4MUAA 5DO9A 4AD8A 4M1OA 5BXQC 4A8JC 1QG4A 2EFGA 4FINA 2IEYA 1E9BA 2FEMA 2GXUA 2ZTSA 3X1XA 3AUYA 4C9BA 3UANA 1FMJA 3QBTA 1YE8A 1S1MA 4C0HA
chains in the Genus database with same CATH superfamily
3KL2A 3LP8A 3KJHA 5LVAA 2M2IA 3EGCA 4QG7A 4X94A 4C76A 3LX5A 1UR5A 1ZIXA 1C3VA 4O4LF 1LW7A 4DY6A 3QWAA 4QJ3A 4J90A 5C5DA 2L19A 3FPSA 3MILA 4WZAA 4GH9A 2NVUA 1L8QA 4BMVA 3ER9A 2P67A 4MR8B 4HQOA 2G0TA 2IYOA 1KO5A 1HT2E 4I99A 3WTCA 3AVVA 4B4KA 4CMAA 1XC8A 4Q3OA 4ZT2A 5A03A 2HTFA 2ZYUX 2XNHA 2C2ZA 4Z86A 4E5SA 1IXYA 1U7HA 1NUQA 3DZGA 3GPBA 2HADA 2J46A 5H9WA 3R0VA 3D4OA 1TU3A 2GPBA 3MJ4A 3GT7A 2FCAA 4IMPA 2AI3A 5JH7B 5EXXA 4RH3A 4QJ5A 1N5OX 4DV1B 2D13A 2XUHA 4K9QA 4OSEA 1I4TD 4HXGA 2H3HA 4Q1DA 1TM4E 2ZI5A 4XDHA 5DKFA 2WE7A 1VJTA 1YI0A 1JR3D 2ZWIA 4IY1A 1V9LA 1GQFA 3T1NA 1YT5A 3EGWA 4DA6A 2C8VA 3V4SA 3MWDA 5BSGA 1NFQA 1L1QA 4MV4A 3NRJA 3ZWQA 5E6UA 1LQTA 1WIWA 4M8KA 5IT9S 3JAKA 3K9WA 2DOKA 4RQUA 5IC4A 1Y1QA 2CZQA 2XEPA 2QRKA 5DF1A 5HOQA 2VLBA 5KYXB 3E22B 1DGBA 2RHCA 1LWNA 3A6FA 4MYTA 3W79A 4R54A 2UZ4A 3KPJA 2JP7A 1RXYA 2AOTB 1XPRA 2O2XA 3ESCA 4BGDA 1SZPA 1B6SA 4LJSA 2CHVA 5KTKA 1J99A 1EGQA 4TMVA 1TQDA 1ULAA 2D0OB 2BKXA 4RAOA 4UHFA 1KQOA 2YUIA 4R8SA 3KYJB 2PWBA 2FFRA 3SXUB 4FKZA 3KQPA 7ADHA 2GA8A 5B6IA 5IAKA 5GGYA 1GU0A 1IBRA 3OFNA 3BE6A 4AS2A 4KQ9A 3A37A 3KYCA 4MUNA 3LY8A 2PJZA 5IC6A 4DV3M 3K0CA 5JNWA 2XFTA 1VPWA 3FMIA 2NSYA 1XX6A 3CA8A 1ZCBA 2H6EA 3QVOA 5AW3A 4KIWA 3CPEA 3WLOA 1L2BA 3C6BA 3LT4A 1G5PA 2XCIA 2R0IA 3WLJA 4BNUA 2UUCM 3H2YA 3M1YA 4LCEA 5DBOA 5DNAA 3BHNA 4HGOA 3FUUA 4KZKA 5COQA 1GYPA 2DBVO 4XX1A 4X64B 2XOKA 1L5HA 4DM4A 1GT6A 1WF6A 4D3FA 2ZB3A 3N8HA 4W6ZA 1FXSA 4B32A 4HN9A 4P83A 4C0SA 1T34A 4FYWA 3D31A 4JC0A 3TW4A 3PCXA 3RM3A 3AHDA 3CLHA 3GN1A 4FHFA 1T8UA 1WCIA 2CBXA 3WX0A 2V45A 4JBXA 1QYRA 5CLGA 3O03A 2ZUBA 3PP8A 3KHKA 3SAVA 1U0NA 4W1RA 4TTIA 3WIOA 3KSXA 1OPXA 2WJYA 2XDAA 1OJLA 1K5DA 2ILTA 3Q40A 2E87A 4GT1A 4GWKA 5KQDA 1QFZA 2Q0HA 1BA3A 3SJBA 4ZQFA 3SZ3A 3HM2A 4R8LA 1WQ4A 3OIUA 4TKUA 4FMDB 3ULKA 4F4FA 4YUYA 5KU7A 1E99A 5JJKA 2BW0A 4S1PA 2GAIA 1BH6A 1X1QA 1YACA 2C84A 2OD7A 2FSUA 2P6MA 2HREA 2QP4A 2ZFUA 2QJRA 4QOSA 3GQBA 3N5CA 3DFFA 1OFVA 5LMUB 3BUSA 1YMUA 4JJIA 4YJFA 5ITXA 2WIFA 5ALDA 4PNHA 3VPSA 4BATA 4DHWA 3ZZUA 2QY9A 2XUQA 5AIAA 1ZCFA 3JVUA 3HJCA 3Q7IA 2IU0A 2KE5A 4XEUA 1ID8A 3RUCA 5BSFA 1RLOA 1YCDA 2PZAA 3PYLA 1QF9A 2DR2A 3CH4B 3EA0A 5ALOA 3FPHA 4ETIA 5B5SA 1WW2A 3ETNA 5IRCD 1HBJA 1PF7E 3TJRA 4IBFA 3DXFA 4Y3UA 5K8CA 1NQXA 2IEIA 3P52A 1ZIOA 4MCHA 4CMEA 3OQ6A 4CEJA 3DOEA 1SXIA 2V8OA 4AJIA 3X1ZA 2C2OA 3MN1A 3E9RA 4AZSA 2NXJA 2GJ8A 1YNSA 3O3NB 2AYXA 1M2OA 2O50A 3LQ4A 5AKIA 1JA0A 4CUKA 2NUAB 4XWKA 3PJRA 5GQSA 2PUBA 1YGYA 5AJZA 5AI4A 2MJLA 1U8YA 4NE2A 4HMPA 4X65M 1H2HA 1OC4A 1YAJA 5IULC 1BA2A 4DPKA 2CVQA 2WYIA 1UQUA 1ZM9A 5B4VA 1A97A 3ICEA 3TCNA 4HGYA 2W2MA 3AM4A 3LPLA 1Y5RA 4S24A 4B8ZA 4LK3A 2AOVA 1L5NA 1MVOA 1FP2A 3BCHA 4D9GA 2RRUA 5IKMA 1CUSA 1YONA 4J3JA 4DILA 1CY2A 3ZNOA 4DDWA 2BJWA 2PIAA 4XDGA 2OCLA 2WR8A 3CLVA 3HJSA 1QKKA 4BLSA 4YCMA 1U3FA 2Q1TA 1CQPA 2HSJA 2OCDA 1US8A 3BAZA 1FBTA 2X4GA 2PTHA 2XUZA 1F0YA 2ZIXA 4EF4A 4ENTA 1UBFA 3E5RA 1BXRA 5AI6A 4IBDA 3GWZA 4M7PA 5LZ4A 2FNAA 3PK0A 1QDUA 1U2SA 1C8KA 3AY3A 3QWFA 5BQXA 5THXA 1RQ7A 2C92A 2JIZA 3MLEA 1RHKA 2WWTA 2YXPX 2XGMA 3ROMA 4OBWA 5C1DA 4YDSA 1JWLA 3ZZ1A 3BFXA 3O4RA 1VHJA 4CMHA 1KEUA 4J16A 2C5EA 4PHGA 4ZOBA 3P4YA 2NX2A 3U6EA 2XRMA 4J75A 3UCXA 2QUKA 3COZA 1L4FA 3SYTA 2GN2A 4AG6A 1G20B 8CATA 3DDNA 2YDXA 4GM4A 5D8DA 5IZ4A 1PSZA 3VAYA 1J0CA 4W5JA 4W5TA 3S40A 1FMFA 1IPFA 3M9WA 4Y98A 3K5WA 4KGZA 2JKVA 3VH2A 2IYPA 2K4MA 1OROA 4PM4A 3H0KA 4JL5A 3LS2A 3T3HA 4QSHA 1IN6A 4A27A 1XK6A 5C8ZA 4X41A 3O83A 1JEEA 3IRUA 5HQ3A 4BQRA 1KIFA 2UXBM 3RYFB 2VJPA 5IDWA 4LZPA 2GCGA 1Q3TA 1U2DA 1T9GR 3BYZA 3HN6A 3I09A 3VNRA 3Q3IA 4DIOA 3WISA 4KMRA 1D0MA 4UARA 4AMYA 4U4AA 3R6DA 4QASA 4ZO7A 4KWTA 1T5DX 4LFAM 3ZG6A 1QIJA 8LDHA 4CIVA 4R05A 1TM5E 2PXXA 3PZBA 4YT2A 5GZ3A 5DWDA 2FN4A 5EJ6A 5FR2A 1PS8A 4R9NA 1Z4MA 1SCJA 2QE7D 2VK2A 4UHBA 1QP4A 2WVHA 1R9MA 1FMTA 1PO7A 2J5QA 2N75A 3V9PA 4BNWA 4CIWA 2Q3BA 1YB5A 4BRZA 1R9GA 2HA6A 4LRYA 4O2BB 1CRZA 3FMPB 4DLVA 4ZCRA 2PMBA 1FYVA 4D8TA 3C7TA 4RUKA 3HXTA 5EJIA 2VCEA 3QIVA 2Y1OA 1VKNA 3ZE6A 1J9GA 4X8MA 1YDFA 3LOQA 4Z3KA 1EFRD 1FFXB 4KO3S 4MS3A 4RZIA 4ARZB 4D9NA 3RYCA 4P38A 4FYYA 1FLAA 2CNKA 2CMDA 3DWFA 4Y0NA 5EKDA 3SJCA 1BE6A 3CRZA 4CMEC 1GPH1 3QENA 4MOWA 1OUMA 3X1JA 4X7BA 2Q0SA 3TIGA 2RMKA 4UAUA 5C53B 1ONPA 2XUAA 2GA9A 3K70D 1A72A 3BTVA 4UHCA 2BUAA 1V96A 3ANSA 3EIUA 2QOEA 3SDBA 3PX2A 2RJ3A 2PFGA 4CL0A 4TL8A 4RBNA 4UTZA 1ND6A 1NNJA 1ZDMA 1FTYA 1LA2A 2BEWB 3MSXA 4UU1A 2MGWA 1W5FA 1B14A 2GHIA 3L0OA 1R3DA 1X7GA 2IPXA 2OESA 1UDBA 2ON6A 1CF2O 1E2LA 2ZJ4A 2QUAA 3B9QA 1P5ZB 4LG1A 3CRMA 5EINA 2ZYTX 3DDCA 3U80A 1U2DC 4C0WA 5IKXA 2Q9AA 2Z6UA 4ESOA 4YDHB 1AE1A 1RM5A 2RBEA 2Y0PA 3VR6D 3H86A 1CS4C 4QHTA 4FVTA 4LXIA 2DRIA 4FDMA 4OQDA 3TUJC 3QW4B 1CZNA 3J2PB 4GL4A 4XARA 3HBMA 3NTRA 2B1IA 2FYTA 3P9XA 4LXHA 3TR6A 1L5FA 1V8FA 2HQRA 2CSXA 2Y21A 2G3YA 1GL7A 3KAQA 3NVAA 4B6QA 1K7FB 2XMSA 1TZMA 5CK4A 5ALRA 3LF2A 4UW9A 2TMKA 3H11A 4A8HA 3C41J 2G72A 1AHHA 1WA5A 1X8LA 5IEJA 2HQ1A 3ZC3A 3BQMB 2XB6A 4KE8A 2IV3A 4NCBA 2X8JA 1DDOA 3CLRC 2O05A 3PL1A 4HYYA 5I4KA 3IIMA 4P4NA 4UM7A 1HDYA 4BHTA 3K8YA 1NQVA 2DWUA 2P68A 3EG5A 3JQ9A 5DK6A 2HNKA 1LLDA 3HKBB 3RWOA 3D6VA 2E89A 1EVYA 4HH4A 1X87A 3ZV6A 3F6BX 1L7MA 5AKHA 1ORIA 3SQNA 3I73A 3O31A 5IPFA 3IT3A 4RGVA 4QUGA 3ICPA 4IICA 4BWYA 2VDWB 3TRJA 1AB6A 1UKEA 2CL0X 4LOLA 2HA2A 1O95D 4KFRA 2WQ6A 1N33B 4WASA 4P7FA 3SC4A 2ZZNA 2GBFA 1OIPA 4FYPA 3IQHX 2UZ0A 3DKVA 4DIKA 1WRBA 3IUJA 4EQ6A 1X2EA 1CEYA 3PQ6A 3M8KA 1QSGA 3TLBA 3WK7A 3WS7A 2X9GA 1DCFA 3K3PA 2H0AA 3TRFA 2UUBB 4L0QA 2J3JA 3HU1A 1M83A 1PSDA 1RYEA 5BSHA 3LKBA 5G02A 2O06A 3D5QA 5F3DA 5AWFC 4EG1A 1CZRA 1KFEB 3KC2A 3SEFA 3CB4A 1AK1A 1W30A 4G9EA 1N2ZA 5I4IA 4HAUA 4DRXB 4NXMB 3QOFA 5EQJB 3LMKA 1N2CA 3N7UA 3UJNA 3QVTA 4YWHA 4CQMD 2QGFA 4RVFA 3Q7QA 3GUUA 4RU1A 4XQEA 2J9ZB 3PQCA 3T3MB 2ZIFA 4DR1B 5IFLA 1SH7A 2I87A 1IBCA 1CYEA 1KBOA 1MN3A 3G7NA 3QF4B 4OVZB 2ILVA 4FFMA 5FD8A 1QP0A 3QLUC 2UUAB 2MDTA 3DFUA 3E9YA 2I2WA 3OJWA 1OWPA 1JIIA 4R2XA 1UXJA 1PVOA 2EF1A 5BV2P 1TPYA 2QLJA 1DKLA 2D62A 3HB1A 2W8ZA 3OT1A 2FK7A 3QYPA 5BR8B 4ZT7A 1I13A 3CLTD 3OLYA 3ICQB 4PFKA 3OCVA 1IJKA 1QVVA 4LFCM 3LF1A 5FBRB 4QYIA 1QMGA 4KG7A 4Q9IA 1U1IA 1E9SA 2QVZX 5E4JA 3WNCA 4BWVA 1NVMB 2WU0A 2QNIA 2DTEA 4D3ZA 2G80A 4QWWA 1Z75A 2GPYA 4H1HA 4Q6BA 1JR3A 3FTPA 3SGLA 2RGNA 4UU8A 3K35A 2QMOA 1F2TA 3SJAA 4CFYA 1D2NA 1NJFA 1TUEA 2Q7XA 2DY0A 9ATCA 2M6KA 3ROFA 4P4GA 4KDFA 3ZW8A 3GEMA 1AZSC 5TEWA 3HVKA 3QEBZ 3LFUA 3EA4A 2PA0A 3EISA 4NWIA 2QL5A 2NU8B 1ZMTA 9LDTA 3GOQA 1RHUA 2OV1A 3PQ8A 5L3SB 4Q4CA 1KU6A 1JVNA 2HLHA 3FWHA 4EO4A 2Q4OA 2QIPA 3O4JA 1IUPA 4U2EA 1W94A 2YMPA 5CJ2A 3W4IA 1Z82A 1NW4A 3GEGA 4RFVA 1NYLA 4BVHA 4J29A 4KYIB 2BFBB 4L8GA 4IGAA 2P5UA 4KR9A 3L6EA 3NHBA 3NWEA 4OK6A 3SPXA 3THOA 4X92A 2F5QA 3TEJA 3U6CA 3LA8A 1T5BA 2PLRA 2HIGA 4X1YB 2VC2B 3UK1A 4FFSA 2F8TA 2L18A 2W8BB 4GWGA 2EHDA 3LHKA 4NEGA 4HWTA 4Q9AA 2NU9A 5FRDA 4BGVA 1BN6A 3NEJA 4JQYA 1J1ZA 2W48A 4MVJD 4NF2A 2G1PA 4R7GA 2R6AA 2WQZA 5C1PA 3CVOA 1W93A 1YMQA 3MT9A 1PHPA 2D8AA 3PTLA 3SAJA 4UQOA 3V4PB 2FR1A 3UJDA 4Y2TA 3ZWBA 3KJFA 2YW2A 4HGQA 3W8EA 5FNVF 5KSPA 3ZTTA 4BB5A 5AKJA 1JPUA 3A2LA 3PENA 4EBFA 2ZS7A 3DTVD 3DE7X 2PMKA 3D6AA 4LMPA 5MFZA 3HCFA 1UT5A 2GAJA 3GG2A 2YNMD 2ZAYA 1DXQA 2B8JA 4FLFA 5GMOA 4X66B 3DL2A 1TD9A 1DGFA 5I7SA 4LHZA 2I4NA 2WP0A 3GFOA 3GMSA 3MEQA 3O4HA 4K05A 1JI3A 4O08A 4ZJZA 4BXOB 1Z7WA 2X49A 4LJLA 3NKLA 1GPDG 3H9UA 1II8A 1KDOA 3A1VA 5B4UA 1Z5GA 2A7QA 2ZAMA 2VF8A 2B8NA 1KAQA 1C4KA 2ZCVA 2ZG6A 3H1EA 2BF4A 5J9FA 4AU1A 2ZJAA 3EBPA 1JFRA 5KOHB 2EW2A 1QZ3A 2CLSA 4WECA 1QYVA 1LW6E 2CNWA 3R6LA 3U4MA 3LLSA 2G7MC 2F59A 1K3UB 1XGKA 2M1ZA 3K9CA 3AVQA 4J07A 3T3EA 3VR5H 1NZDA 1GNQA 1I32A 4P35A 1UC9A 2Q99A 3OZVA 1TUBB 2VA9A 2OUIA 2CB0A 3Q6NA 4GZMA 4LXXA 4ENSA 4MKFA 5JEDA 4NMLA 2ASVA 2I1VB 3DZKA 5CXXA 1EUZA 2V7UA 1DMRA 1OF1A 2GEUA 4BLPA 3QVUA 3AIMA 3IAEA 4P86A 4X93A 2BTEA 2IWHA 5G1PA 4JXJA 4CG3A 4V24A 1EXDA 5FB3A 5HMLA 4N0PA 1JALA 1E7YA 1VPDA 2BH9A 2HSGA 2Q3FA 1HF3A 2J3KA 3HCAA 4F93B 1XRLA 4KB5A 4B6RA 1T9CA 2HO4A 3RSGA 2BM0A 4GX2A 1H4VB 1GLNA 3FTDA 5ITQA 1N7JA 2GKOA 2ZITA 4S1OA 4YP7A 4CI0B 1P75A 4LHWA 4RPLA 3NOOA 5FBWB 4V0SA 1SVLA 2JIBA 3L8EA 5BQPA 3RGSA 2IBMA 2YJNA 3CONA 2I8LA 2QQGA 2XX3A 3MSCA 4G4IA 4C5AA 1L1EA 3I6QA 5K01A 4P7KA 3HKEA 4H1TA 1N0WA 4WHMA 2XDQB 1NNEA 2I4LA 4WLEA 3X2EA 3E0XA 3BE5A 1XP5A 3PEUA 4HMOA 2J0UA 3RRMA 5HZGA 5JNVA 1E4VA 1E60A 1I2MA 1HMPA 4GICA 1QQ5A 5EC8A 3VR4D 1WTCA 1XZPA 4I08A 3N2YA 1FYFA 5CFRA 5MGNA 4JX8A 4IEFB 1NJ8A 4RHFA 4CUZA 2ZQYA 1U94A 2VHWA 5A05A 1KVQA 1R5NA 4H7EA 5CIWA 1T3HA 1VECA 3CLTC 3EW7A 2Q4DA 3UJ9A 1BX0A 1QRTA 5AVKA 2C5RA 3JR3A 1ZUNB 4AN1A 4JELA 4N82A 4KL8S 5K3SA 2JFPA 2VLIA 1X70A 2JAOA 3JATA 4L76A 3OH8A 3DMNA 2JIZD 4HRYA 4CQLB 5DWQA 1NRXA 4QOJA 5LBUA 4OUDA 3NVMB 1AS2A 2Q1UA 1RYZA 2D7DA 3TLGA 3TTVA 5CLLA 4RXUA 3I1FA 2HRDA 3DDSA 3T3NA 1G3RA 5L7WA 1H94A 4MCIA 3AP1A 1ULUA 1X8KA 4TRJA 3T9BA 3NI2A 3HM9A 1XXLA 2A3NA 3L0YA 3V4FA 3GLFA 4F92B 3ZV4A 1DCTA 4I14A 4IOMA 3ZDBA 1XZGA 4FYHA 2AG8A 4LYAA 1FFEA 4EMSA 2R6R1 1YO6A 1K7YA 1UXIA 3T15A 1YE5A 2BZSA 2OWDA 2Y4NA 4Q9KA 3RVPA 3OG9A 1SWWA 5AK4A 2WJHA 3B1YA 4DNXA 4EVIA 3IT0A 4OHYA 1ENZA 4NXNM 3KFXA 4OHWA 2GO1A 1GL3A 2VJBA 5ES4B 2O3TA 4WKPA 4ZOAA 3RGGA 1V4VA 2WSBA 4BNXA 3EFOB 4V2IA 6CHYA 4PZDA 4EGQA 5IXYA 2NVOA 5IREB 5DEIA 1G8YA 2GSWA 3P0FA 1UAGA 1YIDA 3LGAA 3AQ4A 4GOXA 2OCGA 5AESA 5HFAA 3U6SA 3CVYA 2EJWA 2VL7A 4BKOA 4KRFA 4NZ9A 4EHHA 1D03A 3BMXA 2R8YA 4A91A 4CYMA 3U3JA 1EP2B 2Z5FA 1YQUA 1W44A 4MARA 2R8ZA 2MINA 3N0RA 5B58C 1Z5UA 1W59A 2GCPA 2WTEA 3DOCA 4ID3A 1SU4A 2C59A 4FFBA 1M6VA 1A88A 1T9ZA 3DBIA 2ZIXB 4ZYVA 3KYDA 5ANRB 3OWXA 2AOXA 2WSLA 4F4UA 4Y1EA 3EGDB 7YASA 4MJ3A 1OB2A 3BFKA 1EVLA 4OB8A 1JEQA 3TMKA 3W5CA 2W7TA 3SX4A 3QUAA 4P58A 4E5YA 3PS9A 1IRXA 4JK3A 4MUIA 1KZ7B 4KODA 1RZRD 3VJRA 1TDZA 1X3LA 2O5VA 4OQ4A 1RP1A 4HPWA 2AEFA 1OTXA 3BEDA 5CNMA 3VSCA 1DHTA 1WU8A 1Q19A 2QUJA 3D6JA 4RWZA 1FC0A 4ZU1X 3W2TA 4EJ2A 3UAOA 3KT8A 3HXMA 1FFYA 2Z43A 2XH9A 1DJQA 4B40A 4D6YA 2G5CA 4U7GA 2CK3A 3GQVA 3WLRA 2Y4OA 1IATA 3LPMA 2QAGC 1T2FA 3DO5A 3QFHA 1H1DA 4G6ZA 2SKCA 3WYAA 3LC0A 3UTCA 4EVRA 1CR1A 1WS6A 1G18A 1PFUA 3FBGA 3VGJA 3MBKA 1JHRA 2MYPA 3AR6A 3NB0A 5G1OA 1BXGB 1ST2A 1P0MA 2CVPA 3W5IA 2C2MA 3KWMA 4NJMB 3EFHA 3JSXA 4XH9B 1NWHA 1PR2A 2GWRA 4HQRA 1EVKA 3RVJA 2IODA 4NHOA 3RYFA 2C7OA 1SXQA 1PT5A 1CUJA 3MJDA 4NI5A 3I9NA 3VO2A 1FW6A 1QE0A 1HG1A 1NNLA 1VE9A 3A4LA 3D81A 4AP6A 1P0PA 1W4AA 1BVUA 3DVAB 4G1EB 4AJNA 1O0CA 1Q1BA 2YMLA 4HZIA 3W6OA 1YR7A 3OPXA 3R23A 4CN9A 3AL0C 4BFWA 5IUJC 4B7ZA 1GTZA 4JWTA 5CDFA 2DBYA 2IIVA 3RIYA 4O29A 2W2XA 1QYIA 3ENNA 3INYA 2WF9A 2FLKA 1MAUA 1W35A 2A2ZA 4P9NA 3QPWA 2EFYA 4RKEA 1R88A 2CN1A 2GASA 4EPVA 4MW0A 3NATA 3CWQA 2IU4A 1OT5A 2Y99A 4QQ8A 4S1VA 2E9SA 4GEGA 4N5LA 2HO5A 4CDGA 3LVQE 1G5IA 3L9WA 2DZNB 4YJDA 1WD7A 1G3IA 3C3AA 3ZJVA 4JQOA 4I50A 1KXZA 1KEKA 3G0IA 3MWJA 2AG5A 1I51A 1Z68A 4G86A 4LRTB 3VU0A 2X0FA 3AFMA 1DBPA 1F1JA 4OGKA 4KQ6A 4G4RA 5DNYB 3NXSA 5AM1A 2RGEA 2YYSA 5LNK1 5EIAA 1H0HA 2J09A 1AXGA 2N46A 4IIJA 2EZUA 4B7FA 1XQ9A 3LBFA 5E6RB 3TLXA 3K0FA 2GNOA 3VNQA 4D79A 5KHOC 3G5UA 2XCTB 3H6GA 1DL5A 3RSQA 3W4JA 4Z6KA 4LCBA 1KTVA 4G36A 3BK1A 4ND5A 2I34A 1RI4A 3MMZA 5D87A 3TBKA 4N0EA 3QVJA 5JXGA 3BB1A 2GPJA 1Y6GA 4B76A 3A9TA 4UASA 1X80B 1R0YA 3DMTC 1GTG1 3UH1A 4LF9M 1GAQA 3AEUB 2CXSA 1SRRA 5K20A 5EUBA 1QUSA 4EG7A 4DQ0A 2UUCB 3JQFC 3H3JA 3AW8A 1UBUS 1AT1A 1D2AA 2CL6X 3BPSA 1BOOA 1ZEJA 3KJQA 3L8FA 3P0JA 1VMKA 4J1SA 3VX3A 3S2EA 2A5DA 2NZUG 1GO5A 1C8LA 4UJ5A 1C0LA 4MYUA 2NV2B 3KDSE 4FE4A 2PLAA 1BE8A 2NUTA 2FG5A 1K06A 3EBLA 2J5RA 1UODA 3OWHA 4K9DA 3LP5A 3VR6A 4Q4LA 2VHQA 3KXIA 3FDJA 4B3FX 2IZ1A 2R46A 1F8XA 2OAQ1 4RTJA 3KXDA 5C8XA 4H59A 1EVIA 1XDBA 2ZRAA 1U81A 2IDKA 4LF6B 2ZYAA 3WKCA 3D7KA 4XSGA 5DCWA 3AJDA 3QJYA 4WNYA 4H17A 5E3JA 4BMSA 1C7YA 5KJ6A 4RGYA 3UMRA 1USVA 2EJVA 1II0A 2QM7A 1PRBA 4HDOB 4ZODA 3M6FA 4OHMA 2H08A 2QQ0A 3LWBA 3SZOA 2IOFA 3JVIA 3LJKA 4LXQA 3UUFA 2RGRA 3M81A 4YHHB 2H92A 4MRNA 3QQ5A 3FHCB 3HVIA 4OOEA 5C4GB 3NRCA 3EXIA 4JZKA 3I01A 1PFVA 4NENB 1BH2A 3L1IA 4TLDA 2NV6A 4PWZA 5KQSA 1PNRA 3HRIA 1XDUA 1IBKB 1DFIA 1SBHA 3MCTA 4LI0A 4L8WB 1NHWC 4PY2A 1X9GA 2GKGA 1OGYA 2R4TA 2X86A 3F2IA 4Y2PA 5AXDA 4KDEA 3ZHUA 5C3MA 4KQKA 1T6ZA 1RYYA 3GYBA 3B1VA 4TSRA 1K8XB 2BLLA 4R81A 3HKPA 3MWDB 2J6HA 1U3GA 2GTPA 2P77A 3OLCX 4WV3A 5JO0A 1QLHA 4JI1M 1TQ2A 2YXBA 3AO0B 4ER7A 2G5PA 2QR5A 3G2IA 2VUSA 3TB6A 5JAOA 2ZVQX 4LYYA 4JR2A 1CQIA 3UK7A 4E03A 1B16A 1H65A 1ZP6A 1VJGA 4UM5A 1JMVA 1MR3F 1X7WA 4TTQA 3B3GA 4Q21A 2Q9CA 4Y0AA 5ECYA 5B1DA 1FXWF 3S28A 3VZDA 5AHXA 3M83A 4MLPA 4CGZA 3CCCA 3KZXA 4Y2QA 5DYIA 2ASEA 4MR7B 4MZDA 3COVA 1D8TA 4DBVO 1MEEA 2QXTA 3SXUA 1J0BA 1NVFA 4Y2YA 2FZWA 2WJ6A 4MUGA 4DSAA 3QE9Y 4BGEA 2FEXA 4O3MA 3D4LA 1ZFNA 5DSZA 3KU4A 3CCFA 5IBRA 1JQLB 2FWMX 2O2ZA 1ORVA 1HMYA 3I5UA 5FOXA 4F4JA 2QS9A 5JQWA 1U99A 3BWEA 5HKAA 2VQ6A 2AXNA 1KNXA 4QBFA 2QNBA 4WLUA 1TC1A 3AEYA 5JPIA 4OOFA 1UBEA 2KB0A 3ZHZA 1I94M 2ZTDA 1BJKA 2CXTA 3VR0A 1H93A 2F4VM 1G8FA 2Q3HA 4Z9XA 2DQZA 3GARA 3N39C 4JU8A 3KSZO 2R79A 1QIMA 4LQCA 1VL8A 2JHPA 3IUQA 4O5OA 1RWBA 3PWZA 3QI2A 1JXMA 1PZMA 5J2UB 4JBHA 3FR7A 1W0KD 2NYVA 1U8FO 1JHMA 5H37D 2E85A 1HK7A 3EEYA 4NP6A 2QP3A 1LK0A 4Q4HA 3WQHA 4A0HA 1VM6A 5ALPA 1P44A 2B4AA 3RK0A 1E1LA 1FSFA 1VKZA 2Q28A 2R4UA 4NX2A 2VNJA 4CEHB 1O0SA 1VLHA 4JR1A 4XD2A 1EWRA 4R1NA 4YXWD 1LC3A 4NDZA 4DA0A 1GGHA 1B41A 3RUAA 4IM7A 3W2HA 3ZIAA 5EHQA 1YR9A 4FFVA 5DNDA 3FFAA 1JIUA 1BSVA 2TS1A 3I04A 4AS3A 5IVPA 3LOUA 3EASA 2OLEA 3U0VA 4DSOA 2KX7A 1I14A 4X6LA 4IDGA 4G24A 5ITSA 1K66A 1LRJA 5C8YB 1NLUA 1VQ1A 1YS2X 3BF7A 1D1PA 3RUDA 4B85A 2E5WA 3JW8A 3GJ4A 1F5NA 3KTAB 3ROKA 3TZQA 4C04A 2TRSB 3NGMA 2FJPA 4L2IB 2GHTA 4GEKA 1J00A 1KJIA 4WY8A 2XYGA 4UNQA 5A9TA 3RTAA 1AO0A 5DN6A 1QFXA 2HEIA 3JQGB 4YEDA 1Z28A 5GINE 1DIBA 4RSMA 5IXSA 4G1FA 2X8WA 4D8VA 4DJDC 1CIVA 5HUHA 1TQ6A 3G2KA 2CGEA 4KK3A 4PF1A 2YNMA 1UWKA 3A4YA 4AI6A 4CV0A 4HN4B 1JB1A 5DULA 3NG1A 1M2OB 2QENA 2X9VA 3CKKA 3RVQA 3AI1A 3VOTA 4EA6A 3L82B 2CMKA 2CJWA 2W2TA 4NSNA 4PG8A 1PLLA 5MFPA 2QTWB 3KSBC 1AU9A 3BXHA 4Q1AA 1ISRA 2IL1A 3QX7A 5IJZA 4OV6B 4AVYA 1OFTA 1E9AA 5DH9A 4M89A 3V8VA 3X43A 4BC0A 3AW9A 1EA7A 3GI1A 2PL9A 1QB8A 1UJMA 2QD3A 3NC4A 4L51A 3PUZA 1KGDA 1XNHA 2JLXA 4JFRA 4LDJA 2J5XA 1OMOA 2CV0A 5CCXA 4MRPA 3E81A 1W0CA 2CVOA 2VIIA 3LU1A 1QP7A 1H2AS 1CUFA 3CLKA 5LXTF 3P19A 4OQLA 5P21A 2EJSA 1Y3BE 3AP2A 2WUVA 1XAGA 3IILA 4HV4A 3KG2A 2IEAA 1ENOA 1XTKA 1ZPDA 2FPSA 2DAPA 3HCOA 3ZE1B 3UBTA 2IY7A 1TZ2A 1X9IA 2IE8A 2VPPA 3LUPA 4KR0A 3S3TA 3L26A 2HA4A 4II7A 3BBPA 3HFJA 2R60A 4PFSA 4UTXA 4Z9BA 5J2TB 2VP4A 1KZGB 4BZXA 1WXHA 2WDPA 3R0JA 4GXTA 1PX0A 4JEHA 4D0LB 1NATA 4B84A 1BJTA 2PY6A 1NUPA 2I4IA 2A1TS 4C7MA 2HYIC 1HQYE 2XAUA 1X1AA 4ZVVA 3ORYA 4E2WA 4N5DA 4MVJM 3TDKA 3OX3A 2YWXA 5CVEA 5CXQA 1TEZA 3VZQA 1BFDA 2CNBA 2DWZB 4EENA 1WDTA 3U7RA 3IJ5A 4WFJA 1SHJA 3X44A 3U19A 3C8DA 2XOKD 2JVJA 2WJGA 4TYYA 3DP9A 5ALWA 1E9VA 3ZV3A 2Q49A 3KSJA 1JT2A 1LB1B 2M98A 4ND3A 4UCFA 2DFKB 1TTHA 4NSRA 2C1XA 2O23A 2Q6VA 1SY7A 5HIJA 1ZONA 3DC7A 3S0JA 4JROA 1MTZA 2NACA 3T7EA 6ABPA 2AF4C 4PO8A 1ORDA 3PFIA 4IFEA 4MMYB 3GBPA 2B4YA 3PG5A 3Q3EA 4GMQA 2NUAA 5ECGC 4EGAA 3A6GA 1GPBA 3QNMA 5KQLA 2HK7A 3P9YA 5CT9A 1EFKA 1L5SA 3EPRA 2Y76A 4E6PA 1DQPA 1OHHA 3E6AA 3FH0A 3QKWA 5TDHA 3U5TA 4I9GA 2J31A 3HYLA 4QWMA 1UKCA 2DEUA 1FSGA 5T3UA 3E1KA 1BHSA 1L4GA 4FE3A 4OYRA 1CF4A 1R0SA 3UN1A 1A7KA 1O8BA 1O97D 1T29A 4NJEB 4AYWA 2C20A 3W5VA 2C2KA 1KAHA 1A1VA 2EW8A 4Y2RA 5KREA 4IOLA 1E6MA 4NK5A 4JWKA 4BVFA 1I2CA 4RYLA 5T8KA 3ZBUA 4C29A 4Z8XA 1E1MA 1JR3E 4NCHA 1US8B 1BEUB 1E20A 1YDHA 1L4MA 3PUYA 2BBTA 2N47A 1G8JA 3OEWA 5TT0A 4JQCA 1TK2A 1DAPA 1X13A 1CS0A 4BLVA 2P90A 1D6NA 3FNFA 4YHBA 4XI9A 5LWHA 1NO1A 2GZRA 4UATA 4MV0A 1W2GA 2PYDA 4C22A 3H4TA 1G60A 1D4OA 1ZYUA 2ZBKB 2BGNA 1PJJA 1AGRA 1ZMWA 4UDXX 3K9FC 2PD4A 5ALHA 1RJGA 2DKNA 1J8YF 2BFCB 2R6JA 2WE8A 2FPGB 2ZBQA 3FR8A 3MT7A 5CEEA 2Z6VA 3GP1A 3KW6A 3DB2A 5H59A 4AT1A 2XYVA 1V45E 1IHXA 1Q1GA 4NJOA 1ZK2A 4Q9LA 2IYYA 3EF0A 4FYJA 5F9MA 2FZGA 3RVNA 4EYGA 5CDUA 1HFWA 1K5GA 3FRJA 4OA8A 1LPNA 5GJBA 3JD4A 3WFIA 4CMGA 1WTAA 4ETNA 4O2BF 5IVHA 4KE9A 2GH1A 4B3SB 2LVBA 3NR2A 4A1FA 5LQRA 1B93A 1NW3A 1XZJA 2NYUA 2GNPA 2G8LA 2IV7A 2FN7A 2PNFA 4N3CA 4BE9A 5A9RA 4YI3A 3ZXYA 1FTQA 4JFAA 2W6NA 5D7BA 4YRPA 2B8EA 2IK8A 3KNZA 1GU1A 4HLUA 4JSTA 1IMJA 5SYMA 3TCKA 3ZKAA 4PZPA 4LMAA 1P73A 1ML4A 5K4AA 4XTCS 5K3DA 4NV3A 4P36A 1TIBA 3ND8A 4JOSA 2PUEA 5CRIA 5DMXA 4Z7NB 1J2EA 1RJDA 1ILEA 4W8GA 2D1YA 5DEOA 3E7WA 1OFUA 2WF8A 1PZHA 3BSYA 4CKCB 4EATA 4KSBA 1A8IA 1IZYA 2CNNA 1T2AA 4QYTA 2I7VA 5EHIA 5KTSA 2G70A 3IAS6 4RA9A 3TGPA 1PR5A 1TMYA 4H3HB 3UG7A 3LA6A 3QKIA 5EWJA 4C3OB 3MTAA 2IY9A 2X0RA 4G1MB 4A0FA 3Q3HA 1M1ZA 2P7HA 5T4EA 1XA0A 3N86A 1A95A 1E2BA 3SFZA 1H6UA 2FY8A 3A4TA 4BO2A 3EWSA 2H2WA 2BKEA 2C42A 2WG1A 4P7BA 1QPBA 2IF2A 4LZJA 3BGDA 1GL9B 2F1KA 4WMLA 4GC5A 4MI9A 4EKGA 2DB3A 2PZMA 4X7MA 1IG0A 1NQWA 4KK4A 3O92A 4JLVA 3TWLA 3LVVA 4ZDIA 4M1KA 1U04A 4NMXB 5T6BA 3DMFA 3SEZA 1YFJA 4QOHA 4BU0A 5EE1A 4G1BA 2FSHA 4ER0A 1UJ5A 4YUAA 2YYZA 1F3OA 1P3Y1 3LPAA 4IYJA 3TIVA 1XLTA 4EFLA 4QU5A 4US2R 2CUNA 4IHJF 4QOIA 4L7QA 5LPNA 4HVAA 3UPUA 1SHTX 1YS6A 1SOVA 1J5EM 1B15A 3IULA 2WJVA 5DYWA 2A5YB 1V5IA 3AJIB 2BEWA 4I5SA 2ZI9A 4H7FA 5C81A 1I4LD 3EFEA 4MUHA 2WBLC 3JQBC 1E92A 1UMBA 4CQJA 3GD7A 3K1JA 1CEXA 1CJBA 4GZ5A 4RULA 2A0WA 2V6MA 1J70A 4PZYA 4Y28F 1QE3A 2I8AA 1A9TA 1N5IA 3UHAA 1UOPA 1Z6TA 4ESVA 3HO6A 3ZE8A 4XFDA 1J21A 3R8CA 2A5JA 2FF5A 1ZAYA 4KGVA 4PXSA 2AQIA 5IYZA 1EFCA 1EFRA 5F23A 4HLUC 1GPKA 3F1LA 1OAIA 1S2NA 4C4OA 4DJ5X 4DF3A 3H11B 1Z33A 2Y0BA 2WUEA 2AFHB 3DH0A 3U3KA 1IVNA 1FCJA 1PGOA 4R69A 4BV2A 1RNLA 4DRYA 1AC5A 1KZYC 1N8KA 1QIIA 2PSEA 4G3XA 1KZ1A 2JGLA 2I5PO 4LWQA</