3C9PA

Crystal structure of uncharacterized protein sp1917
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
122
Chain Sequence
NAMSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRDVTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein SP1917.
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SP1917
total genus 45
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09966 DUF2200 Uncharacterized protein conserved in bacteria (DUF2200)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.290 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 uncharacterized protein sp1917 domain 3c9pA00
3C9PA
chains in the Genus database with same CATH superfamily
3JR5A 1IQPA 2O25A 4LZJA 2DWZB 2L7IA 4GEWA 5KQ8A 1D0KA 1NV8A 2YNMD 4JI3M 3TL4X 4AZFA 2XFSA 4JYAM 1QAOA 2I7NA 3PVSA 1AUAA 2QP9X 1T6OA 2EUCA 2ZM6M 2QQ8A 4IIWA 1IN7A 4LF7M 1EFUB 3A42A 3K92A 4P17A 3M7GA 2UUCM 3I51A 2ZTCA 3V76A 4YY3M 4NOOB 3M6AA 4QNMA 2JWSA 1WGLA 3B9PA 1QYRA 1XXHA 2LNHC 4LJ9A 4PT5A 1MU5A 1XMQM 3QAUA 1L2CA 2Y0QA 1FJGM 2X49A 2E5LM 2D7GA 5ITQA 3E4RA 5F3WA 1GL7A 2HCBA 2C98A 4R7GA 4B3TM 3W0FA 4MGIE 1UM8A 1PJIA 3LVVA 1R4GA 3KVWA 3ZC7B 3U5ZB 3U6PA 3SARA 2QNJA 1IXZA 1J5EM 2VF7A 2K0BX 1IBKM 2Y20A 3KSXA 3FUTA 2L2DA 4G3OA 2DXIA 4LFBM 1X37A 3SC3A 4LFCM 4K0KM 4LRTA 2RGHA 4AKHA 1PRBA 1V34A 3U6SA 2DZLA 3VLFB 2M5ZA 4FW9A 4B3MM 4KLNA 4D80A 2EO2A 4LJ8A 3HWSA 2FH0A 4LJ7A 4A3VB 5ITUA 2P5TA 2DKLA 2F5QA 1QAQA 2X8AA 2DI0A 4MGHA 3KP1E 5ITRA 1QAMA 5KPZA 3CF2A 2W82A 4DV1M 4W5WA 3RGPA 3UGJA 5GKNA 3GLFE 1XWIA 5DYIA 1QUTA 1IBLM 2R46A 3W68A 2K47A 4GC5A 3U60A 4NSRA 2G5GX 2HWJA 3OTOM 4KT0F 1ZMWA 1ZQ9A 1WIVA 2KNZA 4OVZB 3SMPA 4ANRA 4D81A 3U6EA 3U6LA 3K9PA 1Z59A 2QBYB 2MGWA 5FLXS 4Z8XA 1OFIA 3LVWA 2UXDM 3BXWA 3R8FA 4OW0A 2QSFX 1GO5A 1IFYA 2DENA 1IY1A 3SAUA 5L8RF 4B3SM 5ITXA 2HL7A 1WR1B 4MM3B 1QUSA 3WHKA 5A2QS 3LMMA 1QZMA 2Z4RA 4MH0E 1T43A 3A98B 3GLIB 3L25A 1SXJB 4FCVA 3C58A 3SASA 1ZMVA 1EE8A 4FCWA 4IBJA 1MJGM 1IY0A 3FRIA 3HJQA 1SXJE 4JV5M 3AFHA 2JY5A 3L2AA 4L15A 4AG6A 2CV1A 3IECA 2OO9A 4LJ4A 2CWBA 4IBFA 1QDRA 5IZ7D 1OIPA 3IG8A 3LCUA 4MGYE 3B7QA 4G4QA 4NC6A 4AW4A 2G8LA 2WSCF 1N75A 3E46A 2L4EA 2VQFM 2UU9M 2JY8A 3FUXA 3HHWA 3Q8XA 3A45A 2X4AA 3KOWE 1R2ZA 1SXJA 3E9SA 3AJIB 4DV2M 1IBMM 1QZEA 4JI8M 2L4FA 3HU1A 3GLGB 1C7YA 2MJ5B 2LVOC 2R65A 3DA1A 3THGA 2CV2A 1E32A 4OX9M 4I81A 5ITYA 1HNXM 1I94M 2QHOB 2DAGA 3NWLA 2DAKA 2Z7JA 1L2BA 1XMOM 2Q2EB 2LXEA 3SBJA 2C9OA 3VK7A 1HNWM 5H37D 1R2YA 3SATA 3C9PA 3HJSA 4OVZA 4PD2A 1KYIA 2EA0A 2XZUA 3U60B 2BJVA 2DNAA 2V6ZM 3LQQA 3T6PA 2LVQD 2R62A 1OIZA 4LCBA 3EIHA 2ZAMA 4GC9A 3PNYA 3BBZA 3UK6A 3FUWA 4DV6M 1N36M 1G71A 4NXMM 1LV7A 3FTCA 3FRHA 4B08A 5EJCA 4PCZA 3U61B 1NVMA 2R0IA 4L6V6 2Z4SA 3QWLA 3SFZA 5IWAM 4DR5M 1N33M 2DWNA 3KS4A 2UXBM 2H1RA 1YUBA 4JI0M 3HU3A 3GRVA 4FWDA 2BJWA 2D7HA 2KDLA 2JXNA 4R71A 2UUBM 4L16A 4LF8M 4FCTA 4B3RM 1Q02A 1TTEA 1NY6A 2XLJA 2FE8A 1WXQA 1HQCA 2R6FA 4F2LA 2Z8YM 4OU7A 2R4EA 3GLIE 3B7NA 3VKHA 1ORYB 3AOEA 1QVRA 3K1JA 4LF5M 1V33A 4WW0A 1S3SA 3GPUA 5FSWA 1G41A 1VDDA 3FE3A 4QHSA 2RKOA 2FS1A 2CFOA 1CUKA 5KQDA 4F1IA 1OAOC 3B89A 3GRRA 3GPXA 4RF0A 1SXJC 5IREB 4DV5M 1E9RA 1D0LA 3TQSA 4R3DA 3FTDA 3MJ5A 3TWLA 1NJGA 3HKPA 4NRVA 3T1YM 1PJSA 2L6OA 2KW0A 3LW5F 1R6BX 4GMQA 3F92A 2XZFA 1DGFA 2R45A 4DR2M 1NNUC 1XHBA 1ZV1A 3GRUA 5FTLA 3RE8A 3SYLA 2XSZA 3R9XB 1DGBA 3TPZA 1DGHA 5BPVA 2KRKA 1NO1A 2APLA 2GQFA 4HEOA 1D0MA 1E94E 3TWKA 2CP8A 2ZANA 3I04M 2DHYA 4LZZA 3EIEA 2L7HA 1D2NA 3L29A 1RU3A 2K6BA 3NBXX 2F4VM 2HAKA 3VDPA 2LBCA 5FTJA 4LGMA 2YR0A 4Z6YA 1MX0A 3AOGA 4IBIA 3U6CA 1OQYA 1K3XA 3AL0C 4DR7M 4DR6M 4LJ5A 1IN5A 1IXSA 1Q39A 2B3TA 1PJQA 1PJJA 2LVPC 4L78A 1NHWC 1NY5A 3HJ8A 4IBBA 2F5SA 3SMSA 4KHPM 1YE9A 4DUYM 4I4LA 2EKKA 4M0DA 2WZJA 3KOYE 4MB7A 4AKIA 2J7OA 2ERCA 3MHVC 1OFHA 4CJ6A 3U6OA 2EJSA 1KFVA 4M0WA 4X64M 1HNZM 1XNQM 1F4IA 2D7EA 1J09A 1DGHB 2R18A 1OTRA 3PNVA 3UJNA 4LF4M 3GLHE 1L2DA 4DR4M 2JY6B 2FFJA 1DO2A 4JI5M 4HL4A 2DAEA 2BWBA 4LRSA 1Q3BA 3ZCBB 4D82A 2JZ1A 2DZOB 5LMUM 2JNHA 1Z5AA 3UZUA 3M0EA 3ZH9B 1GKIA 4II7A 4LGYA 3FUUA 4X65M 5IT9S 2LVNC 1ZAEA 3T15A 4NXNM 3K9OA 8CATA 2HKJA 3W0LB 3GQ3A 1QQWA 1HT2E 5EP3A 1PGYA 2VDBB 1L1ZA 3J7BA 3SAVA 4I8OA 1QDTA 3A46A 2MR9A 3UMMA 3B7ZA 1Q3CA 3KDSE 1JR3A 4DV4M 3GLGE 3BOSA 3VK8A 2ZTDA 3TE6A 4MGKE 5EXXA 3CF6E 3U6QA 1TR8A 4WURA 3IG5A 4DR1M 3LQRA 2LTUA 4JN6A 4RNAA 2EKFA 3PFIA 2GNOA 2CHGA 3J81S 3GPPA 2C96A 1NNJA 2CHQA 1IXRC 1GLNA 3KSJA 4BB9A 4PDGA 4CHTB 1OAIA 1SG9A 3FD9A 4CIZA 2OOAA 2WSEF 4ITQA 2OQ4A 1VEJA 1G4AE 3J7AS 2DAMA 1TF0B 4GH9A 1I4WA 1L8QA 3U61A 1TH4A 3KXEC 2I7PA 4Y28F 5JI2E 3CF0A 3PXGA 2RRUA 1HQYE 1WHCA 4IBEA 2LWXA 3W67A 2V1UA 3GO8A 2G3QA 1R7RA 2KZUA 5LMNM 5FTMA 2JUJA 2QZ4A 2OOBA 4DV7M 1VEGA 2NQ8C 5E6JA 2CEAA 2BNKA 3HZJA 2LHGA 4EIWA 5C18A 1N77A 1VDLA 2C99A 1WJ7A 3E21A 1TH2A 2VIIA 2QCUA 4G4RA 3SAWA 4HLQA 1VQ1A 1JR3D 1WGNA 1DO0A 2R4JA 2ZBKB 3FUVA 4B7HA 2JZ0A 1AIPC 3ZQJA 2XSZD 3K8ZA 3JR4A 3FTEA 3HGIA 3AOEC 3IHPA 3GLGA 2F5NA 4AI6A 1DGGA 4KODA 1NHGC 1W5SA 2YFQA 5EXTA 3VDUA 2FOIC 4KO8A 3SHFA 5BR8M 1L1TA 4GHAA 4DV3M 1HJPA 3GLHB 1E9SA 1P3QQ 1XC8A 1HT1E 1Y8GA 4UN2B 3MK6A 4IBCA 3RFWA 1IY2A 3DOAA 1VG5A 4GIPA 5DFLA 2XEPA 2CUZA 4REZA 1IN8A 4M9SA 2OPFA 1NSFA 1KSFX 1OJLA 5DNYA 2M60A 2AHMA 2LH0A 4M9ZA 3GLIA 3CGWA 4B7GA 2JY7A 1XXHE 2J7NA 1W5TA 4LY6A 4BBAA 3GPYA 2DWLA 3HU2A 1V92A 1Z5BA 4QHTA 4IBKA 3AKZA 2WSFF 4LJAA 3D8BA 1IN6A 2DZNB 2LHCA 3L27A 4IBGA 3K2LA 3FYCA 5EP4A 3HHYA 4ZPXA 1GL6A 3RGSA 1T3TA 5JI3E 2QBYA 2CHVA 4DR3M 1YSYA 1GVNA 3WHLA 3GQ5A 4GKKM 3HY5A 2KEBA 1ZMUA 5C1BA 1SXJD 3SHGB 4LG2A 2QENA 2FNAA 3DZDA 4FWGA 3VFDA 1G59A 3QYEA 4S12A 2CE7A 1C1KA 4IJEA 5EP1A 2XH9A 3CTWB 3GLHA 3I01M 4AQYM 2LVAA 4TUWA 1DV0A 3T38A 3FTFA 1PM5A 3KOZE 1NJFA 3NBIA 2RGOA 1G8PA 5FTKA 4CISA 2CRUA 4QOZC 4RKUF 2MROB 2J5YA 3I4VA 5EP2A 4DBGB 3DFZA 4GITA 4GKJM 4P16A 4LFAM 4JI4M 1TH3A 3T1HM 2DWMA 2XGNA 4AKGA 3KFUG 1TGUA 4RF1A 4Q7JA 4G6ZA 4WP2A 2F5OA 2KA6B 2KXEA 2C5RA 4JI1M 3TWMA 1JQJC 3U5ZA 2XFTA 4L8RC 2DVWB 4JI6M 1R5LA 4X62M 2R44A 1IM2A 4MGZE 2VF8A 3Q8GA 2QPAA 1J7KA 2MH8A 4B7FA 1JB0F 2A5YB 2O01F 4DV0M 1OKSA 2HHHM 3MMPA 5EXSA 3U6DA 4LJ6A 4NSOB 1Z5CA 3C3EA 1XXHB 3H4JA 5KO3A 7CATA 2L09A 4GHLA 3HX3A 1MN3A 4JI7M 1N78A 2KHHA 1IN4A 2BWEA 3C3DA 1XNRM 4CGYB 2F5PA 1NV9A 1G3IA 2O5RA 1K82A 1HR0M 5ITTA 2DAIA 3J2PB 1EIJA 2ZAOA 5DYGA 3VKGA 1GJSA 2KNAA 4PDIA 3B74A 3JAMS 3L26A 1N32M 2KRUA 4JI2M 3J80S 3KP0E 2JA2A 2K9DA 4G4NA 4NL4H 3KW6A 3HHZA 3SYKA 3L28A 4NRWA 4XGIA 2Y0TA 4IJFA 1GABA 4QOSA 4QNRA 4L4UA 2H5XA 1VEKA 4GRIA 3I4YA 1GJTA 2XF3A 4XBOA 5KPTA 2Z3XA 1TDHA 3FKEA 1UFZA 1XB2B 3H4MA 3KOXE 4AG5A 3FYDA 2UXCM 4FWHA 1QANA 1PJTA 1A5TA 4G4OA 1LTMA 4XK8F 3QYBA 4JXJA 5KPRA 4FD2A 3D8LA 1N34M 1JR3E 3ILKA 4LF6M 3GQ4A 4BLCA 4YHHM 3GLFA 4IBDA 3GLFB 3J27B 4I5SA 4M9XA 3GRYA 1Z6TA 4DUZM 1TDZA 2C9CA 2KNVA 4LF9M 2N35A 4FVMA 4X66M 2CV0A 3KS8A 2DHRA 1H6UA 2Y21A 3LCVB 2JP7A 2UUAM 3GP1A 1BVSA 1YLAA 2VQEM 1FNNA 2YQZA 3HHXA 3AV0A 5FTNA 3U6MA 2V1CA 5EXPA 5EQTA 5E26A 1IXSB 2KZSA 1K3WA 5ITXE
chains in the Genus database with same CATH topology
3C9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9P A; 
#chains in the Genus database with same CATH topology
 3JR5 A;  1IQP A;  2O25 A;  4LZJ A;  2DWZ B;  2L7I A;  4GEW A;  5KQ8 A;  1D0K A;  1NV8 A;  2YNM D;  4JI3 M;  3TL4 X;  4AZF A;  2XFS A;  4JYA M;  1QAO A;  2I7N A;  3PVS A;  1AUA A;  2QP9 X;  1T6O A;  2EUC A;  2ZM6 M;  2QQ8 A;  4IIW A;  1IN7 A;  4LF7 M;  1EFU B;  3A42 A;  3K92 A;  4P17 A;  3M7G A;  2UUC M;  3I51 A;  2ZTC A;  3V76 A;  4YY3 M;  4NOO B;  3M6A A;  4QNM A;  2JWS A;  1WGL A;  3B9P A;  1QYR A;  1XXH A;  2LNH C;  4LJ9 A;  4PT5 A;  1MU5 A;  1XMQ M;  3QAU A;  1L2C A;  2Y0Q A;  1FJG M;  2X49 A;  2E5L M;  2D7G A;  5ITQ A;  3E4R A;  5F3W A;  1GL7 A;  2HCB A;  2C98 A;  4R7G A;  4B3T M;  3W0F A;  4MGI E;  1UM8 A;  1PJI A;  3LVV A;  1R4G A;  3KVW A;  3ZC7 B;  3U5Z B;  3U6P A;  3SAR A;  2QNJ A;  1IXZ A;  1J5E M;  2VF7 A;  2K0B X;  1IBK M;  2Y20 A;  3KSX A;  3FUT A;  2L2D A;  4G3O A;  2DXI A;  4LFB M;  1X37 A;  3SC3 A;  4LFC M;  4K0K M;  4LRT A;  2RGH A;  4AKH A;  1PRB A;  1V34 A;  3U6S A;  2DZL A;  3VLF B;  2M5Z A;  4FW9 A;  4B3M M;  4KLN A;  4D80 A;  2EO2 A;  4LJ8 A;  3HWS A;  2FH0 A;  4LJ7 A;  4A3V B;  5ITU A;  2P5T A;  2DKL A;  2F5Q A;  1QAQ A;  2X8A A;  2DI0 A;  4MGH A;  3KP1 E;  5ITR A;  1QAM A;  5KPZ A;  3CF2 A;  2W82 A;  4DV1 M;  4W5W A;  3RGP A;  3UGJ A;  5GKN A;  3GLF E;  1XWI A;  5DYI A;  1QUT A;  1IBL M;  2R46 A;  3W68 A;  2K47 A;  4GC5 A;  3U60 A;  4NSR A;  2G5G X;  2HWJ A;  3OTO M;  4KT0 F;  1ZMW A;  1ZQ9 A;  1WIV A;  2KNZ A;  4OVZ B;  3SMP A;  4ANR A;  4D81 A;  3U6E A;  3U6L A;  3K9P A;  1Z59 A;  2QBY B;  2MGW A;  5FLX S;  4Z8X A;  1OFI A;  3LVW A;  2UXD M;  3BXW A;  3R8F A;  4OW0 A;  2QSF X;  1GO5 A;  1IFY A;  2DEN A;  1IY1 A;  3SAU A;  5L8R F;  4B3S M;  5ITX A;  2HL7 A;  1WR1 B;  4MM3 B;  1QUS A;  3WHK A;  5A2Q S;  3LMM A;  1QZM A;  2Z4R A;  4MH0 E;  1T43 A;  3A98 B;  3GLI B;  3L25 A;  1SXJ B;  4FCV A;  3C58 A;  3SAS A;  1ZMV A;  1EE8 A;  4FCW A;  4IBJ A;  1MJG M;  1IY0 A;  3FRI A;  3HJQ A;  1SXJ E;  4JV5 M;  3AFH A;  2JY5 A;  3L2A A;  4L15 A;  4AG6 A;  2CV1 A;  3IEC A;  2OO9 A;  4LJ4 A;  2CWB A;  4IBF A;  1QDR A;  5IZ7 D;  1OIP A;  3IG8 A;  3LCU A;  4MGY E;  3B7Q A;  4G4Q A;  4NC6 A;  4AW4 A;  2G8L A;  2WSC F;  1N75 A;  3E46 A;  2L4E A;  2VQF M;  2UU9 M;  2JY8 A;  3FUX A;  3HHW A;  3Q8X A;  3A45 A;  2X4A A;  3KOW E;  1R2Z A;  1SXJ A;  3E9S A;  3AJI B;  4DV2 M;  1IBM M;  1QZE A;  4JI8 M;  2L4F A;  3HU1 A;  3GLG B;  1C7Y A;  2MJ5 B;  2LVO C;  2R65 A;  3DA1 A;  3THG A;  2CV2 A;  1E32 A;  4OX9 M;  4I81 A;  5ITY A;  1HNX M;  1I94 M;  2QHO B;  2DAG A;  3NWL A;  2DAK A;  2Z7J A;  1L2B A;  1XMO M;  2Q2E B;  2LXE A;  3SBJ A;  2C9O A;  3VK7 A;  1HNW M;  5H37 D;  1R2Y A;  3SAT A;  3C9P A;  3HJS A;  4OVZ A;  4PD2 A;  1KYI A;  2EA0 A;  2XZU A;  3U60 B;  2BJV A;  2DNA A;  2V6Z M;  3LQQ A;  3T6P A;  2LVQ D;  2R62 A;  1OIZ A;  4LCB A;  3EIH A;  2ZAM A;  4GC9 A;  3PNY A;  3BBZ A;  3UK6 A;  3FUW A;  4DV6 M;  1N36 M;  1G71 A;  4NXM M;  1LV7 A;  3FTC A;  3FRH A;  4B08 A;  5EJC A;  4PCZ A;  3U61 B;  1NVM A;  2R0I A;  4L6V 6;  2Z4S A;  3QWL A;  3SFZ A;  5IWA M;  4DR5 M;  1N33 M;  2DWN A;  3KS4 A;  2UXB M;  2H1R A;  1YUB A;  4JI0 M;  3HU3 A;  3GRV A;  4FWD A;  2BJW A;  2D7H A;  2KDL A;  2JXN A;  4R71 A;  2UUB M;  4L16 A;  4LF8 M;  4FCT A;  4B3R M;  1Q02 A;  1TTE A;  1NY6 A;  2XLJ A;  2FE8 A;  1WXQ A;  1HQC A;  2R6F A;  4F2L A;  2Z8Y M;  4OU7 A;  2R4E A;  3GLI E;  3B7N A;  3VKH A;  1ORY B;  3AOE A;  1QVR A;  3K1J A;  4LF5 M;  1V33 A;  4WW0 A;  1S3S A;  3GPU A;  5FSW A;  1G41 A;  1VDD A;  3FE3 A;  4QHS A;  2RKO A;  2FS1 A;  2CFO A;  1CUK A;  5KQD A;  4F1I A;  1OAO C;  3B89 A;  3GRR A;  3GPX A;  4RF0 A;  1SXJ C;  5IRE B;  4DV5 M;  1E9R A;  1D0L A;  3TQS A;  4R3D A;  3FTD A;  3MJ5 A;  3TWL A;  1NJG A;  3HKP A;  4NRV A;  3T1Y M;  1PJS A;  2L6O A;  2KW0 A;  3LW5 F;  1R6B X;  4GMQ A;  3F92 A;  2XZF A;  1DGF A;  2R45 A;  4DR2 M;  1NNU C;  1XHB A;  1ZV1 A;  3GRU A;  5FTL A;  3RE8 A;  3SYL A;  2XSZ A;  3R9X B;  1DGB A;  3TPZ A;  1DGH A;  5BPV A;  2KRK A;  1NO1 A;  2APL A;  2GQF A;  4HEO A;  1D0M A;  1E94 E;  3TWK A;  2CP8 A;  2ZAN A;  3I04 M;  2DHY A;  4LZZ A;  3EIE A;  2L7H A;  1D2N A;  3L29 A;  1RU3 A;  2K6B A;  3NBX X;  2F4V M;  2HAK A;  3VDP A;  2LBC A;  5FTJ A;  4LGM A;  2YR0 A;  4Z6Y A;  1MX0 A;  3AOG A;  4IBI A;  3U6C A;  1OQY A;  1K3X A;  3AL0 C;  4DR7 M;  4DR6 M;  4LJ5 A;  1IN5 A;  1IXS A;  1Q39 A;  2B3T A;  1PJQ A;  1PJJ A;  2LVP C;  4L78 A;  1NHW C;  1NY5 A;  3HJ8 A;  4IBB A;  2F5S A;  3SMS A;  4KHP M;  1YE9 A;  4DUY M;  4I4L A;  2EKK A;  4M0D A;  2WZJ A;  3KOY E;  4MB7 A;  4AKI A;  2J7O A;  2ERC A;  3MHV C;  1OFH A;  4CJ6 A;  3U6O A;  2EJS A;  1KFV A;  4M0W A;  4X64 M;  1HNZ M;  1XNQ M;  1F4I A;  2D7E A;  1J09 A;  1DGH B;  2R18 A;  1OTR A;  3PNV A;  3UJN A;  4LF4 M;  3GLH E;  1L2D A;  4DR4 M;  2JY6 B;  2FFJ A;  1DO2 A;  4JI5 M;  4HL4 A;  2DAE A;  2BWB A;  4LRS A;  1Q3B A;  3ZCB B;  4D82 A;  2JZ1 A;  2DZO B;  5LMU M;  2JNH A;  1Z5A A;  3UZU A;  3M0E A;  3ZH9 B;  1GKI A;  4II7 A;  4LGY A;  3FUU A;  4X65 M;  5IT9 S;  2LVN C;  1ZAE A;  3T15 A;  4NXN M;  3K9O A;  8CAT A;  2HKJ A;  3W0L B;  3GQ3 A;  1QQW A;  1HT2 E;  5EP3 A;  1PGY A;  2VDB B;  1L1Z A;  3J7B A;  3SAV A;  4I8O A;  1QDT A;  3A46 A;  2MR9 A;  3UMM A;  3B7Z A;  1Q3C A;  3KDS E;  1JR3 A;  4DV4 M;  3GLG E;  3BOS A;  3VK8 A;  2ZTD A;  3TE6 A;  4MGK E;  5EXX A;  3CF6 E;  3U6Q A;  1TR8 A;  4WUR A;  3IG5 A;  4DR1 M;  3LQR A;  2LTU A;  4JN6 A;  4RNA A;  2EKF A;  3PFI A;  2GNO A;  2CHG A;  3J81 S;  3GPP A;  2C96 A;  1NNJ A;  2CHQ A;  1IXR C;  1GLN A;  3KSJ A;  4BB9 A;  4PDG A;  4CHT B;  1OAI A;  1SG9 A;  3FD9 A;  4CIZ A;  2OOA A;  2WSE F;  4ITQ A;  2OQ4 A;  1VEJ A;  1G4A E;  3J7A S;  2DAM A;  1TF0 B;  4GH9 A;  1I4W A;  1L8Q A;  3U61 A;  1TH4 A;  3KXE C;  2I7P A;  4Y28 F;  5JI2 E;  3CF0 A;  3PXG A;  2RRU A;  1HQY E;  1WHC A;  4IBE A;  2LWX A;  3W67 A;  2V1U A;  3GO8 A;  2G3Q A;  1R7R A;  2KZU A;  5LMN M;  5FTM A;  2JUJ A;  2QZ4 A;  2OOB A;  4DV7 M;  1VEG A;  2NQ8 C;  5E6J A;  2CEA A;  2BNK A;  3HZJ A;  2LHG A;  4EIW A;  5C18 A;  1N77 A;  1VDL A;  2C99 A;  1WJ7 A;  3E21 A;  1TH2 A;  2VII A;  2QCU A;  4G4R A;  3SAW A;  4HLQ A;  1VQ1 A;  1JR3 D;  1WGN A;  1DO0 A;  2R4J A;  2ZBK B;  3FUV A;  4B7H A;  2JZ0 A;  1AIP C;  3ZQJ A;  2XSZ D;  3K8Z A;  3JR4 A;  3FTE A;  3HGI A;  3AOE C;  3IHP A;  3GLG A;  2F5N A;  4AI6 A;  1DGG A;  4KOD A;  1NHG C;  1W5S A;  2YFQ A;  5EXT A;  3VDU A;  2FOI C;  4KO8 A;  3SHF A;  5BR8 M;  1L1T A;  4GHA A;  4DV3 M;  1HJP A;  3GLH B;  1E9S A;  1P3Q Q;  1XC8 A;  1HT1 E;  1Y8G A;  4UN2 B;  3MK6 A;  4IBC A;  3RFW A;  1IY2 A;  3DOA A;  1VG5 A;  4GIP A;  5DFL A;  2XEP A;  2CUZ A;  4REZ A;  1IN8 A;  4M9S A;  2OPF A;  1NSF A;  1KSF X;  1OJL A;  5DNY A;  2M60 A;  2AHM A;  2LH0 A;  4M9Z A;  3GLI A;  3CGW A;  4B7G A;  2JY7 A;  1XXH E;  2J7N A;  1W5T A;  4LY6 A;  4BBA A;  3GPY A;  2DWL A;  3HU2 A;  1V92 A;  1Z5B A;  4QHT A;  4IBK A;  3AKZ A;  2WSF F;  4LJA A;  3D8B A;  1IN6 A;  2DZN B;  2LHC A;  3L27 A;  4IBG A;  3K2L A;  3FYC A;  5EP4 A;  3HHY A;  4ZPX A;  1GL6 A;  3RGS A;  1T3T A;  5JI3 E;  2QBY A;  2CHV A;  4DR3 M;  1YSY A;  1GVN A;  3WHL A;  3GQ5 A;  4GKK M;  3HY5 A;  2KEB A;  1ZMU A;  5C1B A;  1SXJ D;  3SHG B;  4LG2 A;  2QEN A;  2FNA A;  3DZD A;  4FWG A;  3VFD A;  1G59 A;  3QYE A;  4S12 A;  2CE7 A;  1C1K A;  4IJE A;  5EP1 A;  2XH9 A;  3CTW B;  3GLH A;  3I01 M;  4AQY M;  2LVA A;  4TUW A;  1DV0 A;  3T38 A;  3FTF A;  1PM5 A;  3KOZ E;  1NJF A;  3NBI A;  2RGO A;  1G8P A;  5FTK A;  4CIS A;  2CRU A;  4QOZ C;  4RKU F;  2MRO B;  2J5Y A;  3I4V A;  5EP2 A;  4DBG B;  3DFZ A;  4GIT A;  4GKJ M;  4P16 A;  4LFA M;  4JI4 M;  1TH3 A;  3T1H M;  2DWM A;  2XGN A;  4AKG A;  3KFU G;  1TGU A;  4RF1 A;  4Q7J A;  4G6Z A;  4WP2 A;  2F5O A;  2KA6 B;  2KXE A;  2C5R A;  4JI1 M;  3TWM A;  1JQJ C;  3U5Z A;  2XFT A;  4L8R C;  2DVW B;  4JI6 M;  1R5L A;  4X62 M;  2R44 A;  1IM2 A;  4MGZ E;  2VF8 A;  3Q8G A;  2QPA A;  1J7K A;  2MH8 A;  4B7F A;  1JB0 F;  2A5Y B;  2O01 F;  4DV0 M;  1OKS A;  2HHH M;  3MMP A;  5EXS A;  3U6D A;  4LJ6 A;  4NSO B;  1Z5C A;  3C3E A;  1XXH B;  3H4J A;  5KO3 A;  7CAT A;  2L09 A;  4GHL A;  3HX3 A;  1MN3 A;  4JI7 M;  1N78 A;  2KHH A;  1IN4 A;  2BWE A;  3C3D A;  1XNR M;  4CGY B;  2F5P A;  1NV9 A;  1G3I A;  2O5R A;  1K82 A;  1HR0 M;  5ITT A;  2DAI A;  3J2P B;  1EIJ A;  2ZAO A;  5DYG A;  3VKG A;  1GJS A;  2KNA A;  4PDI A;  3B74 A;  3JAM S;  3L26 A;  1N32 M;  2KRU A;  4JI2 M;  3J80 S;  3KP0 E;  2JA2 A;  2K9D A;  4G4N A;  4NL4 H;  3KW6 A;  3HHZ A;  3SYK A;  3L28 A;  4NRW A;  4XGI A;  2Y0T A;  4IJF A;  1GAB A;  4QOS A;  4QNR A;  4L4U A;  2H5X A;  1VEK A;  4GRI A;  3I4Y A;  1GJT A;  2XF3 A;  4XBO A;  5KPT A;  2Z3X A;  1TDH A;  3FKE A;  1UFZ A;  1XB2 B;  3H4M A;  3KOX E;  4AG5 A;  3FYD A;  2UXC M;  4FWH A;  1QAN A;  1PJT A;  1A5T A;  4G4O A;  1LTM A;  4XK8 F;  3QYB A;  4JXJ A;  5KPR A;  4FD2 A;  3D8L A;  1N34 M;  1JR3 E;  3ILK A;  4LF6 M;  3GQ4 A;  4BLC A;  4YHH M;  3GLF A;  4IBD A;  3GLF B;  3J27 B;  4I5S A;  4M9X A;  3GRY A;  1Z6T A;  4DUZ M;  1TDZ A;  2C9C A;  2KNV A;  4LF9 M;  2N35 A;  4FVM A;  4X66 M;  2CV0 A;  3KS8 A;  2DHR A;  1H6U A;  2Y21 A;  3LCV B;  2JP7 A;  2UUA M;  3GP1 A;  1BVS A;  1YLA A;  2VQE M;  1FNN A;  2YQZ A;  3HHX A;  3AV0 A;  5FTN A;  3U6M A;  2V1C A;  5EXP A;  5EQT A;  5E26 A;  1IXS B;  2KZS A;  1K3W A;  5ITX E; 
#chains in the Genus database with same CATH homology
 3C9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...