3C9PA

Crystal structure of uncharacterized protein sp1917
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
122
Chain Sequence
NAMSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRDVTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SP1917
publication title Crystal structure of uncharacterized protein SP1917.
rcsb
source organism Streptococcus pneumoniae
total genus 45
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09966 DUF2200 Uncharacterized protein conserved in bacteria (DUF2200)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.290 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 uncharacterized protein sp1917 domain 3c9pA00
3C9PA
chains in the Genus database with same CATH superfamily
4KT0F 2OO9A 1G59A 3MJ5A 2LBCA 3SASA 1E9SA 2KNZA 1HQYE 3HJSA 2KRUA 3QYEA 1NV9A 5DYIA 2ZTDA 2EKFA 1T6OA 4CISA 2ZANA 4DV2M 1I4WA 1I94M 3GLHB 4FWDA 2CFOA 3SFZA 1XWIA 2QBYB 4F2LA 4GKJM 1N32M 1HNWM 3SYKA 1TDZA 1VDLA 4ITQA 1XMOM 3E21A 3HKPA 1D2NA 2DZNB 5FTMA 4FW9A 4X66M 1IY1A 1VG5A 5EXTA 3IG8A 3FUUA 3KP0E 3U60B 1N36M 1XNQM 4DR4M 2QNJA 2HCBA 1F4IA 2YFQA 2J7NA 4IBDA 2UUCM 3QWLA 1NHWC 2L4EA 4PD2A 1Z5BA 3FUVA 5E26A 3GPXA 1VEGA 3TL4X 4JI0M 3U6EA 2DWMA 3FKEA 3JAMS 5DNYA 1R4GA 3GLFB 4KODA 2DHYA 3MK6A 4G4RA 2HWJA 2BNKA 3B89A 3CTWB 1PM5A 2DXIA 1IN7A 3THGA 5DYGA 1FNNA 1T3TA 3FD9A 4M0DA 3GPPA 4NC6A 3AOEA 2OOBA 2UUAM 4I81A 3GLHA 4JI2M 3HHXA 4DV4M 4GKKM 2DAKA 3V76A 2QBYA 3D8BA 1JR3D 3SAVA 1PJQA 2LHGA 3FUXA 3LQQA 3H4JA 4LY6A 2Z3XA 4AKGA 2QZ4A 2J7OA 2L7IA 2QQ8A 2K0BX 3HHWA 3U60A 4LGMA 1PJIA 5ITUA 3R8FA 5C18A 3GLIE 2JY5A 3B7ZA 2XH9A 4Q7JA 4ANRA 1Z59A 1G71A 4NRVA 3GLIB 3U61B 4LF9M 5EQTA 4JV5M 3KXEC 2BJWA 2DZLA 3W0LB 5H37D 4IBJA 3E46A 2QP9X 1NSFA 3K1JA 3RFWA 2Z8YM 1E32A 2JUJA 2O01F 4GH9A 4AW4A 4TUWA 4YY3M 4R71A 2F5QA 3GLFA 1GABA 3DZDA 1OJLA 2KW0A 2KZSA 2CP8A 4RF0A 4AKIA 4QNRA 2L09A 3LQRA 1C7YA 4DBGB 1HT2E 4AQYM 3L26A 2ERCA 1TF0B 3CF2A 3K9PA 1QAQA 1SG9A 3C9PA 4F1IA 2M5ZA 2RGOA 1WJ7A 2Y20A 1KYIA 2JP7A 5EXSA 2ZM6M 3GLGB 3AJIB 1Q39A 5GKNA 1HQCA 1VEKA 1IXZA 1DGHB 3LMMA 4MGIE 2K6BA 5EP3A 4LFAM 5DFLA 4DR5M 1QUSA 3PXGA 2EJSA 2KNAA 2RGHA 3OTOM 2JXNA 4DR2M 1IN8A 1N33M 5IT9S 5FLXS 3K2LA 3SMSA 4DUZM 1R2YA 2BJVA 3IECA 2Y21A 4B7GA 4Y28F 1K82A 2L4FA 3U61A 1OFIA 2LNHC 4LFCM 1OQYA 3HGIA 1IBKM 1QANA 1DGBA 4LJ9A 1GJSA 2JZ1A 4WURA 3TWLA 2Z4SA 3GRYA 1IY0A 3WHKA 2HHHM 1V33A 4LFBM 2C98A 4LGYA 3HHZA 3MHVC 4RKUF 4A3VB 2R4JA 3K8ZA 1KFVA 2KXEA 4DV5M 4B3MM 1QDRA 4JI7M 2V1CA 2B3TA 4AG5A 1L2DA 3HY5A 2DENA 1SXJC 3RE8A 3A98B 3GO8A 4NOOB 4QOSA 2F5OA 1Q3BA 1OTRA 3GLGA 3SC3A 2LVAA 4JN6A 7CATA 1DO2A 2X8AA 2CV2A 1DGHA 3BBZA 1IQPA 2XGNA 3HJ8A 1PJSA 2XF3A 1XMQM 1HNXM 4X64M 4FD2A 1WHCA 1XHBA 2JA2A 3GRUA 1AUAA 5KQDA 1VDDA 5KQ8A 1J5EM 4JI1M 5JI3E 2DNAA 1ZMVA 1WR1B 3UZUA 3GLHE 1N78A 1IFYA 3U5ZB 1TR8A 4HL4A 4DV3M 1WIVA 1X37A 4UN2B 2EKKA 2VDBB 5LMUM 2KRKA 1EE8A 4CJ6A 3KOWE 2MGWA 1QVRA 4REZA 3U6SA 4B3RM 1MX0A 2ZTCA 1ZV1A 1Q3CA 2XLJA 3JR4A 5C1BA 1YUBA 3E4RA 5EXXA 2ZBKB 2D7EA 3B7QA 1JB0F 1R6BX 2QENA 4GITA 4LRSA 1QAOA 3U6LA 3TPZA 1GKIA 5ITRA 1NY6A 3E9SA 3DA1A 1VEJA 2DZOB 2YNMD 3HU3A 4GIPA 3ZCBB 4DR7M 3GLFE 4LG2A 4L78A 1NO1A 2NQ8C 3VLFB 3AKZA 1SXJD 4NRWA 2J5YA 1DGFA 2X4AA 2XSZD 3I4YA 5EP1A 3UK6A 3VK8A 1R7RA 4JI8M 2HL7A 2DWZB 2WSEF 1C1KA 1PRBA 1YSYA 4M0WA 5BPVA 3PFIA 3EIEA 3U5ZA 4HLQA 2EO2A 1GL6A 2Z4RA 4WW0A 4GC9A 4JI6M 2LVNC 5JI2E 3HZJA 3A42A 1QZEA 4LF8M 4NXMM 2A5YB 2CRUA 1HR0M 1ZAEA 1GL7A 2BWBA 4CHTB 4WP2A 3NBXX 3SAUA 2BWEA 1RU3A 2VQFM 3KW6A 2V6ZM 8CATA 1NNUC 3PNVA 2JZ0A 4IBKA 4FWHA 1BVSA 1Z5AA 2OOAA 3KSXA 2D7HA 3IG5A 3ZQJA 2YQZA 1NJGA 2VQEM 3T1YM 2WZJA 1W5TA 3LVVA 1L2BA 2KDLA 4YHHM 3DOAA 3MMPA 3ZC7B 2LXEA 5ITXA 3M0EA 2QPAA 2CEAA 3D8LA 2CHVA 2DAEA 4IBFA 3J27B 4B7HA 1R2ZA 1GO5A 2O5RA 4DV6M 2UXBM 3U6MA 2K47A 4G4OA 1NV8A 2FNAA 4RNAA 1R5LA 2XFSA 4L16A 2DHRA 3J2PB 4LF7M 1TH2A 1QQWA 3GLGE 4LJ4A 4CGYB 3QYBA 3FYCA 2C9CA 1HNZM 2MROB 2GNOA 4D80A 1UFZA 4FVMA 3T6PA 3K9OA 2D7GA 4AKHA 2H5XA 3I51A 4OVZB 3UGJA 2LVQD 3SMPA 3FTFA 1XNRM 4I8OA 4W5WA 4Z8XA 4G3OA 3J7AS 4AZFA 4JXJA 1Z5CA 2VF7A 1SXJB 2R46A 4I5SA 4LJAA 4X65M 4L6V6 2KEBA 2FFJA 3GRRA 3RGSA 4D82A 1K3XA 1D0MA 3KOYE 4IJFA 4I4LA 3L27A 5EP2A 3W68A 2C5RA 4P16A 1WGNA 2AHMA 1QUTA 1H6UA 2JY6B 3SBJA 5IZ7D 4NXNM 4IBBA 3AFHA 4P17A 4JI3M 3FTEA 3SYLA 1XXHB 4LJ5A 5L8RF 4B3SM 1G41A 3CGWA 2CE7A 4MGHA 3GP1A 2ZAMA 3VDPA 5KO3A 4JYAM 3FTCA 4JI4M 2G8LA 1N75A 4GC5A 3J81S 3TQSA 2O25A 2R18A 2RRUA 2C96A 4FCVA 1GLNA 4M9XA 1ZMWA 5FTNA 1D0LA 2XEPA 4OVZA 3TWMA 1OIZA 4GHAA 3L28A 5LMNM 3VKHA 4AG6A 3FTDA 2JWSA 4AI6A 3L2AA 5E6JA 3TE6A 3BOSA 1XC8A 2APLA 4M9ZA 1SXJA 1IBMM 4JI5M 3J80S 4L15A 2UXDM 4MGKE 2DI0A 1YLAA 3FRIA 1TH4A 2FE8A 2QSFX 5EXPA 2F5PA 2Y0QA 4BB9A 2OQ4A 3B9PA 2CHQA 1IM2A 2E5LM 2VF8A 2FH0A 4DV0M 3FYDA 1IXSB 1V34A 3I01M 2CV1A 2K9DA 3A45A 4IBGA 4LF4M 2XZFA 3SATA 1LV7A 1DO0A 1Z6TA 2W82A 2OPFA 2LTUA 1MJGM 2I7PA 3L29A 4LJ7A 1JR3A 1OKSA 3C3DA 1WGLA 1XXHA 3Q8GA 4NSOB 1PJJA 4LJ8A 2WSCF 2L2DA 3A46A 3KSJA 3CF0A 5EJCA 2QCUA 1JQJC 3PVSA 3VFDA 4EIWA 2R62A 1J7KA 1ZQ9A 4NL4H 5ITXE 4IJEA 3NWLA 2UUBM 1L2CA 4GMQA 3EIHA 5IREB 2ZAOA 4HEOA 1OIPA 1IN6A 2LH0A 1G8PA 3J7BA 4G4NA 1L1ZA 3KOXE 2F5NA 5KPRA 1DV0A 3NBIA 2HKJA 4OW0A 1OAOC 1TDHA 1OAIA 5ITQA 4MGZE 3LCUA 2KA6B 4LRTA 4PCZA 3U6OA 3U6PA 2R0IA 2VIIA 3M6AA 4B7FA 2DAGA 4FWGA 3AOGA 2FS1A 1L8QA 2XFTA 3DFZA 1HJPA 2CWBA 3Q8XA 4GRIA 3FUTA 4LZZA 5FTKA 4X62M 4XGIA 2C9OA 3UMMA 1Y8GA 4LJ6A 1VQ1A 2QHOB 3GPYA 2G3QA 4B3TM 4K0KM 1IXSA 2KZUA 4CIZA 1K3WA 1MN3A 4DV1M 4QHTA 3C58A 4KO8A 3L25A 1ORYB 2MJ5B 1P3QQ 2Y0TA 2MR9A 2JNHA 1YE9A 2I7NA 3B74A 1V92A 3UJNA 2MH8A 2DVWB 4BLCA 3B7NA 3GRVA 2H1RA 3AOEC 3KP1E 4ZPXA 2L7HA 5KPZA 3JR5A 1PJTA 2Z7JA 2F5SA 1IXRC 2LWXA 1S3SA 2DAIA 1UM8A 2JY7A 2Q2EB 1J09A 4OU7A 3VDUA 1G3IA 2F4VM 1CUKA 2G5GX 1NJFA 3M7GA 1AIPC 1TGUA 1W5SA 3TWKA 4KLNA 4IBEA 3C3EA 3FE3A 3SHFA 3SHGB 2R6FA 4L4UA 4MGYE 4S12A 5IWAM 5F3WA 2R45A 4PDGA 4Z6YA 3GQ5A 4G4QA 3T1HM 4LF5M 3QAUA 2N35A 3I4VA 1Q02A 3AV0A 3LVWA 4FCTA 4MM3B 3I04M 3AL0C 1EIJA 1LTMA 4L8RC 1N34M 3H4MA 4DR1M 1QYRA 4XK8F 1L1TA 4IIWA 2KHHA 4PDIA 3IHPA 1WXQA 1NHGC 4XBOA 1SXJE 4LZJA 1A5TA 4MH0E 2FOIC 1QAMA 4LCBA 4R3DA 3GQ4A 4IBCA 3T15A 4R7GA 4QNMA 3U6QA 5ITYA 2WSFF 3CF6E 4GEWA 2R4EA 4II7A 4DR3M 2P5TA 3HU1A 1MU5A 3W67A 1T43A 1JR3E 4NSRA 4B08A 1XXHE 3HHYA 2LVOC 2M60A 4FCWA 2HAKA 3F92A 4G6ZA 4BBAA 2C99A 2EA0A 4D81A 4PT5A 3SARA 4DR6M 2LHCA 2R44A 1QDTA 4M9SA 3K92A 4IBIA 3HU2A 2UU9M 4RF1A 3VK7A 3U6CA 3HJQA 1IN4A 1FJGM 2DWLA 5KPTA 2XZUA 2EUCA 2LVPC 3ILKA 5FTLA 3R9XB 1HT1E 4MB7A 3FUWA 1G4AE 4LF6M 2RKOA 4DUYM 3GLIA 1OFHA 4DV7M 3PNYA 3SAWA 3GPUA 2UXCM 4OX9M 3KFUG 2CUZA 3KS8A 1TH3A 5FTJA 2DWNA 1IY2A 1NVMA 1QZMA 1IBLM 2V1UA 1EFUB 1NY5A 2XSZA 1ZMUA 1TTEA 2L6OA 5EP4A 5FSWA 2X49A 3LCVB 3W0FA 1N77A 1XB2B 2DAMA 5ITTA 1E94E 3LW5F 3KDSE 3KOZE 3ZH9B 3T38A 1KSFX 4KHPM 3HX3A 3HWSA 3U6DA 3BXWA 2CHGA 3GQ3A 1GVNA 1DGGA 2JY8A 2R65A 3RGPA 2DKLA 2CV0A 3VKGA 1GJTA 5A2QS 1E9RA 1D0KA 2GQFA 1IN5A 3KVWA 4QHSA 3KS4A 3FRHA 2YR0A 5BR8M 1NNJA 2KNVA 4GHLA 4QOZC 3WHLA 1PGYA
chains in the Genus database with same CATH topology
3C9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9P A; 
#chains in the Genus database with same CATH topology
 4KT0 F;  2OO9 A;  1G59 A;  3MJ5 A;  2LBC A;  3SAS A;  1E9S A;  2KNZ A;  1HQY E;  3HJS A;  2KRU A;  3QYE A;  1NV9 A;  5DYI A;  2ZTD A;  2EKF A;  1T6O A;  4CIS A;  2ZAN A;  4DV2 M;  1I4W A;  1I94 M;  3GLH B;  4FWD A;  2CFO A;  3SFZ A;  1XWI A;  2QBY B;  4F2L A;  4GKJ M;  1N32 M;  1HNW M;  3SYK A;  1TDZ A;  1VDL A;  4ITQ A;  1XMO M;  3E21 A;  3HKP A;  1D2N A;  2DZN B;  5FTM A;  4FW9 A;  4X66 M;  1IY1 A;  1VG5 A;  5EXT A;  3IG8 A;  3FUU A;  3KP0 E;  3U60 B;  1N36 M;  1XNQ M;  4DR4 M;  2QNJ A;  2HCB A;  1F4I A;  2YFQ A;  2J7N A;  4IBD A;  2UUC M;  3QWL A;  1NHW C;  2L4E A;  4PD2 A;  1Z5B A;  3FUV A;  5E26 A;  3GPX A;  1VEG A;  3TL4 X;  4JI0 M;  3U6E A;  2DWM A;  3FKE A;  3JAM S;  5DNY A;  1R4G A;  3GLF B;  4KOD A;  2DHY A;  3MK6 A;  4G4R A;  2HWJ A;  2BNK A;  3B89 A;  3CTW B;  1PM5 A;  2DXI A;  1IN7 A;  3THG A;  5DYG A;  1FNN A;  1T3T A;  3FD9 A;  4M0D A;  3GPP A;  4NC6 A;  3AOE A;  2OOB A;  2UUA M;  4I81 A;  3GLH A;  4JI2 M;  3HHX A;  4DV4 M;  4GKK M;  2DAK A;  3V76 A;  2QBY A;  3D8B A;  1JR3 D;  3SAV A;  1PJQ A;  2LHG A;  3FUX A;  3LQQ A;  3H4J A;  4LY6 A;  2Z3X A;  4AKG A;  2QZ4 A;  2J7O A;  2L7I A;  2QQ8 A;  2K0B X;  3HHW A;  3U60 A;  4LGM A;  1PJI A;  5ITU A;  3R8F A;  5C18 A;  3GLI E;  2JY5 A;  3B7Z A;  2XH9 A;  4Q7J A;  4ANR A;  1Z59 A;  1G71 A;  4NRV A;  3GLI B;  3U61 B;  4LF9 M;  5EQT A;  4JV5 M;  3KXE C;  2BJW A;  2DZL A;  3W0L B;  5H37 D;  4IBJ A;  3E46 A;  2QP9 X;  1NSF A;  3K1J A;  3RFW A;  2Z8Y M;  1E32 A;  2JUJ A;  2O01 F;  4GH9 A;  4AW4 A;  4TUW A;  4YY3 M;  4R71 A;  2F5Q A;  3GLF A;  1GAB A;  3DZD A;  1OJL A;  2KW0 A;  2KZS A;  2CP8 A;  4RF0 A;  4AKI A;  4QNR A;  2L09 A;  3LQR A;  1C7Y A;  4DBG B;  1HT2 E;  4AQY M;  3L26 A;  2ERC A;  1TF0 B;  3CF2 A;  3K9P A;  1QAQ A;  1SG9 A;  3C9P A;  4F1I A;  2M5Z A;  2RGO A;  1WJ7 A;  2Y20 A;  1KYI A;  2JP7 A;  5EXS A;  2ZM6 M;  3GLG B;  3AJI B;  1Q39 A;  5GKN A;  1HQC A;  1VEK A;  1IXZ A;  1DGH B;  3LMM A;  4MGI E;  2K6B A;  5EP3 A;  4LFA M;  5DFL A;  4DR5 M;  1QUS A;  3PXG A;  2EJS A;  2KNA A;  2RGH A;  3OTO M;  2JXN A;  4DR2 M;  1IN8 A;  1N33 M;  5IT9 S;  5FLX S;  3K2L A;  3SMS A;  4DUZ M;  1R2Y A;  2BJV A;  3IEC A;  2Y21 A;  4B7G A;  4Y28 F;  1K82 A;  2L4F A;  3U61 A;  1OFI A;  2LNH C;  4LFC M;  1OQY A;  3HGI A;  1IBK M;  1QAN A;  1DGB A;  4LJ9 A;  1GJS A;  2JZ1 A;  4WUR A;  3TWL A;  2Z4S A;  3GRY A;  1IY0 A;  3WHK A;  2HHH M;  1V33 A;  4LFB M;  2C98 A;  4LGY A;  3HHZ A;  3MHV C;  4RKU F;  4A3V B;  2R4J A;  3K8Z A;  1KFV A;  2KXE A;  4DV5 M;  4B3M M;  1QDR A;  4JI7 M;  2V1C A;  2B3T A;  4AG5 A;  1L2D A;  3HY5 A;  2DEN A;  1SXJ C;  3RE8 A;  3A98 B;  3GO8 A;  4NOO B;  4QOS A;  2F5O A;  1Q3B A;  1OTR A;  3GLG A;  3SC3 A;  2LVA A;  4JN6 A;  7CAT A;  1DO2 A;  2X8A A;  2CV2 A;  1DGH A;  3BBZ A;  1IQP A;  2XGN A;  3HJ8 A;  1PJS A;  2XF3 A;  1XMQ M;  1HNX M;  4X64 M;  4FD2 A;  1WHC A;  1XHB A;  2JA2 A;  3GRU A;  1AUA A;  5KQD A;  1VDD A;  5KQ8 A;  1J5E M;  4JI1 M;  5JI3 E;  2DNA A;  1ZMV A;  1WR1 B;  3UZU A;  3GLH E;  1N78 A;  1IFY A;  3U5Z B;  1TR8 A;  4HL4 A;  4DV3 M;  1WIV A;  1X37 A;  4UN2 B;  2EKK A;  2VDB B;  5LMU M;  2KRK A;  1EE8 A;  4CJ6 A;  3KOW E;  2MGW A;  1QVR A;  4REZ A;  3U6S A;  4B3R M;  1MX0 A;  2ZTC A;  1ZV1 A;  1Q3C A;  2XLJ A;  3JR4 A;  5C1B A;  1YUB A;  3E4R A;  5EXX A;  2ZBK B;  2D7E A;  3B7Q A;  1JB0 F;  1R6B X;  2QEN A;  4GIT A;  4LRS A;  1QAO A;  3U6L A;  3TPZ A;  1GKI A;  5ITR A;  1NY6 A;  3E9S A;  3DA1 A;  1VEJ A;  2DZO B;  2YNM D;  3HU3 A;  4GIP A;  3ZCB B;  4DR7 M;  3GLF E;  4LG2 A;  4L78 A;  1NO1 A;  2NQ8 C;  3VLF B;  3AKZ A;  1SXJ D;  4NRW A;  2J5Y A;  1DGF A;  2X4A A;  2XSZ D;  3I4Y A;  5EP1 A;  3UK6 A;  3VK8 A;  1R7R A;  4JI8 M;  2HL7 A;  2DWZ B;  2WSE F;  1C1K A;  1PRB A;  1YSY A;  4M0W A;  5BPV A;  3PFI A;  3EIE A;  3U5Z A;  4HLQ A;  2EO2 A;  1GL6 A;  2Z4R A;  4WW0 A;  4GC9 A;  4JI6 M;  2LVN C;  5JI2 E;  3HZJ A;  3A42 A;  1QZE A;  4LF8 M;  4NXM M;  2A5Y B;  2CRU A;  1HR0 M;  1ZAE A;  1GL7 A;  2BWB A;  4CHT B;  4WP2 A;  3NBX X;  3SAU A;  2BWE A;  1RU3 A;  2VQF M;  3KW6 A;  2V6Z M;  8CAT A;  1NNU C;  3PNV A;  2JZ0 A;  4IBK A;  4FWH A;  1BVS A;  1Z5A A;  2OOA A;  3KSX A;  2D7H A;  3IG5 A;  3ZQJ A;  2YQZ A;  1NJG A;  2VQE M;  3T1Y M;  2WZJ A;  1W5T A;  3LVV A;  1L2B A;  2KDL A;  4YHH M;  3DOA A;  3MMP A;  3ZC7 B;  2LXE A;  5ITX A;  3M0E A;  2QPA A;  2CEA A;  3D8L A;  2CHV A;  2DAE A;  4IBF A;  3J27 B;  4B7H A;  1R2Z A;  1GO5 A;  2O5R A;  4DV6 M;  2UXB M;  3U6M A;  2K47 A;  4G4O A;  1NV8 A;  2FNA A;  4RNA A;  1R5L A;  2XFS A;  4L16 A;  2DHR A;  3J2P B;  4LF7 M;  1TH2 A;  1QQW A;  3GLG E;  4LJ4 A;  4CGY B;  3QYB A;  3FYC A;  2C9C A;  1HNZ M;  2MRO B;  2GNO A;  4D80 A;  1UFZ A;  4FVM A;  3T6P A;  3K9O A;  2D7G A;  4AKH A;  2H5X A;  3I51 A;  4OVZ B;  3UGJ A;  2LVQ D;  3SMP A;  3FTF A;  1XNR M;  4I8O A;  4W5W A;  4Z8X A;  4G3O A;  3J7A S;  4AZF A;  4JXJ A;  1Z5C A;  2VF7 A;  1SXJ B;  2R46 A;  4I5S A;  4LJA A;  4X65 M;  4L6V 6;  2KEB A;  2FFJ A;  3GRR A;  3RGS A;  4D82 A;  1K3X A;  1D0M A;  3KOY E;  4IJF A;  4I4L A;  3L27 A;  5EP2 A;  3W68 A;  2C5R A;  4P16 A;  1WGN A;  2AHM A;  1QUT A;  1H6U A;  2JY6 B;  3SBJ A;  5IZ7 D;  4NXN M;  4IBB A;  3AFH A;  4P17 A;  4JI3 M;  3FTE A;  3SYL A;  1XXH B;  4LJ5 A;  5L8R F;  4B3S M;  1G41 A;  3CGW A;  2CE7 A;  4MGH A;  3GP1 A;  2ZAM A;  3VDP A;  5KO3 A;  4JYA M;  3FTC A;  4JI4 M;  2G8L A;  1N75 A;  4GC5 A;  3J81 S;  3TQS A;  2O25 A;  2R18 A;  2RRU A;  2C96 A;  4FCV A;  1GLN A;  4M9X A;  1ZMW A;  5FTN A;  1D0L A;  2XEP A;  4OVZ A;  3TWM A;  1OIZ A;  4GHA A;  3L28 A;  5LMN M;  3VKH A;  4AG6 A;  3FTD A;  2JWS A;  4AI6 A;  3L2A A;  5E6J A;  3TE6 A;  3BOS A;  1XC8 A;  2APL A;  4M9Z A;  1SXJ A;  1IBM M;  4JI5 M;  3J80 S;  4L15 A;  2UXD M;  4MGK E;  2DI0 A;  1YLA A;  3FRI A;  1TH4 A;  2FE8 A;  2QSF X;  5EXP A;  2F5P A;  2Y0Q A;  4BB9 A;  2OQ4 A;  3B9P A;  2CHQ A;  1IM2 A;  2E5L M;  2VF8 A;  2FH0 A;  4DV0 M;  3FYD A;  1IXS B;  1V34 A;  3I01 M;  2CV1 A;  2K9D A;  3A45 A;  4IBG A;  4LF4 M;  2XZF A;  3SAT A;  1LV7 A;  1DO0 A;  1Z6T A;  2W82 A;  2OPF A;  2LTU A;  1MJG M;  2I7P A;  3L29 A;  4LJ7 A;  1JR3 A;  1OKS A;  3C3D A;  1WGL A;  1XXH A;  3Q8G A;  4NSO B;  1PJJ A;  4LJ8 A;  2WSC F;  2L2D A;  3A46 A;  3KSJ A;  3CF0 A;  5EJC A;  2QCU A;  1JQJ C;  3PVS A;  3VFD A;  4EIW A;  2R62 A;  1J7K A;  1ZQ9 A;  4NL4 H;  5ITX E;  4IJE A;  3NWL A;  2UUB M;  1L2C A;  4GMQ A;  3EIH A;  5IRE B;  2ZAO A;  4HEO A;  1OIP A;  1IN6 A;  2LH0 A;  1G8P A;  3J7B A;  4G4N A;  1L1Z A;  3KOX E;  2F5N A;  5KPR A;  1DV0 A;  3NBI A;  2HKJ A;  4OW0 A;  1OAO C;  1TDH A;  1OAI A;  5ITQ A;  4MGZ E;  3LCU A;  2KA6 B;  4LRT A;  4PCZ A;  3U6O A;  3U6P A;  2R0I A;  2VII A;  3M6A A;  4B7F A;  2DAG A;  4FWG A;  3AOG A;  2FS1 A;  1L8Q A;  2XFT A;  3DFZ A;  1HJP A;  2CWB A;  3Q8X A;  4GRI A;  3FUT A;  4LZZ A;  5FTK A;  4X62 M;  4XGI A;  2C9O A;  3UMM A;  1Y8G A;  4LJ6 A;  1VQ1 A;  2QHO B;  3GPY A;  2G3Q A;  4B3T M;  4K0K M;  1IXS A;  2KZU A;  4CIZ A;  1K3W A;  1MN3 A;  4DV1 M;  4QHT A;  3C58 A;  4KO8 A;  3L25 A;  1ORY B;  2MJ5 B;  1P3Q Q;  2Y0T A;  2MR9 A;  2JNH A;  1YE9 A;  2I7N A;  3B74 A;  1V92 A;  3UJN A;  2MH8 A;  2DVW B;  4BLC A;  3B7N A;  3GRV A;  2H1R A;  3AOE C;  3KP1 E;  4ZPX A;  2L7H A;  5KPZ A;  3JR5 A;  1PJT A;  2Z7J A;  2F5S A;  1IXR C;  2LWX A;  1S3S A;  2DAI A;  1UM8 A;  2JY7 A;  2Q2E B;  1J09 A;  4OU7 A;  3VDU A;  1G3I A;  2F4V M;  1CUK A;  2G5G X;  1NJF A;  3M7G A;  1AIP C;  1TGU A;  1W5S A;  3TWK A;  4KLN A;  4IBE A;  3C3E A;  3FE3 A;  3SHF A;  3SHG B;  2R6F A;  4L4U A;  4MGY E;  4S12 A;  5IWA M;  5F3W A;  2R45 A;  4PDG A;  4Z6Y A;  3GQ5 A;  4G4Q A;  3T1H M;  4LF5 M;  3QAU A;  2N35 A;  3I4V A;  1Q02 A;  3AV0 A;  3LVW A;  4FCT A;  4MM3 B;  3I04 M;  3AL0 C;  1EIJ A;  1LTM A;  4L8R C;  1N34 M;  3H4M A;  4DR1 M;  1QYR A;  4XK8 F;  1L1T A;  4IIW A;  2KHH A;  4PDI A;  3IHP A;  1WXQ A;  1NHG C;  4XBO A;  1SXJ E;  4LZJ A;  1A5T A;  4MH0 E;  2FOI C;  1QAM A;  4LCB A;  4R3D A;  3GQ4 A;  4IBC A;  3T15 A;  4R7G A;  4QNM A;  3U6Q A;  5ITY A;  2WSF F;  3CF6 E;  4GEW A;  2R4E A;  4II7 A;  4DR3 M;  2P5T A;  3HU1 A;  1MU5 A;  3W67 A;  1T43 A;  1JR3 E;  4NSR A;  4B08 A;  1XXH E;  3HHY A;  2LVO C;  2M60 A;  4FCW A;  2HAK A;  3F92 A;  4G6Z A;  4BBA A;  2C99 A;  2EA0 A;  4D81 A;  4PT5 A;  3SAR A;  4DR6 M;  2LHC A;  2R44 A;  1QDT A;  4M9S A;  3K92 A;  4IBI A;  3HU2 A;  2UU9 M;  4RF1 A;  3VK7 A;  3U6C A;  3HJQ A;  1IN4 A;  1FJG M;  2DWL A;  5KPT A;  2XZU A;  2EUC A;  2LVP C;  3ILK A;  5FTL A;  3R9X B;  1HT1 E;  4MB7 A;  3FUW A;  1G4A E;  4LF6 M;  2RKO A;  4DUY M;  3GLI A;  1OFH A;  4DV7 M;  3PNY A;  3SAW A;  3GPU A;  2UXC M;  4OX9 M;  3KFU G;  2CUZ A;  3KS8 A;  1TH3 A;  5FTJ A;  2DWN A;  1IY2 A;  1NVM A;  1QZM A;  1IBL M;  2V1U A;  1EFU B;  1NY5 A;  2XSZ A;  1ZMU A;  1TTE A;  2L6O A;  5EP4 A;  5FSW A;  2X49 A;  3LCV B;  3W0F A;  1N77 A;  1XB2 B;  2DAM A;  5ITT A;  1E94 E;  3LW5 F;  3KDS E;  3KOZ E;  3ZH9 B;  3T38 A;  1KSF X;  4KHP M;  3HX3 A;  3HWS A;  3U6D A;  3BXW A;  2CHG A;  3GQ3 A;  1GVN A;  1DGG A;  2JY8 A;  2R65 A;  3RGP A;  2DKL A;  2CV0 A;  3VKG A;  1GJT A;  5A2Q S;  1E9R A;  1D0K A;  2GQF A;  1IN5 A;  3KVW A;  4QHS A;  3KS4 A;  3FRH A;  2YR0 A;  5BR8 M;  1NNJ A;  2KNV A;  4GHL A;  4QOZ C;  3WHL A;  1PGY A; 
#chains in the Genus database with same CATH homology
 3C9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...