3C3DA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and phosphate. northeast structural genomics consortium target mar46
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
total genus 89
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3dA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3dA01
2P0YA 3CGWA 3C3DA 3C3EA
chains in the Genus database with same CATH superfamily
1CJUC 1HDIA 1CXZA 3PENA 3E35A 1Y9JA 2WBLC 2FMFA 4V0KA 1E2GA 4S24A 4BNXA 1E1RD 2XNCA 2IZ5A 4IDPA 4QQKA 2VSFA 5DBHX 4ENSA 1B73A 5FADA 4OV6B 4G4QA 4CL8A 1EHCA 1P29A 3WV5A 2CVPA 1EUYA 4QGBA 1P19A 2OBYA 3WL5A 4N9WA 5EFZA 4IDGA 5AMXA 3DQPA 4DMGA 1K06A 4QM6A 1FJXA 2D8MA 3R3VA 5DXFA 3WJ7A 1BHJA 1N34M 4JJGA 2Q50A 5TPWA 2A0XA 3TE6A 5G3ZA 2CV2A 2C0QA 2HDOA 3IMEA 3WTCA 3U5TA 1VJ0A 4FZJA 4AJPA 1ACLA 5GIPE 1J9ZA 3ZQUA 2PGNA 1AF7A 3P8ZA 1DKRA 1N2OA 2E18A 2ILVA 1DMSA 1XEFA 3VPXA 4WP2A 3B74A 1TYZA 4EY6A 2ISCA 3T52A 3Q3HA 1TTEA 1AZWA 4HUQB 2VF8A 3EW9A 1EFUA 1J5EM 5I7VA 2XTNA 2PLWA 3QNWA 3LFUA 4QRIA 5T6MA 5CXQA 2G3QA 1IPEA 5AKKA 4C88A 3O74A 3PKJA 1ZMTA 1U7OA 2I3DA 2AN1A 2QJRA 2D1FA 3WADA 2PMFA 4GLJA 1E2FA 4Y18A 4ZO4A 3HVKA 4Z6YA 4FHFA 2PKRA 1PEYA 3JPYA 2Q1TA 1TMGE 3WBJA 4D0LB 3EXFB 4I55B 1G21B 3EIFA 2RH8A 2RRUA 3BJRA 5TT1A 3VHXA 1UEJA 4REZA 5JY1A 2GFHA 3RYCB 1L5GB 4XCVA 4CL0A 1KRXA 4KG7A 1T8RA 2A9PA 1IPFA 2F00A 2CXXA 1KU6A 4UE6A 2V9ZA 3WB0A 3T94A 4HAUA 4WZBA 4CRWB 2TMDA 3LW8A 1Z2AA 5T5QA 3OZDA 3RTEA 1YGYA 2HSGA 3NUZA 1L3IA 4ZOQI 7MHTA 1CQXA 4HYYA 3RE1A 2HXGA 3PC8C 2ASEA 3V1MA 5FUVA 3W2FA 3BGDA 4HVTA 1VECA 3R0IA 4IJFA 3PXCX 4X41A 5LSAA 5AQ1A 2LTUA 1OQYA 3WR5A 2ZTMA 4OL0A 1DUSA 3EGDA 1JHXA 3JQFA 1YL7A 2R4QA 4KDEA 4V0SA 1NP3A 2B92A 1IONA 1NC1A 1L9KA 3KVWA 1DINA 1ORDA 1JT2A 1JLKA 1T1EA 1QYRA 2IF0A 1E1QA 3SP1A 3QVUA 5KKAA 1C0LA 1ZQ9A 1EXDA 1RQXA 5BNFA 3T4UA 3UPUA 4BNNA 3VDXA 3DZJA 1RD4A 1YNSA 4RJLA 1TA4A 5D6OA 1C7FA 4MGYR 3EA5A 2JJ2A 3C39A 4QHYA 2NXCA 1TEVA 4F8JA 1PJBA 4OQMA 3VHQA 1DHRA 3E70C 4YXWA 3ADKA 1PR1A 2FNAA 2VHCA 4JJZA 1OYVA 4DV0B 4MULA 1Z16A 2GVNA 2V7VA 2QSZA 1US8A 4UTZA 3REQB 5BUSA 1MTOA 2F90A 5JBNA 2OORA 4MO9A 1U04A 1AGXA 4DUZM 4PXAA 2AW3A 5B2ZA 2J07A 4WEOA 3DT8A 1E63A 4JY7A 4EPXA 3QUBA 1E0JA 1CULC 1K6XA 2WYHA 2B5VA 2GPTA 3Q85A 2VNKA 1V9LA 4DB4A 1H05A 3UGTA 5HIAA 5KU7A 1C7JA 3L6EA 2D13A 1H93A 4ZQBA 1GLVA 4DXAA 1XMJA 3SBXA 4UAGA 2QRPA 4CM9A 3IE0A 5HPYB 2EFDB 5E6SB 3U17A 4GMKA 5JAMA 3I8XA 1H9CA 5HWSA 1YR1A 4NK4A 1U65A 1RQPA 2ZP1A 1DEXA 3WAJA 1Q7EA 2WTEA 3VOAA 2YJGA 5ILQA 3SZRA 2ET6A 1ANKA 3QPVA 4EYGA 2WD9A 1KRWA 3DZKA 3DP9A 3P1JA 2CL5A 1QGED 1GGHA 1U5CA 3P0RA 5LMCA 5KOYA 1YR7A 2P2LA 5B5SA 5AW8A 2R25B 3DCJA 2AVDA 4MYTA 3TZLA 3S5JA 1GUZA 3KSDO 4MWSA 1UBLS 4CW7A 2ODTX 1R50A 4YRZA 5F9FA 3BQNB 5H82A 1EFAA 1X0XA 4G8BA 1I0ZA 4YCMA 2PBRA 4BNDA 4AN0A 3T7RA 2P2YA 4AN4A 1BS2A 4E21A 3CIFA 4HADA 3ZD9A 2XD9A 1OZGA 3DZIA 1N92A 2QJOA 1XDZA 5FO0A 3V2HA 2OESA 4YALA 5ALIA 3VR3D 3T1HM 3WSWA 4S1NA 5DNYB 1T6XA 4JT2A 1M8FA 3UN1A 3EQ9A 1SVOA 2R8XA 2I2AA 4Y6LA 3WLTA 3UK7A 3TRFA 2AQIA 4RIIA 4YRNA 2EP7A 1F8UA 5F3DA 1UP6A 4DADA 2V54A 2HJHA 1GR1A 3FIJA 3OIGA 4LIPD 3FYDA 2WP0A 1Q84A 3ACBA 3F6CA 3AY7A 1GADO 3OLQA 1XF1A 3LHIA 1PCXA 5E7IA 3FNQA 4FGUA 4R1OA 1WBBA 5CA0A 4OW0A 2VJAA 3WGHA 4LXHA 3M6VA 2NUBA 4DMMA 1QVZA 2ZTUA 3FPSA 3KUXA 1TB4A 5JJLA 3UM9A 1Y7PA 1XKQA 1FJGM 3WGLA 1N9GB 1TH4A 3HHEA 3BGWA 5DXJA 1AGPA 2QUKA 4OU7A 1NMXA 4TWRA 4AJOA 2R47A 2QE7A 4G8DA 1O94D 2XSZD 4NE7A 5H83A 1QRUA 5LC1A 3R7WA 2WTXA 3A04A 4REQA 2PWPA 3KJFA 2G28A 2HK7A 3GMIA 1KYTA 2FRVA 2XB9A 4HDMB 2B94A 3SYNA 4DVGA 3LX8A 4N5IX 4CG3A 3QX3A 1EU1A 3W8FA 1OROA 1PR9A 3A6PC 2WJVA 4BO0A 4A15A 3LAWA 2NQ8A 2C78A 1U3GA 1OAKA 2IQ5A 3NALA 2K7FA 1F38A 2BISA 3B5IA 3F5QA 1IQPA 2JI4A 2FTKE 1Z5UA 1JL3A 4MQ4A 4MVJG 3Q3VA 3QVJA 1FXSA 2VSQA 4IS2A 1GYPA 3O3OB 1V1RA 5K4GA 3WJ1A 5JIBA 2M6SA 4F3NA 5ITRA 3DG9A 4RIHA 4DLVA 4JASB 4X6XA 2IHJA 1JHDA 1E6LA 4JSTA 5BY2A 4OU5A 3OKPA 2ZXFA 1XZAA 3QTLA 2C4VA 1OI3A 4QL3A 1ZGBA 1WMDA 4WCFA 3HKCA 3KXEC 2O5VA 3PRKE 5HF8A 5TMDA 1WIVA 1VG8A 1AUAA 2DX7A 2P11A 2J5KA 3PRJA 4Q7QA 3CUVA 3G0CA 2PS1A 1I3NA 4QSMA 1FX1A 2Z9BA 2F3TA 4M0MA 1RIIA 2QPAA 4R31A 2F3QA 4UDYX 3EXHB 3FYHA 3JR5A 1I7LA 1XNQM 1EMDA 5LBTA 3BA1A 3CX8A 1BN7A 5D6NA 5AW9A 4QC2A 1KF0A 5ALMA 5IKOA 2JFHA 3A98B 1EI9A 3H2JA 2EA0A 4WDRA 4OQDA 4JYMA 3SMQA 4EQ6B 1UCFA 1QNFA 2ZTCA 4U1RA 4I1OA 1CR2A 4LS3A 2CF5A 2UU9M 2EBFX 2WF8A 5IXSA 4JI8M 2W2KB 2BGGA 2MT9A 4M99A 3BK2A 1FW8A 3ZQ4A 3UOAB 3KL4A 2IYZA 4GAEA 5BV7A 1WMEA 2ATEA 1DFIA 1ISMA 3SQLA 1F2TA 1ESNA 2VRWA 4RTNA 2ZCVA 5G53C 4XYLA 2IS4A 1GHTA 2C4KA 5A05A 2AS0A 3ZY3A 1W49A 4FU0A 4GI3A 3TL6A 2X14A 1VCNA 4DF3A 4ZDWA 3A36A 3ZWOA 1N0VC 3FDIA 5FJJA 3WWYA 5ELLA 3E5MA 1OAAA 4D6XA 1C1XB 4P53A 1J99A 4Q4HB 2ONCA 3C97A 3DQZA 2WVJA 5A9RA 1QLWA 5JJKA 1R3UA 4I1PA 3FJYA 4RHCA 5FBZA 1HTBA 4PNEA 1WZCA 4J9UE 4EPTA 5KOJB 3M3PA 3AFNA 6GPBA 3UAZA 1JZSA 2C9CA 2UDPA 3WNDA 5EHIA 4PSVA 1GG2A 5FFMA 4QVGA 3NHJA 3QVTA 1NBEA 2GOYA 2A7XA 5A6SB 4PY2A 3TWOA 2YXBA 2FMTA 4LDNA 3FI0A 3ZNNA 3WAGA 5LMUB 3MGBA 3RE8A 1C3JA 5IVPA 1XTRA 1RWWA 3JQ6A 3QSGA 1E4YA 1OFUX 4OBXA 4N5NA 1ISGA 2J9FB 1R8JA 4EB6B 2C98A 2VQEB 1RYYA 4HTAA 3OI7A 3HXLA 4N8DA 1KO1A 1AQUA 3M6WA 3MJFA 2QN2A 4EA8A 1TADA 1JQLB 2FX2A 2QMQA 1FQOA 2ZUEA 1PKXA 3TDKA 3ZDCA 3U1BA 5A0TA 4TMZA 4B84A 4IYJA 1CCWA 4H7KA 4GEGA 4DR4M 2X19A 3QVOA 3KP1A 1PYGA 4ARCA 4KJZA 2XCSB 2HPVA 1CZLA 1T91A 3GLFE 3HJSA 4D6YA 1JJBA 2H4XA 5FOUA 4R2JA 1F20A 4ZJUA 3GO4A 3HEBA 4ANFA 1DBQA 3BAZA 4TWJA 4UW9A 4KL8S 4D44A 3QY0A 1NYTA 3I5UA 3ANXA 2XHEA 4KZPA 4ZQFA 2E4YA 3CKKA 4Y7CA 1WM1A 2VP5A 1YL6A 4L8YA 2GD6A 5KTNA 3SJBA 1H6CA 3KOWE 2JLSA 2WVAA 2WWYA 3B1WA 2ZLBA 5BQPA 5JNSA 1F5NA 4HWKA 1IY9A 3UV3A 3MMXA 5A9SA 4KYTA 5IYZB 1XV5A 4AF6A 2OO7A 5DYYA 2WLTA 1NKSA 4GHWA 4PPFA 4WAUA 1J49A 2HMYB 2JS7A 2PSHA 3C5EA 3O91A 3M8KA 3PDCA 721PA 3NOVA 1I6MA 3JZIA 3VYSB 3D54D 3PX2A 1E5QA 4KLNA 4V0RA 4EJ0A 1T5BA 1UJNA 2I71A 4BVEA 1QZMA 5ITYA 1RJGA 2YZMA 2ZR0A 1VYTA 4WLNA 3V9AA 2GD0A 3K96A 4JVOA 4C29A 4G0UA 3B1VA 1SC4A 1X0VA 1C4WA 5BOSA 3I01M 4H7IA 4URUR 4N18A 3TI9A 1VRVA 2BFEB 2BFAA 1VPDA 1QO7A 3LUCA 3NDJA 3AXTA 4ACAA 3DF7A 4E2XA 1QH0A 1AQYA 5ITXE 3BCHA 1E1MA 2JGEA 3UPDA 1XHFA 2MINA 3E0QA 3RRJA 4JB3A 2ZVPX 5KOIA 1Z4MA 3HC7A 3RRXA 1YMVA 2PZKA 1L7BA 3BA6A 4JBHA 3HDYA 5F64A 5LDGA 3TJMA 5KDDA 2R1ZA 3HQ4O 4N6NA 2QMYA 3WMXA 5B55A 2AWNA 1AV6A 4DR7M 1MEEA 1SXQA 5REQA 3IPAA 1LTMA 5BMVA 4EJ6A 1W88A 3TLBA 2BFCA 4M4SA 3DMFA 2VT7A 1ZUNB 4OX9B 4I6EA 2CVFA 3K0KA 2HW8A 3LUDA 3FMFA 1T4BA 3C3CA 3P0EA 5AJXA 3B1YA 1L6IA 1MC8A 4KH1A 4G6ZA 2MSEB 1Y3BE 2QMOA 3PUYA 3D7MA 3C6ZA 3IB3A 1OFVA 1RXWA 3UT5B 4DC0A 5DYNA 2XX3A 2AYXA 3GBVA 3QJGA 4KPGA 5CB4F 5BVGB 4ALLA 3I4CA 1MB2A 3D6FA 1XZKA 3UENA 1X1DA 1A8PA 3L8DA 3KDSE 4Q7KA 1JDBB 3TCXB 3EA0A 1NMSA 3ORYA 4QXRA 4YUVA 1BFUA 3FF4A 4LWQA 1XP8A 4FWDA 3HU5A 4F6CA 2UXCB 3BRWA 4GSLA 4N3AA 2EFJA 1L9XA 4HAYA 2FR8A 3HCCA 2X23A 2QU7A 1E7QA 2CHGA 3MTJA 3L5OA 3U39A 2HA6A 4BLVA 4AS1A 3BL8A 2XH9A 4ABYA 3HMQA 3HDTA 2V8BA 4QGFA 3RF7A 5JZOA 3IH5A 1PLJA 1QUSA 1VFPA 1BGVA 2ZS9A 3SARA 1P5ZB 2R7KA 4LHEA 4U7WA 2E9SA 4Y9UA 4ATNA 3TTUA 2CEAA 3AI3A 3NDRA 4TN1A 3TG2A 1NZJA 1P91A 5HRCA 3MWEA 4C06A 2IY9A 4HS4A 3V4VB 4BZXA 2PXAA 1YVDA 3STYA 2AFHB 2XE4A 1JVNA 5SY9A 2GT1A 1T6OA 5F1YA 1KI6B 4F93B 1ZN8A 1UJCA 3OPYI 4PICA 4RKRA 3L3BA 3SSMA 1FDWA 4WKOA 2QRHA 5MF6A 1ZN2A 5HCNA 1GKIA 2ZRBA 3TW4A 1F5SA 3TQFA 2ZJBA 1I9GA 4CTNA 1Z68A 4U0KA 4HPWA 3PNOA 2XWSA 1R4ZA 1EFHA 3BWDD 5T7BA 3SZOA 1PNOA 5DV9A 3FTDA 1X7XA 4TKVB 3TSCA 4KPYA 4LF7B 2QV0A 2WJWA 1IXSA 2I2WA 3FVTA 5J2TB 3ZDRA 3KB6A 4JX8A 3IRUA 1VG1A 1J2YA 2HRZA 1V6CA 1F6DA 3EVAA 2X76A 1L8QA 1ODJA 4NZZA 2QP9X 3CXRA 4YJ2F 3IECA 4RY0A 1BX1A 2V7GA 5ADUS 2WHXA 3P9XA 2J09A 3L49A 2PH1A 5K3EA 3I39X 4PBTA 4FHZA 1RR6A 5IW8A 4FFVA 3FMOB 3UAWA 3HKEA 2AMJA 3UO8B 4RD1A 1U2DA 4D7AA 1GEGA 3B7WA 3DBRA 4DE5A 4LDRA 1X7YB 1N5KA 1U3VA 3BCRA 1AO3A 3HNRA 1O3YA 4G85A 3DZFA 4PYJA 3H7IA 3SC3A 3HUDA 3AVVA 2Q2QA 2PUWA 2X8WA 3ESCA 1UDRA 4X66B 1FRZA 2W6NA 5TQVA 3FA2A 3T1YB 2H59A 2G67A 1GXSB 1H94A 5AI8A 4FE4A 3ILKA 4TQ9A 4HQRA 2ODQA 1W4ZA 4AY3A 1RSZA 3EMVA 4NOOB 4DB2A 3EXG1 4P4GA 1JQKA 5FV4A 5LIPA 2H65A 1ECLA 5K8CA 1A72A 1NU8A 2IKQA 3PUVA 3JZAA 1DS6A 4DCCA 1WSBA 2F4VM 2LKDA 4QOZC 4DM4A 4MVCA 2HMVA 1WOMA 4OHZA 5JARA 2ECKA 2XA2A 4UNRA 3IR7A 1AMNA 3BFPA 4WI1A 4GPZA 4D0RA 4CQNA 4XLLA 5IDQA 3NO4A 4LVCA 4CU5A 3KHTA 2QBYA 5AH0A 1W5TA 2M32A 3VR5A 2ECFA 3MMNA 2ZSFA 4B79A 3BIOA 2JJQA 4LY6A 2XYQA 4L6IA 4DILA 3BD9A 1U98A 1Z0JA 1UZLA 4TV8B 5IPFA 3U56A 1QM5A 2QD4A 3T34A 2OKGA 4HC4A 4BE4A 1BU5A 4I0WB 2ADOA 1NP6A 1M34A 2XT9A 1E99A 4AIRA 4DR6M 3A6GA 1X2BA 3AIIA 2XMCA 3A6ZA 4NZOA 4IVRA 3TRKA 1IN5A 4HR7A 2BLNA 5G4LA 3RTCA 3ZJ5A 2IVFA 3NW9A 2QI9C 4HQNA 1Y8AA 3LO8A 4Z8XA 4G3XA 4BN5A 1RPAA 3U4AA 4HV4A 5BN5A 3OQIB 5HQ3A 1T24A 4J43A 3GLHA 4QSHA 3KQUA 2EVWX 5K01A 4OHVA 2AZ4A 1HZZC 3HA3A 1HQDA 5EP3A 5ALEA 4KAJA 2XQIA 1WD7A 1SU7A 4RH1A 2IHVA 4G86A 4CG2A 3ZBPA 1H66A 1GZ3A 3BHJA 3DW1X 1B3RA 3FTCA 3C70A 1UJBA 4OYYA 3PYLA 4G5RA 4UM8B 1AD2A 4O0LA 4FUQA 4AJJA 1JKJA 5ESRA 4ALMA 4JP3A 1TI7A 5HCIA 3S0JA 2HI0A 1C9YA 4QUBA 2C95A 1ZJZA 1EX9A 3OETA 3VISA 2BBWA 3ZKWA 3HHYA 4TPKA 4FMCF 3SE7A 1YZVA 1ORRA 1Z2PX 3RNLA 3EA4A 2BF4A 3D3JA 4ECEA 2HU7A 3GLRA 3H5IA 5MDHA 3UGJA 3K35A 1I7PA 3TSOA 2BV3A 2FCAA 1Y3IA 5FAKA 4F5WA 1ZA2A 2D2VA 3CO5A 3M2TA 3W5VA 2PX3A 4YCAA 5CU7A 1X7ZB 4IBOA 3VUEA 1RYZA 3V2IA 5GM1A 2ZJ3A 1MQAA 2WWGA 3U3OA 4ITRC 1UPUA 2R8BA 4TUYF 3CCBA 4DGQA 3NM4A 4DSTA 3FDZB 3WLHA 1PO7A 3E9SA 4QDUA 1X8LA 4ZEWA 3GQBB 4Y0AA 2GJSA 2J9GA 3OX2A 4US2R 4UHBA 2TMGA 3UXYA 3K6KA 2FQWA 3PR3A 3WL3A 1DLIA 1R64A 4FYWA 4FYKA 2BTQB 2EW1A 1Y8ZA 2NV2B 5HJEA 2IP4A 4KVZA 3W2HA 4ZMBA 3QYJA 4LX0A 4LRWA 1V7QA 4GKKM 2Y68A 3I09A 2XZDA 3WGGA 3CRW1 4QBIA 1QGDA 4CN8A 3R0QA 2OOAA 1GQSA 3ZI0A 2CXPA 2C9YA 4XPIA 3USCS 1UXIA 3NWBA 3WE7A 5GOZA 3A37A 4B45A 3J7BA 2YZGA 1RQGA 4FXOA 3BHIA 3DO8A 3CVXA 4FFRA 3TH5A 3KTDA 4DT1A 3UWPA 4RY8A 3GNTA 1SCAA 3NHKA 3T95A 2PU7A 4XEUA 4B3DA 1DRKA 5AVTA 1VLMA 2FF5A 1Q0ZA 1RJWA 1CS0B 3OWXA 2ZBPA 1DNPA 4PYKA 2SBTA 2P6RA 3EVFA 4EYSA 4N6OA 3RSQA 5KKNB 2QSJA 4QEZA 2FQYA 2BR3A 2BM0A 2PGAA 5BQOA 1GL3A 4I5SA 2OHXA 2YL2A 1X2EA 4UUMA 1KSJA 3QITA 3KJIA 4C0BA 3LHFA 1L4KA 2XWJI 4ZODA 5HEKA 1Z3IX 3ZDZB 1LFAA 4DV3B 3ER9A 1VL6A 3GD5A 2VBIA 1W1UA 1TT5B 3IP7A 3WLSA 1CDDA 1EUDA 3O7WA 2O8EB 5CFRA 2I7PA 4WLVA 2IS6A 1WB6A 4LHVA 2W22A 3TO5A 2N35A 4D8XA 1FDIA 1PT9A 1E0SA 4BNKA 5EJ5A 2XRZA 2RGGA 3TB6A 3F1LA 1C7YA 4QYSA 5LYJF 4GE0A 1HGXA 3B6JA 1UEIA 4JI1M 4LQDA 5LP6F 1M1YE 1GTL1 4FFNA 2NVUB 1OYWA 2H5JA 3PHHA 1I4TD 1VE1A 4M0LA 2ZRKA 4RF4A 4P81A 3GLVA 8ADHA 2F4NA 3D0QA 1XALA 3UJ3X 1PJ2A 1D03A 4NLLA 1E61A 1KVUA 2QZJA 1ADCA 2CLHB 3GFTA 4MCJA 4ZT3A 3NCHA 2NZJA 3HP7A 5K3SA 5BRJA 3EQ8A 2FWNA 3W7VA 4AUKA 1OIPA 4B3RM 3A2LA 4R2IA 3F8SA 2F5QA 1GV0A 3TINA 3DNFA 3EVZA 1U5BB 3IBCA 3LY9A 3IAS1 4GL2A 3MZ0A 4JJ8A 4KXQA 5K0TA 4BXOB 2OHJA 1XJCA 2HM7A 2Q0XA 3SNKA 4CF5A 1Y5IA 3PA8A 3X0DA 3AEQB 4YQZA 5LJIA 2Q5FA 3KSUA 4F06A 4BGUA 4PLZA 4EECA 3QW2A 2ATXA 3PR2B 3UTDA 4H35A 4W6QA 3RSZA 1JHUA 4OOFA 4DPLA 1PEAA 4WFQA 2HEIA 4AUNA 1UDBA 5F23A 4JMLA 3EZYA 4HB4A 3EXEA 2J1LA 3MJCA 1GZ4A 3QX7A 4Q02A 2IDMA 2C1ZA 1Z73A 5LMZA 1HT3A 4MUYA 1HG0A 4D99A 4X1OA 5EXTA 1ZM2A 1DQZA 2DKFA 2G70A 4FN4A 4RFVA 1H65A 1MA0A 1ECBA 1SELA 3VR4D 4TQAA 4I50B 3MMSA 1MIHA 4NFLA 2H85A 3A58B 4GM0A 2B2NA 5LXTB 2V3CC 2GF2A 4GZ3A 1B15A 2B9EA 1KS9A 2H5LA 1DJLA 3QEJA 4REMA 3T7AA 4YRQA 1PVOA 3IBGA 2V9CA 3PUIA 3T9EA 4JB0A 4LWOA 4BO1A 3TXAA 4AJEA 1XFAA 4P0PB 1JEOA 5A06A 2O5CA 1II0A 5KTTA 2VJKA 1Q02A 5DCWA 4E12A 2EEPA 3HDQA 3TWKA 3LX4A 4B3MB 3RYIA 1U7PA 1PG5A 3NNSA 3HGMA 3FVVA 4Q34A 2C99A 4DRZA 1MABB 1FP4B 1T5OA 5LL6P 4MV6A 2C7VA 5JS1A 2OG2A 1Q1EA 1P6XA 3DMTA 4RADA 3AUXA 2ZSEA 3DJYA 1BCRB 3ICOA 5BN4B 3I64A 4IJQA 1ZD1A 5IVDA 5BYJA 3VI4B 1PFGA 2QX4A 3T06B 4ZHQF 5FLKA 4YRRA 3H17A 4D9JA 3QF4A 2O06A 3KE8A 2B8WA 3RJTA 4A0QA 2X4IA 3FCUB 3LP8A 3J2PB 4M1TA 1JSLA 2DJIA 4FW8A 1DG9A 2UYYA 1WA5A 5GQSA 4YAJA 3D3WB 4P93A 1PYDA 2WF9A 1CVIA 1JNYA 2LIPA 3KALA 2VDWB 2CNWA 1EM8A 2DTEA 4ZEMA 1V26A 4M0UA 4MVWA 2LCIA 1AIPA 3H87A 1QUFA 1G2PA 2ZI9A 1HO3A 1I3CA 4RF3A 4OMDA 2CXTA 1THGA 2HL7A 3ZWPA 2DWQA 4K03A 2R65A 1XNJA 3GV0A 2EKBA 2JW5A 4JMPA 2X7HA 5C0OE 1KSFX 1IBKM 4HYEA 1KDTA 3UCFA 3FE2A 3UUWA 1QKJA 2WG0A 4I66A 1FYVA 1K98A 2UZ1A 4JSRA 3TLKA 1JHRA 1QGZA 4EQ6A 2O25A 4DLPA 3NHZA 1P9NA 1HOXA 3ENWA 1JRLA 2JIBA 3KZOA 4U7HA 2C9OA 2Y1GA 1JIKA 1XWWA 2ZRFA 1IOVA 1QE5A 3B3GA 5HKBA 5EZ6B 1IQRA 1HNZM 1YRYE 1TCUA 1MXFA 1A9XB 1QG6A 3BVPA 1L5SA 3MYYA 4JC0A 2IKSA 1PR6A 1FP2A 4KO2S 3B9PA 3U4CA 2B34A 1NR7A 3FN4A 3QY9A 3MQFA 5HDQA 1YQ9A 5DHUA 4HVLA 2B6NA 4YHHB 1NDQA 3DO5A 4M6WA 5CNMA 4QXMA 1N33B 1HFWA 1ABBA 4GR9A 1JF8A 1CE8A 2VAWA 3HP4A 3GAMA 4K81B 3EIUA 3BKXA 2F1RA 1UFZA 4IIYA 2VPQA 2LDXA 1ODKA 3DR5A 3CRQA 2HWJA 4XLZA 1W52X 2HQRA 2P6UA 1ZJ6A 3ILYA 1SC1A 1YONA 4ZVVA 4G26A 2JGNA 1EB8A 2JBWA 1FNSA 4Y3UA 2QX8A 4PLCA 1LDMA 2H1CA 5HGXA 2WWHA 4YBZA 3LDGA 1E9EA 4AJ9A 1H4VB 3IQFA 3CRMA 4YP1A 1MB0A 1QO0A 3SG0A 4E14A 5A6SA 1TXGA 4GOOD 3R3JA 5JFTA 1MEJA 1OBFO 2JVKA 4Q39A 2IH4A 5KZMB 4WNAA 4RABA 2VH2A 1MB4A 1B6GA 5EKXA 4EO9A 4TL7A 5BV1A 1KERA 4NTZA 1CUZA 4M2LA 1WLYA 5G3YA 4BGIA 4KE8A 2QR3A 2CK3D 3LUJA 1FA9A 1C30A 1STOA 3Q7PA 5E2AA 4H3HB 1DAHA 4ZO7A 5CMLA 1TD9A 2P4HX 5IU6A 1NG9A 2A5YB 3FUUA 3VV3A 1SXGA 1XE3A 4D4HA 3CF4A 4R2KA 3ITDA 3RSHA 5DHSA 2VCEA 2P5TB 5IHPA 4BECA 1SRQA 4OHFA 4TROA 4AXBA 1ZSNA 1SVWA 1CIVA 2RGAA 5C52B 3ORQA 3SJAA 2OUKA 3DBOB 3L4EA 2GO7A 4ZT2A 2Z9DA 1E0DA 2I2FA 1E1KA 1NF2A 1H9BA 5EIBC 3QKTA 2TECE 1NFQA 1DBIA 3KAJA 4IUCS 2PLFA 2V1XA 5AHKA 3S1LA 1LTKA 2IUSA 3AHJA 1W36C 4RZQA 3RYHB 2CLEB 5FBVB 4B75A 3F6YA 1GDDA 2XZOA 3C7TA 1Z0SA 1XVIA 4ITQA 5EY5B 2O8BA 1D2GA 3UYLA 4P36A 1SUEA 3MAGA 5A5VA 4G4SO 5COQA 2Z83A 4WK6A 3K0AB 3E18A 1HR0M 2RKBA 3DONA 4E7PA 1H8ED 3JAMS 2WHPA 2H92A 3OEYA 4D02A 1XVAA 3IBTA 2IPLA 3A6KA 1O97C 5JCOA 2CL6X 3ME5A 4WNIA 2IITA 4YI5A 5CITA 1Y3CE 4LMAA 2GUGA 2PXCA 4L5JA 4RSMA 4DCVA 1A4XA 5IJZA 2RAVA 2Z8YA 1TO2E 1QZZA 1QPZA 4NG5A 1DEHA 2YHAA 3FUVA 2W90A 3IEPA 3JD1A 3T5GA 1CNEA 1QF6A 1T3ZA 4XD2A 4GKJM 4NESA 2CWDA 5HFJA 2GPJA 2QG6A 5DNWA 2Z1NA 2R3SA 1L3CA 2ZETA 3JQPA 5DM70 1COZA 1EDEA 2VXOA 2OQ2A 1ZH4A 3UMFA 4NRWA 3I8SA 3TW6A 5JLAA 3DMHA 1CFJA 1U8YA 4MTLA 2BFEA 2D2IA 2ZG6A 3VAZA 3EC7A 4CBVA 4IQ8A 1AVTA 4TVKA 2I4NA 4DKXA 3CZPA 1V11B 1M67A 1UC8A 1K7XB 1RLIA 5I01A 1GO5A 3K2QA 4CMCA 1DG1G 3FUCA 4X1YB 2NVWA 4Q24A 4OFZA 5HOQA 4YJGA 1T36B 3KOZA 1XQYA 4XVQA 1Q11A 4EAQA 3TCNA 4PGHA 3AV3A 2D5AA 1RYEA 3T7EA 3T4PA 4TYWA 2PVSA 3UKDA 4A6DA 1WCWA 1QDTA 3PU6A 4Q3DA 3SR0A 4BVLA 3TBFA 3CVYA 5CT4A 3DHYA 1ZUNA 4GFDA 5E95A 3BWYA 5FL3A 3TRIA 1GU0A 4O08A 3G5TA 2PWAA 5TEVA 4DBVO 4HX2A 1G63A 3GDFA 2IBSA 2BMVA 4BFZA 3EAFA 4AY6A 3TWLA 3L8ZA 3W1VA 4X84A 2OQ4A 3MVEA 4JJ7A 4HNSA 3VU9B 3V80A 2JLYA 1J21A 2AOUB 3VK7A 2X0JA 3OC6A 2O0KA 4R6XA 3SD7A 1TZJA 2FFQA 4UNPA 3OUZA 4K05A 4JUCA 3KRTA 3IDZA 5I9IA 4I4TA 2H7VA 3IVCA 2FUCA 3T9FA 4NECA 1CY6A 4L7QA 4TTIA 4KO4S 5LD2C 1LQTA 5HM6A 3S28A 1D0KA 3WISA 4KW7A 4BHTA 1YK0A 4R2MA 2MWMA 2XQJA 4ARIA 3OPYA 4A92A 1ZMUA 3HK2A 4MS3A 3H86A 3FWKA 1N9ZA 3ADBA 1P0FA 1GUBA 3ASYA 1EE2A 3CLRC 2BONA 2BEUA 4EFLA 1ZNQO 2Q49A 5JWOA 5K8JB 4ER0A 3ADDA 5CPFA 2G0TA 4NCXA 5C2JB 2EO2A 1XCOA 1A9RA 2ZIAA 5TGDA 1ID1A 3ONFA 3BEDA 3BBZA 4JQSA 3H5NA 4OHUA 1BO6A 4IDHA 5GGXA 1CHDA 1DPFA 4MVJP 1SAYA 4MUIA 3QZUA 4L16A 3DKKA 4TMXA 3PEYA 1O7JA 3B3JA 1TQ8A 3ZGXA 2A78A 1ONBA 1GPBA 4ZQIA 2ALJA 4LWPA 1TTTA 1J0CA 1I1QB 4QNRA 6LDHA 3L2OB 1G98A 2DKLA 3JVUA 3NBQA 4UOZA 1V9CA 3O8BA 4QD3A 4FNGA 5GWXA 2P7HA 4MB0A 2IU0A 2J87A 3EFOA 4ND1A 2RB4A 3IAM6 1XMOB 4PX5A 2VHVA 1XA3A 2DAIA 2IEYA 3A1WA 2E2WA 2XRFA 4KUHA 1ADYA 3TLCA 1Z12A 3U7HB 2M60A 2G4VA 5J2TA 5IC5A 4BLPA 4NQRA 3Q9UA 4RDHA 2O2ZA 3QJ5A 5CAEB 4JJ6A 3TIXB 1ABFA 3RU7A 3NMUF 4G5YA 2NU7A 4A1OA 1E32A 2ZYWX 3QLUA 4MWDA 1UJMA 3R5FA 1EUZA 3GRRA 1JIIA 2X5OA 2JEZA 1WNFA 1CJSA 1HE3A 3FMGA 2OO9A 3MERA 3PDIA 3ZIAA 3IJEB 4COKA 4CMBA 1QBKC 4JBYA 4RV5A 4XYMA 1VJ1A 1X7YA 2WTUA 3BRQA 4JI0M 2H8KA 2WHQA 4TV9A 1KAEA 2DZLA 5FQNA 2WAYA 3T8YA 1I2ZA 2I3GA 3I42A 2J4FA 1KFEB 1CP3A 1ZQ1A 1RYNA 2GDZA 3IS3A 4EHKA 2YRWA 1SHJA 4OUKX 5KHLB 1KYXA 4BP9A 3LS2A 1YZHA 2CDAA 2VP6A 4BTLA 4BFSA 5SY4A 1SHUX 1XAJA 1YS4A 1F2VA 4D9EA 4CDNA 1R0BA 3FKSD 2WMYA 2V74B 2I7XA 2OYSA 3DPUA 3OOJA 3ZGOA 2W6PA 2D7DA 1G19A 5DNVA 2GA8A 3V1YA 1VHWA 4IOLA 1WDKA 2F9MA 3ZE9A 1N1DA 4K1LA 4EL5A 1KQOA 2DOKA 2ZTDA 1F6WA 2B35A 4C22A 3ZGYA 3GQ5A 2GEVA 3ZQKA 2ZJ4A 4FZRA 2VK8A 4L9SA 2CWBA 4JJIA 1OWNA 1CLEA 1H4QA 1K5PA 1OV4A 3KPYA 3T7DA 2F43B 1H2HA 4G07A 2V6FA 1FFHA 1KNQA 2IVZA 1QG0A 2VJPA 2I78A 2P5UA 1PL0A 1RKQA 5JDCC 3WDSA 2G1AA 3D8RA 1E1NA 1RVDA 1R5OA 3ISVA 1OB5A 1M54A 3QLTA 5U4XA 3S99A 2HMSA 2XMZA 4HDOB 5EJ7A 3V3TA 3GJ6A 3OQIA 2BGKA 4QQNA 3PC2A 3QYFA 4NYMR 5LU9A 2DSTA 3ZUGA 2QTNA 2Y6UA 1K4KA 4XVRA 2KB0A 3WAKA 1KDPA 2ZI3A 3KBBA 4CIVA 3SCZA 4G24A 2D4AA 3B6IA 5JNLA 4F6RB 1UWCA 3QHQA 3UGKA 3UFXA 1YCFA 1OX6A 5I8PA 5B30A 1QVAA 3JD2A 1SXJD 4MGZE 1EJ6A 4U2KA 2HT6A 3L77A 4Y2YA 5IVHA 3Q7TA 4IR7A 1J33A 4P4LA 3GRUA 3REGA 5DX8A 4YQYA 1ONPA 5JSZB 2AE2A 3AO0B 4B3SB 2QAGC 1CF9A 1N0HA 3F4KA 2YRFA 3JYLA 2XB4A 1WB9A 4MPDA 4EK9A 4G8JA 3I05A 3EF0A 3LPAA 3C5CA 4Z5XA 4WN9B 7CATA 4WDQA 4DXHA 1WU7A 1Y3AA 2WU3A 3OFKA 3NWPA 2R68A 3WNZA 2CJWA 5ITZB 4NAUA 2YUTA 3IUNA 4QGHA 4GQIA 4DRXB 5FI0B 4Y28F 3GOQA 3RT9A 2VTDA 1XDDA 4MV3A 1J23A 3KXIA 1EGMB 3EEIA 2X6TA 4Q7LA 3T7TA 3R3HA 2ZJAA 4IJEA 1ID8A 2OD9A 4I9NA 2IHTA 3SBDA 4BATA 2ZT8A 4PAGA 3RS2A 5KDLA 2J0QA 3CMCO 3PF8A 4MJXA 3BSFA 3G5MA 1EK1A 4WV3A 1E18A 4WL0A 3TZCA 4ER7A 2G4LA 4IFTA 1T2EA 3DOJA 1MJFA 4C6HA 4W1PA 1SD5A 2VCHA 4KQ6A 1AA9A 4XE5A 1TUBB 4JLJA 2DNAA 1BOFA 1VPWA 1X6VA 1SBHA 3PGJA 1KZHA 1JA1A 2HTEA 3RVLA 4OHRA 5TIIA 3ZHSA 4IY1A 1MO2A 1GNQA 1Z35A 4O5AA 2A5FA 3WOVA 2HA3A 4O4JF 2KYRA 3GJRA 3ML1A 4AUMA 1CSEE 1LDEA 5HP4A 5H4HA 1TDHA 8ATCA 5HX7A 4KP7A 5KPRA 5AKYA 1OILA 3GFQA 1CBUA 2QTMA 3O26A 3I2YX 4ZYLA 4GPBA 3AIOA 4K26A 3GPDG 3BXOA 3WMRA 3C7CB 3NIGB 2E37A 2QZPA 1G5HA 4GYJA 1SUDA 2R4EA 4BUCA 1TCCA 3UKOA 2O8FA 4BNZA 3OCXA 3NTVA 2WSSA 3GAZA 4GPAA 1U8ZA 2QRVA 1K1EA 3ENNA 2FQ1A 1JEDA 1V4NA 2IHUA 1UC5B 3KYDA 1ECJA 3NHYA 3H16A 3OZGA 1XJQA 1IM8A 3H0KA 4EELA 4YLGA 4IKPA 1QRRA 4PC6A 5L8RF 1KNXA 4NVRA 2AYZA 1KP2A 4LYGA 4B2LA 1XU9A 3QYPA 4F60A 3E1SA 1UXHA 1F14A 3D4OA 2QG9A 2ONJA 4WD3A 3TOCA 1PK9A 5A9TA 3KJHA 3CLTD 4I46A 4ON9A 4QOFA 2H3HA 1DGBA 1T15A 4J6EA 4Y2SA 3VH4A 1I1NA 1EZ1A 4AP9A 3SAJA 2PLRA 4MRMA 5DT2A 1QF9A 1PGYA 5DTRA 2QUAA 2GF0A 3V00A 2WWXA 3KPUA 4ENQA 1A9YA 2IYTA 1SU6A 4KN5A 4HGRA 3IGFA 4F1IA 4DJAA 2KQUA 3DC2A 5TC4A 4MQ5A 1T8SA 4UVIA 1C50A 1E5TA 1JLLB 4IGEA 1UM8A 3L82B 4P58A 4C21A 1X70A 1BWSA 1WW8A 3UB3A 3FSJX 4UAVA 4RVSA 4PLWA 4NDNE 2ZAIA 1UDCA 1ZM7A 1Z4OA 2ZBFA 1MMFB 1BGXT 4D5EA 4L2IA 3MLBA 1RQ2A 3Q88A 4PLGA 2ZUWA 2XR1A 3ZS9A 1BHSA 3RUDA 4DLLA 3M0EA 3ZE0B 5B7PA 5JZBA 4U7GA 2WLSA 4KLCA 1Y4ZA 4JLUA 5G1NA 3MCZA 5JSHA 4IIWA 1JX6A 3PX7A 2OSBA 3LT1A 1QWSA 5BVHA 3FWZA 3P9CA 1V5GA 2RAUA 3OBBA 3U7IA 4UTRA 1DQNA 1UUFA 4JAVC 4H60A 4OJMX 3AKEA 4RAOA 5JFGA 1RLTA 1QPGA 1NT4A 2OZEA 1O77A 4Z9BA 3O75A 2GZ2A 1HKHA 4DWJA 1KVSA 2PMWB 3A9RA 3BILA 5IDYA 3E7DA 2OPFA 4QO7A 1V5WA 2SHKA 2P2DA 2NO0A 5FUWA 2HA4A 4QG3A 3FPKA 2JKVA 3IPXA 4EARA 4KACA 4QDZA 4UVHA 3SHVA 3AJAA 1DJOA 2NUPA 1QMGA 3PFBA 2JH3A 1C7RA 2A30A 2OXTA 4GMDA 5CXUA 3IA2A 1EFRA 1J0AA 3IX7A 5JXJA 1G3UA 1R12A 2O52A 1NUAA 1U3DA 4WZZA 4UPVA 1A9QA 3HUEA 2AJTA 1FYDA 1XX6A 3VZCA 4NU6A 5EHNA 5CW1A 1KJWA 1TAUA 3ZGLA 1ESEA 3HJQA 5LKAA 2AEMA 1IOZA 1DP4A 4ZYTA 2JY6B 4PIMA 2X9NA 3RIHA 4XX1A 3TMKA 5FTJA 4DUGD 4JA2A 1YE9A 2XMSA 1VI2A 3LQRA 2J3MA 5TX7A 4OD0A 2BGIA 4ZAXA 2BYTA 1A88A 4HNAA 4I7EA 4WBNB 4A8HA 4FEAA 3ZK8A 4NJEA 1R6UA 4UM7A 3IQZA 4K6HA 3QELB 1SIBE 5JAPA 2GJ8A 3JAKA 3LRPA 4LC1A 3PJGA 1H5UA 3G2NA 3V8PA 5JO9A 3K1AB 4M9RA 3WWOA 4C4XA 2PUFA 3R24A 1DTWA 2OA0A 1CPYA 3K0FA 2Q41A 4YONB 2CNBA 3TB4A 3G8YA 4P54A 1L5YA 4ZEOA 3G13A 1JMYA 5JASA 5HS6A 4DV1B 1QQ6A 2YNMC 4YREA 1B8PA 5FNVA 4YQEA 5FBLB 2IZ7A 5TJ9A 1IRXA 4A0SA 4MKHA 4PM4A 4WRRA 4J1QA 4LGMA 2IYYA 3GJ7A 3PNYA 3RVOA 5IBRA 1S0UA 4QTYA 2FQQA 1M3SA 1GARA 4A0RA 2QTVA 4LOIA 2BE7A 5DE3A 3D2BA 3ETEA 1ORTA 2HA2A 3RSLA 1SOVA 3VO2A 4BMZA 1R2QA 4BMPB 5IBCA 2RKWA 3AESA 5M04A 2MSLA 2DY1A 2EDCA 3VXKA 1S8FA 4O2BA 4JI6M 2OTCA 3WB2A 3USES 2A67A 1D2RA 2C4NA 1OAOC 1D2EA 4CMAA 3K4QA 4AJ2A 4AECA 1Z5NA 2R9VA 3L46A 4N7RA 4JB2A 3RFVA 1QCDA 2XKJE 3IE2A 4LHYA 4AP5A 1VGVA 3FD9A 5K2MA 5K8TA 1ODLA 3L1KA 5ICEA 5CLHA 1R0SA 2CYAA 3WXMA 3RJMA 2I1VB 4RNCA 1LGYA 1LDYA 2B1QA 1WF6A 2QT0A 2VHQA 1SN7A 1D4ZA 3QG5A 4CLRB 3AF4A 1X9IA 1PJIA 5CVJA 4OXRA 3EQZA 3SHFA 1UKAA 3TX6A 1Y3HA 2ZWMA 1D4AA 3U7RA 1M74A 1RT9A 1YKSA 3S27A 3QYEA 3IHKA 4ZVNA 3KM0A 1E9RA 3QEBZ 3TCKA 3A1DA 3GEIA 5DHPA 4BFYA 3IIEA 1UAYA 3VVCA 3JXEA 5DBOA 3O2JA 1AC5A 5EWMB 4C2AA 1GY8A 2GTIA 1N2CB 1BFKA 5E1BA 4MQBA 3RNOA 4R0NA 5A5EA 3NWOA 3HU3A 4XVHA 1JALA 4PGAA 4K2AA 5CNJA 4LXGA 3EQ6A 5JFOA 1G41A 2CUKA 2F17A 2QV7A 2ZE7A 4F5EA 3IQGX 1USVA 4PG4A 3AERA 4HLUA 5COAA 5AVRA 3RSSA 4LHXA 4ASUD 2WPDD 5EIAA 2YV3A 2Y9MB 4JLNA 3PQ5A 2RJOA 3ADOA 3U6DA 3W1EA 4INJA 3N5CA 4FVMA 4KDFA 1L7NA 2H2IA 1ZD3A 5EZYA 4J16C 5F7JA 4CLXA 2B8NA 1OZHA 4EKIA 5FUBA 5HTOA 1FE8A 2QAJA 1G1AA 2AEFA 2ZROA 2PX6A 5AVYA 1FTQA 3KOOA 2ZT7A 1ZXXA 3KKMA 4ZU3A 3HV2A 3TFWA 4IQ4A 1A96A 1XN4A 1QDRA 2HHHB 2QEQA 4K7JA 1W47A 2L7HA 3II6X 3S8EA 4C0KA 3F7TA 2FK7A 5JMWA 1ICIA 3N2IA 3O3NB 1KYIA 2YN4A 4X65B 1P7ZA 2SKDA 1MB3A 2WM2A 2QF7A 2WF7A 2XXAB 5CDTA 4CXMA 5BR8M 4BFUA 3GMTA 5KSOA 1L2BA 1G9XA 3HM9A 5AVKA 4Y2VA 1UT6A 621PA 1V45E 2CN1A 2ONYA 4TZ6A 2NSHA 3GJQA 2PU5A 4Z8YA 2NXEA 4POAA 3WICA 2B1RA 4RMJA 2DQSA 1TF2A 1E1YA 1JSRA 3RWOA 2DJ5A 1D0SA 3OM8A 2FY8A 1GLGA 1AB6A 1QP7A 1JN0A 2IJGX 4BJHB 4IFIA 2YZKA 3WJAA 2MYUA 1WHCA 3JZMA 3BRCA 5FOTA 2OAP1 1YB1A 4MUHA 1VCIA 3PQCA 4RVHA 1UKVY 3OTHA 4IDFA 1PT7A 4QJ4A 4DLZA 3AUAA 1ESMA 3K0AA 2LR0A 1NWCA 4UE2A 3MQ2A 4WVFA 5ULLA 5EJCA 4G01B 4F5DA 3RGSA 2BSQA 2LVPC 3PJEA 4GVLA 3RIEA 2QTWB 4FW9A 4ZCIA 3C6BA 5KTPA 2XT0A 3VO1A 2AXNA 4XQEA 4N7JA 3CLSD 1QE3A 1XYVA 1SGWA 4I4NA 2XCLA 1G5IA 8LDHA 1QH1B 4AG3A 1CQJB 4YTEA 3RRMA 2JDIA 3FJ1A 1NT2A 4AW4A 1KY4A 2AL7A 4MCHA 1E8NA 1M2OB 1DPGA 3M5CA 5LUAA 4MQLA 4JLDA 1A1VA 4HUQA 3QVKA 4Z7QB 4IX1A 3T3NA 4QNNA 2W58A 3A4TA 2YFHA 3RUHA 4L3WA 1JHOA 4PSCA 1O95C 3D7KA 4XFKA 3AK4A 4X5OA 1D1TA 2R66A 3PP8A 5GZ3A 1JJAA 1U9CA 3ULKA 2XGOA 4YVFA 3EXFA 4I55A 1G21A 3TEMA 1NPYA 2P8JA 2DBYA 1V11A 3RYCA 4Y1FA 5AJTA 5JBQA 4TYPA 1X15A 2PV7A 2HWUA 1N6NA 2ZJ8A 4EUEA 1YDMA 4EQZA 3PHCA 4X1YA 1E64A 4KR3A 4BEBA 1NN3A 3PWZA 2W2MA 4PW0A 2JFUA 3IR5A 4H0NA 4R1UA 3PPXA 3QXXA 3AR4A 3PFHA 4FYVA 3LYHA 4XPZA 4C4AA 1PNVA 2BMAA 3ASVA 4YDRA 4L8VA 1XVUA 5JYEA 4DWOA 3ZUPA 3GY0A 4RFLA 1CHNA 2QIOA 3ZBTA 4NYMQ 4F92B 4WXMA 2OHVA 2VOJA 4HGOA 4RLFA 1DEOA 1IEQA 1EG7A 3FVRA 4RKQA 4GEKA 5BMOA 1JDJA 4NBNA 5HIIA 2WFZA 3IAAA 2AWOA 2W93A 1OH5A 1JILA 1V41E 2C8KA 3QWHA 1A9OA 1XTJA 4YAEA 1ESDA 3VU9A 5FEMA 3S70A 4WECA 1M33A 3LT4A 1UPCA 1A7KA 4WW0A 3LDFA 3ZVRA 4MNTA 4HFRA 4I1UA 3IVXA 2VBCA 3VSAA 1U2QA 3H1GA 3B52X 3OKFA 4G0ZA 3STWA 3CPSA 2VQDA 3H6HA 1MHPA 2DPLA 3IIKA 3U6KA 3VX3A 1KAQA 4EPWA 1RAEA 3NJ4A 5BWLA 4YMUA 4YAGA 3EPLA 3RRBA 1H4SA 2GSDA 5DWDA 2ZE5A 4DJDC 2RHTA 4G9GA 5AESA 3LDAA 4P80A 2QLTA 4OHCA 3C58A 4NU0A 1W87A 2FEPA 2FOIC 3L4SO 3REQA 3KW6A 2VTBB 4MYCA 1Z38A 4MVJA 2OK7A 2H2DA 1TPYA 4YMIA 1V3TA 4FMDF 5DTMA 1J9GA 1CVLA 3SLKA 4MYHA 3Q15C 4RD4A 3AOEC 1P3QQ 3B9QA 1MKYA 3ICWA 1PLLA 1Z5OA 4ZZ2A 4IWNA 3DE5X 4GLOA 2PD3A 4PRLA 2OGWA 3SJZA 4UMDA 1T10A 3VKVA 4LJKA 4KMSA 4BQIA 4EITA 3W4KA 2HPZA 2KBEA 1G8PA 4YMSA 5LA6F 3E3AA 4KLZA 1UOEA 1F8GA 5EUCA 1FPMA 4KXVA 3NWLA 1E2LA 5E6SA 5HZHA 3HDGA 2OHIA 1DKUA 2V7QD 4HEJA 3KJXA 4XCQA 5LPNA 1ZD2P 1XCBA 2FWMX 1WXEA 1D4OA 3GUCA 1VDMA 4D9KA 4QUIA 5BRNA 4JYAB 3NPMA 5D3ZA 3L8MA 2G7ZA 1CZUA 1MJGM 5IAGA 4ZVUA 4TSRA 4OMUA 4B33A 3GRPA 3WHKA 5K09A 2DLNA 2ZRDA 1JSZA 2XD4A 3AEUB 3U0BA 4OI0A 2DBRA 4R1MA 1HL7A 1N2IA 1E4EB 4LFCM 2OZLB 4P8RA 4G4RA 2VUHB 4MSUA 4XK8F 1J2JA 2ZW9A 3CJQA 2ZBRA 2JFOA 1SVSA 2Q3CA 1S3GA 1OTRA 1Y3FE 4HBGA 1NBAA 3ANMA 3U19A 4JC4A 3KLOA 1ZDMA 5JE8A 1J9EA 3ZDXB 3VH3A 5GJWC 1QG2A 3O2SB 3PKZA 5DNYA 3KT3A 2PJZA 2FW0A 3TVTA 3S7TA 3AF6A 4XH9B 4H7FA 3TFOA 3PGLA 4E2WA 3LGAA 4BGEA 4EDFA 4BS9A 2C94A 3OOHA 3L7JA 5DNDA 2MDTA 4QG7A 4ZVLA 1RHMA 1BQ4A 4J0FA 5KQ8A 2DULA 2QSUA 2X8JB 3AJIB 2AH5A 1G9TA 4CISA 1M73E 4WLFA 1DRUA 3TLGB 1RCFA 4TS4A 5AM2A 3ZU4A 1VSTA 3OEWA 3D5QA 3HE3A 1YRWA 4G41A 1TO6A 1L7OA 2EGHA 4OQEA 5C32A 4GI5A 3R3UA 5AWFC 2WY2D 3LTEA 2C5HA 3GR6A 3GEMA 5ALPA 1EFLA 3U6QA 1MX1A 1N9GA 1SHLA 4M0WA 3EAGA 1DC7A 3K94A 4B3BA 1R0CA 5EUMA 4RA6B 1K97A 2GK6A 4AQ7A 1HSZA 2HPAA 2ROQA 4FI3F 3UC5A 2PFGA 2E3JA 5DI3B 4V0NA 2X9GA 2ZITA 4UAJA 4TTRA 1LF5A 1D6JA 5E3JA 2C58A 1M2NA 1TGUA 3A28A 4EMBA 4HDMA 5HM8A 4AXXA 4H4CA 2CVQA 3D1JA 1LZLA 4A82A 2QYTA 1SVKA 4IZ6A 1GNTA 3ZLJA 3U7GA 4RF0A 1DE0A 4ZXPA 2FH5B 1W34A 1KEPA 3N2YA 5JWRA 5A6VA 4JEMA 3QKIA 2C5LA 4B3JA 4XD7D 1S7GA 2O2JA 2HEGA 3TE7A 3Q7RA 1V47A 5H02A 1LWOA 3GEBA 1WR1B 1GZVA 2WDZA 1NJSA 1R10A 1KIAA 4HAVA 3N6VA 4E5NA 4DPKA 1R27A 3UTCA 4EAAA 5EERA 1FTSA 3GA7A 3H0EA 1P0PA 2FMXA 4ZJYA 5EQJB 5AW1A 2BSAA 3AWDA 2GKOA 1YIAA 1LCIA 3PUZA 1TQDA 1WV0A 5EZSA 3DE7X 3DNPA 1UMBB 1G5FA 1M9NA 1AMOA 4CKZA 3KE9A 5CX1B 5AJZA 4Z0PA 1XL0A 5JNVA 2AG8A 1QRAA 2AK3A 3CSDA 3KOMA 2LH0A 3BMXA 5G0WA 1E8DA 4FYIA 4CMGA 2W6JA 3GRAA 3UQZA 2IHNA 4G5SA 3EUFA 2VS1A 1YE3A 1HE8B 1YO6A 3W0FA 1ZNYA 2AHRA 3ZTYA 3UEOA 3IVAA 3EXHA 2BMFA 2OQVA 2V0GA 2UUAM 3WQQA 3F4LA 1SCQA 4MDFA 2J0VA 2QX9A 2VPYA 1LRJA 4FILA 3L7LA 4F9TA 3Q8LA 2JZNA 1NNI1 3VBEA 4MRPA 1IN6A 1UH5A 4W5HA 4Z9YA 2H11A 2WVHA 1VLZA 4LJSA 4L22A 3T5AA 1W96A 4EGSA 1PV2A 3ELDA 3WGZA 3ZCVA 2HV8A 3WNVA 3HXMA 4RF5A 1VJDA 1JZQA 3GRFA 3SC2B 3CW9A 3H3XA 2CD7A 2W2KA 4YK7A 1FBNA 2MR9A 5JS6A 3IP9A 4XWKA 4GKBA 2CBXA 1ZM3A 1VJTA 3OY7A 1AQ6A 5CK5A 4BRWA 2Z5LA 4IIVA 2YS7A 3HRHA 2QLNA 1MRNA 1MG5A 2LP4Y 2QW8A 3FZNA 1AK2A 3MK31 1O94C 4GRDA 2W4IA 3WWZA 3I5AA 2Q07A 2QYOA 2NVOA 1UIRA 3Q2KA 5C35A 5KTKA 3DM5A 1RJ9B 1SEVA 3JATB 5TGTA 1P3Y1 1O5IA 1JQDA 4ZEVA 5ARBA 1C1XA 3B6KA 4L7VA 2DM6A 1B76A 5FB3A 1ESZA 1KSGA 4Q4HA 5EQDA 4S1WA 4CI0B 2JHFA 5IXJA 5D7NA 3RU2A 1A8QA 1PL7A 1ST2A 4V02A 3WDLA 1Z7WA 3M6XA 2ADFA 4DM7A 3O2QB 3KZMA 3ANNA 5KOJA 3I30X 5TDHA 3T3MB 4C30A 4KUEA 4LYYA 1DOZA 1I0LA 4D0SA 1ZMXA 1SXIA 4KIGA 2FDCA 2GBGA 5CRIA 3HG7A 2YINC 4IGFA 1GA6A 4JUFA 1EH5A 3T9CA 3H9JA 4KAFA 4JU8A 4OB8A 3OO0A 1FDTA 1B41A 1ZGGA 3M34A 4V2IA 1W0CA 2WNIA 4OHBA 1V71A 3WZMA 3IB6A 2J9FA 4FDUA 3PXXA 4EB6A 3PQ2A 4ZAYA 3D3EA 1QX3A 1AZSC 2X42A 3HXKA 3A2NA 4G1EB 2D1YA 1RI5A 3DEJA 2VYVA 1SCNE 3GGPA 3BXGA 4YRFA 5IKPA 1YIDA 1SKYB 2RHWA 3NAQA 2FH0A 2LRHA 3ZHQA 1UFOA 1NVVR 4D4MA 3W3AA 4B1FA 4GP7A 2TYSB 1FTYA 1SBZA 1ARZA 3WO0A 4EYEA 5AKXA 3PEFA 3LSYA 3AQIA 1PW5A 4JP1A 1XCGB 1OVMA 3N86A 4BO4A 3I5XA 1UXJA 2VH1A 1T5SA 1LZKA 1VLJA 2FSFA 4D9IA 1Z7GA 1XT6A 2YOFA 3TDMA 4U9HS 1JLLA 4TMTA 4CKCB 2PEYA 1F9EA 1TD1A 1I1HA 2LZ0A 2WVGA 1JU3A 1CJBA 1XRSB 1KHTA 3LNTA 2Y1KA 3P52A 2UUOA 5DCYA 3QTBA 5J4VA 4DA4A 1YR9A 2JLBA 2JGJA 5IYZA 1RW4A 4IZIA 2P67A 2IYWA 1NYQA 5D01A 1CZRA 2FB9A 3KOYE 2BGLA 2G09A 4KK3A 2LIVA 2REQB 2JRCA 1CUKA 1UQRA 3GZNB 1QQ5A 3IP3A 2PS0A 2X9VA 1WDWB 1V25A 4BMYA 2I8AA 4NV0A 3AHIA 2QYSA 2ZUSA 5C5IA 4JZKA 4INZA 1SOWA 4LVNA 2BAGA 1JKFA 3BJEA 3HMKA 4R8MA 3GPIA 3PVCA 4P3XA 5JAZA 1JE0A 2ATIA 1O6ZA 4WESB 1L5RA 2Y66A 3FBGA 3FGNA 3N3AC 3JTMA 5DNEA 2LCQA 1C1YA 1OTHA 1CF4A 4BKMA 2PD4A 3KEGA 3OWHA 3FHLA 4NOJA 1P2DA 3D6VA 2P9BA 1Y1TA 3VYRB 3B7GA 1ZAEA 1KI1A 3OJWA 1MW8X 4N3BA 1E2DA 3BPSA 1JPVA 1AK9A 1R8YA 3LHDA 2ES4A 4G97A 5J40A 2HA0A 1S89A 4U2GA 1IZZA 3RAPR 1INLA 1YIOA 1S8OA 3NOOA 4B6EA 1XZIA 4PN3A 5D51S 5FJIA 3LUBA 3L6RA 1IVYA 1E6MA 1IHDA 3UCEA 2NZYA 3MG9A 5B3JA 2XLJA 2G83A 4C9BA 3EZ7A 4UHDA 4LX8A 4R3DA 1P6UA 2IU3A 1AUQA 3OCWA 3BIFA 3M83A 3T0GA 1Z8NA 3QBJA 5CYFA 3RTGA 2H16A 3MRSA 3DMDA 2O2XA 4RORA 1EP2B 4E5VA 1NVMB 3EG5A 2HH9A 1RNLA 5FWYB 4IIGA 3QAUA 1LK7A 4KNYA 4Q12A 1Z4JA 3QBEA 3OOSA 4FGJA 1PW7A 1XSEA 3FLAA 1X94A 1BDMA 1O4WA 4GWGA 1G66A 1ZKDA 3SOZA 5AM1A 3OZ7A 5HJ5A 1EFDN 2FSHA 5ADHA 4NFSA 4P3NA 3CNQS 3HKBB 4BP1A 2ZB3A 1HNWM 2QN3A 2XZFA 2UYGA 3VR2D 3M89A 4Y2JA 4V39A 4M86A 4CGYB 4LYJA 5KVVA 4C6TB 3UT5A 5AVWA 4KSBA 5I7UA 2IXBA 5HBGA 5K0EA 2XUJA 2O0LA 2XUZA 3NHFA 2OLKA 5BVGA 3W04A 1QVWA 3I1IA 4JR2A 2ID7A 3LQFA 5C1OA 2YXEA 2WSIA 3ABZA 4EFKA 2QTGA 2O0MA 3RIXA 3ECSA 1BZYA 4W9NA 4F84A 2YWXA 1E92A 5D84A 3OY2A 3GN1A 4WADA 1FX0B 2QGFA 2M2IA 3LL4A 3D4PA 1JR6A 1ADFA 3LY7A 2JIQA 2EF1A 4Z2YA 2XMQA 1XZMA 1T6NA 5H59A 3O8OB 4TRNA 4OMCA 4E5DA 4LJ9A 4XR4A 4N8EA 1AT1A 2CFRA 4G9BA 3SZ3A 1Z33A 2A1IA 4Q37A 5KYUB 3PNKA 3KOXA 1NXTA 4EB3A 4PU0A 2Q4RA 4G84A 3GP3A 4XWOA 4ZGBA 1Q7GA 4RIGA 2AFHA 3UANA 1RYBA 3O4FA 1DXYA 3TIIA 4E5MA 1KI6A 2WSMA 1MGOA 5CJJA 3LBNA 4FYPA 2Q0HA 2GCGA 1CV2A 1QYXA 1QQAA 1GO2A 1ZGCA 2PNFA 3MBIA 4WZBE 4EL0A 1J0DA 4MVJI 1EWQA 5HA5A 3PIRA 5EQTA 1K66A 3C3AA 3FYCA 4B3TM 4F2DA 2R6ZA 3AONB 4BBPA 4GLFA 2J4DA 4NFHA 1N2EA 3OJEA 1YBFA 3IDSA 2Q2VA 3D8TA 2VKQA 3DTVD 3DVAB 5I6DA 3EF3A 4TKVA 1Y37A 2JAUA 5DEOA 1WE2A 1H42A 3KHSA 1S8NA 3AJDA 3KFLA 1UWKA 2CXHA 1BWQA 3C1UA 3TSWA 4BO6A 2PL3A 4AJ1A 2O2IA 1FXWA 5LJLA 2WIGA 2Z95A 3EIHA 3OP1A 5HUHA 5LZ2A 3Q8XB 1KO7A 1U2GC 5F9MA 1KO8A 2JGKA 1GP2A 1H2ZA 4HLQB 2ZDHA 5J58A 3ORHA 5B1YA 4M1QA 1ZEMA 2R6R1 2L4FA 3TZEA 4B32A 3SI7A 1VOTA 13PKA 1OXVA 2EFHB 4YRTA 4PR3A 1IRIA 4B3IA 2FVXA 1P2GA 5BYAA 4G9EA 4DSZA 4PAMA 1GXSA 4IHJF 5C5DA 2EFCB 1QTRA 2JL1A 2A88A 3DOAA 3IQXA 4GOJA 3F47A 4OKIA 3RGGA 2Z2XA 2JH8A 2WFLB 1BRMA 3QLVA 1OFIA 2CDBA 1LQUA 3A10A 4QXAA 2G1JA 1DBWA 3G49A 3QFCA 3F67A 1CR4A 3IEVA 1JFTA 4KGDA 4JI2M 3GJ8A 1R9MA 4BRSA 4UNNA 1YA8A 2DTDA 2G36A 1Z18A 3U0VA 5B12A 4BOYA 4MIKA 3QLEA 1XPOA 2QD1A 2V7XA 5BSGA 2FG7C 1X7DA 3PYMA 4TV8A 4CM6A 1EGVB 2QNRA 2MGWA 5LQDA 1ISIA 2QCUA 3IO3A 3AM1A 2Y1LA 2IGTA 1RJFA 3ZD8A 3VVLA 2WIBA 1UAGA 5KWIA 4B2YA 5G0TA 2Y0QA 4GNKA 1AHHA 3KG2A 3NBKA 2GZ3A 2FX3A 4FFOA 4WE3A 1BDBA 2ZM6M 2IQIA 4KT0F 1L8AA 3GHYA 2ISSD 4Q3BA 2ICAA 3NIWA 4AICA 3E03A 2HAKA 4ACBA 4E0BA 2D5CA 4PSAA 4F3TA 3LCRA 4D6PA 4XZ3A 3FYSA 1QO9A 5J5AA 1HG1A 2JFVA 4KBFA 3N76A 1UOOA 1TO1E 2HHAA 3MEQA 2EHDA 4WZAB 3JQDA 4D1YA 5I9SA 1R9JA 4B8WA 4FCWA 1DWPA 4X8OA 2ERXA 1ZD4A 3HN6A 5DTQA 3IL2A 1FYFA 2UUBM 1VLHA 1G1MA 1Y80A 5EMJA 2G77B 3THOA 2G3YA 4HEA1 1C1KA 1E7SA 2FPIB 2P41A 3TECE 1OGIA 1TM3E 5FYDA 2B78A 4MKXA 1P2FA 3QVVA 4I99A 1B93A 3KZ1E 2RBGA 3IT0A 2WA1A 1X7ZA 3AR6A 1Z6AA 3GMDA 1FIUA 3E58A 2UZ3A 2A0UA 5CJ2A 1RYFA 2GAIA 2D3WA 4RVUA 1U9IA 1V8PA 4IOKA 4QGGA 4WN3A 4LE2A 5I7SA 2XQVA 3TSYA 1RBQA 2OK8A 4KN6A 4RK7A 1AKWA 2ZXUA 2ZIVB 2CLDX 1AMUA 1GCIA 3FDZA 2IZOA 5L9AA 3CUWA 3GQBA 4KTTE 4IIUA 3STTA 5I4IA 1ZVMA 4JSYA 2C4WA 5B36A 3A9TA 1BGWA 3RHFA 1KGDA 4HH3C 3FGZA 1F3OA 4B6QA 1W0JA 2PBFA 2BTQA 5A5GA 1MF7A 4U7PB 4EUSA 3LCUA 1GSAA 2IHYA 1AKQA 4N48A 1I10A 3PNPA 3H5RA 2REOA 1MW9X 1ZP6A 3VYTB 1NXPA 1Q3TA 2XCUA 4DYDA 5K0BA 2JFFA 1KKUA 5GV8A 3T4XA 3GUZA 1FUUA 5FBWB 3TZ6A 3LX6A 2GJ9A 4HXYA 2JHAA 4MJ3A 4ZI5A 4HZUB 3T1NA 4RQBA 3GEEA 1AGNA 4P86A 3GJ4A 4Z9FA 1T29A 1LQ2A 2H4FA 3DA1A 1KY2A 2XH8A 5BUCA 1QR6A 4M8LA 2FXIA 1FC0A 5ENDA 4B3FX 1NPTO 4P2BA 2V3VA 4L85A 2WUDA 4BNTA 3AZQA 5CCXA 2VYND 2BDUA 2VHWA 3AWIA 3Q6MA 3R5TA 3SBEA 4IM7A 3DT9A 3FR7A 1CS0A 3SIRA 1MFZA 3SIPA 4LJLA 2H5EA 3DWGA 2JIOA 3DDSA 2HBQA 3G5LA 3ROQA 3LD9A 3QH4A 3IC5A 5JSYA 3PXBA 1HPLA 1OZAA 2X5KO 4NV3A 1Y9ZA 3VR0A 3EDRA 5KOHB 2RHHA 1BG6A 1PFYA 4QQRA 4CFYA 5J47A 3LRXA 3G1UA 4YV0A 4QWMA 3REOA 1LNZA 3SMSA 3KC2A 5EE9A 4UTNA 1TT5A 2DUWA 2ZWAA 3DGEC 2F1JA 2H0RA 1Y6FA 1W9HA 5LZ4A 3P45A 4OSEA 4ZCRA 1S4MA 2DENA 2O8EA 1TF7A 4BZWA 4JODA 2DC1A 1DZ3A 2Z3XA 6ADHA 5JWHA 5F2OA 3GARA 1GTG1 3K09A 1VB5A 2NACA 3R0ZA 4Q9HA 4ZQEA 5AVQA 1GAWA 3TEJA 3VAAA 1CUJA 2OT3B 2DHQA 2E82A 3EOBI 3NANA 3FVQA 5LQNA 2NVUA 3PI7A 5DBFA 4Z1MD 1CUGA 5JVDF 2CFCA 2NYVA 3QSYA 4RK1A 1VYVA 2B4RO 3R0JA 2I2CA 4WSOA 4RZ2A 2C3OA 2H1IA 1Z4QA 1BVHA 4CQMD 2QSFX 2IYUA 2QJTA 3ABIA 5E1MA 3G2HA 4DR1B 4IDQA 4F04A 3LXRA 1XUOA 3KLBA 3WGIA 4X64B 4Q3EA 4CM4B 2H07A 3UXHA 2OUIA 4K6OA 3ZY4A 3L41A 3DO6A 4HZGA 5B1EA 4FOOA 4H08A 5JCZA 3LLCA 1FEZA 1HFKA 5CT6A 1U5BA 4P5EA 1RWVA 1YRLA 3DXXA 5LQCA 1V3QE 4BXOA 1J22A 3WL6A 1DARA 5G0UA 3GCZA 5LNK1 3PFWO 3AEQA 4Q3CA 2F8LA 3KSBC 1W5SA 1J1ZA 3OO1A 4YMVA 5IWCA 1MC4A 4FDMA 4IX9A 2NO5A 4EHLA 3DL4A 5CM9C 4CM3A 5HNKA 3X1WA 1WBDA 5AXCA 5DSTA 3P9NA 2J7OA 1NVVQ 4MRNA 2PZEA 2G40A 4J94A 1WUJS 2IE0A 3TLGA 5TS3A 2Q1UA 3N53A 4UBMA 1BMFD 2HAEA 3FPAA 3B5JA 2C2YA 1T8PA 1VLQA 4CN9A 2A0FA 4YAKA 3IHTA 2I6UA 4LAFA 1J8DA 4M0EA 3R09A 3VYVA 4GZMA 2QM0A 3DE2X 3U1VA 5F5LA 5ISMA 3KQTA 4LJ8A 3MAAC 2Q45A 3ICCA 2XITA 1V39A 2EGGA 2O2SA 1EA5A 4BE9A 2NX2A 3GPXA 1UKCA 5ALYA 2B2XA 3T61A 3BWMA 4Z53A 4I50A 3S55A 2E89A 3N2NA 5LXTA 1PJJA 4G3OA 3KP1E 2AG0A 3HCFA 4MUEA 4ABTA 5DKFA 4Z3KA 3GW8A 4BJ3A 2VXCA 5LQJA 3FPFA 5BW5A 4Q93A 2MH8A 4X63A 3HADA 1Z28A 2WMDA 4OGLA 1DC5A 3IEIA 4Z3DA 4ENWA 3G9ZA 1FVXA 2YY6A 5IF3A 1JW9B 1A82A 1U4OA 2HWXA 3KD3A 5BV2P 5GPBA 3R3YA 2FX5A 4DV4B 3AXSA 2WIAA 1MABA 3RADC 4F1KA 1UWLA 1FP4A 3WK7A 4QDOA 3P71T 2CKMA 2IW1A 3NX4A 1PWHA 5EMMA 1KOFA 1QWOA 1OWPA 3LK7A 4RVCA 3CRNA 2FN4A 2FZWA 1BCRA 3RQSA 5EVJA 5BN4A 3HDHA 4J49A 1IHYA 4DV2B 4CKEB 3ZC3A 2EF0A 3CEAA 4WLUA 3UHFA 1TAHA 3UV6A 1N2SA 3U26A 3B9BA 2QMZA 1HA3A 1X8XA 5F5NA 2RONA 3D3WA 3SM3A 2HNBA 2P9QA 3ND8A 3NEYA 1Z4LA 3KQLA 3ZD6A 4G5QA 1VE9A 1HLPA 4WKPA 1TZ2A 3G2PA 3RRZA 1WAMA 4QECA 1TX4B 2VDWA 3CVWA 3NKVA 2F3RA 4MUKA 3EFEA 3GP1A 1DX6A 9ABPA 3LP6A 3M6MD 2EJSA 4M55A 3KZCA 5TE9A 3INGA 1TYCA 1PZFA 5T4HA 2EDAA 2ZUUA 3AFIA 5IHXA 2I6GA 5AVZA 1NOIA 3IUSA 2AMVA 4PRYA 2HCJB 2IIQA 2V4ZA 1HDRA 5TV2A 4K1XA 3RV4A 5JPIA 4BCBA 3S40A 2X4GA 3CH4B 2JFZA 3DULA 2JY7A 2POCA 2XNJA 5JXWA 1QJCA 3D5EA 2G08A 1GTZA 2RI6A 1C9JA 4QQFA 3I83A 1KIFA 4O3FA 2AX4A 3HO1A 4Y9SA 3PCTA 3LA8A 1QFYA 4N40A 1NMZA 3LF1A 4S12A 4LJ5A 1U2PA 3TTSA 1N2BA 5K3DA 3NFRA 1OHHA 4HG2A 2OV8A 1A9XA 1P1JA 3MCUA 4CLHA 3L7MA 4LA4A 3WYAA 2SCUB 5EMKA 4YCSA 2HQOA 3UUFA 3K70D 3QG1A 2YXPX 1UPFA 2YIDA 4GI1A 4ID3A 1OTYA 3NAZA 2YHIB 3SQNA 4URHA 1RJ9A 5A7FA 2FW6A 1GA4A 2E4ZA 3HJCA 4BFXA 1JHVA 2BFMA 2PZBA 1A8IA 1YVUA 1JMVA 2OMEA 4E03A 2W6ID 2R00C 3DFUA 5HFAA 4FINA 3W4IA 5JC8A 1TGYA 1B4DA 2BHLA 5GMOA 2H29A 2D5IA 4U0JA 5BWMA 1CRPA 5DK4A 10MHA 5K20A 2ACEA 5LDDC 3ZCPA 2DFNA 4WY8A 5KDOA 4K8OA 1Q0RA 2HNAA 2H5IA 3VYUB 3ZVMA 5KO3A 1JEYB 4DA8A 2B1IA 1QAMA 3X2FA 4ZV7A 5DRYA 3SY8A 4YO7A 1W93A 4GYWA 1ZWKA 3U31A 4LK3A 4IMJB 2UUPA 5AJWA 3BDIA 2FSSA 4YQFA 2OFXA 3GGSA 3PJDA 4Z51A 4X62M 3H75A 4MGHA 1X8KA 2CV0A 4KTVE 4JYPA 4WOCA 3V55A 4C7OB 3T54A 1T0PA 2YJTD 1LUAA 5F7XA 4MLZA 4BFTA 2DZDA 2HWYA 2VCYA 1SOAA 4OLJA 3PXAA 2P5TA 1DXQA 2AMLA 2QRLA 5F51A 1E2NA 2PIAA 2AOVA 3VO9A 3FHCB 5A0VA 1MXHA 3GRZA 2CLKB 2CB0A 3R5JA 5FPTA 4J7AA 1DBVO 2E87A 3W9UA 4GOXA 4GKVA 8ABPA 1UBOS 4JEUA 4AY5A 2IEDA 3VKHA 3FPJA 4D81A 1JPJA 1K3WA 3EVGA 2QJFA 3N7TA 1DOHA 1M2HA 3RYHA 1Y81A 4MW1A 2ZT6A 3I9LA 4I1SA 3RSCA 2Y20A 4JI5B 1WU8A 3AP3A 5THXA 3KQQA 2JPDA 1X7WB 4AY2A 1ZR4A 4P3KA 3QE2A 3NEAA 1K7EB 3BMNB 1V5IA 1YASA 3I45A 4KLRA 3K5HA 1N2GA 4NH0A 2NXWA 3KFUG 1FFGA 4UREA 1N75A 1RI1A 2IXTA 4JGGA 4JVLA 2PZMA 4EHDA 1T3SA 2Q1XA 5ENVA 3N3BC 2GHQA 1MAHA 5HKAA 1QDLB 3VJRA 1UJ5A 4YN3A 1EVJA 1R1DA 1ZIYA 1NHGA 4QVIA 2V45A 4MYUA 1YZFA 3HB1A 3LBYA 2NYAA 4PGGA 3EUAA 4A2WA 1O0SA 1B6SA 1F48A 5K0SA 3M5WA 2HLDA 1JEJA 4RKYA 2NAFA 1Q21A 1EX6A 5HTKA 3B5EA 5IK2D 2JD1A 1L2CA 5C7OO 4DA0A 2BBTA 2BZ0A 3R23A 1ZO8A 2EJVA 2GZAA 1XQWA 4ZANA 3W2IA 1EP1B 3ABOB 1KJYA 5DPMA 3LH5A 1ISHA 1T4GA 2VI5A 1PSWA 1P5JA 1G0OA 3OZBA 1N8SA 3LWNA 1NF9A 2OC9A 4PHCA 1RVV1 2HDHA 3ZXXA 1URPA 1ZUIA 4ZTBA 4FJ1A 4HD8A 5H1YA 4ZALA 4UBIA 3HXPA 1TFUA 3WFJA 3FKQA 4N82A 3EEFA 1IZ8A 4IF4A 2O54A 2WMOB 2YR0A 2APJA 1L5HB 1T36A 3BL6A 4F8YA 1KIMA 2PN1A 1GCUA 2FRDA 1LWNA 1PGQA 3MHPA 3G2JA 3BXZA 4PCUA 2EZ8A 4I9FA 3R20A 1T5LA 3GIDA 4KUGA 3B70A 3HWSA 4Q0MA 1U2EA 4OXXA 3STVA 1NIJA 3RFXA 1NUHA 5CBPB 3FOEC 2TMYA 3QMWA 4FPXA 2IPMA 3WKBA 1XD9A 2C5RA 1Z0FA 3IUPA 3EJ6A 3NRJA 5ALJA 3AVQA 2A4KA 1M34E 1UKEA 4CTKA 3H19A 3HY3A 4RTJA 4DJEC 1DUVG 3W6NA 2PPLA 3BBPA 4FQ5A 1W4LA 1ZW1A 2A7QA 3H3JA 3JQ9C 3DDWA 4DTIA 4BWFB 3QENA 1Z8DA 3OU7A 3WGMA 3AF3A 2AOUA 4IICA 4KR2A 2YCBA 3GLHE 1UZNA 1HUQA 1CVRA 1Z47A 4OQNA 3PPIA 1T8WA 4YP7A 3ZHZA 1GPWB 4Q1AA 3U7JA 2DWZB 4R16A 3CH7A 2ODEA 3T0FA 5K9ZA 1I5RA 4GM1A 4QU9A 2OO5A 5GONB 1AKRA 5LP6C 3IIMA 4QLAA 3FFBA 4C0WA 1IM5A 1JYEA 3EGEA 4BNWA 4EW3A 5K0LA 3SOPA 1I94B 1MU5A 1L7VC 4MHSA 4KVGA 1VYUA 1NNLA 1D07A 4MKFA 4K8RB 5DWVA 4JC5A 2WV7A 5E6JA 4P35A 2POQX 1G21E 1BDHA 2GBCA 2F1OA 1EB9A 2R86A 2X0RA 1BH2A 3ET5A 1E9FA 1UQTA 3URKA 1XQVA 1KQFA 1BDJA 1BCSB 3WLNA 5EGSA 3QNMA 4L9RA 3OG9A 4RDIA 1W46A 4KREA 3P2OA 1JXAA 3PFKA 1VPTA 5E9WA 1R0WA 2DPYA 2HSZA 3C8MA 4TXJA 4O02B 3LJKA 2WQ7A 1AG9A 3UICA 2J6BA 3BXPA 5JAIA 1PN3A 5KB3A 1L5LA 1XZ8A 4MROA 3IT1A 1YCHA 1N25A 3NOXA 3KSAC 3FPLA 1EYZA 4G4JA 5BQFA 3JPWA 4PWZA 5DHTA 4JZYA 1VBMA 2K47A 3UH0A 1U28C 4YJHB 3EK2A 1K8RA 4B08A 2XADA 4EHIA 4QYWA 1BVUA 4C87A 5CAEA 1FSGA 1D6MA 4LJAA 4MI1A 2FYTA 2E48A 1BOOA 4D9FA 1ZN7A 3CPHA 3K71B 2VDRB 3QEKA 4BDTA 4ETIA 1VRCA 1U8XX 4AMGA 3AR8A 5JNWA 1LPMA 4NF2A 2ACVA 3VH2A 2RIRA 4BQQA 1LS1A 2QTFA 1ND6A 3DKRA 4OK6A 3HSSA 1O5TA 4UU7A 4IMRA 1XL1A 2GXQA 1GRRA 4I08A 1R5NA 3A7DA 5M34A 4JUBA 1XRLA 2RGCA 1KK2A 1PJRA 2YWGA 3GGOA 3MTBA 2Y1XA 1XYGA 3HR7A 4EFDA 3O4VA 2VAMA 4L50A 1ODFA 4D8UA 3EBLA 2C9DA 4D3DA 2CHVA 4U7JA 1FFYA 4MWEA 2YFQA 2IYFA 2VUIB 3JQAB 4IZOA 4H7DA 1WRBA 1Q1GA 2Q3BA 5IT9A 1U7WA 5F4ZA 3RQIA 5IF9A 1SEPA 1W19A 4NONA 4RZSA 3BSYA 4CKBB 1RE1A 4RQAA 4IJ5A 3SGLA 5CGQB 1G0NA 3KWFA 2YCLA 2DBVO 3BREA 3K30A 4G5FA 3C24A 3IP8A 2DWUA 3P4XA 1TUGA 4FEYA 5JXGA 2XB8A 5EGNA 1WIWA 4TTTS 2L42A 1ZRSA 3BXXA 4AQDA 3RJ5A 4P6VF 1DV2A 5MN5A 4MO2A 4R3UC 3B89A 2F43A 1D9ZA 2ORWA 2E5LM 4DLKA 2Q5CA 2WSEF 1OIXA 3WGJA 4Z4QA 5EMNA 4LECA 1H5NA 1I3LA 2RIPA 3V8VA 2W7TA 2GZSA 5C1IA 1ACJA 5SV2A 4GU5A 2BSXA 4D3SA 1QIFA 2PO5A 3FDFA 2HL6A 5BO5A 2LNDA 3QNUA 4C5AA 4F71A 1Q0TA 4I19A 3HLYA 3OEHD 2IDZA 1U8CB 1ES9A 2GJAA 5L45A 4B6JA 1C29B 4NHEA 4II7A 2R6FA 4F6RA 3SYKA 1ZZGA 2O2EA 4UBLA 1NDUA 3YASA 1DO2A 4XEHA 1Q6ZA 1PTJA 5FA5A 4JUAA 2J9YB 1N4DA 3WBKA 1YJ5A 1GPDG 1ORIA 1QU3A 1P8AA 2AGVA 4IRMA 3OWOA 2N3ZA 3EPKA 2QW1A 3C3DA 1DG3A 3GLGB 4UDOA 3U40A 5JSZA 1YXMA 4M1KA 3MT0A 3CH6A 1JAHA 4HH0A 5FLXA 4LF6M 2ODNA 4I5IA 2DBZA 4OVZB 3KKZA 2NUAB 1VKJA 1QIDA 2X77A 4IINA 1GRNA 4YAOA 1ISRA 4FLEA 4WN9A 1RXCA 2FXVA 2RK4A 2WKPA 5LOVB 1GUYA 3IESA 4JV5M 5ITZA 4DAEA 5AIBA 4DRXA 3KT0A 4ZYXA 1PJ4A 6PFKA 3C0KA 2ZRAA 3A6HA 2B5WA 4PG8A 3DFFA 3ZWQA 1XPRA 2LV8A 3GEDA 3HSYA 5HIMA 3ZCSA 4NMLA 1Q7TA 3NDPA 3PE6A 2VP9A 4XRRA 2ECOA 3KKEA 1GDTA 1KKLA 1P73A 1PFQA 1TJYA 1CTQA 4EG8A 3PC7A 2K7ZA 3GFBA 4IJ6A 3U6PA 3QFHA 1G8HA 1TYAE 2HU5A 4XXHA 1DT5A 2PL9A 1M8GA 4IV8A 3CF6E 1E7YA 3ZLVA 4K9MA 2VRCD 1TUBA 4HLNA 4MMXB 4MA0A 3FWNA 3ZGVA 1BS1A 4B7GA 4EKDA 4XVUA 4DDUA 2CDRA 2YQZA 3G1TA 3L7YA 1SPXA 2V55B 3TXXA 1MZVA 3VQTA 2O8CB 1Z4NA 3FB1A 4AKSA 4B6GA 4ZZIA 2I1LA 4MARA 5D5HA 2QN1A 3HI4A 4M8IA 4LSMA 1P5FA 4KR0A 3Q7EA 4NBVA 4EGFA 5ERXA 2OGTA 4DBLE 2QRQA 2CCGA 4ISCA 2FPWA 3S8YA 2VDNB 5KPTA 2AR9A 3IULA 2L17A 2MJ5B 3U62A 4XOUA 5DTIA 3KS9A 3JY6A 1QC5B 3B2NA 3KOUA 4JYZA 3HZHA 2VEOA 1QZUA 2P2NA 1K6JA 3ZN2A 2YDXA 3GG2A 3R40A 4DVJA 2X1VA 3H9QA 3OFVA 1TYEB 2XWPA 3QU5A 2PSDA 5FAXA 1XWIA 5CURA 3EGCA 1SXJC 3NWJA 4MH0E 2Q7DA 2QB5A 2RHOA 3WI7A 1U7TA 5KCMA 4MZXA 2R7LA 3BC1A 2N46A 3E9RA 3HB5X 4KQ9A 2J5YA 1ZCAA 1E5DA 1GL9B 1GTVA 1U8FO 1O89A 4RZ3A 2GEKA 2HDNB 4YRPA 5BP7A 4QU0A 4WOBA 5J4LA 1QIIA 3GAAA 1NUTA 3KQHA 5AKZA 3L01A 4I3GA 1L3BA 1XDSA 1PQWA 3H99A 2FZ4A 3A4NA 2PT7A 5G2OA 1WB4A 4OY3A 4X97A 2CJFA 2GD2A 5B4UA 2FK8A 4AAYA 2NU9B 5LKRA 3UXMA 1ZESA 1DKNA 1X9GA 2ZT5A 2PUHA 1M2KA 2VQSA 2WD7B 3EE6A 2B99A 2XNHA 2XVZA 5ERGB 4LCBA 3JU3A 2C84A 4GHAA 1CUHA 5BQXA 1TF0B 2JFWA 3B2QA 1L4EA 1NVKA 4K6CA 2XNDD 5EMLA 3NBUA 2LDBA 1G20B 1NI5A 4BUZA 2Z3WA 3AI2A 4R9VA 3L8FA 2W6ZA 1PJTA 5ALDA 2B20A 3B85A 4DAOA 3RKSA 1SCUB 2OENG 1I80A 3KT6A 5J2UF 2AJDA 1SWVA 3R3ZA 3I0NA 1T0UA 2DF8A 1UFRA 5HIJA 3SBJA 4FX2A 3WV4A 1GYQA 3E46A 1E60A 2IYEA 1RHJA 2X0FA 5FV7A 3PQFA 3GPYA 1MNAA 3T1QA 3PIIA 3NP7A 2Q4TA 4KQCA 4KQ2A 1DKOA 1V43A 1QHSA 3WG9A 2GM9A 1N78A 1HFEL 3FDJA 1TOAA 4RZHA 1ZMVA 4HP8A 8CATA 3L6OO 4RA9B 1LBHA 2ZE6A 1SHKA 5AHRA 5T67A 3NG1A 2CZQA 1M0WA 2HWWA 1QZEA 4EA7A 3GXOA 2YHSA 4I6GA 4FKMA 3OLVA 5EE0A 4GYKA 3KAKA 3PHBE