3C9PA

Crystal structure of uncharacterized protein sp1917
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
122
Chain Sequence
NAMSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRDVTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein SP1917.
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SP1917
total genus 45
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09966 DUF2200 Uncharacterized protein conserved in bacteria (DUF2200)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.290 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 uncharacterized protein sp1917 domain 3c9pA00
3C9PA
chains in the Genus database with same CATH superfamily
3I51A 1NHWC 3IG8A 5EP2A 3SFZA 2CV2A 1NNUC 2CRUA 4G4NA 4LF7M 2HL7A 3Q8XA 4GIPA 3F92A 1PJQA 4D80A 4OU7A 2FOIC 3HY5A 2F5PA 4R71A 1Z6TA 1QANA 5LMNM 2Z4RA 2LHGA 3H4MA 2WZJA 1R5LA 1HNWM 3FRIA 2LWXA 2CV1A 3K2LA 4Q7JA 1NJGA 2BNKA 5IZ7D 3CTWB 1GJTA 3GQ4A 2ERCA 2L4EA 2L09A 3B7ZA 2O5RA 3J7BA 4R3DA 1A5TA 2LVOC 1IFYA 4B7GA 4YY3M 4AKHA 1OAOC 4MH0E 4GITA 1NV9A 1VQ1A 2UUBM 2EJSA 4DR5M 3U6DA 2A5YB 4NSOB 5BR8M 4NRWA 4MGZE 1QUSA 3KW6A 4PDGA 2V1UA 1HJPA 4GH9A 1K82A 3ZH9B 1IN4A 1XC8A 2K0BX 1OFIA 2DHRA 3UGJA 1F4IA 4AG6A 2KNVA 2ZTDA 1TH2A 4LFBM 1E32A 4IBFA 2JY7A 3GQ3A 1FNNA 3HWSA 3W68A 4EIWA 2LHCA 3U6MA 3KFUG 4LZJA 4LGMA 4LJ8A 2RRUA 2FNAA 1V33A 2DAMA 2H5XA 4XK8F 4FWDA 2L2DA 3FTFA 3GLHE 3VLFB 3MHVC 3KOZE 4MGKE 4AW4A 1HR0M 1GL6A 4WW0A 3FUXA 1GO5A 5ITRA 4B7FA 1T3TA 3ZQJA 1HT1E 4BB9A 1C1KA 2RKOA 4DV7M 3RGSA 4KLNA 4GKKM 1MX0A 2R44A 4FVMA 3FE3A 3UMMA 2MROB 1TH4A 4JI2M 1HT2E 3R9XB 4CIZA 2BWBA 3GLGE 4LJ6A 4LY6A 4FCVA 3FRHA 3ZC7B 1N36M 1IBLM 4AZFA 3JR4A 3MJ5A 3L28A 2YNMD 3C3DA 5ITYA 3AL0C 1QZMA 2DKLA 3QYBA 2ZAOA 1I4WA 3PVSA 4PDIA 2Y21A 4OX9M 3AOEA 5E6JA 3T15A 5DYIA 2LNHC 4GEWA 3W0LB 2VQEM 2Z8YM 3SMSA 5C18A 5IREB 4ANRA 4CHTB 4DR2M 1E94E 1TF0B 1ZAEA 3E21A 1N75A 1YSYA 1LTMA 2JY5A 3B9PA 4Z6YA 4D82A 2VQFM 2B3TA 3L25A 4L4UA 1L2DA 1Q02A 1Z5AA 1IM2A 5ITXE 2F5SA 2R4JA 1DGHB 2H1RA 3HU1A 3KSXA 1K3XA 2CWBA 4CJ6A 4IBEA 2HHHM 2Z7JA 4HLQA 5ITQA 1PJTA 4ITQA 2MH8A 4B3SM 3AV0A 4JI3M 3U6QA 4A3VB 4RF1A 4AI6A 5E26A 1C7YA 2QZ4A 1WHCA 2UUAM 1BVSA 2HWJA 1ZQ9A 4OVZB 1ZV1A 2O25A 4MB7A 2D7HA 1Y8GA 2WSCF 3L27A 3SASA 4PCZA 4NL4H 4PD2A 2DAKA 4JI6M 4JYAM 4AKGA 2CE7A 3U60B 1W5SA 1WIVA 2R4EA 4LRSA 2JXNA 3U6OA 2F5NA 3M7GA 2EKKA 2QHOB 3SBJA 1OQYA 1MN3A 5EXSA 3D8LA 4B7HA 2UXDM 3DFZA 3PNVA 3VKHA 2UXCM 3K1JA 4LJ7A 3IHPA 4Z8XA 5KPTA 2KXEA 4I81A 3GPXA 2KZSA 2LVPC 1PJJA 7CATA 2R62A 2I7NA 1G71A 3SMPA 2JZ1A 3RE8A 4G3OA 2QENA 5EJCA 3LMMA 4X64M 4JI7M 2L4FA 2LVQD 2KNZA 4KO8A 4XGIA 5JI3E 4DR6M 3J2PB 1OFHA 1XXHE 1HNXM 4LF9M 1GKIA 1QVRA 3HHYA 3ZCBB 4L6V6 1OTRA 5C1BA 2DHYA 2CHGA 4LGYA 3TL4X 1VDDA 3HJQA 5EXTA 4MGYE 1XMOM 2JWSA 3GRYA 3VK8A 1DGGA 1QAOA 2CHVA 2BJWA 3M6AA 1L1ZA 4IBIA 1PJIA 2CV0A 2JA2A 3U61A 2EA0A 3PFIA 2OOBA 1XWIA 3A42A 4DR4M 3VDPA 1AUAA 3GRVA 1XNQM 4ZPXA 1IXZA 2V6ZM 1WGLA 1XHBA 3NBXX 4IBJA 2ZM6M 4LFCM 2YFQA 2C96A 3GLGB 3KS8A 2HAKA 3L2AA 3QWLA 4KHPM 2JUJA 1VG5A 3T1YM 2UU9M 4RNAA 3JAMS 1SXJC 3HJ8A 1GABA 3TE6A 1K3WA 1WXQA 5EP4A 3THGA 1N33M 3B7NA 3R8FA 4QOSA 2DZNB 3VK7A 3VDUA 2X4AA 3A98B 5FLXS 5DFLA 4CGYB 2R0IA 4G6ZA 2HKJA 4YHHM 1YLAA 4LFAM 4KODA 5KQDA 4REZA 3HX3A 1UFZA 1E9RA 5JI2E 4DV6M 5FTKA 3C3EA 1OIZA 4FWGA 5KQ8A 1GL7A 3U6EA 1TR8A 4L78A 3L29A 1JR3D 1J09A 3U6LA 2BJVA 3MK6A 2X8AA 1J5EM 3FUWA 1PM5A 1IN7A 1SXJD 2R6FA 5KO3A 3M0EA 2FFJA 1IXRC 1G59A 4JV5M 1KSFX 3GLIB 3U6SA 1Z59A 2F4VM 1P3QQ 1J7KA 2P5TA 2KA6B 3NBIA 2DWNA 4S12A 1TGUA 4FW9A 3FD9A 3U5ZA 1SXJA 2R45A 1LV7A 4I4LA 2LH0A 4OVZA 3KSJA 2N35A 2EUCA 2XF3A 3PNYA 1JB0F 2KZUA 3FTCA 4WURA 3FTEA 2XZUA 3DZDA 2FE8A 2WSEF 4UN2B 4DUZM 3H4JA 1NHGC 3J80S 1QYRA 2L6OA 1IBMM 1QAQA 1IXSB 3KXEC 2JP7A 4GKJM 4NXNM 4GRIA 4G4QA 1XXHA 3SATA 5FTMA 3SHFA 2D7GA 2GQFA 1HQYE 1HQCA 3SHGB 4G4RA 1N77A 2Z4SA 3FYDA 4IJFA 3T6PA 4P16A 1SXJE 2J7NA 1S3SA 3SARA 4FD2A 4DV4M 1NJFA 2CUZA 2I7PA 3SYKA 4LJAA 3IG5A 1HNZM 3GQ5A 2J5YA 2VF7A 4GMQA 2DWZB 1IN8A 1IN5A 2APLA 3SAWA 2Y20A 1KYIA 1TDZA 2F5QA 3QAUA 2QQ8A 4B08A 1MU5A 4RKUF 3SAUA 4JI5M 3AOGA 4G4OA 1IY1A 4I5SA 4DR7M 1MJGM 3HJSA 3FUUA 3K9PA 5EXXA 3U6PA 2JY6B 4B3MM 2KW0A 3I4YA 4KT0F 3HZJA 4AKIA 2YQZA 3VFDA 2MR9A 2OOAA 1N32M 3NWLA 2M5ZA 3SC3A 4OW0A 3TWMA 1NNJA 3I01M 1R6BX 4LF5M 4IJEA 4BBAA 2JZ0A 2XGNA 4JI0M 3U61B 2Q2EB 4JI8M 2QBYA 3J27B 4B3RM 3DA1A 3HHWA 2Y0QA 5FTJA 2QSFX 5L8RF 1V92A 3E46A 1QZEA 2C99A 3FKEA 1OAIA 2DXIA 4DV5M 1R7RA 8CATA 2JNHA 2KRKA 3K92A 1D0MA 2DAIA 4NOOB 1T43A 2K6BA 1ZMUA 1D2NA 2HCBA 3HU2A 3SAVA 3GLHA 1PJSA 2C98A 2CEAA 1R2YA 2L7HA 1FJGM 3E4RA 1N34M 4M9SA 5FTLA 2XFSA 3LQRA 4HEOA 3CGWA 3ILKA 1JR3E 2KRUA 1QQWA 4M0WA 4CISA 4HL4A 4QNMA 3GLFB 1D0LA 3GP1A 4X65M 4Y28F 4M9ZA 5BPVA 1VEGA 1W5TA 2KDLA 4LRTA 3FTDA 1R4GA 4QHTA 5ITTA 2M60A 1L2BA 2CFOA 2EO2A 2LVAA 4NSRA 3JR5A 3FYCA 4MGHA 3A45A 1PRBA 4BLCA 3KVWA 4B3TM 4AG5A 4LJ5A 1N78A 4M0DA 1ORYB 2DAEA 4XBOA 2E5LM 1YUBA 3LQQA 2Z3XA 3QYEA 4K0KM 2R65A 2DVWB 4NXMM 1IQPA 1DGFA 3U5ZB 3GLHB 4IBGA 2WSFF 2XFTA 2AHMA 3CF6E 2OPFA 1EFUB 1Z5CA 1D0KA 2DENA 2LBCA 1OIPA 3GRRA 1Q39A 1WGNA 4L15A 4NC6A 1GLNA 2DI0A 2FH0A 3FUVA 4W5WA 5FSWA 4MGIE 1G41A 2NQ8C 2X49A 4X62M 1IXSA 2QNJA 5KPZA 3GRUA 4IBKA 3GLFA 4DV1M 4FCTA 3VKGA 2DAGA 3FUTA 4LG2A 4GHLA 1VDLA 4P17A 2QBYB 3SYLA 5A2QS 3AFHA 2KEBA 1CUKA 5EP1A 3C9PA 1OKSA 1WR1B 4DV2M 1I94M 2QPAA 5EQTA 2DZLA 4NRVA 1H6UA 1Q3BA 2K9DA 2O01F 2ZBKB 4FCWA 3LW5F 1QAMA 1DGHA 2MJ5B 2L7IA 2LXEA 1JQJC 2DWMA 1TH3A 5EXPA 4PT5A 1L1TA 3MMPA 3U6CA 3W0FA 4WP2A 1VEJA 4FWHA 2XLJA 1NO1A 4F2LA 2KHHA 1DV0A 3TPZA 4MM3B 1VEKA 5ITXA 4AQYM 4DR3M 1DO0A 1TTEA 3HGIA 1ZMVA 5IWAM 2V1CA 4F1IA 3AKZA 3GLFE 2QCUA 5IT9S 2J7OA 1AIPC 2XZFA 2YR0A 4JN6A 1XNRM 3EIEA 2G5GX 1NSFA 2LVNC 4I8OA 1WJ7A 3KOWE 1XMQM 1IN6A 1QDTA 3DOAA 1L8QA 2QP9X 3I4VA 3J81S 2C9CA 1QDRA 2EKFA 2XSZA 3KDSE 1NY5A 2FS1A 4IBDA 3K8ZA 4L16A 1EE8A 1NY6A 1YE9A 4JI1M 2UXBM 1G4AE 3RGPA 4IBCA 3TWKA 3UZUA 3BBZA 3W67A 2XSZD 1QUTA 2ZTCA 3KOXE 3LCVB 3GLGA 4DV0M 1T6OA 2RGOA 5EP3A 4DR1M 3WHKA 3WHLA 2XH9A 1GVNA 1OJLA 3V76A 2KNAA 2ZANA 1Z5BA 4DUYM 3CF2A 3K9OA 3E9SA 1DO2A 1RU3A 4QOZC 3AJIB 4LJ4A 1V34A 3EIHA 3LVWA 2G3QA 3J7AS 3B7QA 5GKNA 3AOEC 4DBGB 3GPPA 2RGHA 4TUWA 1R2ZA 5H37D 1JR3A 2CP8A 1PGYA 3HHZA 1L2CA 4DV3M 1IBKM 4LJ9A 3CF0A 3GO8A 4LF6M 3GPYA 2Y0TA 3U60A 3Q8GA 1ZMWA 3BXWA 4GC9A 3LCUA 1IY0A 2D7EA 1DGBA 3IECA 1KFVA 4L8RC 2VF8A 2VIIA 4IIWA 1SG9A 3OTOM 4GC5A 3BOSA 3GPUA 1IY2A 2DNAA 2MGWA 3T1HM 2G8LA 2W82A 2C5RA 3GLIA 3UK6A 1E9SA 2JY8A 3HHXA 3PXGA 2K47A 2OO9A 3I04M 4QHSA 3RFWA 1G3IA 1X37A 5F3WA 2CHQA 3TWLA 1EIJA 2VDBB 3UJNA 4LZZA 1NVMA 2UUCM 2DZOB 2BWEA 1XB2B 3D8BA 5LMUM 4LF8M 4LF4M 3KP1E 5ITUA 3KP0E 4M9XA 3KS4A 3HU3A 4X66M 4QNRA 4R7GA 4LCBA 3B89A 2LTUA 2R18A 4D81A 2OQ4A 2C9OA 4II7A 3LVVA 4GHAA 3B74A 5DNYA 2DWLA 1NV8A 1XXHB 3KOYE 1G8PA 1GJSA 4IBBA 1Q3CA 2ZAMA 5FTNA 3C58A 2R46A 1TDHA 3GLIE 3A46A 4JI4M 2F5OA 4RF0A 2XEPA 2GNOA 5DYGA 3T38A 3TQSA 1SXJB 1UM8A 4JXJA 5KPRA 3HKPA 3L26A
chains in the Genus database with same CATH topology
3C9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9P A; 
#chains in the Genus database with same CATH topology
 3I51 A;  1NHW C;  3IG8 A;  5EP2 A;  3SFZ A;  2CV2 A;  1NNU C;  2CRU A;  4G4N A;  4LF7 M;  2HL7 A;  3Q8X A;  4GIP A;  3F92 A;  1PJQ A;  4D80 A;  4OU7 A;  2FOI C;  3HY5 A;  2F5P A;  4R71 A;  1Z6T A;  1QAN A;  5LMN M;  2Z4R A;  2LHG A;  3H4M A;  2WZJ A;  1R5L A;  1HNW M;  3FRI A;  2LWX A;  2CV1 A;  3K2L A;  4Q7J A;  1NJG A;  2BNK A;  5IZ7 D;  3CTW B;  1GJT A;  3GQ4 A;  2ERC A;  2L4E A;  2L09 A;  3B7Z A;  2O5R A;  3J7B A;  4R3D A;  1A5T A;  2LVO C;  1IFY A;  4B7G A;  4YY3 M;  4AKH A;  1OAO C;  4MH0 E;  4GIT A;  1NV9 A;  1VQ1 A;  2UUB M;  2EJS A;  4DR5 M;  3U6D A;  2A5Y B;  4NSO B;  5BR8 M;  4NRW A;  4MGZ E;  1QUS A;  3KW6 A;  4PDG A;  2V1U A;  1HJP A;  4GH9 A;  1K82 A;  3ZH9 B;  1IN4 A;  1XC8 A;  2K0B X;  1OFI A;  2DHR A;  3UGJ A;  1F4I A;  4AG6 A;  2KNV A;  2ZTD A;  1TH2 A;  4LFB M;  1E32 A;  4IBF A;  2JY7 A;  3GQ3 A;  1FNN A;  3HWS A;  3W68 A;  4EIW A;  2LHC A;  3U6M A;  3KFU G;  4LZJ A;  4LGM A;  4LJ8 A;  2RRU A;  2FNA A;  1V33 A;  2DAM A;  2H5X A;  4XK8 F;  4FWD A;  2L2D A;  3FTF A;  3GLH E;  3VLF B;  3MHV C;  3KOZ E;  4MGK E;  4AW4 A;  1HR0 M;  1GL6 A;  4WW0 A;  3FUX A;  1GO5 A;  5ITR A;  4B7F A;  1T3T A;  3ZQJ A;  1HT1 E;  4BB9 A;  1C1K A;  2RKO A;  4DV7 M;  3RGS A;  4KLN A;  4GKK M;  1MX0 A;  2R44 A;  4FVM A;  3FE3 A;  3UMM A;  2MRO B;  1TH4 A;  4JI2 M;  1HT2 E;  3R9X B;  4CIZ A;  2BWB A;  3GLG E;  4LJ6 A;  4LY6 A;  4FCV A;  3FRH A;  3ZC7 B;  1N36 M;  1IBL M;  4AZF A;  3JR4 A;  3MJ5 A;  3L28 A;  2YNM D;  3C3D A;  5ITY A;  3AL0 C;  1QZM A;  2DKL A;  3QYB A;  2ZAO A;  1I4W A;  3PVS A;  4PDI A;  2Y21 A;  4OX9 M;  3AOE A;  5E6J A;  3T15 A;  5DYI A;  2LNH C;  4GEW A;  3W0L B;  2VQE M;  2Z8Y M;  3SMS A;  5C18 A;  5IRE B;  4ANR A;  4CHT B;  4DR2 M;  1E94 E;  1TF0 B;  1ZAE A;  3E21 A;  1N75 A;  1YSY A;  1LTM A;  2JY5 A;  3B9P A;  4Z6Y A;  4D82 A;  2VQF M;  2B3T A;  3L25 A;  4L4U A;  1L2D A;  1Q02 A;  1Z5A A;  1IM2 A;  5ITX E;  2F5S A;  2R4J A;  1DGH B;  2H1R A;  3HU1 A;  3KSX A;  1K3X A;  2CWB A;  4CJ6 A;  4IBE A;  2HHH M;  2Z7J A;  4HLQ A;  5ITQ A;  1PJT A;  4ITQ A;  2MH8 A;  4B3S M;  3AV0 A;  4JI3 M;  3U6Q A;  4A3V B;  4RF1 A;  4AI6 A;  5E26 A;  1C7Y A;  2QZ4 A;  1WHC A;  2UUA M;  1BVS A;  2HWJ A;  1ZQ9 A;  4OVZ B;  1ZV1 A;  2O25 A;  4MB7 A;  2D7H A;  1Y8G A;  2WSC F;  3L27 A;  3SAS A;  4PCZ A;  4NL4 H;  4PD2 A;  2DAK A;  4JI6 M;  4JYA M;  4AKG A;  2CE7 A;  3U60 B;  1W5S A;  1WIV A;  2R4E A;  4LRS A;  2JXN A;  3U6O A;  2F5N A;  3M7G A;  2EKK A;  2QHO B;  3SBJ A;  1OQY A;  1MN3 A;  5EXS A;  3D8L A;  4B7H A;  2UXD M;  3DFZ A;  3PNV A;  3VKH A;  2UXC M;  3K1J A;  4LJ7 A;  3IHP A;  4Z8X A;  5KPT A;  2KXE A;  4I81 A;  3GPX A;  2KZS A;  2LVP C;  1PJJ A;  7CAT A;  2R62 A;  2I7N A;  1G71 A;  3SMP A;  2JZ1 A;  3RE8 A;  4G3O A;  2QEN A;  5EJC A;  3LMM A;  4X64 M;  4JI7 M;  2L4F A;  2LVQ D;  2KNZ A;  4KO8 A;  4XGI A;  5JI3 E;  4DR6 M;  3J2P B;  1OFH A;  1XXH E;  1HNX M;  4LF9 M;  1GKI A;  1QVR A;  3HHY A;  3ZCB B;  4L6V 6;  1OTR A;  5C1B A;  2DHY A;  2CHG A;  4LGY A;  3TL4 X;  1VDD A;  3HJQ A;  5EXT A;  4MGY E;  1XMO M;  2JWS A;  3GRY A;  3VK8 A;  1DGG A;  1QAO A;  2CHV A;  2BJW A;  3M6A A;  1L1Z A;  4IBI A;  1PJI A;  2CV0 A;  2JA2 A;  3U61 A;  2EA0 A;  3PFI A;  2OOB A;  1XWI A;  3A42 A;  4DR4 M;  3VDP A;  1AUA A;  3GRV A;  1XNQ M;  4ZPX A;  1IXZ A;  2V6Z M;  1WGL A;  1XHB A;  3NBX X;  4IBJ A;  2ZM6 M;  4LFC M;  2YFQ A;  2C96 A;  3GLG B;  3KS8 A;  2HAK A;  3L2A A;  3QWL A;  4KHP M;  2JUJ A;  1VG5 A;  3T1Y M;  2UU9 M;  4RNA A;  3JAM S;  1SXJ C;  3HJ8 A;  1GAB A;  3TE6 A;  1K3W A;  1WXQ A;  5EP4 A;  3THG A;  1N33 M;  3B7N A;  3R8F A;  4QOS A;  2DZN B;  3VK7 A;  3VDU A;  2X4A A;  3A98 B;  5FLX S;  5DFL A;  4CGY B;  2R0I A;  4G6Z A;  2HKJ A;  4YHH M;  1YLA A;  4LFA M;  4KOD A;  5KQD A;  4REZ A;  3HX3 A;  1UFZ A;  1E9R A;  5JI2 E;  4DV6 M;  5FTK A;  3C3E A;  1OIZ A;  4FWG A;  5KQ8 A;  1GL7 A;  3U6E A;  1TR8 A;  4L78 A;  3L29 A;  1JR3 D;  1J09 A;  3U6L A;  2BJV A;  3MK6 A;  2X8A A;  1J5E M;  3FUW A;  1PM5 A;  1IN7 A;  1SXJ D;  2R6F A;  5KO3 A;  3M0E A;  2FFJ A;  1IXR C;  1G59 A;  4JV5 M;  1KSF X;  3GLI B;  3U6S A;  1Z59 A;  2F4V M;  1P3Q Q;  1J7K A;  2P5T A;  2KA6 B;  3NBI A;  2DWN A;  4S12 A;  1TGU A;  4FW9 A;  3FD9 A;  3U5Z A;  1SXJ A;  2R45 A;  1LV7 A;  4I4L A;  2LH0 A;  4OVZ A;  3KSJ A;  2N35 A;  2EUC A;  2XF3 A;  3PNY A;  1JB0 F;  2KZU A;  3FTC A;  4WUR A;  3FTE A;  2XZU A;  3DZD A;  2FE8 A;  2WSE F;  4UN2 B;  4DUZ M;  3H4J A;  1NHG C;  3J80 S;  1QYR A;  2L6O A;  1IBM M;  1QAQ A;  1IXS B;  3KXE C;  2JP7 A;  4GKJ M;  4NXN M;  4GRI A;  4G4Q A;  1XXH A;  3SAT A;  5FTM A;  3SHF A;  2D7G A;  2GQF A;  1HQY E;  1HQC A;  3SHG B;  4G4R A;  1N77 A;  2Z4S A;  3FYD A;  4IJF A;  3T6P A;  4P16 A;  1SXJ E;  2J7N A;  1S3S A;  3SAR A;  4FD2 A;  4DV4 M;  1NJF A;  2CUZ A;  2I7P A;  3SYK A;  4LJA A;  3IG5 A;  1HNZ M;  3GQ5 A;  2J5Y A;  2VF7 A;  4GMQ A;  2DWZ B;  1IN8 A;  1IN5 A;  2APL A;  3SAW A;  2Y20 A;  1KYI A;  1TDZ A;  2F5Q A;  3QAU A;  2QQ8 A;  4B08 A;  1MU5 A;  4RKU F;  3SAU A;  4JI5 M;  3AOG A;  4G4O A;  1IY1 A;  4I5S A;  4DR7 M;  1MJG M;  3HJS A;  3FUU A;  3K9P A;  5EXX A;  3U6P A;  2JY6 B;  4B3M M;  2KW0 A;  3I4Y A;  4KT0 F;  3HZJ A;  4AKI A;  2YQZ A;  3VFD A;  2MR9 A;  2OOA A;  1N32 M;  3NWL A;  2M5Z A;  3SC3 A;  4OW0 A;  3TWM A;  1NNJ A;  3I01 M;  1R6B X;  4LF5 M;  4IJE A;  4BBA A;  2JZ0 A;  2XGN A;  4JI0 M;  3U61 B;  2Q2E B;  4JI8 M;  2QBY A;  3J27 B;  4B3R M;  3DA1 A;  3HHW A;  2Y0Q A;  5FTJ A;  2QSF X;  5L8R F;  1V92 A;  3E46 A;  1QZE A;  2C99 A;  3FKE A;  1OAI A;  2DXI A;  4DV5 M;  1R7R A;  8CAT A;  2JNH A;  2KRK A;  3K92 A;  1D0M A;  2DAI A;  4NOO B;  1T43 A;  2K6B A;  1ZMU A;  1D2N A;  2HCB A;  3HU2 A;  3SAV A;  3GLH A;  1PJS A;  2C98 A;  2CEA A;  1R2Y A;  2L7H A;  1FJG M;  3E4R A;  1N34 M;  4M9S A;  5FTL A;  2XFS A;  3LQR A;  4HEO A;  3CGW A;  3ILK A;  1JR3 E;  2KRU A;  1QQW A;  4M0W A;  4CIS A;  4HL4 A;  4QNM A;  3GLF B;  1D0L A;  3GP1 A;  4X65 M;  4Y28 F;  4M9Z A;  5BPV A;  1VEG A;  1W5T A;  2KDL A;  4LRT A;  3FTD A;  1R4G A;  4QHT A;  5ITT A;  2M60 A;  1L2B A;  2CFO A;  2EO2 A;  2LVA A;  4NSR A;  3JR5 A;  3FYC A;  4MGH A;  3A45 A;  1PRB A;  4BLC A;  3KVW A;  4B3T M;  4AG5 A;  4LJ5 A;  1N78 A;  4M0D A;  1ORY B;  2DAE A;  4XBO A;  2E5L M;  1YUB A;  3LQQ A;  2Z3X A;  3QYE A;  4K0K M;  2R65 A;  2DVW B;  4NXM M;  1IQP A;  1DGF A;  3U5Z B;  3GLH B;  4IBG A;  2WSF F;  2XFT A;  2AHM A;  3CF6 E;  2OPF A;  1EFU B;  1Z5C A;  1D0K A;  2DEN A;  2LBC A;  1OIP A;  3GRR A;  1Q39 A;  1WGN A;  4L15 A;  4NC6 A;  1GLN A;  2DI0 A;  2FH0 A;  3FUV A;  4W5W A;  5FSW A;  4MGI E;  1G41 A;  2NQ8 C;  2X49 A;  4X62 M;  1IXS A;  2QNJ A;  5KPZ A;  3GRU A;  4IBK A;  3GLF A;  4DV1 M;  4FCT A;  3VKG A;  2DAG A;  3FUT A;  4LG2 A;  4GHL A;  1VDL A;  4P17 A;  2QBY B;  3SYL A;  5A2Q S;  3AFH A;  2KEB A;  1CUK A;  5EP1 A;  3C9P A;  1OKS A;  1WR1 B;  4DV2 M;  1I94 M;  2QPA A;  5EQT A;  2DZL A;  4NRV A;  1H6U A;  1Q3B A;  2K9D A;  2O01 F;  2ZBK B;  4FCW A;  3LW5 F;  1QAM A;  1DGH A;  2MJ5 B;  2L7I A;  2LXE A;  1JQJ C;  2DWM A;  1TH3 A;  5EXP A;  4PT5 A;  1L1T A;  3MMP A;  3U6C A;  3W0F A;  4WP2 A;  1VEJ A;  4FWH A;  2XLJ A;  1NO1 A;  4F2L A;  2KHH A;  1DV0 A;  3TPZ A;  4MM3 B;  1VEK A;  5ITX A;  4AQY M;  4DR3 M;  1DO0 A;  1TTE A;  3HGI A;  1ZMV A;  5IWA M;  2V1C A;  4F1I A;  3AKZ A;  3GLF E;  2QCU A;  5IT9 S;  2J7O A;  1AIP C;  2XZF A;  2YR0 A;  4JN6 A;  1XNR M;  3EIE A;  2G5G X;  1NSF A;  2LVN C;  4I8O A;  1WJ7 A;  3KOW E;  1XMQ M;  1IN6 A;  1QDT A;  3DOA A;  1L8Q A;  2QP9 X;  3I4V A;  3J81 S;  2C9C A;  1QDR A;  2EKF A;  2XSZ A;  3KDS E;  1NY5 A;  2FS1 A;  4IBD A;  3K8Z A;  4L16 A;  1EE8 A;  1NY6 A;  1YE9 A;  4JI1 M;  2UXB M;  1G4A E;  3RGP A;  4IBC A;  3TWK A;  3UZU A;  3BBZ A;  3W67 A;  2XSZ D;  1QUT A;  2ZTC A;  3KOX E;  3LCV B;  3GLG A;  4DV0 M;  1T6O A;  2RGO A;  5EP3 A;  4DR1 M;  3WHK A;  3WHL A;  2XH9 A;  1GVN A;  1OJL A;  3V76 A;  2KNA A;  2ZAN A;  1Z5B A;  4DUY M;  3CF2 A;  3K9O A;  3E9S A;  1DO2 A;  1RU3 A;  4QOZ C;  3AJI B;  4LJ4 A;  1V34 A;  3EIH A;  3LVW A;  2G3Q A;  3J7A S;  3B7Q A;  5GKN A;  3AOE C;  4DBG B;  3GPP A;  2RGH A;  4TUW A;  1R2Z A;  5H37 D;  1JR3 A;  2CP8 A;  1PGY A;  3HHZ A;  1L2C A;  4DV3 M;  1IBK M;  4LJ9 A;  3CF0 A;  3GO8 A;  4LF6 M;  3GPY A;  2Y0T A;  3U60 A;  3Q8G A;  1ZMW A;  3BXW A;  4GC9 A;  3LCU A;  1IY0 A;  2D7E A;  1DGB A;  3IEC A;  1KFV A;  4L8R C;  2VF8 A;  2VII A;  4IIW A;  1SG9 A;  3OTO M;  4GC5 A;  3BOS A;  3GPU A;  1IY2 A;  2DNA A;  2MGW A;  3T1H M;  2G8L A;  2W82 A;  2C5R A;  3GLI A;  3UK6 A;  1E9S A;  2JY8 A;  3HHX A;  3PXG A;  2K47 A;  2OO9 A;  3I04 M;  4QHS A;  3RFW A;  1G3I A;  1X37 A;  5F3W A;  2CHQ A;  3TWL A;  1EIJ A;  2VDB B;  3UJN A;  4LZZ A;  1NVM A;  2UUC M;  2DZO B;  2BWE A;  1XB2 B;  3D8B A;  5LMU M;  4LF8 M;  4LF4 M;  3KP1 E;  5ITU A;  3KP0 E;  4M9X A;  3KS4 A;  3HU3 A;  4X66 M;  4QNR A;  4R7G A;  4LCB A;  3B89 A;  2LTU A;  2R18 A;  4D81 A;  2OQ4 A;  2C9O A;  4II7 A;  3LVV A;  4GHA A;  3B74 A;  5DNY A;  2DWL A;  1NV8 A;  1XXH B;  3KOY E;  1G8P A;  1GJS A;  4IBB A;  1Q3C A;  2ZAM A;  5FTN A;  3C58 A;  2R46 A;  1TDH A;  3GLI E;  3A46 A;  4JI4 M;  2F5O A;  4RF0 A;  2XEP A;  2GNO A;  5DYG A;  3T38 A;  3TQS A;  1SXJ B;  1UM8 A;  4JXJ A;  5KPR A;  3HKP A;  3L26 A; 
#chains in the Genus database with same CATH homology
 3C9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...