4LZZA

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 57
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lzzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lzzA01
2FMXA 4M53A 4QBFA 3LQRA 2GESA 3UPUA 1WQ1R 1YRAA 3IILA 2X19A 4JLNA 3K0CC 2RKOA 4M8NE 4MUAA 2JJ2D 1XTKA 4NBSA 4HDQB 4PQYA 2VF7A 1W44A 3HU2A 4ZDIA 3L82B 1MT0A 2ZJZA 5IHPA 2VF8A 3X1YA 2BCGY 1ZIPA 5BN5A 1Z6GA 1P73A 4OJKA 3BIFA 3R20A 3CZQA 4Q4HB 1F48A 1S8FA 5BXQC 1N6LA 3CWQA 3QPWA 2GJSA 3QI2A 3TNFA 2IYXA 4ZI3A 3W6OA 3EIQA 2Z83A 2W83A 3BXZA 3U60B 1XD8A 3LW8A 5FOXA 3IEVA 1ELOA 3AKDA 3B1VA 3A37A 5J40A 1X8KA 2ZI3A 2QL6A 2AWOA 4DDWA 3OAAA 4CZ2A 4MYTA 1Z6TA 2JLWA 2W0MA 1T3LA 4DKXA 1SHZA 4A8JC 1U8YA 1XU4A 2MMCA 2ERXA 1XNJA 3QVVA 2QTFA 3Q85A 4LHZA 4M9SA 2WHXA 1Q20A 4QJ4A 1IXZA 5EE5B 2W58A 2QU8A 4XVQA 1VG1A 1AS0A 2ATXA 2CNWD 3TJZA 2OFWA 4RZ3A 2IS1A 3LD9A 3QQ5A 3R8FA 5KNDA 1KI3A 2VHJA 4LRWA 4DWJA 1M6NA 1NI3A 221PA 3GD7A 2P3SA 2W6ID 1E99A 2O8FB 3VX4A 2LKDA 2PEYA 2GJAA 3SFVA 2ZM5A 2G3YA 1GKUB 4U7DA 1ZC3A 2RGNC 1KOFA 5FTLA 1MH1A 3U7EB 1RRCA 2GK6A 4PAOA 1EFUA 1D9ZA 3AV0B 4KXFB 2YWHA 4D80A 3OIUA 1I2MA 1WDTA 3B9QA 1X37A 3AGPA 4HSEA 4PSKA 3ADCA 2P67A 5FL3A 3CWZA 2QY9A 2FPMA 4PC6A 4O2RA 1N6OA 1RJ9B 5FFMA 3Q5DA 4AY2A 1TEXA 1G9XA 4EFMA 3HP1A 3GJ0A 4A2WA 1BOFA 1W5TA 2A5GA 1LF5A 4A36A 2F1JA 2AK2A 2D2FA 2NPIA 3AKCA 2HJVA 2PT5A 3EW9A 1TPZA 3UK6A 2WIBA 1T5LA 2ODBA 1UBGA 4D82A 4W9MC 1Z07A 3K53A 1NVMA 1R0YA 2FEMA 4DDTA 2OXRA 2RB4A 3JVUA 2JDIA 4C0LA 1OH8A 1M7BA 3CONA 1PVOA 2PZFA 4TTQA 1G20E 2DVWB 1W0KD 2ZSFA 4OI0A 4TLAA 3LBIA 4EPTA 4G5QA 3QXHA 4P4UA 3CLVA 4EPXA 1AGPA 4RCYA 4CF7A 1UDXA 2X77A 1NLZA 2C04A 3RRMA 1RC8A 4FINA 3EZ6A 4US2R 2ZRJA 1XEXA 3I8SA 3K1JA 3QPUA 3KKQA 1CKEA 1G7TA 2Q3FA 2YHSA 3WMGA 2MSDB 2AN9A 3RRNA 5EXPA 2DFNA 2FN4A 1SVMA 4G5SA 3WRYC 4CRWB 3QF7A 3K09A 4B74A 3NBFA 2IS6A 2JJ8A 5E7JA 2FSHA 2ZSBA 1R0XA 3AP2A 2OM2A 4KSCA 4TZ0A 5CB6A 3RWOA 3F5FA 4KFSA 2IXEA 4KI0A 5FOUA 2VYFA 4TSFA 4NCHA 2HDNB 5CK5A 2ZJYA 1HYQA 4IEIA 3LQQA 1UDWA 1T0HB 1EWRA 2V9PA 3BERA 3THWB 4MYUA 1GRQA 3SYLA 3TLXA 1TQ2A 2TMKA 1AGRA 2ZE5A 3W5JA 4IDHA 1E9EA 3AVVA 1DVRA 3GLIA 1N0VC 1RZ3A 3FGNA 1XPOA 2ZRMA 5B64A 4G5GA 4UNPA 5KO2A 3AM1A 2RGBA 3VLFB 1F2TB 4OK6A 4R2HA 1NRJB 4WVFA 5CJPA 1A2BA 5HZKA 3ICEA 1Z0IA 3KKNA 3U3RA 3OZXA 3I92A 2QA5A 3FKSA 3QE0A 4NP6A 1FX0A 3AP3A 3CX6A 1R0WA 2PLFA 3KXLA 4YONB 4LY6A 2PCLA 4LCBA 4V0NA 1Q21A 4AKHA 2ASEA 1Q57A 3WXMA 1A2KC 4US1R 1W7AA 1TQ6A 4LHYA 2NPFA 4IDPA 4JKIA 1FPMA 2XEXA 3QEJA 2IEZA 4P31A 2UVQA 3PQCA 3ZZUA 1DPFA 3CRVA 2ORVA 1E1QD 3WY9A 1W47A 2VHQA 5KOYA 3IHLA 5K8UA 1P3JA 1G8FA 4P3YA 1WMSA 3OIVA 2IYSA 2ZREA 2AD1A 3EXAA 1GITA 4XTCS 3SJCA 4ASUD 2WSSD 4XVUA 4Q00A 1RYHA 3U61B 1VHLA 1DAEA 1Z47A 4Q4HA 5EP4A 1W4RA 3CF2A 3LXXA 4NU0A 5C4GB 3WYGA 1CXZA 4DCSA 1KK3A 1E2QA 2CMKA 1ZNYA 3OHMA 1IQPA 3OEHD 5DO9A 2R6FA 4DCUA 2ZS7A 1Z5ZA 3U2QA 1G3QA 1JXOA 1UEIA 1KKMA 3K0EA 3PFIA 4P4TA 2RGAA 5GVRA 3THOA 4F4JA 2WWHA 1G41A 1VIYA 2GRJA 1OJLA 2YOHA 5KSOA 5M04A 1JAIA 2BDTA 4IFEA 1FMJA 2BMJA 5J4LA 4WA7A 2G1JA 1P2VA 2OXCA 3CNNA 5KSPA 2CEAA 3MG9A 2XB2A 1DEKA 2OESA 3MAAC 1R5NA 1GL9B 4MGYR 3CUEF 1NMXA 4PZLA 4KFTA 4JT2A 4C4PA 4C0JA 4N0EA 1R4AA 2CNWA 3RS2A 3CKLA 1P9RA 3TH5A 2AFIE 4HLQB 2O8FA 3H2YA 621PA 1IY0A 1XMSA 5EE0A 2VHTA 3FOZA 2IBMA 1WXQA 1US8B 2W6IA 3ZIAD 2OCBA 1P7CA 2JIZD 1AZSC 3WMEA 4B3GA 3D3QA 2PLRA 3KKOA 2J3EA 2O0JA 3ZYCA 3Q3JB 5BW8A 1GVNB 4Q02A 4TMTA 3WP1B 2YYZA 2QROA 2H5EA 5LD2B 1RJ9A 1RRFA 2KSQA 1KTVA 5CK4A 3X1XA 3HYRA 3QENA 2HT6A 4FN5A 3TQFA 2J7PD 2OILA 4DVGA 1UJ2A 1TF7A 3W90A 4LZZA 4FCWA 1Z08A 1T91A 4LV5B 4CVNA 1XZPA 1BO6A 1YZGA 3I32A 2A5DA 1PLKA 2X2FA 3KUDA 4LC0A 2P5SA 4QGFA 3VU9B 2ZU6A 3N5CA 4EPVA 3UANA 2NZ8A 3A4LA 1ZU5A 3LO5A 1G3IA 3P26A 1UKEA 1L8QA 1BS1A 1G4UR 4ILEA 5BWMA 1UM8A 3MJRA 5CIWA 1UEJA 1KKLA 4EAQA 1KJZA 3U7GA 2E87A 1P9WA 4PTLA 3BB3A 2GKSA 2DFLA 2FFHA 1KO1A 4ABYA 3ND8A 1DG1G 1DOAA 4M9ZA 3ZQJA 2CL6X 1GIAA 4GPTA 2EFCB 3VKGA 4QGAA 2WWIA 2B6HA 1SXJE 2ZVQX 1NJFA 1IJEA 2HEIA 4E22A 3A4MA 2YKGA 4HZIA 2W0SA 1EFCA 2RH5A 1M8PA 3K70C 2J41A 1XTQA 3PUWA 2D7CA 1Z2AA 4BFXA 1Z3IX 2HF9A 5TV2A 1TTTA 4C2UA 1PUIA 4BECA 2XZLA 3KXKA 4QFMA 2REOA 1R7RA 2BBWA 3SYNA 4XVRA 4HLCA 2P6RA 3CRMA 4P4SB 4KO8A 2WKPA 2V7QD 5EJEA 2F1HA 4AD8A 4GNKA 1ZD9A 4B71A 2NG1A 2QUZA 3MRSA 5EUQB 1Z06A 4FXPA 2GZDA 4V03A 4US0R 1HURA 3THWA 1SQ5A 3I73A 4UKDA 4YDSA 4TL9A 2IL1A 4HAXA 5DH9A 1GP2A 5LDDC 2DCUA 5DE3A 2R65A 3EARA 2QPAA 4FMDB 4FIDA 5TDHA 2PX0A 5FPSA 4AIIA 2EWWA 2D7DA 3ECCA 2HUPA 2YC2C 1E2KA 5G53C 4PXAA 5EXSA 1F2TA 5IK2A 3CB4A 4EKDA 3S1AB 3THYB 2GF9A 2C99A 2YOGA 3LH5A 2AKAB 2CK3D 3BFVA 5E7IA 3EG5A 1ZNWA 3KB1A 1FOEB 2FG5A 3U3MA 3SJBA 2QRNA 1XP8A 4Q4LA 3IGFA 3NVAA 1S4QA 1ZM2A 121PA 4ZPXA 4WXPA 3CIOA 4XWAA 4ZKDA 2B7CA 1ZBDA 4H1VA 4YMVA 1FUUA 1W36C 1EFRD 1YZQA 4XJXA 2P2LA 3WNDA 4DDUA 2OBLA 1JJ7A 2J0UB 4PC1A 4BLTA 1KK0A 4FMDF 4CGZA 3GP8A 1MO5A 1G8PA 2VO1A 5CDFA 4TLCA 4CYMA 4Y0AA 4TL8A 5F98A 2IHBA 2R6AA 4ACAA 3QY0A 3T61A 1WP9A 3MMPA 3NIBA 1X6VA 4HB3A 3KL4A 3NBXX 4NMMA 1G8HA 4DHEA 5BN4A 3SHFA 3D8BA 1QHYA 5F3WB 3RS7A 2AL7A 3VR3A 3EIEA 4MYHA 4GOXA 2WTUA 1NVVQ 5EP1A 4MRRA 2GXSA 4C0BA 1XMVA 2VLIA 4GP7A 2BBTA 2ORWA 2WJIA 3OEHA 1S9DA 4CT5A 1Q1QA 3DKPA 3M0EA 2VSOA 3ONWA 2I1VB 1SZPA 2F9MA 3BB4A 3NTUA 2GNOA 1ZCBA 2CJWB 4BGDA 4LPSA 3UMFA 3KQKA 3B85A 1N5KA 3GJ8A 1SVLA 2IX3A 2OCPA 2Q3HA 1IN7A 2VHUA 5FUVA 4B44A 4DLYA 2OT3B 2DFTA 4OHZA 3MWJA 4AYXA 1DAGA 3BRWD 3HDTA 2X1VA 4B3FX 1KI4A 2QSYA 1GFIA 4V0OA 3CPEA 5JRJA 4B2IA 5KUTA 1US8A 2FPKA 2A9KA 4OQMA 2O0HA 3GEIA 1ZAKA 1R6BX 3I1FA 2OCYC 1II8B 2DBYA 1S96A 1Z0JA 3RRYA 3VFDA 1AS3A 3ZIAA 2XZPA 3VX3A 1MABB 3WRXC 3FMPB 1QG2A 1DE0A 1JJVA 1ETUA 4BZPA 3GPLA 4Q5IA 6Q21A 1IJFA 4HB4A 4BFYA 3TSWA 3DKVA 3A6PC 3VKHA 1ZUIA 1BMFD 5GJWC 2ZROA 1DAFA 4URZR 2ZSAA 2OFXA 3VHLB 3HPRA 4AKIA 3QG5A 3P4YA 1VTKA 3T5DA 3NEJA 3VU9A 1CULC 4MDFA 3DO6A 4LOAA 3L0IB 1CRQA 1D9XA 4V02A 1W4CA 2OCAA 5H1YA 1JR3E 2WWWA 4LK2A 2PJRA 2GEUA 4WXRA 3DEFA 4POAA 1SGWA 1E3MA 4XSGA 2OBNA 2OE2A 4D0NA 2ZI4A 3MWLA 5AJZA 4QBHA 2BWJA 3CF0A 1NVVR 1ZNXA 1FZQA 4LHXA 2KJQA 3QF4B 1KI7A 3T06B 3KUCA 2GK7A 4L9SA 4A0HA 1X8LA 3QBVA 4S35A 5KHOC 3QKTA 4YMUA 5DSZA 1OH7A 5K8LA 1E6CA 4HLUA 1S9HA 1ZM3A 1UBCA 4NYIQ 4AWXA 2F43B 1FMLA 2FJUA 2GJ8A 2JDID 1G4AE 1KYIA 2CHVA 1NLYA 4FWTA 1OIWA 3VQTA 4DSTA 3AVXA 3M4YA 3GCGA 3P27A 3I72A 2GXQA 3C4JA 4C30A 2RGDA 4V0MA 3GEHA 3SU8A 3IUYA 3KQUA 1RRPA 2FH5B 4BUJA 2REXB 5FBLB 4LGMA 1LV7A 5FL7D 4M9XA 1GOTA 1TADA 4Q9JA 1HQCA 3DVLA 4I81A 4FWHA 4P4SA 4FD2A 4IW3B 4NCJA 2YVUA 1E9SA 1EWQA 4D0GA 2EYQA 4FI3C 3HR7A 3SC3A 1KY2A 3LLUA 1C1YA 2OAP1 4BEBA 3LBHA 3V4FA 2V7QA 5G41A 3NBZC 2GAAA 2FGJA 2ZR7A 3DDCA 4DJTA 4BLSA 2WOOA 5C18A 3T1TA 4AKEA 5GJBA 4GI7A 2IUSA 3BAFA 2CHGA 3X1DA 1IBRA 4ON9A 5CM9C 4M4SA 3THXB 2CL0X 1X3SA 2IXFA 2KBEA 4N0DA 1ZMXA 2AWNA 2FSGA 2UZIR 4TSFD 3DOFA 3MLEA 4R2IA 5DIFA 3RS5A 2D3WA 3D31A 2IHYA 3S1AA 1KZGB 2KBFA 4PPQA 3THYA 3X1WA 1QHNA 3IO3A 4HLDA 3B2EA 3RDPA 2ZI5A 3BJIC 4L8GA 1XJQA 2QQ0A 4PPGA 3K0FB 4GITA 2CK3A 3QUSA 4LYHA 2G77B 2AK3A 4B35A 1J8MF 5DLQC 1G3MA 4F7WA 4M1TA 4MDEA 3AJIB 3UIEA 4TMWA 2G0NA 1KZ7B 5E3HA 3WBKA 3SN6A 4PANA 3CRRA 4C7OB 1MRNA 1XCMA 4L15A 3HU1A 1F2UB 4FMBB 5A4JA 5EE9A 4DRZA 1DELA 1RYFA 4M1SA 4PC3A 2D06A 1NJGA 2F1RA 3K0AB 3PG5A 5SZIA 2HLDD 1UFQA 1ZNZA 2J0UA 4JLBA 4QL3A 1W48A 3AB3A 3WNBA 3AVUA 2BMEA 1QG4A 3CPJB 4GOJA 1OFHA 4BLQA 1ESMA 1MKYA 1U9IC 3DM5A 2IEYA 2O8BB 1HEIA 4IHQA 2H16A 1WA5A 2QI9C 4LI0A 3U4QB 1N2CE 1ZUHA 4LJ7A 4JBWA 2DZNB 4V0ME 4L9WA 3Q9LA 4LBZA 5AUOB 1NVXQ 1G7RA 1OPXA 3V4RA 1NG9A 1ZRHA 1EGAA 2OEPA 5LB4A 3TW8B 1HQYE 1H8ED 3V00A 1Q3TA 2YZ2A 3ASZA 5FOVA 1JQLB 4Z1MD 2EQBA 2UZ3A 3K0CA 5CLLA 5AR1A 4KFUA 2QP9X 2ZRHA 4WW0A 3NHBA 4PHGA 4OHWA 1MV5A 1IAQA 2BM1A 4EJSC 1ZD8A 3TAUA 3WMFA 4DSOA 4LYFA 3A1UA 1LY1A 1R5BA 2A5YB 4KHZA 4RZXA 4OQFA 5FOTA 2FSFA 1E0AA 3DPUA 3IPYA 2ZJ8A 1Q44A 1XTIA 5DI3B 2CJWA 1YZTA 1IOZA 3E70C 2ZJAA 4PHFA 2ZRFA 1XXHE 2NO7A 5TMPA 4PHHA 2IYVA 1GL6A 3OFND 1UADA 2ZIAA 3LVRE 2WIAA 3R9XA 3RS4A 4RD6A 5EE3A 2RGEA 2EFEB 2V1UA 2JA1A 4CW7A 1G6HA 4LUCA 2BCJQ 2ZU0C 1SXJD 1GAJA 1A5TA 1R2QA 4Q4AB 1N3BA 4ZDJA 2XGJA 3AF3A 1R5OA 1II8A 2ZJBA 3QXJA 4D4KA 4QBIA 1SXJB 1JI0A 2F9LA 1MABA 3A1SA 3P32A 2R6GA 4KVGA 2C9YA 3T15A 5FUWA 1E4YA 2F6RA 3B5JA 1KI9A 4IOMA 3R7WB 4G1UC 2R44A 1QRAA 2PEZA 2NO6A 2VH5R 3ZVNA 2CVHA 2GWHA 4MUBA 5D3QA 2O8DB 2QAGC 2YNMA 4C0HA 1FTSA 1BH2A 1Q22A 3IHWA 4MGKR 4P0TA 1NY6A 4JYBA 3LY5A 2Y8EA 4M1OA 5LPNA 1BMFA 4LSGA 3CX8A 4TYPA 2FSIA 3A1VA 3MCAA 4IKEA 1D2EA 2XTMA 2VP9A 3G82C 4TYYA 1H8HD 2XTNA 3BB1A 2G0TA 1OT3A 3H0KA 2BEKA 1EX7A 3DMDA 5LB2A 2LKCA 3K9NA 3EWAA 4KCGA 1GKYA 4HB0A 3W8RA 1SKQA 3TSOA 5JS8A 5EZ6B 4HEJA 4EUNA 5C4MA 2WWYA 2OLJA 3EZ2A 3QF4A 2GXAA 4JN6A 2WAYA 1DADA 2JLSA 1KAGA 3FYHA 4GBMA 4HAWA 4TWZA 2F43A 2QPOA 2JLYA 3P20A 3T12A 1G7CA 1IXRC 1Z28A 3UMSA 1E2DA 1E2GA 3CF6R 4RFSB 2B92A 3IKJA 2XSZD 3KW6A 1YZNA 3QPVA 2WMOB 3DMNA 1NP6A 1NNEA 3H86A 3VHXA 2GTPA 1P2SA 1FQKA 1ZIOA 1N0UA 2CLCX 2ZYUX 4D2IA 2ZEJA 3FE2A 2A30A 1XPRA 4JYCA 3FWYA 5FUYA 4AG5A 3U6KA 3NDBB 5JWOA 4HAZA 1NKSA 4YMWA 5FL7A 1XPUA 3TSZA 3VNUA 3U3OA 1DAKA 1OSNA 4M9QA 1U99A 5TARA 2FF7A 1XDBA 4OYHA 5K8IA 4JBYA 4LJ5A 1TEVA 2GVZC 5TB5A 4DCVA 3BD9A 1COWD 1J8YF 2YV5A 1EG7A 1QZXA 1G8GA 2BHRA 4OQNA 3KDSE 5FOSA 521PA 3THXA 3VR2A 2CHQA 2WJHA 3FFBA 3CW2A 4UNQA 3PR1A 4DEYA 1Z0AA 1AKEA 1XEFA 4I1UA 4M1KA 2WWGA 5CJ2A 2JAQA 2Q6TA 2J5XA 4JS0A 1YZKA 1E2PA 2XOKD 3RLFA 4Q9LA 4ZCIA 4Z54A 4R71A 2BBOA 4DLWA 3L2OB 1OXXK 1YU9A 4NCNA 4NYMQ 5JI2E 4LV6A 2J1LA 2WWFA 2EFDB 1WBDA 3K0FA 1DAHA 4R98A 4DB4A 1YRBA 3I8XA 3K09C 3IPXA 1U98A 2V4ZA 4QOSA 1XTRA 1GG2A 3RS3A 3SHWA 4C7OA 5IK2D 2JLVA 4FWIB 5FPHA 3F0TA 1F2UA 3KKPA 4RD4A 2R8RA 5B30A 1ZUNB 2ZE8A 3K0AA 1R8SA 2CE7A 1GWNA 3AKYA 3AVYA 1CU1A 1M7HA 4UJ5A 5D3MB 3FMOB 4HZUB 2G9NA 2IS4A 2DWOA 5DI9A 3KJGA 1NKTA 4MKFA 2HLDA 3KTAB 2FZLA 3UG6A 2A2ZA 2O8BA 4JVNA 3U4QA 1AIPA 2ZRAA 2V8OA 4OL0A 4RD3A 5G3ZA 3QJYA 1W36B 1R0ZA 2HCBA 1S3SA 1NSTA 1Z8FA 2P6UA 2QAJA 1T3SA 3KQHA 5DN6D 2HXYA 4LWZA 2FOLA 2BM0A 4HUTA 4L4UA 3U3KA 4YQFA 3AH8A 1H8EA 4QG7A 5JZVA 4Z1MA 4BZXA 4PAQA 5FBQB 2RHMA 3CR7A 3JVVA 3TMKA 1XEWX 1KK1A 2H18A 2ZYWX 2QEQA 1JR3D 4NL4H 3IDQA 1OXUA 2QG6A 4X8OA 2DWPA 3I5XA 4Q03A 1Z63A 5JWRA 5DYIA 3NC0C 2Q21A 3ASYA 3A1WA 4Q9HA 5DI3A 2C5LA 1HH4A 4JLKA 5FTKA 1AA9A 1JR6A 1RRGA 4XWOA 1VYVA 4C0QC 5C2JB 1G16A 3NH6A 4NZYA 1O87A 2ZRNA 3FTQA 3NEYA 4DXAA 5EE1A 1GILA 4B2PA 2BJWA 1T5IA 2KWIA 3QKUA 2OFOA 2P5TB 1YKSA 3BGWA 2JLUA 1SKYB 3OFNA 4NYMR 3KX2A 4HYYA 4MRVA 4Q4AA 1E2LA 1BYUA 4TMXA 2D74A 2Z4SA 5FTMA 4CEHB 1T8UA 4MGIR 1F6BA 1YR8A 2PH1A 4II7A 4XH9B 5SZKB 3NDPA 2ONKA 1SXJA 2NIPA 2I3BA 1PLLA 3KKMA 4NCIA 2PZGA 4HAYA 3T5GA 2YWEA 1KHTA 2IWHA 2DZOB 3I62A 2ZI7A 1XFAA 2JASA 3DZDA 4PHTA 5FI1B 4C9BA 3R7WA 4RVCA 4HUQB 3PEWA 2NQ2C 1UF9A 4B33A 4KV9A 3U3JA 1NIJA 4MRNA 2VTKA 2C98A 4TYNA 2ZI9A 2ZTSA 2O8DA 3PEVA 3QNUA 1D6JA 3IQWA 2G6BA 4DDVA 4TN1A 5C1BA 2NOAA 4IOKA 3QOFA 4XOIA 1Z0FA 1OH5A 2GZAA 5JS7A 4UNSA 1UBEA 4P32A 5H68A 4ZI2A 3QXSA 2C9OA 4BWYA 1UKYA 1VECA 4X8HA 2IUUA 2IT1A 1H8HA 1ZC4A 4N3NA 2WBLC 4DBLC 2C8VA 2H17A 1YHNA 3CBQA 1N0WA 1T4GA 1T3HA 2CVFA 1TF5A 4JMPA 2BMDA 2ANBA 1EFHA 3PUYA 1WRBA 1PLJA 1VPLA 4A3VB 3SS8A 3NH9A 2VPPA 1N6KA 2QRZA 1N6PA 3MFYA 4XSHA 4A4DA 1F5NA 3GLFB 4QBGB 3A4NA 4Q9IA 5CIQA 5TVKA 3MHVC 1MR3F 4RFVA 3RANA 2HCJB 4G01B 1SVIA 2W2XA 1RFLA 4G3XA 3X2SA 1G18A 2B7BA 4RFSA 4RZ2A 4IDOA 3Q7QA 5BYKA 2VRWA 5AUNB 1OXVA 4DLRA 2XITA 1V5WA 5FBRB 2J0SA 2XSZA 2W2TA 3KFVA 5JSZB 1VCMA 1WF3A 4BFSA 1M1YE 4I1SA 2REBA 4I99A 2J9RA 3UWOA 1Q0UA 1YJ5A 1Z6AA 4UXJA 1FTNA 1A4RA 1X8JA 2WJGA 1N25A 2D2EA 4NDZA 4KYUA 2FZ4A 3GMTA 2B21A 2IF2A 2OLKA 4LBWA 4GFDA 2CLSA 4A0GA 1H65A 1U8AA 2ORIA 3L43A 3M6AA 4A0FA 1WB9A 1Q1EA 4MA4A 3HR8A 4PO1A 1W1WA 3WBJA 2N46A 1COWA 1DTSA 1ZCAA 1P62B 4HATA 3JZMA 2F3RA 2RMKA 4GOKA 2GCNA 2OV2A 3C5HA 1ZM9A 3GLHB 3PUZA 5HPYB 4NH0A 1VIAA 1KO7A 4JT4A 2EVWX 2GAOA 1GNPA 2XOKA 3U44B 2DFKB 2RHDA 4IVPA 3WNCA 1W4AA 2VSFA 5FPTA 4BLOA 2C03A 2FFAA 4GP6A 2QT1A 2KRKA 3EZFA 1OFIA 4PSAA 3E2IA 2YC4C 1XXHB 1JEEA 4TZ6A 4DLUA 3K9LA 2V3CC 5G40A 3W6NA 4M0LA 4B76A 2PMDA 2ANCA 3ZGXA 4M2LA 5SZJA 4F4CA 5A5GA 1ZINA 1TNDA 1YR6A 2QGZA 1NVWQ 2YOFA 4KJZA 2CCKA 2FE4A 4OQLA 2RAPA 5D3MA 3LX5A 3GJ4A 1GSIA 4HZUA 3UWKA 1NIPA 2GF0A 3UG7A 1M74A 4UXHA 3KTAA 2XB4A 4RZUA 1IONA 4NONA 5AJYA 1E2EA 3GQBA 4A6XA 5JEEA 3VNVA 1E79A 2ZUCA 2BKUA 4MRSA 4B73A 2H57A 1C4OA 3T34A 2WVJA 2AX4A 3B82A 4FWGA 1Z0DA 3Q7PA 2R62A 2FFQA 4F92B 5FR2A 1AN0A 3WYAA 1XX6A 2XX3A 2NO9A 4ZDKA 2IYLD 2GBLA 4JIMA 3SBDA 5DN6A 4Z8XA 1SVOA 5F2EA 2HYDA 1L2TA 1XWIA 1D5CA 2GETA 1CTQA 1WCV1 4NTZA 4Q7LA 4RJLA 721PA 4TLBA 1HUQA 3SFZA 2OSBA 1JXMA 3IIJA 3GJ5A 1JR3A 4QM7A 5LBIA 1XB2A 4QGHA 2BEJA 1U81A 2PX3A 2ERYA 1I4LD 3M1IA 4PO9A 2ZS9A 3BORA 2GJ9A 4GZMA 3IEUA 4PAMA 4I4LA 4U02A 2FA9A 2C78A 2YINC 1NLFA 4CEHA 5TY0A 2ZRDA 3B7GA 1AJEA 1A82A 4B3BA 4B6FA 3AF4A 2PT7A 2FGKA 1O3YA 4TTPA 4KVAA 4DLXA 1GRNA 1U0HC 1FW6A 3EPHA 1G5PA 1ODFA 4HUQA 1JNYA 3TW4A 1PUJA 2C77A 2H1LA 1XBTA 3RSLA 4JKYA 1OB2A 2JLZA 3CPHA 4IRUB 2QGNA 2XTZA 1KMHB 2PCJA 5BQ5A 2QENA 1CJMA 1Z22A 2PZEA 4KSBA 4TTRA 1JBKA 4A8JB 2G1KA 4G0NA 4KYIB 3OESA 1Y3AA 3OEED 1GTVA 1KK2A 1G21E 1ZJ6A 1UKZA 4O2LA 5AJVB 1L7VC 5CYOA 1CRPA 1G291 1FP7A 4JL5A 3KB2A 4EPYA 2ZQ5A 4Q9KA 5J4HA 2QAGB 2FWRA 1II0A 4ZDWA 1XRJA 3L8YA 4MRPA 5BYJA 3BE4A 5KSZA 2QSZA 2BVNA 3Q72A 2ODNA 4YLGA 4JL6A 2P0EA 4CT4B 1HE8B 1CLUA 5KU1A 3AVOA 4FCTA 1U94A 2WJVA 3I3SR 3GLFA 1JB1A 1E98A 4DB2A 4LX0A 4B47A 4TMVA 5HZHA 2QMOA 2DWQA 3T1OA 3QKSB 3PJRA 1TAGA 4IVRA 4RD0A 3RVBA 1QHXA 3QBTA 4U00A 4EIWA 2IF0A 3RWMB 4BQSA 4KBGA 4K8OA 2IXGA 5FTJA 5CM8B 2ZYVX 5B58C 2EW1A 1KJYA 2WPDD 2FPLA 4YMTA 2DY1A 4ITRC 2ZRIA 5KPJA 1NN5A 4URXR 3CRQA 5JSZA 3AVQA 1B23P 1OKKD 1FNMA 2Q0HA 1UPTA 4LYAA 4Z51A 4QRHA 1SKYE 2ZSEA 2OG2A 1PJRA 2D4HA 4BRUA 1PV4A 3B13B 4A0RA 5CB8A 4A92A 1CBUA 3FHOA 3TK1A 2BJVA 1FNNA 3PXGA 2GZHA 4LDJA 4OI4A 5P21A 3LBNA 2ZI6A 3C14C 3ZS9A 3KQLA 1DO2A 3HPQA 3MSXA 5H70A 5JCPA 1HV8A 3QXCA 4C0KA 1OHHD 2Q9AA 2QN6A 2BIFA 2GEDA 1OFTA 3EZ7A 1D8TA 4TQAA 1QF9A 3LAWA 2OAQ1 1QVRA 3TGPA 3KQNA 1KDRA 4PR0A 4HI0E 4F38A 4TQUS 4B75A 2Q3MA 4WZBE 4PQFA 3HU3A 3GLHA 2GVDC 3NC1C 4Q1EA 4Q7MB 5JJIA 4GL2A 2X8AA 1Z6YA 2VSXA 3RNLA 3GJ3A 3EIHA 3U44A 1E2FA 1R10A 1VG0B 2P65A 4B32A 1VG9B 2PMKA 2VBCA 2F1IA 4M1MA 2MMGA 1OLOA 4V0LA 1XXHA 3KJEA 5B2ZA 1HT2E 1XD2B 1EK0A 2EU8A 4MKGA 4MKIA 1TQDA 1ZVQA 3C15C 3LW7A 3LRPA 5E4FA 3I4LA 2WZQA 3GLFE 1E0JA 4TT3D 2PL3A 1OIXA 2ZETA 1E9CA 1E0SA 2C9CA 3HWSA 4C0SA 5UKDA 2A5JA 3W9YA 4ARZB 4ZV4A 4BFTA 5EXTA 4D4LA 2ZR0A 2CCJA 2R6DA 2FU5C 3OIYA 4OI2A 1RIFA 3WYFA 3TIFA 4JZKA 3SQXA 1MO4A 1N6IA 4UXIA 2LWIA 2V6ZM 2ZPTX 3N2IA 4JLMA 3IBGA 3BH7A 2V54A 3OIWA 4ESVA 4W7SA 4BFZA 4RD1A 3QSYA 1X1SA 1E94E 4BLRA 5J4KA 4RKFA 2QE7D 3UATA 2AKYA 3T1QA 2J0QA 4OHYA 3QIAA 3REFA 3VR5A 3RC8A 1XMJA 4GZLA 4ZIRB 4DZZA 3NHAA 1YVDA 2OHFA 5AJWA 1QHSA 1Y63A 1WBBA 2J87A 2ZRCA 2DR3A 5EP3A 1OIVA 2J46A 1KO8A 3B1YA 3TUJC 3X1ZA 2VL7A 2QNRA 2H7VA 3FKQA 3OE7D 2IYZA 4JLOA 4Q1DA 1RVDA 3BH6A 3GLHE 2DYKA 4QGGA 2WKRA 2A5FA 5DHFA 4DSUA 3ZH9B 2CLDX 3R8CA 5KDLA 3ZVMA 1VYTA 4LV8B 4HDCA 1GDDA 421PA 1KNQA 2Q9CA 4WIAA 3PEYA 1E69A 3VMFA 3IIKA 3TAHA 3ZD7A 3RS0A 1K5DA 4L5BA 4B34A 5HR5A 4TYWA 2QORA 2B8TA 1J90A 1KO4A 1KMHA 2F3TA 821PA 3KJHA 2JATA 2QZ4A 1CIPA 4I1OA 5KYKA 3SI7A 1VDZA 5AJXA 1NY5A 3DZ8A 4WAUA 1E9AA 2NO1A 1P4SA 4A8JA 4FMCB 3SE0A 5BN3A 4JLVA 4PFSA 3O8DA 2B8WA 4Q66C 1EXMA 2ZJ2A 1VHTA 3OEEA 2EWVA 2Q9BA 4UNNA 5JECA 4G5RA 4O0MA 5KSYA 3B60A 2QAGA 4Q1BA 3L8ZA 2ZS8A 1KI8A 2FV8A 4OJQA 4RCZA 3AUXA 1N5IA 3LXRA 1DS6A 1F60A 2ECKA 1CF4A 4MKHA 5IF9A 1S2MA 2RGNA 4QHSA 1E2JA 4YXWA 1IY1A 3LNCA 3ZD6A 4DC9A 1NMYA 5A0FA 3TVTA 2W00A 1D2MA 2GXUA 4URYR 1L4YA 4GT1A 3QKSA 4WOPA 2WV9A 2QTVB 1EESA 3GLGE 3LFUA 4FMCF 4PC2A 4GMXA 1KSFX 3U6BA 3CH5A 2VP4A 1JQJC 4EFLA 3I5YA 3U7FB 4YDHB 3LX8A 1T8TA 4TLDA 2IUTA 3ZJYA 1BYIA 1FL9A 2WPDA 4EPRA 5L3SB 4DIDA 5ELXA 4PQRA 3O8CA 2BKEA 2KE5A 1AKYA 1W4BA 3HYTA 1M2OB 3K9HA 3SJAA 1OKKA 5GJVC 8OHMA 4H9GA 4IJMA 1A1VA 1E0KA 1IN6A 1XTJA 3IO5A 4S2EA 2IWRA 4ESHA 5L8VA 1KSJA 1HTWA 2ZRLA 4DSNA 3BS4A 3LVQE 3UXMA 4JLDA 3C5CA 4C0AC 3I61A 2Z5FA 5J4VA 3SYKA 1II9A 3FB4A 1HE1C 2JLQA 3IBYA 4URVR 1K5GA 4J0QA 1LS6A 2W6JD 2DPXA 2Z43A 4DCTA 4X8LA 2VA8A 1OHHA 4JJKA 1N5LA 4R9UC 4HB2A 2A78A 3K70D 1IN8A 3P4XA 3SBEA 4OBEA 1FP6A 2IYQA 3T1VA 2E9SA 4QHYA 3KFXA 4LBYA 3WHLA 3K70B 2VQSA 4L16A 2JCSA 4JBXA 4MH0R 4B43A 4D6PA 4F4IA 2RGXA 3RSOA 1AZTA 1P72A 1P9NA 4DCNA 1OB5A 1G8YA 2XNDA 4XTRA 2FEOA 1NSFA 3FFAA 4QXAA 1NBMA 4C3ZA 4CEJB 4CEIB 4AKGA 1HA3A 2W2VA 1XD2A 1ZU4A 1QHHB 3CNOA 1QZMA 4IXNA 1VCNA 1FFHA 4GMDA 1CP2A 4B48A 3TUZC 4PPFA 1XF9A 3SJZA 3SR0A 4DIEA 3AEZA 4QJ3A 1P5ZB 1N5JA 3CX7A 3IIMA 3FPAA 2JLXA 4Q1FA 1NN1A 1Q12A 1Z0KA 3B1WA 3EC1A 1DARA 4GRAA 4TT3A 1W5SA 1NF3A 2QMHA 4ARZA 1RE0A 3A36A 1G1MA 2BC9A 2OZEA 2IS2A 1HT1E 2ZJ5A 1UBFA 4WBSA 1YE8A 2WM9B 1GL7A 2IYYA 2QT0A 1KJWA 3H84A 1T0JB 4PX9A 4Q1CA 1LNZA 5DYGA 2R9VA 3H1TA 1E9BA 4M22A 2AR7A 4LJ4A 4QC2A 1D2NA 5EXXA 2A7QA 2P6NA 2RCNA 2GILA 4E07A 1E79D 2HJGA 4BZQA 1KAOA 2GCOB 2QE7A 2ZR9A 3ZLJA 1GUAA 2VP0A 2L0XA 3ZDQA 1W36D 3W3ZB 4KAXA 3KXIA 2VHCA 4Y0VA 1G7SA 4TL6A 4LRSA 2FNAA 1XMIA 4ZIRA 1J99A 4DLVA 1G3RA 3GFOA 4IDNA 1K6MA 4PSVA 1NL3A 1I4TD 1V43A 1IN5A 1J2JA 1ANKA 3BFKA 2ZXUA 4BPBA 3OF5A 5IDVA 1E2MA 4BE7B 2VP2A 3B6EA 3ICQB 5HKKD 3FMFA 2AD5A 2WWXA 1OW3B 4FW9A 1DAIA 4IOJA 2RGGA 3EASA 3OE7A 3O8BA 4LJYA 4Q18A 5GJCA 1AK2A 3LLMA 3ETLA 3J81k 2ZITA 4OHVA 1JPJA 3QXXA 3AQ4A 2K5UA 2QQEA 1QDEA 1ESNA 3Q8XB 3ADKA 2WKQA 1NBME 4A15A 4DT1B 1NN0A 3O47A 1AQYA 3ZZ0A 4TMKA 1U0JA 1KSGA 1TF2A 3VAAA 2C96A 1DBSA 3UKDA 3ND9A 1SVSA 1DG3A 3BH0A 4BFWA 2WSMA 1EFTA 4B3CA 4A2PA 5GADl 4LYJA 2XAUA 2JJ2A 3C8UA 3TBKA 1SHKA 5HCIA 2HXSA 3GFPA 5HTKA 5JWHA 1YR7A 1N6NA 2V1XA 3C16C 4M1WA 1G64A 3ZS8A 2EFHB 2YJTD 3RABA 4UNRA 5DGXA 3B1XA 1R8QA 1E2IA 3D6TB 4E5UA 2HF8A 3L0OA 1XCPA 2ZYTX 4AI6A 2H8KA 3TKLA 2ZRPA 1OYWA 1TQ4A 1KSHA 1T6NA 2SHKA 1W0JD 1L4UA 3RC3A 2KI5A 3AP1A 3EZ9A 2J7KA 4RD2A 4Q4JB 1WE2A 2QMUA 3C7KA 4W5JA 3RRZA 5J5CA 1MO6A 2IYWA 1N6RA 4LJ9A 1SXJC 4LPKA 2C2HA 2HYIC 4OK5A 3NKVA 4YC7A 1CS4C 1KNXA 3VTKA 1Z83A 3GLIE 2CDNA 1Z29A 3NXSA 5B57C 3G0HA 1OYYA 5JJKA 1U8ZA 1E32A 2I4IA 2QMEA 3TQCA 3VKWA 1E2NA 3BC1A 5FI0B 4EQ6B 1J70A 1BIFA 5JMTA 3EC2A 5L3SA 2LCFA 1KO5A 2NTYC 4BFUA 2AFHE 2VP5A 2XNSA 3TR5A 2WMNB 4EPWA 3HJNA 5F9FA 5CLQA 2Z6VA 4KBFA 3QEOA 2R2AA 3LV8A 1RKBA 3DOEA 3ADDA 3CM0A 1KGDA 2IYUA 4WZAE 2GDJA 4JLPA 4UJ3A 3LA6A 4MGZR 4LHVA 4W5WA 5CITA 5KNCA 3N2EA 1U2RA 2BBSA 5JBQA 1ZW6A 3E5HA 2W6JA 2XJ9A 4QM6A 5JLJA 2JJ1D 3PUVA 3VR4A 2GA8A 3B78A 4MYCA 4HAUA 5G3YA 1IY2A 3B1ZA 3CRW1 5JFGA 2H92A 3GFTA 1P6XA 4D4JA 2O8CB 4K81B 3P1JA 1G17A 4URUR 4D0LB 1P2UA 2ZAMA 4PC7A 5JHGB 3EPKA 4UQOA 1JEDA 1P61B 2CXXA 4XIGS 2F7SA 2WICA 3GJXC 4EFNA 1W0KA 3PIRA 4URWR 3ADBA 5L3RA 4CEIA 4CEJA 2QM7A 5FUXA 3R9WA 1QHHA 4GSYA 2G83A 2V6JA 4DLTA 4NKRA 2NZJA 4IOLA 1MOZA 1JPNA 5K8TA 1E1RD 2VIIA 3TE6A 3O8RA 1OXSC 1GNQA 1CJVC 4OQXA 1Q1ZA 3W5IA 5C46F 3C41J 4CIDA 4WZ6A 2IK8A 3QKRB 2O0KA 4JVSB 4LRTA 2QP3A 1TUIA 3GJ7A 3W3AA 5CYPA 5L3VA 1RPZA 1W2HA 1KDTA 4P33A 4ZO4A 3TVDA 1M34E 3W6PA 1LTQA 1Q1BA 2QBYB 2WJJA 2J45A 1Z6XA 4IFBA 1QHIA 1IHUA 1XTSA 4RY2A 4D81A 1U0LA 2IW3A 2OBMA 1LW7A 4BLPA 2NGRA 2X2EA 5HCNA 2GCOA 1OF1A 1YZUA 1KY3A 5ANRB 1KI6B 4A2QA 5J4YA 1AM4D 1TL7C 2CE2X 4M1YA 4O3MA 2HV8A 3GEEA 3PUXA 2ZE7A 4NYJQ 4LJ8A 3K8YA 5EZ5A 5JEDA 2BMFA 1VG8A 1KMQA 4Q7JB 1TU4A 2XJ4A 2QP4A 4NPHA 1QVAA 1RW4A 4ZKEA 4AYTA 3AVWA 3A58B 2GEVA 3MJHA 4DEXA 2ZVPX 1G19A 2AHOA 3LWNA 1SVKA 2CL7X 3KJIA 3H4MA 3VR1A 4TMZA 1GKIA 4TQ9A 4DUGD 5HKKA 5IRCD 2UKDA 5EUMA 2RGCA 3TUIC 4O25A 2XXAB 3N70A 4QJ5A 4X8MA 1KDPA 3VR6A 4PZYA 4B3DA 1C1KA 3GLGB 5DISB 3RYTC 1ZP6A 1GNRA 1KDOA 4AK9A 2QM8A 4ACBA 5L3QB 2JLRA 4OHXA 3K0SA 2HT1A 5JHHB 4DT1A 4QHTA 3B8HA 3MWYW 5GVSA 2E1RA 3BFXA 4JJZA 1TU3A 1KIMA 1LFDB 1P75A 4A6PA 4JLJA 1SULA 4A1FA 3DL0A 4EJSB 1IXSB 2O8EB 4XWKA 3BBPA 4JSYA 2GBLC 4ZCMA 1G6OA 4D4MA 1KI2A 1QHGA 4Q1AA 4YMSA 1Z2CA 1E1QA 3ZVRA 1JALA 2D62A 5KPDA 2NMVA 3EX7C 5EP2A 5JI3E 1ZM7A 4XD7D 2R6CA 2EFGA 5JJLA 3MUFA 1VKJA 4ASUA 4LJAA 2WSSA 3QG1A 1E9DA 2AXNA 4I1VA 2WAXA 1UKVY 4NE2A 4NHOA 1W46A 1CJUC 5FPKA 4QKQA 1F3OA 1S1CA 1E96A 2I1QA 4JLAA 2GHIA 2NO0A 2Z0MA 1E2HA 3PV0A 2MSEB 4TYQA 3FDIA 3FMIA 1U90A 5JCZA 3D7MA 4DLSA 1I4DD 1MRSA 4GDFA 1ZYUA 4V0KA 1XZQA 3PCRB 4Q4JA 3MWKA 1W0JA 3QVUA 5HE8A 1LF0A 3AUYA 4NCKA 3V9PA 4EDHA 5IT5A 2XZOA 2PBRA 5F9HA 4PPNA 4M21A 4RSGA 2DHRA 2N1BA 4NYJR 4F91B 3ZZTA 4AURA 4E09A 1GZSA 1NVUQ 1JAHA 2N42A 4IVQA 3T35A 4BEJA 3OAAD 5FH9A 4EQ6A 5FBWB 4YXWD 2YWFA 1S1MA 1T9HA 1X86B 3Q5EA 4B3XA 1XJCA 3E1SA 2A3RA 4LBVA 5FR1A 3TRFA 1YQTA 3CZPA 2CCGA 1CJTC 1MO3A 4IDQA 3EAQA 5AUQA 4PO8A 1XD9A 2YWGA 3AF0A 5SZHB 2Z4RA 2JIZA 1B0UA 2G88A 2OO7A 1GRRA 3L0PA 3NWJA 2BV3A 1M7GA 5J47A 3EWSA 1Q3HA 5DHAA 1TUEA 2EYUA 4KU4A 5HE9A 2ZE6A 3EPLA 2ZANA 5LD2C 3B9PA 2GJKA 1G5RA 3WP0A 1HY3A 4Z8YA 2PJZA 4IEEA 1IN4A 2KB0A 4QNRA 2J7PA 3KZ1E 3R9IA 2FFBA 4KITB 1E4VA 3BWDD 4KFRA 5H8WA 1E9RA 2V6IA 5KDDA 5CDFE 1A7JA 1PZNA 4CDGA 1C9KA 3SQWA 3DM9B 2F55A 2BOVA 3ZQ6A 1P2TA 2JJ1A 4OKSA 2ZRBA 1XEWY 5DNYB 2O8CA 4A82A 2IYRA 4LHWA 3PENA 2O5VA 3F3YA 3PEUA 1GM5A 1LB1B 3UMRA 4FCVA 3TR0A 2J59A 2ZUDA 1TMKA 5JRZA 3SDZA 3ZVLA 3PITA 4B2LA 1DO0A 5AK0A 2FDCA 2AXPA 4DLZA 3FHTA 2IYTA 4IXMA 4FWDA 3MGCA 4LJ6A 1SVWA 4KODA 3F8TA 4ZCLA 5EQTA 3A8TA 3A1TA 4HLUC 4A9AA 4QNMA 5KNBA 2OUKA 1LS1A 3NBYC 1E1RA 2XNDD 1X1RA 3FHCB 1G5TA 3QKRA 1NBMD 2J0VA 1IM2A 1I2DA 3MD0A 4Q47A 3U5ZB 1CR4A 1NG1A 1VCOA 2IC5A 2ODEA 4OI1A 2ONJA 2QBYA 3GJ6A 4F93B 1TX4B 1FUKA 4PZZA 4W5HA 4C2TA 4G5OA 1W49A 1XEXB 5E7MA 1XCGB 3LDAA 2CBZA 1P60A 2WJYA 3U7HB 5E95A 1JECA 3W34A 2ZRGA 1CR1A 3RAPR 4AG6A 1VMAA 2ZSDA 4MQBA 3NG1A 4OK3A 4TL7A 1KI6A 3AF2A 4Q7KA 5FPYA 2DB3A 3SNHA 4Q21A 4RKEA 1OV4A 5TXGA 3EA0A 4K46A 1AQUA 1CR2A 1VCIA 1YR9A 3CNLA 1N6HA 2VEDA 2IA5A 5FBVB 5KTYA 1OH6A 4H1UA 4JVLA 4N1AA 4B6EA 1G3UA 4AYWA 1OFUX 1LVGA 1CJKC 2WOJA 1BKDR 4E03A 1E9FA 3EPJA 3K9GA 2FX3A 4BRWA 2O52A 3REGA 3AVTA 5KDOA 4HDOB 1U9IA 3CO5A 3G5UA 2ATVA 4HAVA 4AC9A 3FVQA 2ZRKA 3AKEA 2XXAA 4Q01A 3CR8A 4DUGA 2V55B 2MSCB 2DWZB 3AGQA 1ONBA 2JEOA 4KLZA 3SZRA 3SEAA 1FQJA 4JL8A 1W2GA 3GLGA 2ZJOA 3W8NA 1KI1A 1OXTA 2GCPA 3BK7A 4BFVA 4TLEA 1DAMA 3GLIB 5L3QA 2QTHA 4D26A 1NMZA 1XJ0A 4LC1A 4KLNA 5FTNA 1VYUA 3RHFA 1CEEA 1ZM4A 3EA5A 4NYIR 1AS2A 4JSTA 4ERNA 2VP6A 4EJSA 3JZAA 5AUPB 1S3GA 4R7ZA 4U5XA 1K8RA 2ZAOA 1EFRA 2ODWA 3FKSD 3SOPA 2O8EA 4JVMA 3L0SA 1EX6A 3AF1A 2C95A 1QBKC 3IQXA 1FX0B 3BOSA 5FOWA 2QPTA 1S0UA 2JGNA 3DHWC 4BASA 1YZLA 3AVPA 3CH4B 1OE0A 2ZUBA 1UAAA 1NN3A 3WHKA 3PVSA 1ZD1A 1CR0A 4D25A 4Q19A 4MITA 5AWFC 1J7KA 4Q48A 4XD7A
chains in the Genus database with same CATH superfamily
4B8ZA 5M2QA 2BLNA 4ZYTA 5EJ8A 2J31A 3DPSA 4GF5A 1W44A 3HWWA 4LVUA 1JZTA 1U1DA 2Y76A 2QYTA 4RV4A 1ZIPA 2MYPA 4C7MA 3BIFA 5BXQC 4XYGA 3WG9A 1EPUA 2Z98A 5FDFA 3ANXA 2DBRA 3CISA 4D02A 3JYOA 1BCSA 1ELOA 9ABPA 1M1UA 2FSVA 3LUKA 3NEPX 1KA9H 1GAQA 5AVKA 2PGAA 3LD9A 2UUBB 3T9CA 5KNDA 1RXSA 4MQLA 2OBBA 2DWCA 4JC8A 4MJ7A 3UT5A 4DCCA 3D3WB 3ZKWA 3FTFA 3B9QA 5E2IA 5J2TB 1GJSA 1XHLA 5JXJA 2O3UA 1U3CA 2JI6A 1A9SA 3HGMA 3RSCA 1BOFA 2JANA 4IDFA 1TO1E 1NUAA 3EW9A 1TPZA 2ODBA 2HA5A 1RWQA 3P52A 3GRKA 2JDIA 2K4MA 1E5XA 3CONA 2ZSFA 4DCGA 5K6AA 3R7DA 4F4HA 4P4UA 3T5PA 4CF7A 2AKEA 3INGA 1HC7A 3AEUB 3K8QA 4RVGA 3HP7A 1HLFA 4KIUA 4EJ0A 4HVCA 2GPYA 3W5AA 3L8FA 1T5DX 4G36A 1O7JA 5AESA 2QD2A 3NBFA 4PG6A 3TZHA 2I3GA 4NBKA 3F5FA 3PE6A 3BQMB 1U0OC 4CDNA 1P7VA 3IAAA 4DMRA 1T0HB 5K3DA 3H2HA 2X42A 4Q4DA 3SYLA 4WUVA 2FX5A 4WNAA 1K8QA 1DVRA 5IWAM 3DPIA 1D0MA 3PIIA 1EIJA 2RH8A 1GZUA 2NSLA 3WLSA 1E4OA 4BB5A 1SO8A 1MJHA 3WXMA 4KB5A 4EVIA 3SKXA 1LKZA 4JKIA 2G40A 2XEXA 3IV7A 1DMRA 4CXMA 2LVQD 2YIJA 2F2TA 4J9UE 1KR5A 4E5MA 2NACA 3KOYA 1GQQA 4A8HA 4P81A 2RGAA 2WWHA 3KD3A 4MGHA 2CEAA 1G6KA 1GQFA 5H80A 4KE8A 2JGFA 3KEOA 3NWPA 4JT2A 2CNWA 2P6OA 2XBMA 2GJ4A 3AR4A 2OCBA 2OKCA 3LHKA 2JIZD 4OFBA 2H07A 2YYZA 3KQWA 2H5EA 4U3JB 4RXUA 2OILA 3O03A 4I4TF 3B12A 3D59A 4CVNA 4PQGA 1VI6A 1P4RA 3MHPA 2YJNA 4S1NA 3BF7A 5A4DA 3LO5A 4HH4A 2Q3DA 3SYTA 3V55A 5JQWA 1MV8A 2X6QA 1OA1A 1O95D 3E8MA 2EKQA 3ETDA 3L01A 2DG2A 3OQPA 4KX3A 3EGVA 3ZQUA 2IBTA 1UDAA 4AXBA 1T26A 3DTYA 1UM9A 4IVNA 2ADMA 5CIYA 3HBJA 4IBKA 4ZHSA 4CI9A 2C2GA 4QBKA 4LF6B 3I3OA 2REOA 1DCMA 1CS0A 3GZ4A 3CRMA 4RH0A 5ALNA 3AK4A 3A4TA 3X0DA 1MXFA 3NS7A 4B71A 3P8ZA 5EUQB 3SOZA 3DTVD 1DFIA 4QBTA 3I2JA 1XT6A 2NU6B 5IK2A 1ZD4A 2DHYA 3KSBC 3K0KA 3DBRA 4RA9A 1Q0QA 1B00A 3DEYX 1XP8A 1EX9A 3QGMA 3Q3GE 2C61A 2HJRA 4S1PA 4X95A 1Z2DA 1USKA 3MGGA 3WB1A 2J0UB 3PA6A 4OSEA 2JGMA 1G8PA 1SCJA 4DZRA 1EBFA 4S1VA 3N2KA 5BN4A 5F7XA 2QI9F 3ZW7A 3D8BA 5AKYA 3RVPA 4J16C 4C4AA 4C0BA 3CW9A 3PQDA 2CNBA 2NZUG 2NVBA 3T7SA 2CC2A 2F9MA 4TXJA 2CJWB 3UMFA 2W2OA 3W3AH 1RYDA 1ZO8A 3MELA 3MWJA 3JV7A 4B79A 4EY8A 2X1VA 4BO2A 1H22A 1UWKA 3OG9A 1R6BX 1OZAA 2DBYA 2MOKA 5KYXA 4QOGA 1GVNA 2AN5A 1GSAA 1ETUA 1RAEA 2HBYA 3TOVA 4AZ3B 1JDBC 2B4YA 5IEJA 1A7AA 3VISA 1E92A 2YXNA 2A1TR 4LYGA 2OXIA 3SHQA 2CF5A 3K6SB 4NOMA 5IZ4A 1DSSG 4QUGA 3QF4B 4FBGA 2WTEA 1X8LA 1YC5A 2B4TO 2M6RA 4AWXA 4Q82A 1OC2A 4BAGA 2BEWB 5F73A 4IDBA 4C7JA 3VHXB 3IDOA 2NV2B 4M38A 4YCDA 2G5PA 4LGMA 3E0QA 5MN4A 3KR2A 4UUBA 5BW6B 3NZEA 3BMXA 4PBSA 3LBHA 5G41A 2ECFA 1E5LA 3BAFA 3REQA 2X1LA 5AVOA 4FM9A 1DBRA 1VE3A 3M8KA 1VEKA 3DOFA 4BMPB 3P0HA 3THYA 5ALJA 2IHUA 3ZZNA 1GR1A 3EXG2 3DTTA 1VGVA 4F7WA 4D97A 1NW6A 4L15A 2E5FA 4CLHA 5EE9A 2AFIB 1NJGA 4ALNA 3L6CA 4LTMA 3IOBA 4AUNA 4G0UA 2CXSA 1NBOA 4QOEA 1LX7A 3F98A 4AIRA 5AUOB 2CP8A 3V4RA 2OEPA 3IUMA 1JQLB 3N58A 4QDOA 4KFUA 3TTSA 1ZD8A 2PGNA 1R5BA 4FE7A 5JMPA 2FSFA 1IRIA 4IV8A 4GOND 1CK4A 2BFFB 1PJSA 2C20A 1UADA 2WIAA 3VTFA 4Q4AB 2CXQA 2LHGA 3VZDA 2PTGA 3A1SA 3GOHA 5EN4A 1I6KA 3DLTA 1Z73A 4AZFA 1P0PA 1DGQA 4O1MA 4BNNA 2WHYA 5K0BA 5E0OA 4KAAA 2O8DB 4R1NA 3DZBA 2IV3A 1D03A 3GJTA 3O95A 3WLMA 1C41A 2OHVA 1FPQA 4TYYA 3GGDA 1MOSA 5I7AA 2E4XA 3GJSA 3DE3X 3BD7A 4OREX 4EUNA 2HA7A 4FQ7A 2JIQA 1KAGA 4M8IA 5G0VA 3J7AS 3WYDA 2QPOA 1I94M 3T12A 2COEA 3CZ9A 3QUAA 3E61A 4LDAA 3HKDA 5KPTA 4U2CA 4F3RA 2DY0A 5JZ9A 1C3JA 3RVKA 2FF7A 4CMAA 3C24A 4QRDA 3AI3A 4NENB 3ZZMA 4DCVA 4U8HA 1G8GA 1Y81A 3OTOB 1L5OA 1BA2A 1Z0AA 1N9ZA 4M1EA 5IT9A 4IV5A 1UAYA 4Z54A 3GCXA 4YYEA 4WCFB 4DLWA 3L2OB 1WBDA 2AF3C 3JD4A 1HMPA 3ZXIA 1BWSA 4YRIA 2GYUA 2V4ZA 4O4IA 5CB4F 4KLAA 3WK5A 3EUEA 2QU7A 4B7CA 2NU7B 4UJ5A 3S68A 1OZ0A 4IH1A 4JVNA 3U4QA 4P93A 2V8OA 1R0ZA 4CCAA 5F64A 3KQHA 2M6KA 1WJ7A 3NALA 1FNCA 1E2BA 3VKVA 3FMVA 2QG6A 4ZCRA 3ASYA 5LL6P 4PICA 4TZTA 1IC6A 1HH4A 3N05A 1VYVA 5ESWA 2CW5A 1G16A 1T5IA 2OFOA 3BVPA 4TMXA 4CEHB 4MGIR 4BJ1A 3C3PA 2PZGA 4DXDA 2ATIA 2VNSA 2JASA 5LMNM 1ULHA 3MGBA 4B33A 3U3JA 4MRNA 5IBPA 4MLDA 3E3OA 4ZYVA 5JVDF 3AB8A 1E3QA 2WTXA 4ZI2A 4WD3A 1YQWA 4HTAA 2C8VA 4IBEA 4AN0A 2ZBUA 3G9QA 2IUYA 2J3DA 3NH9A 1F5NA 4QBGB 5TVKA 1DC5A 2P62A 2JY5A 5E6UB 1VKZA 3ITNA 3K05A 2K6GA 4M87A 1TM7E 5FBRB 1TK3A 4BFSA 1F4VA 3F8WA 2PZLA 3UWOA 5BRAA 2C5RA 1ODLA 1Y8QB 4C07A 1U0RA 1B8VA 4OXKA 1G8JA 1H65A 1U2DA 2V0CA 2YASA 2F3RA 3HCWA 1DTEA 2WSIA 2PUAA 4FCCA 2XOKA 3U44B 3TVYA 4ZVVA 1AO0A 1W4AA 2WD7A 4WJZA 3L05A 2VYQA 3IDAA 2YC4C 4G1VA 3AR8A 2FSSA 3BZUA 4QUJA 4ES6A 2OO3A 1Q02A 4ZI5A 4H60A 1HG0A 2W70A 3FNHA 2R97A 1MDBA 1YZHA 1QPZA 4G0WA 2IPMA 3SAUA 4L1KA 3S99A 1RLMA 3ZX5A 2H4JA 4QE3A 1EFAA 2VF2A 2G9ZA 2I2BA 2YXLA 4RJLA 1UKCA 3U4GA 1RKUA 3H1EA 2WYIA 1TEHA 1VEJA 1E4EB 1PNQA 5ALLA 2AMYA 3U4DA 1K98A 5CUQA 1G5PA 3ME5A 1CZOA 3A1NA 5ERYA 3U6EA 4U2GA 1F0KA 1NTRA 2DVMA 2GEFA 5CA1F 3M4XA 4CM8A 2E4UA 1IXKA 1Z9BA 1P44A 3ONNA 2QLLA 3BDVA 4XZ3A 3TNYA 2AMFA 2BRUC 2BD0A 2JGDA 4KOAA 5AW7A 4N7JA 2XMGA 4LCEA 5BYJA 1EGMB 1XA3A 2QSZA 2I7PA 4AZVA 4AF7A 5GMOA 5KU1A 4FCTA 3MJFA 2O5EA 4HPXB 1Y80A 1I5OA 3L4JA 4JI5B 2PZKA 5INTA 4K8OA 4TWIA 1ISIA 1M2GA 1ND5A 3UZUA 3FVRA 3D7LA 3PQFA 1U7OA 1ENOA 3B13B 4A0RA 4A92A 1FNNA 1SD5A 4OI4A 1JQKA 3MSXA 3EVEA 1OFTA 1YR2A 3HYLA 4NAHA 1KDRA 3JR3A 2GR9A 2GVDC 4U7WA 4RKWA 4W1QA 5JJIA 3S70A 5JT1A 4M89A 1IUNA 2HCRA 4CE6A 1VBMA 4CIBA 3QI7A 4XM0A 1GCOA 3I4LA 4M60A 1JBEA 1E9CA 2YHIA 5UKDA 3B9RA 2QRHA 5BSMA 4C4OA 4ZHQB 2IV7A 4YNBA 3FF1A 2ZPTX 2V6ZM 1CHNA 4BFZA 3QSYA 3PNMA 1MIOA 4C21A 5PGMA 4OP3A 3GH1A 3KFLA 3MEQA 4AY6A 4MKZA 4LRSB 3NHAA 2YBDA 4R31A 3MCZA 3HJAA 1BA3A 3CXUA 2VL7A 2A5FA 1VYTA 4G1FA 1DEXA 3PEYA 2FN3A 1YI1A 5ERGB 1W76A 5E9AA 1KMHA 3LUDA 3O84A 4GZ3A 5E3IA 2V7EA 1E9AA 3CC8A 2Y68A 5JDCA 1VHTA 3OEEA 5JECA 5AW2A 2JHGA 1K3TA 4FKBA 1WR1B 1JZQA 4RCZA 3DKKA 2ECKA 1KFVA 2RK4A 4ARUA 1RT9A 2W2NA 1GN9A 3ZE7A 1L4YA 3C9PA 5TX7A 4ZJPA 3P45A 5AM0A 2LVOC 2JRLA 1CVIA 4V1CA 3TO5A 2IUTA 4RIIA 4HGYA 5I9IA 1MQ8B 1W5EA 2BKEA 3T7TA 4H9GA 1QDUA 5AK4A 5DNAA 3HXTA 3IBYA 2Z43A 1BS2A 4M0EA 2H1SA 4JBXA 4D6PA 3QPCA 4CL3A 3A9TA 1P72A 2C82A 4TYMA 3A6DA 2Q1TA 5A06A 3LU1A 2NUTB 1NBMA 4LJLA 4GMDA 4MQEB 1C1XB 3O93A 1Z0KA 4GRAA 2QMHA 3IC5A 3MMZA 3TD9A 1C7EA 4XA8A 2JIOA 1YRYE 3MUEA 5C7YA 1NLMA 1E79D 3W3ZB 4OIFA 2FP4A 2EKPA 4D3YA 3HJRA 4XDHA 3F73A 2RGGA 4Q18A 1P2DA 2F8TA 3R0VA 3RKRA 1AQYA 1U1GA 4GPBA 1KSGA 4X3OA 1XCLA 4NG5A 1DBSA 1YBMA 1DG3A 4L27A 1W85B 2JGLA 4ZZ2A 2V1XA 3JZDA 3QE9Y 1T6NA 4N8EA 3V8RA 1YASA 2E4ZA 2I67A 1RSZA 2JZ1A 3ILXA 2QRMA 2F1KA 4I4TB 3GLIE 3NXSA 4EKGA 4ZZ1A 3L7KA 3BC1A 1M34A 2NN3C 2GD2A 2NTYC 4IHAA 4YXFA 4G5HA 4Z4IA 2ZKIA 3SS7X 4NF2A 5HS6A 3M1YA 1T1EA 3MXOA 5E9WA 3DOEA 4RU1A 2D5LA 3CM0A 3IUEA 4CF6A 4LOHA 5CITA 3V1UA 4QM6A 3QLTA 3U7RA 2VBFA 1MLDA 4MYCA 2H92A 2PSSA 5E3JA 3K9PA 3EJ6A 3ZOZA 2WNSA 1QWSA 1IZYA 4LWPA 3J7AC 2QM7A 5KCMA 4JI3B 4DLTA 4IOLA 3O8RA 2FWBA 1CJVC 3C41J 1GGJA 1AK9A 4F9FA 2EAUA 4RA6B 4QDTA 3COJA 4FJ0A 2R5WA 4BWFB 1QYVA 1X1CA 3HKBB 3NT4A 1OF1A 4MROA 4XYMA 4QTXA 3B5EA 5EKXA 3OD1A 4ZVOA 1NNUA 3IR7A 4RELA 4ZAWA 3DAHA 1N34B 3IAEA 1H2XA 4PBTA 3GLGB 3RRFA 5CYGA 2RKBA 4IGAA 5JHHB 5TEVA 3UBMA 1RBZA 3VNQA 4BO5A 3ILHA 2PR7A 1Z5CA 5B55A 4ZT5A 1JALA 2X3YA 4QXMA 3DL4A 2Z6QA 5FPKA 3L46A 2I1QA 4FR5A 5JCZA 1B0AA 4LQLA 2L6OA 5KEIA 3EVCA 2DEUA 1OXMA 3CY6A 4O5AA 3ED1A 3OLCX 2DHRA 3L0ZA 1I9GA 4TPKA 2NQ8C 1GZSA 2I6GA 4CFSA 2PUGA 5ARBA 3E1SA 4MIEA 4DV5M 3KPVA 5K0LA 4MR7A 1JDTA 2EYUA 5LD2C 2OVBA 1KVUA 2IEGA 4MHTA 3IKMB 1IN4A 5A3VA 1HFKA 4ZQIA 4QA9A 2JJ1A 2O8CA 3PXDA 1AE1A 1DFHA 3TKYA 5D8DA 3ZVLA 3GAMA 2NVUB 4ZCLA 3A1TA 2PRKA 4REQB 3NBYC 1E1RA 3HFGA 4HK4A 4JMLA 1PJTA 1M6HA 3JR4A 4OP1A 2IC5A 1Z7EA 4R9VA 4H59A 3UH1A 4YRKA 1M9NA 2GSDA 3QXGA 1M1XB 3RAPR 3PI6A 1KI6A 3AF2A 3INTA 1RPAA 4C3UA 2AMLA 1RKQA 1OZFA 2HMVA 4H1UA 3WIBA 3HH8A 3QYFA 2DTDA 1NPDA 3EPJA 3A2LA 4YRGA 4L9AA 4Q01A 3GFQA 1G60A 1KI1A 2XGOA 3BK7A 3FYUC 2OL4A 2ZWVA 3X1KA 4S04A 1YFZA 3P9PA 3F1KA 1E7SA 2FSPA 3AF1A 2OTCA 4G1BA 3IS3A 2ZUBA 1ZD1A 3RYCA 1F4LA 2WU1A 2X9QA 4KH0A 2JJ2D 4RS3A 2Y20A 3L82B 5JS2A 3C1AA 2GPJA 5BN5A 3P97A 3KZVA 3QI2A 1IM5A 3KAPA 2I7XA 1RC0A 3BXZA 5TPZA 5LQUA 2WMDA 2OA0A 3E05A 2VDUE 3FRHA 2LCIA 4BMSA 5FFFA 4MUJA 4QSHA 4RZ3A 2VOJA 3K4QA 3R8FA 2PLWA 221PA 3EVZA 5K1ZA 3E7WA 1A5BB 3JQAA 2RHRA 3KETA 4RW0A 3JAKA 4JI6B 5JQGA 4ZZ3A 4PN3A 4YIHA 4K40A 4AULA 2PVCA 4YI5A 4A36A 2NPIA 2X0EA 3EOBI 4JOQA 1IWBB 3PPIA 3O4RA 1A8UA 1LPOA 1P0MA 2PRYA 2XHEA 5KBYA 1JLMA 1UT6A 2V7VA 1PR9A 4B4UA 5TGTA 3K1JA 3I53A 4BO1A 1G7TA 4MV3A 2Q3FA 2MSDB 1XKXA 1SVMA 3G8AA 5CB4B 1ZVJA 4UAVA 1K27A 1ZLXA 5KVVA 4RABA 1R0XA 4TSFA 4Q24A 1WD5A 2FN9A 1GRQA 4CM3A 3UJ8A 3E6AA 2HMUA 3ZV5A 3AM1A 2BFAA 3U0VA 4E2XA 3ICEA 3PX2A 4ROTA 4V2IA 1JW9B 2YJ4A 2QA5A 5DK4A 3KM0A 3C6KA 3LI2A 3KXLA 2LCQA 4H3SA 3OPYB 3L7YA 4BP1A 1SC3A 2ZKLA 4P31A 2IEZA 2QN7A 4FFSA 4EAAA 5KVSA 2OYCA 2P4SA 2EKZA 2UYHA 1YU6A 2FUCA 1ZI9A 2AOWA 1SBYA 1L5LA 2HWWA 3WYGA 4IIUA 1CFJA 2Y1OA 4HWKA 1QP7A 4DCUA 1G3QA 4C04A 2QTMA 4YCBA 2G8NA 4AQDA 2FE8A 2QE6A 2X9GA 4HLQB 2A9PA 1US8B 1GPJA 1OJ7A 4C7BA 4NZMA 3HX3A 4NRWA 2IRWA 4OIMA 2QROA 3UBTA 1ARZA 4TV9A 2KSQA 1TCVA 3NUZA 4RESA 1UJ2A 1WEHA 1GCIA 3KU1A 3JQBC 4EHAA 3IT1A 4JWTA 4EJ2A 4R01A 4FUTA 1BO6A 3VU9B 5TJ9A 3IHPA 1E3JA 2NZ8A 3RGGA 4D8WA 1BJRE 1UM8A 3LT1A 1DGHB 1Y6GA 2DFLA 2FFHA 4X66B 3SDBA 2ZZNA 1CDEA 2EFCB 3H9BA 3EGIA 1EFCA 1MVOA 3RC2A 4HQFA 4ZWNA 1TTTA 2NZVG 4OXQA 3UOGA 1Z36A 1MA3A 2UUAB 2V45A 3IQHX 3FBWA 4YDSA 3AOEA 1QANA 3VOTA 4BMDA 2D7DA 1JKJA 3FE3A 4PXAA 3IURA 2IH4A 5T7BA 2PZ8A 5BNTA 2WYWA 4LYYA 3HJHA 1YS1X 3IGFA 4ZAZA 2PMEA 3CIOA 4AWBA 1L5VA 2NAPA 4QU5A 1FUUA 5EIAA 1AQNA 5KTSA 4CLOB 2R1VA 4G89A 3IPAA 3BYZA 1IWPB 1G8HA 5ENZA 1AUAA 5F3WB 4CMGA 4OGLA 3JWGA 3QYAA 2MINB 1PQ4A 4E4YA 4NRDA 2JGAA 2ODQA 4HDMB 3KO8A 4WLVA 2EHJA 4CF3A 3BB4A 1VLJA 2X86A 4LPSA 4CV3A 2IX3A 3D8LA 4KMRA 1Z38A 4BO8A 1GFIA 4RVNA 2LUOA 2QX9A 4B31A 4HUJA 3R40A 4IXWA 4JDPA 3GPLA 3V7FA 2B4KA 4HB4A 1KFCB 5JTUA 5CX4A 3TSWA 5LCXA 3PKZA 4LFCB 3FCYA 4IZHA 1GFSA 4D8VA 4WERA 1U2QA 4EB8A 1QAQA 3ZD9A 2WP0A 4XR9A 2WWWA 4LK2A 3ELDA 4WXRA 4JXJA 5HIKA 3DEFA 2ZP1A 3RSQA 4AUEA 1M0EA 3DTNA 2YZ7A 4R0VA 3LPAA 1SCKA 4IF4A 2GJ8A 1VHWA 1NLYA 4NFYA 2QGFA 4MICA 2EBHX 2B25A 4ZO8A 5K0ZA 4YMLA 3VU0A 2NSYA 3FOBA 2WF8A 3EISA 4FD2A 1E9SA 2GPAA 1Q7TA 1KORA 4XYBA 5C53B 1DKNA 1KJ9A 2IUSA 2NUAA 1EVQA 1RDFA 3T1YB 4RPHA 1NZJA 4F1IA 5KYYA 3MJ5A 4L8GA 3TNDA 4PPGA 1XALA 2WUWE 3E9SA 4M1TA 2I2XB 4D9CA 1P0CA 1E0DA 4DNOA 1A71A 4L8LA 3WB0A 2F1RA 4BC1A 3Q1KA 5HQTA 2PKRA 4BLQA 4D9FA 3C1UA 4JBWA 3S8EA 1HQYE 2YZ2A 3KJFA 1DCFA 3L9XA 4PHGA 2DETA 4Z4EA 5FOTA 4MWZA 1MTZA 1Q44A 3ZD8A 3OSZA 1YZTA 3E70C 1N9KA 3A4IA 2MTBA 3E03A 4UTNA 4XJSA 2D0OB 5BW5A 2RGEA 3AEKA 1S3FA 2CV0A 2ZJBA 3BICA 3R77A 4L73A 4GXNA 5CCXA 3FCSB 4FFNA 2NO6A 1LNSA 4N18A 1H66A 1JLSA 5AM5A 2W11A 4JYBA 2VPIA 5EPOA 1GKYA 4H7FA 3WX0A 1LJ8A 2R1TA 3W2TA 4NNJA 1PG5A 4OFZA 2DQKA 2F43A 1NRWA 4UVEA 3OC0A 3UOWA 2I3AA 2C7GA 4C4SA 2I5PO 3HNRA 1A96A 4W6ZA 3WRYA 1DQPA 1Z12A 2QR2A 5IZ7D 2QVZX 1VHJA 1TEVA 4GVLA 4RLQA 2Y1XA 2IYEA 3VR2A 1E3EA 5CJ2A 2FPIA 3UHJA 1LSUA 2V97A 5CLFA 3OQMA 4DBZA 4REZA 2BBOA 2OKGA 3IUSA 4NCNA 1O54A 2N1MA 1WSBA 3QPDA 3ZJ5A 1O94C 3UGJA 3IPXA 1Z0ZA 2GN6A 5EXDA 2GX6A 3ISJA 5C5DA 3X2EA 4TXMA 1OI7A 4P4GA 4PSDA 3TWOA 1HSOA 2BM9A 1TPYA 4DC0A 4RD3A 5G3ZA 1W36B 3C48A 4G23A 3ABOB 3MOGA 5G4LA 1BG6A 1C3EA 5LBTA 4WX2B 1ML3A 3VKFA 4QG7A 2GN1A 4KO2S 3OLVA 4HDNA 5EHNA 3LPLA 1AGXA 2XCLA 3NH6A 4UAGA 3RTBA 3UWPA 4EHNA 4HYYA 4DR2M 1BYUA 2D74A 3H8VA 3IMFA 4RFLA 3FPKA 1WZIA 1CT9A 1KHTA 2ZI7A 4HAIA 3UHAA 3L25A 2NQ2C 3F6RA 5AVQA 3ZBTA 2ZTSA 4KT0F 2NUPB 1GGFA 1EVEA 3OQ6A 4XOIA 1Z0FA 5DWDA 4P32A 2GQ0A 3VC7A 3B6JA 1JIXA 1T4GA 1MCZA 1TF5A 4FR2A 1G38A 1OVMA 3EODA 4XSHA 4YJGB 1NVTA 2ESRA 3E4CA 5I9TA 2H1OA 2W2XA 1NQWA 4KXLA 1Q0LA 4IILA 3AIIA 4OAPA 2DX7A 3FTEA 3WLAA 3JD2A 2QSFX 2D1FA 2VDBB 1YJ5A 2VJBA 4UE2A 4W99A 4JQZA 4G8JA 4H3HB 1N2JA 2B21A 1TE2A 1NOJA 1FLAA 1TC1A 4NULA 3P0RA 1I7SB 3EF1A 3OEYA 3TEJA 4GOKA 1JLKA 4NH0A 2HJ9A 3C7CB 3AJDA 4N41A 2V58A 1PQUA 1U7XA 1Z4LA 1W8IA 4P2BA 3N2GA 4F4FA 1MJGA 1ZMRA 1N1MA 2RGWA 5ULLA 3Q3HA 3FSRA 4UXHA 1BDBA 2DLCX 5HYVA 3TRIA 5M34A 4E3WA 2Y1LA 3T34A 4I14A 1W19A 3LQ1A 3TF5A 3WYAA 2XX3A 4UCXA 1MJ5A 4GIPA 4PY2A 4I9NA 1D5CA 1JDPA 2OSBA 2YRWA 3ZHVA 2DAGA 2QX8A 4GZMA 3COYA 2VJCA 2C78A 4LDZA 4WLFA 4XLLA 1NLFA 1JU3A 1YSCA 3T7EA 5IVHA 4EJMA 1FMTA 5LMUM 3WLTA 3ECSA 1T24A 3OU7A 3N0WA 3BMNB 4LXQA 1YJAA 4WZBA 2G1KA 3PF9A 4INAA 2NO5A 5AHRA 4HBGA 1WMFA 3MPUA 3I6ZA 2GHTA 4P82A 3EIUA 3JALB 2FWRA 2F4VB 1JV2B 1CSEE 3Q72A 1GGMA 1IBLB 4Z7JA 2WJVA 4DB2A 2IF0A 3L1VA 3NJ8A 3ZQ4A 5CNKA 3PSAA 5BMVB 5FFNA 3KQQA 3HJUA 4PVCA 3VPFA 1B23P 1L5WA 2ZPUA 2AN4A 4CHGA 1UXGA 1QP4A 4GYJA 3LYLA 4EUSA 1EXDA 3QXCA 1OHHD 2BIFA 4X1OA 1Q7RA 2Q6LA 4IYJA 4PR0A 1ZH6A 4B6JA 2PFSA 1YGPA 3GLHA 1O95C 3FUCA 5TSDA 1VG0B 4RH3A 3A1DA 4A0QA 1VG9B 2VBCA 1KGSA 4FKZA 1MZPA 3TTXA 3KVYA 1P1IA 3G2HA 1ZVQA 1IVSA 4D0SA 1JHMA 2H5LA 1J1UA 4YUZA 4BX2A 3PFHA 2WJZB 3H11A 1GZVA 1SCQA 1GPWB 4DR4M 2LWIA 3N2IA 4KXYA 2Q5OA 3SR4A 4X93A 2J67A 2L2QA 5LQDA 4U7JA 1C4KA 4HMQA 5JADA 4TSKA 1R3DA 1N2BA 2QB5A 4X1KA 5JSFA 1Y63A 1FNSA 1GADO 2Q99A 4UHBA 1WBBA 1KO8A 2QUJA 4C87A 3T7RA 2YYAA 3JWEA 5A02A 1LLUA 4LV8B 4TQGA 1YAJA 3ISTA 4Q3KA 2PMBA 1HBJA 5LXTA 4DA0A 1C2TA 1HNZB 2AOVA 4EY5A 3CGGA 3H0CA 4FFBA 1WOYA 2GFQA 5C51B 2OB2A 5LQMA 1QF6A 4HWGA 3LP8A 3UAOA 1CX9B 2CV1A 1RM5A 1L5GB 5KSYA 4K8RB 4RZSA 1CF4A 2RGNA 3HY4A 2GXUA 1VXOA 2DF8A 4IJWA 1EESA 3LFUA 4RV9A 2WYOA 3DBLB 1YLAA 2PRZA 5AW5A 4L8FA 3KKEA 1YMVA 2RGRA 4BV2A 4S2EA 4KXMA 3QLUC 1LPMA 4WCVA 4YS6A 3EDCA 3ILYA 3E82A 2V6BA 3GGCA 4H7JA 3K35A 4D41A 2Z30A 2PUBA 3BGOS 4OBEA 2IYQA 4EYSA 2D1QA 2YXPX 1AZTA 1P9NA 1ISSA 4XTRA 3IBCA 4PGAA 2FEOA 1L3IA 5A3RA 1H9AA 2F5SA 1I7DA 4L5CA 1FRZA 1F8GA 3EC1A 1Q1AA 1QC5B 1RE0A 4I3HA 1YE8A 4KPEC 3V1NA 4X1YB 1WO8A 1W8DA 1Z5WA 1ZLYA 3G59A 3R5HA 3PL1A 2A59A 4H0NA 3CJRA 3JAMA 4ESOA 4E07A 3NIGB 3O8LA 2QE7A 2ZR9A 4UDXX 2VP0A 4ZIRA 4JQOA 5CNMA 1DC6A 1FC0A 4HEA6 4ENWA 1V37A 2OMEA 1C3OB 4ZMBA 4L8YA 1QYXA 3PTAA 2WKQA 2J3JA 5BSKA 1MB4A 4RAQA 5AOAA 1MX0A 3G2QA 1SVSA 5SY4A 3ZK7A 4B3CA 3IBSA 4P7FA 4HWTA 2Q2NA 1WXEA 3QBEA 3BHJA 5L95A 1LC0A 4MEAA 2WA1A 2B9VA 2AT1A 2V9ZA 3HV2A 1YAHA 1YKFA 3K5WA 2FPOA 1WPGA 2HYIC 3LYAA 5CCBA 2JGIA 1WZNA 1Z83A 2CDNA 4OUDB 2BFEB 5JJKA 4FDLA 1IE3A 4YJ2A 4GQIA 3GPYA 1QH1B 3IMCA 1M2OA 3CU5A 4BO9A 1QFXA 3CLKA 4KBFA 1N33B 4IS3A 2P2ZA 4JI8B 2I4MA 3PR2B 4RM3A 2R6ZA 1JSXA 3FMGA 2UYYA 5JLJA 4RKRA 2BWEA 4K1LA 1JPVA 3CRW1 4D4JA 2ZAMA 4KX5A 4DANA 4CKWB 2EG5A 1WMBA 1W6UA 1PR0A 4LRQA 1OXSC 4IINA 4CIDA 3V8NA 4J3JA 2PVSA 2P4EA 1RLJA 4MW6A 4DGSA 5E2AA 2PO7A 5AI5A 3AUAA 1E1NA 1LTQA 2NU8A 4ZJZA 4MWEA 1GUDA 1XTSA 5AI0A 2ZBGA 4KO3S 2R85A 1NC3A 3RK4A 3TRDA 3HN6A 3KJQA 2FQXA 2BMFA 3OO1A 3KHKA 2XJ4A 1EK5A 3ROXA 3GEGA 2WAOA 2O57A 1G19A 3LWNA 1QV6A 2EF1A 3NFYA 1VJTA 1TLFA 2PNFA 3N70A 1LPNA 4P3NA 1MH9A 2XMZA 3HNPA 1DDGA 4ACBA 3TRKA 1UDBA 1HKHA 1VSTA 1WOMA 5CT6A 2O8EB 3M6MD 4E32A 3VZBA 3ZVRA 5B36A 2N35A 5EP2A 3D7KA 3QWIA 5JISA 3L1KA 3WXBA 3ND5A 3KZNA 2Z3VA 1SN7A 1AZLA 1M2JA 1K82A 2ZXEA 3DC7A 2VLBA 4YA6A 3ROGA 1SZJG 2XUGA 1BCSB 3KQVA 1QQ5A 2XNCA 3I1YA 1PSWA 4DQ0A 3RW9A 2ZDQA 4IDQA 5AUQA 2W5UA 2Z4RA 2OO7A 1M7GA 3PQ7A 2VDLB 3EUWA 3EGOA 4Y8VA 1HY3A 2OCDA 1ULUA 4W5QA 3N07A 3SK0A 3UT5B 4F2GA 2WWTA 4KFRA 5CDFE 3ZKWB 1QZUA 5JC8A 1P2TA 2G25A 4EF4A 1BD3A 1ZOOA 1IVYA 2O07A 3L6RA 3F3YA 1XA0A 2J59A 5ALIA 4LK3A 3IRUA 2FDCA 1U2GA 2BTOA 2H2HA 2VNIA 4MDHA 5DF1A 1KYVA 3PE4A 1X1RA 1ZVMA 1OV6A 1GCAA 3T7KA 3FGOA 2O05A 3C3AA 4C2TA 4G5OA 4IIJA 4JEMA 3GCZA 1W0CA 1P60A 1KY5A 3NOOA 4I6JA 4F6LA 2DSTA 1NASA 5ABPA 3A1CA 4N1AA 2GZ2A 5CG1A 2Y67A 1LVGA 3SZOA 3TPFA 2FR8A 4AC9A 1AF7A 1NUPA 4JEUA 2NYRA 4WNAB 2VJKA 5CFRA 4INJA 4ERNA 5AUPB 4NE9A 2VEOA 1RI3A 3BOSA 1YZLA 1NN3A 4PR3A 2VSYA 5DM0A 1DJMA 3UPUA 1UBUS 1WQ1R 2RKOA 1D6NA 4ZDIA 1JKFA 5IHPA 1XZDA 3OM0A 1ONSA 2GJSA 4ZI3A 4G4SP 3NTLA 3V4SA 2GKGA 5EI5A 1X8KA 4DDWA 2IEAA 4DKXA 2ZSHA 2BMAA 2O3JA 4E21A 1VG1A 1ZKMA 1E5VA 3FNIA 4K2HA 1M6NA 3HCAA 4BNTA 3PQ8A 1R5LA 2EKBA 2YNMC 4W7IA 1ZC3A 4PIPA 1EFUA 4LOJA 4M46A 1G63A 3W9SA 2QY9A 2D5IA 2ZJ7A 1H9BA 4PRLA 3RIEA 1ST3A 2D2FA 1E63A 2V96A 1EM8A 1UBGA 2LBCA 5K2MA 2YMMA 2DAEA 3NKFA 2KEBA 2PZFA 1ZK4A 4TTQA 2ASVA 4YV0A 4D44A 4K7JA 3RRMA 2FXIA 2ZRJA 3BWXA 2Z09A 3D3KA 2OORA 5HIAA 4XUGB 1UM9B 4F9EA 5BUCA 3GRFA 1IMJA 1DRWA 3DP7A 4BO6A 3IX7A 1Q3CA 4PCZA 2ZSBA 1ODIA 1NW4A 1CS0B 4BIMA 2ZBFA 1DIAA 4OBBA 1T5SA 2QD4A 2GARA 1UDWA 1K6EA 2X22A 1O0SA 3D4BA 2O0MA 5KYUA 3ZXYA 3AVVA 4X62M 3IDZA 5KO2A 4PHCA 4OK6A 4R2HA 4AECA 1PGJA 4F2DA 3DBRB 4RA9B 3T5MA 2FWAA 3CX6A 2TMDA 4BQPA 1S8NA 2YICA 2IUEA 4XGRA 1Q21A 1AHHA 1IU9A 1NFFA 3K15A 3NC4A 4TZKA 1NFQA 4BQRA 2UVQA 2ORVA 2VHQA 3LTEA 4HN4B 3NHFA 4JH0A 5F3DA 3UQZA 4Q00A 4MW2A 3N2KB 4OQDA 4J0GA 5BN4B 4P5DA 3KKLA 4UE6A 3RV4A 5G0UA 4RTMA 3CH6A 4PXSA 1ADFA 1DEKA 4C4PA 4KFTA 3SYRA 3M70A 4B3SB 4NECA 4DIBA 4RQAA 4YEDA 1AZSC 2HPAA 1JT2A 2IIQA 5KYXB 1GVNB 1VLHA 1XU7A 4MWCA 1NW9B 1XZ8A 4B9EA 4L0MA 1RE1A 1RRFA 3PC3A 1WCXA 5F1YA 3FWHA 3P9KA 4QGFA 2P5SA 3K16A 5KVQA 5F5NA 2F8LA 2YJ5A 5GOZA 3KS9A 1KJZA 1KVRA 2GKSA 2BM8A 2VUUA 4M9ZA 2EX0A 3N7TA 1W5BA 2WWIA 3T3HA 2H7YA 3URKA 1V5FA 4DUPA 2ZBKB 2WIKA 5I7RA 3GRRA 2FWMX 1JMYA 4C2UA 2VZEA 1GJRA 3GEDA 4JR0A 2PZAA 2P6RA 4FB4A 1TTHA 3JVEA 4BRZA 3THSA 4US0R 3REQB 5DH9A 1NM5C 4WOKA 3EARA 2YFHA 3F2IA 2AQKA 1E2KA 4DARA 3HJGA 2ZTHA 3THYB 1DL5A 5CNJA 3OWHA 4LF4B 5FXMA 2DC1A 1U1FA 4PGMA 1ZM2A 9GPBA 1RMTA 3RJ5A 4JD5A 4YMVA 4RL4A 4DDUA 1MO5A 2VO1A 3TWLA 4CYMA 4Y0AA 1P7ZA 5F98A 2M2IA 3JQ9A 4FFLA 5BSGA 3QJ5A 2ZVJA 3KL4A 4J49A 3PJEA 3RS7A 1U7WA 1ZIYA 2GXSA 2B34A 1IEVA 2R84A 3ZHRA 2OT3B 4N3BA