3C3DA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and phosphate. northeast structural genomics consortium target mar46
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 89
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3dA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3dA01
2P0YA 3CGWA 3C3EA 3C3DA
chains in the Genus database with same CATH superfamily
1ICIA 2WWWA 2FR8A 3MS2A 4MWEA 4MOWA 3BSSA 1SC9A 2NTVA 3W5UA 2NV2B 1B76A 4ENQA 3ND6A 4HT3B 5LMNB 2WU8A 2GBGA 4HDCA 2QTGA 3FMOB 2DFKB 1RI2A 2XF8A 1AKVA 5BWMA 3SYRA 2EBHX 5TMEA 1EUZA 1KERA 3H87A 4NQRA 1SN7A 2R8XA 2LTUA 3L6OO 2VAPA 2AI3A 3V80A 4MUYA 2CT8A 1SIBE 1IRXA 3W4KA 4Y0NA 5IJZA 2IYWA 1KA9H 2I6GA 3CPSA 1WB4A 4HLUC 5TVKA 1FNCA 4AJ4A 2H4XA 1XRQA 3F90A 3A6KA 2OWEA 3FFWA 1FFYA 1HLDA 3V4SA 4L7QA 4DIKA 2EJVA 4ED9A 2APJA 2NAPA 3C48A 5F78A 2AMYA 3FLEA 3R3JA 2VPZA 3ENQA 1BX1A 6ABPA 3IXLA 4BNTA 2VXBA 1K0UA 2OVFA 3THOA 2B2XA 3PXAA 5LP1A 5JS1A 3T95A 4IWNA 4L8LA 4X66B 2YN4A 3HACA 1TLLA 4QHYA 3LNTA 5JCJA 4RTRA 1FDTA 2JZOA 5AK5A 2Z4RA 3L27A 4MCIA 3AEQA 3R2JA 3YASA 4X60A 4B35A 1M5TA 1IXZA 5JHGB 3MWJA 4GRDA 2IQ5A 1MQAA 3HL4A 3B2EA 1EFTA 1QVZA 1CR1A 1C9MA 2ORVA 1ACLA 1SVNA 2PZGA 3ZW7A 4KXNA 3E48A 4WZAA 1DT5A 3P0RA 3AEXA 5EXEA 4LF9M 1Q7BA 4ZCRA 3ICWA 3L41A 2A5JA 1VYVA 5AI5A 4FFRA 1WOMA 5JMOA 3HYLA 3H2KA 3HYCA 4R8RA 4BLQA 2F8LA 1GVHA 1HQKA 1M66A 2ZTCA 4BOYA 3GR6A 2I9KA 4KE9A 4GKBA 1C9JA 4K2HA 4OBXA 3R41A 3NUQA 1P4RA 4FM9A 4UHDA 5DYNA 4R0MA 2ZJ5A 1J0DA 4UDNA 4I46A 4E2XA 4MRRA 1OLUA 4HXGA 4YDSA 4V0LA 5DMXA 4O4HA 2DMRA 1RVV1 2KW0A 3A1VA 3DDNA 1TVMA 4MAAA 5KYTA 4OXNA 3PXCX 5LP6C 3QU5A 3H9BA 2MJ5B 3BL8A 3ZX4A 4LJ8A 1Z6AA 3LDGA 4TYNA 2BFMA 5BQOA 4WLEA 5AMXA 4DDTA 3HWRA 4CODB 1DAKA 3L6UA 2G8NA 1JJAA 4IBOA 4BMVA 1P80A 1X7HA 3DFMA 5DGXA 3L4KA 2NVUB 2QX8A 3OE5A 1GGVA 3DZHA 3EXEA 2WBLC 4EF5A 4MUHA 3AB7A 3GWZA 1NLZA 1ODCA 2QPTA 1B1CA 1ZIDA 4PU0A 1XHEA 1KC3A 1GD1O 3MF4A 2HA3A 1X0VA 4HJRA 1OX6A 4QO8A 1SXIA 3DBVO 1CRWG 1FFGA 2R5FA 4AUMA 1FF9A 5K0NA 4ZK2A 5DSTA 3LGXA 2AK3A 3RJZA 2Q9BA 2YYSA 4FYPA 4R3WA 1X80B 1QHHB 1ZVQA 3K9OA 4PG6A 4DXAA 1T0BA 2FS1A 3V3KA 4JR1A 3PUJA 2P3LA 3HHEA 2GAAA 1YHZA 2ZIZA 4WRRA 1J70A 4O25A 4CTKA 3GCZA 2OM6A 4TSFD 2OECA 1RIFA 1GAQA 2R44A 1C5KA 1MFZA 3RHSA 2P2ZA 3GC6A 3QENA 4ZU6X 1P0CA 1C7QA 2AN1A 3G9QA 4MQEB 4UOEA 4OGFA 5KSWB 3DFKA 5ELMA 3VR6A 4MGYE 2R7KA 1I2ZA 3OUTA 1I8TA 2B6HA 3EISA 1DDIA 4JB0A 1EM8B 4L8FA 5DTQA 5BMVA 3QWFA 1KI7A 3IPLA 5K3EA 4LHSA 1GJRA 3H86A 3SQDA 5B2EA 5LIRA 5EWLA 4A2WA 2ZE5A 1KZ6A 3ZIAD 4C4PA 5HUQA 3HRHA 2W2MA 1HURA 2REXB 4BN5A 1S3GA 1Z17A 5FV4A 2GD0A 2F3UA 5I48A 4F56A 3UQZA 1FP6A 4AKEA 3MHPA 1L4BA 2EFJA 1A1VA 3UW3A 4HLUA 1E0JA 4IFTA 4C03A 3ONVA 3STWA 1W1WA 2ZJFA 3CXUA 4HNGA 1LV7A 1NUUA 3ZQKA 1OBVA 3NOQA 3IMKA 3O0DA 4QXRA 4TT8A 3AU9A 1B8PA 4OHRA 4DLLA 1H6UA 2Z8YM 1ESCA 4ZT6A 1XP5A 3G5MA 4X94A 1W85A 2BGTA 4B4UA 3VZPA 4KHZA 4BATA 1U2EA 1YJBA 4JA2A 4J75A 4RIIA 2AOTB 4HZUA 5JARA 2O8BA 4HQKA 2OO3A 4WXRA 1G8SA 3OX2A 5FOTA 4ASUA 3KU1A 3OLZA 2VHCA 1VGRA 1E9FA 4Q39A 4JJGA 2HW8A 3V34A 3IA2A 3L7AA 1D0IA 2ZJ3A 5EJAA 3U3DA 1HDEA 4FOLA 4A0SA 2LR0A 2OBMA 5A3VA 1F51E 4RNAA 1AHIA 2XVXA 4NZNA 2GK4A 4C88A 3H5AA 2R8EA 3OMWA 3VNAA 1D2AA 1XLWA 2AMLA 1GAEO 1G6HA 5EE3A 1HBJA 3GDFA 5BNZA 1TUBA 2IGTA 3BXFA 1FFSA 4H6PA 2PT9A 1O08A 4LDAA 2QNBA 4G81A 3OC6A 2OD9A 1KWGA 2QZJA 4GFDA 4E0BA 3PGMA 3EC1A 2GDJA 4JX8A 3HSYA 3A14A 4G0NA 1NBMA 4V0NA 4US0R 2FSHA 5T6MA 3PPXA 3DD1A 1PKEA 1Z33A 2RHJA 4X64B 3AH8A 3BFKA 1Z0AA 4AJNA 2D7CA 3JQ7B 1AV6A 1JEQA 4JU8A 5T64A 2DQSA 4RXMA 5DHTA 1K5PA 2P5UA 1QH9A 4JLBA 3GUCA 2IS2A 3SJBA 2KZSA 2HDNB 3I04A 1QPZA 4ZVSA 2VF5X 3K94A 4NBTA 5LP6A 3FG9A 2DU8A 5T4EA 3P9QA 4ZOAA 2ODBA 4K9RA 4PZAA 4XWWA 3UB2A 1OWLA 3JRNA 1C3OB 2IE0A 4M89A 4CM8A 3A2NA 4AVYA 2IZZA 2O2ZA 4N1AA 4L6IA 1YXMA 3FDZB 1YBAA 4Q4LA 4S0XA 1ZGCA 4C6TA 2DFVA 1RQRA 1X7YA 2AD1A 4EMUA 3SKXA 3ZV3A 3T5TA 4IRXA 5H0IA 1KVSA 1HDXA 1EPUA 5B30A 4WJKB 2ZWMA 3UJAA 1QGOA 2RCYA 2J09A 3KV3O 1DOHA 1YL7A 3WNCA 5B64A 1N92A 4G3XA 3IHWA 1RXWA 1LPSA 4LMBA 3TLGB 2R4UA 3AIMA 4UHJA 2UYHA 1QHYA 3MRXA 1PAUA 2RH8A 3ZDBA 3DBHA 2AL7A 1G41A 1ZCJA 4G09A 2IH5A 2I6UA 2HA0A 3FYTA 3HFRA 4J4TA 3KUDA 1JYSA 2NVOA 3KD3A 4MHOA 1EZ4A 1IC6A 1PV1A 4UULA 4TV8B 1QAMA 1GSOA 3VKGA 5IEJA 1E3JA 4P2BA 1R1DA 3KXDA 1NSYA 2I4IA 5KQPA 1N2ZA 1AN0A 1KBZA 1RZUA 2HYDA 2R6AA 5IREB 2QS9A 1OFTA 5ALPA 3QPBA 1NNUC 1T4BA 4Q7JB 2XHEA 3DZDA 1Y6GA 1H9CA 1MZPA 3WR5A 4TRMA 1SVIA 1O95C 5AXAA 1O3YA 1OH6A 3T35A 1KDOA 1WPXA 2P6UA 3M1IA 2X4IA 1WQ1R 2R97A 4OLFA 3RIXA 1XZQA 1I4WA 4C7XA 4NCAA 3E05A 4EI8A 4EUHA 2Z2IA 5T6BA 3D1LA 3BH6A 2DCUA 1E2JA 5GVRA 3A25A 4HLCA 4F2WA 1JQ3A 3TQIA 1A9QA 4GR9A 5ALOA 3SICE 4W1RA 3JARB 3K96A 3RAFC 3VPDA 3LXRA 2ZR8A 3IQWA 1LRKA 1U5BB 3FCEA 3U9TA 1J7JA 2Y93A 1KEKA 1F6WA 3V32A 3OCVA 2G1PA 5A9SB 4V0SA 3U4QA 2XNDD 4L73A 4YT4A 2JC3A 4E3WA 5E3JA 2ZI9A 2ODNA 2BV3A 1R10A 3H5WA 2J08A 1R27A 1G8PA 2J3LA 4H15A 1EDBA 1A69A 1U6IA 3N8NA 2NAFA 4S24A 5DGHA 4AWBA 4MI3A 1DO8A 2ZSDA 1RJ9A 1AVTA 2JHFA 4OP2A 3OX4A 1KK2A 1FNDA 1PJCA 2D54A 3IQIX 4UCFA 1GNSA 2B9EA 1ARZA 3LDAA 2A9JA 1EQ2A 4YP6A 4LGYA 4Z9FA 4BQNA 2NP6A 1E1DA 2RD2A 5JYEA 1KAMA 4NZOA 3JAMS 1WZCA 4DLTA 5DNYA 4DG9A 2HO5A 3OPNA 4V24A 2W43A 5FLXS 2Y1GA 3CNQS 1D2RA 3HP1A 1DL5A 1TZBA 2CJYA 4HAXA 1YQUA 3VBCA 2CW5A 2MU1A 3UMMA 5MN6A 2AJCA 1SC1A 4CJXA 1RE0A 1T4CA 3FNQA 1E32A 1D0LA 5IT0A 1V47A 1CNFA 1TK9A 4RV5A 3I4VA 4O2AA 4GZ6A 5ADUS 1R4MB 2V5UA 4FPXA 3ZZNA 2V8BA 1LZLA 3MGAA 3OLVA 1SU7A 3R8FA 4P3NA 3L7MA 1Z2AA 2L19A 4QZVA 2NU8B 3UWKA 3AL2A 1H69A 2OZEA 3R7LA 2AG1A 3C3DA 5CFZA 1NXVA 4QC2A 1IOLA 4DCJA 3ADBA 4IDAA 4RE6A 2I4LA 3U6CA 5CB4B 3IUSA 4KI0A 3ZDAA 1BA2A 3PVCA 4OI1A 4KYUA 3DH0A 1SHJA 2GM9A 2OV3A 2R2GA 2ISSD 2W2OA 3PZBA 1QO9A 3AGPA 1WEHA 4LYGA 2Y0QA 4BP1A 5EJIA 1L7PA 4ENSA 3UYKA 3OZGA 1RJFA 2QTVB 1NN0A 4BRUA 1K06A 2Q0HA 1X7GA 1VKRA 1BG6A 4F3YA 1ZDMA 4JJKA 1LPOA 3FUCA 4BKPA 2QUAA 4XEHA 1AKYA 4JOSA 2VNIA 4YP7A 3NTVA 2DPHA 3PX3A 5FNVF 3HKCB 5DIFA 1DPFA 1EFLA 2CHVA 3BZBA 3OLYA 4HMQA 5EP2A 1NYLA 2X3FA 1KY4A 5DYWA 3EXFB 5EZYB 1BU8A 2WT8A 4JLDA 3DD5A 3OFKA 2OPHA 1JHZA 2HFJA 3DT6A 1BXGA 4UFOA 4L4RA 3FVVA 3SEFA 3L6DA 2WQ6A 2Q3JA 1FUEA 1LS6A 3DQQA 2HADA 4EZEA 1T8UA 5KQLA 1CZHA 4FN5A 4LX0A 4RHCA 3L04A 5AKJA 3L02A 1JLLA 4D81A 2K47A 1UBSB 4YQFA 3ANLA 1UJCA 4D9FA 1HX7A 1CZRA 1QFJA 1Q2XA 1NNUA 4KTTE 4E70A 2WFAA 4ZO7A 4ABYA 2Q50A 1O95A 1R0KA 4UUBA 5IAAA 3DBRA 4H60A 1PJTA 3CLUD 2OGWA 1U8AA 4X7RA 1CE8B 3HVRA 3FNBA 4QWWA 1RLUA 3UTDA 3KZVA 4AUNA 1YA8A 2IU4A 4Y67A 3G2OA 2I1QA 4LRQA 4HDSB 3WLJA 3MHVC 5SYAA 2JI4A 2WYOA 2XGJA 3L82B 5C9ZA 5EJMA 4KKXB 4F2GA 3AHFA 4ZOBA 1ZU5A 1FC0A 3CVYA 1KQFA 2J9FA 1KK3A 1FPQA 3UNXA 4QRIA 1FJGM 1X1BA 4Q02A 1FFAA 5B7PA 1OTHA 3JR7A 2BHNA 2ESRA 3G9UA 2FZ4A 1HYHA 4M4SA 5F2OA 3A6PC 3JQEA 3WBJA 5A71A 1D2EA 1XALA 2EUCA 2K2QB 1RVDA 4RA6A 1ACJA 1L4GA 2I91A 3K4QA 3KQQA 3GEMA 4UD6A 4P81A 3CIOA 1E5DA 3GUVA 4K05A 4HR7A 2JVKA 1B6TA 4FT2A 2R9VA 2XUDA 3FCUB 4KXUA 2IT1A 3AV3A 3D8UA 3OECA 2UUAM 3V7NA 4DXHA 4ZHQF 2A92A 2Q21A 3ND8A 3P5SA 1V6SA 2V0NA 4HWRA 2E48A 2Y66A 1SQ6A 1XNJA 3H9QA 5WRFA 1G7CA 5BR4A 1IHDA 4L4ZA 1GQQA 2GEUA 2OCYC 1NKTA 4IAOA 3OZUA 1G8MA 4HKTA 2V97A 4II7A 4PRZA 1FUYB 1YUMA 3HKEA 1Z8NA 1T8SA 3NH6A 4ZV9A 2BOVA 4LA4A 1VKJA 5AW6A 3EGVA 3HNOA 3NMUF 3AOEC 3P1JA 5EXTA 3TLYA 2DAGA 4OJMX 1EE1A 3U17A 3U48A 2ZJZA 4M1WA 5I9BA 2O0MA 3L7LA 2H1FA 2PUFA 4LW8A 5EQTA 3WIBA 4IXWA 1BH6A 3QEJA 5HQ3A 4RY0A 4O4JB 3P20A 2XYPA 1UC8A 5FORA 2Q07A 7CATA 4B3GA 4XIJA 1W4AA 1MO2A 2XWJI 4E31A 4H2DA 4R1MA 2OP1A 5FL7A 1JFRA 3QEBZ 4KGZA 5ALWA 2A59A 2H1VA 2IELA 3P4XA 4ENWA 1J97A 5CYPA 4IKEA 3BTVA 2V6MA 2A9OA 4O2RA 1ENOA 4YT8A 2ZUSA 4YV2A 3L1KA 4BZWA 3SNHA 2BEVA 1Z45A 2VS1A 1P3QQ 1M6HA 1XVAA 1TT5B 5KNCD 4ND3A 4PTLA 1E5QA 1EIJA 2DJIA 3F67A 4TVBA 3PV0A 4BQRA 1U2GC 3LV8A 4C7OA 2BWEA 5FI5A 5JISA 5ITWA 4OI4A 1ADJA 2EU8A 4H18A 1MRZA 4OQEA 4G3OA 1KJZA 5K7SA 1UPTA 4ZT2A 4BKQA 1LI5A 5JVDB 1DCFA 1TADA 4LJYA 4ZQHA 1E3SA 4QGSA 4B73A 4C5BA 2LVQD 2QMYA 1VHWA 2IY7A 1KI9A 1UJNA 2CKDA 2ZQYA 3NRBA 2OPFA 2JAHA 1Y9EA 4DQUA 2CYBA 4P4NA 3AT1A 1D5WA 3ZDCA 1U9ZA 5CM8B 2A94A 5DFLA 3ACBA 3G0DA 5NULA 3Q3VA 4WOKA 3RF6A 1ZBDA 5FJJA 1ABEA 4D8TA 3VM6A 1LTMA 2H11A 1AUQA 3UW1A 1HL3A 2QAIA 1KKMA 3IELA 3WGLA 4ZI7F 3HJBA 2VLBA 4GXNA 3UENA 4D0SA 1RXVA 2QHXA 3T4PA 4RORA 1XB2A 3I0MA 3A4NA 5FJIA 1NXSA 3HCOA 2N75A 1U7DA 2AUTA 4Y18A 5JZMA 2C2XA 1NJ1A 1LA2A 2IVFA 3MT9A 5ALFA 4N5NA 2GCOB 3PQEA 3RD5A 1E0AA 4JR2A 3GYGA 1KQPA 1EIZA 2Q7DA 3WMXA 3DSRA 1NE7A 3ILHA 3WIDA 3P52A 4FYIA 1R2ZA 1WB5A 2FUG6 3O7MA 5E2AA 1C2TA 5KJ1A 2ZE6A 1JBQA 1I7LA 3GZ4A 4P7KA 2CFOA 1E9BA 4N3NA 3VSBA 1W4CA 4PR3A 5KDLA 5EHXA 4B3RM 4MV0A 5BSKA 3ENKA 3A6DA 1ZNZA 3ONNA 4RMJA 3F46A 2OK7A 1MQ8B 2AN5A 4C2BA 2NG1A 4GLJA 3H5IA 2R8PA 2VQSA 4C0QC 2JVIA 1TVCA 4IL5A 3SC2A 1B6GA 4LRWA 5DYYA 3OCYA 4YYZA 4HPJB 2QTWB 3F3YA 2JGKA 2H7CA 3TLCA 4L9RA 1OYWA 3L6BA 1XD2B 2B9VA 4DIOA 2ECKA 4NK5A 1DLIA 3QYAA 4JLSA 1YS2X 2HHHB 1UMBA 2O8DA 4RD0A 3KSBC 4EARA 3K5IA 3OWOA 1NZDA 4PLFA 3Q2IA 3UUFA 2QRVB 3CVOA 1XCBA 5KC8A 2BFEA 4BN0A 1PFKA 2WWXA 3SXUA 1LLUA 2A1TS 1PW5A 4B32A 3I4LA 2HU5A 2H2FA 1LLCA 3AOEA 4AQYB 2IJGX 3I83A 1W0KA 3KLMX 4OFXA 1V4BA 1E2MA 3SNKA 2V59A 4X97A 1SKYB 2ZU6A 3OE4A 4DR5M 3NGXA 3IBTA 1O9BA 3PC8C 1R3DA 4G63A 5HBRA 4Z4IA 2WWGA 3NJ4A 4DV3M 4D26A 2X5XA 3V97A 5CVUA 5FBQB 1A3CA 5H02A 3ZNPA 4OHUA 3TTTA 4OKIA 4Q1FA 1GQYA 5LYJB 5KVSA 4HDNA 4QLOA 1SJ9A 2DH6A 3T06B 2II6A 2YHSA 2DULA 4B2IA 1LJLA 2X8WA 3HP7A 4QRDA 2OAGA 4IBGA 2UUOA 1FX0B 4N18A 3DMRA 4DJFC 1XQ1A 1BMFA 1P44A 3GDOA 1KK1A 2K6GA 3THRA 3A37A 2B1RA 2B7BA 4F3TA 3L0OA 4CFZA 2WEKA 4DNOA 1J23A 4L4YA 4TT3D 4WZZA 1UH5A 3DO6A 1HQCA 4P54A 1U2GA 5DKFA 1H22A 3QX8A 1Z2PX 4BFZA 5A5VA 1RLTA 3O0TA 3PSAA 1XELA 4RA9A 5K20A 3IEXA 3WC4A 4XWTA 1YS1X 2Q5CA 4QBTA 1H6DA 4B6GA 3U2QA 4K03A 4EITA 1DAMA 1P2DA 1U8XX 1Z74A 1JU3A 3LGAA 3W2IA 4JN6B 1FU7A 4KMRA 3ZK7A 3JTMA 4OUKX 3U09A 4JI5B 5I8ZA 4YAKA 1FYDA 5B4UA 1OF1A 1H9AA 1L7QA 3DDSA 4NEHB 5AUQA 3ZUGA 4B0OA 4PLPA 5BPVA 3X44A 1Y1TA 1X1TA 1QK4A 4QAQA 1XJWA 1CR0A 5A9TA 3QE3A 3RC3A 1CEQA 2Q5JA 1CUDA 4TZ6A 4CI9A 1IU9A 2G09A 3FTPA 4V3CA 1CQJA 2IXEA 1RE1A 4IQ8A 2OK8A 4B9EA 3F6RA 4MUIA 3LPLA 2WSYB 1YACA 1B43A 2GK6A 4GPIB 1NVKA 1N33M 1C8LA 2FLVA 3CU5A 1S7GA 3ZEAA 4LJ5A 2WJPA 2PJRA 2HR1A 3R1IA 4KNWA 1HLGA 1JLRA 2BSAA 3RFXA 4B8YA 4CMIB 2NUPB 1KGSA 3IVCA 2BTQA 2RJOA 2C96A 1FNSA 2PZLA 1OTRA 2RMKA 3UXHA 3QYFA 1T8WA 2Q8NA 3D2AA 3SHVA 5HFNA 2J45A 5EP1A 1NXQA 3L0ZA 4C5AA 4AFNA 4ROTA 3L40A 3K8ZA 1T13A 3NETA 3ISTA 3PJEA 4BEWA 2XXJA 4YJ3A 3ENNA 1E20A 2BH9A 1QORA 4FWHA 2Y6UA 5FBKA 4HX9A 1QG6A 3LNCA 3IUJA 5K1ZA 4EPYA 4UE6A 2X8JA 3GCDA 3WLOA 4MO2A 3AVWA 1OIVA 3U4MA 2NYRA 1H6BA 2HEIA 3OPXA 1GLGA 2R0IA 1JQLB 3L7YA 1WGNA 4QUGA 3AHHA 3GIDA 1GZ3A 1KI6A 3GARA 4D9IA 2F3PA 3H05A 2ZDQA 5EMJA 4PN7A 1HMPA 2F5SA 3WY9A 3A4TA 1OGYA 2R86A 4K9DA 3EZ9A 1Z63A 3N28A 4C4TA 2O3TA 2Y1WA 5JNUA 3UM9A 3SIPA 1Q77A 1P1CA 3IQHX 3NHZA 3T94A 3R3WA 2ZSFA 4Y9UA 1QHXA 1Q95A 3X1MA 5EKDA 5B6JA 3WL7A 1V8PA 1V9LA 2AR0A 1XZFA 4M3NA 4B3JA 3J81A 1H2WA 3DP9A 2KI5A 2GO7A 1PDOA 2BFWA 4KZKA 1GADO 3QVXA 3F9RA 3MT0A 4F6LA 1R8JA 3PRJA 4YAIA 3ETDA 3RODA 1OWOA 4P4GA 1BTOA 4K8RB 2JLAA 3RGSA 4B8WA 4G0VA 2RC5A 3KYDA 1R66A 1E2EA 3KSMA 4PNZA 2FPUA 1MPTA 3PC8A 3CLHA 1S3IA 4KNVA 5CNJA 5DE3A 1PNOA 1Z4PX 3M4ZA 1MTZA 2BGJA 4MJLA 1AIPC 4BV3A 1ZFNA 5C5DA 1XZLA 4JNKA 2QZ4A 4DEXA 2ZCJA 1QB7A 4JJIA 1TZ2A 4NCBA 4NMWA 1JDBC 4AJHA 1FIUA 3D6MA 4FWGA 1FFXA 2WPNA 3AJRA 1BD4A 1ZJZA 3OOWA 4CWAA 3O1HB 5HKKD 3X3HA 4UFPA 3CINA 2FSFA 1QP4A 1LQ2A 3H2JA 2NTNA 5A7HA 5HF9A 1HORA 3E61A 3EPPA 4TKZA 2W22A 3KVYA 1STOA 1FDVA 1PWXA 3G2PA 1L4UA 4RFSB 3DOUA 3MINB 5DK6A 3PC2A 4C7KA 1HE3A 4UM7A 1YR3A 3AP1A 2PKXA 3P9CA 3SMVA 3VDMA 4RIEA 1NOJA 1RPNA 4C30A 1MB0A 4DMCA 3VSAA 4KVAA 4A2QA 3GRYA 4FC7A 5F7XA 2RKOA 4PFJA 4YJ2F 3JWIA 4ZVKA 3QLEA 1VI2A 2AR7A 1NNI1 4L8RC 5HCUA 3ZJTA 4G86A 2HWUA 5CX1A 5I7WA 1KRXA 6PFKA 3ZN2A 5F7JA 4A6DA 3GZNA 3RVBA 4OM8A 1UKVY 4MVWA 5AHKA 1TYAE 1PJSA 1JQAA 1K6JA 2IYEA 1TF7A 3LF2A 3S6JA 4BVAA 5ADVA 3TSCA 1DC3A 4MS1B 2TMGA 1PK8A 4M1TA 2ZYIA 3JASA 1AZSC 2Z6UA 1P7PA 3L8DA 4N54A 1WJ7A 3BHJA 3HGTA 4JDPA 4BNDB 3QPWA 4DBLE 2AQHA 4JOQA 3VSCA 3IA7A 3ZNNA 2AX4A 2JJ2D 2WIJA 3FOBA 3SBOA 2VUHB 4KQCA 4AW4A 3O1JC 2KSQA 1NMXA 3GJ7A 4BASA 4ARZA 1M2NA 4NMLA 1J2RA 2UKDA 4M8SA 1WW2A 3OM8A 3QELB 3O84A 1FMLA 3G0CA 3HB4X 3LLVA 4B3FX 3RSQA 3EFHA 3KFXA 3A26A 3RC7A 2ST1A 1M6VA 3OOYA 5HQJA 3SYMA 2ZANA 2B99A 2RGRA 5C18A 2OVBA 2V54A 1GLVA 4ZANA 4JYPA 1R6XA 4OK3A 4Y9TA 3T9EA 3E0XA 1BNCA 4FZVA 3MW8A 3PP8A 3NR2A 4UMEA 1UIMA 3EXHC 3HUEA 5C37A 1RJEA 3K6JA 3AWIA 1G3QA 4XPZA 4I2NA 1SCUB 1S1CA 2QMUA 2NO6A 3KQNA 4BFCA 4FHEA 4R1SA 4EHFA 4TKUB 1Z2NX 5AJTA 1FRVA 1UZAA 2QZ9A 1SVWA 3IDOA 7AT1A 4LCEA 4ARVA 1GLNA 5ADWA 3QPAA 3EVGA 3ZXYA 2J85A 2FW1A 3BD7A 4HWKA 3SMPA 4IEEA 3VO8A 1S8OA 1OLSA 3QW2A 1M1YB 2I66A 4BBZA 3CJQA 1MB9A 4X3PA 3DMYA 3L2OB 3HVIA 1YJ8A 4RO0A 2QG6A 4YJFB 4I9NA 2BFBA 2NTJA 1SXJB 3KT3A 4EW6A 4YYEA 3OLXA 3PRYA 5F77A 3E5MA 4TWRA 3ZKAA 2GD1O 1YR9A 3GNSA 4DCTA 3DZGA 3GB9A 4ENVA 4A92A 4ZJPA 2J5RA 4XPIA 5KO2A 3K0KA 4GOOD 3EXIA 3H0KA 4MKFA 3M9WA 3HXQA 3FMIA 4DANA 1R6TA 3R5TA 1HFJA 8ADHA 4WERA 1FDWA 3T99A 2AYZA 1L7OA 821PA 3IT3A 1YE9A 5EJ5A 3KHKA 3H5VA 5ILGA 4LSGA 5EYPB 3RQIA 2A7XA 2W2LD 3FRJA 3ZC7B 1AIPA 3ZWPA 3D3WB 1WPQA 1W48A 2FWPA 4KPUA 3JR5A 2YQ4A 1QCDA 1R15A 5LZ5A 4BP9A 4FVTA 2IBSA 1M8KA 2QXUA 5D6OA 3E5RA 4CQMA 2DY0A 2PMFA 1QRUA 2ZUDA 2D2FA 4Q7QA 4U9UA 1CYDA 3OX3A 3LU1A 4PDIA 2DBYA 4MKIA 2XF2A 3KJGA 2JD1A 1EE8A 4H6VA 4RD3A 2OZPA 4EGQA 1ENZA 3EZ6A 4ZVNA 1PWEA 4LHYA 1Q1QA 1D0VA 1UUFA 1M75A 3PGXA 1QC5B 4EY7A 2CNOA 4JH0A 3H2SA 4QULA 2ID4A 1L7NA 2GJAA 4YS6A 1BVSA 4IIWA 4R8MA 4P53A 4JOBA 1EDOA 4LG2A 3H99A 3QOFA 4ME6A 1V92A 4B33A 2ZJ8A 3RRJA 5AXBA 3KEGA 5CIQA 3VK8A 1K7SN 4ONEA 2QT0A 3NDIA 2Q4RA 5E4FA 4JFRA 3O1IC 4HAOA 1Z6YA 4MGHA 4MA4A 3N7TA 3L49A 3ZH2A 2OC9A 1GY8A 4UBIA 1NVXQ 2IUSA 2JY7A 1VBNA 2FN4A 3HZHA 1WV0A 3MIIA 3WBFA 2XV1A 5U1PA 4H7DA 1VIAA 4MV9A 2QGNA 2WNIA 3OQ1A 2VHQA 4PYRA 4QG7A 2C2OA 4LXTA 5E38A 1IBKM 1AB6A 5ITXE 3ORRA 4EZIA 2AMJA 2F1RA 4XK8F 2YY5A 2PU7A 3UFBA 4JI1B 3CFYA 4BP8A 5F2NA 2WDZA 4G4RA 4LKOA 2L42A 1EQUA 4UAVA 5COBA 3KE8A 2BFAA 1AQUA 4DLXA 3RYCB 3C4JA 4UNSA 5K8CA 3DS8A 3LT5A 3Q8XA 2V4UA 1WIVA 1JYFA 3QEAZ 3QVJA 4FYKA 3BH0A 4OYHA 5GGXA 1ULBA 2B7CA 1U1DA 2PEZA 4RTPA 3JAKB 4QG3A 4L2IB 1QUFA 4J0FA 3UG7A 2I22A 5FA5A 5ALMA 3R7NA 1PZHA 4UOZA 2DBZA 1UOEA 4YI5A 1N3BA 5J2UB 3WGKA 3EXHA 3D6JA 1XK6A 3QU4A 3BKXA 4ZVLA 3EG9B 1KI4A 4DBLC 1R50A 1K1EA 4YLYA 4K6HA 3H17A 1L8LA 1A7JA 4E7OA 5CEEA 3UGTA 3RVLA 1DQSA 3JZAA 3KJHA 2PUBA 4ZVPA 2P90A 1A27A 4LFCB 2H0RA 4BEBA 1Z8FA 4KBFA 3W1VA 4AX4A 1FP2A 4B2PA 1G9XA 2Z9DA 4RKWA 2EW2A 3JYOA 4S2UA 1AH2A 1NSFA 1L1ZA 3PNQA 2JIBA 5A03A 2G0AA 3DCNA 4YRZA 3SJUA 5CFQA 1F8UA 3DF9A 5KREA 1V8OA 5E4TA 2CWDA 4PO8A 3DDHA 2GN8A 2E18A 4POAA 3FI9A 3ZU4A 3RVMA 1AMOA 3TLEA 4DIFA 2ALJA 3DR5A 4IQGA 3NNDA 2D2VA 3TLJA 1IQPA 2CLOB 2R47A 5D7BA 3P5BA 1H8ED 2QRGA 5JPCA 4DLAA 2FDCA 3JWJA 4BNUA 1GITA 3H4VA 2G07A 1EQAA 1IOWA 5IULC 3S5JA 5CGZA 2ERYA 3GVPA 4CR6A 5CLLA 1KFVA 1NYTA 4N7MA 5G1NA 1KEWA 5ALUA 2Q4OA 1NF8A 3DVQX 4K0KM 4QOGA 1C1HA 4KWTA 4B8ZA 2GYVA 1XZPA 1MO5A 3D02A 3CZAA 2ZIXA 4IJFA 2TMDA 6REQB 2I54A 3VU1A 2AOXA 1KEEA 4RTJA 3ZE6A 4HDRB 1E61A 3OOHA 1WXEA 5FWXA 3HLTA 3NHBA 4I1SA 2WSSD 3JWGA 3KEQA 1MAWA 2QTMA 3IBGA 1OKSA 1S8NA 1O5OA 5CU7A 2FOXA 3TZKA 4EVSA 4KQFA 1TKAA 1HO3A 1JLKA 2W00A 2H52A 4YCAA 4MR9B 4G0XA 1G66A 5T7BA 4QXQA 3SHOA 2CHQA 1OWMA 1M0SA 2BTEA 5KCMA 2HSWA 1K0FA 1ZH6A 4O5AA 1JN0A 5TPWA 2F3QA 2X2FA 1RT9A 2XPCA 1U7TA 3PHBE 2NQ8C 1OV4A 2P0EA 1EDEA 1R74A 1XLVA 1ECBA 2HHAA 2C2HA 2RFLA 4HX2A 1CUJA 3JD1A 3AZQA 2CP8A 3VDRA 4JWTA 4TVKA 1BEEA 5LNK1 4QPZA 3AFGA 4HGYA 1Q84A 2CUTA 4F3KA 1EVIA 3VH4A 4NFSA 1NUAA 1E2DA 3MUEA 1PR2A 4NU8X 4PGGA 2X2PA 4KACA 4PAMA 2G0TA 2M60A 3E4RA 1NNEA 3K8YA 4FYMA 3C6YA 2WMDA 5JD4A 4RMNA 1URPA 3MPOA 3UUGA 1NT2A 4LV8B 4G4JA 3WJ2A 5D1HA 3RV4A 1XNQB 2FWJA 3FDFA 2IYNA 2XWBF 4L8GA 1EI9A 3PHJA 3PQ8A 4AT1A 1WNTA 1JT2A 1EP3B 3T1YB 1NLUA 1NW7A 4RVDA 1ZIOA 3A9RA 3L77A 1AKWA 1EP1B 5IN5A 2R6JA 4IXDA 5EWJA 2AQ8A 1H2EA 4NKRA 3RRZA 1U7PA 4QFBA 2JI9A 1W4LA 4NOMA 4GD3Q 2HSEA 4HUQB 3N76A 3IHPA 4N0DA 3N0WA 4N0QA 4X00A 2PYZA 3HZZA 5AK3A 1JE1A 3VDNB 4B7AA 2AI2A 3UOWA 5EE9A 2R18A 1CIVA 4DCVA 1L5HB 4X54A 5HUJA 3TW8B 1ZH0A 3D1JA 4EYGA 4JI7B 4B3SB 1X42A 2DT5A 5FOSA 3FM9A 4EX6A 4GZ5A 3CJRA 2CF6A 3OQHA 2WAAA 3HRIA 1JMKC 5K0SA 2WC1A 3ZI4A 1G7SA 1MU0A 3MOIA 4EUEA 1KORA 2ODEA 3M34A 1TH3A 4RKYA 2VTEA 5C1OA 3IECA 1SWVA 3A2KA 2YVKA 4DM3A 4MS3A 3QUBA 4HD8A 3X1KA 4J1QA 4D6XA 1CQPA 4XVQA 3V00A 1UC4B 1UMCA 4DDMA 3RDPA 2XTNA 2XQVA 1S2LA 3B53X 2PRYA 3EUAA 1CUUA 4LKRA 1Z38A 2OCGA 3QFHA 1PSZA 4TL7A 5FTMA 4D98A 2RGDA 2CB0A 4QFMA 3W4JA 1W34A 4JYBA 4YMGA 4U9HS 3NAZA 1T25A 2WJAA 1ZW6A 4EMTA 3QGMA 3MFQA 4U2GA 2UZAA 1DC6A 4FDAA 2B25A 3RTDA 3PE3A 4CIXA 1GUDA 5IBCA 4IWXA 5EZSA 1DEHA 1RQ2A 1Z16A 2KHZA 1XX6A 3GT4A 4H59A 2CEAA 4GMHA 5AOCA 5BV0A 2R8YA 3G79A 4MW5A 3T6KA 4N9QA 2XUHA 4HNAB 3T9AA 3KOMA 3FDJA 5J47A 1DQYA 4YRBA 1QYIA 4YWHA 4R2LA 4XYLA 2VHYA 1AS3A 1ODKA 3W3ZB 4FGLA 4ARIA 4TYYA 2G6TA 3NKVA 2WV9A 2HWJA 4CEJB 2JDID 4L5YA 5K4HA 3QV2A 3GRRA 5FNZA 4BNXA 3DL0A 2NVBA 4GVPA 1P0QA 3QYJA 1J8FA 2R6GA 1IBRA 1FLAA 4G0MA 1A5SB 1D6NA 4M1SA 2D13A 1E7QA 3BZUA 2TSYB 2WF5A 2E3JA 1FXWF 2DZLA 4D79A 1HEUA 3KUUA 2H06A 4QXPA 3LBHA 3EAQA 3VGPA 4LVNA 4QNNA 3TRHA 3U7FB 3C6XA 3E81A 3G89A 3UA3A 1XKQA 1RXSA 4NOLA 3Q1KA 1QZZA 3N0VA 1EINA 4QGHA 4B48A 3HXKA 2ZIWB 3CLRC 4PZZA 3P9ZA 1PEYA 2NQ8A 1WSWA 4PRLA 1PBNA 4Y1RA 2IHVA 4AZFA 4MP8A 4AYXA 3WNBA 4JVOA 3DV0A 2K7ZA 2XMBA 1JBEA 4TWZA 4LF4B 4LWQA 4JZYA 1M3SA 1BEUB 1ORVA 4BMPB 3NIFB 2W4MA 5KKCA 2YX1A 4DRYA 4FXPA 4H3SA 5E6RA 3SQOA 2W6JA 1GGJA 1VBMA 4MQBA 2XNSA 2W6QA 1JLMA 4RDHA 2HIHA 1K7XB 3FHOA 5JJIA 3W6OA 3EF3A 4KMMA 4B43A 5AO9A 3BVPA 4PCVA 1IWOA 2ZYWX 1WMDA 1G2PA 4M9QA 3PUHA 3L8GA 1ZNYA 1S2GA 8ATCA 4C43A 5EUMA 1Z5VA 3DAHA 2WW8A 5E0OA 4KAAA 5CA0A 3IFSA 4FHGA 3BPSA 1SUPA 3FYCA 2DX7A 4UVDA 4ZYUA 3HBMA 2EQBA 3RWBA 1RTTA 4FI3F 4DW8A 3P19A 2B30A 4D4IA 5KX5B 4YROA 5E7IA 1L2DA 2QI9F 4YIKA 4P5PA 4OUDB 4C7MA 1UP6A 4EL0A 2P2LA 1Z4MA 2JCSA 3HJAA 5FUXA 3JVVA 3RT1A 5J4KA 4Z51A 1UAYA 3PXXA 5ITXA 2WVHA 1ZHOA 2DWLA 2ZBPA 3L9XA 3MUFA 3ZHSA 3FWPA 3BF7A 1U9CA 4XW2A 2ZT8A 3R9XA 5JAQA 4C76A 3EFOA 3BMOA 1Y1QA 2E4XA 1RQGA 1M2OB 2NU6B 3W2EA 1E7MA 3EQZA 3VQTA 4URWR 1T0UA 3PYMA 2H17A 3K71B 1T9BA 4TL9A 3EMDA 1H9BA 1ID1A 1M1ZA 5HSGA 1IQUA 1MOPA 2XB6A 4M22A 1TGVA 2JFYA 4BE7B 4TXNA 3TX6A 2YZNA 3AJ9A 2X0IA 2XOXA 2F8MA 1AQJA 2ON6A 1JQKA 3AETA 4YQYA 3BDVA 1NLYA 2D1QA 3D4IA 5BQ5A 2MSNA 2Q62A 1S01A 4PIVA 5TT0A 2ATVA 2G1UA 5K3AA 2ZSBA 3QV1A 1EESA 4LZLA 4EBBA 3M1AA 4HUJA 2R85A 3G68A 4EUSA 4LN1A 2IXAA 4BLUA 3DEYX 1L7MA 3FRIA 5L3QB 3QAUA 3DEFA 1CHNA 2RJNA 2J7OA 3PD7A 3N2NA 2BONA 3Q85A 3PNLA 2R46A 3O1LA 1RHUA 3OPYI 3UH0A 3CZCA 1SU8A 3N75A 3NQ41 2HA6A 4MR7A 3IP8A 3QUSA 4ZQBA 4L9SA 3UO8B 2P4QA 3OZ7A 2WU3A 3A46A 3JQGA 1ZCZA 1IOVA 2YRXA 2O5EA 3WGZA 1T6OA 5LXTF 1K3UB 3TSAA 3WNZA 5F76A 4LI0A 1GKYA 1Q0RA 5FBLB 3MK6A 2Q4EA 5LWQA 3OZVA 2JJ1D 1VBFA 2PQ2A 4UBKA 3I42A 4PNEA 2C5FA 1EGHA 3DJYA 4HEA1 5C8DA 3QPVA 2SICE 5EJ4A 3DLCA 1Z5BA 3O03A 2ZWAA 3R3ZA 3J81k 3BD8A 4DRXB 4PNPA 5LPNA 3PD1A 4LRSA 4MRMA 3BRCA 2A57A 3U60A 3H5RA 3ECSA 1K2WA 3ML1A 1GDHA 4HDAA 2VJOA 2XH9A 1I3LA 4EVIA 4GR4A 4YUVA 1ZJJA 1PR4A 1WCXA 4L5IA 2QZPA 2X6QA 2XQGA 4Y2TA 1W88B 1C3EA 3ID6C 1T2FA 5C7IO 4JJ6A 2WHYA 1XXHB 4NESA 3OE7A 4DV4M 2ONYA 5IF3A 3GLGE 3B70A 3CUYA 3F9CA 1M1XB 4RFLA 1Z4IA 5GONB 3UJ9A 5EKXA 2WD7A 1U31A 3FE2A 3QMWA 1B42A 3KNZA 1NJGA 3MWEA 2NZWA 4F1WA 3KV1A 3OURA 2P0YA 3HDHA 3ZZ0A 4J29A 3HUDA 3PNBA 1V39A 1COWA 2PGIA 3M7GA 2W48A 1ONOA 3LIPA 3TEJA 3TK1A 2DQZA 4OA8A 3AR6A 3FPHA 2GAIA 4I9GA 4W7IA 4XIYA 4XFJA 4EHNA 1NASA 3WGNA 2NU7B 3DOAA 1P9LA 4EJ0A 5ALRA 1UEIA 3RUCA 1N2CE 3GOHA 4L4SA 4HAYA 1O1YA 1Y7TA 4CM6A 4HMOA 4GITA 1GZ6A 5ITYA 2I34A 1ZQ1A 1KF0A 4K6OA 3CEJA 2AA3A 3ZDQA 10MHA 5AKLA 5K05A 1Y3DE 5AI8A 1W5BA 1T2AA 3GLSA 1O6FA 5AM2A 2QRZA 4PPYA 5FTJA 4CR7A 4BDTA 3I1YA 4ZEOA 2YTZA 1REQB 1W46A 1P2FA 5ALTA 2QQ5A 2AJLI 4CLDA 4RHTA 1J90A 2CBZA 2WZCA 1QQTA 4QLBA 4RETA 4HFMA 4I14A 5DLEA 5E0KB 3OTGA 2QJRA 1L7VC 4KVFA 3KB2A 1JX6A 4I4TA 1PLKA 4O59O 3OJFA 1ZQ9A 4F45A 5EWMA 3TPCA 1EJBA 1SXJD 1ZM2A 4G1EB 1IBSA 3NJRA 4I50A 3TXAA 1JPVA 1RBYA 1UADA 4UQOA 2I6SA 1RMTA 4H17A 3UMCA 3HC7A 3WLEA 4IP0A 2BH2A 3O3CA 1WXXA 4RULA 1G8HA 1E3TA 2JLCA 5ALHA 1YI0A 1B73A 4YA6A 2M6LA 1MEJA 2H7XA 1JVBA 5HK9A 5DLQC 4YCMA 2LIVA 1S3SA 5CCDA 5KO3A 2CXNA 3Q8KA 1XO1A 5KYXA 4M88A 3S44A 2QPOA 4PZ0A 4P5DA 5AK0A 4AZ3B 1KTIA 3AR3A 4FFMA 3T9FA 3GFOA 5AUOB 4OP3A 2F43A 2YHIB 4O2BA 3P9PA 4PQRA 2D5CA 5K3SA 3N8KA 3G13A 3I2JA 1E2NA 4PXSA 5AVZA 2JFGA 2PZEA 5AOBA 3TL4X 1XAHA 3GEHA 4FDLA 4C4AA 3OPYB 3LZ6A 5HX7A 2ZRIA 3WLHA 1BOFA 5KSOA 3QWIA 3EWAA 4R3NA 3E3AA 3O4RA 3GOQA 1SM4A 3KKMA 1XAJA 4H7HA 1DKMA 1ZAYA 4CM5A 4TRNA 3UOAB 4BXOA 4W5JA 4IBDA 1KYYA 4I1PA 1IZYA 3CBGA 4BMXA 4IBFA 4G0ZA 1TTQB 2P9HA 4BU1A 4GPBA 4LYFA 4ZI3A 4HFNA 2PUHA 2FE8A 2QYSA 1QPBA 2Q5FA 4EB0A 1P3JA 4DJ5X 2C5BA 3MHTA 5A2QS 1DWPA 4Y2SA 3EIUA 5FAXA 4TTJA 4MLZA 1PKXA 2YV4A 4E2ZA 3O93A 1Q1NA 2PUWA 1XRPA 3U0VA 3WL5A 2R1VB 3KBOA 2WVAA 3HJCA 4K9PA 5ALDA 5LR6A 3LLCA 4NJOA 3WGQA 3D31A 1E9CA 3VPHA 4ZVOA 2I67A 3O3OB 1FK8A 1ZO8A 5AM0A 1KARA 2PX0A 4NDAA 3GGSA 3PNSA 3RCBA 3NXKA 5CYFA 5FPPA 3CQ9A 4M8IA 4URVR 3QK7A 4LFBM 4K3UA 4X84A 4JKOA 4IXMA 3KAKA 5AKHA 3FSEA 1C3LA 3ZZTA 1DZ3A 1KO8A 3OEWA 2RI6A 5JS7A 4CDMA 2XDQB 2W8BA 4HFJA 3OX1A 1TA0A 1FE8A 1ILEA 3VDUA 1M0EA 3L9WA 1JWAB 1C3VA 4KH0A 4F2PA 2ZRHA 1N4DA 3ORYA 4BFXA 4EUFA 4O4LB 2LDXA 4XLLA 4FWDA 4FR0A 2WWRA 1FOEB 3KPVA 1CKEA 2I71A 2QTFA 5K45A 3TQFA 3HFJA 3BA1A 5LC1A 3FAKA 4B44A 4MGZR 3LBAA 2EW1A 3ADOA 1Q5PA 4NV1A 3JAWB 3G2HA 3PUYA 4I3HA 4ZMSA 3TNLA 3TAUA 2KNAA 1YR6A 1FW6A 1LXCA 3BULA 3TN7A 4A6EA 3N2ZB 2DQYA 5IU6A 2QMEA 4N82A 2V7GA 1UWLA 1UXOA 5GJCA 2JIRA 4JLKA 2YYYA 1RC1A 1IAVA 3UG6A 2H1CA 4RANA 3GRAA 3IBYA 1E1RD 3K8OE 2PX6A 3SQNA 4RVNA 4JGBA 3DLAA 4DJJA 4QU5A 2ZJ6A 2PJDA 3EMBA 4L4XA 4F60A 4WOJA 4CKEB 4BB5A 4U8HA 1ZD3A 3JY6A 2NO5A 3PXEA 2CVHA 1EFPB 4U63A 4DGQA 2AEJA 2C00A 3IE1A 3TD9A 2AUMA 3MMZA 2Y2UA 2W0SA 1BE6A 5A0FA 1TFRA 2VLIA 3ADKA 1F48A 4X45A 1U6JA 3Q2KA 3QFCA 3K6SB 1DC5A 3D7SA 4J0QA 1GOTA 5G0TA 1PR3A 4OJTA 4G5XA 1KXJA 3NI2A 4G41A 4NXNM 2G7ZA 1LJUA 3VGJA 3KYJB 3G5UA 1FZQA 1OB2A 1F2DA 4JKIA 2VHUA 4IIUA 3P97A 1SCKA 2NO1A 3D0OA 1NPTO 2ZS9A 3LUPA 5LU8A 3CG4A 2O59A 4NENB 1C8VB 3FFAA 1JPUA 1ESDA 2C98A 3ZXSA 4HXFB 3IPCA 2EJTA 3BGWA 2NVWA 1ZCFA 3OKAA 1C7FA 3BORA 1PK7A 4FC6A 1CJSA 4EP1A 2VDWB 2C83A 3RJMA 2I2AA 1Y9ZA 2QNIA 2IHNA 4HEHA 3MWFA 4L0QA 2QL6A 1LJ8A 1V26A 3TI7A 4KHPB 2JGIA 1RAFA 2ADOA 5LMNM 4MUKA 3EFBA 3FKQA 5AQEA 2Z3VA 4IFEA 5HFJA 2ANCA 3TTUA 4DT1A 1KJ9A 3U9SA 2QGZA 4MR8B 4TLLB 3UK6A 4M0KA 4MMXB 2OWDA 1ECFA 4FN4A 2HU8A 2DERA 1JDJA 2WHEA 5GWXA 3T7KA 5H80A 3B7WA 1IL0A 3FCXA 2OQVA 5ITQA 3KXLA 3H5LA 2NQTA 1U2TA 2WSLA 1MKYA 3DZIA 4LOJA 3EEBA 4ZOCA 4GEWA 3OG9A 1VHJA 1V7PC 5BSGA 8CATA 1FL9A 3T34A 1O77A 4JSYA 2GA8A 3H9UA 1QFYA 4NH4A 2VYND 1IPEA 2PANA 3DUFA 4REQB 1CS0A 2G4VA 3AVUA 1KDTA 2ATEA 4C0JA 3AR2A 4RY9A 2ECFA 2W90A 3N5CA 2GJ4A 5DEIA 2IEDA 4QQFA 4X66M 2XE7A 2GN2A 3B1WA 1BSVA 1RCUA 3M1LA 5T5QA 4LXGA 1TDJA 2RHOA 2FZKA 2NUAA 3QKUA 3MJSA 1Q0SA 4YMUA 5CA1B 3ZWKA 2GX6A 2P7IA 1SXPA 1IZ7A 3UZUA 3GLGA 1N3LA 4NY1A 1T35A 4M1EA 4D8VA 4PQEA 3P27A 3KZXA 4B6PA 3DDZX 3WIUA 4U7PB 5T41A 3ZY2A 5SICE 1XWIA 5HM8A 1UMKA 4BAUA 4Y0AA 3QE0A 5H9VA 3H11A 1Q91A 2ODQA 3U6BA 2X9GA 3X2SA 4JFAA 2H4ZA 4XDGA 2FH5B 2PPLA 3BBPA 1D4OA 4L7VA 2DUWA 3VJMA 3GEEA 1ZA2A 3QFSA 3HU2A 1NQAO 5TJHA 2VPPA 1JHMA 3CVJA 3TSWA 3I32A 4RVCA 1N2CA 2GESA 5KYKA 1T1EA 2HMSA 3F78A 4TXMA 2R79A 4JK3A 1YLAA 1LI4A 1JJ7A 3ZJVA 4Z9XA 4EM6A 3F4LA 3OA0A 1I4EB 5G2OA 4ZYVA 2DZOB 2V0CA 4MGKR 2VUTA 4HPWA 3HVHA 2Y0BA 621PA 3N05A 1EGVB 5EHZA 4GQBA 3NBMA 3GQBB 3W9UA 2D8MA 4MH0E 1QMGA 1G8KA 1ONBA 4NZPA 1UXHA 1HKUA 1JDNA 2DH5A 3DAFA 4QIHA 3TZHA 3V9PA 2H63A 3KVNA 3BREA 2A14A 4BVEA 3GV0A 1QP8A 4MEJA 4PG8A 4WN9B 3NNNA 1EDDA 4YUYA 4IFBA 2IGBA 1M73E 3SXJA 1FSSA 3QUTA 5HW0A 1TCAA 3DYBA 1XZNA 3TRIA 3G2QA 4ZCTA 4FMBB 4X5OA 3S8EA 3NHRA 5L7YA 2I87A 1LK5A 3TTXA 3O75A 4KPFC 5IKOA 4GKJB 3Q3HA 5B1EA 4QDUA 3RGGA 3WKBA 1B93A 2AFHB 2F5NA 1AM4D 1QU3A 5DWVA 3GDGA 4TUYF 1R6VA 3F4BA 3K70C 2XE4A 1I10A 3IDFA 3NVDA 2KPOA 1JTFA 4GLOA 2PGOA 4G8JA 5AIAA 1NGSA 1F8YA 2N46A 1E9VA 3IVMA 4A23A 4HH0A 3O9MA 2ZJYA 5BR8B 3VHLB 3HB1A 5IXYA 3WYNA 3PRHA 3A27A 4R5MA 3RASA 1N7JA 1ZU4A 2HA7A 2YUIA 2J0EA 4XGKA 1N5DA 1YSCA 2Q9UA 4J9UE 4O8CA 4LG1A 1R4NA 2QMQA 1W35A 5DYIA 1Y63A 2GYUA 4RAQA 1SU4A 2X14A 3QHQA 4CIAA 1XU4A 5F7OA 3NRJA 1HETA 1FQKA 1YVEI 5CYGA 4NOJA 5AVXA 2WHPB 2JUJA 2A4KA 3KZOA 1TJYA 1O4VA 3CT4A 4V3BA 4YPOA 2O2EA 2VDUE 5BWBA 2AH5A 2MWMA 2SKCA 2ZRQA 1XTUA 1WLYA 4EWLA 5KDDA 4BRSA 1XEXB 3P2JA 4LDZA 5AW0A 1NQWA 3DE6X 4DV0B 4L5CA 1PSWA 2JKYA 6GPBA 1OKKA 1W5SA 1N0UA 2IV2X 3PHIA 3VNRA 1P0MA 2XSZD 3FAZA 3JQRA 4DVGA 5BSEA 4BU0A 2CXSA 3D0KA 3HCWA 4MVJI 4JEIA 1ENYA 4Z7JA 3AEKA 4C21A 4JI4B 1BC5A 2QJOA 1U5CA 1GR1A 1GFIA 2XOKA 8AT1A 1KMHA 3GLTA 3MBKA 3NYIA 2ZI7A 1N75A 1I3NA 5IVIA 4WXHA 3ONWA 2C31A 3ZW9A 3JATA 3PGLA 2CHEA 2YS7A 1P33A 5F5NA 2C9ZA 1MXHA 1QCYA 3RREA 4D9GA 2AW5A 2ZIUB 2TYSB 2G71A 2CVOA 2J3EA 4IOJA 1HWYA 2BGNA 3SF8B 1KVRA 2XUAA 2RBEA 2XLJA 3EW7A 3ANMA 3CB4A 4F6CA 1VE9A 1YOVA 1RWWA 3VBEA 3AKZA 4LY6A 1N1GA 1DJLA 2NXJA 1SHKA 5AT1A 1V6AA 4Q4JB 4YAGA 4IX9A 2PAAA 1H3FA 2Y05A 5IJ0A 4IGIA 1DQPA 4X64M 4LEIA 3U26A 3GCWA 2GNOA 1CR6A 4ANFA 3DOIA 5TPZA 4C89A 2NZVG 3QEMB 1RCTE 5I9IA 3LHSA 4YACA 1NUHA 1V3UA 1RNLA 2IV3A 2H92A 4J07A 4TN1A 4DIBA 4DMMA 3MT8A 3VPSA 1NV9A 1P4JA 2QUKA 4NI5A 1UBGA 3OWHA 1M7BA 3BB3A 2F1JA 3JVIA 4HNQA 4MUNA 4RQUA 3R7BA 2OB2A 2V7TA 1QE5A 2E4YA 4QVIA 2NZJA 4TTIA 4LHZA 1JHOA 1U8EA 2A78A 3Q6MA 2B83A 3WNDA 1CUYA 2ZSHA 3LKBA 4RY8A 2NXCA 5FTNA 4HSEA 2FYTA 4OY3A 3OEHD 2R45A 4B2YA 4Z8YA 4ZAZA 1ULZA 1VIDA 4E30A 1I4TD 2QAJA 5DM0A 2JFQA 3C58A 1T4DA 1DBVO 1Y48E 1C4KA 4Q4CA 2EJCA 3KEMA 2BI7A 1AV7A 3TUZC 1O0SA 3O8DA 1MA0A 3GIWA 3E82A 4HVCA 4DPMA 2XUGA 4KITB 4QJ3A 5JALA 2LBPA 1IY2A 4CLHA 7MHTA 4BNJA 1RWMA 2VKTA 2VJMA 2J0UA 1UQUA 2XGSA 4A5OA 2YCBA 2CFIA 3RB8A 2PVPA 1NKVA 3PQCA 2J9GA 1NJSA 4U7GA 3TZBA 3I61A 5H16A 2ILTA 4G97A 3KCQA 1KMNA 3KD2A 3TUJC 2VUIB 4IJQA 1W76A 3SPXA 4MXDA 2AFVA 2GEFA 2DZDA 1IEWA 2NP7A 1GPJA 3OJEA 5JJBA 1AS0A 1WABA 2ZUEA 2D0DA 1MXFA 3FMGA 4L6V6 3JD2A 3OMXA 4QASA 2B4QA 5M3BA 1GR0A 1LQUA 2QCUA 4FR2A 2LNHC 3HZRA 3T0IA 5LB2A 2IXDA 3A4LA 5C35A 1R2QA 2JCVA 3ZGNA 3K31A 1YZLA 1KZGB 1SWWA 3RE8A 1YDHA 1M2FA 1P1KA 5GOZA 3EGXB 3NHFA 4YRJA 3HBAA 3MD0A 1PLLA 2UV8A 3U7RA 1BX0A 2C4KA 3KLPX 2HXGA 1I7QB 3V2UA 2QZZA 4KK3A 2C4TA 1WB9A 1ZRSA 4ESEA 1YQTA 3L26A 3GGPA 2BE9A 1T2DA 3P9YA 1UL1X 1C1DB 2A4MA 3H3FA 1H2ZA 4P93A 1YSYA 2CY0A 4LFAB 4JT4A 4ZVUA 3EY9A 1ZXXA 3E2MA 1ISGA 3I12A 4PHGA 2H2WA 3R3HA 3FJYA 1YUNA 1UINA 5CPFA 2FPMA 3IRUA 3U4AA 2FX2A 4WXMA 1BDBA 2PZFA 4WFIA 3OAAD 5JPDA 1Z8HA 4Y6LA 5B53A 1R9NA 1J20A 4E12A 4NHEA 1X77A 5A0TA 3JZIA 2RSLA 4AICA 2FPWA 1NI5A 3G7UA 1H3NA 2BDTA 5CD1A 2UXBB 1EBUA 1B15A 4AL4A 1U2PA 1EUCA 2H5IA 5PGMA 5CBKA 4A0QA 5L6MB 4XLZA 4PLHA 2YC4C 2A33A 4PF1A 2GNPA 3KE9A 2FPLA 5DOVA 2A9RA 2PL1A 1OXKB 1TW2A 4DHEA 1C14A 1GNRA 4BNMA 4AMGA 2ZAMA 1YL5A 5KWEA 3W9YA 1DRJA 1R0WA 4RHUA 1OE0A 2VPTA 3W4IA 5HHTA 3AR8A 1C0LA 4FP9A 3TFOA 2IHBA 4BFTA 3QA9A 4H27A 2QBYB 2ZRFA 4GOJA 3H7IA 1VC2A 4LSZA 1OBFO 3NM6B 2JH8A 1IM8A 2P6RA 4IIBA 3DEHA 4XH9B 2OUIA 4EO7A 3ZCTA 1HSZA 3TGLA 2ZXEA 1JDUA 4RVGA 1YA4A 3ANYB 2L09A 5REQB 1V7ZA 4FDUA 4B76A 3TR6A 5KU7A 5GZ1A 1QH0A 3SZ3A 1VLVA 4ECEA 5KOYA 4YP1A 5J3JA 4XX0A 2ERCA 5J59A 3VR4H 3GQ5A 1Z0FA 1QS0B 5AVTA 5SY4A 3UQYS 4PLYA 4X20B 4AP5A 3U61B 1H1TA 2HU2A 2XT0A 1L1EA 4PHHA 4XARA 4I1YA 4L0DA 3PENA 1TZMA 3CHYA 1FDOA 2ODPA 1ZOPA 4AO7A 4IHJA 2NXWA 2CK3A 3S2UA 1DRUA 1U9IC 2OFPA 3EJ6A 2FFAA 3HJGA 1GQFA 2AXPA 3D6TB 1D0SA 1ADBA 4PSVA 1F06A 4RM3A 1E3WB 3ER9A 3QWLA 4M76B 2VJNA 4EO9A 4FUTA 1C1XA 3INTA 1MABB 4LBYA 3IB6A 4PVCA 4BAGA 3PQ6A 1SD1A 2XQKA 4CVNA 5IM4A 3UFXA 3LRPA 3BYZA 3BSFA 1A9TA 1ISIA 2D0OB 3LDHA 1I0ZA 2IYQA 4LZOA 3E6AA 1OIPA 2FCAA 5SY6A 4PZLA 2K7FA 3QBEA 3TWMA 2YWXA 2I1LA 3SOPA 2WVJA 4Z7QB 3K0AA 3E7XA 1R88A 2JH9A 4YECA 4F8EA 3IE0A 3CF2A 5KCZA 1CJBA 1L5KA 1OCEA 1I7DA 4ZAGA 3BQ9A 3BJZA 2FA9A 3N7UA 1EUDA 4OV6B 1EM6A 4TZ0A 5TMDA 4B7HA 1R4AA 1GPDG 5E7QA 4ZXFA 1ZIYA 4QX6A 1KFBB 3W8NA 4AJOA 5CURA 1IN6A 1UDCA 2XRFA 1RLIA 4C6HA 5K0BA 2EGGA 3EZXA 1PYDA 3KSZO 1LTHR 4FHDA 5C80A 3KR9A 3S1LA 3ANXA 2WIFA 1IXSA 1K7FB 3EVNA 3NVAA 3OSUA 4BLOA 3ZWBA 4IBBA 5NLLA 4D7AA 1M1UA 4NBSA 1OHHD 1I2DA 5DXJA 4BX8A 4D9CA 3RWMB 5HOQA 2QN1A 1OROA 4K88A 3K9CA 4NEQA 1N1DA 3KXEC 4TVOA 1AKUA 1X1SA 3PD0A 4MB2A 1VCNA 1KSHA 3UHJA 1DJPA 3NB0A 3AEZA 5D5QA 4LXUA 1U1IA 4CT4B 4RTNA 1JILA 1LF0A 1E7SA 2C4WA 3LVRE 3KK0A 2R60A 1H0SA 1CFJA 3KXIA 1TC1A 5BN4A 2Q3FA 4D5EA 4AJIA 2RGWA 2A3NA 4CM4B 4RK6A 1B1AA 5E4YA 4JT2A 5CP8A 2BP7A 4RU1A 5EJFA 3U7IA 1TKBA 2CD7A 3CUSA 2YFKA 5FYDA 2FK7A 2QENA 4FMDB 2RHCA 4OHZA 2QTNA 4O08A 2I3AA 4WD3A 4D92A 1Q22A 1EEHA 2JCYA 1W25A 4M0EA 5SZKB 2X15A 4IJUA 2W6ZA 4RZXA 4G25A 2CJWB 2WYIA 3HKDB 3FMVA 4RFVA 1SBNE 4L8YA 4INOA 5I9TA 1K89A 2X8AA 3L0PA 5EGSA 1M74A 1QP7A 1A2OA 1YZYA 3EGDA 4AMZA 5JNWA 4LBWA 3U13A 3BMNA 5KPZA 3CPJB 1LKZA 1UBEA 4EQZA 5HP4A 2I4TA 3LHDA 3HCAA 4DBZA 4HN9A 5HM6A 4MSUA 4F9FA 3L1JA 2FF5A 2E87A 3VR2A 1MQ9A 2I7PA 3SJZA 5ED0A 3L92A 3DAPA 1JQEA 2AE2A 3EIFA 3SN6A 1PG0A 2ZUUA 5ER6A 1PGPA 2MYTA 3I8XA 4N5DA 4L3VA 2O23A 4L9AA 3ZVKA 3T3NA 4YH1A 4R6WA 1IJEA 1KY2A 1W29A 4P08A 2Z1NA 1ZCAA 1RRVA 1K9VF 4KO4S 1N6NA 4E2WA 4BO3A 4Y1GA 1P1RA 3VO9A 3NWLA 1E6WA 1GJSA 2IUEA 3HUFA 5K6RA 2CLFB 5KAPA 1NZJA 2VHWA 1VE3A 3NTRA 3W2TA 1KDPA 3BAFA 2RH9B 2MJLA 3U7EB 4TYMA 1GUFA 2VYVA 4Q1BA 4CIYA 4O4IB 3PQ4A 2WWHA 1OI2A 2WSMA 1U9IA 4EKIA 1FQJA 2H29A 5COQA 2TRSB 2PZAA 4PSDA 3WGUA 4WA8A 5JNSA 8LDHA 1SVKA 1NQVA 4K9KA 1G21B 1PJZA 4E4RA 1I2MA 4MHTA 1GRRA 4WACA 4QNRA 5K4GA 1Q1EA 1R0ZA 3CGGA 4EHHA 5FUMA 1E69A 3H65A 4UCXA 4FDMA 3N0TA 4FKZA 3PPWA 5ANRB 1I3MA 1BXZA 2R8ZA 2WABA 3UB3A 5IKXA 1KI2A 2ANBA 1MVOA 1NXPA 1E1QD 2D4HA 1D2GA 1OBHA 2X5NA 1A4UA 1E79D 2OL4A 3CPHA 4R2KA 4IH9A 2B1JA 4M46A 4IIJA 3TS1A 4K81B 5JMPA 1E0KA 5HRCA 3VPGA 5L3SA 2IWRA 3SAWA 1IPHA 1KPHA 2I7VA 2H1SA 5D85A 2ZITA 5I9NA 1UKCA 2ENUA 2BGUA 4WQMA 3FJOA 4HS4A 1H2BA 3JQBC 3ZLVA 3DOJA 3D3KA 1YJ5A 2WICA 2ZATA 3NHMA 2Q2NA 2DQKA 4PICA 5AQ1A 4EB6B 3RVSA 4D8UA 2HIGA 4GYJA 3VR1A 4RELA 3ZOKA 2HHJA 2ADMA 4PNHA 1M5UA 3ZWXA 2O14A 3WQHA 4LY3A 1MNAA 4DRZA 3DYVA 4TM7A 2B34A 3HGIA 3C3JA 1E89A 3QPUA 3AY7A 5B55A 1C9EA 4XM2A 2HUPA 4WMLA 3LBFA 3TFWA 1KMIY 3RJ5A 4K9LA 4KXWA 2WAXA 4EK9A 2Q41A 1ONPA 5HF5A 3UKJA 1JG3A 1NXXA 1BHSA 4KVGA 4ZMRA 2QD1A 3SP1A 2ZYRA 3GMSA 3DE0X 4UJ3A 4LOKA 1SVSA 2HHHM 1FP4B 2WG0A 1EBBA 5K8UA 1I6WA 2Z6QA 3RHFA 2BGRA 4E94A 4L8WB 2R00C 1HKHA 3OZFA 3SHWA 5FCDA 2D7DA 4JGIA 4H35A 2IIQA 3GEPA 4DKJA 2PH5A 5KTTA 2LW7A 3GEIA 1JPJA 7YASA 3DAGA 1N2IA 3CMCO 1PJLA 1OZAA 3QKWA 3PDUA 4LV5B 4AQYM 1AKEA 3HKBA 3G1WA 1RU3A 1B8UA 3AK4A 4K9OA 1XFDA 4J0KA 1M2VA 2W2VA 3PUVA 5TNXA 1QIGA 3LWDA 3UAZA 1YB6A 4A36A 3NHSA 3VH3A 4AJKA 3ZIUA 3JPWA 2DETA 1OGJA 3ZNOA 1QRRA 4TMVA 5A0VA 1SVMA 4MZXA 1FTQA 3THWA 3CT6A 2BI4A 2B78A 2QLJA 1ECGA 4E33A 1L5YA 4ZPXA 3H97A 3DXXA 5J2TA 4L76A 3OT1B 3V8MA 1V1MA 2VR1A 3LWBA 4U7TB 1HYGA 3CGWA 2ASVA 1TH4A 4XB1A 1Z28A 3UEOA 1ZAKA 1AD2A 2UZ1B 2PTGA 3W77A 4B6RA 2QUZA 1Y81A 1ZNXA 2QDKA 1O94C 16PKA 4WA7A 3L43A 2DTXA 4B3BA 2Q3MA 1E18A 4XTRA 1WVMA 2O3SA 1T6NA 2HRRA 1DMRA 1TJ4A 4C0AC 3A1SA 3OH8A 5K0JA 2DHYA 1P77A 4HWGA 3J81S 3G8BA 5CVDA 3AVVA 2C8LA 4Q3EA 1QF9A 3RNLA 4YCNA 5DN6A 4DMGA 3H2BA 2DG2A 4LDJA 2VRCD 3OA2A 3KVVA 1HGXA 3RK0A 2JFFA 4NCNA 5GTDA 5CXQA 4IMPA 2W2KB 2Z9BA 4PCUA 4JI5M 1XKLA 2C59A 2GYYA 1YDEA 3V8VA 2JS7A 4QTYA 4RF3A 4TRJA 3MTGA 3GH3A 2H2AA 1QLJA 4OSOA 3ERCA 2ZGVA 4OB8A 4G67A 1Z82A 4DV6B 1HV8A 1IONA 3OM9A 1Y6FA 3GJ0A 3H4TA 2PXHA 3JYLA 2W0MA 1JU4A 3DFIA 1G3IA 3C6ZA 1MX3A 4ND5A 4BYMA 2ZZKA 5LNK6 4H7EA 1SXQA 1CB0A 4S1WA 2Q28A 3DKPA 2WWTA 3ADCA 4Q6WA 5KZMB 4C6RA 2D6FA 1PGQA 4LF8B 3IV7A 4JX9A 2NUTB 4B31A 1CUBA 1NUTA 3B52X 4E5UA 2OHVA 1Y8AA 2QUBA 4JVMA 3FGPA 3BCHA 3CWZA 3V7UA 4UAJA 1ZI8A 3TWLA 3O90A 4NRDA 3JQBA 3GPXA 3IJRA 2D7HA 3VAYA 4ALIA 1QANA 3KFVA 1WSDA 3KSDO 5DBGA 4OLAA 2O2SA 1CS4C 4NPAA 3RE1A 3C3BA 1C9KA 5I7AA 4C4YA 3MXOA 1WHSB 3CJTA 2CLDX 2UZ0A 4FLMA 2AKAB 2HWXA 3QZUA 3OY2A 3T5GA 4U39A 1FJXA 4Q3AA 4IBEA 4YRNA 1Q3KA 3U3JA 1DV0A 3RARA 5JBQA 1A8UA 2PXAA 1AE1A 1VXOA 4ND6A 4GPZA 3R8XA 1PFYA 3S7ZA 1ZK2A 4K2AA 3TRKA 3NEJA 3ISVA 4IKOA 5DHSA 2ZIVB 5AI0A 5LA6A 3R44A 2BDEA 1B0PA 2VK2A 1IM2A 3VHRA 1QU2A 3DA8A 4CG2A 3QVSA 3U1BA 3AW9A 3SXPA 5CXXA 3DE2X 5C46F 2QUIA 1Z08A 2R00A 3NASA 1A9PA 4AS3A 3T6PA 2HPZA 5LQUA 4G85A 3TDNA 3LQRA 4ZZ1A 4U2BA 1QO7A 1F2UA 1M2JA 4HRXA 4HAZA 3RS2A 2QX4A 3K16A 4EUKA 1QYWA 1G8AA 5ITTA 2IZ1A 2M1ZA 2FP3A 2MSWA 1I0LA 4W1SA 4UPVA 1CUFA 4YJGA 3I8OA 3W79A 3UANA 4F71A 1UCFA 4LJ4A 4D9NA 1O03A 3U49A 4NECA 5KKNB 3QHPA 2H5LA 4M7PA 3SBJA 2I6XA 2FEPA 3LL7A 3KAJA 4Y3UA 4J90A 1VCHA 2YZMA 5GPBA 2H1OA 2MSCB 1UAAA 1PYOA 2NO9A 5T3YA 2DFDA 1E9RA 2XT9A 4JL5A 3CTPA 1B4DA 2EZTA 2HWKA 4M7WA 2QWXA 1U28C 2L69A 2MSKA 4EJMA 2XUOA 4WFJA 1EXMA 3U56A 1YGYA 1NVBA 2YJ3A 1LPNA 1T3HA 2I55A 3ZVRA 1K8RA 2VWHA 2R5NA 2X0KA 1O94A 1E2LA 4ZU3A 3GW8A 2W6PA 1YBMA 3W6NA 1KU6A 4MVJG 3P2MA 5FOVA 4C01A 4IZHA 1BE1A 2BKAA 2O2HA 4M1QA 2XVZA 5FP0A 4GKKB 2X1HA 4Y1EA 4KN5A 3GPCA 4MDFA 1UBOS 3K0HA 2BEWA 2WVGA 2NX2A 1XPRA 1IZ0A 2IX9A 3MTQA 3VR3A 4P92A 5HIKA 5FNVA 1K9SA 3RLIA 1RRGA 1ESNA 1Z0DA 2CE7A 3HJNA 2BHTA 4W63A 4M6WB 1FVFA 1QHIA 3EPJA 1Z2CA 1SG6A 3AP2A 3I9MA 2E5WA 3C74A 2XB2A 1V9CA 2BLLA 1XDZA 1WLSA 3REOA 4C20A 1Z75A 2V6FA 1J0XO 5CNMA 1QQ6A 1NIJA 1SCQA 1SQFA 1PWHA 1NHGC 1HDYA 1E3IA 3UCFA 4ALKA 4XD7A 3G9XA 1Z39A 3DHEA 4P0PB 3AERB 2FZ5A 4X24A 2DE0X 1NVMA 1UP4A 2P4HX 2XW6A 4YRSA 1MX9A 4HNTA 3WWDA 4DLNA 1S02A 3ELDA 4CHTA 5CVEA 3Q9LA 4MM3B 1B16A 2FEXA 4LOHA 1TD9A 4R01A 1TIBA 4OFBA 1GPWB 4IOLA 3ER6A 4PPFA 3G9TA 2LD4A 2R0QC 2VOJA 3ZHCA 2YY7A 4WKNA 3FIUA 3SC6A 2FGJA 4U2FA 4JI4M 1FZTA 3SZOA 1EVZA 3SHGB 1TRKA 5TGDA 2D5LA 1C1KA 3OTOB 5C7OO 3TR0A 1VPDA 5HDQA 1QGUB 5JEEA 1H6CA 4G1VA 3SYKA 4OIFA 1WS6A 3FROA 1Y6ZA 3UICA 3TNDA 4PGHA 5CVTA 4QICA 3R7SA 1LCIA 3RKRA 1NLFA 1X92A 5AI6A 2WPDA 1RJDA 2J5YA 2IL1A 3IYLW 2ATIA 3H5NA 2GBIA 4ENRA 3IPXA 4DZZA 3CC8A 4IYRA 2YICA 1D8AA 1FS5A 5MGBA 2GTIA 4PSCA 5BN5B 4UVHA 1EUQA 1NMYA 1XA3A 2JWSA 2WM2A 2VJCA 3QLJA 1RR6A 5G1OA 3DTVA 4KYIB 2YBEA 4YDQA 3FWZA 2E2WA 4II3A 1C7EA 4UNPA 2W6CX 5F1KA 3AJAA 3E3NA 3IG8A 3SFVA 1EWTA 3P4YA 1U8ZA 3CURA 3GRVA 3BRQA 4YP9A 4R1NA 3S2EA 5JFGA 3K6KA 2J41A 1Y5NA 1X8XA 2NWQA 2BF7A 5IYZB 1H2AS 1DUIA 4BNLA 3I64A 3O8CA 3REGA 2UU9B 4I6GA 3ZY4A 2QT9A 2VSOA 4D9KA 1TM2A 1HJPA 1M72A 2CV0A 5D3QA 1Z4LA 4GBJA 4XQ9A 3QH4A 3OEEA 3BMQA 3IT2A 4GMKA 1I4LD 1LI7A 4JR0A 1RRMA 1QO0D 4ZEWA 5KQRA 3NLLA 3V4FA 2EERA 4PYMA 1N2OA 5C8XA 2VSQA 4CQNA 1KAQA 4Q01A 1MTOA 4GVLA 1NTOA 3STTA 1PZGA 2EHJA 2CLIB 1ISPA 3TVTA 2R6FA 1SU6A 2IU3A 4AUEA 3HR7A 3NBKA 3UHFA 5JAHA 2FPGA 1PR6A 5DJ5A 1MBZA 2Q9CA 4AKTA 4QOJA 3WI7A 1JB1A 3HP4A 1GUBA 3CM0A 3X1ZA 3D6FA 1U28A 1XD8A 3PHCA 4CTJA 2XRYA 3KU4A 1C7YA 5BR7A 2H2IA 4J7XA 2CMKA 2WUVA 1O97D 5DBIA 4LUCA 3A9SA 3KT6A 4ID9A 4XVHA 4WZBB 2IE8A 1V16B 3E70C 4S05A 4LDQA 4P7BA 1N6RA 4FNAA 3ZCXA 5DPMA 4EPWA 3S2GA 2GB4A 2G9QA 3RSOA 4QXMA 4RGYA 1A5BB 2X5JO 4TPKA 1TJ5A 1CRQA 4AC9A 3O7WA 3SBDA 2C77A 3OLCX 1MJGM 1A88A 5KQ8A 4QGFA 2QSYA 4PZPA 4DUZB 3LWNA 3A6JA 5CVVA 4RWZA 5DHRA 5C8YA 1UFKA 2IOHA 5AXDA 4RH0A 2X0FA 1SOWA 4HNSA 1ZI9A 1NHGA 1B26A 3AUYA 2GZHA 1IVNA 3H04A 4HEA6 3IQFA 3VOSA 1DTSA 2IU6A 2GM4A 4OQDA 1Y1RA 3CLTC 3H18A 5K3DA 2ZRPA 5AR1A 1DBIA 3S2YA 2ACEA 3VR4A 2DLDA 4M0FA 1APBA 1VPEA 4WN3A 2CHGA 2BBSA 4FBGA 4PZDA 1JKJB 4JI1M 2NO4A 2VHXA 2ENWA 2HWWA 4BX0A 1ZN7A 4OI0A 3BXHA 4QGAA 2W2QA 5B7NA 4HBGA 1P4AA 5DCWA 3C5HA 4LXYA 2HEGA 3M4XA 2IC5A 1VKHA 4HRVA 2YVQA 1CIJA 2OO5C 1G7TA 5FBVB 5MDHA 1Z6TA 3IDZA 4B5LA 5LM3A 3T5AA 1SEPA 3N0RA 5JH7B 4A5SA 4PG7A 3DXZA 4BQQA 4LTMA 1E5LA 2PWBA 1BCRB 2PGAA 2GZMA 4EFNA 4A0FA 4PINA 3UMVA 2BWJA 2IEZA 5B5SA 2FK8A 2CLEB 3F8SA 5JLJA 4M9XA 3WDMA 4I8DA 4MCJA 3VMFA 5AHXA 4Z9AA 1VPWA 4DR2B 1W52X 5A3SA 1Z2DA 4B1FA 3RSGA 3FUTA 3EDMA 4I4NA 3BSWA 2HA5A 1Z5NA 3TO5A 3U3OA 1Q0ZA 1YDFA 2P9BA 4LFCM 1YK1A 1ZM3A 4Q4HB 3QW4B 1I30A 5DB4A 2OCLA 4TTQA 3WHIA 3Q3EA 4W6QA 5IS2A 5GIPE 1X7WA 4E13A 5IC4A 1XZMA 2ZRDA 2OAQ1 3CSSA 4NBNA 3KL4A 1JFFA 2VG8A 2GOYA 3RC9A 2VDBB 3BGSA 4MUAA 2QR5A 4ND2A 1NC3A 3OJLA 1A50B 3UGJA 2C4UA 4GRAA 5H8WA 3SSMA 3DBLA 1SUAA 2A5FA 4EFLA 4G24A 2IEGA 2IZ7A 1PDVA 1KI3A 1YVRA 3HSKA 5FA6A 2YHAA 4EAAA 1F0NA 1N2EA 1YJQA 3MB8A 3BRWD 1ZN9A 1TW3A 3F3MA 1D04A 3QQ5A 3EIWA 3EMKA 3BERA 3W0FA 2UVPA 5ARDA 2G1AA 4IUDS 2Z2ZA 3NC1C 2FW8A 2HD4A 5F5LA 3T3PB 3QSYA 2C9CA 4E4TA 4WSOA 4P2GA 1WIWA 1TVKB 1JQ5A 3QVGB 4JLUA 3D3JA 1ZD2P 3CZPA 1E9DA 3FSGD 3ZD7A 2P9JA 2JFXA 3C3XA 4LF6B 3ZH9B 1QZUA 2VCEA 3R6TA 1SIWA 1PNVA 4BMNA 1QLWA 4MINA 4XWOA 4HH4A 1MIOA 1Z0ZA 5JSZA 4RKFA 2DM6A 1WMFA 2AVDA 4HLQB 4JT8A 3GVHA 5ISMA 5ITZB 2FG5A 3AOGA 2PRIA 4M60A 4LNUB 1SZPA 4OAPA 3ODPA 2JIZA 1ZD5A 1L2BA 4DMUB 4PWZA 1QQBA 4D80A 3MJDA 4PO1A 1KAOA 3LQFA 1ATZA 1PFVA 1CJUC 3V76A 1OW3B 2IYZA 5B58C 1F3OA 2AUNA 4HGNA 5DT9A 3BILA 4XJSA 3RG8A 2JI7A 3ZWWA 2QP9X 4AJJA 4KN6A 4UTVA 1DCKA 3KW6A 3K1ZA 4I5EA 2ROQA 1N6OA 4RYDA 1YNOA 3GAFA 4D3ZA 4QDKA 4RHXA 4CCYA 2YL2A 3I5YA 2GWHA 3USZA 3C8MA 1DAEA 1Q44A 4FWBA 1XNQM 3JV7A 3WWZA 2J30A 4EJSC 3ZY6A 2F67A 1QWOA 2CDAA 3C1TA 1TOAA 1HDOA 3Q6IA 3T1YM 2BFCB 4IGKA 4YV1A 1XZGA 3O47A 2X22A 5FEUA 4ACBA 2B4YA 2B8TA 1KK0A 3LQ2A 3RVJA 2W4IA 1PGYA 3CLSD 3N70A 4FCCA 4CKXA 1D0KA 3ZLUA 1IDOA 2OO5A 3EW9A 1F0YA 2K4MA 1V3VA 4BX3A 1DQRA 3JQAA 5D86A 2XVAA 2FW6A 4DCOA 4C05A 4E5VA 3TECE 4CG3A 4DSTA 4L6CA 4J0JA 1F3LA 4X7MA 2H9YA 3EXAA 4O4JF 4XYEA 1Z5WA 4JI7M 4B3SM 2GDZA 1J21A 5TJ9A 4R1OA 2DPYA 3X1DA 1LS1A 2HL6A 4FFSA 4OFWA 3A0UA 1XUOA 3EPRA 3EPHA 3R7WB 1O54A 4ZAWA 1QONA 4IJ6A 4PSUA 3AIIA 2HQRA 3AX6A 2VP9A 4HUTA 3N59A 5I7FA 4IS3A 3JQ8B 3H2GA 1F9AA 2EP5A 3M0EA 1HZZC 1RWKA 1W1IA 3LX4A 4NULA 1P9WA 2AMFA 3UXYA 3R75A 4EZBA 3D4LA 1FRNA 1E6EA 1FXSA 1A9XB 3IAEA 3KTAB 4XXHA 1BGXT 1HT2E 4GEKA 2JAWA 2Y76A 3HHYA 1K4KA 2REBA 3OQIB 1SQ0A 1AGPA 1QVVA 4ARBA 4JQSA 3I1FA 2ZWVA 1I1OA 2K0BX 4NS4A 5K3OA 1GXSA 4U7HA 1P91A 4R8LA 4OJQA 3DDOA 4MV6A 1KHHA 3U6OA 4C3OB 1WBDA 1Z56C 3ZHQA 1IZZA 3O8NA 1LVHA 2QROA 2N3ZA 3SEAA 5F9HA 3T7TA 1NFRA 4D6YA 1W47A 3UKDA 2Q8QA 2BW0A 4URFA 4CN9A 1CP2A 2G08A 3AR5A 3DCIA 4ZOLF 3DNPA 1GZHB 2WKSA 1ZUWA 3F0TA 3LM8A 3M6XA 2P62A 2XXAA 5F12A 2F4VB 4JJZA 3B1VA 5HRAA 5JCOC 4AYWA 3MWDB 2RARA 4I1OA 4PIMA 2NSDA 3KLBA 4G8CA 4CL2A 3LSTA 2R3SA 3WYDA 4JVSB 5KYWA 3SIXA 3THGA 5HE8A 4L28A 2ZUWA 2ABWA 3HGMA 2VNHA 3LUKA 1XMSA 4ZAVA 3HUTA 4TV9B 4U02A 2RGOA 2GXAA 2DFLA 2VQEB 1GCUA 2YNMC 3U6PA 3FIJA 3FN4A 3TD6A 1ZGBA 3L8MA 3WJAA 3MMPA 4YPFA 2XAAA 3NM5A 2NTYC 1YJXA 1WNFA 2FTKE 4OHMA 3EZFA 5IK2D 2H65A 4J3NA 2F1IA 3FNGA 1TAUA 3QITA 2ZYHA 3RYFA 3HJFA 1XE3A 1YB1A 4Q1VA 2GRJA 3INYA 2PUTA 2IPNA 2ZYGA 2X0NA 1IXYA 5DZSA 4MP3A 3ZWVA 4LF4M 2WUDA 3LUFA 4RF0A 2X4DA 3C5CA 1UWKA 2FPOA 3WYCA 3F49S 2PUVA 4NG4A 1GYPA 1HOXA 2JFBA 3EGEA 5CTAA 2CZCA 2WM9B 3Q5EA 3DQZA 2I2CA 3J80A 1RAGA 2DGDA 4U2CA 5HIMA 3MAJA 4HTFB 3GNLA 1DX9A 1WY7A 5H4HA 4GSKA 4WCFC 1BQ3A 2KB0A 4EYQA 4TM8A 1SKMA 2ZAGA 4YREA 2Z7JA 3BXPA 2ORIA 4XIFA 2VK8A 4PYKA 1HMYA 4GEGA 1SZDA 3NBYC 5LJIA 2VP3A 3BN3A 3NRCA 3IAM1 5KYUB 4D3DA 2OB1A 4M21A 2PH3A 1O6GA 1HE4A 3TFQA 3I30X 3NEAA 1WHTB 4Y2VA 4IMRA 2QTCA 2QOEA 4DQXA 1LY1A 2DFNA 3IEKA 5EZ6B 4R1QA 5HZMA 2DTDA 5LUAA 3OO1A 1PT5A 3NBAA 1SKQA 1V4NA 4YGYA 3RYHA 1WBJB 4DIEA 3JR3A 5CFLA 4LX8A 4AU1A 3HABA 1WMBA 2O8CB 3O4IA 3HN6A 3ILXA 3OJWA 5DMHA 3AUAA 1HY3A 2REQB 4P9NA 2Z5VA 4NMHA 2K5UA 2O5RA 2P3QA 3BDAA 3UMJA 1Z59A 3BMXA 3LMMA 2JPDA 3V9AA 2QQGA 3IAUA 5GJBA 5L6LB 4CKWA 5I4IA 4Y9RA 1V45E 4HAVA 4RQTA 1XU9A 1TCVA 4B17A 1JDTA 4EYKA 1GL7A 1RQ7A 1HZZA 4ZZIA 4HCJA 4OQLA 4DC1A 4MW1A 3RW9A 3V4VB 5F9MA 1OZ0A 2GBPA 1KSGA 5A04A 4YR9A 2HRBA 5FT9A 3NALA 3PFBA 2EO2A 3FE3A 4ID3A 4JC0A 3W5SA 1DAPA 1ND6A 2VC2B 3UCXA 1QTIA 2BM0A 1N2SA 4CMHA 5BV8A 4JS0A 3O38A 4CMGA 1GU7A 3IVXA 3I2FA 2OFXA 4EKGA 1Q7EA 3V1TC 1DG3A 1PUIA 3ZBUA 4US1R 3SS8A 4HQ0A 5KIAA 2AZMA 1ODIA 1WDWB 3R0XA 4LSMA 1SIOA 2C5GA 3LRTA 5C7YA 1HLPA 3O4VA 2PUDA 1SUDA 1W1UA 2KZUA