4LZZA

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
molecule keywords Transcriptional regulator (NtrC family)
total genus 57
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lzzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lzzA01
1G5PA 1NN5A 1P4SA 1U99A 4N1AA 5KDLA 3ZVLA 2WIBA 4K81B 3BFVA 4YDHB 2HEIA 1G21E 3B8HA 1EFRA 4OHXA 4Q1DA 5EQTA 5E7IA 4YMWA 4KVAA 1W4RA 4TTRA 4LPSA 5JHGB 4HLDA 2AKAB 3EZ7A 4PC1A 5CJPA 1EESA 4Q00A 2C2HA 4E03A 2DY1A 1TQ4A 2J0VA 3BORA 4EPRA 2OCYC 2LKCA 2QAGA 1IJEA 1S1MA 4G3XA 3S1AB 4V0LA 3NTUA 3Q85A 4OYHA 4JLDA 2W6JD 3TLXA 1CU1A 2DR3A 4P4TA 5CB6A 1XRJA 4Q9JA 1WBBA 4V0ME 4NCNA 4BRUA 1Q1QA 1P5ZB 3TVTA 2RKOA 4BFWA 4DB2A 4EPXA 1D2EA 3GCGA 4LJ8A 5E4FA 1EG7A 4HZUB 1R10A 2GTPA 4D6PA 1DS6A 4Z1MA 1W47A 4HSEA 2VSOA 3AVQA 4JLMA 1KI9A 1RJ9B 2BKUA 1DG3A 4GOJA 2HF9A 2ZI9A 4UNSA 3R8FA 1Q3TA 1OH6A 4TZ0A 3HYTA 4OQLA 3T35A 2FSHA 3ZZ0A 4X8OA 1CR0A 2ZR7A 3NDBB 3G0HA 4JLPA 3MMPA 2JJ2A 3MWYW 1AKYA 4KFUA 2HCBA 5JECA 1NLZA 3KXIA 2QORA 1XWIA 3K70B 1MR3F 1F2TB 1OPXA 3EWAA 3VX3A 5JEEA 4I4LA 1N5IA 3FTQA 2WWXA 3RHFA 2O8FB 1OF1A 1QHYA 3DDCA 4WXPA 1MKYA 4DUGD 4F4JA 3RC8A 1ZU5A 1VG0B 2NGRA 4DLTA 5EJEA 1GRNA 3PCRB 3AGQA 3RS5A 4IXNA 4LYJA 4QXAA 5KSPA 5SZHB 2EW1A 2MMGA 4A92A 1W2HA 2EFHB 5C1BA 1OW3B 2FGJA 3NKVA 4Q1EA 3E1SA 3KL4A 3PQCA 5AUOB 1EWRA 4YLGA 4Z1MD 1J8YF 2GDJA 4I99A 4OQNA 4MGYR 1CRPA 3KKMA 5FPTA 2C9CA 1ETUA 4BGDA 5L3VA 5HKKD 1L4UA 2Q9BA 3NHBA 4XWAA 4CEJA 1KZ7B 3ONWA 4FMDB 5FR2A 1W36B 1CULC 3K8YA 3SJZA 2GF9A 3U60B 1VG8A 3U2QA 3I72A 1E96A 4GSYA 1YZUA 2WOJA 3AKCA 4IEIA 2MSEB 4P4UA 1UF9A 2BJWA 1ZVQA 4LHYA 5FI1B 3VKGA 1TU3A 1W44A 3AVTA 1QVRA 1YZTA 3UK6A 1U9IC 2HYIC 4HLCA 3IPYA 2A9KA 1RIFA 3T5GA 1SVLA 3CZPA 4HAZA 3U3MA 4CEHA 4B6FA 4IDPA 3TIFA 3RS7A 3LA6A 4BLPA 3FMIA 4TTQA 2IYTA 1RRFA 1XXHA 1LTQA 1Z0FA 1E2KA 4TT3A 1R2QA 4C9BA 3FKSD 4DT1A 1WCV1 1R0WA 4TWZA 1G18A 1XEXB 1KAOA 1V5WA 3RWMB 4MDFA 3ASZA 3PEYA 1PLKA 2OXCA 2R6GA 3CH4B 1OH5A 4Q21A 4G5GA 3GLIB 1MO6A 3KJGA 4TT3D 5J47A 4TYQA 2BCGY 3DVLA 3C8UA 2H57A 4MKGA 1SKYE 4I81A 4PC7A 4Q7KA 1AK2A 1CP2A 4JLOA 1UEJA 2C04A 1E79D 1IM2A 3VLFB 1RKBA 1U81A 3PEVA 4URYR 4XVQA 1H8HA 2AK3A 4YC7A 3CR8A 1DPFA 2B7CA 1J8MF 2JLYA 3K70D 5JCPA 1NN0A 1TF2A 2CDNA 3A4MA 3FB4A 3U4QB 3A4NA 3GLIA 1DO0A 1NVVR 1OFUX 2B6HA 2L0XA 2GJKA 2OBLA 3CKLA 3DKVA 3L82B 4JS0A 4KV9A 1COWA 4L5BA 4ZCIA 2F9LA 5FUVA 3GLFA 1GKYA 5J5CA 4LJAA 1P72A 3N2EA 5JBQA 3IO5A 2OHFA 3PR1A 4QNRA 3QXSA 1GL6A 4G1UC 3ZYCA 4KCGA 4KLZA 1ZC3A 3L0OA 1U0LA 3LX5A 1IXRC 2QTHA 4LGMA 3WMGA 2XEXA 3VR3A 4D0NA 2IS6A 1KO5A 3PUVA 2VSXA 4KU4A 2W2TA 3M1IA 2FA9A 3BH0A 2ORVA 2IYYA 1F60A 2QE7A 2ZE6A 4QM7A 2QTFA 4Q1CA 1AS0A 1BKDR 2PZFA 2RB4A 3D6TB 3MJHA 4DBLC 4Q9KA 121PA 5JHHB 2NO1A 4Q4HA 3RRYA 1XX6A 3BERA 3U7EB 2DHRA 1CXZA 1DAKA 2ZETA 2ZYTX 4HDQB 1OFTA 3OE7D 4E5UA 4Q9LA 1KMHA 2ZI4A 2IXGA 4ON9A 1VMAA 2GXSA 4DWJA 1NNEA 3KJHA 3T1QA 2D7CA 3B1ZA 2R6CA 4R9UC 2QQEA 2BMFA 4PSVA 2H17A 2PX0A 4B3XA 4NYIR 5GADl 5L3RA 2A30A 2ZR0A 2OAP1 3SHFA 2J59A 4O3MA 1VECA 2QRNA 4U5XA 1GL7A 4RFVA 3U6BA 2OLJA 2ZROA 4PPNA 2ZRHA 4EQ6B 3P4XA 5EE1A 4BLSA 3IPXA 2PZEA 5H70A 3LXXA 1HUQA 1KHTA 1KI7A 5E95A 2C99A 4AYXA 2ZRJA 4NCKA 3MJRA 1KK1A 2UKDA 1R8SA 5C4MA 3WP1B 2FN4A 2KSQA 1YRAA 4A3VB 1S2MA 2O0KA 4JT4A 2ODBA 5EXPA 4DT1B 1KMHB 3LH5A 4ZDIA 1RRPA 2JJ1D 2JASA 3EWSA 3SFZA 4BUJA 5LB2A 1UDXA 1E2PA 2QMHA 2DPXA 3QF7A 4QNMA 4RD1A 1N6KA 1GILA 3KUCA 3LV8A 1ZIOA 4RD4A 2ZYUX 4OHWA 4LDJA 3WXMA 4JYBA 3K9GA 1O87A 6Q21A 4Q1FA 1S96A 4BFVA 3CNLA 2CCGA 5FPSA 3NC0C 2CHQA 3DZ8A 1P60A 4RFSA 1YZQA 1N6IA 1KNXA 2J87A 1AKEA 2HLDA 3AM1A 1OHHA 5IT5A 4IXMA 4BFXA 3GLFE 3X1DA 1Z8FA 4G01B 1DARA 3I5YA 3PVSA 2WKQA 3GLFB 1P7CA 4LC1A 2ECKA 2ZXUA 3VMFA 2W0SA 3WMEA 4B44A 2A5GA 5FBVB 1U8AA 3Q8XB 4JLAA 3AP2A 3AUYA 1KI1A 3VAAA 4L16A 3MRSA 3T1TA 1X3SA 1BS1A 1WXQA 5DLQC 3OEHA 5P21A 1NVXQ 1WDTA 1U8ZA 4URUR 2ORWA 2FFBA 4OQMA 2KBEA 1GDDA 2F1IA 5KYKA 1C1YA 2IYLD 2G1JA 1EGAA 1Q22A 2ZRMA 2R44A 4YMUA 5IDVA 2JJ1A 4X8LA 1N6NA 2A5DA 3B6EA 3RS3A 1OH7A 2ZE8A 2IYXA 2IYVA 2YWGA 2FF7A 5AJWA 2JLXA 1IXZA 3Q3JB 3B85A 4IOKA 2A5JA 1ZMXA 5UKDA 1U9IA 2QMUA 1OYWA 3DZDA 2O0JA 2K5UA 4FWDA 2DWQA 2FFQA 2ZU6A 5DIFA 1E99A 2WWGA 1UADA 4J0QA 3Q7QA 3L0SA 3ZQJA 2VF8A 2F1HA 1NN3A 4XTRA 3MUFA 2H5EA 1VYTA 1W0KA 1Q3HA 3R7WB 2ONJA 4B2PA 3UG7A 1Z6GA 2CK3D 3G82C 2QROA 1MABA 3QNUA 2R6FA 3HPQA 1OT3A 4M22A 5EUMA 2J41A 3TBKA 1G8YA 1N5JA 5DE3A 2C95A 2OM2A 2NTYC 1IOZA 4Q19A 1IJFA 4DCSA 2WHXA 1Y63A 3BXZA 3CR7A 1VIAA 2XZLA 2XGJA 3MWJA 1II0A 1OIWA 3NG1A 3KX2A 4JZKA 5D3MA 3ICEA 3UANA 4CW7A 4OHYA 4ZDWA 4M1MA 4IEEA 4M1WA 4UNRA 5F9HA 4WZBE 5FPHA 4JL5A 3EARA 5DO9A 1SGWA 1IN6A 5KNBA 3M4YA 1LS1A 2KJQA 4RJLA 3GLIE 2ZIAA 2D4HA 1G64A 4BRWA 2ZSDA 4C0QC 2W6JA 3VX4A 5B58C 4GITA 1Q1BA 1RRGA 4QHSA 3B7GA 5GJBA 2C9OA 1OE0A 4AURA 2ZRDA 2B8WA 3PEWA 3M6AA 3AVXA 4B3CA 5EE3A 1M74A 4DEYA 2O8CB 3AF2A 1X8KA 1Z47A 1JXMA 1NF3A 3DMNA 3I73A 1L7VC 1RJ9A 1ZNXA 4DZZA 5JFGA 5M04A 2CXXA 4MGZR 3VNUA 1S8FA 1TUEA 2YOGA 2R65A 4IDOA 1KNQA 4OK3A 4XVRA 3SYKA 3K0AA 5H68A 2QRZA 4WVFA 3WY9A 4I1OA 4WBSA 3SE0A 2BVNA 4TMVA 3U7GA 3LAWA 1IY1A 1F3OA 1Q44A 1JB1A 1NLYA 1ZW6A 3K09C 2NOAA 4YONB 4NZYA 1XPRA 3CX8A 1AQYA 1DTSA 1Z6XA 2GA8A 3THYB 3S1AA 2BMEA 1GOTA 2IYQA 4O2RA 2QPAA 3FHOA 4DHEA 4NL4H 3SU8A 2ZRAA 1E9AA 4HAUA 3WYFA 3CRQA 5IRCD 4AKEA 5TB5A 3W8NA 2ZVPX 4JJZA 3FFBA 2N42A 5DYIA 2PLFA 2GWHA 2ZSFA 1DVRA 3IKJA 5HTKA 2GF0A 1CJMA 3KW6A 5FOUA 3DM5A 1SXJC 3QG5A 4DVGA 3LFUA 5SZJA 4Q5IA 2PMDA 3HR8A 3ZDQA 1T5IA 5HKKA 1F48A 2RGBA 2VSFA 1E4YA 1DAIA 1OHHD 1BO6A 1JJVA 1WMSA 1OB2A 2FE4A 4EFLA 2WWWA 5KO2A 1G6OA 2IUSA 2KI5A 3HP1A 4GBMA 4A9AA 4RCYA 1U2RA 4URVR 2ANBA 5BN5A 2GK7A 1NSFA 1UM8A 4L9WA 3QKTA 4QGHA 1CR1A 3LBNA 4QJ4A 1GG2A 1PJRA 1SHKA 2ERXA 5E3HA 4URXR 5LDDC 4RCZA 1E1QD 3CB4A 1MRSA 3ETLA 4DCUA 2G3YA 2CCJA 3THWB 1E2JA 4F4IA 1BOFA 4Q02A 4M21A 1NRJB 821PA 1Z63A 4Y0AA 5TXGA 4FWTA 4Z8XA 1KJYA 4U02A 5EUQB 3B9PA 3BE4A 4G5RA 4JLBA 2WJIA 3LY5A 3REGA 2CNWA 1OIXA 1AZTA 1KSHA 5E7JA 1GIAA 2ORIA 1SXJD 2DFTA 5EP1A 1NVMA 2ZI6A 4PR0A 2QT0A 5G40A 2V9PA 3HU1A 2VP4A 4HI0E 2OE2A 3CWZA 1TTTA 1L4YA 4Q1AA 1I4TD 1N5LA 4ZI3A 2BWJA 1US8A 4II7A 4ZIRA 4MUAA 2FSFA 4KYUA 4LV8B 3EIHA 4LSGA 4B75A 2ZTSA 3OE7A 1J99A 5AR1A 5AWFC 4CYMA 1S4QA 1XCPA 4HB2A 5FI0B 2V55B 2IUUA 1CJUC 1W0KD 4LJ9A 4NCHA 5CIQA 5CB8A 2H16A 3AVOA 1G16A 2BIFA 1NN1A 1J90A 2CJWA 1A4RA 4JVLA 3T61A 4QGGA 2ATXA 4GNKA 2QE7D 2WKRA 1OB5A 2ZI5A 1PUIA 3OHMA 4JBXA 4FMCF 3WNCA 2LCFA 4D4MA 1LFDB 1NVUQ 1E9RA 4BEJA 1W48A 3NVAA 2O8BB 2ZS9A 4QC2A 5DSZA 1NY5A 4B48A 2RGEA 1S1CA 2HXSA 1T0HB 2W6ID 3GEIA 4MYUA 5EE0A 2YHSA 2B8TA 2W83A 4TQUS 2PCJA 2AR7A 1WBDA 2VP9A 2G6BA 4FWIB 3C15C 5DI3A 1KI8A 4HAWA 1R6BX 2W2XA 1I4DD 4JVSB 5KPDA 4PPFA 4D81A 1I4LD 2VYFA 1IN4A 3EZFA 4NONA 2VP5A 2F3TA 1AJEA 2NZ8A 1CIPA 1I2DA 2BV3A 2EFDB 1E4VA 2J7PD 4TYYA 2AL7A 1PVOA 2AWNA 1OFHA 3NEYA 1Z0AA 1E79A 5CDFA 1JPJA 3REFA 4F91B 2WOOA 3BJIC 4MH0R 4H1UA 1JJ7A 4NYJR 5LBIA 3TUZC 1NI3A 3I4LA 3OIVA 4B34A 2QSZA 1JAIA 1P62B 3C16C 2HT6A 4HLUC 1P3JA 4WW0A 1BIFA 1MRNA 3JZMA 3W3AA 1AGPA 5J40A 4GMDA 4EDHA 5CLLA 3RWOA 4HB0A 1FMLA 4W5HA 4LHXA 4NPHA 4FI3C 2CBZA 5L3SA 3FKSA 2V7QA 3SQXA 4DIDA 4C0KA 1E1QA 2PBRA 2O8BA 3VHLB 2GILA 1AN0A 4GI7A 2H18A 2NO9A 4LYAA 1F5NA 3U5ZB 3EXAA 1D6JA 4CEIA 2Z0MA 3P32A 4M1TA 1GAJA 2ODEA 2QP4A 3L43A 5F9FA 5KDOA 1FZQA 2RCNA 4P33A 3O47A 4IRUB 4F92B 1UKYA 2OZEA 1P73A 4IVPA 4X8HA 5JSZB 4ZPXA 1WQ1R 3W5JA 4RZ2A 4HLUA 1CR2A 4PO8A 4B3DA 3VHXA 5JRJA 3H84A 3OZXA 4LV6A 3SR0A 1T8UA 1JNYA 3TQFA 1JR3A 1YKSA 3DO6A 1XZQA 4AG5A 2AFIE 3P4YA 3W9YA 4EJSB 4KVGA 4Z51A 2ZJBA 3JZAA 1ZM7A 1QHXA 4DLVA 5KNCA 4C0HA 3GLGA 4A8JB 2ZSBA 3NWJA 5DNYB 4ZCLA 1KO7A 3T5DA 5BQ5A 2CHVA 2ZRGA 1DOAA 1UBGA 4JLVA 1OYYA 5DHAA 4XSHA 3TRFA 3ADKA 1ZAKA 1Z2CA 3WBKA 2CVHA 2JA1A 4JL8A 3H2YA 2XAUA 1XXHE 2EWVA 4FWHA 3KXKA 4BZXA 4FMDF 3QXJA 2ZEJA 3GFTA 1GNPA 2JDID 3NH9A 2GK6A 1QBKC 2Z83A 5KSZA 3B13B 4M9SA 4RZXA 1ZM2A 3RANA 5FTNA 1NIPA 2JLUA 4U7DA 1FMJA 2B92A 3CNOA 1P61B 4MYCA 4NDZA 3QENA 2X2EA 2AKYA 2J0UA 4Q47A 3PG5A 3T06B 2XTZA 3WHKA 2F1RA 5EP4A 3A4LA 4MDEA 4DDUA 1U98A 4FCTA 2ZM5A 1BYUA 1LW7A 2JJ2D 5FL7A 3UATA 2GJSA 1E2EA 2HXYA 2JLSA 1Z07A 4LBWA 4CZ2A 1DAGA 4NYMQ 4C4PA 3TK1A 4NBSA 1GRQA 5B2ZA 4GPTA 2NPFA 4DB4A 2F43A 1A5TA 3TJZA 2G0TA 3SDZA 1QHHB 1M7BA 3UKDA 4EPTA 4I1VA 3V4RA 4KSCA 3LW8A 2YWHA 2OBNA 2C96A 2NPIA 3BRWD 1R0YA 2ZYVX 4E22A 1N6RA 3Q9LA 2WTUA 2DBYA 4Q1BA 4FIDA 1XJ0A 2AFHE 3CRW1 4HUQB 2Q21A 4G5QA 1ZM4A 1Z5ZA 4M8NE 2OCAA 2GCOA 2CL0X 1KK0A 4AYTA 1KDRA 2JAQA 2ZYWX 4DCVA 1M2OB 2IC5A 4GOXA 1QVAA 2XSZD 5KU1A 1U0HC 5K8TA 3A58B 3LLUA 3CO5A 5EXXA 3GP8A 3KTAB 4I1UA 3ZLJA 1KIMA 2IHBA 1PLJA 1WA5A 4MRSA 1ZNWA 5CYOA 1E2HA 3CH5A 1W5TA 4IHQA 1NG1A 3W8RA 1YRBA 4DSOA 2FMXA 4QJ3A 2BOVA 3PXGA 2ERYA 2NIPA 2XZPA 2ODNA 5AUQA 2W2VA 4LJYA 4PHGA 2XX3A 1SXJB 5AJYA 3RS0A 5KTYA 2J3EA 2FWRA 1J7KA 4MKIA 1ODFA 1G7TA 3PIRA 2R6AA 3FYHA 1KK2A 1E0JA 4HDOB 1IBRA 1X8LA 4ABYA 1FOEB 1NIJA 3VR6A 1JAHA 3MWKA 4EQ6A 4AY2A 4XIGS 1R5OA 3A1WA 4RZUA 4GL2A 2H7VA 2QP9X 3UMSA 4UNNA 5HPYB 1LF5A 1T3HA 1YVDA 1NMYA 3IEVA 4UXHA 2DVWB 4Q9IA 2W0MA 3OIUA 2RHMA 3W3ZB 2YV5A 3CPHA 1KKMA 3CNNA 5IK2D 3LVRE 2PCLA 1W49A 1ESMA 2Q3MA 5K8UA 1WP9A 1XMVA 2FJUA 2C03A 4XH9B 2PX3A 1NJFA 3R7WA 3LDAA 5GVSA 3KJEA 4V0KA 1E2FA 3DMDA 4JKYA 3TUJC 4DLYA 2WWHA 3O8RA 2W00A 2EYQA 2PJRA 1E1RA 4LX0A 2ZUBA 4GRAA 4LBYA 3ND9A 8OHMA 4Q01A 4QBGB 3QPUA 3HDTA 2GBLA 3PV0A 5KNDA 1YZGA 1KI6B 1Z28A 2DFKB 2REOA 2RGAA 4WXRA 3HPRA 3WMFA 4C2TA 1DE0A 3EPLA 2I1VB 1UAAA 3KFXA 2IYWA 1KJZA 4A82A 2GVDC 2IA5A 1W7AA 2HF8A 2ZS7A 1XMIA 2GVZC 3EA0A 1FP6A 4BPBA 5CIWA 3ECCA 3CLVA 3NIBA 4JLKA 2QA5A 1E0KA 1FPMA 5A4JA 3HU3A 4XSGA 1KI6A 1EX6A 2Z5FA 1I2MA 2WZQA 1A2KC 3NXSA 3SJAA 2F1JA 2VP2A 3EC2A 1QG2A 3CBQA 4A2QA 4L15A 2OUKA 4UKDA 1ZD8A 1N5KA 3THXB 2DWZB 3F0TA 2QY9A 2JIZD 1G291 1G4UR 1HH4A 5G3YA 2QL6A 2WJVA 2FPKA 3ADBA 2VF7A 1GUAA 4M1SA 1RC8A 1XTIA 3CF2A 5G3ZA 1KDOA 4RD6A 2HJVA 4JL6A 1XEXA 1W4AA 2DCUA 5AJZA 4EKDA 5JCZA 1ONBA 1FTSA 2EWWA 4TYNA 2QG6A 4KYIB 3SOPA 1KSJA 2C9YA 1QHGA 4LV5B 4R2IA 1Q1ZA 4Z8YA 1D2MA 4A0RA 1OXSC 4DLRA 1HA3A 4DLSA 2N1BA 1DO2A 4NKRA 3RSLA 2CLSA 1N6LA 2Z4SA 2QT1A 4IOJA 5EZ5A 2JATA 2VRWA 3GJ5A 1YR8A 1RVDA 3GLHE 1T4GA 2REBA 2GKSA 2XZOA 4B32A 3FPAA 2CHGA 3CRMA 1E9SA 1SVWA 1W1WA 4NCJA 3RRMA 4B6EA 1MO4A 2BBOA 5HCNA 2VHJA 3BB3A 1F2UA 4DCTA 2GAAA 2WWIA 4IOLA 4CT4B 2JLVA 3T34A 1X86B 5TDHA 2GZDA 2F3RA 1KO8A 3IUYA 1SQ5A 4DEXA 4OQXA 2GJ9A 2PZGA 3TAUA 4D80A 5HZHA 1XEWY 3UG6A 3C41J 4LHWA 4W9MC 4IKEA 1TEXA 1AGRA 4TLBA 4HUTA 2YWFA 5JS7A 4FINA 2CVFA 3RSOA 5EE9A 3B82A 2DZOB 2IYRA 1ZM9A 1A2BA 1MT0A 3RC3A 3SJBA 2CL7X 1YZKA 1OXVA 2XTMA 2OG2A 3LQRA 3SI7A 4R71A 3A1UA 3I5XA 1P75A 5JMTA 4PO1A 2QM8A 2O0HA 1OSNA 1IY2A 3IILA 2FEMA 2OFXA 4EPWA 4G0NA 1CF4A 1Z06A 3QKSA 4PHTA 1PV4A 1G3RA 3X1YA 1A7JA 2V3CC 2BM1A 3FMFA 4BECA 1J70A 2XSZA 3BH7A 4JBWA 1SKYB 5FBRB 2JLZA 2QAGB 3W34A 4KFRA 1C1KA 2ZAMA 2VH5R 3R20A 4ZDKA 1AM4D 1JEDA 4M0LA 2PT7A 3QPWA 1E0SA 2A2ZA 4HLQB 4M4SA 3Q5DA 5E7MA 5G53C 2IS1A 2OLKA 1R5BA 4P0TA 2WPDD 3TNFA 1FQKA 3VTKA 3DPUA 2XXAA 2BCJQ 1RYHA 3AVYA 3SS8A 5TMPA 3E5HA 3TW4A 1GM5A 3EW9A 3B9QA 3FKQA 4QRHA 2RGCA 3TR5A 2FH5B 4BEBA 1XTRA 3RABA 5BXQC 5KSOA 2XNSA 3DEFA 2XNDD 4HATA 2ZANA 3C4JA 4FWGA 3QXCA 4N0EA 1SVKA 5C2JB 4B73A 2D74A 1QHIA 1XMSA 4IVQA 3U4QA 2IXFA 2V1UA 2J0UB 3CIOA 2FPMA 3BWDD 4CEJB 4HAVA 2JGNA 2VHCA 4V03A 3WRYC 4DKXA 2Y8EA 4KFTA 2AHOA 2QENA 2WICA 4TLEA 2AD1A 4LJ7A 5DYGA 4OQFA 4DUGA 1N6OA 1UBFA 3B2EA 1DG1G 2CL6X 2VP6A 4PPGA 5GVRA 1BH2A 3KTAA 2GBLC 1RE0A 1UJ2A 1YZLA 1W46A 2JDIA 2BM0A 3ASYA 4KFSA 2OV2A 4BZQA 1DADA 2A3RA 2EU8A 2RGGA 421PA 4BE7B 4A6XA 4BFYA 1TQ6A 4GOKA 4RD3A 2IYSA 2XOKD 1E2QA 1XTKA 1JR6A 1HT2E 1W4CA 3BFXA 4PQRA 4FD2A 1HQCA 2OILA 5KUTA 1RRCA 1BMFA 4EFNA 2IT1A 1PZNA 1IHUA 1IXSB 4MRNA 3WYGA 3I92A 2JIZA 3D7MA 2O8EB 2NO7A 4DIEA 4DLXA 2BKEA 1ZUNB 3T15A 2HYDA 4BZPA 2ZUDA 3HJNA 3NBFA 3V00A 2PT5A 2MMCA 1VYUA 2QPOA 1ZRHA 1E9EA 1D9XA 1GFIA 1KMQA 4P32A 4IW3B 4AKIA 4LYHA 2WAXA 3RRNA 2XNDA 3QKRA 3V9PA 3K0SA 1G8HA 1DAMA 3VR1A 1U90A 5K8LA 4CF7A 3EX7C 2WJGA 1EFUA 4JLNA 1RYFA 1LVGA 5J4KA 3RVBA 1M1YE 1XBTA 2QBYA 3EZ6A 4AIIA 2VEDA 2VHUA 4JN6A 4ESHA 1GVNB 1R7RA 2H1LA 3CONA 2WSSA 1ZIPA 2IS2A 2P2LA 4S2EA 2QN6A 2NMVA 4W7SA 4L4UA 2O8FA 1G9XA 2HLDD 4P4SB 4Q4JB 4C0SA 1TX4B 4MYHA 4LOAA 2YC4C 1G4AE 1G1MA 2V7QD 1S9HA 3BD9A 3UWKA 2YZ2A 2ZSEA 2A7QA 2V8OA 5BYJA 3IBGA 1Z3IX 3NC1C 4AG6A 3RS4A 1DBSA 4A15A 1GL9B 1VCNA 2IW3A 2UZ3A 3KKQA 1SVSA 4EFMA 1T5LA 4ACAA 2RH5A 2O8DB 2QZ4A 3HR7A 5J4HA 1GSIA 2GHIA 2SHKA 3R9IA 2YOFA 5H1YA 4A0GA 1AS2A 1V43A 1OXTA 3K09A 4TMTA 1TMKA 2P65A 4M2LA 3WHLA 3X2SA 2QSYA 4C0BA 1Q21A 3ADCA 4HAXA 2BDTA 2CCKA 4YXWA 4TYWA 1Z2AA 4PAQA 1Q57A 3QF4B 3C5HA 1QF9A 4C7OB 4PC3A 3OAAA 2GEDA 1FUKA 1JI0A 2FOLA 5LD2C 2GZAA 4B74A 3UMFA 2R62A 4IDHA 2FSIA 2GXUA 2VP0A 721PA 2MSCB 4GFDA 4HB3A 4S35A 2FZ4A 1S3GA 3CM0A 2IX3A 3PENA 3BFKA 3CX7A 5FUWA 3TR0A 4NH0A 1QRAA 2AXPA 3P20A 4EIWA 4WIAA 3ZQ6A 2IYUA 2G88A 1X6VA 3KJIA 4I1SA 1N0WA 2A78A 2AN9A 1QZXA 3SBDA 1Z6YA 5FOXA 4TTPA 4CRWB 3BC1A 1XD9A 4IVRA 5IHPA 4D0LB 1R4AA 3KB1A 3AVWA 4DLWA 2NG1A 3O8BA 4BASA 3CW2A 4BWYA 1ZBDA 2IYZA 3AGPA 4OL0A 1Q12A 3QVVA 5CLQA 4G5SA 3IIKA 1LNZA 2FNAA 4R98A 4ARZA 1MH1A 3TGPA 1L2TA 1LY1A 3DL0A 2HT1A 1Z0IA 1D8TA 2ZRNA 3Q7PA 1VCOA 4GP6A 4Q48A 5FBLB 3KQKA 2IF0A 221PA 3AH8A 4W5JA 2C98A 2IS4A 2KB0A 2XJ9A 1VHLA 4FCWA 3RNLA 4OJKA 2FDCA 1CEEA 1FNMA 2J1LA 3SJCA 5GJVC 4ERNA 2O52A 3LO5A 1OKKA 1M8PA 1PLLA 4GZMA 2YC2C 1BMFD 2DYKA 2J7KA 4QBIA 5EE5B 2XITA 2Z6VA 3GJ4A 4Q4JA 3K9HA 2X1VA 1E1RD 2D2FA 4P4SA 4A0FA 1XMJA 1YZNA 1CKEA 4LK2A 5FOVA 3A8TA 4MRPA 2VA8A 3TSWA 1KK3A 3K0AB 4FN5A 3M0EA 4AKHA 4QL3A 4JKIA 4HYYA 3WRXC 1E69A 1U8YA 4POAA 5TARA 4F7WA 2RGNA 3I8SA 4RKEA 3B1YA 3A37A 1SVOA 3UXMA 1XF9A 5AK0A 4D4LA 1XTSA 2GRJA 3NEJA 2VBCA 2P3SA 1GKIA 3CRRA 4D82A 2JCSA 4LHZA 5AJVB 3QKRB 1G7RA 2R6DA 1FFHA 3T1VA 1E2LA 5TV2A 4LUCA 1XEFA 2I4IA 2R9VA 4WAUA 4OK5A 1NSTA 5FTKA 1UPTA 3LD9A 4ZKDA 5FOWA 4JLJA 3NBXX 1QHHA 5KOYA 4UXIA 4DC9A 2N46A 3BBPA 4YXWD 1E9FA 2BEJA 2J45A 3H0KA 4OI0A 3GD7A 4QGFA 2D7DA 1RPZA 4QM6A 3ZH9B 2J9RA 5HE9A 1Z0JA 3RAPR 3THYA 1CJVC 3ZIAD 2JLRA 3PUZA 3BAFA 1H8HD 3PUXA 4OBEA 2ZSAA 3KUDA 3VKHA 2GZHA 1E32A 1G8FA 1OLOA 2ZU0C 3I62A 3P1JA 521PA 2ZRFA 1FQJA 1XJCA 3AKDA 4B2LA 3KB2A 4RSGA 3KKNA 1KO1A 5FBQB 4NYJQ 3HYRA 5CJ2A 3B1XA 2ZJZA 4UNPA 4EUNA 4B47A 2EVWX 1KOFA 3O8DA 1E2IA 3EG5A 2OT3B 2VHQA 3TE6A 1Z0DA 1ZNYA 4F38A 2P5TB 4PSKA 1ZU4A 3QF4A 4NHOA 2ASEA 2WWFA 2QEQA 3GEHA 2Z4RA 2KWIA 2P6UA 2BBSA 1NMXA 2NZJA 1OFIA 1JQLB 1NLFA 1Z83A 3MHVC 3I32A 1UDWA 3Q5EA 3AUXA 2ZJ5A 1GKUB 2WMOB 3A36A 3TSZA 1Q1EA 2FSGA 2ZREA 1WE2A 1KY2A 4NYMR 1TNDA 4EJSA 2GCNA 4M1OA 1P2TA 3ZZTA 1MO3A 3D8BA 2OFOA 3KKOA 4GDFA 2KBFA 3C5CA 4L8GA 4NCIA 4RD2A 4EPVA 1YJ5A 3KXLA 2DFLA 3UIEA 2XXAB 1TPZA 1N6HA 2XJ4A 5CM8B 4Q9HA 2ZRKA 4D4KA 5JZVA 3LX8A 1AQUA 2ZRPA 3AF3A 4ILEA 1DELA 3TQCA 4JVMA 3QI2A 5DH9A 1JALA 1JEEA 2H92A 3FDIA 2OCPA 5F98A 4V02A 5B64A 2WSMA 1MABB 2YNMA 2C77A 4MA4A 3FVQA 3IIMA 1II8B 1Y3AA 3H4MA 5TY0A 2ZS8A 3QKSB 1FP7A 2D62A 4JYCA 4PXAA 4BFTA 5AUNB 3AKYA 3VU9B 4PSAA 1ELOA 4LC0A 2GAOA 5DHFA 4YMTA 4LCBA 4TMKA 2ZVQX 3OEEA 2ZRBA 4HDCA 4L9SA 3LVQE 3PUYA 1OV4A 4PO9A 3TVDA 3TH5A 4QGAA 2FGKA 2WJJA 2ONKA 1KZGB 4UJ3A 4MGKR 5JJKA 3F5FA 2O8CA 1D5CA 3GJ7A 1E2DA 3B1WA 2ZJYA 3OFND 4RY2A 4CDGA 1JPNA 2AWOA 3GFOA 2FU5C 2I3BA 3TUIC 2J0QA 1G41A 4A1FA 4RD0A 1G7SA 3TAHA 4JSYA 3SZRA 4QJ5A 4C3ZA 1NG9A 4IOMA 5DI3B 3U61B 1RW4A 4PC2A 2Q3HA 4AC9A 3K0FA 1W0JA 5BWMA 2OESA 2QMEA 2PH1A 4R2HA 1TF5A 2ZQ5A 2VL7A 1UEIA 2BBWA 4FMBB 5D3QA 4KJZA 4F4CA 1K6MA 1EK0A 2QBYB 5ANRB 1VDZA 1P9RA 3N5CA 2UVQA 2UZIR 4E09A 3HWSA 1P2UA 1EFHA 1R0ZA 5JI2E 4TMXA 2G0NA 1TQDA 4LHVA 4C30A 1N3BA 1G8GA 1G3UA 3I8XA 1IN8A 5KSYA 3CPEA 4QFMA 3ZS9A 1E2GA 2B21A 1ESNA 1SVMA 1JECA 4TN1A 5G41A 1HTWA 1YE8A 2G9NA 5DISB 3TMKA 4MGIR 4DSTA 4OI2A 4TSFD 1P9NA 3GPLA 3AQ4A 2YKGA 4RZ3A 3NH6A 3UPUA 3LQQA 5J4VA 1XB2A 2PMKA 4FCVA 3LXRA 5JLJA 4V0NA 1KJWA 5B30A 5EXTA 5L3QB 3U44B 4N0DA 4PC6A 5FTJA 1Z6TA 1S9DA 3RRZA 2IK8A 3IIJA 4C0AC 5FOSA 4PANA 4XWKA 3VNVA 1FUUA 2OCBA 3OIWA 1VTKA 4A6PA 5EZ6B 1HEIA 2J46A 1KKLA 2V4ZA 2O5VA 3E70C 2DWOA 3VR2A 1GZSA 1WRBA 5CYPA 2BBTA 3ND8A 3OF5A 2QM7A 3W5IA 4IFBA 2P0EA 2VIIA 3R9XA 3FE2A 4WZ6A 5LB4A 3MD0A 4V0MA 2CMKA 5FOTA 3B1VA 1DAHA 1O3YA 2VHTA 2EFCB 4NU0A 3GJ8A 1GNRA 1T6NA 2J7PA 1G7CA 1SVIA 2R8RA 1IAQA 2O8DA 2P5SA 1D2NA 1GWNA 2XOKA 2QGZA 4CT5A 2HCJB 1T3SA 1RZ3A 2DFNA 2ZUCA 5JS8A 2Q6TA 4DJTA 3QJYA 3OIYA 4RFSB 1S3SA 1N0VC 1ZCAA 2RHDA 4PQFA 2FV8A 2C8VA 2AXNA 4NP6A 1HT1E 4QBFA 1OXXK 4B2IA 2ZJOA 5JWOA 1T91A 4TQAA 3U6KA 4D25A 1UBEA 5FH9A 3U3RA 3LNCA 4M1YA 1GRRA 4GP7A 3ZVNA 1OIVA 1XJQA 1DEKA 2EYUA 4M9XA 4CGZA 3IGFA 2YJTD 4BQSA 1JBKA 1GNQA 5B57C 4TL7A 2V54A 4DLUA 2IEZA 2MSDB 5EXSA 5CM9C 4OHVA 1F6BA 3P26A 3WYAA 3MGCA 3D31A 5IK2A 1SXJA 4NMMA 2HV8A 3R8CA 2CNWD 1X1SA 1YR7A 2IWHA 3CUEF 1NBME 3F3YA 4MRVA 2QAGC 4TZ6A 4DRZA 5DI9A 1CLUA 3W6NA 2G83A 1CR4A 3TW8B 5A5GA 3MG9A 3EZ9A 5DGXA 1G20E 1W5SA 3DM9B 3GEEA 4LWZA 1ZCBA 2E87A 1Z22A 2RGNC 2TMKA 3QEOA 3IHLA 4MKFA 1Q0UA 3Q72A 2GJ8A 1G3IA 4URZR 1N6PA 1TU4A 4Q7MB 2GEUA 1TAGA 5C46F 1JQJC 4ASUD 4QHTA 1NL3A 2VLIA 1XD8A 2FFAA 1OXUA 1XPUA 4A4DA 3BK7A 2A5FA 3PITA 4BFUA 5DN6D 2LWIA 1LV7A 1YHNA 1F2UB 3EIEA 3B60A 4PAMA 1II9A 4PZYA 1P2VA 1TUIA 1KI2A 3H86A 4BLRA 1NVVQ 4YMVA 2ZRLA 1JR3E 1QDEA 3GMTA 3ZJYA 2WSSD 3AF0A 3QPVA 4DSNA 1R8QA 1SZPA 4LBZA 1N2CE 1QG4A 2Q3FA 3SC3A 3GQBA 4DDVA 3FOZA 2CEAA 3KQLA 1SKQA 3EASA 3UWOA 1E0AA 1QHSA 2CE2X 3MLEA 5BN3A 1XPOA 3QOFA 3IO3A 4FMCB 4XD7A 2PJZA 4YQFA 2QMOA 4D0GA 1JR3D 1HQYE 1FL9A 1M6NA 1KDPA 4A2PA 3AJIB 2VTKA 2BMDA 4Q4HB 3ADDA 2PLRA 2IF2A 3JVVA 3I3SR 4X8MA 3J81k 4M9QA 4B76A 4A36A 4PTLA 4LJ6A 2Q9CA 3OEHD 2XB4A 5JI3E 4DXAA 3NHAA 3C14C 2QP3A 2F7SA 1E2MA 2X2FA 4LPKA 3EIQA 3CRVA 4MYTA 3SQWA 1G19A 5KDDA 3B5JA 1CJKC 2F55A 1EWQA 1G5TA 5DN6A 2ZI7A 4ZV4A 5EP3A 3I1FA 2D2EA 4DLZA 4Q4LA 3T1OA 1A82A 4TYPA 1ZM3A 4NE2A 3VFDA 2QNRA 3N2IA 4NYIQ 5J4YA 5KPJA 1Z08A 1MOZA 2WV9A 3AEZA 2ZJ8A 4KITB 1M34E 1XXHB 2RAPA 4UJ5A 3FHCB 2FX3A 3NDPA 2NQ2C 1XZPA 5EP2A 4HEJA 4PPQA 1X1RA 4ASUA 3SEAA 2OO7A 2AX4A 2KRKA 1B0UA 2P67A 3QXHA 1P2SA 1HYQA 1NBMD 4LJ5A 4TMWA 2HJGA 4P3YA 5FL3A 1Q20A 1OJLA 3CWQA 3MFYA 1TADA 2D3WA 2IBMA 4D2IA 5JSZA 1XTQA 3G5UA 2G77B 5SZIA 2X19A 4IDQA 5AJXA 1E9CA 3ICQB 5HE8A 3BB1A 4LRTA 3TKLA 4JBYA 4US0R 2ZPTX 1TQ2A 2GCOB 4QOSA 3SBEA 1KY3A 4PZZA 4R7ZA 2X8AA 1VG1A 3GLGB 1YR9A 4ZDJA 2FEOA 2JJ8A 1H8ED 4D26A 3VR5A 3TSOA 4RKFA 3MAAC 5HZKA 4CIDA 1X8JA 4MRRA 3E2IA 1HURA 1K5DA 2CK3A 5FR1A 1VYVA 4US2R 1ANKA 2J5XA 3FMOB 2I1QA 1M7GA 1E94E 1T9HA 2WJYA 3GFPA 3BH6A 3OESA 4FW9A 3JVUA 3PJRA 1VHTA 3NBZC 3L0PA 3KQNA 4US1R 1C9KA 1XNJA 2IL1A 3I61A 3FHTA 3A1TA 4JJKA 1NVWQ 1DAEA 3KKPA 3GLHB 3QVUA 1R0XA 3D3QA 4IJMA 1HY3A 1VKJA 4Q66C 4ACBA 4PAOA 3RDPA 3A1VA 4OJQA 4ZI2A 1LF0A 2WWYA 2GEVA 4KBGA 1U94A 4AYWA 2J0SA 3SYNA 2BJVA 1FTNA 3THXA 2H8KA 2ZITA 2WJHA 5BN4A 4F93B 4EJSC 3WNBA 1Z0KA 4Q03A 3ZGXA 3VU9A 2KE5A 3K0EA 2WBLC 3R9WA 3AVVA 2V6JA 5FBWB 2V6IA 4GMXA 1PUJA 4LYFA 4WZAE 2GXQA 4K8OA 4HUQA 3H1TA 4ZCMA 1AIPA 2BMJA 3AF4A 4O0MA 3A6PC 1H65A 3U7HB 3AVUA 3QG1A 3O8CA 1NKSA 5CK4A 5TVKA 3U3OA 4XVUA 3AP1A 3THOA 1KI3A 1KO4A 4UNQA 4OKSA 2WKPA 4DCNA 5L3QA 3U44A 3BS4A 2YINC 4FXPA 1C4OA 2ZR9A 4TLCA 1G3MA 2NO0A 2ANCA 2EQBA 1NKTA 3FMPB 4LRWA 4TSFA 4B3GA 1D9ZA 1SULA 4M9ZA 1E9DA 3X1ZA 4Q7JB 2WM9B 4W5WA 5FPKA 5FUYA 1TF7A 1FW6A 4ZKEA 1FX0A 1XDBA 2ZRIA 4PQYA 1XU4A 1Z29A 5HR5A 1OKKD 1P9WA 3B78A 3QBTA 2IUTA 1TL7C 4EPYA 4TQ9A 2Q0HA 4DDWA 2DZNB 3ZZUA 2ZE5A 2ZRCA 4KBFA 1LB1B 5K8IA 1E9BA 4PHFA 1W0JD 2YOHA 4HB4A 2QPTA 2Z43A 5GJCA 1FNNA 3ZS8A 2BEKA 4C7OA 5FFMA 3ZVRA 1KAGA 4P31A 2GESA 5FTMA 3EA5A 4OK6A 4Q18A 4LY6A 3RLFA 5LPNA 3ZD6A 3F8TA 2WVJA 2P6RA 2IWRA 3K0FB 1R5NA 1IY0A 1XTJA 4QHYA 1NBMA 4KI0A 3L0IB 4KSBA 5FL7D 2W6IA 3V4FA 1T3LA 2IEYA 3BIFA 4BLOA 3ZVMA 1W36D 4KHZA 3ZD7A 1M7HA 1W4BA 4BLQA 2QGNA 2YYZA 3EC1A 4KAXA 2FG5A 4TL8A 1ZD9A 4TLAA 2OBMA 1X37A 3EPHA 1KDTA 2V6ZM 3OFNA 3P27A 3WBJA 4DDTA 2RGDA 3AKEA 4CEHB 1H8EA 2VPPA 5JJIA 1GP2A 2QTVB 3L2OB 1EFTA 4GZLA 4NTZA 5FUXA 4A2WA 1P6XA 2REXB 1NY6A 4MQBA 1CS4C 4E07A 5AUPB 3BB4A 1VPLA 1VCMA 2A5YB 3OAAD 5F3WB 3EAQA 1T8TA 2QI9C 4B33A 3THWA 4KXFB 4URWR 1XCMA 2F43B 3OEED 4RVCA 3DOFA 3IDQA 3AB3A 3QEJA 4H1VA 3SFVA 3PFIA 3GJ6A 3LLMA 3LBIA 4H9GA 2XB2A 1MV5A 3A1SA 1GITA 3QXXA 4QKQA 4OI1A 1VIYA 1YR6A 1ZP6A 4ITRC 4AKGA 4O25A 4B3BA 3KFVA 3RYTC 5JWHA 3FFAA 4LI0A 2LKDA 4HZIA 3CPJB 2PL3A 2QU8A 1TEVA 5FPYA 1SHZA 5L3SB 2AD5A 4ZO4A 4B43A 2GJAA 4TL9A 1BYIA 4YDSA 4D4JA 2XTNA 5KHOC 1COWD 1G17A 3SYLA 3HU2A 2HDNB 1NMZA 2Q9AA 1JXOA 1F2TA 4XJXA 3FGNA 5C4GB 4Q4AA 2WPDA 1G5RA 5J4LA 2ODWA 2JLWA 1EX7A 1HE1C 1HE8B 3QQ5A 1K5GA 5CITA 3PEUA 4OI4A 4JT2A 2O8EA 1XD2B 3W90A 5IF9A 2NO6A 3L8YA 3N70A 3PUWA 5A0FA 4AI6A 3U7FB 5H8WA 5JJLA 1QZMA 1XP8A 4A8JA 1IQPA 2CLCX 3CX6A 3LRPA 2WIAA 4MITA 2B7BA 3VR4A 4HZUA 1ZD1A 1K8RA 2OSBA 4JSTA 2YWEA 3T12A 1CJTC 5JWRA 3IHWA 621PA 4JIMA 4A0HA 4LRSA 2EFEB 3LBHA 4G5OA 1KYIA 1II8A 2QUZA 2WAYA 4Y0VA 2RMKA 2E1RA 1AS3A 3MSXA 4XD7D 3WP0A 3KDSE 1E3MA 2V1XA 5HCIA 2VO1A 2OXRA 2C78A 2P6NA 4AWXA 3X1XA 2DB3A 1N0UA 4QBHA 4A8JC 1E98A 4CEIB 2CJWB 2X77A 2RGXA 1UBCA 2OAQ1 3ZIAA 4ARZB 1EFCA 2OFWA 1AZSC 5FTLA 3IQXA 3QE0A 3LW7A 3SN6A 5LD2B 2QQ0A 3KZ1E 1E2NA 1G3QA 3AF1A 2IXEA 3SHWA 1G6HA 4B3FX 3KQUA 2JLQA 2EFGA 1GTVA 1W2GA 2ZE7A 4CVNA 4ZIRB 1VG9B 5F2EA 4AK9A 2PEYA 5JEDA 3C7KA 1W36C 1UKZA 1WF3A 3EZ2A 5SZKB 4IFEA 3L8ZA 1KI4A 3CF6R 2YVUA 1HV8A 2FZLA 2ZAOA 2ATVA 4TL6A 2IHYA 1XEWX 4JMPA 1KSGA 3CF0A 4C0LA 4Q4AB 1IN5A 1KGDA 2R2AA 4MKHA 4PFSA 1ZUHA 5BYKA 1CBUA 1KTVA 4YMSA 5L8VA 3QIAA 1ZJ6A 4GT1A 2ZI3A 1ZYUA 4OHZA 2QAJA 1KSFX 2W58A 3W6OA 1IONA 3KQHA 3K9NA 2HUPA 4MUBA 1WB9A 1NP6A 4U00A 3IQWA 4AD8A 1ZNZA 4KLNA 3EPKA 1NJGA 1S0UA 4Q7LA 3NBYC 4N3NA 4B71A 3FWYA 2CE7A 1UKEA 1LS6A 3QKUA 1QHNA 4PZLA 1T0JB 3K9LA 3X1WA 3CZQA 3VQTA 1XD2A 5CK5A 2OEPA 1UKVY 4QG7A 1UFQA 3MWLA 4XWOA 5GJWC 2DWPA 2FPLA 2BC9A 4BFZA 1A1VA 4M53A 3BGWA 2GXAA 4XTCS 5CDFE 5BW8A 1EFRD 2WMNB 1ZINA 2D06A 4IDNA 4EAQA 3AV0B 1Z6AA 4TLDA 2CLDX 1MO5A 4PX9A 1IN7A 3LWNA 4HAYA 4DSUA 4PHHA 1L8QA 1J2JA 3RS2A 4UXJA 3DHWC 1US8B 3K53A 3SNHA 1XCGB 1AA9A 2GNOA 1YU9A 1OH8A 1N25A 3AVPA 1YQTA 5D3MB 3K70C 1CRQA 4LJ4A 3MCAA 3QBVA 1ZC4A 2E9SA 2F9MA 4C0JA 3K0CA 2PEZA 4BFSA 2ZJAA 2G1KA 1SXJE 2ZJ2A 3U3KA 3VKWA 4XOIA 4KO8A 4TMZA 4ESVA 4O2LA 4UQOA 3GJ3A 4B35A 1XFAA 2F6RA 2VQSA 3DOEA 2AK2A 5JRZA 1CTQA 4KODA 1EXMA 3GLHA 4LZZA 2C5LA 4M1KA 4WA7A 3UMRA 3K1JA 4JVNA 3AP3A 3K0CC 4WOPA 3W6PA 4K46A 3IEUA 3QSYA 4C2UA 1DAFA 2GETA 3WNDA 4LBVA 3GJXC 1B23P 3U3JA 3GJ0A 1G8PA 4Z54A 3GLGE 5C18A 1E6CA 1U0JA 3BOSA 3DKPA 3IBYA 1ZUIA 3QY0A 3EPJA 1VCIA 5ELXA 4BLTA 1FX0B 2BHRA 1RFLA 4V0OA 2FFHA 2JEOA 2GCPA 3QUSA
chains in the Genus database with same CATH superfamily
2XQKA 4C5AA 1NN5A 2A0KA 1VEGA 2XKJE 3TR6A 4ZEVA 1U99A 4N1AA 4X1YA 5KDLA 2COUA 2OWDA 3MF4A 4K81B 4ZVKA 3BFVA 4LZJA 3ZJ4A 2FAXA 3B8HA 3LUGA 4OHXA 4Q1DA 3SMSA 5CB0A 4YMWA 1JFTA 5LYJB 1Z82A 4ZGBA 4TTRA 1BDMA 3OMLA 4IIFA 5JHGB 4HLDA 2AKAB 4Z9BA 5AKJA 1AXEA 1RABA 4PC1A 2XQJA 4FYVA 1VKOA 1EESA 5FV7A 1GXSB 3ZV7A 2C2HA 1KOLA 2DY1A 1ZX1A 4EPRA 4AMBA 1J5EB 4C4RA 4GPEA 2FW1A 1NW7A 2EBFX 2OCYC 1ZIYA 2XI4A 2OCGA 3DYBA 3B7QA 3RUDA 2RB5A 1SPXA 4JLDA 5LSAA 4HEA6 2E5FA 1TOAA 2G9QA 3E4CA 2YJGA 4GL4A 4L22A 2A9FA 1DL5A 4Q9JA 3ZXYA 1E60A 2NZWA 4TKVA 4FM9A 1GHTA 1YVPA 3EXEA 1U2PA 4BRUA 4BQQA 3E9YA 4BFWA 1WPQA 5AW4A 2ZM6M 2XAAA 4HZUB 1CY2A 1R10A 4F72A 4KMRA 1DS6A 5KKAA 4O33A 4REQB 4Z1MA 3BMNB 2NLOA 5IJ0B 1E3TA 1CZLA 1OR8A 4G5FA 4MLPA 2V8BA 3KSAC 4AVYA 4JLMA 1KI9A 3Q3CA 4G25A 2D1YA 3O38A 2HF9A 2ZI9A 3QE2A 4EHNA 3R8FA 1JEJA 1OH6A 3LPMA 4TZ0A 5EJ7A 4TXLA 4OQLA 1PZEA 4PLWA 2DU8A 4N0PA 4X8OA 2ZR7A 4Q6BA 1DOZA 4JLPA 2HMYB 3MQ2A 3OCJA 3Q8GA 2B25A 3KPJA 2NYUA 3NTRA 2JJ2A 3MWYW 3K0BA 1V5FA 2WSFF 1K3FA 4KTTE 2J9FB 1FVXA 4QOJA 4TVBA 3RT1A 3GDOA 4CN8A 4Z4QA 1MR3F 5GV8A 1T9GR 1OPXA 1UDRA 4TRRA 3VX3A 5JNWA 4B7CA 3F73A 3GLRA 4QUDA 2WWXA 4KN9S 5KAMA 3RHFA 1OF1A 3DO8A 4WXPA 4DUGD 3RC8A 4G2NA 3M70A 4AZTA 1Q0LA 5G0TA 3P97A 1TK2A 1VG0B 1VSVA 1IC6A 2Q1WA 1TAQA 3T1YM 3HUFA 3R1IA 1RZRD 3D3JA 1KTIA 1FYDA 1C7YA 4LYJA 4QXAA 1YA6A 2EW1A 2MMGA 1UZLA 2PM8A 1PGNA 5IVKA 1S2DA 3WV5A 3NKVA 2FGJA 2JCGA 3E4DA 2G28A 1U0FA 1GPLA 3KL4A 3L01A 1JR2A 1U2DC 4OQNA 3NNDA 3OIGA 2V5UA 4MK4A 4KW7A 5JPDA 4A6DA 4LRTB 1KAQA 4L57A 4MRAA 2C9CA 3UMVA 3FAZA 1Y8AA 2CMFA 2Q9BA 2L4EA 2NV0A 3NHBA 4XWAA 1CYEA 4DF3A 1G5FA 4DMFA 2AG8A 5FR2A 4TGLA 1ZXXA 4TS3A 4B4VA 2OWEA 3U60B 1VG8A 2QW0X 4PXAA 4P4UA 2RGUA 3VK7A 1UF9A 1KF0A 3BRCA 2WABA 1ZMTA 5IAEA 4Q7QA 3R7SA 5BRJA 1U9JA 4RIEA 1QVRA 1YZTA 3UK6A 1U9IC 4HK4A 4B81A 1QDUA 4QJIA 3W06A 5FLXA 2HYIC 1TCCA 3F97A 1ADGA 3OFJA 4UATA 5EGNA 5GONB 3CZPA 4HAZA 5IMBA 3U37A 3U3MA 1IUPA 1Q39A 4GU5A 4QX6A 3Q2IA 3VTAA 1QBGA 3GVXA 2MDTA 4GQBA 2FWPA 4TTQA 1RRFA 1LTQA 1ZJWA 3DMTA 4NEHB 1M6WA 2PGNA 3FKSD 4FVTA 4WTOA 1GUDA 2XUOA 3KPVA 1CB0A 3DZKA 3JQRA 1WCV1 3FNEA 1CZKA 4P84A 4WDQA 4DT1A 1IYZA 4EYKA 3AHHA 4REZA 2WTAA 2AT1A 4CFYA 1X9IA 4FPXA 3EUEA 1STOA 3FZQA 5B3JA 3W3AD 1R18A 1R74A 3I3OA 4M7WA 5JAIA 1PZMA 3I1JA 1RLJA 4AXXA 4ANRA 4R1LA 4TT3D 2G1PA 2O4CA 1XO1A 2BCGY 2NYRA 3O4FA 4TYQA 4ZC8A 2HCTA 4AS1A 4LYDA 3C8UA 1AF4A 2JJMA 2H57A 1P5JA 3Q8KA 3ABQB 4MKGA 5CH5A 4LOLA 3RIMA 1UMCB 1UEJA 2QJOA 4QOEA 4FIZA 1E59A 5FYQA 4JV5B 3VLFB 1RKBA 1XAJA 4XVQA 2VP3A 4QDTA 3OF3A 3EVDA 1N8NA 2O3RA 4X84A 3AINA 1MEEA 3QA3E 4HX5A 4NEQA 3T7SA 1TF2A 2YZNA 1L7QA 2FE8A 1CE8B 2I7VA 3GLIA 1DO0A 2LD4A 1JILA 3H6KA 5JXWA 3L82B 2I2WA 1SC6A 2O5RA 1COWA 4ZCIA 2F9LA 1RADA 1GKYA 3IDFA 3ER6A 2QL5A 3GDHA 1Z5WA 4LJAA 1ESDA 2A8YA 3HS3A 4NDAA 4D9JA 5ICSA 1WUTA 4DLAA 4ZQGA 3RNOA 3FOWA 1DKQA 1CK4A 3SF0A 1GL6A 4F60A 3ZYCA 1VHWA 2X49A 2CXPA 4UW9A 1J06A 3V3KA 2IV2X 3L0OA 3RUHA 4DQLA 2NSJA 5EJ8A 3OX2A 5BRAA 2Z2ZA 3IFSA 4QYXA 2X5JO 2PO5A 1K4MA 1VP9A 3PUVA 3HADA 4KU4A 5K3BA 2VUUA 1G6Q1 3I9V6 4EECA 2AF4C 1DC3A 2AYXA 1T15A 4QECA 1S8AA 4E46A 1ZO8A 1JDVA 1XROA 4O2AB 4DVJA 3O93A 4JR2A 3N07A 1RQ7A 5ADWA 1HKUA 4Q9KA 4L76A 1E61A 1ZH2A 2NO1A 1WUJS 3Q1KA 3SXJA 5HHTA 4LDAA 3GN1A 5JSFA 4U2DA 4YRQA 2BJHA 3DSRA 3OE7D 1ZQ9A 3COYA 4Y98A 1KQGA 1KMHA 2ZI4A 1CR6A 1VMAA 4L4ZA 1Z36A 1ZGZA 1MF7A 4R1TA 3EYWA 2R6CA 1TZMA 4KQ9A 1YWGO 4RS4A 4X20B 3W0LB 4G8DA 4FFPA 1BW9B 2QUKA 3SM9A 1RT9A 3JARA 2JZOA 4LVNA 3SOZA 4EGQA 4U5XA 1OQAA 2EX1A 4WESB 4O3MA 3V4OA 3THYA 3OPYI 1W25A 1HZJA 2Q41A 3HCAA 4R83A 3S2UA 1HUQA 2C4KA 1KI7A 4RHEA 4GM0A 5E95A 3HJFA 4GZ5A 3G0DA 5DBFA 3SAVA 2EKKA 3NHZA 1H22A 3V1UA 3WP1B 1YUMA 4CLRB 1JFLA 4FHCA 7ADHA 1VZ2A 3AO0B 1RWMA 3CA8A 3DB2A 4JT4A 1M75A 4C78A 4DQVA 3PDCA 5SYNA 2EV9A 3ACDA 4OTZA 1T4CB 1P4GA 2A1UB 5EJ2A 2ZAYA 4IX1A 4BVBA 3GPCA 4JEHA 2IVZA 4MJXA 1UDXA 4G36A 4Q3OA 4ZJPA 2DPXA 3R23A 4FDAA 4OMDA 3OPQA 2YWCA 4XRRA 3AWDA 2WM2A 1QORA 1XB2B 3WL5A 2M2IA 3KUCA 4QRDA 2ACEA 4BUCA 4BDTA 3Q0IA 4RD4A 2IDMA 1OI7A 3BK2A 1I14A 3CT6A 4JYBA 4X3PA 4P16A 5B2EA 3K9GA 3TGWA 3NHSA 3ME5A 3HH8A 4M9UA 1PZGA 4QUJA 4BFVA 4AAYA 1TZKA 3CNLA 1XQ6A 4KR3A 3H8JA 4NZMA 2ZZNA 3PICA 2PSEA 3JWGA 4BO0A 1P60A 1WB4A 2J87A 4PLGA 1AKEA 1WWKA 2UUBB 2YWXA 4DILA 5IT5A 4IXMA 1RS0A 3RT7A 4G01B 2Z5LA 3P7MA 4RDHA 3TQRA 3O0DA 4D7AA 3I5YA 3DAPA 1P7CA 5CT8A 3OOJA 2ECKA 5H3LA 2XMCA 3IE2A 3VMFA 1N7IA 2YWRA 4H0FA 3DZBA 8CATA 3CLTC 4JLAA 3AP2A 4OY3A 1IEWA 2I80A 5IAJA 1FTGA 3JD0A 4JR1A 4Y7DA 4S05A 1LEHA 3E8XA 1TO6A 2Y92A 2OQVA 3VAAA 2JC3A 3OQIA 2PSHA 1WXQA 5DLQC 6GPBA 1IHYA 3VSAA 4K0KB 4MVJP 2JGFA 2ORWA 2B8NA 4OQMA 3RVJA 1AXGA 4E2XA 2F1IA 1OZAA 1D7OA 1QQTA 1YRYE 2G1JA 1BZYA 3AUJB 4MA5A 1W93A 4YMUA 3JAWB 2DPMA 5KYUA 3NTVA 4CKWA 3RS3A 3B6EA 5JG7A 1HEYA 2B0CA 4PRLA 3STTA 3E3LA 3FNRA 1GCGA 4KIUA 2IYXA 1F6WA 4O02B 2VTBB 4H7EA 2FF7A 3AOEC 4DV0B 3G0IA 3HZRA 5REQB 2NX2A 4YV7A 3QTBA 5K0ZA 1RWBA 1ZMXA 1RPNA 4L7VA 2QMUA 1YHZA 2ODTX 3HA7A 4GVLA 4AXBA 3TLGA 4PYMA 2PUEA 4D9BA 2FFQA 4NPCA 1L5KA 1U7XA 3PDJA 3SEFA 1M8GA 2BISA 1UOQA 1V4NA 2LIPA 2QIPA 4IJVA 5CIYA 1WMAA 3RKSA 2AUNA 2RGWA 2EC5A 1E99A 2XEDA 4D9KA 1LU9A 2JI9A 3Q7QA 4JOSA 5LLSA 3PRJA 1GUFA 3L0SA 1KZ1A 1T6YA 2VF8A 1RM0A 4J76A 3TIXB 2G0AA 2M6LA 3FN4A 4AO8A 1V41E 1SBHA 4XTRA 4ENWA 2AG0A 3K5WA 3L6OO 4EM6A 4V1CI 1VMEA 1CCWA 4UFNA 3UG7A 4HAOA 4B79A 5IVPA 3WISA 3A2MA 1RWPA 2VT7A 3FGZA 5I5EA 2J41A 1G8YA 1K7EB 2PS1A 1CWUA 2Y2UA 2Z30A 3F3SA 2OM2A 3VJLA 4L28A 1IUOA 4ETMA 4WCFA 5K6AA 1VYHA 3UMYA 3MINA 4IX9A 1IJFA 4OJNA 1P0FA 1X7WB 3W6UA 3CR7A 2XZLA 4RM2A 4G0ZA 3F9CA 4KDRA 3VH4A 4HNAA 3U7IA 4DMKA 2XGJA 2QTRA 3NG1A 3C3EA 2FXIA 1P4HA 1HSOA 3QK7A 2AH5A 5E9WA 3CN9A 2X6RA 3NHKA 4HQ0A 3UWPA 3GLUA 1PWEA 4EFKA 2VZLA 4G5XA 4JL5A 1XN1A 2CLFB 4IHJB 3TCXB 1UJBA 4BB9A 2I6TA 3Q6IA 4BC0A 2DXIA 1T4MA 3HWRA 3FJ1A 3I12A 5DDIP 3VHXB 1H1LB 5HZGA 3AB8A 2D5BA 1G64A 3RUFA 3UW1A 4YMIA 4BRWA 5KNDH 3VX4A 1AQNA 1FVOA 3LFTA 2L69A 3ZDAA 5HJ7A 2G09A 4FKBA 1NYLA 3NPMA 5GJBA 5AXAA 3OC0A 4PLPA 1F20A 1OE0A 3M82A 4AURA 2DX7A 3SIXA 4BNJA 1E3SA 1E9VA 3QWHA 4B3CA 2QVCA 1M74A 5EE3A 1RXCA 1X8KA 3EG9A 2HMAA 3VI4B 2VNHA 2EZ8A 1EDBA 2Q2OA 1R2ZA 3CLTD 3EE6A 3NGLA 3OZFA 3QVGB 1RJ9A 1ZNXA 3QP9A 1XNHA 3T41A 3WB2A 5AVYA 5JFGA 4H7JA 5EMLA 3SM3A 4B4DA 1IU9A 5AM0A 1RBZA 1N1MA 1KNQA 3G89A 4OK3A 1F8YA 3LZ6A 4WK2B 3DE2X 1PSWA 4K7JA 1V2GA 2PU7A 4MPRA 5BOSB 1O94A 1V48A 1VMKA 1ZOOA 2A9PA 1NMQA 2C2XA 2BVNA 3EJWA 2L18A 3M6MD 4GYKA 4O2BA 1C9YA 4PTZA 4PZCA 1OWLA 1IY1A 1TQHA 5F2NA 1Q44A 4WN9B 5K99A 3ZH2A 2D4AA 4J0DA 4ZVVA 1ZRMA 3ZUGA 4NZYA 9GPBA 1OJ7A 3CX8A 3K20A 2GA8A 1WZEA 3NNSA 2IYQA 2XBMA 4DHEA 2BTEA 2WYVA 5B1SA 1J56A 2EKLA 4MKZA 2ZRAA 5DLEA 1GTJ1 1K8QA 5FQOA 4HAUA 3CRQA 1M66A 1T8YA 3JR7A 3LYLA 3EQ6A 2CNBA 5IRCD 2PZJA 2A9VA 2C97A 4JJZA 2MYTA 4WLNA 5HRUA 1FFYA 4IUCS 4J8PA 1QE5A 1XGKA 1Q1AA 1GR0A 2IEDA 3I1IA 4U3JB 4X97A 4YRIA 4I3FA 2KMLA 5KHAA 2GUWA 1CJMA 3EVGA 5F5NA 1SXJC 3H9EO 3LKBA 4HH1A 1KH3A 1FMCA 3G5LA 3VR0A 2XMGA 3I45A 4K9OA 3VVBA 3ZDQA 1ZJYA 1ISSA 1F48A 2FLVA 2NVUA 2TS1A 3CPSA 3PRKE 4ZAYA 3ROPA 4QICA 3G5TA 4JYPA 1SXPA 4XQ0A 3DBRB 1BO6A 4MS3A 1CEXA 1E8NA 1GPYA 2FE4A 2VJQA 4TV9F 1G6OA 4AICA 5AYVA 4LN1A 3WWYA 4OF4A 4I1PA 1V34A 1VGQA 1AOXA 4RCYA 1TTHA 2AG6A 4OFBA 3GP5A 4URVR 2ANBA 4NBWA 2ZXFA 4FB4A 4MUXA 5E26A 4CKZA 1KAEA 3FSGA 3KQPA 5AVKA 3EMKA 1CR1A 5LQSA 4QVIA 2PFSA 1MW9X 1HKHA 3HGTA 2ZUVA 3DQZA 1CNFA 2Y1DA 5I9MA 3U09A 2RI6A 3EXFB 1GJTA 4RYDA 4RCZA 3R9XB 1E1QD 2JAXA 3BCSA 4EENA 1ULBA 1JHOA 2Y1GA 2FWMX 1PTJC 2G3YA 1YGPA 3DP9A 3THWB 3M2TA 4MV8A 4Q02A 5DHPA 3FRHA 4M21A 5ADHA 2PK3A 1IK6A 5ITRA 5G4KA 3H2IA 2GCEA 3T95A 4BX3A 4F5WA 2AC4A 2XW6A 2YS7A 4CE6A 3VR6D 4AJLA 2WJIA 3M33A 1PP4A 2FPPB 3REGA 5FEUA 4QYTA 1RP7A 4JNCA 1DGHA 2NYVA 1AZTA 2W9XA 3UJBA 4EYEA 5E7JA 2DAEA 4DV6B 1SXJD 4CQMD 1GFSA 3J27B 2A9JA 4PR0A 3T9CA 4EEXA 1U65A 4GMQA 1D09A 4IZIA 2V9PA 4KQEA 2ECOA 5G40A 4B0OA 5D7BA 2R60A 5ABPA 4PX5A 1J8QA 3HHPA 4RVHA 4P3XA 4EG1A 1N5LA 2IKQA 2VDUE 4ZI3A 3WIEA 4JI7M 3BA6A 3ZNPA 1US8A 4XVRA 4II7A 1HE2A 1MPTA 5EIBD 3S5UA 2FSFA 1J33A 4ERXA 4LV8B 4RIGA 2X9QA 3V3TA 2F3PA 3X0DA 5KCZA 4QODA 1A9OA 2ZSJA 1J99A 4I5EA 1G8MA 5AR1A 2N0SA 4MV1A 3V8BA 1FXWF 5EINA 2Q29A 4G37A 3EPPA 5CB8A 1YDMA 3GDFA 2DR0A 3DO5A 2XRYA 4H4DA 2B4TO 4FYXA 1JIIA 3N2KA 3O7MA 1E4EA 2QE7D 4GX2A 3EK2A 3F8SA 2PUFA 3V9AA 2LCFA 3SYTA 1LFDB 4LZAA 3NOVA 1NW4A 2BHNA 5JCOC 3HNPA 1J39A 2QGFA 2QL9A 3EW7A 5DSZA 3P9RA 3PXAA 2CVQA 4B48A 4CR8A 3CRNA 3IOCA 3M34A 4YT8A 1XNGA 5IJZA 5G0SA 1TVEA 1V4BA 1EUCB 2E2WA 2G70A 3GVHA 4L8RC 2FSSA 2OZKA 2W6ID 3G8BA 4OMFG 1LRLA 4PIVA 1DI0A 2E55A 2V4UA 1M6HA 2PCJA 2AR7A 3Q8MA 2BFBA 2FRXA 2Q9UA 1JQBA 4XR4A 2CUKA 1KI8A 2X41A 3T3MB 3ZQKA 3AKZA 4KXNA 2VYFA 3EZFA 1OVMA 2VP5A 1FP4B 1OXMA 1UQRA 2NZ8A 3W9SA 4HDNA 2ZBPA 1HORA 5GP1A 3ZDXB 1CIPA 1I2DA 1RAGA 5JQGA 2AFRA 3VUFA 3IG8A 3TQHA 3IUQA 2AL7A 1OFHA 1DKNA 1AV7A 2V74B 4G41A 5CTJA 3TW0A 5JDIC 3BXOA 5CDFA 1JPJA 6PFKA 4RQAA 2PHZA 5F73A 3WK6A 4H1UA 2WYOA 4NYJR 1L8OA 3MEQA 3FBWA 4R2LA 3FDZB 2H4HA 3RJTA 3RM3A 4YWHA 4OHBA 3I4LA 3VOSA 4BNTA 1QK4A 3BHJA 4XZ3A 3KYCB 1JAIA 1OREA 1T4CA 5KYWA 2HT6A 3GZTB 1P3JA 4HLUC 4UD2A 1N9GB 4L2IB 4UVIA 2E4WA 4ZYUA 5C4IA 4I19A 1HRKA 1MRNA 3IEMA 3U4GA 3JZMA 4CDRA 2IPLA 4NU5A 4CLRA 2ID8A 5KTTA 3D2LA 1SQGA 4LY3A 5TGZA 1KWGA 4BIIA 1FMLA 1WSWA 4G23A 2HMTA 4LHXA 4NPHA 5LQKA 1O4WA 5T8KC 1WMEA 3HACA 3FKSA 1C9DB 4RK6A 1OILA 1XDSA 2EOAA 3DLAA 3H8WA 3MQFA 2LVQD 3JPYA 3O94A 4IPTA 4ND8B 3LTNC 1OLXB 3S2GA 5KQGA 4RVNA 5KTKA 3OP4A 5GGYA 4C0KA 1XCJA 1E1QA 3PC2A 3K1ZA 3VO9A 2YQZA 1T36A 4CLDA 2GILA 1W9MA 1C0PA 2NO9A 2WHEA 1XYVA 1F5NA 3U5ZB 3PFHA 1PL0A 4BX9A 4E7OA 4BGIA 4BMSA 2Z0MA 4M1TA 1GAJA 2ODEA 2H3HA 4OAOA 3G8DA 4DV2M 3EEYA 2OO5C 5EMNA 1VKHA 3HVRA 3MAJA 3MPUA 2HBQA 2AOVA 1TYDE 2GMWA 3VHXA 2X0NA 4LV6A 2P78A 4Q7JA 3CLSD 2CUZA 3TQFA 3P71T 2VDVE 3EGVA 2R0IA 1QANA 2JF0A 1QGDA 3P4YA 4H7IA 4HX9A 2MSKA 2FJPA 5F23A 3E8MA 2G63A 4ZQBA 4Z51A 3JZAA 1YHYA 3JD1A 1N0IA 4XX0A 4R8LA 4C0HA 4LISA 5DNYB 4EELA 5A4AA 1T2FA 2Z5VA 4MI9A 1PZXA 2HK9A 5BQ5A 2CHVA 3T5DA 1W75A 3QKWA 2ZRGA 4C4TA 1DOAA 1SJ9A 1UBGA 2JUJA 3FRJA 4JLVA 1Y42X 1AUVA 1DUVG 1QMGA 2I3GA 3SP1A 2EBHX 2NNWB 5DHAA 2RBEA 1WV0A 1ZAKA 1FP2A 3ADKA 3F47A 3IQEA 3WBKA 1P0PA 2JA1A 2P9ZA 3HA3A 3H2YA 3KXKA 5CHYA 3HEAA 4FWHA 1U5CA 4FMDF 4YHHB 3UTDA 3QXJA 5HF6A 2ZTMA 3MM4A 2FQWA 2OCDA 4A2CA 2LDBA 4ENRA 3SASA 2JDID 4LVCA 1YI8A 5BV7A 2GK6A 2RCYA 5BVGA 3K2BA 4XPIA 3E22B 2HGZA 5AKGA 4AP6A 4ER0A 1QR6A 1QYRA 3B13B 3RANA 4I9NA 5KJ6A 1IJKA 2X0EA 2DFVA 5FTNA 4BQEA 4DYHA 5TF0A 3AG6A 4L0QA 5ALWA 1FMJA 2B92A 2P7IA 3CNOA 4PX3A 3V1MA 1T0PA 4E2YA 3U1BA 3QENA 2PR2A 4AKTA 2YIMA 3PG5A 5IFKA 3T06B 4RHYA 4KYVA 4NFYA 1P91A 2AHRA 4DV7M 4DV3B 1SKBA 3HO6A 1L8AA 2I9PA 4FCTA 1M2FA 3LXUX 1BYUA 5FNVB 1NVFA 4UQLA 1NYTA 2HXYA 4P80A 2JLSA 4N49A 5HFAA 5REQA 4IUYA 1L1FA 4CZ2A 2E4YA 4NYMQ 2MJLA 5HBRA 3SQMA 2FFJA 2XT9A 3U3DA 3D3WA 3A2LA 4G4IA 4P08A 4NBSA 2C29D 5CXXA 5B2ZA 3R4CA 5GAJA 1A9SA 1I0LA 5IP5A 4HGQA 3JWIA 4E08A 3QFRA 1QQWA 4MWSA 4XQEA 3JQAA 3WGOA 1TVMA 3USES 1WTAA 4I1VA 2HRQA 5DMHA 2HRCA 4IBGA 5HS4A 1DC7A 4EUFA 2IPNA 1NW8A 4CM8A 3HY6A 2QIOA 2OBNA 3K6JA 4GXNA 2C96A 3BRWD 5EXEA 4B7AA 3D6FA 1N6RA 3Q9UA 1A9TA 5D1NA 3ZWBA 1S01A 4YJHB 3TB4A 3H04A 2H0QA 4FIDA 4A0QA 4HUQB 1RHMA 4L8YA 4MPDA 3V8EA 3ZKWB 1ZLYA 1XOIA 2O8NA 3E1KA 1Z5ZA 2PIDA 2J48A 2UUCB 1IBSA 2PRYA 3SMPA 3MWFA 1BDIA 4Y0NA 5G1PA 1BXKA 2CL0X 4W8OA 3LZDA 2PX6A 3OTQA 2JAQA 2Q5HA 3AQIA 3FLMA 1WCWA 4BBAA 2V03A 2IGTA 3GPBA 2NO4A 2XSZD 3JAMA 5KU1A 4N5LA 4UHJA 1U0HC 4P5EA 3K2IA 5TEWA 1BJKA 2YHBA 1UPUA 1QNLA 3A58B 5CA1A 1G8KA 3GP8A 3KVRA 3QVXA 3AJDA 4CG2A 2IHBA 4F9TA 1DBVO 5AVJA 1WA5A 3GQBB 4AZVA 2X0RA 4FR5A 4CMGA 3CH5A 4IHQA 1NG1A 4IGIA 3OQNA 3DFUA 4M9RA 4WKOA 3W8RA 3CG0A 3WE7A 5K51A 2Q6IA 2Z6UA 1M6EX 3SQNA 1FRQA 3GQ3A 3MLBA 5B12A 4PX2A 2ODNA 2JGDA 3HFGA 3SMQA 3GUVA 2Y1EA 3LWDA 4LE1A 4XQGA 2C4UA 5AJYA 2EHJA 5KTYA 5K6TA 4I1IA 4UBLA 4R2WA 4MI3A 1NT2A 2QTAA 1JHRA 4MKIA 2H0RA 2EFJA 3HJRA 5C31A 4WN9A 4BE9A 2PU5A 3G1UA 4EHDA 1U2ZA 2YQ5A 2VR1A 4I5GA 4OGWA 2CNKA 2ZUEA 2Q4EA 2O19A 1JAHA 3H4IA 4KDFA 4AO7A 4JBNA 1OU0A 5F1PA 3HTXA 1JLLA 2W6ZA 2YNMC 4M0MA 1R5OA 3A1WA 3ZIUA 1RKUA 3WIOA 1CLEA 2QP9X 2H7VA 5D84A 1XWWA 1W19A 4UNNA 4X62B 1LF5A 2XHEA 3VOTA 5HSGA 4BKPA 3IEVA 2AI1A 2DVWB 3MT0A 4Q9IA 5CBPB 2OPBA 1FFDA 3OIUA 1C8LA 4WNYA 3CPHA 2ZIZA 5AK6A 2VTEA 4QSHA 3CNNA 5CDGA 4UUOA 4GI2A 5K8UA 1ESMA 2Q3MA 1AGNA 4GH9A 1OA1A 1XMVA 4HC4A 1QP0A 2FJUA 3IPAA 3TDKA 4FJ2A 1T6XA 1W29A 4IO0A 1A76A 3LDAA 4PYIA 3R7WA 4G9GA 1W59A 4HYEA 1DCFA 4K9RA 4D4GA 5GVSA 5I5GA 4FLMA 5IG2A 4F71A 3QFHA 2D5CA 4EMTA 3JQGB 4IG4A 2WWHA 1JG2A 2CLMB 5JZSA 5ILGA 3O8RA 2VJYA 2Y6UA 2VK1A 1JWBB 4KRGA 4LBYA 4LX0A 2HWWA 3ZNOA 1AD2A 2GH1A 4KP7A 5JR3A 1VJ5A 1T2CA 1CHDA 1TB4A 4YO7A 5BURA 4Z53A 1KEUA 4YXFA 2V96A 2Y76A 5AW7A 5MN6A 1KMNA 1YSCA 1UT5A 5ESDA 4G0UA 3DZJA 4YPOA 3K2LA 4FGJA 2QRLA 2I1VB 1OZ0A 1UAAA 3ILYA 4TXMA 3LKZA 3T1HM 3KFXA 2IYWA 2QX4A 1Y5MA 3C87A 5J2UF 1XQ1A 2ZS7A 3V8MA 3EA0A 2CFOA 4RZQA 2AHMA 3CLVA 1E3EA 3RK1A 3QRWA 4LYGA 3BEOA 1Q3KA 1FTWA 4R1OA 4JP5A 3SPXA 3HU3A 1OAIA 5BNFA 1EX6A 3VSBA 2WZQA 4HEA1 2HHCA 5JALA 1CUSA 2GDZA 4IY1A 1D1QA 2F1JA 3OHPA 4UC0A 3O92A 1QG2A 1QQ5A 3CBQA 4YACA 3X1MA 3RJZA 4A2QA 5KWEA 2WE7A 2PLWA 1ZD8A 3THXB 2COEA 4IHJF 4S1TA 3RRJA 2QY9A 2HSDA 3VR5H 1C81A 1SVUA 3I9KA 3WG9A 1Q2UA 1ZHHA 4ZRMA 1GUAA 3ZOZA 3IEXA 4RD6A 5G3ZA 1N2HA 1FK8A 3K9QO 4NWIA 4BJHB 1D1SA 1T26A 3LS2A 2XB8A 4DG5A 1OBFO 1T5HX 2DCUA 3F4KA 1UWLA 2QZJA 1XMQM 2WFLB 3AFNA 4JQCA 4AECA 5I3CA 1QQ6A 3FYCA 4Z4IA 4UM5A 2KPOA 3CX4A 4HQRA 1JHUA 1O95A 3NOOA 1M10A 1E6UA 1M2KA 4L0DA 1JEQA 2QR2A 1QKIA 2R4QA 2XXJA 3KT6A 1IB0A 1M73E 4RH0A 5DT9A 4CV2A 4DLSA 3ZCRA 1DO2A 4NENA 4Q4CA 5JNVA 1Y80A 3BJEA 2HUNA 2X8WA 3UJ9A 3LUDA 1O0CA 4XWYA 4OHFA 1KU6A 1IG0A 2RIPA 4YPFA 4EY4A 3S8YA 2ENUA 1EE8A 3GLHE 1RVDA 2REBA 2K4MA 4FGKA 2Q2QA 1C1DA 5KB3A 4UFOA 1D1TA 5D01A 4WJLA 3FPAA 4C6RA 1A69A 2CHGA 1E9SA 1W1WA 3KSUA 1XMPA 3F9RA 4NENB 4NRVA 1MO4A 1WDMA 5BXYA 1F2UA 1T24A 1U2QA 1GYRA 1JYFA 1VL2A 1YMVA 2C0PA 2WWIA 4J90A 5KKCA 2JLVA 3DULA 1X86B 1EDOA 5IH7A 3D3WB 2R4EA 1KO8A 5JD4A 3WSVA 1XKLA 4DR1B 4EVQA 4MB6A 1EHCA 3TAUA 1EMDA 5HZHA 1XEWY 1NQUA 3UG6A 1ILEA 3WK9A 4V0SA 1AGRA 1MTOA 4HNSA 1YQXA 2PX4A 2R7LA 3P9IA 1R27A 2IIVA 1BNCA 4GW3A 4UVHA 4J4BA 5EE9A 5BSRA 4DIMA 5JVDF 1C4KA 3AB7A 4WLEA 1ZM9A 3KPUA 1A2BA 5JIBA 1PRBA 1Z2DA 4DR7M 2OG2A 4RVDA 3I5XA 1P75A 1S2GA 3FSGD 3U6PA 1OSNA 3I9FA 1M1XB 3PP8A 2FEMA 2IYOA 1DTEA 1WU7A 2D1RA 4LG1A 2Q7DA 1VPTA 2ODAA 3QKSA 4G0NA 2O01F 1F5SA 1GCAA 2O9JA 2ESRA 5AOVA 4FNGA 2F00A 1YJXA 4E14A 2B30A 3S2IA 1NRWA 1J70A 3BH7A 2GBGA 2JLZA 2Z08A 4A7PA 3TXYA 1YOBA 2P9YA 4KFRA 2ZAMA 2FX2A 3OZDA 2GLXA 3CUSA 4OVZA 4FU0A 1DKOA 1JEDA 3ABOB 1XZHA 2A2ZA 5B4UA 4DR7B 4RJKA 5E7MA 2PD4A 5G53C 2OLKA 5TPWB 4Q24A 4F96A 1Z5GA 1FQKA 4H31A 2MR5A 2BCJQ 4RXTA 1RYHA 3AEXA 3QLVC 3AVYA 1TMGE 1T1EA 4XCQA 4EB6A 3SQOA 5TMPA 1IY8A 3OTWA 4PZAA 1GZHB 4FC7A 3LMKA 3O3MB 4IILA 1BN6A 2FH5B 1XTRA 5BXQC 2CXHA 2VAMA 5LP6B 1NVBA 2VH2A 2XNSA 2C0CA 4H2DA 4D97A 1G5IA 3C4JA 1XA4A 4N0EA 4ARVA 2FLKA 1XMOB 3HKPA 1ZGGA 5C2JB 5CFLA 2G9ZA 2JL1A 1QHIA 3GRAA 4FDUA 1BEZA 2WVGA 4CCYB 5LU8A 2IXFA 3U4QA 2HA6A 2J0UB 4F3RA 4R81A 3ZU4A 1YQ9A 1UXKA 3BWDD 5F35A 4CEJB 2SICE 4UQPA 4DGSA 2I8AA 4MWTA 1QCZA 2FUG1 1UBNA 1EQAA 2Y8EA 1HL7A 3V76A 3UOGA 3LCJA 1J2EA 2FEPA 3ND5A 2AD1A 3BE5A 3L5KA 3HO8A 4GOLD 1VBKA 1ZIXA 5DTQA 4HNTA 2PSJA 3KS8A 2RH9B 5DW0A 3CJRA 2IHKA 1C80A 2F67A 1U1IA 1UZNA 3UHAA 5TRTA 5CA1F 1BH2A 4JB0A 1RE0A 5EZQA 5B7PA 1W46A 4QOGA 4DLKA 1J42A 1G8JA 3ASYA 4YV2A 5CDTA 1C4WA 2EU8A 2ZBKB 2H1VA 3VPAA 4A6XA 4BFYA 5HQJA 1XXLA 1QQBA 2YY7A 3H2KA 2XOKD 4UDNA 5J59A 5GPBA 1OPRA 1JR6A 4IIHA 1F12A 4L0MA 1W4CA 2QLMA 2OA0A 2WT8A 3MJDA 3QNWA 1WG8A 1HQCA 1Q91A 3KG2A 1UK9A 4J3JA 4RHCA 4DQDA 1Y8ZA 1PZNA 2FPRA 5KJCA 4RSRA 3I92A 3BL8A 1R6DA 4YAJA 3I5UA 3OQPA 2WAOA 4ND7A 4LNAA 3ZC7B 2NUAB 4BZPA 2NZ2A 4I9UA 1K3WA 4Z1OA 2DFDA 2W8BA 4H7KA 3CMMA 3ILSA 3V00A 5KQPA 3ZLTA 4ZI7B 4D3YA 5TGDA 4F11A 4ER3A 2MMCA 1AK1A 4L0CA 3OPNA 1E9EA 1D9XA 3F6CA 3RH0A 3GGOA 1KMQA 1XPJA 3GNLA 4IW3B 1Q7CA 4AKIA 3LC1O 4J03A 3M49A 4LWPA 1MO2A 1CRWG 2BFBB 3NCTA 1K82A 2PYZA 4O5AA 2XNDA 3QKRA 4PR3A 4CV0A 3IQDB 5K8VA 1KWKA 3I01M 1DAMA 3DCJA 3FTFA 1U90A 1QF7A 1EVKA 3PE6A 3BTOA 3ICWA 4KK3A 1ZCJA 5K8LA 3KO8A 3UVEA 1LVGA 5CDSA 4UCWA 3L7LA 3RVBA 5G0VA 4DZRA 4WUTA 2R7AA 4MKRA 3G2JA 4MR9B 2JXNA 1GVNB 3ASVA 1WXEA 3QFSA 1ZEMA 1R7RA 1XTTA 2BSXA 2PQ0A 4E33A 5KNDD 1U4OA 3PEFA 4G4SP 1K6EA 1P33A 2B34A 2UXBM 5A6SB 1H4VB 2KNVA 1DAOA 1Z3CA 3NVMB 4TTIA 1GZDA 4JEMA 3QEMB 1T0UA 2PRJA 4UU0A 3AG5A 2ROQA 4MYHA 2XYQA 5AKIA 3KOWA 4LOAA 5BSVA 1G4AE 1DEOA 2LR0A 1QYWA 3IAXA 5COBA 3S7ZA 1S9HA 1TEHA 1YOVB 3UWKA 4DYVA 2YZ2A 3ASUA 4XQ9A 4JI7B 3A9CA 3NETA 3IBGA 2PANA 5ELLA 4AUMA 1EIWA 2AXEA 3RS4A 2JAOA 4RANA 1VL6A 3ECAA 1Q6ZA 4KXUA 4P98A 3KKQA 1I2BA 2QZ9A 2PX5A 2DWMA 3VBCA 1IQRA 5CMLA 2O8DB 1K4KA 1L6IA 1RYZA 3AFOA 1GSIA 3HKBA 4Q7EA 1EPUA 4IGAA 1KOGA 1CZUA 4WERA 2Q3BA 3R9IA 4BGUA 3M4ZA 4HVCA 3V8PA 1AS2A 3WOVA 1FUIA 2GAIA 2JGKA 1RI1A 2O2SA 4FGSA 5FQNA 1JIUA 3GUZA 4UM7A 4C0BA 2H48A 3A45A 3X2SA 1Q21A 4X64M 5SY9A 2Z8YM 4TUYA 1NQVA 4MV4A 2BDTA 2CCKA 1NSYA 3AXSA 1CUAA 1L7XA 4YXWA 4ENSA 5JJBA 1Q57A 3C5HA 3IKLA 5LBTA 1K3XA 2FN9A 3LL4A 5F64A 4TX1A 1B6SA 4XGQA 1G4HA 3HUEA 4DLNA 1JI0A 3O74A 4B74A 2SKDA 3UMFA 3HKEB 4YJGA 1Q1NA 4GFDA 4HB3A 4S35A 1QGOA 3T7CA 3LYUA 2IX3A 2VDWB 4XX1A 3BFKA 4OHOA 5KJ1A 3CX7A 4QDKA 1XNRB 2ZAGA 4E13A 3VDUA 4RF0A 1OAKA 3IT1A 4GPD1 5A0VA 3HZJA 1FRZA 2IW1A 4YYZA 3AL3A 4IBEA 3KJIA 3OLCX 4KI7A 4E6PA 2AN9A