The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
89
|
sequence length |
306
|
structure length |
306
|
Chain Sequence |
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLEH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
2-phospho-L-lactate transferase
|
| publication title |
Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb |
| source organism |
Methanosarcina mazei go1
|
| molecule tags |
Transferase
|
| total genus |
89
|
| structure length |
306
|
| sequence length |
306
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
2.7.8.28: 2-phospho-L-lactate transferase. |
| pdb deposition date | 2008-01-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01933 | UPF0052 | Uncharacterised protein family UPF0052 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Helicase, Ruva Protein; domain 3 | CofD-like domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | CofD-like domains |
