4LZZA

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 57
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lzzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lzzA01
4PC1A 4AY2A 2XSZD 1M7BA 1XPOA 3MUFA 4TT3A 1Q12A 1GL6A 4TL9A 4WBSA 5KNBA 2WHXA 2JLUA 3I61A 2MMGA 5C18A 2D2EA 3GPLA 2IYRA 2I1VB 1OV4A 3DEFA 1UF9A 5KDDA 3OIVA 4CGZA 1Q21A 2ZM5A 2VPPA 3LV8A 2ZETA 4UKDA 3B78A 3CX8A 1E32A 1P9NA 4FCWA 1MO6A 2WMOB 4DZZA 1SXJA 2F1RA 4XTRA 4C0BA 1CJTC 2DBYA 1V5WA 2OBNA 4HUTA 2O8FA 3KJGA 2PX0A 3PG5A 4JL6A 2ZI4A 1DEKA 1XU4A 4IVPA 4YMTA 2ATXA 4B2IA 2W6ID 1OXSC 1EG7A 2OEPA 2B8WA 2NIPA 5L8VA 5TDHA 4B3DA 1II8B 2IEYA 4IEIA 5IF9A 4DDUA 1MOZA 1OB2A 2OESA 3NXSA 3ZZUA 4TYWA 2XZPA 3L0SA 1DAIA 5J40A 2IF0A 4IDNA 2WJYA 4WZ6A 1SULA 2F3RA 1VCMA 2CBZA 2ZVPX 3PITA 3QXJA 3FHCB 1E2QA 1U94A 4HAVA 4G3XA 4I1SA 1JPNA 4Q02A 1IXSB 2BOVA 5TY0A 1W36B 3IEVA 3Q85A 1T5IA 4HB3A 1XMSA 5FL7D 3L0IB 5FTKA 4W7SA 4EPYA 1XPUA 1W36D 2RKOA 4F4CA 2BC9A 4JLVA 4Q19A 5HTKA 4A1FA 2KRKA 5BQ5A 1CLUA 2ZI9A 4BRUA 1LV7A 2ERYA 2QBYB 2W2VA 1B0UA 1ZJ6A 1YZKA 2DPXA 4I4LA 5EE0A 3I5YA 4KAXA 4DLSA 2GVDC 5FOUA 1JR6A 3BRWD 3FE2A 4C4PA 3ETLA 1W0JD 4TMKA 2KB0A 2WWFA 2LWIA 2X2EA 1P73A 3S1AA 3GJ8A 1HE1C 1NVMA 1K8RA 2GDJA 1NLYA 3ASZA 1HTWA 5EQTA 2CL6X 2IHBA 2AFHE 4C0QC 3D7MA 1X8KA 4US1R 2EWVA 2DYKA 3DVLA 2GXQA 3SU8A 2PMDA 2IXGA 5DN6D 2LCFA 4C30A 2OZEA 4B3GA 3DMDA 4DRZA 3Q8XB 3U3MA 3B9PA 4LJAA 4Q9JA 1KSGA 4E07A 2HT6A 1U0JA 2D2FA 4TT3D 1GUAA 1TADA 3GCGA 1Z07A 2ECKA 2GCOB 2I3BA 3AVWA 1E2FA 1FOEB 3C16C 2FGKA 4A9AA 5FBQB 4DSUA 1II0A 1E98A 2O8BA 3IPXA 4BFZA 3C5HA 1OIVA 3QPUA 2Q6TA 1S9DA 1FX0B 4OBEA 1KAOA 5CYPA 1UBGA 1TEXA 2R6FA 4ASUA 2WAXA 1SHZA 3NVAA 3KQNA 2GXUA 1Z08A 2BBSA 2IWRA 2ZRCA 1LVGA 5E3HA 2BMJA 3K0FA 5CJ2A 4IVRA 3BH6A 1Q3TA 4H9GA 5IHPA 3SYNA 2PZGA 4OHVA 4PSAA 5KSPA 1QHHB 1E9FA 2UVQA 5DHAA 2MSEB 3A1SA 4JT4A 2HJGA 1GKUB 1KI9A 1ZRHA 2ZRIA 1Q20A 4FWHA 2F43B 3EPJA 3Q5EA 3WMFA 4BZQA 1F2UB 3I5XA 4B75A 5KHOC 2H17A 4EKDA 1IBRA 3AEZA 3PJRA 4AYTA 5FPYA 3PEYA 1SVKA 4UJ3A 4LBWA 4KCGA 3FKSA 2O0KA 4B47A 4X8OA 2IC5A 2IYXA 3GEEA 1VHLA 4O0MA 521PA 1E0KA 1N5JA 1UKVY 3JVUA 4A6XA 3LX8A 1Z2CA 2J7KA 1OW3B 4W5WA 1E2NA 2QI9C 3MMPA 3QEOA 4DXAA 2BEKA 2QM7A 1W46A 4JVSB 2R62A 1X86B 2AKAB 2DFLA 4MGKR 4OI2A 4K46A 2ZJAA 3QIAA 1XJQA 4OK6A 2YOHA 2UZ3A 4ZI2A 5TARA 4NP6A 1IY2A 2D06A 2XB4A 4V0NA 4F7WA 3UATA 3C5CA 2A7QA 3NBZC 3TBKA 4BWYA 4JLAA 1X3SA 1E94E 3AVUA 5C4GB 2PZEA 2ZRLA 2DFKB 2UZIR 4PC2A 1YR8A 4PR0A 1KMHB 2ODBA 4FMCB 3IHLA 3RC8A 2VTKA 4EPWA 2FN4A 4M1OA 3NG1A 3K0CC 4HAZA 1TNDA 2R6CA 4I1OA 5DLQC 3HJNA 1Z0JA 4I1UA 2CHVA 3K09A 1QHYA 3I92A 4BFXA 2RGEA 3DL0A 5DI9A 4GPTA 1CRQA 1TF2A 2FZLA 2ZRPA 1U99A 5LBIA 4Q4JA 4M22A 1T4GA 1W4RA 1YHNA 1KI7A 3GFTA 4PPFA 1II9A 3SE0A 3ZQJA 1ZM2A 1KDOA 3EZ7A 2P6RA 2KBEA 2DY1A 2O8DA 2GETA 3AF1A 4GOXA 4PHGA 3R9XA 3DO6A 5G41A 1YZTA 3KTAB 3AVTA 2CE2X 1M1YE 2QPTA 3TK1A 1I2DA 1GITA 4L8GA 5JMTA 4DLRA 2J5XA 4PFSA 4IDQA 3AKYA 4QJ4A 2EFGA 2QGNA 2WPDA 1CU1A 4ZDIA 3RRNA 1J90A 1F48A 3HYTA 4BFTA 1JJ7A 3L0OA 1IY1A 3P32A 1UKZA 4IDHA 3H86A 4IOKA 4RZXA 5FOWA 2V6ZM 1DAEA 2B6HA 4JKIA 4MUAA 1ZW6A 4WAUA 3SHWA 3THOA 4EJSA 3GLHA 1E2HA 3AVYA 4Y0VA 4J0QA 1OLOA 2FPMA 3HR7A 5H1YA 5JSZA 2QMEA 2F3TA 3SYKA 1XEFA 2GK6A 4DEYA 3KZ1E 5KUTA 2QMHA 4A92A 2Z0MA 4GRAA 3OEEA 4NYJQ 5BN5A 1D5CA 3FKSD 4ZDJA 5EXTA 3TE6A 4F4JA 1P75A 1PLLA 1P60A 4MUBA 4CEIA 4CEJA 3T61A 4NCJA 1RJ9B 4QBFA 4R2HA 2H92A 6Q21A 4HZUA 1OYYA 1E1RA 1G291 3VMFA 1S1CA 4QBIA 4DJTA 2ANBA 4BLPA 2YNMA 1VTKA 2GBLA 3IUYA 3G5UA 4KBGA 1AZSC 4Y0AA 3P4YA 2WVJA 3RS2A 4BZXA 2A5DA 1AGPA 4B3XA 2CJWB 4KFTA 2VSOA 3CZQA 2FA9A 4B6FA 4V02A 2WBLC 1GFIA 4Q9IA 2C77A 4EFNA 4LV6A 1WMSA 4V0LA 2BBTA 1F2TA 4F91B 2GEUA 1G8GA 4OKSA 4GOJA 1X37A 1DAMA 2DWZB 1P9WA 4Q4AB 2O0HA 1Z63A 2TMKA 5JHGB 3CKLA 3K09C 5FPSA 3HR8A 4B76A 2WJIA 2HDNB 4Q4JB 1GVNB 3ZS8A 2GKSA 1G19A 5J4KA 3EPHA 3ICEA 3KL4A 4QL3A 4EQ6B 4XVRA 4JJKA 2HEIA 4QC2A 3QPWA 1G3UA 4NCNA 4PZZA 2D62A 3RS3A 1RRGA 3W8NA 3U6KA 3KQLA 2C8VA 4NDZA 3THYA 1JXOA 1EGAA 1NL3A 3TSZA 4ESVA 2A2ZA 2RB4A 3NBYC 2OV2A 2HJVA 2IYWA 2VO1A 1NVVQ 5TMPA 3OE7D 1KO8A 4OI1A 1S4QA 1TQ4A 5K8LA 2RHMA 2QTHA 2OG2A 3A58B 2X2FA 2RH5A 1G3IA 4TQUS 4W5JA 3IIKA 2R6GA 1E4VA 4YMVA 2CDNA 1JQJC 3FMIA 1FTNA 3CR8A 2QMUA 4JBWA 5JHHB 1G6OA 2H18A 1WXQA 2Q9AA 3TSOA 4EJSB 3SN6A 3IHWA 3GLHB 1N6IA 5HCIA 3A36A 5JSZB 2FF7A 2GILA 2PMKA 2CXXA 1U8AA 4FWIB 4LX0A 2FFBA 1JPJA 1N5IA 4Q7MB 3TNFA 4EIWA 4CEIB 1ESNA 1ONBA 3T1QA 4X8HA 2OXRA 1CEEA 2IXFA 4Z54A 4XD7A 3OEED 1CR2A 5F2EA 1KJWA 1T9HA 3TW4A 5K8IA 1Z28A 2FWRA 2J0UB 3ADKA 3GJ3A 2G77B 2GAOA 4LYFA 2GBLC 5A4JA 2XGJA 2R8RA 4BFUA 4TLDA 4MDEA 2YOFA 2AX4A 1GILA 2VH5R 4KXFB 3TMKA 1JR3A 3A1WA 1E1RD 3QF4B 1DTSA 4PHFA 3SYLA 4JZKA 1ESMA 1CJKC 4KFUA 3NTUA 4PPNA 4M1TA 2NO1A 1ZUIA 2JEOA 1BOFA 2PCLA 4K81B 3VR4A 5LD2B 1U90A 4M9QA 1OF1A 4C0HA 4WZAE 3VNUA 1KI1A 1G7TA 4KLZA 2REXB 4W5HA 1IY0A 3K53A 1YZQA 3KQHA 221PA 4QGAA 2GEVA 2ZRGA 4L9WA 5JJLA 2ZRDA 4LV5B 4BEBA 4B71A 2O0JA 1N6NA 1SKYB 2YVUA 1XEXB 4PPGA 3M0EA 3AGQA 2DWQA 1MKYA 1G5TA 3AKEA 1GNQA 2IF2A 3A4LA 3T12A 2PEYA 2ZAOA 2F9MA 2GZAA 4NZYA 4ZIRB 3CZPA 4ILEA 5G3ZA 3EXAA 1G3QA 3RS5A 4FCTA 1XTJA 2X19A 4JLJA 2GCNA 2C2HA 4V0MA 2B21A 4QHSA 2WWHA 4ZDWA 3CF6R 2ZEJA 3FFAA 3R9IA 5BWMA 2IS2A 4LHWA 1NMXA 4OQXA 4AD8A 4M4SA 5GVSA 3ZLJA 3KB1A 4M1YA 4E03A 1OH6A 2CHQA 5LB2A 5HE9A 1S0UA 1GG2A 5FUYA 1G3MA 5DH9A 2FSGA 5CLQA 4EFMA 1XTKA 3SR0A 2N42A 2CVFA 4FN5A 3TSWA 2VRWA 1UBCA 4LC0A 4G5SA 4QJ5A 3KJHA 4TMZA 1ODFA 1T8UA 2REBA 3G82C 4GMDA 4TZ6A 4RJLA 4YDSA 2OFWA 4BPBA 5H70A 2P3SA 1NJGA 3KUDA 1FW6A 3AUYA 1JECA 4RD6A 4TZ0A 3MD0A 2DFNA 1JAHA 1F6BA 2QP4A 5LDDC 1XCMA 2XTNA 4UJ5A 1DPFA 1KY2A 1MABA 4HSEA 2VHUA 4M9ZA 4AK9A 4LRTA 2ORWA 1VG9B 3GJXC 4NBSA 4TWZA 3P1JA 1F5NA 2DB3A 1XP8A 1NP6A 2CLCX 1M7GA 1P6XA 4H1UA 2HF9A 2Q3HA 3LXXA 1D8TA 4P4SB 1OHHA 3DM5A 1QBKC 4FCVA 4EAQA 5FFMA 4LJ9A 1N6OA 2WSSA 4B2LA 3V4RA 2ZJZA 3LNCA 4XD7D 2ZRNA 4G5OA 3SFZA 1X6VA 2NQ2C 1YR7A 3E70C 1N0UA 2BM1A 1GWNA 1SKYE 1UEIA 3TUIC 3DZ8A 1G3RA 3PFIA 3M1IA 4QHYA 1JR3D 1XF9A 4PAMA 2RHDA 5FPKA 3FMPB 3D3QA 1GL7A 3JVVA 4RD1A 2OUKA 4LYHA 1FNMA 4PC3A 4NYIQ 3K8YA 3CLVA 3OAAD 4ABYA 4D80A 1R0YA 5J5CA 3CIOA 1A2KC 3AVOA 1E2LA 4DT1B 4TMTA 4GZMA 4JLPA 4KVAA 3C7KA 3T06B 4L4UA 1U0HC 1RYFA 2PJRA 4HB2A 4DIDA 1E2GA 1XZPA 2IEZA 1YR9A 2CVHA 4M1MA 1ZD9A 5A5GA 1FQKA 1SKQA 2ZQ5A 2ORIA 4PAQA 3D6TB 1BYUA 1RE0A 1XX6A 2FFHA 2WJHA 4QKQA 1NBMD 2J0SA 2ZR7A 2PJZA 2ZXUA 5JBQA 3FHTA 2PL3A 1AA9A 1S1MA 2ZS9A 5AUNB 1JEDA 3WHKA 1TEVA 1NMZA 5DO9A 1DS6A 1E0SA 3NKVA 1WF3A 2IUTA 2Y8EA 1RVDA 2H16A 2AK3A 1NSFA 1GAJA 3EA5A 5FTNA 1E96A 4A0GA 4DEXA 1BH2A 1VG0B 2CK3A 4A8JB 5KSOA 2JJ1D 3L43A 4PO8A 5GVRA 3JZAA 4M1WA 2RGCA 3IQWA 4KVGA 4TMWA 3AJIB 2QAGC 1P9RA 1DELA 1KTVA 2ZYWX 4A0FA 4FW9A 1AS3A 3AF4A 4HI0E 3RSLA 1TTTA 2H7VA 1DADA 3VHLB 2JJ8A 4LHYA 5FOTA 1R7RA 5CM8B 2WSMA 3VX4A 1IQPA 2OILA 4F92B 4P4TA 1G8YA 1NY5A 3M6AA 4BFYA 3SZRA 4JLNA 3QVVA 2C9YA 3LXRA 2BHRA 3O8RA 5KO2A 2OO7A 2MSCB 2GVZC 3RWMB 1IN8A 4AIIA 4AC9A 2IYQA 3QXHA 2PBRA 2FNAA 1YZGA 1LB1B 2REOA 4B44A 1ZCBA 4Z51A 1DO2A 4P31A 4IEEA 1DG1G 1OHHD 3TQFA 1YU9A 3GJ0A 4GI7A 1US8A 1QHIA 2WSSD 3DMNA 5AUPB 3W3ZB 1ZNXA 2C03A 2CL0X 1R0ZA 4GFDA 4JSTA 2F55A 4LBVA 5KDLA 2FG5A 1HURA 1LY1A 3PUWA 2V1UA 3W6PA 2JJ2A 2FFAA 3AP2A 5FUXA 3TUJC 3FMFA 3CWZA 3SBEA 2FEMA 1NBME 2GTPA 2W0MA 1JEEA 4DCVA 3TH5A 4PQRA 2HLDA 1KJZA 5FR2A 1IN7A 3MGCA 5JS8A 4HZIA 2IYSA 4LYAA 1GRNA 1KNXA 2G6BA 1KNQA 2A5YB 2JLWA 1N2CE 1UDWA 3I4LA 4JVLA 2W6JA 3H2YA 3A4MA 1P72A 1G64A 1G5PA 1D2EA 3ONWA 4A82A 1TMKA 3B1XA 4LCBA 2IA5A 1KYIA 1Z83A 4MA4A 4QXAA 3W6NA 1PUIA 5E4FA 3U3JA 1X8LA 1LTQA 5EZ6B 1KJYA 3PV0A 4MH0R 4P33A 4X8LA 1KKLA 1G7SA 1AQUA 3QPVA 1K6MA 1JJVA 3WNDA 3QXSA 2G9NA 1N6KA 5JJIA 3RLFA 4XWKA 1NJFA 3MG9A 1LNZA 1EXMA 4HUQB 2RGNC 1OXVA 3CRVA 5FL3A 5EXXA 4DLYA 1GNRA 4D26A 3RC3A 1P2VA 3H1TA 5KSZA 1KO4A 2ZJOA 1EX7A 2W0SA 2P2LA 4DSOA 5JRJA 3TVTA 1WP9A 2QNRA 4B48A 3AM1A 1AS2A 3MJRA 3CNNA 2G0NA 3EC2A 1SVIA 2ZRJA 2CK3D 4KFRA 1J99A 1P4SA 2XNDD 3PR1A 4H1VA 1RFLA 1SHKA 2ZRBA 3QENA 1GNPA 5D3MA 4IXMA 2V6IA 3WBKA 1IAQA 4HLUC 4QOSA 4LZZA 3ZZTA 4LHZA 5JI3E 3A37A 3BFKA 1M74A 1Z3IX 4CRWB 1OB5A 2BMDA 2ODEA 1KO1A 4AYWA 5UKDA 4D4LA 2EU8A 3BFXA 1D9ZA 4FI3C 1EFHA 4PX9A 2R44A 4QG7A 2XTMA 2G1KA 4U02A 1RRCA 3ZVLA 2HV8A 1G18A 4B43A 2UKDA 4ZCIA 2VHTA 2HUPA 3GJ7A 3K9NA 5SZIA 4BLOA 2IT1A 3R7WB 3VU9A 2NMVA 4GNKA 2VP6A 1E99A 2V6JA 1LS6A 3M4YA 4ZCLA 4LPSA 4GITA 2Q3MA 5JI2E 2XJ9A 2JJ2D 3UXMA 1PVOA 3LD9A 3SJZA 3VKWA 1XJ0A 1ZAKA 3UK6A 1ETUA 2GJKA 2CNWA 2OCAA 1P3JA 3IEUA 1X1SA 1MV5A 4R2IA 2F1JA 1L4YA 3BH7A 1UAAA 5E7JA 1JALA 1OPXA 3REFA 3U60B 2OE2A 1N6PA 1OXXK 2GNOA 2O5VA 3GLFA 4Q1CA 4TMXA 1N25A 4YMUA 2W6JD 3UANA 1CR0A 3ZGXA 4QHTA 1CR1A 1QHNA 1HA3A 3Q7PA 3WYGA 2XXAA 2FPKA 4HDOB 2EFCB 3TAHA 1YKSA 5KSYA 5BYKA 4JJZA 1AK2A 3A1TA 5AUQA 1KK2A 4IOJA 1A1VA 3IO5A 5JZVA 4URYR 1O87A 2HXSA 3P20A 5D3QA 3ZS9A 3K0CA 3U4QA 3QG1A 1S2MA 2IYUA 3RWOA 4X8MA 2YWHA 3SQXA 1XD2A 1NN5A 1SVLA 3QKUA 4FIDA 2QT0A 1XB2A 1GRRA 2OT3B 4Q4HA 4DBLC 4HEJA 2Z4SA 4LRSA 4HLQB 1YE8A 2V3CC 2G88A 3LBHA 2OSBA 3TRFA 4DKXA 1SXJB 1AN0A 1VG8A 1OKKA 3UWOA 3K70B 5F9FA 3LQRA 4Q5IA 4IHQA 1CJVC 3DOFA 3K9LA 2ZR9A 3G0HA 2GXSA 3A1UA 2O8FB 4RSGA 2IK8A 3A8TA 3LWNA 4HAXA 4RZUA 1Z6GA 1P2TA 1SXJD 4RD0A 4B3CA 1ZM4A 3K70D 2VBCA 1MO3A 4RZ3A 4PHHA 4OQLA 1XZQA 3QE0A 2VP4A 3ADBA 1CJUC 2J41A 4QBGB 3THXA 1NKTA 4MRNA 3W8RA 3I73A 2AD1A 5EJEA 4TL7A 3U7GA 2BVNA 4OK3A 4FWDA 2JASA 5FTLA 5L3RA 4AG6A 1X8JA 3T5DA 4LJ4A 5EXPA 1W44A 1ZMXA 2WAYA 1Z6YA 2VQSA 3AF3A 4TTRA 1TUEA 1T3HA 2C5LA 3AKCA 3B2EA 4GOKA 4D4JA 2XB2A 3VU9B 3U5ZB 3LX5A 2BMEA 4B3FX 3B6EA 4M0LA 1NVXQ 3ZJYA 4ESHA 5F9HA 2WOJA 1W4AA 4A0RA 4Q9KA 1U9IC 1ZP6A 3GEHA 2OAQ1 5G53C 1MO5A 2VHJA 1AQYA 2GZDA 1IN6A 4LBYA 2ZREA 1FUUA 3CONA 3GLGA 3UMSA 4DB2A 3U44A 1S9HA 1OE0A 3E1SA 3OHMA 1FTSA 2CNWD 2QZ4A 5TV2A 5G3YA 1G21E 8OHMA 5LB4A 3LH5A 3S1AB 4MGYR 2BCGY 1ZIOA 1GZSA 2NZ8A 4WXRA 5G40A 4D4KA 2GA8A 4HAWA 3T1TA 1W0KA 4AG5A 4PAOA 2F9LA 1JXMA 3U7EB 2XXAB 1HYQA 3B13B 4JT2A 1G41A 2EYUA 4PSKA 1W48A 4MRVA 2J9RA 3LBIA 4NCIA 3NH9A 3P27A 3VQTA 1SXJE 2MSDB 4D81A 3KB2A 5E95A 5BYJA 1Q44A 3MCAA 3CRMA 3ICQB 4DVGA 4CF7A 2R6AA 4QRHA 1T3SA 4YQFA 1QHGA 5J4LA 1DOAA 4Q1BA 2GEDA 4NYJR 2ZANA 1QDEA 2JLZA 3ADCA 1XTSA 4IFBA 5CIQA 2O8BB 4ERNA 1C4OA 4LC1A 3HWSA 1AS0A 4D82A 2OHFA 4XWAA 2QRNA 1OJLA 4LJ6A 2X77A 1I4DD 2FSHA 2NO6A 3WMGA 4Q7JB 2VP2A 4Q9LA 4G1UC 3PVSA 4ZCMA 2IX3A 3A4NA 1OKKD 2AWNA 3K0FB 2GJSA 4ASUD 3MFYA 3KFVA 1RC8A 3ZIAA 1PUJA 5JCPA 1BO6A 2GJ8A 3B1VA 3LDAA 4A0HA 3CRRA 2W2XA 4FWGA 4ITRC 1KHTA 3ASYA 4M8NE 3KX2A 5EXSA 4XOIA 4XSHA 4WW0A 1XCPA 5C2JB 2WJVA 2WKPA 3C4JA 3QKRA 4ZDKA 1Z6AA 1WBBA 3VKHA 4LDJA 4ZKDA 1SVSA 1DAHA 3QKSA 4DC9A 1UKEA 1Z8FA 4NU0A 2SHKA 1G17A 2OBLA 4L5BA 1GP2A 3NC0C 1ANKA 4PO1A 5FI0B 2FFQA 4RZ2A 2JLXA 4LHXA 3DHWC 4MKHA 3BE4A 2ZUBA 3CW2A 5AJWA 3MWJA 3SFVA 5B64A 4ZV4A 2A5JA 3C14C 4DLXA 4U7DA 1EWQA 4Q1FA 2E1RA 3ZDQA 2Z43A 1OH8A 3HPRA 3IO3A 3GLIA 3B5JA 1YZUA 3CPHA 3VLFB 3U44B 3KW6A 2FE4A 4V0KA 4S35A 2VIIA 4OQMA 4Q9HA 3W5JA 3X1YA 2DZOB 1YRBA 4FXPA 1N5LA 2VP9A 2QG6A 1WA5A 4DCUA 4D4MA 3BORA 2C96A 3V00A 2JLRA 2E9SA 4MRSA 1D2MA 1RW4A 1GRQA 2BKUA 2QUZA 4DDVA 5HPYB 3AH8A 2BKEA 1Z47A 2G0TA 3QBTA 2WV9A 1MT0A 1W1WA 1W0KD 4M21A 2V55B 1XEWY 3EA0A 1XFAA 3QNUA 4RY2A 2V4ZA 1YZLA 3PUZA 5FTMA 2KWIA 2P6UA 2FSFA 1K5GA 2ZROA 3KJEA 2AN9A 4OYHA 3CNLA 4C0SA 3B85A 1KZ7B 4L15A 3RDPA 3CF2A 5C1BA 4A3VB 1G7RA 1VHTA 1VG1A 3VR2A 4BLRA 3TR5A 3CBQA 1OIXA 1IJEA 2RGGA 2FH5B 1E0AA 3NHBA 2O8DB 1CJMA 5JEEA 4G5GA 3AF2A 5C4MA 3R9WA 1Q1QA 1UPTA 2BCJQ 3QUSA 1QHSA 2IYZA 3DKVA 3ZQ6A 2GESA 3RS0A 4PO9A 1GOTA 2IUUA 4Z1MA 4DLVA 4UNPA 1KI3A 3VR5A 4IJMA 2LKDA 2ONJA 4G5RA 4TN1A 3WP0A 5CB6A 2CCKA 4IDOA 5CJPA 1YJ5A 1IN4A 1O3YA 2FPLA 2J7PA 4EPXA 1KI6A 4KSCA 2WWIA 1RRFA 1D6JA 3QKRB 3F3YA 4OJQA 2JLVA 2WPDD 3EARA 3H0KA 3BOSA 1UADA 2PEZA 4A6PA 4EDHA 3DDCA 3BB3A 1PLJA 2QSZA 1OH5A 621PA 3AUXA 4PC7A 4MQBA 1TF7A 3FDIA 3U7HB 2AL7A 4MYCA 4FMBB 4Q48A 3REGA 3HU3A 5EP4A 4AKGA 1KSFX 4CEJB 3C8UA 3SQWA 4MDFA 1HE8B 3K0AA 4UXIA 3K0EA 5HKKA 1CBUA 4HZUB 3IDQA 4YMSA 1XRJA 4URUR 3DZDA 1E9SA 3GFOA 3OEHA 2IXEA 1QVAA 1QZMA 3AVPA 2ATVA 2VP0A 4C0LA 5AWFC 1XBTA 4QM6A 3UIEA 1ZBDA 3WRXC 3EAQA 2EFEB 1XXHA 1G1MA 2HCJB 2KI5A 2NOAA 2ZYUX 3L8YA 4LK2A 5CM9C 2ZI7A 2QEQA 4Q1EA 4WXPA 1T3LA 1F2TB 2BIFA 2ZJ8A 4OI0A 3KFXA 2EVWX 4B2PA 2PLFA 2EFHB 4B32A 4DB4A 2AXPA 4RFSA 2O52A 4BFWA 4JLBA 1TQ6A 3BGWA 3GP8A 4QNMA 5P21A 3TKLA 5L3SA 2JA1A 2OM2A 2QRZA 1S8FA 1OFUX 1XD9A 2D7CA 4XWOA 2JATA 5KDOA 1E9EA 4MYHA 4TTPA 1LF0A 1UFQA 2WTUA 5FH9A 3KDSE 4IFEA 4XIGS 1OXUA 5LD2C 3O8DA 4CYMA 2J87A 2C9OA 2CLDX 2BWJA 5JCZA 2DZNB 3V9PA 4A2WA 3FKQA 1E2PA 4PQYA 3THYB 2DVWB 2NG1A 1CS4C 5CYOA 2QE7A 3NEYA 2C9CA 1E79A 1KI2A 1U8YA 1X1RA 4LUCA 5CDFA 3CPEA 4ARZA 2ZIAA 3GLHE 4G5QA 1KSJA 1NKSA 1OFTA 1XTIA 5EUMA 2QY9A 5GJBA 1IHUA 3CPJB 4Z8XA 5JECA 2VA8A 4BLSA 1G16A 2YJTD 1GIAA 2ODWA 2W2TA 3KKQA 2R6DA 4MKIA 2A30A 4NYIR 2XAUA 3RRMA 3WYAA 1E9CA 1KOFA 2QP3A 4WOPA 3RSOA 2J7PD 1F3OA 3T1VA 3DKPA 4KSBA 2ZAMA 1W4CA 2QAGA 3CR7A 1R5BA 4K8OA 2ZYTX 1XDBA 3CWQA 3WMEA 2QENA 4WZBE 1AGRA 1DAGA 3AF0A 4P32A 2WJJA 2EFDB 3GD7A 4TLBA 3KXKA 3EX7C 2IW3A 2WWWA 1XTRA 3AGPA 4OQFA 3DM9B 4B74A 2QP9X 3MAAC 3SJCA 2HYIC 5JS7A 3GJ6A 5F3WB 2O8CA 2XOKA 2VEDA 5BW8A 2ZTSA 1RKBA 3W9YA 1ZM7A 1QZXA 1KIMA 2ZRMA 3WYFA 3SEAA 4BUJA 2Q0HA 4RD2A 4JS0A 5HE8A 4KBFA 3X1DA 5JFGA 1VKJA 1Q57A 1COWA 4DUGA 1R10A 2EQBA 3VX3A 3PUYA 3B9QA 4BRWA 1XXHB 4NE2A 4URZR 2F6RA 1UBEA 3SBDA 3ZH9B 3OIWA 3ZD7A 3D31A 2DCUA 1J8YF 2O8EA 1A5TA 4LGMA 2A78A 2OLJA 1NVWQ 3NC1C 2OCYC 4JVNA 4NONA 1HT1E 1S3SA 2P6NA 4RCZA 4QBHA 1C1KA 2GAAA 2NO9A 5DYIA 1KZGB 5FUWA 5AJYA 1EK0A 3FOZA 1CXZA 5FBVB 3BXZA 3RS7A 5J4HA 5KYKA 2IYLD 2XTZA 1N6HA 3BH0A 3QY0A 4IOLA 1G6HA 1VYTA 2Z83A 5IT5A 1KSHA 2GRJA 2OXCA 4C7OA 2ZUDA 3HU2A 2ORVA 5EE3A 2OLKA 2AWOA 2ZE8A 3SS8A 1M2OB 3BIFA 4NMMA 1M8PA 2AXNA 4NH0A 5GJVC 3K0SA 3CM0A 4XH9B 2YZ2A 3C15C 5HR5A 3LY5A 3VNVA 4KJZA 1I4LD 3L0PA 1NG9A 3SC3A 3O8BA 2QTFA 4MYUA 1F60A 1Q22A 4PHTA 1OH7A 2V54A 4B6EA 1W2GA 2N1BA 4LV8B 4A2QA 1E2KA 1TUIA 4BQSA 1E3MA 2QE7D 1WQ1R 4JSYA 1Z0KA 4KO8A 4TL6A 1U81A 2IWHA 5DIFA 4DLTA 2VHCA 2RGNA 3LLMA 1KK3A 1M7HA 4D0GA 1R5NA 1ZD8A 5DI3A 2WWYA 1YQTA 3EW9A 3Q5DA 2YOGA 1IM2A 4URXR 3LVRE 2HT1A 1LF5A 5TB5A 1YR6A 1MABB 2CLSA 1E9AA 1JR3E 1UBFA 4BZPA 2BBWA 2J3EA 1BIFA 5FOSA 1HH4A 5EE9A 1ELOA 4RFVA 4A8JC 4HLUA 1TPZA 4PZYA 1N5KA 1XMIA 1P5ZB 5AJVB 5FBLB 3L82B 3P26A 1G4UR 2JLSA 4BEJA 2AFIE 2XOKD 4US0R 1NRJB 1G8HA 2ANCA 3F8TA 1XTQA 4LPKA 4NYMQ 3ADDA 1R8QA 4TTQA 1GM5A 2YINC 4N3NA 4YXWA 4KYIB 2KE5A 3RHFA 4GL2A 1N6RA 3R8FA 2IHYA 2KBFA 5K8UA 2A5GA 1FQJA 4LJ7A 1HV8A 3EG5A 2F1HA 2ZSFA 3PEWA 4QGHA 1COWD 1U2RA 4DUGD 3AQ4A 3QVUA 1U8ZA 1EX6A 5FUVA 2CCJA 3BJIC 3MWYW 3U3KA 1OFHA 1G8FA 4CEHA 5EE1A 4V0ME 4G01B 4D0NA 1CIPA 2J45A 3E5HA 1II8A 3NIBA 4TLAA 4A4DA 3L8ZA 3T35A 2F7SA 1AM4D 1G5RA 4TYNA 4HATA 3SDZA 2OCBA 1TU3A 3CNOA 3IPYA 4KU4A 2BJVA 3FB4A 4PZLA 4DWJA 1WRBA 4TMVA 4LBZA 4B3BA 3KKPA 5CB8A 1A4RA 3NDBB 4NPHA 3LW8A 5GJCA 821PA 3SI7A 1DBSA 1W47A 4QGFA 4CIDA 1GDDA 3O8CA 1MO4A 4I81A 421PA 4AKIA 1E2MA 1BMFA 3X1ZA 5JWRA 1E9DA 3HP1A 3TW8B 3ZD6A 1E2JA 2QGZA 1TQDA 1Z6XA 4Q21A 4N0DA 1W2HA 4HYYA 1W0JA 3QG5A 2QBYA 1EWRA 2QT1A 1YVDA 1KO7A 1NIPA 1ZIPA 5E7MA 3F5FA 1I2MA 5TVKA 4B33A 1J7KA 2GZHA 3QBVA 1VIYA 4P3YA 2IL1A 3ZYCA 1NLZA 4A15A 1ZYUA 4CVNA 2V1XA 3SHFA 5B58C 3LLUA 1P2SA 1XMVA 2BM0A 3BAFA 4JKYA 2RGBA 3UG7A 3FGNA 1XWIA 4OI4A 3TQCA 4WVFA 2WIBA 3CH4B 2Q9BA 3WP1B 1WE2A 1Z6TA 5CK4A 3LQQA 2NGRA 1YRAA 1KDPA 3KQKA 2ZS7A 1NMYA 3EPLA 3VTKA 2WWXA 2GCOA 2FV8A 3GJ4A 2FMXA 2XITA 3VR3A 1VYUA 2ZPTX 1UEJA 3JZMA 3ZVNA 2OFXA 1RZ3A 4LSGA 3PUXA 2J0VA 4UNQA 3EIQA 4URVR 2C99A 2ZSAA 1DVRA 1US8B 4JLDA 1FX0A 4EPTA 4TYYA 1D2NA 4OJKA 5H8WA 3R8CA 1SQ5A 1BKDR 2CEAA 1G9XA 5F98A 4YXWD 4ACBA 1TF5A 2ZE7A 1L8QA 4HDCA 3IILA 4UQOA 2RGAA 3UMRA 1UM8A 3UPUA 3L2OB 3QQ5A 4CEHB 1QHHA 3EIEA 2ZYVX 3U61B 3B1ZA 1U9IA 2RMKA 4LJ8A 3MWLA 4R98A 4GZLA 1R0WA 4CDGA 3W5IA 5GADl 4M2LA 2F43A 5L3QA 3AKDA 1F2UA 4L16A 2HLDD 3LRPA 1KI8A 2FOLA 3PIRA 1DARA 3B1WA 4UXHA 2D3WA 3GQBA 5ELXA 1W36C 1KDRA 4WA7A 1NF3A 4XSGA 1QHXA 5JJKA 3MRSA 3UG6A 1V43A 1XMJA 2D4HA 3QKTA 4OHYA 4R7ZA 2DFTA 1L4UA 1L7VC 1WDTA 2GK7A 3I3SR 4JYBA 1PLKA 3U6BA 2RAPA 3MHVC 3AVQA 1SZPA 2WICA 2ZSBA 2GWHA 721PA 3EZ2A 4TL8A 2C78A 4Z8YA 3X1XA 2YC2C 1IONA 4HDQB 1BMFD 2P5SA 4OL0A 3UKDA 5BXQC 3WY9A 2ZJ5A 2CMKA 2YC4C 1CKEA 2Q9CA 2ZSEA 3N5CA 2KJQA 3K9HA 4LWZA 4D6PA 4FWTA 2GF9A 3V4FA 4MITA 2OFOA 1KI4A 4TLEA 1AIPA 1CULC 2ERXA 1FUKA 3UMFA 2B7BA 4PC6A 5SZKB 1HQYE 2BMFA 2YHSA 2FZ4A 3RABA 5J4VA 5DGXA 1VYVA 1KMHA 2V7QA 3CH5A 4Q1DA 4E5UA 1GKIA 5D3MB 2P5TB 1P61B 4HAUA 1M6NA 3OF5A 3IQXA 3VHXA 2A3RA 2C95A 3B1YA 4KI0A 4OHWA 2ZJYA 3CUEF 2QPAA 4KV9A 1JBKA 2ZE6A 5DISB 2ZJ2A 4A2PA 2ZUCA 1Q1BA 2AK2A 2PCJA 2B92A 2Z4RA 2AHOA 2IS1A 4BFVA 1ZC3A 2VL7A 4B73A 3P4XA 1FL9A 1SXJC 1OSNA 1ZC4A 2Z5FA 4I1VA 4AYXA 3K70C 4TLCA 3TJZA 2VSXA 3EC1A 3E2IA 5FPTA 5AK0A 1Z29A 1GL9B 1Z06A 1XJCA 3KTAA 2HF8A 1ZM3A 1Q1ZA 2PT7A 4IDPA 3BERA 3Q72A 4M53A 1QVRA 4GT1A 1FPMA 4TQAA 4JL5A 2QMOA 3PENA 121PA 1K5DA 5CLLA 1LS1A 4YONB 2X8AA 5TXGA 4BFSA 2ZRKA 5CITA 2VHQA 4GP7A 4E09A 1R8SA 4G0NA 1IJFA 1HT2E 3GFPA 3LVQE 3PEUA 4V0OA 4DDTA 5L3QB 2N46A 2EYQA 1GSIA 2GF0A 3F0TA 3FMOB 3KXLA 1Z0FA 4Q18A 5FR1A 4HLDA 3T15A 1J70A 4HLCA 2W83A 1T0HB 3GLFB 3KUCA 3K9GA 3AP3A 3QOFA 4R9UC 1JQLB 4P0TA 2P0EA 4I99A 2CHGA 2H57A 1T0JB 5J47A 1SVWA 1EFUA 4BE7B 1MRNA 4YDHB 1NN1A 1ZCAA 2WKRA 5DNYB 5EP1A 1KK1A 1NSTA 1OIWA 2PZFA 3IIJA 4LI0A 3J81k 1XPRA 1RJ9A 2ZRHA 3OZXA 3RRYA 4D25A 2VF7A 2ZI5A 1IXRC 4JYCA 2J59A 3U4QB 3Q3JB 3OIUA 1I4TD 4Q1AA 1JB1A 4RKFA 1XD2B 4Q4HB 2CJWA 3AVVA 1Y3AA 2JIZA 2VLIA 4Q4LA 4RD3A 3CRW1 3TIFA 1W4BA 4N1AA 2NPIA 3MWKA 4L9SA 4O2RA 4OQNA 4EPRA 3NWJA 2C98A 4IRUB 3PXGA 4B34A 1LW7A 2ODNA 4Q03A 5EP3A 5EUQB 3GJ5A 3DPUA 2AR7A 2VP5A 2ZSDA 4GDFA 3X1WA 1HQCA 4ZKEA 3GMTA 2EW1A 4Q4AA 3PUVA 5DSZA 3A6PC 2V7QD 4E22A 4DSNA 3FPAA 5CK5A 3RYTC 4DCSA 2Z6VA 4FMDB 2XZOA 3THXB 4CW7A 2VF8A 3LA6A 5GJWC 4EQ6A 4MRRA 3NEJA 3I62A 2WJGA 2QQEA 2GCPA 3KKNA 5KNCA 3HU1A 1ZNWA 4TYPA 1VIAA 4JL8A 1DO0A 3ND9A 3OE7A 1J2JA 3WNCA 5BN3A 3ZVMA 1CRPA 2ZS8A 2FGJA 4Q47A 1NN0A 1XD8A 4NL4H 1JAIA 2BBOA 3LW7A 3QEJA 1R5OA 3GLFE 3BK7A 4UNNA 2R2AA 5SZJA 3QI2A 4CT4B 4BLQA 2BDTA 4U00A 3RAPR 4EFLA 1IN5A 1KKMA 1P62B 3IIMA 3A1VA 4KHZA 2DHRA 4V03A 2X1VA 3GLGB 5EE5B 1U0LA 2JCSA 2R9VA 4JMPA 5KTYA 5B2ZA 2GXAA 4OHXA 4F93B 1NVVR 2YWEA 1TU4A 4LJ5A 3THWA 1ZNYA 2H8KA 3CX6A 4LRWA 2B7CA 3D8BA 3VR6A 2NPFA 1N0WA 4Q01A 1C9KA 1FMLA 3ECCA 2MMCA 2HCBA 4F4IA 2ASEA 1C1YA 3QXCA 1KAGA 1JNYA 3WXMA 2J0UA 1OFIA 2IBMA 2DWOA 1NG1A 4M9SA 1ZNZA 5K8TA 4Q7KA 1A82A 3B8HA 3QF4A 4IW3B 3SOPA 1W49A 4IKEA 2XX3A 4OK5A 4LHVA 3VR1A 5JEDA 4PTLA 1KY3A 5KNDA 3NH6A 4PQFA 1NNEA 3X2SA 4BLTA 3AVXA 2JIZD 2PH1A 4QGGA 5AJZA 3W34A 5LPNA 1G20E 1N6LA 2ZI3A 4GBMA 3QSYA 1QF9A 2ZITA 4EPVA 5AR1A 1FZQA 1BYIA 2AKYA 5B30A 2YYZA 1XEXA 1E0JA 3WHLA 1ZVQA 2ZRFA 2WOOA 4O2LA 2VSFA 2QU8A 1A2BA 1CP2A 2V9PA 4LOAA 1CF4A 1YZNA 5H68A 3ZIAD 4ZIRA 5KPJA 4DLUA 1WBDA 3QJYA 4DCNA 3T1OA 1Z5ZA 2IYYA 2NO7A 3IBGA 1NY6A 5KPDA 5JWOA 4A36A 4OHZA 2ZR0A 4Q7LA 3QKSB 2A5FA 2QSYA 2FEOA 4PANA 5L3VA 1VMAA 2D7DA 4ZO4A 2FSIA 2B8TA 4NKRA 4HAYA 3GLGE 1IXZA 1FNNA 1XEWX 3BB4A 2FDCA 1MH1A 5BN4A 3B7GA 1Q0UA 2L0XA 2ZU6A 1DAKA 1SGWA 1U98A 4S2EA 5CIWA 4C0KA 4XTCS 2QPOA 3KJIA 1G7CA 4GSYA 4D2IA 3GLIB 1CTQA 4IVQA 4M1KA 4EJSC 2CL7X 5AUOB 3N70A 1E4YA 4ZPXA 1WCV1 4DSTA 1ZUNB 1RIFA 5FOXA 3B82A 3THWB 1TX4B 5HZKA 1D9XA 1NIJA 4O25A 4KLNA 4RCYA 4U5XA 2K5UA 4C0JA 1W7AA 3B60A 4CT5A 2W58A 4AKHA 4HB0A 2J0QA 1Z0IA 2XJ4A 2CCGA 4JN6A 3BC1A 4C9BA 1E2IA 2EWWA 2JLQA 1MR3F 4AURA 4GMXA 4FMCF 4W9MC 2Q3FA 4P4SA 4D0LB 1ZM9A 2ZI6A 1FMJA 4II7A 1NLFA 4MRPA 4QM7A 1R0XA 1ZINA 1Z2AA 4YLGA 3OFNA 4ON9A 1TL7C 4C2UA 1N3BA 4Q00A 1E1QA 2P65A 4FD2A 5HCNA 1HEIA 1E6CA 1EFTA 1H8HA 4AWXA 3OAAA 3CF0A 3FFBA 3GEIA 1KK0A 4YC7A 4FMDF 2V8OA 3AB3A 3MLEA 4KODA 2PT5A 3HPQA 4XVUA 2JDIA 2WKQA 4QNRA 3KKMA 3MJHA 3I72A 3FTQA 4CZ2A 1UKYA 4TSFA 1XNJA 1AKEA 4DT1A 3TR0A 1VCOA 1UJ2A 4NTZA 1E69A 3FWYA 3RRZA 3I1FA 2R65A 3W3AA 2KSQA 1LFDB 2LKCA 4DDWA 5KOYA 3CB4A 4Z1MD 4P4UA 2GJ9A 1S3GA 4KFSA 3I32A 1KI6B 1NBMA 2ONKA 1RRPA 2OCPA 1FFHA 2A9KA 4EUNA 2J1LA 3FVQA 3GLIE 3SNHA 4DHEA 4TYQA 2G83A 4B35A 4BGDA 1TQ2A 4MYTA 4YMWA 3H4MA 2FJUA 3H84A 3U3OA 2YV5A 3K1JA 1TAGA 4PXAA 1SVMA 3DOEA 2QAJA 1VDZA 2JJ1A 2GJAA 5AJXA 1Q1EA 3BBPA 4XVQA 1PZNA 5A0FA 4QJ3A 1A7JA 3K0AB 1QG4A 4IOMA 3T34A 4DLWA 3AV0B 2PX3A 4US2R 4JLKA 4A8JA 3W90A 1H8EA 3VAAA 4BASA 2NTYC 3BB1A 5FOVA 3QXXA 1ZU4A 1MRSA 5IK2A 3NBFA 1DE0A 5HKKD 2HYDA 5FTJA 3UWKA 3WRYC 2IS6A 3OEHD 4R71A 3MSXA 2PLRA 3IBYA 5M04A 2G1JA 3BFVA 3PEVA 1T6NA 4JBYA 4FINA 4LJYA 4MKGA 2QM8A 1E9BA 5FI1B 3NDPA 3WBJA 1VPLA 1GKYA 1ZD1A 1W5SA 4WIAA 1KO5A 1P2UA 5KU1A 4N0EA 2WIAA 4POAA 4GP6A 1T91A 4RFSB 4DLZA 4MGIR 3TGPA 3I8XA 3RVBA 5L3SB 1VCIA 3EZ9A 4PPQA 4AKEA 1GTVA 2XNSA 3LBNA 1FP7A 2I4IA 1M34E 1NVUQ 1P7CA 3LAWA 3NBXX 3AP1A 3TAUA 1N0VC 2NZJA 2RGXA 3FYHA 3N2EA 1EFRA 1KDTA 2NO0A 3OFND 1QRAA 4HB4A 4UNSA 1E1QD 2BV3A 1B23P 1CR4A 2ZE5A 4RD4A 2J46A 3ZZ0A 3KQUA 1H8HD 2QA5A 1W5TA 2Q21A 3KXIA 4JIMA 2BJWA 4DCTA 1KGDA 3EZFA 4DIEA 5FPHA 2JDID 4ARZB 5DYGA 4JBXA 3PCRB 2WM9B 4NYMR 3IKJA 5JWHA 1RPZA 1EESA 1QG2A 1BS1A 2QL6A 4TSFD 1OT3A 1L2TA 4JVMA 1E79D 1Q3HA 2D74A 3U7FB 3RANA 3TVDA 3W6OA 5HZHA 1PV4A 2IYVA 1UDXA 1AJEA 3EZ6A 2XSZA 3LFUA 5FBRB 1E2DA 1XCGB 4URWR 1H65A 2F1IA 2QAGB 3PQCA 4C0AC 1OXTA 1DAFA 2C04A 3RS4A 4MKFA 1R6BX 4MGZR 4C3ZA 3VFDA 3OESA 2H5EA 3BD9A 3R20A 1AKYA 1Z22A 4HUQA 3EWAA 4F38A 4ZI3A 1E9RA 2O8CB 2WZQA 3BWDD 3RNLA 1XXHE 3KKOA 1HUQA 3ND8A 4ACAA 5EZ5A 3ZVRA 1Z0AA 2QTVB 2H1LA 2XNDA 4IXNA 1J8MF 4KYUA 2RCNA 3NHAA 3SJBA 5J4YA 2QN6A 4QFMA 4C2TA 3CX7A 3SJAA 1H8ED 3CRQA 1SVOA 1R2QA 1Z0DA 2ZVQX 3N2IA 2AD5A 3IGFA 5C46F 1T5LA 4UNRA 3TLXA 5IK2D 4O3MA 5EP2A 2W6IA 2OBMA 4KITB 1PJRA 1RYHA 1WB9A 2BEJA 2VYFA 4NHOA 4UXJA 2O8EB 2ZJBA 1KMQA 3EIHA 4NCHA 2ZU0C 4TQ9A 2XEXA 2WWGA 2QROA 2IS4A 2I1QA 1EFCA 3BS4A 3I8SA 4PSVA 1E2EA 1FP6A 4RKEA 2FX3A 1JI0A 2CE7A 3OIYA 1NN3A 1G4AE 1Y63A 5DE3A 3Q9LA 2XZLA 4JLOA 3U3RA 3HDTA 1ZUHA 4NCKA 1R4AA 3O47A 4M1SA 3EWSA 1NI3A 4C7OB 1DG3A 2FU5C 5B57C 2YWFA 3TUZC 5CDFE 2WMNB 5E7IA 3U2QA 1VECA 2IYTA 3CO5A 3EPKA 2YWGA 4M9XA 2OAP1 5FL7A 4AI6A 2JLYA 3QF7A 4JLMA 3EASA 2DWPA 1HY3A 1ZU5A 1S96A 1VCNA 2JAQA 2P67A 3R7WA 3FHOA 1EFRD 4LYJA 1G8PA 2DR3A 1AZTA 2JGNA 2G3YA 2RGDA 5SZHB 5ANRB 1OYWA 1IOZA 5DHFA 5IDVA 3Q7QA 3LO5A 2E87A 4Q66C 5IRCD 2YKGA 2IUSA 3HYRA 3T5GA 3WNBA 2QORA 4LY6A 2GHIA 2HXYA 5JLJA 3C41J 4XJXA 4BECA 5JRZA 3VKGA 1T8TA 5DI3B 5DN6A 2ZRAA 5FBWB 4RVCA 2W00A 2QQ0A
chains in the Genus database with same CATH superfamily
2XSZD 3DBHA 1XPOA 4BBPA 1P4AA 3TIXB 3U6MA 4TL9A 4R1TA 2NX2A 1QRTA 1XZAA 4I50A 1MB0A 1P3QQ 4DR5M 2F4NA 1K3TA 2ATXA 4B4OA 5ILQA 2W6ID 2C2GA 4KMRA 1ZMWA 3QX8A 2FZEA 2IEYA 5IVDA 1OB2A 1DAIA 1UK9A 1IXSB 1PJBA 1XMSA 3WBFA 5FTKA 2J3KA 4ZJPA 4IMPA 1YZKA 4I4LA 3I5YA 3G3EA 1V25A 3M7IA 1Y81A 3OLZA 1BS2A 3ASZA 5FORA 4JJ7A 3Q8XB 2QSUA 1OAKA 1FYEA 5FBQB 3FTPA 4DSUA 2ZIZA 4RXMA 3ORFA 3ZVKA 3FRIA 2QYHA 3G1UA 3IDSA 3WJ1A 2WAXA 1BGVA 3NONA 1XMOB 3SYNA 1TRKA 4NMLA 1FFCA 1GKUB 4BVJA 2R46A 1RKXA 5SY4A 4BVLA 2R8OA 3WG9A 4LBWA 3L7JA 1JF8A 4ZO7A 2G82A 521PA 1N5JA 1HOXA 1RRKA 3FF4A 3A05A 3AW8A 1W46A 2O3JA 3PP8A 2AQHA 3WAGA 1KGSA 5TARA 3VH3A 4P36A 1GHTA 4RJJA 2PK3A 3N58A 3S8MA 3TBKA 1HTBA 1E94E 2DFKB 4PC2A 3HYCA 3PDCA 3HFJA 4G1FA 2ZJ0A 4HDNB 3MB8A 5DULA 3WA7A 3I92A 2FZLA 4DLPA 5JOQA 4UHFA 3WLNA 2EX1A 2EKDA 4WNCA 3PXXA 3ND7A 3HZJA 2QPTA 3EGIA 1TLTA 3IESA 2QXYA 4QJ4A 4WLUA 3AI2A 4N0QA 2H4WA 1LPNA 1VKOA 4F60A 5K8VA 2B6HA 1GLGA 2NV2B 4EJSA 1RLTA 1K82A 2QMEA 1TM3E 1NVEA 1MW8X 3AFOA 3ZWNA 4QBFA 1OYYA 1G291 2ZRQA 1V6CA 1AZSC 4Y0AA 3P4YA 5K4GA 1ZVJA 2FEWB 1USIA 4FFPA 1G5HA 4Q4CA 2WRZA 3N6VA 1I0IA 2C77A 4V0LA 5CGQB 3A0UA 5AD1A 3GH1A 1ZGBA 3TOVA 2HDNB 4W1SA 3WWPA 5CFRA 4L1KA 4LDQA 1NL3A 1UFKA 5DBGA 1U3GA 4MYSA 2Z6QA 4TQUS 5IVIA 3R74A 3VZRA 2DENA 2KMLA 2XYRA 2O5RA 1U3WA 1JBEA 4LY3A 1XLUA 1U0FA 3F3MA 2EKKA 1RCFA 2LUOA 1JR3A 3FPEA 3R7FA 4G84A 2Q1WA 1QE5A 2RHRA 3VR4A 4OV6B 3DHVA 4RKWA 2W11A 4NG5A 2OHXA 1G7TA 1CLEA 1SKYB 4XASA 4Q34A 1KQNA 3UXHA 4L4XA 4N12A 1GLNA 1M2OA 5LXTF 4ZIRB 3MBIA 1NOKA 1G3QA 1IDOA 2J30A 2ZEJA 1AKRA 3KB1A 5CW1A 5I3ZA 4U2DA 3HE3A 3NLLA 5HZMA 1XTKA 1VQ1A 4G5SA 4X66M 4TZ6A 4YDSA 2VFAA 4LOIA 2Q2OA 5DM0A 3GPUA 3P97A 1T36A 1T35A 3F67A 2QMQA 4B85A 4JN6B 4BNMA 4HFNA 3A98B 2DB3A 1XP8A 2CLCX 4V1CB 1G6KA 4C4OA 3SFZA 2NQ2C 3C8ZA 4YRNA 2BM1A 2C84A 2D2XA 4L4SA 5LA6F 4OX9M 3KZKA 1CJCA 2EA0A 3QVKA 4MUFA 5FO1A 4TV8A 1N78A 4NRVA 2YHAA 2MJLA 5BVGA 4ZQCB 3RQSA 1W88B 2PL3A 4AMUA 3FPFA 1Q0HA 3MIZA 4WY2A 4A0GA 3PUKA 2EIHA 3W5SA 1FU4A 3DP7A 4NXNM 3RAFC 3NYRA 3STYA 1A69A 3QUQA 3PHBE 3GCZA 1R7RA 3MMNA 1Z5NA 1NY5A 1CIJA 3ZOKA 3UXEA 4XQ9A 4PFKA 2PUEA 3I0MA 3BTVA 2REOA 4OHRA 4R0NA 4UTNA 4IEEA 4FSXA 1RWOA 2Z09A 5KDLA 1UZAA 1LY1A 1VYHA 2OSVA 1JZTA 1NONA 3A9CA 3ENQA 4OD0A 2H29A 4TUYA 3AKZA 3LECA 1Z33A 3EXHA 1B00A 5ISMA 1UDWA 2DRIA 3IR5A 2V0NA 1P72A 4HFMA 3ONWA 3PLNA 1AUAA 2R79A 1SUEA 1EK2A 2PMBA 3W6UA 1WW2A 1FSFA 3ZE1B 1OTRA 2XUIA 3FH0A 3KS9A 5CNIA 5LUBA 4DLYA 4LTNA 2QNJA 2MWMA 2W0SA 1D6MA 2OTCA 3C1OA 3MJRA 5E3IA 3PTAA 1ICIA 3KWFA 1N2BA 1RFLA 2PZBA 4B5KA 3DNPA 2NXCA 5FEUA 4E4TA 4ZA2A 2BMDA 4B4KA 1J9GA 3KHUA 1H5QA 1Z8DA 3QZUA 4X95A 3ZVLA 1GVHA 3E9NA 4O2BB 3VU9A 2PM8A 1E99A 3KAKA 4CM6A 3FUVA 2XUFA 2OCAA 1ETUA 4OPMA 4WOCA 2ZM6M 3H75A 3OJCA 3R3YA 5LJIA 5HDBB 4UOZA 2XZUA 2IHNA 1Z4MA 1AK2A 3ZGVA 4URYR 2IP1A 1H6DA 1X1CA 1DUIA 3DJFA 4OA5A 3DQQA 2JI4A 4JR2A 3A6FA 4CKYA 3N59A 4NC9A 4TWJA 5KAMA 3UWOA 4YAWA 1Z6GA 3H6KA 4RD0A 3N2YA 1AGNA 2X0KA 3CLTD 3VDUA 4KI7A 3MUEA 4D3DA 1X19A 2WAYA 2QLNA 1DOZA 2Y1WA 3GEHA 4F2HA 3SKVA 2JY6B 3G02A 3CONA 2QZ4A 1CVIA 1Z4PX 1UBTS 2XXAB 1H5UA 2PFSA 1W48A 1D1QA 4MRVA 4MK4A 4D81A 2DOKA 4F45A 1ZN2A 4BVBA 2IVZA 4X41A 4BQEA 2JLZA 1L7AA 1NHWA 4FNOA 4MMZB 3FGPA 1AS0A 4Z4CA 3IDOA 2YZKA 1RACA 3ZXXA 1LW6E 1S89A 4C3UA 2FX5A 1D7OA 3S6JA 4M8LA 3ABZA 1U2EA 1R6XA 4KE7A 4RZ2A 3MTAA 2QVCA 3MMZA 4C6TA 3SFVA 3ROXA 4I1IA 3HPRA 2H8GA 2GLTA 3B5JA 3AEUB 4E11A 4KWCA 4IBFA 4DEVA 5HIKA 5DVZA 2QUZA 3AH8A 3B7ZA 2G0TA 4PZPA 3QMPA 1NU6A 3L8DA 4V3BA 2V4ZA 4N48A 3KJEA 1H0KA 3CF2A 4FN4A 1N2EA 5JNLA 3PQ7A 2EUCA 3T5BA 4RQTA 1Y1SA 1Q1QA 2C3OA 4DV4B 2GTHA 2OG1A 5KCZA 2CW5A 3CG4A 2QRPA 2Q8PA 4MVXA 3FFWA 5EIWA 2LKDA 2ONJA 3BN3A 1DGFA 1G0NA 3I42A 3FHLA 5KYVA 4JBLA 1Y6ZA 3FNHA 3R3HA 3Q1LA 4HNQA 2X8WA 4EA8A 3U7HB 1NYQA 2AOVA 4N01A 3C8UA 3PXUA 4GW3A 4YMSA 3KFUG 3OEHA 2WJPA 3WL4A 1EU1A 4IDAA 2XYPA 2NOAA 3EVBA 4UM7A 2AYZA 3RLIA 1Q2UA 2JA1A 3DDOA 1S8FA 2D7CA 3FZEA 5A3JA 5AK3A 2Q7DA 4BMOB 3HUFA 3ZCPA 4F9EA 1CQIB 4CG3A 3O8DA 2WU3A 2A59A 3B36A 1FYDA 3SPXA 2QYOA 3SICE 1R9JA 4FR0A 3UV6A 4YECA 2XV1A 3JARB 2VDQB 3GI1A 4D4GA 1E2BA 5MDHA 1GIAA 2QP3A 4WOPA 1SUDA 4GYKA 5AW9A 3ZXUB 4EI8A 3WLIA 2CHFA 3SJCA 4N5MA 4HNVA 2Q3BA 3INTA 4YP5A 3HCFA 4CCSA 2P0YA 2Q0HA 4J75A 3NHUA 2QV7A 4MQ6A 2EQBA 3PUYA 1T2FA 4ZKDA 3EB9A 4IJKA 1UWVA 1C8KA 4IOLA 2F3QA 3HNOA 2AWOA 2ZE8A 1PD0A 1GV0A 1XYVA 2ZYAA 3ED5A 1X7YA 4EBBA 5DTRA 1H2AS 4PHTA 2E7ZA 1E2KA 1YZYA 4HDKA 2QE7D 1XZ8A 5BWLA 5LMNB 4V2UA 5JG7A 4D7AA 3RG8A 1K0UA 1KEUA 1YQTA 4WK4B 4AMZA 3KSRA 4NBWA 1RMYA 2WWTA 4TRRA 3Q6NA 1TD9A 1FTGA 4CQMB 2UXBM 4BUZA 5DFLA 4W63A 3H11A 5KSWB 4BYMA 3WYNA 2H1VA 3P26A 4BEJA 4US0R 1G8HA 4KL8S 3ZX5A 2RHHA 4YBRA 3SMSA 2P9BA 1FC0A 3DLIA 4FQ5A 4ZEMA 2J07A 3OIFA 3W4KA 3VO1A 2YXEA 1QJCA 5AVKA 2HK7A 3OP4A 3T7IA 3K3PA 2VHZA 1RPAA 1CUGA 2NVUA 4CIDA 4QGFA 4NOOB 1LFAA 4V0RA 2AH5A 1WPQA 4Q9DA 4JI0B 3TRDA 5LVAA 2XRFA 3HKEB 4B46A 3P52A 3TS1A 5DEIA 3MJSA 3MTIA 1R16A 3RUFA 1AOXA 4PLFA 1MP0A 3WGOA 2PKXA 1KYXA 3JZMA 1RXCA 3AILA 4TVSA 4UNQA 3AHEA 4JLDA 1R27A 2L19A 2I4LA 4DY4A 1U7ZA 4O8CA 1UBLS 5CDUA 1WIVA 5LZ5A 2F43A 5D00A 1UMBA 2R7LA 1W36C 1Z4QA 5CDTA 3OCZA 5JJKA 3LPCA 3W2GA 1TJNA 2VQFB 1L4UA 1SUIA 1DKRA 2WICA 3R7BA 4G0WA 2Z3XA 1PWHA 3X1XA 3EJ6A 3QLTA 1E7MA 2XRYA 3BTUA 2VNIA 4MITA 3PSHA 2OFOA 3C3EA 5JNUA 3W04A 3ZXYA 5D3MB 3UAZA 2NU6A 4J4BA 4KV9A 2PCJA 3R77A 1RLUA 2C8JA 4PX5A 3LVBA 3ZHTA 4D4IA 3KQWA 2X4LA 3PUJA 2ZDHA 4JI5M 2G1UA 4JYPA 4A16A 5TXGA 4GP7A 3GFPA 1OAOC 4YJGA 3FMOB 3ZUPA 4BVAA 2H1OA 4E5NA 3FBTA 4I99A 2OZKA 3OFKA 2YVQA 4J0GA 4KR0A 4BNVA 1SUFA 4N6GA 1JB1A 1XB2B 4JI6M 1YMQA 1YASA 2VLIA 5F7XA 1H3NA 1UBHS 1E6UA 2L42A 3BSSA 3CEJA 3I04M 4XUEA 5EUQB 4BLVA 3TSCA 2PQ0A 2C92A 2EJWA 5FDFA 2XZOA 3THXB 1EFAA 1QH1A 2ZBFA 1PT7A 3P94A 2FGJA 1U28C 3RBZA 3B8EA 5AKJA 5SZJA 3QI2A 4BQOA 4BKQA 4KN5A 4BLQA 1VBFA 3RAPR 4C0XA 1BQEA 3OHPA 4J3FA 5T4FA 1ZUNA 1QUTA 1AU9A 1NVVR 4M0CA 3CVUA 4B0OA 2C2YA 2O2HA 4HTFA 3ZKAA 1JNYA 3SSNA 4LF5M 4KH1A 3DMTA 5K8TA 1A82A 4OU5A 4IJWA 2G7ZA 1P29A 5BSUA 1O6FA 3DV0B 2GJ4A 3BMOA 3KKKA 5E0OA 2PH1A 5IKPA 1PS0A 5LMUB 2NTVA 3C87A 3EQZA 5AR1A 1FZQA 1ZVQA 1W34A 3Q8LA 1DXHA 4O2LA 3DMYA 4HH3C 3OMLA 1EAMA 4WPGA 4JB3A 4OHZA 2ZR0A 1JGTA 3CRNA 4AB1A 3RYIB 4HAYA 1QKIA 4DR1M 3LRXA 2QL9A 4UARA 1NYTA 1SGWA 4HEOA 3KJIA 5LQUA 5AJUA 1KPIA 4BDTA 3O4RA 3HKCB 1NUTA 3RV3A 5FOXA 1PJTA 1R12A 4BEVA 2K5UA 5KO3A 4YDRA 3K9QO 4TS4A 1Z4JA 4BN5A 4CMIB 2PYZA 3KJQA 3OTOB 2XMCA 1Z2AA 4EJ0A 2BR5A 1FDUA 4XFKA 3LRTA 4MB0A 1M34B 3IHKA 1E7RA 1H4QA 3CB4A 4P4UA 1Z3CA 1UM9A 1ADBA 2C7BA 4OXXA 4YV7A 2ZOSA 2AXEA 1FJXA 5JZMA 4ZHQA 4PCVA 3L04A 2D8MA 2WYUA 1K3WA 2AVDA 1UFRA 3K1JA 2V03A 3DOEA 1APBA 4DA4A 1VFPA 4LDZA 3HI6A 1V0JA 3W90A 1YIAA 1CRWG 5EJAA 3B5EA 2RHBA 3IBYA 4MKGA 3SEZA 1NNSA 2VSQA 3W5DA 1P7ZA 2YZ7A 5H9VA 5K03A 5CAEA 2PJDA 1A9XB 4FJ1A 2JCXA 2H85A 1Q0LA 4JODA 4D74A 3M7GA 4LXXA 4S24A 1QFMA 4JFRA 1QG2A 2QL6A 2NUPB 2R4UA 4JVMA 4PLTA 3SHGB 3INYA 3OZEA 3BXWA 5A0VA 3U3XA 4O2AA 3RU3A 5JQWA 2XUGA 2H1HA 1R6BX 1C0KA 1ECGA 2WSEF 3IUMA 1B2RA 4TQGA 2VUUA 3ZVRA 2MROB 4UE3S 1PJRA 2VWHA 4Y2RA 3BIWA 4PIPA 2FW8A 2I1QA 3BS4A 3S2SA 4D5EA 4IG4A 2M32A 3AR3A 3DTVB 2J7OA 4N4AA 5B57C 2AZXA 3U2QA 2QJRA 2GN2A 2BYTA 4JYAB 3AIMA 1ZU5A 2NUTA 1G8PA 2AUNA 1Q1NA 4JB8A 4HBZA 4GRIA 1P81A 4JJEA 3WNBA 2GHIA 4GX5A 4NECA 3ZWCA 3CH7A 2B25A 2EHJA 1OV6A 5BV7A 1O97C 2A0XA 4F2PA 3OTWA 1ZUWA 2UUBM 2FWIA 4IUYA 2G9VA 1TLLA 1M7BA 3WGQA 3TMAA 2VPIA 3ZHXA 4WBSA 4D3SA 3DEFA 4YT8A 1U7DA 4QELA 1L3BA 1ZAEA 4QT0A 3HK2A 1D0SA 1XRPA 1RKVA 2IPAB 4EY5A 2QN7A 1V5WA 4GKJM 2AUMA 1EG7A 2WFMA 2OEPA 3MINA 2N0SA 4IEIA 2EQAA 2OESA 3BWBA 2FR0A 3UUWA 2IF0A 4WOKA 4GDMA 1DGHB 4YHBA 3ZNOA 2XPCA 2BGLA 4JLVA 3CSSA 5BQ5A 1H93A 1RM3A 2DPXA 3GO4A 3HH8A 3O4FA 2Z1NA 2V7BA 4G86A 2X2EA 1HFEL 4CFZA 3LL7A 1YI0A 3DVLA 1MJNA 1NYRA 1CZRA 3O7MA 1RXEA 3DMDA 4MGYE 4BCCA 1VLLA 2QTZA 1ZIXA 4G4JA 3C16C 1XKXA 1LKZA 3NAQA 3WWDA 4DQDA 3OPYA 3LX6A 4JC4A 1Y9AA 3L6EA 2GASA 1S9DA 4FS3A 4Q7JA 1LZKA 1RI5A 2IWRA 1G4HA 3DZCA 2NQ8A 2P79A 4MQEA 1ONSA 1JEAA 1Q20A 1XZJA 2FZ5A 2XQJA 5CXSA 1KS9A 1TF0B 1NPTO 3TZ6A 3G0OA 2O0KA 2IYXA 5I4BA 3DEHA 4MWGA 2YY5A 1IJKA 4CTOA 1N36B 3QEOA 2QM7A 3V6LA 3FPJA 4MGKR 1YI8A 2AN1A 3FUXA 5G0UA 3CBGA 3D2AA 3DKIA 1T2UA 4N5LA 2VI5A 4LIPD 5C4GB 4PSCA 1L5WA 2PZEA 4HWKA 1JU3A 3RC8A 1RLOA 2AMJA 3NG1A 4LWQA 4UVGA 3K0BA 3R3UA 4KXWA 2HR1A 3BYZA 1X77A 2QTLA 5B3KA 2GCGA 1SCUB 2LR0A 4IR7A 4MB7A 4Q16A 3IAS6 4HDMA 4QQRA 2JZOA 5JJBA 5JAUA 4KR2A 3I01M 4BVEA 1DAEA 3RADC 2R18A 1RP1A 1XQYA 4H1HA 4BU1A 2GK6A 2QMHA 1Q3BA 5KYXA 5DCUA 3KHSA 4OAPA 2XI4A 3P9IA 4XR4A 2WPNA 4DJTA 1WHSB 3VVMA 2VJMA 5I4IA 3QVJA 4W9NC 4B3XA 3ZU3A 3CZQA 4RLHA 2WBLC 1PWEA 3V1UA 4M88A 4C3VA 5C7OO 2NM0A 2UYYA 4Q4AB 3V2IA 1MOSA 4COKA 1EZ4A 2QX6A 2BEUB 5CT8A 5K4AA 5TX7A 5FV4A 1RXWA 1USWA 3VPGA 3BEDA 1BHQ1 5D7BA 2OCLA 3RTBA 1EGAA 5TQ2A 3RYHB 3U4MA 1DCMA 5CURA 1V26A 2AYYA 2WD9A 3W79A 2XNJA 3I76A 4C5CA 1G6OA 3DFFA 5F1YA 1GJTA 1JS1X 3OMXA 4N54A 3KR2A 5H80A 5IKMA 4AUEA 3EEYA 3LDHA 1ZUD1 4JQZA 3IUSA 4X8HA 1CR2A 1RPNA 2E4AA 3GJ3A 4JH0A 3MWGA 2YOFA 5AVSA 1L7QA 5LOVA 3A1WA 1YNSA 4DF3A 4FOPA 2QCUA 1K5PA 1U5AA 2XUOA 1BOFA 1T0BA 4M9QA 4KLZA 4H77A 221PA 4IPTA 2GEVA 3O4VA 5JJLA 1FXSA 2WQZA 3NHRA 4B3SM 1EP1B 1GNQA 3T12A 4AJ4A 3SX0A 2R48A 2F9MA 1BFDA 3SM9A 2Z2IA 4RHYA 1VLJA 5K51A 1EB9A 4ZDWA 2VDBB 3PPIA 3FXAA 3D4PA 3U1TA 5GVSA 4M1YA 4E03A 4K03A 4A8HA 2J9XB 1UQTA 3FAKA 4YJKA 2GZ2A 1PJZA 1R15A 3Q0TA 3PGLA 3TB6A 3RH0A 5K09A 4U6QA 5LDDC 1FSSA 4AK9A 3OEYA 3K8QA 2JFUA 1A5SB 4B84A 1JEYA 4XA8A 1DDIA 4B9EA 1G3RA 3TZBA 1PJCA 1GL7A 3MGKA 3PD1A 4LFAM 3AUSA 2BE7A 1JDTA 4DLKA 4FK8A 1XZPA 2B9VA 2I6GA 1FQKA 2QHXA 2H5JA 2Y1KA 2QR5A 3WO1A 1VPTA 3D6TB 3G8AA 3GPIA 4HQ6A 2B4TO 3RYFB 1I5RA 4NBNA 2FVYA 2I87A 2Y8EA 5L7WA 5EMMA 3E7DA 1FU8A 4AWBA 4AJ9A 1P6QA 3DZKA 3U4DA 4ND1A 1UJCA 3DE7X 3SM3A 5BV2P 2KNVA 1JKJB 4ENUA 1NQOA 3NIGB 3O9VA 1WUKS 1TXGA 1OD6A 4JI4B 4OSPA 3H3FA 4AIIA 1YZGA 1NW5A 1R0KA 1GY8A 1R0LA 2W5UA 2FG5A 3W6PA 4LXGA 4KIGA 2I6TA 1GRVA 4FPXA 3N0XA 3IG8A 1ECPA 4D9KA 1KNQA 1KP9A 4JVLA 2ZBRA 1C4WA 1X1AA 4REZA 2ZVDA 3ZGYA 2GEKA 3NHLA 1X8LA 3EFEA 3PV0A 2Q5EA 1MPXA 3EODA 1WXHA 1JP7A 4BLWA 4R3NA 2XOEA 4RVGA 1P2VA 1PWYE 1WP9A 1VEGA 1XJWA 2JW5A 2FRVA 3AM1A 4BU0A 1SVIA 2BR4A 4R9NA 1J99A 1XNQM 4AJ1A 5CB4B 5T64A 4H1VA 3DBOB 1DQZA 1IAQA 5L6LB 3FUWA 3IL2A 2JBWA 4LHZA 2Q0SA 4AF6A 4AKSA 1KO1A 4WX2B 2EU8A 2XT6A 4FI3C 5GWXA 1TYEB 3P2JA 1G8SA 4WXEA 1CZUA 4UEKA 2X5NA 1AD2A 4F5DA 3E9RA 1DGQA 1LRKA 1LS6A 1CB0A 1EVLA 1RBYA 3LD9A 4Z53A 2IFTA 2JY5A 1OXXK 2FPOA 5EJ8A 1QLHA 2O57A 4LTDA 4OAQA 3TAHA 2P4HX 5D6OA 4IQ0A 4Y9SA 1FFSA 2VP3A 3VVBA 5FXMA 2YWHA 2QD5A 4UEJA 2UYCA 1SO8A 3LLVA 5HM6A 4XM2A 1V6AA 1NXQA 2Q99A 2VF2A 2OQVA 1P2TA 1UPCA 3CJTA 2AZTA 2VBCA 1O54A 1TT5A 4MAFA 3BDIA 4MRNA 3D54D 2FN7A 1R64A 4ZPJA 2BVNA 4OK3A 2JASA 3EUWA 2D1RA 5FTLA 3C3MA 5AK5A 1PYOA 1QIHA 3B2EA 4D9HA 1CFZA 4Q9KA 2BDEA 1F7VA 5HOEA 3RIEA 3FFTA 2VHJA 2GD0A 2IHTA 2JAUA 5FWAA 1JQEA 2CNWD 3IMCA 4HNTA 2NZ8A 4WXRA 4ENQA 1CS0A 1J07A 4ONEA 3SZOA 3LBIA 1J39A 1SXJE 3AL0C 2QDKA 3L4EA 4YT4A 4QRHA 2ST1A 5BW6B 2WAAA 1QAMA 1AIPC 4OB6A 4ZYZA 3OOHA 3OA2A 3RFVA 2GBGA 5GONB 1C4OA 3CJQA 4R0MA 3PI7A 3M6XA 1WVIA 1T2NA 4OXIA 5COBA 4ITRC 5JSHA 3KEFA 3NDRA 5F5NA 1DRWA 1Z7GA 2MH8A 1DSSG 2OMEA 2SHKA 3O3OB 4PO1A 3HRIA 1IHYA 4RO0A 4MKHA 3Q12A 3CW2A 5GOZA 3RNOA 3HVKA 3ZDQA 3IO3A 1JDJA 4WFJA 4Q9HA 1RWWA 4JJGA 3BORA 3F1KA 5I9TA 1YQDA 1XEWY 1GZ3A 4MJLA 2C7VA 4MRMB 5DBOA 3ILSA 4TOIA 1YS7A 1YQGA 4JITA 4FX5A 3ODPA 2BJHA 3O1IC 2BCJQ 3R9XB 1MJHA 2ZDQA 4FTWA 3KETA 1PNTA 4LF7B 1IB0A 2G5TA 1KDVA 1XPJA 4EL0A 1ENZA 2H1RA 4GKBA 5HQJA 4DC1A 1NJ8A 3CTPA 4AZWA 1D8AA 2PEZA 5IDXA 5CM2Z 3P9QA 4K0RA 4MYCA 2XEDA 4Q48A 1QIIA 5EKTA 1YZHA 3SQWA 2DJIA 3IDQA 3AB8A 2O1EA 2Z56A 1B8OA 4JU8A 5BV1A 5H83A 3EXEB 3IERA 2UXDM 1WUYA 5FI5A 1XXHA 3PDWA 1JLMA 3IJEB 1GGFA 2BIFA 2EVWX 4B2PA 3OZDA 5DGHA 3BGWA 1XD9A 5EZQA 4HR7A 2P69A 4X6UA 3MQFA 2FP4A 1PR1A 1CQWA 1OJ7A 1U8YA 4ARZA 4BJ6A 3CPEA 3DO8A 3ZW9A 2YJTD 4NYIR 2A30A 3RRMA 1KOFA 1A8UA 3DKPA 2ZAMA 5GPBA 2QENA 1DAGA 2EFDB 1ZMOA 1YNOA 1GA4A 4LCEA 4YRGA 3P9PA 3CT6A 1ZM7A 4CG0A 3E4DA 2REQB 1X7WA 3RE8A 2A1UB 4KBFA 1VKJA 5FB3A 4W7IA 3JRNA 2F6RA 3IDZA 3TDNA 5EJ6A 4GP9A 1NVWQ 1C1KA 1KZGB 4K3VA 4L2IA 1TA9A 1KSHA 2FK8A 2BFPA 1AHPA 1N1EA 3ZWYA 3AEKB 4FE3A 1FNSA 1M2VB 3VDMA 4X62B 3NWBA 1ID8A 1BEZA 1MJFA 4FR5A 1F60A 1Q22A 5AW5A 4JWTA 1JFSA 3PRHA 1Z0KA 3A9VA 2RGNA 3BA1A 3FWKA 2M6SA 3REQA 4R1MA 1QP4A 3LVRE 1KMCA 4MWBA 4CKBA 2IPXA 5F1OA 2D1YA 5H3HA 2J5KA 2VOJA 5AJVB 3GQ4A 2O59A 1N2SA 5B6JA 1C0PA 3R8FA 1DZIA 2ZSFA 5SY9A 1YACA 1WKCA 3JWEA 3CISA 2B6NA 3BIOA 1B3BA 4A4DA 4TYNA 1MCZA 4F4UA 3NDBB 5ALGA 4B7HA 4KK3A 3OCWA 2BE9A 2X7HA 1WXDA 5KQSA 1WXWA 3WZLA 1ZMBA 4CLXA 3VYTB 1JSCA 4A15A 1C0EA 4WKPA 5C5DA 3UG7A 1WB4A 3G2NA 1RE1A 2R85A 4PZDA 2I4RA 4RHFA 3GJ4A 2O50A 2P77A 1QK5A 2D5LA 3DC2A 4Y1FA 2I6QA 1LK5A 1QIGA 3CC8A 3PGVA 3WZMA 2XGGA 1D1PA 4MS1A 3BD6A 2A0FA 5JTUA 4I4IA 2Q9CA 2JH8A 2KJQA 3LUFA 4FWTA 1CZOA 3WI7A 1Y3DE 2VYCA 3UMFA 2X0NA 4Z99A 5F2OA 1KMHA 4N6OA 3SHVA 1P61B 1O0CA 1Y3BE 3GPPA 2I6XA 4KK4A 3WQRA 2C8LA 2YY6A 4PG4A 1ZC3A 1MNQA 1JFLA 2GD6A 5EQFA 5KYWB 4QPNA 4IDPA 3A0RB 1QVRA 1RYNA 3R0QA 3I6MA 4LZWA 1I6MA 3T3OA 4L95C 2W6CX 2PIAA 3LVQE 4V0OA 5CNMA 1GSIA 3VZSA 2PY6A 4O4HA 3NBQA 4MO2A 4P0TA 3O31A 3SDBA 2IXAA 3VTAA 2WKRA 1VL8A 4G0MA 2CLFB 3DB1A 4EUHA 3LPDA 1IXRC 4YFVA 4JUIA 3H99A 5AKGA 3QX7A 2EOAA 3MWKA 3C4QA 4L9SA 3M3HA 2COEA 4WCFB 4PT5A 3A6PC 3EQ8A 5ALMA 1MOQA 1VE5A 3LA6A 4PCZA 1FBNA 3GGGA 4HRXA 3L7IA 2OCIA 3KKNA 2QX4A 3CNQS 4D8TA 2OZLA 1J2JA 4A6EA 4JIGA 2NSDA 4L9AA 2JWSA 3PD7A 2N75A 2AC2A 3KWMA 4JI1B 5CBKA 4JAVC 5EY5B 1ZOOA 5J2UA 1P62B 3IIMA 3SJ7A 2HJWA 3LC0A 2OWEA 5KTYA 2GXAA 3EEFA 1ECFA 4DS3A 3QVGB 2NPFA 1QR6A 2FW0A 1Z4OA 3FCYA 2H0RA 1FJGM 2LV8A 4BNLA 4G0OA 3ZWKA 1W49A 4PQFA 4V38A 1B8NA 2JIZD 2WF9A 4BNIA 1QF9A 5B2FA 4EPVA 3ESQA 1EINA 4P92A 2CUZA 2WT4A 1JAYA 2HBZA 4XYGA 3Q0IA 4BNZA 1P33A 2BGMA 3LHKA 4ZYWA 2J9FB 4IMRA 4FU0A 4ZO4A 2V9ZA 4NKRA 5I7FA 3RSGA 1QK3A 4GM0A 1CQPA 3I23A 3G2QA 4IVQA 1CF9A 4PN3A 4KUGA 3LP8A 2GK4A 3B82A 3THWB 1NPDA 3GK3A 5CFMA 1EBBA 2WAMA 4I6EA 3C6XA 4R7GA 2J0QA 2YFKA 1I4EB 3U56A 3OLYA 3DWFA 1PTJA 1XTPA 2CNLA 3OAAA 4C2BA 5A6SB 3TL2A 1CUEA 4MQ4A 4QNRA 3NPAA 2VBGA 5GGXA 3A7DA 4G0VA 2YBEA 2FLWA 2I4OA 3RRZA 2C0CA 1LBSA 2XE6A 1Y9DA 3ORRA 1EE9A 1FFHA 4TV9A 2A9KA 1ZPDA 3F2IA 2FJUA 4NX2A 4ND2A 4W1PA 4JEHA 4MQ5A 1T4DA 1G8KA 1MAWA 2CJPA 2I54A 3FRJA 1DE0A 5FTJA 4KLAA 1ZITA 3TNYA 3BFVA 1UOEA 1UFOA 2ODPA 2OWDA 2EERA 4F8JA 1JA0A 3UMYA 1WW8A 1J5PA 1T43A 2Z1MA 2HMSA 1IU9A 3EGOA 1CUDA 3LWDA 4IBBA 1NHGA 1KY5A 3V1YA 1LSOA 1ZEMA 3LFUA 1XCGB 1SZCA 3NRBA 3D7SA 3G8CA 2AI1A 2CF5A 3DGFC 3PYXA 2P9QA 1DRJA 1Q83A 4IQ8A 3JASA 3H0CA 3T9BA 3GDOA 5MGBA 1RM0A 1AQLA 3HR4A 1H8ED 1ZGAA 4IJFA 1W93A 3JQBC 2EDAA 3F6RA 1IBLM 4KITB 3AONB 2BI7A 1NF2A 4B83A 2GBPA 3PYLA 4FDUA 4D9BA 5FL7A 2JAQA 1XTVA 1J33A 2KX7A 2RGDA 1OYWA 3AHCA 2ZSIA 4NZ9A 3BRWA 3D0QA 5D87A 1K89A 2I6SA 2NP7A 3ELBA 4F12A 4DNPA 1LPAB 5F9MA 1O6ZA 2QQ0A 3LCJA 3E4CA 3G0BA 3UOWA 4P38A 3RT7A 3I61A 2G5GX 1YJ8A 4WN3A 4CGZA 4NBKA 5EZYA 4CG1A 5LNK1 2M5ZA 2BGUA 2P9FA 3SVLA 1EHIA 1X14A 5TDHA 4UD6A 4REQB 4IIVA 5KHLB 2W70A 3QXJA 1U94A 4I1SA 4W6QA 5CEEA 1ACLA 2PFGA 2VT7A 4ZOEA 4F4CA 2OOAA 4YMGA 4JOBA 5IP5A 5JZOA 1PYGA 2B4YA 2GN9A 1J22A 4C4PA 2XCQA 3QEMA 2PLWA 3PKZA 3EXFB 4LJAA 1MC4A 3AHJA 3OU6A 2I3BA 2FGKA 1WV0A 1BXRB 1II0A 3P9YA 3KDPA 2TMDA 4BMPB 2XCSB 3QPUA 2PMFA 4EATA 1RLMA 1M5RA 2YS7A 3LHFA 3TZLA 1EXDA 4RDXA 2YV2A 3PK0A 3NFRA 2OYRA 5JASA 3CZ4A 1ZVMA 1KRHA 1MJ5A 2P35A 2Q2WA 4KZKA 1KYTA 5K5EA 1MHPA 3QVLA 3L92A 3NUZA 4X8OA 2ZWAA 3SSAA 3MJ4A 4RTLA 1PIWA 5INTA 1VL5A 3MOSA 3KOZA 1QIKA 4L0MA 2GMWA 1IY2A 3JU3A 4F7WA 3RVRA 2VYVA 3BVPA 2QAIA 2ZRLA 1VL6A 3FSEA 3LP5A 4EPWA 3T3PB 4MB6A 3BE6A 4KZPA 3IP5A 4B6PA 4MUEA 2OC9A 1II9A 4S1PA 1GPWB 3EZ7A 2IDJA 4PHGA 5AI6A 1GZ4A 3EF3A 2C1EA 1M1YE 4LYDA 1GITA 4FFWA 3AKYA 1QZUA 3I6QA 1OX6A 4QU9A 3RRNA 4EHIA 3SHWA 1FRQA 1RLJA 1IZ7A 5JSZA 1T6ZA 2IU6A 4DHWA 2MINB 1NW3A 4NYJQ 1EFUB 4JCCA 3TE6A 3ASUA 3T94A 4MUBA 3ZQUA 4EHBA 2GYYA 5IBQA 4LKRA 5EJ4A 1DV1A 2YVAA 3LCMA 4Q3LA 5CFZA 2OGSA 1DG9A 4KRXA 2WZDA 5FPSA 2WJIA 4AZTA 4C4RA 5BSTA 3EXG2 3EY4A 1EZ1A 4I2NA 2I29A 1A50B 2OV3A 3THYA 3P4UA 1WDLA 5HOQA 4XQEA 3EEBA 3NBYC 3LOPA 3BWMA 4K9SA 2I34A 5TMPA 1KO8A 1S4QA 2X2FA 3TQHA 4PZUA 4FOOA 3FMIA 5LQAA 3JALA 4ADSG 1EUYA 2H18A 4PN7A 5B7PA 4K3UA 5E8JA 2QJTA 1HC7A 2ILTA 3K31A 3TD6A 1HLFA 5J58A 3L4BA 4DZTA 3G2PA 1O4WA 1U6JA 2WNHA 3O75A 3U6QA 3B3GA 2FWRA 4KWEA 2OZPA 5ICSA 1S6YA 3PXCX 1LUAA 4JZKA 2IZ0A 4LF9B 1ZUIA 1TIKA 5JYEA 2DKLA 1RTTA 1QRSA 1K5HA 1N6NA 4PPGA 4N6NA 2UDPA 4E2YA 1G5TA 2XD9A 1JW9B 1R3DA 4PS1A 3AFGA 1XTJA 4DM7A 3GRVA 1N0HA 3ET5A 4I8XA 1KE1A 3TLJA 2JIBA 5HE9A 5J3JA 5LQSA 3W5CA 3F8SA 4E3WA 2BUBA 4TMZA 1T8UA 3QLUA 5DWQA 4RTKA 1G0OA 2CFSA 2E5LM 3AEQB 2HL6A 2RK4A 1YJQA 2ZAIA 4LRTA 4JDPA 5HA5A 4X63A 4GWKA 1BKSB 2DAPA 1N6OA 2WSSA 4K40A 1VLZA 2FN9A 3NB0A 3QVTA 1LBIA 3G68A 3WK7A 1GWNA 1K7EB 2R1TA 1DBPA 2HMWA 4HK4A 5CA1A 3H1FA 4RD1A 7MDHA 4LYHA 1E1CB 3PNSA 4PC3A 4Q1VA 5DP2A 2RHCA 5AVJA 1E2LA 4UBIA 4JGIA 5G0WA 3O9ZA 5K6RA 4L4UA 3JYNA 3A27A 2QL5A 2ZJ6A 4OQZA 2I55A 4G3OA 5LSAA 3OVMA 3C4VA 1IUKA 3N2GB 3ACDA 2IH2A 3TW8A 4ER0A 5CBPB 4KB5A 4INAA 2I2FA 3C48A 1U2TA 2QZPA 1WGLA 1B6GA 3WAKA 2C57A 2JFWA 1QB7A 1SFRA 4HI0E 4QDUA 3NOOA 1F12A 3SZRA 4K0KM 2Y1LA 3JQFC 3GZNA 5F7OA 1DO2A 2QRJA 1GO2A 1ZNXA 4IQGA 4N41A 2W2PA 2O1WA 4IDEA 2JHGA 4DR6B 4U4AA 3WMWA 3HDYA 2FEMA 3EIFA 1BA3A 1XNGA 3TH5A 2FPIA 2D3TA 5D84A 3KM0A 1P1CA 1DTWA 2EKQA 1Y6FA 3QFFA 4DWVA 1ZCJA 1P0IA