4LZZA

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
b'EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 57
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lzzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lzzA01
1P5ZB 4ZCLA 3B82A 5TY0A 5FUVA 1E2QA 1PLKA 4TYNA 4D0NA 2IXFA 4R2HA 2VHUA 5FOUA 3RVBA 1KY3A 3EAQA 3Q5EA 4A36A 2W0MA 2R6AA 2ZETA 2WWFA 5DO9A 3GLGB 4LHWA 1NRJB 4OI4A 2XNSA 2QRZA 1LNZA 2QT1A 5KSYA 4JL6A 3AF4A 3RRMA 1LV7A 2OBNA 1U8AA 2CDNA 2W6IA 4YQFA 4WVFA 1ZU4A 1IOZA 1JXMA 2CCKA 3BC1A 4YLGA 5C2JB 2CMKA 1G6OA 3NBYC 1IN7A 1Z3IX 4LJ9A 3RS5A 4DCVA 1CKEA 3CX6A 121PA 2V9PA 1G4AE 3SOPA 3NH6A 1XD2B 3CM0A 3RC3A 3RDPA 2WMOB 2XITA 5FL3A 2WSSD 3LVQE 3VNUA 3ECCA 3DO6A 1Q21A 1OFIA 3KJIA 5FOXA 2NPIA 3VHLB 3U6BA 4FD2A 1NIPA 4JL8A 2YWHA 1EGAA 2VF7A 2QZ4A 3NKVA 4DDUA 2QPAA 4D0LB 1X1RA 2QY9A 3VU9B 1VTKA 4M9QA 3AV0B 1I2MA 4Q19A 3WYGA 3AUXA 4KYIB 3P32A 3MGCA 5J4LA 2OFOA 3WY9A 4OHVA 1F2UB 3OFND 4C7OB 5GJVC 3RC8A 3T61A 4L9SA 4M9SA 3I73A 4ZIRA 2RB4A 2CVFA 3MJRA 3VR1A 2JDIA 3UPUA 3RANA 1OB2A 2R6GA 4Z1MD 3EPLA 5J4HA 1NG9A 4ACBA 2RHDA 2OILA 1RJ9A 4M1MA 3GLGE 4Q9LA 1EESA 4M53A 4LHXA 2W2TA 3LAWA 4B71A 1AN0A 4C0HA 1JXOA 1VG1A 2D06A 3BH0A 1XEFA 2BBWA 4FXPA 5FI1B 4BE7B 4DSTA 2QBYB 1CRPA 4NCJA 1XCPA 3ZH9B 2TMKA 1WQ1R 5C1BA 2GCNA 3KJEA 3NBXX 1GRNA 4HLUA 1IONA 4U7DA 1KKLA 1AK2A 4JBWA 4D4JA 4TSFA 1TU4A 1Z22A 1XTQA 3KDSE 4DSUA 4ZDKA 4G1UC 3ZLJA 1IJFA 5FTLA 4NONA 3T1VA 4E22A 1XD8A 5GVRA 4MKGA 3WYAA 3UANA 5HTKA 3GLIA 1E4YA 2WWHA 1G6HA 5JWRA 2BBTA 2CL6X 4TTRA 4Z8XA 2ZRFA 2C95A 4JZKA 4HB4A 2OXRA 3B1ZA 3TR5A 4KHZA 4RSGA 3I5YA 3CF2A 3GPLA 1DAGA 2CNWD 2WZQA 1XFAA 2WWIA 3T35A 3EC1A 1G3QA 4EJSC 1YZKA 1TMKA 2EFEB 3OEHA 4AURA 1OIVA 1DOAA 2X2FA 4JSYA 3LNCA 3K0FB 4EPXA 1J8YF 2P6RA 3BAFA 2R62A 1E1RA 2LKCA 3W8RA 3K8YA 1D9ZA 4P0TA 4B3XA 4B6FA 3E5HA 1QG4A 1MO3A 3B5JA 4HAXA 4ABYA 4D80A 3L0IB 1IQPA 2EWWA 4OK6A 1S1CA 2P65A 2P6UA 2ZR9A 2AK3A 4HAWA 4X8MA 2Q21A 3EG5A 2O52A 1PLLA 2WJIA 1HE1C 3QPUA 5F2EA 1OLOA 4RY2A 4A2QA 4O3MA 3N2EA 4PHTA 2LCFA 2WAXA 1SVSA 4GDFA 1G8GA 4LCBA 5IRCD 1AZTA 1OXSC 4A92A 4P4SA 1W2HA 3I8SA 5CLQA 3GLIE 4AKGA 3ZD7A 1EWQA 2YHSA 3NTUA 4PAMA 2EWVA 2IYQA 3LO5A 4KVGA 2YV5A 2XTNA 1P9RA 1Z07A 4JLPA 2EYUA 4WXRA 5CB8A 1E9RA 3DL0A 4A8JB 1N5LA 1TPZA 2FGKA 4HLCA 4PPFA 1OB5A 4UNQA 2ZSAA 3VKWA 2XTZA 4LJYA 5L3QB 2D74A 1WF3A 1XTSA 3HJNA 2GDJA 4Q7KA 5CIWA 4F91B 1W47A 4JMPA 4MRSA 1XZQA 2ZE5A 4ZV4A 1YZGA 2Z6VA 4NHOA 5IK2D 3ZQ6A 2IS4A 1ODFA 1QHGA 4Q4AA 1JR3A 1TAGA 4C0QC 1L7VC 3UWKA 3O8BA 2V1UA 2ZRHA 2OO7A 4RKFA 3E2IA 4C0LA 4DIDA 4F4CA 5FPKA 4R7ZA 3KUDA 8OHMA 3K70B 4FCWA 4LRTA 4NYIR 4I1UA 5KTYA 3AJIB 1M7BA 4JLVA 2GVZC 2VH5R 4OQFA 4B3GA 1G9XA 5ANRB 5KO2A 1A1VA 2WKRA 1NN5A 3VTKA 1HT2E 1N0WA 1ZUNB 1QRAA 5HPYB 1IXSB 2P5SA 4M1TA 2W58A 3NC0C 2D4HA 3MAAC 3AVTA 1PJRA 3MWLA 3EIHA 1N0UA 3UATA 3D7MA 4V0LA 4B3FX 3KFVA 2GZDA 2F9MA 1P2VA 1D2NA 4ASUA 1OYYA 1XXHA 4KSBA 2MMGA 1HY3A 3D8BA 3TVTA 3QJYA 2WSSA 3GLHA 5EE5B 1MO4A 2RMKA 1JECA 1HTWA 2C9YA 2ZRDA 3KKPA 3GMTA 2H5EA 2HJVA 4MKIA 4Q4LA 5FL7D 5J4VA 4Q00A 5F3WB 2IWRA 4OI1A 1CTQA 1JB1A 1XX6A 3IGFA 1XDBA 4DSNA 4HUQA 1NP6A 3RYTC 4DBLC 1TQDA 3C16C 3KKOA 3U3KA 2JLQA 1N5JA 4QM7A 2G3YA 2ZRKA 1OFUX 1KJZA 4AG5A 3GEHA 4PZZA 4JYBA 2ZRIA 3Q5DA 1D8TA 3VR3A 4BGDA 2PJRA 2N42A 3OFNA 3LW7A 2ZYTX 4MGKR 3KTAB 1JR6A 4PAQA 3QKTA 2GJ8A 5KPDA 3A4LA 1ELOA 3FGNA 4YMUA 2G83A 2DFLA 3BE4A 3UWOA 5JS8A 2IF0A 1IBRA 4Z1MA 4POAA 3GLFA 2QMUA 1Z0AA 2VEDA 2XJ4A 3L2OB 3U60B 3WBKA 4OI2A 3B1YA 1RW4A 3V4FA 3W6OA 3EPKA 1Z6GA 2IXGA 1FTNA 1AKEA 1QHXA 4Q1DA 4PO8A 1W36B 2FU5C 3AVQA 4HZUB 1ZIOA 4A4DA 3OEEA 1DO2A 4FIDA 4NCKA 2CE2X 2Z43A 1FP6A 3OAAD 5JEEA 5GJWC 4M9XA 5DISB 3AVVA 2QSYA 4Y0VA 1T5IA 4OQXA 1CR2A 4H1VA 4NCNA 4CEJB 2JA1A 1WB9A 4E5UA 2VHQA 1E2MA 4LHVA 4GZMA 3EA5A 4P32A 1DG1G 1NBMD 4M22A 3GFTA 2FPKA 2ZSDA 4K8OA 2BKUA 2D7CA 4DZZA 4YMSA 2JLYA 4DUGA 2BBOA 2GBLA 2HF8A 1TQ4A 3THWA 4LZZA 1NNEA 3QKSB 4JT4A 1A82A 4QHYA 4G5OA 5FUXA 3SJBA 3KX2A 2QA5A 2V6JA 1KI2A 3W5IA 1TQ6A 2PZFA 1E9FA 4B3BA 1YU9A 5EXXA 2FFBA 1DADA 3BB4A 4AYTA 2KE5A 3I1FA 2P0EA 2GZAA 2WIBA 1XMJA 1MO6A 3VNVA 5DI9A 4DSOA 3U3OA 4JSTA 4TLDA 4YONB 2EQBA 3W34A 2CXXA 1VCIA 4BLQA 5AUPB 1E79D 1RRCA 2OUKA 3EW9A 3QKRA 4S2EA 4QG7A 1AGPA 3ZVLA 4XJXA 4I81A 1LVGA 5JRZA 3AEZA 1XMVA 4IXMA 4NKRA 4BFVA 3C41J 4XTCS 2OLJA 1VYVA 2H16A 2PZGA 1ESMA 5TVKA 1M8PA 3GEIA 3MWJA 4C0AC 1TADA 2GAOA 4DC9A 2O8EB 1M6NA 3G82C 5EZ6B 4DWJA 3PEVA 4C2UA 5IHPA 4XVUA 2QMEA 2VF8A 3G5UA 4F4IA 1SKYE 1JBKA 2MSCB 3KKNA 1VG8A 4IVQA 4U5XA 4A6XA 4IFEA 3IUYA 1FUKA 4KU4A 3BH6A 1P72A 1ONBA 2O8DA 3MMPA 3TVDA 1G3MA 2GCOA 1NLZA 2J1LA 1LFDB 2QQ0A 2YZ2A 3S1AA 1G8HA 1D2EA 2WWWA 2C98A 2YC4C 2ZI5A 4RZ2A 4OKSA 2KRKA 1MRSA 2JAQA 2F3RA 2NGRA 3PFIA 1S9HA 4RFSA 4V0NA 2BBSA 1E2JA 1G5PA 2HDNB 2ZUBA 2R2AA 1FZQA 2VTKA 4QHSA 5B58C 2ZJ8A 3EXAA 4GP7A 4IOJA 4BWYA 1KI6B 4DDWA 3TK1A 1X6VA 3EC2A 2KJQA 4PPGA 2IS2A 2QAGB 2AX4A 3RS0A 2UKDA 1SVKA 5FBRB 2ZANA 3AF1A 4F7WA 1SXJB 4EPTA 4Q02A 5LBIA 4LJ4A 4A82A 1KHTA 1P9NA 2WV9A 4KFSA 4LBVA 5G3YA 1YZTA 2JLWA 1AIPA 3GJ5A 1LTQA 1YZQA 1S4QA 4PTLA 4QOSA 1U8ZA 5DNYB 2EYQA 2R65A 1X8JA 2CEAA 1QHHA 2A3RA 1OH6A 1E98A 2FMXA 1R6BX 2Q3FA 3O8RA 4Q1FA 3PV0A 4DJTA 3TUJC 1XB2A 2AR7A 1KO1A 2GKSA 2V54A 1LY1A 3BXZA 1TEVA 2ZYUX 2GRJA 4JLKA 4P33A 4XWOA 3B2EA 2BOVA 3TR0A 2XNDD 1NY5A 3O8DA 2QM7A 4S35A 3U5ZB 1WRBA 5BN3A 2Z4RA 3CNLA 1IN8A 1SZPA 2FPLA 1ZRHA 2PMDA 3HPQA 5KNCA 1UKYA 3B1WA 4X8HA 1FNMA 3BB1A 1U0HC 4KLZA 4F93B 5FTKA 1UPTA 4F92B 3NBFA 3CPHA 1CJTC 3TLXA 4RD0A 1IN6A 1UFQA 2ONKA 1M74A 2ZJ5A 4TMXA 1FMJA 1HUQA 1BO6A 4KYUA 1JPNA 1L2TA 4LUCA 4C0JA 4W9MC 2WWGA 3K9GA 1N6IA 3SN6A 1KIMA 1HT1E 4EJSA 5CB6A 3NXSA 4D82A 3ND9A 1E4VA 1DAIA 4HB2A 5E7JA 3NVAA 4US2R 3IILA 3C4JA 1N6HA 3KB2A 3PUWA 3WNCA 5JSZA 3AF2A 2ZRNA 2A5GA 2J9RA 5C18A 2OG2A 3C8UA 4CYMA 5JECA 1SVLA 2GEUA 2V3CC 2H1LA 3QF7A 4Q1CA 4FWDA 1G41A 1EX6A 1YZNA 3ICQB 3QENA 4OBEA 4TQAA 2X1VA 4RKEA 4TL9A 2I1VB 621PA 3WBJA 1WP9A 1NMYA 3U44B 1CEEA 4QNRA 2D2FA 1NMXA 1OHHA 1Q3HA 1KI8A 1Q1QA 4BUJA 1ZVQA 3BJIC 1H8ED 1DAMA 4AY2A 1G3UA 3PCRB 1IHUA 4MGIR 1OKKD 3MUFA 4BFTA 5KNDA 4V0ME 4QGHA 2IW3A 3RWMB 3CB4A 5L3VA 3CR8A 2FSFA 1FQJA 1NBMA 1ZW6A 3CRW1 3CZPA 1UAAA 5CDFA 3EIEA 3FHTA 4MDFA 1G8YA 2ATXA 4M4SA 4O0MA 2X8AA 1N5KA 3QXHA 1Z0IA 4QHTA 3A4NA 3FYHA 1U98A 3LQRA 1OIXA 4QC2A 2HXYA 2KB0A 1Z29A 3UMRA 3V4RA 5DHFA 1F6BA 4IEIA 5HE8A 4PHFA 1EFRD 2CCGA 2MMCA 1MH1A 3IO5A 2AKYA 2JATA 4TL6A 1KO8A 1TNDA 3CUEF 1DAKA 2REBA 2CVHA 4A8JC 2JLXA 1KO4A 5J5CA 1Z0DA 1FTSA 2RGBA 1PLJA 4WZBE 1DAEA 1E79A 1G7SA 5JRJA 5FUWA 1QF9A 2PBRA 3CKLA 1F3OA 4KFTA 1OT3A 3EASA 2QL6A 3LLMA 1OE0A 2DWQA 4FWHA 4KO8A 4JVMA 3T1TA 3C7KA 2J0UB 2QNRA 4LYFA 4MRVA 4MUAA 2J46A 5FOVA 1CJMA 4D6PA 2YWEA 2N46A 3QF4B 4URUR 1U81A 1ETUA 1Z47A 3QPVA 4NL4H 4R98A 3LD9A 1N0VC 3K70C 2XOKD 4JLJA 4URWR 1KI1A 4O25A 1E9BA 5DI3B 4ACAA 3U7HB 5KPJA 5DHAA 1F60A 3K9LA 1AA9A 4QJ3A 2VA8A 5EXSA 3L0PA 2CK3A 1RC8A 3R7WA 4YC7A 3X1XA 4G0NA 5FPYA 2C2HA 1QHYA 3MRSA 3MWYW 1GM5A 1DTSA 3U4QB 2IYWA 3PXGA 1P60A 1CRQA 4GBMA 3P20A 4OQNA 1COWD 3K0EA 2IYLD 1CJKC 1JEDA 1KZ7B 2QU8A 4B47A 4KFRA 5JBQA 1YZLA 1Q3TA 3TQCA 1ZM4A 4LWZA 4ZO4A 1II0A 521PA 3M1IA 3CRRA 4Q9JA 1ZC3A 1US8B 4KFUA 1M7GA 2NIPA 4FCVA 1YRBA 1F5NA 4N3NA 2GVDC 2IT1A 1QHIA 1LW7A 2DR3A 1G7CA 4K81B 1KMQA 3REFA 1XJQA 3QSYA 3OF5A 4XD7A 3C15C 4PQYA 3H1TA 2V6ZM 3I62A 3R8FA 4MYUA 1SQ5A 4P4UA 3PUZA 2JLVA 1N6OA 4F38A 1FX0A 4LYAA 5EE9A 2WOJA 5L3SA 2AL7A 4CIDA 2HT1A 1FW6A 1JJ7A 3IQXA 3QXJA 4EDHA 1WXQA 2BKEA 3THXA 3BH7A 3TUIC 1KJWA 2FZLA 3GJXC 1F2TB 4Q4JA 5FPHA 1OV4A 1Y63A 3LY5A 3KKQA 1R0WA 2XZPA 1W36C 4DT1A 1HE8B 1M1YE 4AIIA 1KOFA 1OXUA 4WW0A 1W0JD 3C5HA 3MG9A 4GMXA 2O0HA 4DDTA 4H9GA 3QVVA 2FEOA 2ZSEA 2P2LA 2CLCX 3SYLA 2XB4A 5DIFA 5LB4A 1CU1A 3ZIAA 1E3MA 3UK6A 2WIAA 2O8FB 2IA5A 1NMZA 1E9CA 2DWPA 1N6LA 3D6TB 3RS4A 5AUNB 1KDPA 1NN1A 2FE4A 2FFQA 4PFSA 4OI0A 1RVDA 2GJSA 4NCIA 4GT1A 1TX4B 4TL8A 3TIFA 4B35A 2Q3HA 4A0GA 1Z0KA 2FPMA 4Q01A 1CR1A 2JASA 4IDNA 1EXMA 1KSHA 2REXB 2YINC 1X8LA 1XMSA 2XEXA 2R44A 2BEJA 3NEJA 4PO9A 3FOZA 5LDDC 2ZAOA 2WJJA 4WAUA 1KAGA 1KK3A 3MWKA 4DLZA 3K9HA 1IAQA 4DCSA 3FMPB 2VP6A 4B32A 2GETA 1R4AA 2RGAA 4IKEA 4Q1AA 1U9IA 3OIVA 3KQUA 3HPRA 1TTTA 3WMGA 3CRVA 1WDTA 2RHMA 3CO5A 4RCZA 3ADDA 3FTQA 3K70D 2AFIE 1E2NA 4KITB 3A36A 1CF4A 2VBCA 1Z6TA 2BMJA 5HCNA 1GZSA 1N2CE 1Q22A 1AKYA 1D2MA 4TLAA 2QUZA 3IBYA 4ZKEA 2WHXA 5EP4A 2W6JA 3LWNA 3IHWA 4A6PA 3PG5A 3N2IA 4B74A 2J5XA 2WJYA 4G5SA 2R8RA 4HLQB 4PR0A 4L8GA 4AI6A 4ESVA 2ECKA 4JVNA 1R5BA 4RD6A 5C4MA 2LKDA 1W7AA 2QEQA 1X37A 1Q1EA 2HLDD 2IL1A 4IDOA 1RJ9B 1XD2A 4PAOA 5JLJA 4TLEA 2OE2A 2ZR7A 1BIFA 2IX3A 2WSMA 4PC6A 2XGJA 3SQWA 4GP6A 1ZD9A 3TAUA 2KSQA 1VHTA 3LH5A 3AKCA 2NTYC 4MGZR 2OCPA 3OIYA 2ZXUA 2ZPTX 1Z6AA 1G3RA 4FCTA 2FFAA 2Q9BA 1GOTA 2C8VA 4B6EA 3VU9A 1CLUA 3QPWA 2C03A 4BLSA 2QPTA 4B33A 1W44A 4MDEA 2Q0HA 2QAGC 5KU1A 1ZJ6A 2FV8A 1F2UA 4HB3A 2IHBA 4Y0AA 3GLIB 1SXJC 1D9XA 2IS6A 3WHLA 1W4BA 4PHGA 5E4FA 1C9KA 1CIPA 3WYFA 5EP2A 3U7FB 2CHGA 1BMFD 1NG1A 2HEIA 1Q0UA 2NO6A 3I72A 2CCJA 3LX5A 3VAAA 1E0AA 3M4YA 4C4PA 1J99A 1GUAA 4IW3B 4BLTA 1WA5A 3FDIA 4V03A 4EKDA 1OH8A 2GK6A 2QGNA 1W36D 1E2DA 3VFDA 1TF2A 3FMFA 4DLSA 2XOKA 4KJZA 4A1FA 1NVVR 1NVMA 1HURA 2WOOA 4OK5A 4TMKA 2QBYA 2QAJA 1R0XA 2JIZD 4HUTA 1X1SA 1MABA 1N25A 1Z0JA 4GOKA 4C0BA 1KNXA 1MR3F 1UKEA 1DARA 2C9CA 2JJ8A 2ZJZA 4JBXA 4E07A 4EFMA 2CJWA 2VP9A 1ZNZA 4WBSA 4B3DA 4X8OA 1E9SA 2W2VA 3W5JA 1XF9A 1COWA 1GNQA 3DHWC 3U7EB 1D6JA 2AFHE 2JJ1D 2ZR0A 5E7IA 2RGXA 5FR1A 3CH4B 1GKUB 4KXFB 3RAPR 1E2EA 3I92A 3VR5A 4NU0A 4D81A 2OLKA 1N6RA 3AKYA 1R0ZA 2WJGA 4JJKA 4LV8B 1KGDA 4TZ6A 4JLNA 2FOLA 4Q9IA 2OT3B 3V9PA 4CT5A 4TYYA 1FQKA 4Q03A 2J7KA 2N1BA 4O2LA 1J70A 5CYOA 3K0FA 4KSCA 3B13B 1WBDA 4YMWA 1KK1A 2ODEA 2ZE7A 1M7HA 3K53A 5JJLA 1Q1ZA 1KI7A 2WPDA 2ZREA 2F55A 2GXSA 3ZZTA 3SHFA 2GJ9A 3DDCA 4FW9A 4GNKA 5FR2A 2IYZA 1JEEA 2OCYC 4B75A 2L0XA 2A78A 2R6DA 2O8CB 4FWGA 2MSDB 4HLDA 1R5OA 3P4XA 4Q4AB 1QHNA 4LPSA 1JJVA 4IJMA 1OW3B 5J4YA 4CT4B 4I1SA 5KUTA 5DE3A 3R20A 4UXIA 1KO5A 3BWDD 4TN1A 4BZQA 3F5FA 1AM4D 2PMKA 5DN6D 1TUIA 3ZS9A 2WICA 1W0JA 2UZIR 4PC2A 3W8NA 1KMHB 1ZNXA 3GD7A 1AZSC 3ONWA 4EQ6B 1G291 1B23P 3NEYA 3VR4A 4HB0A 3SU8A 4YXWD 3KQNA 4A2WA 5AJWA 2OHFA 3DOFA 5EE1A 1P9WA 4ZI2A 4A8JA 2AN9A 5TDHA 1VPLA 3VQTA 3AB3A 2PT5A 1Y3AA 2EFDB 4R71A 5K8IA 3IPXA 1GKYA 4ILEA 3LBNA 4K46A 3WNBA 2WVJA 3KB1A 1XXHB 1SXJD 2FSGA 1VDZA 3CX8A 3QBTA 5B64A 3AF3A 2ZTSA 2JJ2D 2ZE8A 4ZDWA 1H65A 4HEJA 2G1KA 4M9ZA 4PSVA 4TTQA 4TYQA 1E2KA 1W4RA 1R8SA 1ZM2A 2O5VA 4ZPXA 4GMDA 4JKIA 4LRWA 2IXEA 4BFYA 1HH4A 4URXR 5IF9A 3EX7C 1UJ2A 4LBWA 2VIIA 1UM8A 2J7PD 4HAZA 4AKEA 1T0JB 1T91A 3QXXA 1ZAKA 1Z63A 1P2UA 1MV5A 2E9SA 2DCUA 3B6EA 4DLRA 3AF0A 1C1YA 4JT2A 4IXNA 4MRNA 1GRQA 221PA 2ZQ5A 1UEIA 3NHAA 3P27A 1T0HB 2QE7D 2HUPA 3QE0A 3QIAA 1VMAA 5SZKB 1JR3E 1ZCAA 2H92A 3UXMA 3L82B 3QY0A 1OFHA 1QG2A 2PEYA 4L9WA 1AS2A 3SDZA 1G3IA 1RRGA 2EU8A 2F43B 1R10A 2GA8A 1XEWX 3SI7A 1IY2A 1SHKA 3U2QA 1OPXA 4JLAA 5KNBA 1QZXA 2AHOA 3KXLA 1ZC4A 5AJXA 1XU4A 2ZIAA 4N0EA 2ZS8A 3U3JA 1KK0A 3H4MA 1XP8A 2J0VA 2IC5A 2RGDA 1L4UA 4A0FA 4C30A 2HYDA 5BW8A 3SBDA 5KSOA 3RRZA 5D3QA 2IYTA 4DKXA 3PR1A 2CHQA 4OL0A 3IO3A 2C99A 5JJIA 1DBSA 2YC2C 4WZ6A 1GITA 3AUYA 1E32A 2W83A 2D7DA 2YWFA 1SKYB 4G5QA 2IYXA 3AKDA 3GFOA 1XTJA 1Z28A 1XXHE 3AP1A 5AJVB 1IY1A 1E2IA 1E9DA 4DDVA 3HYTA 4Z8YA 1UDWA 3GLHE 1GRRA 3W90A 1CS4C 1W1WA 3KTAA 2AXPA 2ZRJA 3MCAA 4JYCA 1MKYA 2XAUA 2IYVA 3L0OA 4LBZA 1U99A 1IY0A 2DHRA 4B73A 1H8HD 2QM8A 4XTRA 2C5LA 1XNJA 1IXRC 4CZ2A 1Z2CA 2Z4SA 1XJ0A 2PL3A 3FE2A 2OCBA 2Q6TA 1G4UR 4IRUB 1NI3A 4RVCA 3MSXA 5L8VA 1WMSA 3GCGA 3AM1A 4A9AA 5FFMA 2O8EA 3EPHA 4HZUA 2D3WA 2FSIA 5TV2A 2A9KA 1AQYA 4YDSA 4MYTA 1QHSA 2CNWA 4EFNA 3IEVA 2V8OA 3TGPA 5EE3A 3O47A 1E94E 3OHMA 4TMZA 3QKRB 4AD8A 4TT3D 4LYHA 4EPRA 4CEJA 3GJ6A 2RH5A 1RE0A 5DH9A 3DMDA 5EXPA 4DLXA 3HU2A 3LV8A 1IXZA 5KDOA 3GLFE 1E1QD 4RZUA 1P61B 3K09C 1VCNA 3KKMA 2QI9C 4YMVA 2ZUDA 3KL4A 4NTZA 4TQUS 2ATVA 4UJ3A 1JQJC 2OV2A 2JJ1A 2P6NA 3W3AA 3J81k 1TF7A 4A2PA 3DZDA 4HATA 3SHWA 4QGGA 2JLSA 1EFTA 4Q48A 1HQCA 3VHXA 3GQBA 4DB4A 2W00A 4NCHA 1MOZA 4KBFA 2FDCA 2O8DB 3CPEA 3PUXA 2GCOB 1LF0A 1NVXQ 3GP8A 1P62B 1VG9B 2ORVA 5G53C 2YVUA 1LF5A 2VP4A 3SE0A 3AGQA 4BFSA 1GWNA 3GJ3A 4YMTA 1CXZA 1GAJA 4L16A 3THYB 4DXAA 4MH0R 1R8QA 2IF2A 2R6FA 5KSZA 4DLTA 2J45A 2G1JA 4PC7A 5H8WA 1UBFA 2F1IA 2WKQA 5D3MA 3E1SA 3EZ9A 4G01B 4FINA 3WRYC 2NQ2C 3RWOA 5CM9C 3CPJB 3K9NA 4M21A 2DB3A 1JQLB 1K6MA 4EPVA 2DWZB 3FKSD 4QJ5A 2W0SA 4J0QA 4PC1A 2F6RA 4JVSB 5FOTA 5KDDA 2JGNA 5IK2A 3EIQA 4QBGB 4FMBB 5FTMA 3HR8A 4ON9A 2BVNA 4MITA 2FG5A 2FWRA 3FKQA 4BRUA 4D0GA 1FMLA 3ZVMA 5F9HA 4RD1A 4P4TA 3CZQA 2IYYA 4UNPA 2ZI4A 3A1SA 2HT6A 1KI3A 1NSTA 3GJ0A 1ZBDA 2IHYA 3F3YA 3QUSA 3KXIA 3MFYA 2IK8A 2V4ZA 3N70A 5J47A 2FX3A 1KI6A 2AXNA 2B8WA 2GK7A 3Q8XB 5HR5A 4ESHA 3AQ4A 4CGZA 3RNLA 2QAGA 1II8A 1OH5A 4CVNA 3SYKA 3U61B 1T5LA 2G6BA 5SZJA 1SXJA 1ZYUA 1P4SA 3PENA 5JHHB 3NH9A 2PJZA 2JJ2A 1AS3A 2B21A 2REOA 3R9XA 5JCZA 4QGFA 4L15A 1DVRA 4CEIB 3MHVC 4DCUA 1J7KA 5FTNA 1PVOA 3O8CA 3K0SA 1ZCBA 1CJUC 5JJKA 2PEZA 2J0QA 1OXTA 4V02A 1O3YA 1II9A 4LPKA 2J41A 5FL7A 2PT7A 3K0AB 1S1MA 2IYRA 4CEHB 4ZDJA 2WKPA 2YYZA 1S3GA 5G3ZA 1RPZA 1G8PA 4TTPA 3TUZC 4NP6A 1EWRA 3CNOA 5LD2B 3SBEA 1GVNB 1NLFA 1ZU5A 2YOHA 4RD4A 3PEWA 2ZJAA 1KI4A 5CM8B 2ERXA 5JS7A 3CLVA 4CDGA 4B2PA 3PJRA 5L3RA 4RZXA 1G21E 3EWSA 2GNOA 2ZRAA 2O8BA 3ZVNA 1E2HA 4Q1EA 5H68A 1BYUA 3ZJYA 3RHFA 4AG6A 1D5CA 2H17A 3BFKA 1SGWA 3CBQA 4DIEA 5GJBA 1T8UA 2IUSA 4EUNA 2FGJA 3X1YA 5CIQA 1U0JA 2G77B 2BJWA 1N5IA 3T1OA 4P3YA 4EAQA 2A5DA 1QDEA 2XX3A 1M34E 5GVSA 4AKHA 2IUTA 4B48A 3TQFA 3IBGA 3AVYA 1E2PA 3U3MA 4GFDA 1Z08A 1G20E 2YOFA 2VP2A 1E69A 3CNNA 1NVVQ 3OAAA 4ARZB 4PPQA 3BBPA 2BV3A 4B34A 1ANKA 4B2IA 4URYR 1W46A 5HCIA 3BOSA 1S9DA 1LS6A 4KLNA 2C96A 1EX7A 4HAUA 3DM9B 3X1ZA 2O0JA 1S3SA 1NKTA 3A8TA 3NDPA 5CK5A 1T9HA 1XEXB 1H8HA 3CF0A 3Q7QA 3HU3A 3JVVA 2BC9A 1ESNA 4W5HA 2CBZA 3NWJA 3KQHA 2RGCA 3EARA 3ICEA 1DEKA 4PXAA 421PA 4W5WA 4Q4HB 3I32A 1NN3A 1ZNYA 4TMVA 2DZNB 3H0KA 2ZVQX 2BWJA 5JHGB 3FHOA 3DM5A 3LDAA 4M2LA 4TZ0A 5DYIA 1P2TA 2B7BA 4QRHA 3A4MA 4MRRA 4GOJA 4UNRA 5JEDA 4TT3A 4TLBA 4QBIA 2WBLC 5C4GB 1Q1BA 1TU3A 3K1JA 3GFPA 4HYYA 2HXSA 2FH5B 2WTUA 2OEPA 2ERYA 3QKUA 1MT0A 3LVRE 4V0KA 1CR0A 3E70C 2VHTA 4LGMA 1KSFX 1GILA 1Z6YA 4IHQA 3RS3A 2Q9AA 1RZ3A 2R6CA 4Q18A 3THOA 1CP2A 4IOMA 4JVLA 721PA 1OIWA 1P7CA 3ETLA 1UADA 1OYWA 1GL9B 1ZM7A 3CRMA 4D4KA 2IEYA 4LJ6A 3GJ7A 3ZS8A 4BEBA 3R7WB 2NPFA 1NBME 1UDXA 3GEEA 2NO9A 2XXAB 1CULC 1M2OB 2ODNA 4TSFD 2KWIA 5CDFE 4XOIA 5M04A 1GNPA 4AWXA 1ZD1A 3PITA 1ZM3A 4MQBA 4RCYA 1Z2AA 3CONA 4C2TA 5CYPA 1DG3A 3HR7A 4NE2A 4NDZA 3B9QA 4RD3A 2WJHA 1KYIA 1HEIA 3DMNA 1HV8A 1IN4A 5HZKA 3SQXA 2JEOA 1OH7A 2J0UA 3CW2A 1JPJA 3KXKA 4FI3C 1UEJA 4HSEA 3AKEA 2QTHA 3PUVA 4DCTA 3QF4A 2VQSA 2FEMA 3OEHD 2WWYA 1I4TD 1TUEA 1Z5ZA 3CR7A 3KW6A 3FB4A 2I1QA 5G41A 3AGPA 4I1OA 4PQRA 5BYKA 2XZLA 4OK3A 5K8LA 1KY2A 2OCAA 2C9OA 4MUBA 4FWIB 1SVOA 1Z83A 1J2JA 2CL0X 2ZVPX 4D4LA 3LA6A 1X3SA 5L3SB 4QBFA 2Y8EA 3Q85A 4ZKDA 4Q1BA 1KSGA 3U3RA 4AC9A 3HU1A 2GZHA 4B76A 4A3VB 2DFNA 1IN5A 1OSNA 1YHNA 2I3BA 4LJ7A 3P26A 5CITA 3THXB 3BFVA 3IEUA 2UZ3A 3CF6R 2XNDA 1XPOA 3W9YA 1NLYA 4BEJA 4DT1B 1PUIA 4RD2A 4BQSA 1G18A 1G7RA 2FSHA 1N6PA 5E7MA 5TXGA 2BDTA 2A7QA 5UKDA 3REGA 2NZJA 3F8TA 2PCJA 3NC1C 1FPMA 1N6NA 3LXRA 5KHOC 3QXSA 5TMPA 3CRQA 2KBFA 4IDHA 5K8UA 1HYQA 2I4IA 3MJHA 4LK2A 3A37A 2VP0A 3ADKA 3ZDQA 1XPRA 3H2YA 2ZRPA 5CK4A 2BCJQ 2E1RA 1I4DD 5AK0A 2H7VA 5FI0B 2VHCA 5IT5A 1VIAA 3VX3A 4PZLA 4JS0A 1AQUA 3IIKA 4DEYA 4URVR 2ZJBA 3WXMA 3OIUA 2ASEA 4OQMA 2ZROA 2B92A 1F2TA 2ZE6A 5BQ5A 3BK7A 5J4KA 3D3QA 3UMFA 2JCSA 4GOXA 2XTMA 1NVUQ 4JLOA 4NPHA 4PZYA 4Q7LA 3EWAA 1S96A 2QTVB 2GXUA 4W7SA 4PHHA 4MGYR 2GXQA 2A2ZA 4OHZA 4JLDA 4Q7JB 4X8LA 1UBEA 3ZQJA 3MD0A 4WXPA 2BEKA 4ZDIA 4KI0A 4KAXA 2LWIA 3FWYA 2RKOA 4LBYA 2O8FA 3AVPA 1P6XA 3GLGA 3BB3A 1S0UA 4PX9A 4GRAA 1U0LA 1J90A 5ELXA 2MSEB 1BH2A 1H8EA 3OZXA 4NZYA 5P21A 2NO1A 4QM6A 2QT0A 3GJ8A 5EE0A 4PPNA 2GCPA 5EUQB 4ASUD 3U7GA 4ZIRB 1OKKA 1E0KA 5DGXA 3IDQA 4IVPA 1PZNA 3PEUA 4IEEA 1OFTA 4M0LA 4GITA 4CW7A 2V6IA 1ZINA 4BLOA 2IUUA 2WMNB 2BM1A 3SFZA 2VYFA 3EZ7A 4PC3A 1C1KA 1SHZA 2BIFA 4LRSA 2NO7A 4URZR 2PCLA 1SVIA 3H84A 5G40A 2OSBA 2P5TB 4DVGA 1T3LA 2OXCA 1EFRA 4XSHA 4IOLA 1ZUHA 3PEYA 1P2SA 3SYNA 3I3SR 3I8XA 2ZS9A 5JZVA 2GILA 2ORWA 4F4JA 1SVMA 4XVRA 3AVOA 1VKJA 3ADBA 4C7OA 1K5DA 5IDVA 1W49A 2KI5A 1GP2A 4WIAA 2P67A 1R2QA 1W5TA 1JAIA 1LS1A 4WZAE 5KDLA 4D26A 1J8MF 1KZGB 2G88A 1TF5A 4Q47A 2FZ4A 3OEED 3RRNA 1XBTA 3BFXA 4QNMA 4MA4A 1CBUA 1GFIA 1S2MA 4D4MA 4QJ4A 3FVQA 1VECA 1KKMA 4XWAA 5E3HA 5TARA 4WOPA 1MABB 4ZCIA 5EZ5A 3LW8A 1DO0A 1GDDA 4L5BA 2VLIA 2V1XA 1BYIA 3NBZC 1YR6A 2CJWB 2HCJB 3A1VA 1V43A 5J40A 3LFUA 3EA0A 4DUGD 3UIEA 3EZFA 3X1WA 1U94A 1OXXK 1U90A 3AVXA 4GZLA 3TE6A 4IDPA 3RRYA 1FP7A 3ZZ0A 1YRAA 4M1YA 4DLVA 3VKHA 5CLLA 4A15A 1Q57A 4PO1A 3RABA 2AKAB 4DLUA 4XVQA 3TMKA 3NDBB 2D62A 3RSOA 5BWMA 2QMOA 4R2IA 4BFWA 4G3XA 2IWHA 4LI0A 2YJTD 2X77A 4RZ3A 4P4SB 1NN0A 3HYRA 4C9BA 5A4JA 3IQWA 4C3ZA 4E03A 3M0EA 3TKLA 1TL7C 2ZITA 4JN6A 2Z0MA 2R9VA 3BORA 1KSJA 4IOKA 4TQ9A 3SEAA 3B1XA 5LD2C 3T5GA 2ANBA 3RSLA 3CWZA 3IHLA 1P73A 1FUUA 2B8TA 1B0UA 1VYUA 4R9UC 4Q66C 1KDOA 3TAHA 4DCNA 3U4QA 4LJ8A 2GXAA 1ZIPA 5EQTA 3T5DA 3RS2A 4ZCMA 4FWTA 4KVAA 3JZAA 1E2GA 3TSWA 4EFLA 2ONJA 5DLQC 1E2LA 821PA 1XTRA 2ZJOA 5JCPA 2EFCB 1PV4A 2CHVA 3L8YA 4JKYA 2SHKA 1W5SA 2A5JA 4XH9B 5B2ZA 1K8RA 1E9EA 2J3EA 1EFUA 3SZRA 3KQKA 2IS1A 1KI9A 1UKVY 1UKZA 5LPNA 5EP1A 4QKQA 1NVWQ 3L0SA 4NMMA 3QG1A 2QPOA 4XIGS 2QRNA 4NYJQ 1RYFA 1TQ2A 1KDTA 2CL7X 1Z06A 2OZEA 3ND8A 3CX7A 2F1HA 2XSZD 3SJAA 4I99A 2RGNC 5JI3E 1XPUA 3B1VA 2E87A 4FMDF 2F3TA 2ZRMA 5BYJA 2ZEJA 1E6CA 5GADl 1NL3A 1RFLA 3HP1A 3SJCA 3T15A 4M1OA 2O8CA 2GAAA 5L3QA 2A5FA 4IFBA 4MKFA 3B85A 5HKKD 4GPTA 5FUYA 3GLHB 1E9AA 2XZOA 1NY6A 3JZMA 3WRXC 5DYGA 4FMDB 3V00A 2UVQA 2ZU6A 3G0HA 3EZ6A 2ZRLA 2QN6A 3LX8A 1KMHA 2GEVA 3OESA 2OBLA 3RLFA 4I4LA 2PH1A 4Q5IA 4Z51A 4EQ6A 4HUQB 2AD1A 3DZ8A 2QROA 3BIFA 1UBGA 4D25A 1HA3A 1DAHA 2AK2A 3W3ZB 2BMDA 1N3BA 5FBLB 4XSGA 4BLPA 1G1MA 3TBKA 4JL5A 3FMIA 2OAQ1 1LB1B 2ZYVX 1RIFA 1SKQA 4OYHA 3UG6A 2H18A 5FBQB 3DEFA 4UXHA 2KBEA 2EVWX 5FBWB 1OJLA 3OE7D 2ZI6A 2F1JA 2RGGA 3PIRA 1YR9A 2GESA 2PX3A 4W5JA 2ZUCA 3GLFB 4FN5A 4QXAA 2AWOA 2HLDA 3QEJA 2K5UA 3FFBA 2GHIA 1R7RA 4UXJA 3L8ZA 3I61A 3I5XA 1GL6A 3R9WA 5AJZA 2BJVA 1Q12A 2ZJ2A 3SC3A 2BCGY 2VL7A 3TSZA 5JFGA 3QEOA 3W6PA 1VYTA 1E0SA 2FJUA 4BFXA 5AWFC 3K0CC 2ZU0C 1RRPA 3T06B 1FL9A 4C0SA 2F43A 2VSOA 4US0R 1ZP6A 4TMWA 3THWB 5EJEA 2ZSBA 4LV6A 4LJ5A 4BRWA 3NHBA 4AYXA 3LXXA 3P1JA 1UBCA 3TW4A 1GKIA 1OHHD 2C77A 1BMFA 2NMVA 4NYMQ 2PLFA 3L43A 3QNUA 3CH5A 4UNNA 4QGAA 3KUCA 2F9LA 1W48A 1YR7A 3BERA 1XCGB 4U02A 3LQQA 2Q3MA 2IBMA 2WWXA 3AH8A 2ZI7A 5JWOA 3CWQA 2GJKA 3PQCA 3QG5A 3W6NA 4UKDA 2OBMA 2WJVA 4C0KA 3VMFA 3SR0A 1W4AA 4Q9HA 2JIZA 3OIWA 3Q72A 3B8HA 3P4YA 4HAVA 4BLRA 1EFCA 2VO1A 1DELA 2DFKB 1YQTA 1GSIA 4MYCA 1NIJA 1W4CA 3HDTA 2YWGA 3DOEA 4D2IA 4ERNA 3QKSA 3QI2A 5FPTA 2GF9A 5HE9A 2FA9A 1WBBA 1QVRA 1VIYA 3IIJA 1VG0B 1ZUIA 5B57C 1VCOA 3B78A 4A0HA 1T6NA 2QG6A 4O2RA 1WCV1 3PVSA 2ZJYA 1XMIA 3ZVRA 1GL7A 3KZ1E 1YVDA 2C04A 2VHJA 3S1AB 1XRJA 2V7QD 2GEDA 3QXCA 1Q20A 1I4LD 4N1AA 1KJYA 4RFSB 3WMEA 3A6PC 5D3MB 3MLEA 4BZXA 2CLDX 5FPSA 1Q44A 3AP2A 1U9IC 3A58B 2ZI9A 1JI0A 1OF1A 3KFXA 1VHLA 3WP0A 1DPFA 1C4OA 1CJVC 1QBKC 2JLUA 1FOEB 2G0TA 3D31A 4JBYA 1A2KC 1XTIA 2V55B 4TWZA 3U6KA 2CK3D 3SS8A 4DLWA 2BMEA 4B3CA 5AJYA 1GG2A 1QHHB 5DN6A 2HV8A 1E96A 3ASYA 5C46F 3FPAA 2ZRCA 1E2FA 1RYHA 1UF9A 2ZYWX 2FFHA 4I1VA 4Q7MB 4HAYA 5AR1A 3THYA 1K5GA 2P3SA 1YE8A 2B7CA 5E95A 2J0SA 2G0NA 4LSGA 2XSZA 1YR8A 1JNYA 2DYKA 3WP1B 4YXWA 4DLYA 4GL2A 1II8B 4BECA 4IDQA 2ZRBA 1A5TA 4P31A 1EK0A 1X86B 4B43A 2NO0A 3KJHA 1NKSA 3Q9LA 2OESA 4OHXA 2HYIC 4OJKA 5H1YA 1XEWY 3UMSA 3WHKA 4XD7D 3SNHA 1Z0FA 5HKKA 3TH5A 3B60A 4Q9KA 3QOFA 4KBGA 1HQYE 3VR2A 4HLUC 4KODA 5DSZA 3QVUA 4FMCF 2OM2A 2WAYA 2J7PA 4EJSB 1W0KD 1SVWA 4Q21A 2Z83A 4NH0A 3UKDA 5EP3A 1QVAA 1GTVA 2F1RA 4UJ5A 1G5TA 3I4LA 2D2EA 4LHZA 3AP3A 2J59A 1XWIA 1YKSA 4L4UA 3DPUA 3H86A 4LV5B 5FTJA 3ZZUA 5JSZB 2ODWA 2O8BB 2PZEA 2DFTA 2GJAA 1U2RA 1FFHA 4LHYA 4LY6A 1F48A 1R5NA 2QE7A 1VCMA 4TL7A 5H70A 2G9NA 2DY1A 2JLZA 4TYWA 2WM9B 3T1QA 3TRFA 4YDHB 2AD5A 4FMCB 1AS0A 1IJEA 3KQLA 3VR6A 1JAHA 5KYKA 2VP5A 2QSZA 3OE7A 4HDOB 5HZHA 4KCGA 4V0MA 4JLMA 1GNRA 2ZS7A 5A5GA 4HDQB 5BN5A 4CEIA 4UQOA 4DRZA 1OXVA 2FF7A 3ZGXA 3ZIAD 3N5CA 1G5RA 4PANA 2QP4A 4M1WA 4NYJR 3VLFB 1N6KA 4PSAA 4AYWA 2W2XA 4LDJA 3LBHA 4G5GA 3C5CA 4M1KA 3ZD6A 3X2SA 2QGZA 3K0AA 1ZM9A 4CEHA 4RFVA 2YOGA 1TEXA 1G19A 2W6ID 1SXJE 1XTKA 4H1UA 2BMFA 2QQEA 3DKVA 3ZYCA 1FNNA 1DAFA 1ZD8A 3LRPA 4G5RA 4JLBA 3AVUA 4WA7A 2DVWB 3ADCA 1XJCA 4BFZA 1XZPA 2OAP1 2RGEA 5EUMA 4NBSA 1G8FA 5F9FA 1Z6XA 3TSOA 4EPWA 1KNQA 4XWKA 1P75A 2GWHA 1O87A 3AVWA 3PUYA 3B9PA 1T3HA 4GI7A 5AUQA 1QZMA 1SULA 3A1TA 3LLUA 4M1SA 3UG7A 1R0YA 2QP3A 2DZOB 2HF9A 3A1WA 1DS6A 3U44A 2AWNA 2IYSA 4OHYA 2GF0A 2W6JD 4M8NE 4CRWB 2IYUA 2ZAMA 4LX0A 2J87A 4BZPA 2QTFA 2VSXA 2X19A 1MRNA 2DBYA 4MYHA 4ARZA 2NZ8A 1PUJA 3BS4A 1BOFA 4B44A 4QFMA 2BM0A 4DB2A 1XD9A 2RGNA 4EIWA 1NJFA 1G16A 2JDID 2EW1A 4DHEA 4A0RA 4MKHA 3T12A 1W2GA 1E1QA 2ZM5A 2YNMA 4IVRA 3R8CA 5BXQC 2ODBA 2ANCA 2O0KA 1XEXA 4EPYA 5JMTA 5F98A 2FN4A 2QP9X 4CF7A 5FBVB 4LJAA 1BS1A 2DPXA 1L8QA 3BD9A 3M6AA 2ZRGA 3BGWA 3Q3JB 3Q7PA 1S8FA 5CJ2A 5SZHB 4BFUA 2F7SA 3DVLA 4DEXA 1T8TA 2H57A 2IEZA 3IIMA 4ITRC 1BKDR 4OHWA 4BPBA 3FFAA 2X2EA 5KSPA 5B30A 2QMHA 1L4YA 4Q4HA 2OFWA 2HJGA 3SJZA 5FOSA 3NG1A 3SFVA 2DWOA 3DKPA 1X8KA 5JWHA 4UNSA 2EFHB 2PX0A 3FHCB 6Q21A 5JI2E 2VPPA 3GJ4A 1XCMA 2V7QA 5FH9A 2JLRA 3BRWD 2ZSFA 4OJQA 4TMTA 4BASA 5KOYA 1KTVA 1G17A 5TB5A 3FMOB 1A2BA 2QENA 1GIAA 2VSFA 2XB2A 1KO7A 3IPYA 2GTPA 1E0JA 4GSYA 4QL3A 4JJZA 4RJLA 2YKGA 2ZI3A 5GJCA 3C14C 4AK9A 4NYMR 1E99A 5K8TA 1ZMXA 1CR4A 2VRWA 2C78A 4JIMA 2PLRA 3IKJA 4TLCA 5SZIA 4AKIA 3FKSA 1RKBA 4HI0E 3A1UA 2RCNA 1G64A 1A4RA 2FNAA 4LC1A 5LB2A 3X1DA 3ASZA 5EXTA 5DI3A 4TYPA 1E1RD 2EFGA 2B6HA 4MRPA 5A0FA 1T4GA 3F0TA 3WNDA 3TNFA 2XXAA 3TW8B 1NF3A 5FOWA 3R9IA 1NJGA 4US1R 1FX0B 1P3JA 4NYIQ 4LYJA 1KK2A 4B2LA 4PQFA 3WMFA 1JALA 4LOAA 2XJ9A 4V0OA 1Z8FA 4E09A 3K0CA 3RS7A 2OFXA 2CLSA 1YJ5A 2Z5FA 4PSKA 2BHRA 1AGRA 1U8YA 4Q4JB 2NOAA 2Q9CA 4U00A 3VKGA 1RRFA 4ZI3A 4LC0A 1WE2A 1US8A 1KDRA 3EZ2A 1IM2A 4HDCA 2CE7A 1A7JA 1ZNWA 5AUOB 4QBHA 1G7TA 5CJPA 3QQ5A 4OQLA 3LBIA 3QBVA 4N0DA 4Z54A 2ORIA 3NIBA 3CIOA 2WPDD 2H8KA 1EG7A 1NSFA 3B7GA 2A30A 2QORA 3T34A 1W0KA 2RAPA 3HWSA 1KAOA 2GBLC 3JVUA 3KJGA 1MO5A 1AJEA 1DE0A 3EPJA 1I2DA 1YZUA 5BN4A 4HZIA 4II7A 1EFHA 3TJZA 1V5WA 3VX4A 1T3SA 4KV9A 2HCBA 1JR3D 3K09A 2NG1A 2A5YB
chains in the Genus database with same CATH superfamily
4L4YA 1GPBA 1PTJC 2J6IA 3HM2A 4YXFA 2ZETA 2XNSA 5CDUA 1LNZA 1ECLA 2CXQA 2V5AA 5B2EA 4OA5A 2CDNA 1PWZA 3PU6A 4ESOA 3RS5A 3BBZA 3ZKWA 4D8WA 4IDAA 4EVIA 2CV1A 4OXNA 1OBFO 4RNAA 3JAMA 4BQPA 1NIPA 3G1WA 4IKOA 4DDUA 3I58A 4LVNA 1HGXA 2PGAA 3WIOA 3VR3D 4HDSA 2CD9A 5KNBD 2O2SA 1AXRA 4PNPA 2V3WA 3SE7A 4ACBA 4OMFG 2XT9A 4Q9LA 2NZUG 2RD2A 4OB6A 3BH0A 4FXPA 2ZW9A 3OP4A 3TNYA 3NBXX 5JIBA 3WGZA 5LOVF 4K1XA 2DAGA 1EWVA 3RTEA 4ZDKA 3KDSE 2EHDA 3MBIA 2W71A 3T1VA 2R68A 1PT8A 5AQ1A 4XRGA 5JZ9A 2SICE 3S2SA 3V2IA 3LBFA 3GPLA 1YTLA 2WZQA 4NJOA 3IOYA 1TMKA 3OZAA 2DHCA 4FBMA 3BAFA 3JD3A 4Q16A 3W8RA 4D80A 4OK6A 5EY5B 3A6GA 2O52A 1HE1C 4LDQA 1JFLA 4BZWA 1BX3A 1IHDA 4YJ3A 3CINA 3JQ7A 2F5OA 2PIAA 4R1TA 3DJYA 4EQZA 2E4WA 1YQQA 2IDZA 3BMXA 2UU9M 3KOYE 4CISA 4KUHA 1T9ZA 4NHOA 1ADGA 4CIYA 4QASA 1NT2A 3O8BA 2QS9A 3E35A 4RESA 5FPKA 4XWYA 3DQZA 4FCWA 2Q1TA 4LRTA 3P0RA 1MDBA 1M7BA 3HJSA 3EFHA 4K87A 1CUVA 1TK3A 3AVTA 2QUAA 3KFVA 3U9LA 2VAMA 3NHUA 1MPXA 1DEOA 2MOKA 2ZRDA 1TA9A 4HF7A 4N9WA 1LK7A 4MMZB 1G59A 1J0DA 1Z5OA 4I55B 4PCVA 2G3YA 4TKUB 1KJZA 5A4AA 3Q5DA 2PJRA 1U4NA 2KM1A 2YWBA 1D2GA 5EVJA 2ISQA 1GJRA 3KP1A 2XVXA 3AWIA 4GI5A 2GFIA 2MT9A 1FP6A 3FR7A 4H1VA 2R45A 4BQEA 1YI8A 3PJFA 2DTDA 5KO3A 2JLYA 3LKDA 1NTRA 2J9YB 1TQ4A 1ZJ5A 3DV0A 3QKSB 5J2TF 2ESRA 3U6EA 4RJTA 1E9FA 4EDFA 3WB1A 1I5OA 5AVSA 2DLDA 2P9CA 1MO6A 1FTQA 3W06A 3VSDA 1TT5B 5KYYB 2ZRQA 3EW9A 5M3BA 3ZWAA 3MS7A 3O8QB 3WHPA 2F9FA 4RQUA 3BSSA 4MM3B 5CA1B 5ES3A 3PEVA 2EFJA 1FY2A 3IUYA 3JVEA 2YIJA 3GRRA 3U1BA 3EVFA 4OXYA 3BTOA 3IP5A 3INNA 1FS5A 4XVHA 4R40A 2NV2B 2ORYA 3KNZA 2W11A 3BIOA 3D1LA 2Q07A 2FLVA 5DNYB 1GRVA 1FDWA 2IZ5A 1FK8A 3WG9A 1WLYA 2CHFA 1LY1A 3B2EA 1JJFA 3NONA 2QJTA 1ZRHA 4IYJA 1OX4A 3VDXA 3CHYA 1ZITA 1GLNA 2YV2A 2ZJ5A 4TMFA 2QNJA 2FEPA 5FHRA 3ND9A 3MOSA 4E70A 1S7GA 3P2MA 3PUWA 5H9VA 4FS3A 4GX2A 2PSJA 1VXRA 1WXHA 2XNHA 4AJ2A 1YZNA 3QENA 3BMCB 4MIKA 1CEEA 4MV4A 2JK0A 4KFCA 4NVRA 5DSTA 4P0PB 2PVPA 3U7JA 3WGTA 4LFCB 4AY2A 4UBKA 3AHIA 4B17A 3VC7A 4D9JA 4DQ0A 4QGHA 3CB4A 2A4KA 4V3BA 1NBMA 4OOEA 1L3BA 1G8YA 4QHTA 3FYHA 3FUTA 5ARDA 4PHFA 3IKLA 1BCRA 2O2GA 1ZIYA 5FOQA 2Z6UA 4GYJA 2ZZMA 1YACA 2P9EA 4L5IA 4KFTA 2C2KA 1I01A 3C7KA 4P3OA 2AYXA 3G8BA 5DI3B 3BWEA 2G7MC 3JATA 2PKYX 1M1YA 1LWOA 3K0EA 2DWMA 3OQNA 4BV2A 2G72A 4RNDB 2O05A 3MD9A 1ZCJA 3CRRA 1I33A 2HIHA 3HHYA 4YCLA 4DMCA 4K9MA 2BMAA 4DV3B 1TUGA 1KMNA 5LBTA 2R2GA 4NCBA 3EF1A 2J5QA 3FSJX 3H19A 2C5HA 1EXDA 1JJ7A 1G2OA 1JMYA 5IJ9A 3T7SA 2BKEA 4DW8A 2F67A 4J9UE 1KJWA 4KXMA 2I33A 4J03A 3JQQA 1GA6A 2EZ9A 4R9SA 2QSFX 1ZK0A 2BKXA 1L5VA 2IA5A 2POQX 4NMLA 1H3FA 4TL8A 2OXFA 1IQUA 2H63A 3NEJA 2OAEA 1MB2A 1IL0A 4TS3A 5FCDA 1ODLA 2GETA 3U7QA 1SAYA 2BHLA 3O2NA 2WV7A 4FFRA 3HBFA 3ADDA 1CF4A 2JY7A 2BMJA 1C3XA 1AN9A 4U7PB 1IC6A 2Q99A 3N2IA 5IAGA 3T0FA 1GARA 2VEOA 5A2QA 3O1IC 2WJ3A 3PFGA 1QSGA 4F84A 1YS6A 1LPOA 4NOLA 1JAXA 3EGXB 1EFVB 1B6TA 4EG1A 3G9XA 1RBYA 1WXXA 5A02A 3AV0A 4D99A 3ZJTA 2QAGC 1F2UA 4AZ0A 1M1NB 3GLIB 5E4FA 3GGPA 3U7FB 2CHGA 3EWIA 3VAAA 2CCJA 1E0AA 3INRA 3EGVA 1JIVA 2C42A 3HJUA 4HH1A 4NQZA 3QVWA 4KJZA 4CPDA 1IE3A 4FPXA 3TF5A 3WNQA 1ZNZA 3IODA 3DKIA 2OPFA 4ZMBA 1JW9B 4ZT2A 1TO6A 2GOYA 1E2EA 1R6TA 4GDMA 1TFRA 2OT3B 1DIHA 4Q3AA 4Q03A 4R4JA 2G71A 1J70A 2FP3A 3K53A 1I94B 2Y0TA 3ZZTA 3SXPA 1M76A 1N2OA 1R5LA 1VI5A 3P4XA 5JSUA 2OC4A 1OBHA 4UAGA 4DUYM 4YRDA 4BZQA 4ZVTA 4DBZA 1N0HA 3OUTA 1PCXA 4YMIA 1LNSA 3FNQA 1U65A 2CWBA 3EDMA 5AYVA 2CGEA 3GUCA 1R4GA 4NBTA 3QE4A 4ND4A 2FF5A 4PSVA 1BEZA 3EX7C 1DNPA 1T13A 2J7PD 4KW7A 2GH1A 3DH0A 1E59A 3NHAA 1Q14A 1VMAA 2O3TA 3HTXA 1DJQA 2FWMX 2GN6A 3EXEB 3L5KA 4FZ3A 1TE2A 2J3KA 1MX5A 4LQCA 3UJ9A 5AJXA 1J5EB 4PLYA 3CS3A 4GKBA 4J1SA 1KJ9A 3DDOA 1KYXA 4NAHA 4NDNE 3GXOA 3RVDA 4UEQA 4GIPA 1NNJA 3F6BX 4B3MM 1XXHE 1V16A 1TMGE 1WMBA 2VJMB 2BFFA 3MCAA 1LUAA 1U4SA 2QAIA 3UHFA 1SMKA 1N9GA 3N7TA 1A27A 2VOJA 4D8YA 5FFMA 2YYYA 1WZCA 4AD8A 2WJPA 4CEJA 4B3TB 2QMYA 2Y20A 1J9ZA 3GRKA 2HLPA 3HXMA 3G3EA 4R2LA 4EHKA 4BB5A 1TF7A 4X62M 3UK7A 2WF7A 1K27A 1QE0A 4X6UA 3KPJA 4EAAA 3VU1A 1YUNA 4RMNA 3OIFA 2JC3A 4MICA 4BFSA 1E3DA 1HXHA 5D87A 5EHZA 3KTDA 3WKDA 3ISJA 3IURA 1OTRA 4LF4B 4AJKA 3NBIA 3CPJB 1L5GB 4N7JA 3PCTA 3DHVA 1WD7A 5FSWA 1V5EA 4P4TA 4PLTA 2HT6A 3BIJA 1QV7A 3HCCA 2WM2A 3M1LA 1FIUA 4E7PA 4EHJA 4ZOBA 5IZ4A 2XUHA 3QMPA 1DG9A 2B8WA 5BN3B 1U0NA 1P4SA 5JHHB 4IX1A 1CE8B 5FEUA 3NWLA 1RKVA 4CEIB 3I1YA 1II9A 2FE8A 4ZDJA 1UPUA 3H5LA 1PQYA 2CD7A 4UTNA 5CM8B 4F1IA 3WL7A 3CUKA 5AKYA 5IC5A 4FEEA 3MERA 1ZI9A 5CIQA 1U0JA 2E48A 4RIIA 2G77B 1DQYA 1V6CA 4DQKA 3HCNA 5GVSA 3BXEA 3EQ2A 2WI8A 2FRDA 4ARZB 5BV2P 1F38A 2FUG6 1ANKA 3EQZA 3BXXA 1GQQA 1LS6A 2FVYA 1S3SA 1NKTA 3JYNA 1ZHFA 3QPDA 4PW0A 1UJBA 3R8XA 1W93A 1SPXA 2VJAA 3PIIA 4EG4A 1B00A 4CFZA 1ZEMA 4EVSA 1SB8A 4BU0A 2X86A 5LQSA 4TT3A 4AROA 3BFJA 2ONCA 1ZH2A 1TU3A 2ZWOA 1N78A 4V0KA 5HZMA 3JQDA 2VHTA 3HJGA 1GILA 4ML3A 2Q9AA 2OVBA 4AY3A 4WVLA 1GPMA 3FFTA 2ODNA 4BBPA 5ESDA 1DBRA 4MQBA 2FW7A 3EHDA 4C2TA 2H1VA 3SC4A 3C3YA 2P9QA 4OTZA 1DG3A 4GHWA 1YDFA 5LWHA 3HXLA 4RD3A 2WJHA 1Q7GA 2QQ8A 1TUEA 2YJ4A 4UBIA 2FJPA 4F2WA 1MXFA 1Z34A 1R37A 4MR9B 3LA6A 1X3SA 2OCLA 1DKUA 5TEVA 4OUDA 4Q7EA 2VTBA 3BDIA 2EJSA 4K9SA 4JXJA 4H7PA 1NLYA 3N8DA 2FSHA 3LT2A 5E7MA 2C9BA 2QHXA 3QLUA 5EWMA 4ENUA 5LVAA 2KBFA 1YCFA 5IXJA 2I4IA 4QYXA 3TM4A 5IT5A 2NTVA 4MVJE 3GLSA 2A9VA 5LQCA 3K71B 4XGIA 2CBXA 3U9TA 4OLAA 4H7HA 4PHHA 1I2AA 3ZQJA 4IGEA 3BB3A 1R8YA 4I8DA 5KNBH 1BH2A 4ZEXA 3KB8A 1X19A 1LA2A 4QTTB 3GZNB 2CYCA 4FYHA 3UK0A 4OX9M 3PEUA 1AURA 2V5UA 2IUUA 1M2EA 4KGDA 2XUOA 3BZBA 3ZXSA 3WNZA 1P2SA 4PONA 1SVMA 3Q88A 2QVXX 3DEAA 3P5BA 2HSDA 3AB8A 2LW7A 2AX3A 4G07A 1U1GA 4BMNA 5JY1A 3GFVA 4YI3A 2NO5A 5TT0A 1JYSA 4D4MA 2XE4A 2J3JA 2GHRA 4DS3A 1QCDA 3NORA 1M66A 4KQ6A 1TJ5A 4NZMA 1KH1A 4KQ1A 4XA8A 1AB6A 1B76A 4W1PA 3T5TA 1HMPA 3RABA 1AKTA 4FFMA 5BN1A 4FX5A 3J7AC 5B7GA 5BWMA 3U6OA 1C0EA 4H1TA 1YA6A 4NZNA 4CR7A 3IHLA 4Q66C 1JJIA 4LJ8A 2V6FA 3MCTA 4C6TA 1INLA 2PMWB 4UAVA 1PV4A 5JCPA 2ZJ1A 1OV6A 1PJIA 2DGDA 4MJ3A 3I4FA 1O95D 1XRRA 2F1HA 3SJAA 2BFMA 4JCCA 5LZ4A 4OMCA 4NESA 2PS1A 4O33A 5ALYA 1XLWA 3QFTA 1YS7A 3QUAA 3L7IA 2Y1OA 4CKCA 4DR4B 1BD4A 2A1TS 2XZOA 4QFDA 4U2CA 2Q8QA 3HCEA 1LLUA 1H23A 3EZ6A 4REQA 4C03A 1GUZA 5AO9A 4GRIA 1EG2A 1LB1B 4TYMA 1RCTE 2AIRA 2KBEA 3W68A 2DSNA 2RGGA 4IILA 3QE9Y 2BFBB 2AWOA 2Y1XA 4DR5M 2VDLB 3L8ZA 5DLDA 3OTQA 5AJZA 4FNMA 4ER0A 4NXNB 3H6KA 4HMQA 1F17A 4US0R 1JT9A 2WD7B 1M67A 5IFKA 4P34A 1BMFA 1ZS9A 4FYPA 3U4MA 2ZIUB 4OV6B 3AH8A 2KNZA 4OXXA 1BRMA 2XWBF 4Q9HA 3RSGA 4MYCA 4AWBA 5GPBA 2J3QA 3WDSA 1LJLA 1H1DA 3HUUA 2FW6A 4HQOA 3MJVA 2DT5A 4WFQA 2HHHB 2H1RA 3JQAA 3FI9A 1I0IA 1Z5AA 2PQ2A 3AY3A 3QTTA 4UUPA 4EB8A 1OF1A 4J94A 5FUBA 2X5XA 5EEHA 1USKA 3L8CA 3ZD9A 1XG5A 3GT0A 2Q62A 5EPUA 3U31A 3DFKA 2CLFB 5C46F 3TR6A 1HTTA 4I1VA 1JMVA 5DV9A 3OPNA 3JRNA 1ZD3A 4IDQA 3I2FA 2HSEA 3W7AA 3E9ZA 1X1DA 1Z0FA 2X0KA 1SBYA 2H4HA 4HY3A 4GPD1 1QPGA 3WWYA 4DF3A 3NOQA 1XWIA 4O4IB 4LHYA 2XIQA 1F48A 5EJ2A 5KYKA 3UUEA 1T4CA 2A14A 5ED4A 4RJ2A 3KYBA 4JI8B 3IMCA 4HDAA 4HMOA 4X90A 2W2XA 4LDJA 4M1KA 2QGZA 5DOVA 1KL7A 2R8YA 3I9MA 3HEAA 9GPBA 1ZD8A 4L73A 2HMSA 3LL7A 2RGEA 3UN1A 1ZA2A 3KOZE 1PJZA 2GWHA 5AW3A 5CCBA 3LIPA 3F7MA 1DZIA 3B9PA 1J33A 2YJZA 3LLUA 2QP3A 4BBJA 1ST2A 1DS6A 3HI6A 5IKXA 3M4ZA 5CTAA 4L5AA 4BZPA 4FE3A 1NJFA 5IS2A 1TA0A 2LVNC 2C8KA 4B84A 2FN4A 4MS1B 2H1WA 1BKDR 4Q4HA 5E2BA 5JYEA 3CNHA 2A1TR 4H1HA 5FOSA 2DWOA 1KAEA 4UM8B 1ATZA 4MVJF 3WLOA 2O07A 5EGNA 2OYRA 4FFSA 4GSYA 1E99A 3LF1A 5ITSA 1E60A 3PFCA 2Z2ZA 4DQLA 1J2TA 5KIAA 1GV1A 1K75A 2CWDA 5PGMA 1P3JA 3D3KA 5ALZA 3JR4A 1YE9A 1WV0A 4F6LA 1ECJA 4NNOA 5EHIA 4JGBA 3T5BA 2ZSUA 5AUOB 1Y0BA 4OQLA 3COJA 3MQ2A 5D1NA 5AIAA 4IHJA 2PX2A 4IIJB 3GPXA 3KJGA 2PKEA 1B2LA 3RR2A 3WJ7A 2HIGA 1AX9A 3VX4A 1VCHA 4MEBA 1JR3D 4NJMB 5IM4F 5AI0A 3VO2A 1KY3A 5EN4A 5IVDA 3NX4A 3GEDA 2WWFA 5DO9A 2OSVA 1UP7A 1SUEA 3RRMA 4DJJA 1ZU4A 1L5YA 1FP4A 3QUQA 3D4IA 4DCVA 4OM8A 1W19A 1ZD2P 2XZFA 3VNUA 4BVJA 2HWUA 3CGGA 4JL8A 3Q5GA 4HQKA 3RU9A 1M8GA 1LZKA 3CXUA 1VL5A 2I6TA 4F3RA 2IUEA 4CCYB 2FWNA 2RB4A 1NX9A 4E4TA 3EPLA 4OHFA 4IBJA 1KQGA 4DUPA 4GPAA 4QPPA 1B1CA 1Q3BA 1K7YA 4J2TA 3HA5A 5I9LA 1BRTA 3CJTA 1VHWA 3Q41A 5AXBA 2SCUA 1DQSA 1TCUA 4IH9A 4ZYUA 1QC5A 4LZOA 4TTRA 1I10A 3SS7X 4P93A 1EJ2A 1F14A 3TEJA 3M7GA 2ZYIA 4LJRA 1UXGA 1TRKA 4FYMA 4C0WA 3IQGX 4MJ7A 2IZZA 1MO3A 4YFVA 3EG5A 1OLOA 1EGQA 4EGCB 3DDHA 4YCAA 1AZTA 1OXSC 1ZJJA 5HJEA 3VBEA 2A1UA 4UU0A 2EWVA 4WCFC 2NYAA 1MZVA 3DAOA 8ADHA 4C89A 1V7QA 4B3IA 4PPFA 3K5WA 5C31A 4KC0A 5B1EA 5CDHA 2IFTA 1Y37A 1UBSB 5IK2D 3ZCTA 4Q4AA 3F2VA 4R8RA 4F45A 3MCUA 2K47A 1QFZA 2DKOA 1F1BA 2WDZA 3EVTA 4UU7A 1ZVJA 4COOA 5KC8A 1QBGA 1QRAA 1IXSB 4IL5A 3CUYA 1VJ1A 4N40A 1PJRA 1MJNA 5EWJB 4BBAA 3D8BA 3TVTA 5TVGA 1XRQA 3OP1A 2OK8A 4UFNA 4B6OA 4DBLC 2ZSIA 3KKOA 3D2BA 1KVQA 4Z86A 5AVXA 2GK4A 2H6EA 4QNNA 1E4EB 3NO4A 3GT7A 4X94A 1NQWA 3OSUA 3BE4A 3UWOA 5JS8A 4Z1MA 4UM7A 2QMUA 1AV7A 4FGWA 4OI2A 4J16A 3CLRD 5A4KA 1XNQM 1TQHA 3OEEA 4KTVE 4M9XA 1I36A 3KYDA 4JD5A 8CATA 2PXHA 2KHZA 3HN7A 2I2FA 4RA9A 3TD6A 3THWA 3NWEA 4J75A 1HZZC 3VSAA 3R3ZA 1DC5A 4KXXA 1JEJA 6YASA 2FMUA 1P4HA 3MRTA 3L6CA 1QLJA 1FXWA 1S2DA 3WV4A 1L4LA 2CXXA 4OQPA 3FDFA 2L4FA 1ECBA 3CEAA 4O8CA 2VKQA 2ZJ0A 2P1ZA 2AOUB 1ZN9A 1LSUA 2Q46A 5LMUB 4DC9A 2H4FA 1R16A 5EZ6B 3ONEA 2GERA 1URPA 4MVJP 2HA0A 2J5KA 4IFEA 4KU4A 4MKZA 4HL6A 1KR5A 3WL5A 2J1LA 1KH3A 1ZR2A 1D2EA 1GQ2A 4K9DA 3WTBA 1KI6B 4NPAA 4PPGA 2NU9B 3OF2A 3IVCA 3EPPA 1WUHS 2K9DA 5KYUA 1Y1QA 6NULA 1N2EA 3BWVA 4LRQA 4YT2A 3JSAA 4DV4M 1XRSB 4ND8A 4QYIB 1Y1RA 1E98A 1GPUA 4MQEA 1XB2A 1XZGA 4P33A 1W5BA 4AULA 3CT4A 1SCJA 3PC7A 2ZM6M 2NU7B 3LSTA 1RI4A 4UTRA 2C1EA 4KLZA 4RZHA 5K4HA 4BNVA 1C7EA 4LNHA 1ECGA 1HUQA 1W94A 4ZZ1A 1HT1E 3R3JA 4X00A 1OREA 4TZKA 2QRUA 1FLDA 2FQQA 4NH4A 4I46A 3C8UA 3JAKA 2QHOB 3TOSA 1G41A 4LOJA 3HV2A 3NP7A 3UT0A 4ENWA 3TGWA 621PA 4YK7A 5ARCA 3N1UA 3OG9A 3FPLA 3KP0E 1Q1QA 2KDLA 2RAFA 1XA3A 2L7IA 3CEJA 5BSVA 4Y6GB 4JUIA 3IV9A 2X8AA 2BISA 1Z29A 1Y7HA 3AEKA 1MH1A 2O4UX 4DIMA 4NC6A 1NGSA 4A8JC 4GI2A 4HC4A 4ZYXA 2DERA 1DDIA 1OT3A 1JH9A 4LOLA 2X8BA 1IM8A 1P1RA 2F8MA 3IOBA 2OOBA 3A70A 3ZE2B 4PDIA 3ECAA 1DX4A 3MRVA 4CIXA 2B2XA 2P2YA 3L0PA 1NE7A 1NOKA 2C2HA 1OTYA 1H69A 3PXGA 1NNI1 3U1TA 3ANLA 1ZM4A 3S8YA 4B80A 4ZZ3A 4KFUA 1UWKA 3P2JA 1LX6A 4I5GA 3HY4A 2K7FA 2A1IA 3REFA 5BYBA 3WL8A 4QE3A 1SQ5A 1W34A 4D98A 1RD4A 4H1WA 2C94A 1AUXA 2NO4A 2ZAIA 4QDJA 3QXJA 4EDHA 4JJGA 3C6YA 1DC8A 1XZDA 2WJ6A 2YJ3A 1GZDA 3BUSA 4XIYA 5F7ZA 4KLRA 4ITVA 3D5EA 4WKGA 1MU5A 5FV4A 5CBPA 2XKKA 2FOIC 1TX4B 2Q3HA 3UCXA 3T7IA 2Q45A 2BEVA 5LDDC 3OH8A 4PNHA 1KAGA 3PTZA 2VP6A 4PSUA 2D8MA 4OJTA 3SP1A 3CRVA 4YBRA 4JT9A 5A3SA 1GZSA 4IQ0A 4UHBA 4JI6B 4R8MA 4PSDA 1AGYA 4C08A 4MUFA 3G1UA 1NUQA 3KOWA 3SQWA 1ZD9A 4ARSA 1P9LA 5C5IA 5ALNA 3ROQA 5EEGA 1E6LA 3QLEA 1JTFA 4MI1A 2IZ1A 1OOEA 4BTEA 4JODA 4ZTUB 4QD3A 4Z7JA 1E20A 2XHEA 1TF2A 2ZT6A 3FSGA 1MABA 4J6FA 1M2WA 4G2TA 4MW7A 4WY8A 2XUJA 4X8OA 1MB9A 3TKAA 1ISFA 5FF9A 4C1NA 3I92A 2X5OA 2E5LM 4JJKA 2FOLA 2Z3WA 2N1BA 3RRXA 3MLBA 4XFDA 4LFBM 2L7HA 2HJSA 4D3SA 1P0CA 3OX2A 3OUZA 1G8AA 4ZJZA 3NTOA 3QELB 3ZK8A 2WHYA 1OXKB 2GD0A 5KUTA 1H4SA 2A57A 2QLFA 1MJFA 3DTNA 1TUIA 2ZIVB 2WICA 1KZ9A 4CF3A 4R51A 1QO9A 4FFWA 3DL4A 2OYCA 2JEZA 1K6XA 4FI3F 1VJDA 2F17A 1ZEJA 2QKYA 3AF3A 1H05A 2VK2A 1E2KA 1T2FA 4LRWA 3MJCA 3BICA 1DJOA 4RSHA 4HAZA 3LLCA 3DTVB 4RTJA 1C4WA 4G0XA 3R2JA 4G5YA 4Q12A 2CUTA 3PEFA 4FDUA 2C3OA 1MIHA 4J4HA 3UMBA 3HLTA 3EQ9A 3BG5A 3V55A 3RRZA 2J4DA 2CHQA 4BO3A 2IDKA 2ZVJA 4PYRA 3N58A 4DYVA 1JV2B 3G2NA 4RHEA 1UDWA 1H6DA 3W90A 3GDWA 1CS4C 3P71T 3L1JA 4XB6B 2OD9A 1Z2CA 3PGJA 1AKRA 4FXOA 3H4IA 1QGDA 5EJGA 2A9KA 3L93A 1E94E 1RQXA 1PTJA 1WVGA 1RE0A 5DDIP 4DLXA 1P61B 3DMPA 3KP1E 4C06A 1X7XB 4UJ3A 3G2JA 3KSXA 2NLOA 2Y4OA 3U26A 2FAXA 2B69A 4I1RA 4PBTA 1X14A 2X6TA 1C9MA 3PUXA 1VG9B 2F8TA 5ETJA 1NBAA 1BFDA 4ARIA 5KKNB 3A4IA 3DUFB 4MH0R 4AUNA 2HTFA 4BNXA 4JOQA 5D3MA 1O6BA 2AXQA 4EABA 5DBEX 4OJMX 2DUUA 2NQ2C 3VK8A 1IWBB 3A46A 1TO1E 2VR1A 4KTTE 4MV5A 1JQLB 3BE5A 3BFPA 5DHRA 4C22A 3SXUA 4RD1A 4UNPA 5IT4A 1SC4A 3IV7A 4DJ5X 3P2IA 1NSTA 3GJ0A 3F3YA 1XZNA 2ATEA 1N2GA 5HHTA 4QDUA 2FOXA 1T9KA 4P83A 2YMLA 4CVNA 4IH4A 4XGQA 3E9DA 4H3HB 3PENA 2XYGA 2PJZA 5AK4A 3O2SB 3PDIB 4LHEA 3HK2A 4E30A 1SQGA 1CJUC 4I2VA 5JJKA 2J0QA 4X91A 3LCRA 4MWOA 2CZCA 1XQ9A 5H16A 5G3ZA 3CNOA 4ISBA 3AR5A 5LFAA 3PJRA 1PJCA 5C8YA 1SHJA 3JASA 3FLBA 2WDPA 3PGVA 4XUEA 4RAQA 1ONPA 3CZ9A 3AOGA 4CXMA 1EI9A 4K6HA 3HE3A 3B48A 3TZBA 5E4JA 3CMMA 3UC9A 2O0JA 3A8TA 3WKBA 2GN0A 4HWOA 3D0RA 4O08A 1Z9BA 1ESNA 3KQHA 4PYIA 3E6AA 4KQ2A 4QLAA 3V34A 4QRHA 1XWFA 4GOJA 3BGSA 4QBIA 1YONA 1Q1BA 3H5AA 4RLFA 3Q0TA 5D00A 3E05A 3DFZA 3KT0A 1KSFX 1YF3A 4YRFA 1ZN2A 1AUPA 3ZJVA 3WIBA 1H42A 2IEYA 3VA7A 3KD2A 1NBME 1UDXA 5F78A 4KXNA 4K86A 2NUAB 1I6LA 1QV6A 5I4IA 3U40A 1XMOB 1SU6A 4OIMA 2IH4A 4HEQA 4QX6A 3B9QA 3UHOA 1FSZA 1XROA 1YQGA 1DBPA 1M0TA 2BI4A 1RP7A 3B8EA 3P0IA 5BYKA 5K8LA 4ZMSA 2VUIB 3DOAA 1DLJA 4WN3A 2G4CA 3V8NA 1WKVA 4Q6BA 3QVSA 1FYFA 2GN9A 4A3VB 1G0NA 2FJ0A 4UOEA 3IEUA 3EMDA 1QQAA 5TQ2A 1OPRA 3W9YA 4PNZA 2QR3A 3G5AA 2A9JA 2NZJA 1PL7A 1MENA 1B7GO 2I6SA 2YFQA 5E1MA 3FTNA 2BCJQ 2H7VA 4H35A 4CLRB 4CETA 4LY3A 2PS3A 1JU4A 1JIKA 1L5FA 1JU3A 4XCVA 4I9UA 4Q7LA 4LOIA 1UBEA 3FWYA 5IYZA 2HBQA 4C20A 2AA3A 5K0LA 3GLGA 3RAJA 1H8EA 5ICSA 1HLGA 1QU3A 4M0LA 5JC8A 5KKAA 4ZXPA 1CSEE 1PUXA 1C1KA 2BIFA 4LRSA 4GAEA 5CVUA 3SQDA 2C00A 3USZA 3KU4A 4GMKA 4L8LA 4HX2A 3KQMA 4ZVKA 5KYVA 3SYNA 2E21A 4HLQA 1VKJA 2YV1A 1QQTA 3NHYA 3UWDA 3VXKA 5EJAA 4E0BA 1HG1A 4O4LA 2KI5A 1ID1A 1PR2A 5AW1A 5FLKA 3AKZA 3WKAA 1P7VA 4RO0A 1VECA 5FJJA 1S8OA 2J0EA 3NBZC 1W35A 1V43A 2G17A 4DUGD 1OXXK 1LX7A 4YJ3F 3IUNA 1FP7A 4WKCA 2YXNA 3VKHA 4MH0E 1KEEB 3ZV6A 1D09A 2QUIA 3OTGA 3BT7A 2F3QA 3IQWA 4C3ZA 5KQPA 4EW3A 4HVCA 2CXHA 3MJSA 3VK7A 1RI5A 3TAHA 3TD9A 4R83A 4TV9A 3RF6A 3RS2A 5BVHA 1AMUA 3JZAA 1UXJA 4K9QA 2VUHB 4X60A 1QVVA 2IHVA 3NS7A 5JCXA 4P53A 4G4GA 3RS9A 4QKQA 1C4KA 1IHOA 5A0VA 5FAKA 2XSZD 2JAOA 3EGIA 3STYA 4MI9A 4Y98A 1TUBA 1IBMM 1RFLA 2G67A 2O0LA 1ADJA 4IFBA 3L7DA 1C7JA 1JB9A 4BKPA 3NALA 1IFYA 2ZYSA 4Z51A 4EQ6A 3DZ8A 1UBGA 4JL5A 5E3IA 3I2IA 4OYHA 5EQJB 2HLDA 1LKZA 4BLUA 5H81A 4N0QA 3E8MA 2ZB8A 1VYTA 1R6UA 4XB2A 1OIZA 1Y8GA 1DTEA 1L7AA 5EJEA 2BR5A 3NM5A 3NHBA 1GA1A 3HKEA 7YASA 1JILA 5CVEA 4BN0A 2W8BB 4TXNA 5JVDA 2R00A 1N4AA 2X0FA 1KS2A 3B8HA 1EFCA 1DELA 2NACA 3ST7A 3NJ8A 1BAPA 3IB6A 2FA9A 1QVRA 2VJCA 1T6NA 1L7EA 3OLWA 3AFIA 5DNAA 2UVPA 4B6RA 5AVUA 1YVDA 3FBWA 1I3CA 1Q20A 3H9GA 3AXSA 4ZV9A 3FYSA 3PEEA 1U9IC 1VHLA 4UCFA 3ZD8A 5BWOA 1QH8B 4BY9E 1BQ3A 2M2IA 3DZFA 4P17A 3U6KA 4B3CA 1H3NA 3ASYA 3FPAA 5EYPA 5AR1A 4Y2XA 4FYWA 2B7CA 4GI1A 2CVPA 4YXWA 3L25A 4J0FA 1NKSA 5JXGA 4DG8A 3WHKA 3RD5A 5HKKA 4JP2A 1MN6A 1BGXT 3QOFA 1JWAB 2BTOA 5DSZA 3QVUA 1Q50A 1P2GA 1OAOA 3C1AA 1DI0A 3O38A 3MFQA 1XXLA 3WLQA 2ODWA 2WM9B 1FA9A 2DWUA 3MTDA 2AMFA 4QYMA 2X8LA 4ZI5A 1QWSA 4J4TA 1ESDA 2WC1A 1SOAA 2KRUA 2VSNA 4B6QA 2YOGA 1XTKA 2NX2A 4H15A 4WI1A 5DULA 4NBSA 1Z6XA 3UG7A 2A94A 5ALEA 1E9VA 3RM3A 3MYYA 5H59A 4HX5A 3O1LA 2Q4TA 5EL0A 5BV7A 5A3RA 4JENA 4MUJA 4X1IA 1JDTA 4IGIA 3D8NA 1Y6GA 2JDID 4PVDA 2WD9A 1E1QA 1TGVA 3COZA 2NVBA 5T67A 4R1NA 1RXVA 4GH9A 3ZW7A 1IN1A 4MDFA 3DVLA 5ICEA 1LI7A 1FFYA 2OFWA 3A42A 3UCFA 4BP9A 2K2WA 3BRWD 3CZCA 2DF8A 4TMTA 5K1ZA 1KTVA 3QVKA 4ZN6A 4YQYA 3K2LA 2XB2A 1KO7A 2CVQA 5GJCA 1OAIA 1FSPA 3PPVA 2BD0A 4R3UC 5B6IA 4JITA 2ZAGA 3F0TA 1M2OA 3TW8B 2H4JA 1Z39A 2APLA 3GAZA 2PLWA 5CP8A 2X4GA 3DVRX 1QTQA 3VR5D 3R5HA 4TRMA 2Z5FA 3MK31 2VQEM 1H2ZA 2AXEA 1V3VA 2VT6A 1US8A 1IM2A 1BROA 1Z17A 3JQPA 3KQSA 4C14A 2EA0A 3NIBA 4ZGGA 2A30A 1GZ6A 4BDTA 4RIGA 3D2AA 2ZIGA 1K2WA 4AJIA 1D0SA 3GL9A 4UTPA 5TY0A 2IXFA 4A36A 3NHMA 4LHWA 4AZSA 1CDZA 5AHKA 1ISSA 3OC0A 2LPMA 2J3IA 1V26A 1SIWA 4ALJA 1G4AE 4D9NA 2JH3A 3SOPA 3CM0A 2QD4A 4H0NA 2XECA 1VPEA 1L5NA 3E7FA 1OFIA 3I42A 4R01A 2QTVA 2IE8A 3NKVA 2VWGA 1O95C 2I76A 3OE5A 3U6SA 5IKPA 4G4SP 4KV7A 2Q9UA 4X66M 2Y1CA 4C4SA 5JY6A 1RJWA 3C87A 3FOFC 2AN3A 2NZWA 4C0HA 2E18A 1DRVA 4BXOB 3MMZA 1T8SA 3VPXA 2W2LD 2OGUA 2HGSA 2AE1A 1UM9B 2QRVB 3R5XA 5FTLA 4FQ5A 2VVTA 1BQ4A 4ZZ0A 4CM8A 4YAOA 2ZUUA 2DNAA 2WWHA 2DAMA 5E4TA 2BBTA 3DHNA 5LOVB 3ML1A 2AW5A 1YZKA 1KQNA 4AURA 2YY6A 1ESEA 1D0LA 5JS6A 4H0FA 3M4XA 5DX1A 3B6MA 4P0TA 3I52A 1ZWLA 2W48A 3PP8A 1REQB 4IMRA 2EKZA 3GZJA 3GRCA 2IPXA 1Y6RA 4DLAA 3DC7A 1LBHA 3IT2A 2GPSA 2LDXA 4P4SA 1ZN8A 2JLBA 1J20A 1IBCA 5DLEA 1E9RA 3RTGA 1FLAA 4LY9A 4LVOA 3WFIA 4ALMA 5CIWA 3C3DA 2GDJA 4JMPA 2FW1A 2Y9PB 2Z6VA 1ODFA 4UPDA 4RKFA 3QJGA 2QD3A 3LFHA 3AEUB 1KVSA 1ORWA 2PUAA 1C3JA 4UN2B 4ZCQA 1A1VA 1NN5A 4AN4A 3AFOA 2MINB 4C6HA 4Y6OA 4E4YA 4V0LA 4MRAA 4QWWA 3GLHA 5IJXA 2P75A 3KKPA 2YV4A 4WFJA 4D45A 2VHZA 3PYMA 1NP6A 4IIXA 3R5KA 1UMDB 5TSDA 1CHNA 2OOSA 1Y8ZA 2GJ8A 2Z9BA 2EZ4A 3E0QA 1ZNQO 4GSKA 1TCCA 3ORSA 3F9RA 1FTNA 1W36B 4ZRMA 1VLJA 1ZIOA 2XMGA 1X2BA 4JFRA 1D3AA 1XZCA 2I8LA 2REQA 4II2A 1WB9A 4ZQIA 1GRCA 2P62A 5I7FA 4M22A 2RHOA 1P0PA 5HK9A 2BBOA 1NW4A 5ITWA 2I34A 3MINA 3SY8A 1QFMA 4E6PA 3BKXA 2DU8A 5IH3A 2GZAA 1XMJA 4L8RC 1R64A 2GRUA 4CJ6A 2MR9A 3EG9B 5J2TB 4GW3A 1NZDA 1ZRNA 1YI1A 1YE5A 1XAGA 4I81A 5ILGA 3RJZA 1ESMA 3N8NA 1HRKA 1M6NA 3JAWB 1YKFA 1PR0A 2NPOA 2NGRA 1EVIA 1E6WA 3TBFA 2BLLA 3SVTA 4XX0A 2MSNA 1QP4A 2KJQA 4S1TA 1W1IA 5G3YA 1O89A 1G21A 3B74A 1IIBA 3KU1A 2EYQA 3BL8A 3V1YA 1FU7A 1KOGA 2C4NA 2ZUEA 1G20A 3OE1A 4GPEA 2FPLA 3WV5A 5JXWA 5K05A 3BRQA 2J5RA 3ETEA 3NVDA 5HYVA 1BGWA 2FPOA 5BNTA 1VKRA 1CD5A 3R7LA 1VE7A 4G36A 1GEGA 3ENVA 1WP9A 1NMYA 3FR8A 4RA6A 1M6YA 2D5CA 4LN1A 4BO0A 1UBJS 1OKKD 1CUBA 4WRRA 2GHTA 2HA2A 1C29B 3R5FA 5TLSA 2EF0A 1NR5A 3N0WA 4C4AA