3C3DA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and phosphate. northeast structural genomics consortium target mar46
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
b'MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 89
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3dA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3dA01
2P0YA 3C3DA 3CGWA 3C3EA
chains in the Genus database with same CATH superfamily
2DWQA 4RETA 5F5XA 1EA5A 1Z73A 3FUXA 2FZLA 4LSMA 3W7VA 4BO3A 3BMOA 3SIXA 3I6ZA 5IBPA 1N36B 5J4HA 5F1PA 2WG0A 5JMPA 3VHLB 3ZXSA 4I6JA 1X37A 4KK4A 3QU2A 1JFRA 2B1RA 3QXGA 3SICE 5HWSA 1REQB 4B8YA 2MTBA 1R6VA 1RZVA 3OJEA 4FOSA 1S7CA 5DI3A 3I64A 1QYIA 2R4QA 4MK4A 4JI2B 1T2AA 3FNEA 5D1HA 3DSRA 4F5WA 2C3OA 3FCXA 4MGIR 5BORA 5C5DA 1JE0A 2F17A 4M87A 5A04A 4GYWA 3DLAA 4EJFA 4BDTA 5K05A 3PDUA 3BH0A 4B3RB 4LKRA 4X7RA 1MDBA 1AF7A 4OM8A 3DD1A 1M66A 4INZA 2WNHA 2ACWA 4NAVA 3OZCA 2O7NA 4OEHA 3TQHA 3GMIA 4TLDA 4JYMA 4Z6KA 4N0EA 1JLMA 3I1FA 2RH9B 4L8VA 5CJ2A 3A37A 3PITA 1QK4A 3ZI7A 2AZ4A 3B60A 3G2OA 3WNDA 4C22A 2GN2A 5GZ3A 1JUDA 5AVWA 3EZ7A 1NMSA 5IULC 2VRCA 1M1YA 5IC5A 4DF3A 3PI6A 3RU7A 4NFHA 4PCAA 2JP7A 2HWXA 3CM0A 3RRZA 3ZU5A 3RK4A 1TL7C 3IIEA 3BERA 3MJSA 3E0XA 1G8GA 3R5FA 3PXXA 2IDMA 2ADMA 4K9PA 3B7PA 2XWSA 4I4TA 4A92A 5BUSA 1YL7A 4J0KA 2PWYA 3AVQA 1PTJC 3KVRA 4ZT7A 4JL6A 3IUYA 1JIJA 5CAEA 2VT3A 4TXJA 5I7FA 4FFBA 3AUUA 5BN4A 3R3UA 5FNZA 2O2DA 3DZKA 3K9GA 3I34X 4ER5A 1QHFA 2TRSB 1I6KA 4QO7A 3SYLA 2D62A 3AVPA 4H27A 2G06A 4HGQA 4QBGB 2ZM6M 4WOJA 1JWLA 1OX5A 3EBPA 1I4LD 2FPGB 3BTSA 2MDTA 3BXWA 1BJKA 3OOEA 3PPYA 2R66A 3FAKA 5LQUA 2XVZA 3R1IA 1UK7A 5IJ0B 3WNZA 3T7CA 4EYOA 1U02A 4RK1A 5EJEA 1J8VA 4DYHA 2QD5A 4ZQCB 4X1IB 3QZUA 3U49A 4NBNA 3RFXA 2C0CA 2CDAA 3PNOA 2CJFA 4YRMA 3L0PA 5NLLA 3LVBA 3MGKA 2FX5A 1RM4A 2QTWB 4UD6A 4JA2A 5J9FA 3VK8A 1DXYA 1ISMA 4WFKA 3TVTA 2PT5A 1UJ4A 1CVIA 2ZUTA 2JLYA 2XYRA 4EB8A 4ZCTA 2OO3A 1SIOA 2V59A 4P38A 4BLUA 1GZUA 2G1UA 3CS3A 4BP1A 4HT3B 4TLCA 5ARBA 3RWOA 2V7WA 1YK1A 4OAOA 2SHKA 2CXHA 1D0MA 1QDUA 4PW0A 3BE4A 2K47A 1IZZA 4UDXX 1QE0A 1R1DA 1LPSA 4LZLA 3BBZA 5LYJB 4AO8A 2PDAA 3OMWA 1T10A 3D4LA 2W8BA 3DTVD 2XYGA 3SHTA 3ROKA 3ZKAA 2XCSB 4ZEMA 5CEJA 1V5FA 1DEAA 5HUJA 1GCAA 3NAMA 2OENG 3U4AA 1RM5A 1UAYA 1G8SA 2UZ0A 4QG7A 1L7AA 1DIRA 1RCTE 4GWLA 3OIWA 3WMFA 2HGZA 5CX4A 5AI8A 1FJ2A 4OMFG 3TW4A 1RHJA 1HDIA 1IBMM 2LPMA 3MT9A 4S0ZA 3PRYA 4MEAA 1L5VA 2GZAA 3TAUA 2WR8A 2IY8A 3GLHE 1G5TA 2AUMA 4EG3A 2V9ZA 5TC4A 3IMFA 3I12A 2VA9A 4N65A 4K5QA 2Q4BA 1DQNA 4EYSA 4DLAA 4HFNA 4LMBA 2I4LA 5FSWA 1P18A 3C1TA 2IIVA 3T7DA 2D5AA 1NG1A 4NE2A 2HSDA 4D9EA 2VCHA 1FRQA 1KJQA 2QTZA 3HWSA 4ECEA 4TV9B 3L8DA 1IPHA 4FN5A 3EDYA 4D9JA 4QA9A 2VNHA 5HJEA 4ES6A 3DAHA 2QGZA 5T4HA 3CLSD 4BFUA 3AFGA 3QYEA 4EK9A 1NT4A 3ANXA 2P2NA 1XHEA 5CBPB 1VBKA 2HT6A 4PBRA 1TF0B 4Z4CA 4P5EA 5KYYA 2YHAA 3ZNQA 1DKOA 2YICA 1RYBA 1E79A 3LXUX 4U8HA 3SFTA 2VDBB 3R4CA 2FMFA 2PFGA 3AHJA 2W6PA 1U7TA 1DC8A 1N5MA 3IESA 4PLFA 3A98B 2RH8A 1E61A 1BG6A 2WTAA 2QYOA 1DWUA 4E70A 1WXEA 3C3AA 1JMVA 1LNSA 3O90A 4JJKA 2XBMA 3CF6R 5F76A 4Z5XA 2O8DB 1V7CA 4LNUB 5H59A 4X8OA 4EARA 3UAYA 2EX0A 4YRPA 4QXRA 1E8NA 3RIHA 4QTYA 3R3YA 1XU7A 3UEOA 6LDHA 4JQSA 2DPMA 5AHWA 1MB3A 3VO2A 4TS9A 2V8BA 4GBED 2F9FA 1OU0A 4X97A 2JY8A 3KETA 3THRA 1XEXA 3NGLA 2OM6A 1P2VA 3ZE7A 5IM4A 4XGRA 4CUKA 1FX1A 1O94C 1W85B 3MB5A 2IHTA 2P5UA 1VIYA 3TW8A 1H23A 3X44A 1OFUA 4LJ4A 2PMBA 3THSA 1G0OA 2OUIA 3BORA 5B1DA 1M0TA 1ISGA 1WXHA 4BJ1A 2Q0QA 3GLIE 3CYFA 5HK8A 1HT0A 4MHTA 2W2MA 4OK6A 1JR3A 1UKAA 4AL4A 2F2TA 3EZGA 4N6GA 3A7EA 2AW5A 5JI3E 3SS7X 4QRDA 3WLLA 2O3JA 1P19A 2WKQA 2BGTA 3DZGA 2QP9X 5AI0A 2P78A 4OU5A 3AUYA 4YHHB 3R4VA 2ODEA 5KQ8A 1KRXA 4I9UA 1DKLA 3FDZA 1ZSNA 4RF4A 5CURA 2X0FA 1K88A 4XD7D 3MWYW 1HTTA 4OTZA 4G5OA 2KW5A 4QHSA 4TMWA 1G59A 4F5ZA 2FWRA 5D2CA 1JLHA 4BQEA 2W11A 2YWXA 1NU6A 1K86A 3BJRA 4OV6B 4W7SA 1XNHA 1KP2A 2BJWA 3GXBA 2Q21A 4KKVA 3L79A 4RPIA 5CBKA 3NM6B 5I7WA 4RIIA 2SKEA 4E08A 3C6MA 1X6VA 2G9ZA 2HQSA 5FOXA 3T9BA 5EG5A 2EGUA 3HY4A 2ZYAA 3Q7IA 4ZQFA 3WRXC 7MHTA 2I3DA 3NTQA 1DAIA 2PUVA 3QE0A 2JD0A 3RU2A 4DWWA 1GYRA 1XZHA 1RYDA 5A1TA 1P74A 1KAOA 4JGIA 5IH3A 3UK7A 3IJEB 1ZG3A 1UT6A 4J7UA 4JWKA 4BWYA 3DW3X 2H1WA 1IONA 3JZDA 2BFAA 3HABA 4LHYA 3DV9A 2YZNA 4L0QA 3S2FA 3OX1A 2QJTA 5IAGA 4LJRA 4YLEA 5KSPA 1F14A 2OCBA 3K0HA 3ILYA 5IYZA 3NI2A 3AP3A 2X9VA 4YRCA 5JO9A 4HPXB 2GJ8A 1ODSA 4FHFA 3MUEA 1SBCA 4NEGA 3K0FB 1SXJC 1YHNA 2PO5A 2ZRFA 3ZWQA 4MB0A 1RKQA 4KG7A 2E21A 4CIXA 2BGIA 4EB6B 1N5DA 2IDKA 1L5SA 5FWDA 1MHTA 5AKXA 2B35A 1DB3A 4IBIA 2V96A 2X8AA 2YS6A 3WG9A 1XPOA 1ZINA 1BYUA 2R7NA 3DE1X 4QXAA 2GEFA 2YHUA 2GRJA 4BOYA 4RJLA 3P26A 3H99A 1QV9A 2DPXA 3QG1A 3HMKA 5EAIA 3FOZA 4XSHA 4EPWA 2H4FA 3NBUA 5JAQA 1U0FA 1X87A 4JYCA 3DZCA 4CMIB 1LRKA 1IUOA 3CH5A 5EHZA 3NPAA 2QRNA 1JNYA 1EWRA 4K40A 2PD4A 4R6XA 3BMCB 1GT91 1NDUA 2YX1A 1N4AA 4ZYUA 1AVTA 2WHPA 4MQFA 5AR1A 2VTEA 1JN0A 5BN5A 1HG0A 1JI3A 1NPDA 3TL6A 3PFNA 4KYIB 2R6R1 4Z4HA 1Z5GA 1LDEA 3MTAA 4UQOA 3M6LA 4HDMB 3DMTA 1XKTA 2VJAA 3IE1A 3H2KA 1OJ7A 5CFMA 4YREA 3WK9A 5L6LB 3HYSA 4W9RA 1T6YA 4RVGA 4H7DA 4MQEB 4MVJE 5AVUA 3S6JA 4UVDA 3ZX4A 3PRKE 4E2WA 1Z38A 5LNK6 5DBGA 1TCVA 3NTUA 5H7XA 4OLJA 1P5ZB 1YHYA 2F3SA 1QHHA 1FYXA 1V71A 4O2AF 4B7HA 4LSZA 1KDYA 2O8EA 3ZZMA 2XECA 3OP4A 4LXXA 1NVGA 1Y33E 2NN3C 1R2YA 1JHYA 4PR3A 5TB5A 2EARA 2ZIVB 1OLXA 4H9GA 1VJGA 4G0PA 5I7SA 2OEPA 1RFLA 4TZTA 3TQQA 5BW4A 4X6XA 4REMA 3DW1X 3O2SB 5CFNA 1ZA1A 5KCMA 3FMOB 2HL7A 4IINA 3EOAI 4LPSA 2ZUSA 4HMQA 4QQRA 3T1HB 2DHCA 3UQZA 3HI6A 1W47A 5EIWA 1JB9A 1NW8A 5JZMA 4F12A 1IBLB 2I80A 5J2TF 4EELA 4UUNA 3EXHC 4ITQA 2XNJA 4K1LA 3J7AC 4F1IA 4L9SA 1WM1A 2AE2A 1MX1A 2VPWA 3ER9A 3K35A 3TRFA 2I4RA 1A5ZA 4F2LA 1H4VB 2DQKA 4MQUA 1II0A 1TI7A 4YQEA 1UZLA 3MCUA 4JITA 1OXSC 3EIFA 2UXDM 1SBNE 1GRRA 3H13A 3LHSA 4OQXA 4PCVA 2VHTA 1VRVA 3RAFC 4OHMA 4DCCA 2HU7A 3ZI4A 1NUSA 4RA6A 2GPWA 3QLTA 1OILA 4RF2A 3PCRB 4HL6A 1PR5A 5BWBA 1WEHA 3CVJA 4HRYA 3TOXA 4QUJA 3X2SA 2HWUA 4CYMA 2BTEA 2WF7A 1SKAA 4AT1A 1E79D 1Y6QA 3WFJA 3E4CA 4X7MA 3QKWA 4AI6A 5U4XA 3B74A 4D4JA 2G6TA 1LBTA 4PG6A 1OXVA 2XMCA 4G0OA 2OZLB 3C4QA 1W6RA 3GAAA 4H31A 2Z04A 2IVZA 2MYTA 5LP1A 6Q21A 1V45E 2SECE 3ETDA 4B43A 2NZXA 3U6CA 2QSYA 3TFWA 4FZRA 3UWKA 1JWBB 2XF3A 1YZTA 2CFOA 4YAIA 4RK7A 1QU2A 1U2ZA 4WKNA 1LVUA 4PD2A 1ZXBA 4B2YA 2G9VA 1CDOA 2O5VA 4IBFA 2ZS8A 4HJRA 3CC8A 1TDJA 4QREA 2FY8A 1KZ9A 3R77A 4TMVA 3ETNA 4PPQA 3HFJA 3PSAA 5IAKA 1XYGA 1XAJA 2XNHA 3LLCA 3FPGA 2J3QA 3A25A 4H7PA 4Q4LA 1D6MA 1F2DA 4B7AA 2FDXA 1C0IA 2ES4A 4PFJA 4ML3A 2L4FA 3K70B 2A94A 4A15A 4BVAA 2WTNA 2WINI 3IQIX 2M2IA 1S4MA 1VIAA 4DSZA 2O23A 1TTEA 2RARA 3FFXA 1AUAA 3EQ2A 1NAIA 3WBFA 1RAFA 2JFGA 3TSWA 1JKMA 1MFPA 5DI9A 4BO1A 4B32A 1D0VA 5EGSA 2EF0A 1VDLA 3KCQA 4Q7JA 1VE9A 5KO2A 3PRJA 4YAEA 3C0KA 3WJ1A 1N57A 4PYLA 2BKXA 2AFIB 1LC3A 1LZKA 1C8KA 3BHJA 4BQRA 1T36A 1T2EA 1YS2X 3A4MA 4MKIA 2QL5A 2NUPA 4E4YA 3B6KA 4JLVA 3CN9A 3QVWA 4BEJA 1GCIA 3KYCA 1F17A 2G0NA 1Q83A 3LY5A 2IV3A 2P7HA 3AIKA 2BP7B 1MX5A 2OOBA 2B9EA 1JQ3A 3E3AA 3ZBPA 5CA1A 3ZTYA 4R9NA 2G9RA 1OWPA 2C92A 2C57A 5BXYA 4MB2A 3PIIA 3NBMA 3UG6A 3MJCA 4KQGA 2F7SA 2WIFA 3I9FA 4F2WA 3OE1A 4E5SA 3S8EA 3ZE1B 4DREA 1GARA 4OHKA 5B3JC 3O1HB 1PDOA 2BHLA 2WJWA 2BGWA 3BK2A 3VOAA 1WSWA 1P77A 2C4TA 5DHFA 2FQ1A 2YC4C 4V0RA 2ZYIA 5T67A 1YS1X 1FU7A 5DNAA 1ZV1A 3IMEA 4TL9A 3HA5A 1ZS9A 1FDIA 2V3VA 2D7EA 2PX6A 1JYFA 2VQFM 1KAHA 1SKUA 3JAMS 3F8WA 2ZI3A 1QKJA 3KBOA 4YO8A 4OI4A 3L93A 1XRQA 2RB5A 1JAIA 2EYUA 2LV8A 4IV8A 4AB1A 4ZCMA 3MSCA 2V7XA 3INRA 1IXKA 4FZVA 4K46A 5EWJB 5F7JA 1QGED 4RIGA 2E48A 3BTVA 1IN7A 5DXJA 3OD5A 3R6TA 4JXKA 4UZFA 4S1NA 4CZ2A 1GPAA 3DP9A 2FHSA 4QOSA 3PGJA 5JAUA 3OC0A 1CPYA 4XH9B 2CEAA 2WAAA 1E58A 1RKUA 3EPKA 5A9RA 2QRPA 2IOFK 1IHYA 1XDGA 2QM3A 3SOZA 3M8KA 2A78A 1Z2OX 2O1WA 3DD5A 3ABRB 3F5MA 4ZGWA 1CJVC 2VCYA 2QF7A 2A86A 4NECA 1A76A 3FPKA 3N0VA 4AAYA 2R4TA 1FXWF 4RFSA 1OWOA 2WJYA 1CP3A 2RHCA 3I37X 4F2PA 1S3SA 2F3UA 3A1DA 2YZMA 4BNMA 4UXIA 1DQSA 1OI4A 2O5EA 4L4UA 4UU8A 5B1EA 3H83A 3LP5A 3IDFA 3ROMA 2DWMA 1TPYA 4NFLA 4CKWA 4NDNE 3WMGA 3KKNA 4DLPA 3T3OA 3GYBA 5K01A 4AIRA 2YRWA 3Q7TA 3IS3A 1BTOA 1TCCA 2J3IA 5GTDA 1ABFA 5DW3A 2QD3A 5FP0A 2VNIA 2A5YB 3A06A 5IAOA 3ZQUA 3RGSA 3UYLA 4D3SA 4UBJA 3GP3A 4FDAA 2GARA 5FPKA 4RD1A 1NI4B 4Y2XA 5AKGA 3QPDA 4KW7A 3HA3A 1FNBA 3SJZA 4BNVA 2GTHA 1PBTA 4Q21A 4V0KA 4HOYA 3K9HA 4NPHA 4IJVA 4TMXA 4R2KA 3D6UA 5JSZA 3KS8A 2H1LA 1NOKA 3RYCB 1VPLA 1QZEA 3A1CA 2X6QA 4JQCA 3PC3A 4RTOA 1Q5PA 5CXSA 3IPCA 4F46A 3FKSA 4JS0A 1OIPA 1RYEA 2DUMA 1Z59A 2EP5A 4DZTA 4DUZB 3CHYA 5D8DA 4FHDA 1WAMA 1OBOA 1F1JA 4NYIR 2OHVA 2YJZA 4QYWA 3T5TA 3G0OA 2HGSA 1PEYA 3KXKA 2WJ6A 3ZDRA 2J0UA 2PSFA 1NZFA 3ZPXA 1ZVJA 3EYWA 2GEJA 3RPEA 4M6WB 2Y67A 4O4HA 1YKFA 3I5UA 1BH2A 1T4DA 3A7DA 1VSVA 3O8QB 1M1YE 4UC0A 3L07A 4HCJA 2WM2A 5U1PA 3DJFA 2FEAA 1Z4KA 4MUHA 4RVCA 4TYNA 1VJ0A 3KV3O 2D0IA 2IV7A 4IVQA 3WIEA 3Q8LA 5AW4A 3IP1A 5IT9A 4C08A 4E30A 1R9GA 4EHBA 2FDRA 5LMCA 3VTAA 4QUIA 5EQFA 3A70A 1E3QA 2E2WA 2K6BA 4J1TC 1PX2A 1L8QA 5F2NA 3S0JA 7REQA 1QQAA 4X65M 4REQA 2PBZA 4B76A 1QPGA 1Y48E 4ZVPA 1KY3A 1GNRA 2E18A 1X1AA 2RHWA 5EUCA 3QVJA 2X2PA 5DT2A 1PEDA 2IT1A 4ZQIA 4E1VA 6ABPA 1ORRA 2D6FA 3CR8A 2JLSA 2FWMX 3HP4A 3WX0A 4OHYA 3UZUA 4AFNA 1SC9A 1IHUA 1KFKB 3GLIA 1SQFA 3ILSA 4NCIA 2GJ4A 1F6WA 3D6JA 1O6FA 4MO9A 3FVVA 2BI7A 5I4IA 3O47A 3FCOA 3K92A 2ETXA 2J9RA 3RIMA 2FK8A 2R6JA 1JMYA 1L2BA 3VKGA 1VG9B 2KYRA 2AJTA 1C9MA 3BA6A 3GO8A 5MN6A 2CD9A 2GZMA 4GYKA 3LKBA 1VI6A 4DA6A 1NVKA 5FIUA 3SVTA 1G5QA 4QEKA 1M9NA 3VDPA 4F92B 4AKGA 2OAQ1 2J9YB 2QPTA 2BDEA 4P93A 4I8DA 3BSSA 1NYRA 2II6A 1ECFA 3NWPA 4FUQA 1XJ0A 2O4CA 1Z2CA 4DWVA 2C7GA 1CR1A 2EO2A 4ZI3A 2ZIFA 4HVLA 4PRKA 4UOZA 4GDFA 2WB4A 4LFBM 3ETEA 2Z58A 4OGFA 2IH2A 2FUKA 1KTVA 1XQ9A 3PWSA 3TBHA 3OZEA 1P60A 4K05A 1NTRA 4CMKA 4LGMA 3WGZA 2BMDA 2GI4A 1YDGA 1RM3A 1FE8A 1K66A 1RHRA 3IKLA 5LZ9A 4QBFA 5AM1A 1Z83A 1AQNA 4HH0A 3NU1A 5LU9A 3DPIA 5I4KA 2WT8A 1XTPA 4GPZA 3AUXA 4UCFA 4CG1A 1ZMRA 3ZWDA 2Q9CA 2Y4OA 3R7LA 2QN7A 4OQPA 3OLQA 1ZUHA 2JJQA 3SARA 3W6NA 4Y3UA 4DV6M 3RF6A 4TUYB 4CMCA 1QO0A 2XMRA 3L7AA 1NPYA 3ROXA 4P3NA 4NY1A 5BSFA 1N2GA 3VR5D 1JHMA 3FH0A 3L0OA 2BONA 3OX4A 1RVV1 2P27A 4K2HA 1YI0A 5HCNA 1VL1A 2Y71A 1MENA 3QFRA 1HA3A 3USZA 1PEKE 2K87A 4HC4A 1PQ4A 1HWYA 4BNFA 5AVSA 2V9PA 4KIWA 1U8ZA 2BM0A 4KPEC 5DU2A 1TDHA 3ZHSA 2DFLA 2W58A 1MXFA 4N0PA 3VU9A 4PYQA 5KKAA 5ERYA 5KNCH 1M8FA 3B5JA 4BMZA 3NS7A 1V3VA 4E11A 3OOYA 3ICVA 2V9CA 4QSHA 4XJSA 5K3AA 5TPWB 1JH8A 3HO8A 3UJ7A 2Y6VA 1ZQ1A 3L3BA 3R6GA 4BO9A 1AB5A 1B0ZA 4N8EA 4Y6LA 4JUCA 5FL3A 2BKVA 2QJRA 2A7QA 1IIBA 3MT7A 4EUNA 5AWFC 2BH2A 4MVJA 1FNCA 4M1MA 2X5XA 2VQEB 1VMKA 1E5VA 1MB9A 3LWDA 3OOHA 4FWBA 3CJQA 4YJKA 4K9NA 2I6QA 4UVHA 4Q3AA 4RE6A 1UBRS 3WJAA 5D51S 3DBOB 4IFBA 3BDVA 2JANA 2UYYA 4C21A 4A2CA 2YWHA 4KLCA 1H9CA 3SHFA 5BMOA 2GB4A 3QVGB 3HCWA 2Y1EA 5KTMA 3R9WA 1J0BA 2C2GA 2QAIA 3VU1A 3CINA 4YT2A 1KP9A 2CC2A 3FJ1A 4EHIA 1M67A 5KYWA 2XIJA 2J46A 2HSZA 2IY9A 3ESRA 3L8FA 1ZIYA 4KQXA 3B7WA 1Y5LA 2QNIA 3LLVA 3JD2A 1WY5A 4U5XA 2QVGA 4QUGA 1GFIA 4FLMA 2WUWE 3WVNA 3C7TA 3ZCRA 2ZE8A 3QP9A 1L4KA 5JHGB 1KMHB 2MCFA 5ENDA 2ROQA 4CM4A 3I4LA 1VSTA 2HFJA 5KPJA 2CDCA 3H2SA 2PMCA 3K94A 2EKQA 2F1RA 2PGJA 1NVEA 4PG4A 2B2XA 5JSQA 1YJBA 2FZWA 4ZODA 1UC5B 1W35A 3VR4H 3CMCO 3KKKA 4YR7A 2ZRAA 3ABOB 1D2EA 4LF7B 2C4MA 3E3LA 2ARKA 2JIRA 4TKLA 5FI1B 4D5GA 4B7ZA 2QAGA 4WAUA 4WK2B 3O4GA 2B78A 1VA4A 3PBKA 5E1MA 4OQQA 1MUUA 2QTHA 3G0BA 3FTEA 1Q0ZA 2Y0BA 1RLOA 4EJSA 4DJEC 2Y92A 4I4IA 1QTRA 4R31A 4PSAA 4BC0A 3CW9A 1O96A 3L4SO 3T4XA 4N3AA 1RRCA 5FUMA 3I05A 1DDIA 3KWMA 1ZMBA 5K8IA 4CODB 3R7AA 5EE3A 3RVMA 4XYMA 3EUAA 2LH0A 1T6NA 2JK1A 1QRTA 4Y8VA 3B8HA 1M10A 4RU1A 3O93A 2PBFA 2XKAA 1KFBB 4N3BA 1YC2A 2PX8A 3UB4A 5T5QA 4BMOB 2QTVA 3SMPA 5DE3A 2YWJA 3V8VA 2OHJA 3H3JA 2OCDA 2CLHB 4GX2A 1U9YA 5EKSA 2C03A 3HXKA 3V3TA 1TLLA 4C0WA 2CVOA 3PT9A 2P0EA 3DDUA 1NHGC 1CV2A 3K1AA 4G4NA 1T4BA 1B2LA 3MTBA 3TQTA 2GNOA 1T4CB 3KT8A 2WZQA 5BOSA 2R9VA 5DM60 2EHDA 5JJKA 2YY6A 2I6XA 4K9KA 1ZPDA 4HL4A 2WD9A 2ZTMA 2OK7A 4JAVC 4DCOA 5ALPA 2I99A 1NKVA 1IM2A 3M2PA 1L7XA 9LDBA 5IVIA 1FNDA 1F4IA 4JXZA 4FOTA 4LZPA 3TTTA 1IUPA 5ICEA 4BPBA 3W4KA 4XX0B 4RTJA 3KUDA 3UN1A 5D5HA 3IVMA 4BRUA 3V00A 1UMDB 3T7KA 5KHOC 1SXQA 1ODTC 1OOEA 5EJ7A 5BWCA 5ADWA 2P6NA 1XZFA 4GPD1 4IJKA 3L5KA 1II8B 1K08A 4MA5A 1TCAA 2CWBA 4KVGA 4AYTA 4DLKA 1IHDA 1CQIA 1DPGA 1MXHA 2LVQD 1DO8A 1U7UA 1CUBA 4ZXFA 5LMNB 1TGUA 1XTQA 1CLEA 4RKQA 5KTTA 5EE1A 4ZDJA 1DSSG 5BNTA 5C8VA 2FA9A 3HZHA 3KHKA 2Z09A 1X14A 5JH7B 3Q8WA 3EIWA 4R1LA 4J43A 4R98A 3SC2B 2GN9A 4XIYA 4I1UA 3RK1A 5HX7A 4KHZA 1NUQA 3TUIC 1Z07A 2AL7A 4AMUA 3SFZA 2NZ2A 1KY4A 4FQ8A 4O2BB 3ESQA 2ZVDA 3EWSA 4L3OA 5CJJA 4MUMA 1FTGA 4J8PA 4PPYA 4M54A 3T52A 3E2PA 3EAFA 3NC4A 5EP3A 4K9RA 2ZCUA 5JD6A 4UN2B 1KZ6A 4R71A 1LSJA 1XZNA 1RPAA 3DTTA 1HYEA 1ST2A 3GG9A 421PA 3WICA 4RHUA 5JCOA 1KI3A 2CHVA 3EXFA 2IRWA 1XMSA 2JNHA 4HRAA 3O9MA 1DJOA 1Z34A 5FADA 1J25A 3HGMA 5DK4A 5INTA 2BFDB 3JQ7A 1R9JA 5K2MA 1DBRA 1KK2A 3S27A 2DKFA 3KJGA 2BLNA 1JVSA 4OGKA 5HQTA 2YJ3A 3A46A 3HCEA 3K9NA 2GO7A 1EDDA 2Y68A 3T3IA 1FA9A 1SXHA 1R18A 2CYBA 5ITYA 4IGIA 3UHPA 2F4VM 1EA7A 1KAEA 4B6OA 2IYUA 2Z08A 3S40A 3AXSA 2EW2A 1U3WA 5COBA 2B8WA 1M74A 4JR0A 4DR4M 1Y81A 3HY3A 1T5IA 4BO7A 3HCCA 1PX0A 5BYKA 4KRXA 3EJWA 2IHYA 4X91A 1VRCA 3UUFA 3CLRD 3GZJA 1ACMA 1PQYA 5JRDS 5CYFA 4DCSA 4U7JA 4TS4A 5LD2B 3JYOA 1SG6A 4F60A 4M2LA 4DLNA 3HRKA 3JQFA 1P1BA 4DMCA 2JLZA 3SR3A 4YAOA 1P0QA 1GAXA 1JJAA 2WYOA 2HJRA 2BMJA 2OCKA 1SGWA 4AU1A 4EA9A 2CJXA 1QJCA 4QPZA 5KOJA 1WD7A 4CGZA 3T7JA 2Z6QA 3MHTA 5ES4B 3V4SA 4LFAM 3E48A 3TMAA 2LZ0A 1LA2A 4CTKA 4OM7A 1TECE 4LIPD 2CLDX 2SCUB 3DXXA 3MCAA 3AVYA 4Y9DA 3F4KA 1A8IA 1RQ7A 1ZHHA 3QLVA 1R27A 3GRRA 1ZVQA 4W6ZA 5L3QA 4LJ8A 1ZGGA 2Q50A 2QYSA 3E22B 3H19A 3AZQA 1ESDA 5CH8A 3L0BA 4XD7A 4O08A 2WWTA 3CB4A 4JI1M 4TMFA 4KACA 5MGBA 1BHO1 3R74A 1YVDA 4QHYA 1Y0BA 3W34A 2VRNA 3IMGA 3LY8A 4IP0A 4C29A 3AHCA 5DCUA 4GLBA 1UBFA 1ZRNA 5K99A 3W2TA 1QGAA 3STWA 1Z9BA 4JOQA 3M9XA 2G83A 2VS1A 4V0SA 3I4YA 4MW5A 4HEA1 3QU4A 4ND4A 4P7FA 2ZUCA 1U2GA 3F4BA 3QE2A 1N78A 1ZVMA 4PGFA 4JYAB 1L2CA 3EWAA 3RQSA 5CB4A 3EUFA 4BCDA 3AY7A 3USES 1AKYA 1GTL1 1JFSA 1MEJA 4Q66C 4DR5M 4LSWA 3SBDA 2VQSA 4RS3A 4IUDS 1UEJA 2P1RA 5F1KA 4WJLA 3ZZNA 3LO8A 4WEOA 3S1AA 2I8AA 4JVMA 2F5OA 4NSNA 4CHTB 3I42A 2F64A 1HDGO 1L5GB 2FW0A 4GR5A 2MIIA 3V1UA 1W19A 1EFKA 5A3RA 1OH8A 4GS5A 1Y8GA 3EF0A 2ERYA 3MK6A 1DG1G 4FFNA 4CMEA 1HR0M 4ZVMA 4QEDA 2ZQYA 1W4RA 1K0UA 4FVMA 4TQAA 1OU4A 3OT1B 3UYKA 4JJ7A 4D3ZA 3TXYA 2FWIA 3T9DA 1UWCA 1VPWA 1Z6PA 2GZSA 3U4CA 4NDZA 3CE6A 1H6CA 2AG5A 4XVRA 4OGWA 1OV4A 3RTDA 2UZ3A 1FRFS 2HNAA 5JNLA 5AK6A 1RPTA 3G2IA 1FTQA 1RR6A 3DXYA 4IDHA 3U48A 2ONCA 2P30A 4EKEA 1Q3KA 3UUWA 1H2FA 1TAUA 4ZI7F 2J3JA 3WZ2A 2E5FA 4IF6A 4MPRA 3PC4A 2CHGA 4BEBA 2PR7A 1X8LA 1Y89A 1HE2A 2FMKA 3AJDA 1TQHA 5M34A 4EI7A 2ZPAA 3MJVA 5JYBA 1P8JA 3TTWA 1KJYA 1IEXA 2ZT5A 3V2HA 3RDPA 1C14A 4MCJA 3TRHA 4BFYA 4WERA 2FE8A 2J6IA 3KSXA 2GYYA 4Z4GA 3VAAA 1FMLA 2QMOA 5K4AA 3V8BA 4KX5A 4V38A 4P22A 2D0OB 3GWZA 4J0CA 1Z8HA 3AEQA 2FGJA 4UJ3A 4IWXA 1SB9A 2QA5A 2RBEA 4S04A 2ZRQA 3C6KA 3M7GA 2OAP1 5ALDA 2CLFB 2WPDA 2OBNA 1YZ3A 1XJ5A 4IO1A 1X15A 3HH8A 3T5MA 5JZSA 2GLUA 4XCVA 4MRPA 2BCGY 4DQUA 2HF2A 5HK9A 2BFFB 4IJWA 3JATB 3NEPX 5D3QA 1BAPA 1E1MA 1ES9A 3KEGA 3DFFA 3IEIA 3DFZA 4MUIA 1P91A 5CX1A 2O8NA 5GONB 2XTZA 1T8WA 5E7IA 4H7EA 3TDKA 3K4HA 3PHIA 3JQGA 4M7WA 3GAMA 2OO7A 3L7LA 4K87A 1MMFB 4KAAA 5IFKA 3ICWA 4TWAA 4CKZA 4ZALA 2RGEA 3PQDA 4PSCA 1HFWA 1JV2B 3IH5A 2RGAA 4EENA 4I50B 3TOCA 5I8PA 1Q39A 1N2SA 4E5KA 3KOOA 5ENVA 1MZVA 4PG5A 5BNIA 2OXCA 3MJTA 1DL5A 5FWYA 1JGTA 3P9NA 5KBYA 4GI3A 3FD9A 5L40A 4LXGA 2IUEA 3LH5A 4FVTA 4U2DA 2XW6A 4IVPA 1MF7A 1BA3A 1SUAA 4RDIA 1GL6A 5KQGA 1GABA 4UVEA 2ZWIA 3RGGA 3IBFA 4NBWA 3ESXA 2FUG1 4IBKA 2AXNA 4LJLA 4AMGA 2QVXX 2H2HA 3E8SA 2CF6A 1POWA 2IHNA 2Y99A 3ZDEA 4PZ0A 4TQGA 1DX4A 5SZJA 2I4MA 3KTAB 2IUYA 1JDUA 5HEKA 2CWDA 4DRXB 3DC2A 3NT4A 4DDTA 4L5BA 3GLGE 3W2HA 4EW2A 4CNQA 4WZBE 4C7MA 3CNNA 5LDGA 1J2TA 3BL8A 4S3MA 2QORA 2DRIA 1E2PA 4BTVA 4ANRA 5EPOA 1E2MA 1P5HA 1SG9A 1CEEA 3GO4A 1NR1A 4RCZA 1WZEA 4GMFA 4O4LA 2VWHA 1MQAA 5GM2A 4F85A 5EKUA 4NFSA 2PXHA 3A1UA 2X2EA 2NVBA 3EIEA 2XDQB 2QBYA 4OX9M 5BNFA 1D8AA 3QVKA 4DCGA 3AJRA 3RFFA 5LJLA 2RG1A 1WV1A 1THZA 1SB8A 4QU0A 1ESEA 2ZT8A 2C59A 4DPMA 1G8KA 4DCPA 5KNLA 1CRZA 3D4NA 4WCFC 2UU9B 4PCUA 1J7KA 3OQHA 1G2IA 4BTEA 1BVRA 3OY2A 4LRQA 2WMNB 4ZO6A 2PRYA 5FWAA 4IJFA 1V6SA 3O9ZA 4L0CA 3BD6A 1EP2B 2ZRNA 3PWZA 1MCZA 3VFDA 3JPYA 1N92A 2DP4E 3Q15C 3QQPA 4TTQA 5REQB 4WN9B 2XODA 2ID7A 1JB1A 4PO8A 4BFSA 1TZMA 3AEZA 4MZXA 4UEOA 5KOHA 1VGRA 4BYMA 4ZOLA 3DVAA 1WCIA 4E4RA 2NYAA 3GV0A 2ORYA 4YBRA 1FNMA 2AS0A 4LF6B 2NPFA 1NVVR 1AXRA 1JEOA 1E2IA 2GGSA 1GD1O 4HH1A 5LP6A 3IP5A 1WE2A 2QJWA 3LW8A 3I23A 1JDPA 1P7PA 3ADPA 1DKRA 3LC7O 5L3VA 2VTKA 4WCDA 4HRVA 4HI0E 3PX3A 3UWOA 5ITTA 2NUTA 1BCSA 3IHLA 4BLVA 1RP1A 4YT4A 2LHGA 3O3OB 2PQ2A 3MYYA 4L51A 1DVRA 1RWKA 1X9HA 5HVNA 3GVHA 1RQ2A 3SLGA 3ADKA 3TIGA 3JZFA 1UMBB 1MDFA 1C1HA 4E51A 1JLSA 1K9SA 4PRYA 1L2TA 1TT5A 4KMOA 1UKYA 1I14A 4FW9A 1TJ3A 3RTBA 4Z0TA 3LTNC 3CZAA 2Q9UA 2XQFA 1DGQA 5HIKA 4OQZA 1Q0LA 4G5FA 3RC9A 3KHTA 1XA0A 3GAFA 1V1MA 1NN3A 1XJCA 3PFWO 3OETA 1T9BA 4X84A 1EG2A 2BHSA 3FPCA 3E9CA 2W9XA 4FE7A 4PTYA 4F3NA 2GK3A 5DIFA 3GCWA 4ZEWA 2O3QA 3PNLA 1QQWA 1QQ6A 3E9MA 5KWIA 2FPXA 4YV0A 3LNCA 4OYHA 4C04A 3G2NA 3P4XA 2EFCB 1ZGZA 2PKQP 3FI9A 2OC9A 4F8JA 3U4IA 1U2QA 4YP9A 4DT1A 1AB6A 2PZJA 2Z5FA 3Q3IA 2O2EA 4I6EA 4HDRA 5EHIA 4QUEA 4KQJA 5LB2A 4WK0B 2DBVO 3WFIA 4TXHA 1Q1ZA 1UJNA 5LXTB 1E2UA 1RWMA 3QM1A 1QCCA 3WAKA 2Z2ZA 4LJ9A 2JHGA 3A0RB 5EQTA 4M0CA 3M33A 2OOSA 3QGMA 2GA8A 1GSAA 3EGOA 4OBXA 3KEQA 4IWYA 3K8QA 4DR1M 4BB9A 3PE6A 4UE3S 5JAIA 4AP5A 4IOLA 4C30A 3L6UA 1QIDA 3U26A 2QTBA 2JUJA 2WA1A 2G71A 2PH5A 2ZYTX 4EP1A 1Z08A 1TZKA 3FPEA 3EGXA 1VE1A 2WFLA 4CTMA 3WYNA 3TD2A 3R9KA 1OAOA 3CPEA 3L2OB 1AUQA 3NCHA 1CJUC 3GLSA 3D5TA 1CY6A 2W2KB 1IWPB 2WPDD 1OLUB 1TM4E 2DH6A 4G97A 2ZJ2A 3UK6A 5CUQA 5AJTA 2FSHA 2QY9A 5B58C 1C8BA 4OLFA 5CPFA 4F21A 1XN1A 2X0JA 5KMGB 2AOTB 1L4UA 3KZKA 5JAOA 3TLEA 5TV2A 3CX7A 2EDAA 4UQPA 3WL6A 2JB9A 5B55A 2V7QD 3FPJA 1CZKA 3PNSA 4URUR 4C88A 4ZYZA 4IIJA 1VCIA 1JB0F 2QIOA 3WI7A 3ZV4A 2XHZA 5LIPA 3AK4A 5AIBA 3PNKA 1UBJS 1DTWB 1XNQB 3U61A 5JVDA 2WSEF 3D7KA 1XF9A 1A04A 5IVHA 3MWDA 3B3QA 1DC5A 1O97C 1Z17A 4Y2RA 5IBCA 4S2UA 5C32A 2W70A 4AJ2A 4KZKA 2Q3FA 4FGJA 4LTDA 2JATA 1SCQA 1AKWA 1G291 4YCAA 1VRWA 4QYTA 1Z4OA 4AY5A 3FYSA 3AM5A 1HZZC 5BR7A 1R12A 4X1YB 4AXBA 2HXSA 2FNAA 2XUOA 3WP0A 1G9SA 5BT8A 5A6SA 3MSXA 1OI2A 4BXOA 1V8BA 1C7IA 4L6CA 4G65A 4M1SA 4JLDA 3PHCA 3WMWA 5ITZB 5EXXA 3HO6A 3QHPA 2A0FA 5ESRA 1DBVO 3IBYA 1KI6A 1JE1A 3MBOA 2L2DA 3IG5A 2CE2X 3DEAA 3AKDA 2ATIA 2QDXA 2IS1A 2VJQA 4DR7B 4O4JF 3ADBA 3I09A 1R7RA 4YDHB 2QU8A 1UZNA 3GJ4A 5AXBA 4N82A 4AZFA 2O20A 3QPAA 3LBIA 1I7SB 4EPRA 1IBKB 3R7FA 1GPWB 3L6CA 3BZWA 5CLGA 3AG5A 2RAUA 3NKVA 1LLUA 3TUJC 2R18A 4L76A 3UKDA 2ONJA 1JA1A 2O2HA 4PLVA 2Z83A 1VDMA 3GJQA 3HXOA 4HQ6A 1B16A 4BKQA 3QITA 3QUCA 3K9FC 1XTKA 4PQRA 5AW0A 4IDDA 2I7CA 1KH3A 5A0FA 4JU9A 2PL3A 4ZEVA 3CXRA 3TEJA 2G77B 1AUXA 4DXHA 2ZUVA 4XPZA 4RCVA 4RZXA 3HG7A 1H2WA 4WESB 1DCMA 3E7DA 3CUSA 2X6TA 4TTJA 1ZONA 3F6BX 4KWIA 3A1VA 2GRUA 3NTXA 3F47A 4CCYA 4L6IA 4C43A 1OXUA 4Q3OA 4F4JA 4R2LA 2XMQA 3OQ6A 3H5WA 3N2ZB 4IG9A 2R60A 3M3HA 1KZ1A 4YJFB 3M83A 2BGLA 3WGJA 1U94A 2J4CA 4KFRA 4PZAA 1XT6A 1GJTA 4U9HS 3O3NB 4RZQA 2A9OA 4I46A 3FIJA 3IBCA 2GN6A 4QQ8A 3OCJA 3LPNA 1BU5A 4ZOCA 4WP2A 1E2EA 4LI3X 5LQDA 2H08A 2IYWA 1GKUB 2OV3A 4ZAWA 4DA4A 3B78A 4AYXA 3RFCA 4Q1DA 5IANA 2B7CA 4CL2A 3WQHA 3OPMA 1UWKA 2HRCA 1JLKA 5E6RB 3SEZA 4BB5A 1DV2A 1K97A 5BMVF 3SM9A 4B3MB 2IUSA 4GBGA 3LO5A 5ALZA 1NHWA 2DFKB 1YB6A 1IPFA 1GZVA 3GT4A 4A7PA 3ZGLA 5H0IA 2ZREA 4OFWA 1US8A 2B82A 3QI2A 2PRZA 2PZ8A 2XZTA 3G88A 3LUDA 5A02A 4XVHA 4IH9A 2WJAA 1U3FA 4PTZA 1RWXA 1A5AB 4JI0B 1Z4LA 2RI0A 1L5RA 1M2JA 3EIOA 1VLHA 3WWDA 2AHMA 3IQWA 4IDGA 3HQ4O 1FL9A 4YPOA 5KYTA 3KP0E 3MQ4A 3I8SA 3MMNA 5C1OA 1NJFA 5BYAA 4PHTA 1DAGA 1UBOS 4YQFA 3PA6A 3KZ1E 1V6AA 4LWZA 1TC1A 4XRRA 2C5EA 5EJMA 2QG9A 2XJ4A 4DJDC 1Y6RA 3DM9B 3E18A 1R4NA 3Q7EA 3EVZA 2YYSA 3JAWA 5AOVA 3VR5A 3QWBA 1YZNA 2ZJ4A 3EODA 1Z37A 2WKWA 3G0HA 3B8EA 4XAQA 1CY4A 4JOBA 5GZ6A 4LRWA 3OT5A 2HIGA 3AX6A 2HKIA 4JX9A 1NLMA 5LPNA 5FPTA 5JTUA 4ARVA 5DGXA 1U0TA 2VDLB 2OK8A 3B1KA 4UBMA 2KX7A 3C5EA 3LDGA 5ICFA 1I33A 1EX6A 2BGNA 3BAFA 4M1YA 1CCWA 3MWFA 1CIJA 4YQYA 3RI3A 5J58A 4WFQA 2ABWA 2IP2A 3RBVA 3M81A 1MKYA 4BMCA 5BWMA 1D09A 1K5DA 4B4KA 3ZWBA 4KQMA 3BH6A 2C7QA 3WGLA 5BV2P 1NJ6A 1OH6A 4GPEA 4XK8F 1YU9A 4CU2A 3I4FA 4DSNA 1WX1A 3I2JA 5GQSA 3HGQA 4M0LA 3DH0A 4WY8A 3SSOA 1XD2B 3OPNA 1DXOA 1L7PA 3HJNA 4HUTA 4I8IA 4Y6QA 4BFCA 1M6EX 1Y5RA 4U8GA 5FYDA 1KYYA 3G8BA 4XUGB 4M1OA 4CI0B 1IB6A 1VKHA 2ZJ7A 4P5PA 3R7DA 4ZCQA 1L8OA 3RADC 1KJWA 4G2NA 4EHJA 3KE9A 3RIEA 2EZUA 2ATCA 5KQLA 4M22A 1H2HA 4D1YA 3VNRA 2J87A 2Y05A 3UICA 1IY8A 4AJLA 1YVEI 1A69A 1Z0UA 3QOXA 4OQEA 1N6KA 4YI3A 4IIWA 1PRBA 3INGA 5ER6A 1X19A 5ELMA 9GPBA 1ZOPA 4X93A 4M8NE 1SJ9A 4TYWA 5CT9A 2PMKA 4Q05A 1SM4A 3U7GA 4WASA 1R0RE 2QLJA 4JROA 4QDJA 1PYOA 4CKCA 3T99A 4NYIQ 4MKZA 1JU9A 2KE5A 3TMYA 3PFCA 1EK1A 5AK5A 3AUFA 3DR3A 1Z6TA 2PIAA 5GVSA 1WUIS 3W3ZB 2OBBA 3VNUA 2R7LA 4GNRA 2N0SA 5DLDA 4QM6A 3KSAC 4C0AC 3DO6A 4MRMA 2ZIXA 4HLQA 2C61A 1PHPA 1RWWA 1W6UA 4DVJA 1LXCA 5E26A 1BD4A 1G7TA 2C2WA 5EA2A 1RLIA 4ND5A 4CDGA 2FYTA 2NSJA 3I52A 3ZJVA 4N0QA 2C2KA 3KT0A 2PQ6A 1ODIA 1BROA 3O0TA 3K8ZA 1S2LA 1KBQA 4FZ5A 2NQ8A 5E6JA 2R86A 2FEXA 3G9QA 1USUA 4C14A 2C82A 5IKXA 3U9LA 2MSWA 1Z5UA 4OXKA 5DEIA 2CUNA 2OHGA 5FNVA 1J42A 1LI4A 4F4IA 3ZVNA 4WJKB 1N9KA 4WBXC 3RAPR 3KEFA 2WSFF 2OHOA 5AFSA 1Z7EA 2IOQA 3GLGA 2G40A 2KLBA 2YYYA 1HT1E 4WZBA 4EGQA 3PS9A 1GTRA 4ZP1A 4WUTA 4U39A 1HV8A 1ZNYA 2GVZC 1VYHA 1KO1A 1AK2A 3D3EA 1PG0A 1WCYA 5BV7A 1Y8AA 1DIBA 4JLKA 4MPDA 4B3TB 3FWNA 4RK5A 2QOEA 1DKNA 1F2TA 1KF0A 1NY6A 2CCKA 1VJCA 3KQSA 3PDJA 3ZQJA 1P4HA 3E70C 5H4HA 4YJ3A 5DKFA 1JSRA 3CLKA 3BA1A 3UPTA 1PR9A 2VA8A 2R8EA 4IXTA 4KO8A 4W1QA 4CM8A 1SQ0A 4FEEA 4AJNA 4MS4A 1Q1GA 5I3CA 2QJFA 4B79A 2LIPA 2M6KA 1XK6A 2CFRA 4MUGA 2WWRA 1SVMA 1RCUA 3GELA 1LF0A 4NOOB 1S3FA 4V2UA 1JSZA 4EA6A 5IDWA 4XFDA 1IZ9A 2Q2NA 4L74A 1XDZA 4ZOQI 2DVMA 4UNQA 3V6MA 2CMHA 4WZ6A 5JV5A 3QUAA 1Q3HA 2D7HA 3AU8A 3R75A 4FWHA 3ZHOA 3L49A 3A1TA 4RTQA 2Q5HA 4MAFA 4YK7A 2HNKA 4KT0F 3H1TA 4YIHA 4QXPA 4A8TA 3DFKA 5TX7A 4HADA 4QVGA 3RJ9A 5IXYA 1GPJA 1PUJA 1OAKA 4JI6B 1K4YA 2JKYA 2JKZA 2JCGA 1XVUA 2XCOA 1XB2B 3M5DA 3C3PA 1ZGCA 1FTNA 1RFGE 1PZXA 3AESA 1JT2A 2AJ8A 1FJXA 3COWA 3CRNA 3HWX1 4FYYA 2Q4DA 2ZSBA 1MN3A 3KQHA 3DL7A 3CX8A 3DOHA 4LWQA 5A6VA 3LGXA 1P2GA 1U1DA 2WJ4A 3X1DA 3BICA 3NGXA 2QE6A 4MGEA 1DQYA 4KR9A 1ZU4A 3SEAA 2R6ZA 4DR2M 4DM3A 1AGPA 2XTNA 1WSBA 1BDJA 2TECE 3M6VA 3O3CA 1QRRA 3M6FA 1UDAA 3S7ZA 3GQBA 4P80A 1G17A 3ZTTA 4RABA 2GEBA 2ZWVA 1CHDA 5HKLA 1KQPA 2G4CA 3EHEA 3JQ6A 1L7BA 3LV8A 2O57A 2K6GA 1PJAA 3G68A 3GPXA 1D2CA 3LUPA 1XK7A 2OCIA 2J41A 3ZYZA 1ISHA 2CCGA 1SHTX 1XQXA 3WRYC 1X1RA 3B6ZA 2JZ1A 4HQ0A 1WQ4A 5U9CA 2DR3A 5AK4A 5C8YA 4ZO9A 4TZKA 4ESHA 3V7FA 3ETGA 3GEIA 4ZKEA 1Y8CA 3IAXA 4MRVA 1BXGB 3GCZA 1Z6XA 5GJCA 1ZSVA 3D8SA 4I9NA 3UMBA 4II3A 5K3FA 1J1IA 2WILA 1JSXA 4P0PB 4ALJA 1A82A 1ECJA 4E3ZA 3Q40A 1JEDA 1OX4B 2ZYSA 3OQPA 5IT0A 5BW6B 2C5LA 5DRYA 1NI3A 1QV6A 3ZWOA 4LMRA 2QCUA 4EG5A 3FOWA 1KEUA 4DMHA 1V5EA 2ZJ1A 3AG6A 2FN4A 4LYJA 3EF1A 5G4KA 1X74A 4IEIA 2BKAA 1RRPA 2XGJA 1CQWA 4B84A 5GAJA 4WN3A 1EFPA 2ZSAA 4NCBA 4CV1A 4V39A 2O2IA 1UJ2A 3KQNA 3S8MA 1VTKA 2JZNA 4KPGA 4B8WA 2EFHB 2IJGX 2KB0A 3K6SB 3I6YA 1U1EA 2G0AA 5IEJA 4CGYA 2I9PA 3AHHA 4F4CA 1CUDA 3GYGA 1ZGAA 1X3SA 2A3NA 3A6PC 2XUJA 1HNZM 5AKEA 4DV5M 2C07A 1U2DA 3N0WA 3QVXA 2R2AA 1Y8ZA 3M34A 3DBRB 2XWBF 1TGYA 1GIAA 4KQ6A 3MTGA 4CIYA 4LFCM 4B85A 3SR4A 5CB0A 3FF4A 3WHKA 2ZCVA 2DSNA 5JG7A 3TZLA 2DI0A 4U2KA 1Q12A 4LJAA 3WGOA 2FR1A 5JPCA 4PX3A 1C2YA 1ZNQO 3GLFB 1U28A 3ODGA 3ANNA 3IVRA 2A9VA 1KPIA 1Y98A 2RGHA 1YMQA 2CZGA 1EUQA 2IGBA 3HYCA 3TIFA 1RPZA 2ZULA 4GMKA 4P7JA 4IJ5A 2PCJA 4D96A 3DO8A 4X66B 1Y3FE 4JOCA 3SC3A 1WNTA 3L7CA 1LRJA 3QBVA 2HF8A 5IZCC 5G53C 2VP3A 2VVTA 5C1DA 2H2AA 4U6NA 4YAUA 4UMVA 2BBOA 4JH0A 3TR0A 4BLRA 4IWNA 1UPTA 2OV8A 4IJQA 5C2JB 1HMYA 1S4QA 5A2GA 3KPVA 1ULAA 4Q9LA 2N1MA 2V97A 1B73A 4FNAA 3W6ZA 1H1TA 3EC7A 3RHZA 3JTMA 5BY2A 1B43A 3STYA 1FFXB 1SURA 2GQ0A 3SS8A 4H0NA 4EF4A 4CMBA 1K7EB 5P21A 3ZC7B 3J81A 3QPVA 1ZI6A 2ZTVA 4KI7A 4D3YA 1BDBA 1HL7A 4Y2GA 3VPAA 3AI1A 1T5LA 1JYSA 2CVHA 2EC5A 2JH3A 2O0LA 4I9FA 5A3SA 3D4BA 4H6VA 1GN9A 3SOPA 4F11A 2QLTA 5EMNA 3U40A 4M0UA 4A4DA 1EQUA 5A7HA 3ZU2A 1HDXA 4B75A 3QYFA 2B2CA 5AI4A 5I45A 4WHMA 4RGYA 2HUNA 3GMSA 2CXSA 3B38A 2PLNA 1KEEB 4OXIA 3COYA 3UAOA 3LE8A 1ACLA 3LT0A 2EL9A 1CULC 2BYTA 5KHAA 1DAPA 2O07A 1C41A 1E4OA 4OG2A 3O8OA 3CW2A 3H42B 2VYFA 2O8FB 3ZLUA 3D8HA 2AG1A 2ZB8A 1LPBB 1NJGA 4B6SA 4ICIA 3B7GA 2ZVJA 3F1KA 4RD0A 1R5LA 1GRCA 3QFCA 2G72A 2PG3A 4D79A 2PRSA 2OM2A 3DHEA 4OIFA 1N34M 1KQ3A 4BNXA 2PX5A 3NWJA 3WL7A 1JG1A 2I54A 4RPGA 5THXA 3MW8A 1R4MB 2AX3A 2MSKA 3IC5A 2UZAA 2MU1A 3EC1A 2QGFA 2C99A 1MR3F 5AHOA 5K45A 3IAM6 1WF6A 5B4TA 1KAQA 2XMBA 4HAYA 3SBJA 1X8JA 2P91A 3FAZA 1I2AA 3LC0A 3IOBA 1IN4A 2KLHA 1Z6YA 1Y9ZA 1WSAA 3LMKA 2LWXA 5TMDA 3PQEA 2DNAA 4AJHA 1T2DA 2H06A 3W5IA 3PLNA 1F12A 2WUFA 1FNNA 1EB8A 2X3YA 2BCEA 3BE5A 1LI7A 2Q46A 1GU7A 4KC0A 4Z4QA 4FDMA 4DR3M 4IJMA 4ND3A 4YRGA 1KDOA 1DELA 2OGUA 3TDNA 1G8YA 2GK4A 4DG8A 1EFLA 1ZNWA 2VTBA 1EVKA 3STXA 2VUSA 5CW1A 2B0CA 4GD3Q 3IXQA 3I5YA 2ZJFA 3DZJA 2AHOA 3IODA 1UEIA 1Z56C 1WCXA 4HGRA 2PMDA 3BSWA 4DBLE 2H1SA 1M2KA 2W48A 2Q7OE 2QQ5A 3GRVA 3RV3A 4HDKB 4Q03A 2CBGA 5COQA 1GU0A 3T1YM 2WOJA 2B94A 1U5BA 1GGNA 1A8PA 3CT4A 5TQ2B 5LA6A 1VEGA 4UMDA 3ROGA 5CHEA 3MUOA 3BS4A 3ETCA 3ZGZA 1I1QB 3JQ9A 4ZK2A 5KNDH 4PGGA 3N0XA 4IZOA 4FBLA 3OFKA 4OU4A 1R5NA 3KSUA 3QTBA 5K6RA 4DTCA 2VF8A 4C6TB 2QPLA 1NPTO 3EGDB 4X6YA 3RK0A 1L5WA 3IE2A 5L3SA 3JR4A 3IPLA 2VDPB 3PLAE 3TNYA 4C05A 1O6CA 3MRSA 4JBXA 4DIBA 3K20A 1YE8A 1XZEA 1L4HA 2JNWA 2BR5A 1NVDA 4RKRA 1AV6A 2HA0A 1UAAA 3I32A 3I9NA 1NSFA 1GXSA 1XALA 4UW9A 1E6CA 4ZU1X 2JC3A 4L7QA 1K8XB 1LBHA 4EFLA 2FZEA 3CRMA 1N3IA 2VNSA 3RSLA 3O2NA 2ZAGA 3IQDB 2WM8A 3DZIA 4YCLA 4PQFA 4UAGA 2E3JA 3JYLA 4R7ZA 2P8SA 1QR6A 1KDZA 4GOLD 5JPIA 2H4XA 2G36A 1VKRA 1MW9X 2XA1A 4CIZA 5KQMA 3CISA 2JS7A 1NBOA 3IAS6 3K70D 5A4AA 1GCOA 4Q9NA 1V1RA 3X1WA 2EFDB 3ED5A 2CKDA 5FUXA 1WZCA 1K3XA 4B7FA 1ZYUA 4W8GA 3C15C 3L84A 5HHTA 2O8CB 3G2MA 2VDWA 3TNFA 1N5RA 3SGLA 3ZCSA 4DABA 4B4DA 3NXSA 2XVXA 4ARSA 2J1LA 4MOWA 3CWCA 1P80A 3QFFA 2H1FA 1A95A 1DI0A 3PYXA 5DXFA 1ZK4A 3PYMA 3PCTA 4WNIA 5B2EA 3BXOA 4U6QA 2JCBA 1Z0IA 3KYJB 5JLAA 5EZYA 4P08A 3QE3A 4GOOD 1D2RA 1C5KA 3ZGVA 1VHLA 4QBHA 5SZHB 3F3SA 5CNIA 3UMFA 4CV0A 2V7BA 4DSOA 4RL6A 5HMMA 2HXYA 4FKMA 1K92A 4X8LA 4UEWA 5B3LA 2P0AA 4MV6A 1PU2A 3CO5A 4DZRA 2VP2A 1RLTA 3OKPA 4D42A 1QIGA 4TGLA 2GNPA 3TQIA 2VHCA 4E88A 1QUSA 4WZAA 2AUTA 1KGDA 5DB4A 5I7OA 1PZEA 3AM3A 3O83A 3G89A 3KJHA 1OC4A 2Q8QA 4H3VA 1DO0A 1KYVA 4AZSA 2AHRA 2EW8A 4P81A 2XWJI 3IHKA 3RYFB 2ZS7A 1HE1C 4XEUA 3A31A 3FPLA 1DUVG 4AWAA 2QZJA 1B15A 1PL7A 1T9GS 1W0JD 3VX3A 4QGBA 4CLXA 2Q49A 2C7OA 1TYAE 1EPUA 1F38A 3SG0A 3WWCA 1S96A 2P4QA 4B9EA 4M89A 2LVPC 2EATA 3RS9A 2UUAM 4G0ZA 3EAQA 2ZTLA 4QXOA 2E89A 3SMSA 2O01F 3N2NA 1E0JA 1Z0DA 5TARA 3WJ7A 4EMBA 5HSGA 2GT1A 1FZTA 2HSWA 1QFZA 4P4SA 3GK3A 3P97A 2JCYA 2A0YA 5IABA 1DFIA 1CLUA 3TZQA 3ZGXA 1Q0RA 2HDNB 2F3PA 1PZGA 2ESRA 3UT6A 5JXIA 6REQB 4WLEA 4B17A 4AMBA 2R47A 4QYXA 2W8ZA 2I2XB 4V1CA 1QJ4A 3WLKX 4XB2A 3FGNA 1YS6A 1XJQA 1C4KA 4CIDA 2DETA 1FUEA 3HDQA 5AW9A 5THKA 3FJYA 1VB3A 4P86A 2LCIA 4IIBA 3V8EA 2EFEB 5HRCA 4QULA 3EFHA 2IEDA 5D5QA 2J33A 1PEAA 3QEMB 3P2EA 1NQAO 4UTXA 2NXCA 3LCCA 2FWPA 2PU5A 3W3AH 3LBFA 4BX8A 2OLJA 4PAOA 5HIMA 3KD3A 3RS7A 1NSYA 3IUJA 3WYFA 1KMQA 3NBYC 1PS8A 4F96A 2AA3A 2BEVA 4MS3B 3AV0A 3PR3A 1AZWA 1NNUA 4TYYA 4IILA 5TE9A 2PS1A 4LF8M 1R4GA 1TYZA 2XXAA 1TKRA 3VYUB 3SKYA 3CKKA 2NX2A 3VV2A 4MGKR 1EFVB 2ZGVA 2F67A 2WWGA 1LVGA 3RUAA 3TQRA 3NBQA 4TN5A 1I94M 1TVKB 3K6RA 4JNCA 3F46A 3NAZA 4HQKA 3U0VA 5MN5A 1NVFA 1YS4A 2WMYA 3A1WA 1E6MA 4P4TA 3TLJA 5A5FA 1PFKA 4JN6B 4CQMB 4F3KA 1T5SA 1AUOA 4CEHA 1K6JA 4UNSA 3MXTA 1F5NA 2QM7A 5FI3A 4KSYA 4O2RA 1P9LA 3QELA 3L4KA 5T4BA 3K8OE 2IELA 4ZGGA 3GF4A 4QNMA 4ZU6X 3SLKA 2V7QA 4OXNA 1XMOB 3N6VA 2IH4A 2R5NA 1J49A 3K1YA 4AJIA 3GXOA 3LSYA 1A1VA 4YJ2A 1V9LA 5BV8A 3EN0A 2PANA 4QDTA 1V3UA 4F7DA 1GUFA 5C81A 4ZYLA 4YJGB 2QZ4A 2CJWA 4UM7A 4F93B 1N32B 2F5NA 2IP1A 2YHSA 4B2LA 1M1XB 4BIMA 3RJMA 1PGQA 4RPLA 4NOLA 2NUBA 5LQMA 1DRJA 2DT5A 4RSGA 4LYEA 3FWHA 3VHQA 4MYRA 3TDMA 3RC1A 3G5TA 3MF4A 4P84A 3WNQA 3PGLA 4Q4AB 3SIWA 1M0EA 3T7AA 3ZE8A 4K9QA 2V1UA 2NU8A 2B37A 1GKIA 3PEFA 1EYZA 4M9SA 3HUTA 3RNLA 3GRCA 3SM3A 3N8KA 3E9EA 4NAHA 3NORA 4CKBB 3KQUA 4I5DA 2JRCA 2XQJA 2Q5LA 1T5DX 1Y63A 2GZRA 1NV8A 2PWBA 4GKJM 5CRIA 5M29A 4P7BA 4W63A 2G28A 4PY2A 3R7SA 2Z5LA 2CYCA 1YI1A 1X7WB 2EX1A 5SYAA 1RJ9B 4KXXA 3KAPA 4QECA 4TKVB 4GUDA 4BX2A 1QB8A 1XRNA 2IHKA 5ALXA 3ZLTA 2PCLA 2JARA 2Z9BA 1BQ3A 5EIBC 4Z0HO 2HA4A 1LW6E 2B8NA 1E63A 3ZCUA 3L6OO 4F4UA 1EFTA 3HB1A 1N1DA 3W2EA 5DLQC 1L2DA 5H5JA 5F7XA 1GNPA 3CCFA 1A9XB 1HPLA 1G6KA 4PT5A 4CFZA 2OCYC 1KYWA 1Z4MA 3V80A 4XDYA 1WV0A 3WGGA 3QQ5A 1W1UA 4NAUA 4BNHA 1R3DA 4ARAA 1LS6A 1Y5NA 4CEJA 4KH1A 1Z2EA 1JQJC 2P3QA 2ZZKA 4NH0A 3HM9A 1G18A 3JSXA 2IZOA 4WNAA 5HR5A 1Q3BA 2HHHM 1M2EA 4IBOA 1XZJA 2GLTA 4R8LA 3LUFA 4B6GA 1NVVQ 2L4EA 1TJYA 4EKDA 3FYUA 1XAIA 3MD0A 3A26A 5LM3A 4C1NA 4EH1A 3FUVA 4IHJF 1OFHA 1IG3A 4JVSB 2YMQA 5IT5A 2NXJA 5DM0A 1K2WA 3NXKA 3TR5A 3AOGA 3RUEA 1O1YA 1O5OA 1FDOA 1C1YA 1TKBA 3QU9A 2XI4A 4MITA 3JQ8B 1NLZA 4YT8A 4KWTA 4F5DA 3K5PA 1JLLB 1PGNA 5JDCC 1TTPB 4ITRC 2X5OA 3BRWA 1GPDG 3OAAA 2PM8A 4MW0A 4IMIB 3UFXB 3OZSA 4OLHA 2YN2A 3W8FA 2FF7A 5H37D 2A1IA 3ZOZA 4IW3B 3WOHA 4L5YA 3JWHA 5A2QS 2LTAA 4C0BA 5BN3A 4WVFA 1EB9A 2QS9A 2P1ZA 3OKCA 1KBZA 3U1TA 3OWXA 2WFAA 5HKBA 4OK5A 3DDOA 4H2DA 2XNSA 4B3FX 2OCXA 4JC8A 3HZZA 2BTQB 4Z9YA 3QV1A 5KC8A 4KEAA 2BV3A 2PLWA 3DWGA 4AXXA 3D7NA 4EFDA 4XX1A 4WWHA 2NPOA 5KTNA 2FPKA 2ZBKB 4QPCA 2ODPA 3DBVO 4KODA 2JIOA 2HMUA 2QR5A 3HR8A 2VG8A 3MRXA 2YS7A 3KB2A 3WGYA 4GM1A 4P2GA 2EGGA 1DX6A 3G5LA 5H16A 1O58A 1XZMA 2F90A 2FFBA 5I7HA 3ZHZA 4HWTA 1P0MA 2CDRA 3WYDA 5IJ9A 2YV5A 2I67A 3M6MD 4U0KA 1NM5A 1V11B 1U80A 1IRIA 1D4FA 1NV9A 4UHHA 2NMVA 4GVPA 4WECA 3HBAA 3JVUA 1PYGA 2EG9A 4C4OA 3A6FA 3GRKA 5HS4A 1Y8RB 2G0TA 3ZY4A 1G55A 1NXPA 2IH5A 4P1ZA 2BUCA 3UFBA 4N39A 1BN6A 3NV7A 4BAZA 2E5WA 1EVLA 2XPCA 4QYIA 4NICA 2WSSA 3QXSA 5ED4A 1EUCA 1FXSA 2XUFA 4BO5A 2CXPA 3G2HA 3HO1A 5AVOA 3B1XA 2JZOA 4PYMA 3K09C 5T64A 1KFCB 1V41E 1PWYE 4ROTA 3L6DA 3AR8A 1Q91A 5J59A 3OFJA 2O06A 2FRDA 3R5TA 3OWOA 2D3WA 4JB8A 4XM1A 3W78A 5FEUA 3QPWA 5EWLB 5KSOA 4BNZA 3J7BA 2CYAA 2JGJA 3NTVA 2RHGB 3QLUC 2XMDA 2WT4A 4DR6B 2VP0A 4B71A 5DHUA 2G9UA 1VGQA 4DLWA 1F0YA 4J1SA 2GDZA 5IN5A 2HRDA 3P32A 7CATA 1W2WB 2HMVA 4C5AA 1TUEA 3X2FA 2CL5A 1M2HA 1QYXA 1REQA 4B0OA 5LMUB 1EK6A 1GQQA 5EHQA 2GN8A 3KKLA 4R05A 1NATA 2FF5A 2A5JA 3UGKA 3VUFA 4LVUA 4Z54A 3AF4A 3O38A 1PJLA 3T3HA 1A9QA 1AS3A 2MT9A 3T7IA 5AW3A 3IQXA 3DCJA 3ZVRA 1RRFA 3JZMA 2H85A 4V0QA 4PLPA 5E6UB 1YIOA 4IV5A 3O1IC 1F0PA 1VSBA 4URFA 1DTEA 3TLXA 4BZQA 3VZCA 2IXTA 3QFTA 3V34A 4BMSA 1JEYB 5JE8A 1XMQB 4R4JA 2WQ6A 1VJTA 2AT1A 2I0FA 2JCSA 2AFIE 2Q8NA 2BWEA 1SXGA 3P45A 3LX6A 1P9OA 3SVZA 1KIAA 2F5QA 3WGHA 3WOVA 3U6SA 4M0MA 4IZIA 1EM8B 3NEYA 4LYAA 4ZDIA 1KYQA 1TX4B 4J2TA 1W76A 2X8LA 1S2NA 5HCIA 1NNJA 4RFLA 5C8XA 2KA6B 3UPDA 1FX0B 3ZK7A 5K6AC 4J0FA 4KB5A 2BZGA 3QBEA 1B8PA 2F8MA 2H0QA 2E1PA 3Q6NA 3C6XA 2CL6X 1QKIA 2W6IA 3LXXA 1NGSA 4GEKA 1L5FA 2IYQA 4UTZA 2WHRA 1WCV1 2I4TA 4BNKA 3GMTA 4FWIB 3S1SA 3G85A 4D4IA 4LWOA 3RYHB 2IYAA 2W42A 1XC8A 2VQ3A 1L4EA 1L5QA 1KNXA 3PXGA 4UM9B 3V2GA 3DZBA 1G4HA 5K6TA 4ISCA 2C9CA 2A2ZA 4G81A 2XQVA 4NZZA 2FPGA 3FZEA 3WS7A 1YGYA 1U1CA 2C9ZA 2EWWA 3RFVA 2GO1A 1FUYB 4DLVA 2P6RA 1U9IA 1Z75A 3KSBC 1UK6A 1T29A 3HU1A 2FX3A 1J8MF 2G1PA 3HVKA 4ZA2A 1SUPA 2QRJA 5DMXA 4WFIA 3DA8A 3H9QA 1KQNA 4V3CA 1NA5A 4KR7A 2F6RA 4M1QA 4DXAA 3SXPA 3T5DA 4GPBA 4PC1A 1TM5E 3WXBA 3D43A 5EXDA 1PDVA 4RY2A 2G6BA 1R37A 4IBBA 5HGXA 5CVCA 4MV7A 3HPRA 5DBHX 3GFTA 4JA0A 1YB5A 1NKTA 2A0WA 2FE1A 3VDRA 4BNYA 3DOFA 2AUNA 4K0RA 4FOLA 3KQVA 3CUTA 2ZUFA 4DGQA 3EXEB 4LAFA 1RADA 3HUUA 4G0NA 5H81A 1RIFA 2H00A 2IZ6A 3IB3A 2Q5CA 4ZT5A 4EBBA 4DMKA 3ZWMA 1QIFA 4P58A 1RBYA 1TMOA 4JI4B 5LYJA 4BVKA 2DUJA 3A0UA 5DM70 4OO3A 1OC2A 2AZMA 1JZSA 3AMVA 4DV7B 4M36A 3HWRA 3O95A 1DWPA 4XQ0A 4XE5A 4CKYA 2ZRCA 3ENQA 5FBKA 4DILA 1KEWA 8ABPA 1G3IA 1YFZA 1JLRA 2PZMA 4AG6A 4J9VA 2OFOA 3CUWA 3GJXC 4R1PA 1IPEA 2QVLA 2YBDA 4LHVA 3J7AS 5EMMA 3CVYA 3CSUA 3BRWD 3LCUA 4MYHA 1ODCA 3OAAD 2ZTSA 2VXBA 3MILA 1QZ3A 1UXGA 3SS9X 3A32A 2H52A 5FR2A 2UUPA 5A3VA 3U19A 4CIAA 1QH1B 1U8AA 5F9FA 1FVFA 4L85A 3LKVA 1SIWA 3BCRA 4LXUA 4JELA 2FQWA 4I81A 3H6KA 3D2AA 2IYYA 3W1VA 5ITUA 4C0XA 4HDSB 4PGMA 1JS1X 3GCXA 4E3WA 4TV9A 3BUSA 5ITVA 4D8VA 2ODQA 1MA0A 3ETJA 3CX6A 5KYKA 3L28A 1UBMS 3RM3A 5AJYA 1IFXA 2AMLA 2ID8A 1XEWX 5CBPA 1J9EA 3FYDA 4NABA 1Y4ZA 1ZMOA 3FHTA 4HNRA 1LPPA 5M7EA 3I2YX 1PK7A 5FUBA 4IOMA 4PNEA 1JHPA 4M0EA 1WP9A 3DZHA 4MJXA 1DS6A 1W25A 3MWEB 3WV5A 2EKKA 2HQOA 2CVZA 4WXYB 3RJTA 3ZWKA 2O8DA 2WSSD 1B7GO 4LNUA 3B2NA 4GH9A 1AUVA 5DP1A 1L3BA 2ZBRA 2BHRA 1WB6A 3G2QA 3MPUA 4MYUA 1ZUNB 2UXCB 4XVQA 4B08A 3PVCA 4YV7A 4WQMA 2BFMA 1MNAA 3B53X 2EKZA 4Z4FA 4KO4S 4YALA 3U3JA 1MAHA 5TMBA 1NXOA 5EQJB 2R751 2ZJ3A 3QKIA 1RYYA 3OURA 3AR9A 4D02A 4AN4A 4UUPA 1W85A 1BMFA 3EFOB 5E3IA 3Q4GA 2FEOA 1I7PA 4Y2PA 2L09A 2OBFA 2TMDA 1R8YA 1RXCA 2V98A 2FSSA 1QAOA 2V58A 3ONEA 1RYFA 3HBMA 3T1NA 2HC9A 3FVTA 3RD5A 1GTZA 5IW8A 7YASA 1ZWLA 3E05A 4CW7A 4LV5B 1QUFA 2YDYA 4NZMA 3DVLA 1T2UA 1LJ8A 4CM5A 2I7PA 3U56A 3AOEC 1JPUA 5KVCA 4NYJR 2GEDA 3HFRA 4Q7QA 4IX9A 4UNPA 2FLVA 2ZTCA 3L40A 4KQCA 3DMRA 5F78A 3HNOA 4KE8A 4S1PA 4F04A 4ZCPA 2FEMA 2FR8A 1BVUA 5EKTA 3UWMA 3K15A 4KITB 5DVZA 4EI8A 3O26A 2KJQA 5E0OA 1U7ZA 3B6EA 1PIWA 3KKMA 3OTQA 4QTTB 4M1WA 2HLHA 1TQ2A 4KK3A 2HYIC 1KK3A 4CR6A 1ZLXA 4I4NA 1MC4A 3DFIA 2IXFA 3OHMA 4CM6A 1EGQA 3C8HA 1E94E 1LK7A 2L7HA 3X1MA 1JEAA 2NADA 4TUWA 2E85A 1YIAA 3RFTA 3COVA 3RHFA 1OBFO 1V26A 1D2NA 1O5IA 1SD5A 3P9YA 4CF6A 4NRWA 3CSSA 3WDKA 4MS1B 4AJ1A 2RGCA 4DV2M 2G5PA 3BD7A 4DRZA 1H6AA 2W6ID 1J7JA 3OE7A 1EE2A 4G63A 4WZAE 3RVKA 4ENTA 1PJZA 4YXWA 2HM7A 2EJUA 2P41A 1OSNA 4HEQA 3KDAA 5KX5F 1XYYA 1X7XA 4UHEA 1DKPA 4PQYA 4CFSA 1W93A 3MWJA 5FTKA 1Q0UA 2IVFA 3K0FA 2XRMA 3V8NA 5JC8A 1DLIA 2L7IA 2BPOA 1N3LA 1T26A 3GQ5A 4BFLA 3KQLA 4EB6A 3X1JA 1U8EA 3TLCA 1AKRA 1SK9A 3U5ZB 1OGJA 3I62A 3JQRA 2KS6A 4GU5A 1MH9A 2D7GA 3IXLA 1SBHA 3LUCA 2Y3IA 2ODAA 3LF1A 4F1KA 2PT9A 1XELA 1JFLA 1XTRA 4Z7QB 1KC3A 3ZJ5A 3ZX5A 1NONA 3IIMA 3BIWA 1TQ8A 1T5HX 4CMIA 3D5QA 2CVQA 3JYHA 1VCMA 4W8OA 3BMCA 1CUJA 5D87A 4WW0A 4JLPA 2QLNA 4KPUB 5EIOA 5CFLA 4FHCA 4I55F 4FBMA 5AHKA 3ZY6A 1GG8A 1NQWA 4JYBA 4ZKDA 1GRQA 4EG1A 1P7CA 3EQ6A 1XLTA 2WVJA 1T9ZA 1XD8A 4Q6BA 2ATXA 1ZJ4A 3AR4A 5SYMA 4FJ0A 5HGJA 4M86A 4NLLA 4GSKA 5JPDA 1XQ6A 2VHUA 2PS0A 5I3ZA 4CT4B 2JDID 4YJHB 1E92A 1ZD8A 1CIVA 5U4QA 3OPYI 4MQEA 5JR3A 5KJCA 4B45A 4IIFA 4LDPA 4FP9A 3ORHA 4FB4A 1X42A 3VLFB 4TWBA 2GAOA 3ZV6A 1YA8A 1ZQ9A 4NWIA 4XWAA 2OO5A 1NLUA 3GNQA 1NY5A 2HV9A 5I7UA 1RI5A 1R88A 1PWZA 5JDIC 1T9GR 4G5QA 4ZHQF 3I45A 1WVGA 2Z6AA 3E82A 1S8NA 3OQVA 2E1RA 3W5HA 2ZCJA 2ZG6A 4RIHA 2VWPA 5ES3A 1K68A 2GUGA 1WPXA 3PGKA 2YVLA 3O4HA 1KK1A 3QIVA 4NBRA 2KI5A 1P4JA 1H2ZA 2X0NA 4BASA 8GPBA 4MI3A 3OTIA 4DWJA 1V5IA 5A3JA 3BILA 2DPLA 2OBXA 2X5KO 5DXAA 2I7TA 4EVIA 2DKNA 2Y0TA 2A59A 5ADUS 3THWB 4YP1A 2FFHA 3WRVA 3N59A 4QDOA 1EI9A 5IC4A 4HYYA 4MJ3A 3U6MA 2FMXA 2I65A 1U31A 1P33A 2WNSA 1ZOIA 2AV6A 5GVRA 3UWPA 2VTDA 2Q3EA 1CS4C 3M7IA 4NE7A 3JW8A 3QNMA 4CF4A 3TLBA 4AULA 2GWRA 3HXQA 1MX0A 1MHPA 3WK5A 2GX6A 2I1WA 4D9MA 3KKOA 3A4IA 5JQGB 3DAPA 4HAIA 1IOLA 4WT7A 4OCZA 1YR1A 4I19A 3LA6A 1CUYA 1WW8A 3MT0A 3DE2X 2VUUA 1M1NB 2Q4TA 5FV4A 3ITKA 3H9BA 1VQ1A 3LL4A 3DHNA 1IXZA 1P31A 2JEYA 2ZIAA 2Q6VA 1RDFA 4WSOA 2AK3A 5K3SA 3REQB 1J8FA 1GQYA 1YFKA 4F4HA 2XA2A 1M2OB 2OZLA 1AURA 1AIPC 2BI8A 3P9XA 1RQGA 3O74A 5TIIA 2LKDA 3FMIA 1KSJA 1ZGJA 4ZTBA 4IDAA 5FDFA 3CG0A 1GM5A 2KQUA 4F56A 3SF8B 4HWRA 1O9HA 3RAEC 2CFSA 1VDZA 4RJKA 4O2LA 2WIDA 4NQZA 1JRLA 2WNIA 2FW6A 1ZZGA 4TLLB 4KXNA 3OMXA 2PLFA 1RT9A 1JZTA 3UJPA 4DNOA 2ASEA 4TM8A 1CY2A 3DCNA 4CLOB 3E35A 4IDQA 5A4MS 1YACA 4LYHA 1WMSA 1BMFD 3CCBA 2C4VA 4YH1A 1P7VA 1RAHA 4POOA 1QVVA 1PGPA 2ZRGA 4DE5A 5DTIA 3V4VB 1E60A 1C30B 3UNXA 2DKLA 2F59A 1NW3A 3MFQA 3DONA 2PEYA 2J9FB 5E4YA 4ETNA 3TWMA 4PFSA 4A26A 2Y1LA 4GOND 4L4ZA 4B3CA 4LYGA 3P71T 5JU6A 2ALJA 2UKDA 1X39A 4WLVA 4QRHA 4WADA 2OMEA 4NCAA 4YPVA 1FMJA 1V48A 4H7HA 3NM4A 3FLEA 1HOTA 2AFIA 2H2DA 2ZVPX 1U5AA 4KE7A 4P33A 4BV8A 1RABA 1XHLA 3TTXA 3ASVA 2ANCA 4GC5A 2QLLA 2IUUA 1ZRMA 2OVBA 2W5UA 1CNMA 2J0QA 3L8MA 2B4QA 4NSRA 1QOPB 3C70A 1LC0A 2ZWAA 2XHEA 4Z1MA 2BP7A 1G2OA 5FJJA 1EVJA 3A11A 1G7RA 5EERA 1SK8A 3R9IA 2I2FA 4IVRA 4LK3A 4HWOA 1Z29A 1RIIA 2G09A 3CWZA 1PZMA 1KFJB 3TB6A 2YIJA 2FX2A 2VXCA 1AKVA 4CV3A 5F23A 1DJMA 2VDRB 3WC4A 1IBRA 1ZO8A 3ND7A 3VA7A 4NJMA 3OPQA 2HMWA 4MHSA 2QW8A 3RVOA 1AQLA 3OE7D 3T0GA 3ORRA 3T1OA 5FBWB 1IATA 4YXWD 1MTZA 2E49A 1GZ7A 5IBRA 4ACAA 2D2VA 3U9SA 1DIOB 1KOGA 1W0JA 2RK3A 2H2GA 1J0DA 3Q1LA 4J16A 1YUMA 2RGWA 3KD2A 4HJXA 1SU4A 4NBSA 1L7RA 1YGPA 3WLRA 4IRXA 4BKPA 1JMKC 3FN4A 1IOVA 1WSDA 4YLYA 3GEBA 4J3JA 3RTGA 2BSQA 1P1JA 2Z43A 2P9QA 3IAEA 4HLDA 4HH3C 5FT9A 3Q6MA 2E5LM 5KSWB 1EWQA 2WZBA 2VHYA 3AP1A 4B44A 3WHPA 4UOQA 3LG2A 1TK9A 3ITDA 2B4KA 4QOGA 5CT8A 3KXIA 2C1ZA 1BMTA 3ZBUA 2C3YA 5AXCA 2R65A 1MB4A 3UK2A 2QN6A 4NEHB 4C4YA 2R44A 3ANYB 1PFWA 4FT4A 1QFJA 4JXXA 4YJDA 2WV9A 4BVHA 5F2KA 1QCZA 4E46A 3MGBA 4WCVA 1YS7A 2PZAA 4GRDA 4EGSA 5TQJA 3VHXB 2HCBA 3ZN2A 2ZR7A 3SEQA 2R8XA 3QX9A 4I5FA 5D86A 4NXNB 1PV2A 4BAUA 2PO7A 4MGZE 4P16A 1Q0QA 3BRSA 2F3RA 3EUEA 2EXXA 4JI7B 3ETLA 4GGMX 2B98A 3CNLA 1D6JA 4KQ1A 3AR6A 2V7TA 2OSBA 4IRMA 4CIVA 1UINA 2QNBA 2H0AA 3RU9A 1B3BA 1H4QA 1U0LA 4KNWA 4EA7A 3AQIA 2NO1A 2VNJA 2RMKA 3N28A 3Q2IA 1DBSA 1SC4A 1T6BY 3FI0A 2XZFA 1C9YA 4H7FA 4KBGA 5ED0A 1AZLA 2FZKA 1M5RA 2IDZA 2GFHA 3SFVA 3GRPA 1MIOB 1VBMA 2IE8A 3PD0A 3ECAA 3DOAA 1BXRB 2XGMA 3KZNA 4FNOA 2G3YA 2J3KA 1HRDA 5ALWA 4AJEA 4ER7A 3WB1A 4LE2A 3TXXA 1SKQA 3U39A 4BJ3A 1CUVA 3JASB 2NU9B 2IYXA 1J6UA 3YASA 3BWXA 3DEYX 2XEPA 2ZITA 1NMXA 4P0TA 3L9XA 4YLGA 1VP3A 5A06A 1NI4A 1Q7TA 3VJMA 4YMLA 2Q5FA 1EHYA 2UYQA 1SEPA 2RJ3A 4NCKA 5C7YA 4FPXA 3HCFA 2A5LA 4HN4B 2IS4A 2DWCA 2YJNA 5T8KA 4N76A 2BEKA 5A4JA 1IK4A 2M6RA 1QVRA 2DAMA 1CJCA 3RYCA 2G67A 2VKQA 2YXDA 4P7GA 4LC1A 1XZDA 2DTXA 3F8TA 3EXAA 2VLBA 4ZJZA 3TN7A 4GWKA 3F7OA 3TE7A 1ZNXA 3WK4A 5DBFA 2C1EA 1NQOA 4TTSA 1WDTA 2ADOA 1OLSB 5HF5A 3LPCA 1LLDA 1KSHA 1VE7A 5J4VA 1VPTA 3IUPA 2IS6A 5CCEA 3NVMB 5K2OA 1JJ7A 1FZQA 6AT1A 1N6HA 3ME5A 2B8EA 4DQKA 3GDFA 5B6IA 4M6WA 2O54A 2F62A 2KNVA 3CIFA 4FGZA 3CTWB 3KPJA 3X1XA 1CG6A 2X42A 3O8QA 2WIKA 2FQXA 2HEIA 2EKFA 5JWRA 1WUYA 3DDWA 3LPAA 1EFUB 3B9QA 4A6PA 4XM0A 4LHWA 4IRUB 3T3NA 2QSZA 5KVVA 1TAGA 5CG2A 3HC7A 2QTCA 2H4JA 3UTCA 5T41A 3KLNA 1Z4JA 5AJXA 3Q5DA 4Q48A 4TXNA 1PWEA 2DM6A 4JIMA 5EEHA 4ZVKA 3L7MA 1L5HB 1MP0A 1RLMA 4U7GA 3IMKA 5L8VA 3C74A 2ZM6B 1LNZA 4D82A 3UMJA 3G7SA 1DBQA 1QDEA 4OB8A 4RUKA 4PSKA 2Q2VA 4TT3D 2HW8A 2DPGA 1N5IA 1ILEA 4PN7A 4MDEA 3IYLW 1A98A 3WGIA 1D7OA 2QTRA 4UPEA 4UUOA 3C3XA 3KJXA 4NBTA 4JB3A 3R41A 3G8DA 4TM7A 2EGHA 1K3UB 3OJFA 3BWDD 3MGCA 5E4FA 4UUBA 5JAHA 1JHUA 3NDJA 2C8KA 3RANA 4G4GA 3KR1A 2R7AA 3C85A 4EATA 4WXPA 3GVXA 4RHCA 1Q7BA 1RQPA 4LY9A 5GPBA 3IEVA 3OQIB 3MMZA 3MOIA 4ARCA 1O8BA 5KTYA 2D7JA 4QC2A 3FWZA 3FE2A 1NBMD 4MP3A 4M1TA 2G1JA 3LX4A 3INYA 1NX9A 3C3WA 4EWLA 4PG8A 2YOHA 4EM6A 1VMAA 2HB6A 1Y7HA 1I7QB 3FB4A 1UFRA 4PPNA 2NGRA 5HDBB 5SICE 3JYQA 2PIDA 3OKFA 3W6UA 1SBZA 3CEHA 4Z1MD 1EAYA 3D3WB 3OBBA 4ZVLA 2D2EA 3W79A 4Z8YA 4GMDA 1W581 1DZ3A 3WYBA 5JARA 2CLEB 4BL5A 4NP6A 1PWXA 4PONA 3EVEA 1SZCA 1K5GA 1YA6A 1IBMB 1Q95A 1MOQA 1LDBA 2YZ2A 1AF4A 2MMGA 4QIHA 1WRBA 4LOHA 3W5JA 4PNPA 3NWEA 1P3DA 3NIBA 3M9LA 4B81A 2BSXA 1U99A 4G24A 1QK3A 1DUSA 1IAQA 2OCAA 4XD2A 1Y3BE 3KWJA 1XL1A 3RKUA 2Q0SA 3MG9A 4GR4A 4F97A 2G9QA 5HRUA 1GZ4A 3HJTA 4TUYA 1IUNA 3QVUA 3JPWA 5HM6A 2XB6A 2Y20A 3ZD9A 2QHXA 4R2IA 4HP8A 4KVZA 5JADA 5D5PA 4ZCLA 3H5AA 3TGPA 3D31A 5KNBA 2YR0A 4R7TA 5IKEA 2FS1A 3GA5A 1HNNA 3W5SA 5FI5A 4ZI7B 3NYWA 3KT3A 3SWWA 4YYEA 2UUOA 5LWHA