4LZZA

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
molecule keywords Transcriptional regulator (NtrC family)
total genus 57
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lzzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lzzA01
3CPHA 1NLFA 3AVVA 2VIIA 1F2UB 1G7CA 1E1QD 3RRNA 2YOHA 3TW4A 4JL5A 1G17A 2EFHB 5KSOA 2IYUA 4JKIA 3KQKA 4B3GA 1NLYA 1G6HA 4KVAA 3PEWA 4JZKA 4DSOA 2FPKA 1Z28A 1O87A 4EKDA 2ZAOA 4JLDA 1E2NA 3AKEA 1F2TB 4NYMR 3CH4B 4KYIB 2H92A 3S1AA 4RZ2A 1P9WA 2A7QA 1M7GA 2FSIA 4G5SA 2EW1A 3KXKA 4F93B 3C7KA 1W0JD 1F2UA 5KSPA 2OESA 4XD7D 2YOGA 3THYA 4DLVA 1GKIA 5C18A 2IYVA 2J0UB 2YOFA 4WIAA 3ZVLA 3U6KA 1E2FA 3ASZA 3U44A 2GXSA 3MRSA 4QNMA 2J7PA 2XTMA 1EFTA 1VG8A 1MABA 2QT1A 5CYOA 2JASA 3EWSA 1T3LA 5L3SB 5KO2A 5F9FA 1Z22A 3OESA 5F3WB 2YINC 3NHAA 2WOJA 2FX3A 3F5FA 2ZJYA 4C0LA 4JL6A 2HLDD 4N0EA 1E2GA 1L2TA 3NH9A 4EFNA 1N2CE 2RHMA 1VCNA 1L8QA 1Z6XA 3FHOA 2Q3FA 2O8FB 1XRJA 4MGZR 4URXR 4GP6A 3KXLA 2F3TA 5HE8A 3I73A 3RS0A 1YZLA 1E9CA 4PSKA 4L8GA 1KI8A 3Q5DA 5SZKB 1UKVY 3CW2A 3T15A 4F38A 4NPHA 1KSFX 1E69A 3AVPA 2BKUA 1HY3A 2GESA 2JEOA 3C16C 4Q48A 1EWQA 2GXQA 3ZGXA 2IXFA 3V9PA 5L3VA 1NBMD 2BVNA 2F43B 5D3QA 4LSGA 1KY2A 1ZM4A 4GMXA 4QBHA 1TQ4A 2BJVA 1E9BA 3SR0A 4Q02A 2KWIA 1YZKA 3QPUA 5GJBA 4A15A 5FBQB 3ZLJA 5KOYA 3QE0A 1CF4A 3C5CA 1E2IA 5FL7D 2NO9A 3B1WA 2IC5A 4RD0A 4V0LA 3ECCA 4TLEA 5GJCA 4US0R 4MKHA 2V4ZA 4QNRA 2C99A 3LY5A 4CEIA 3SYNA 1LF5A 2DPXA 2FFHA 3QQ5A 3OE7D 1J2JA 4H1VA 4P32A 3TSWA 3FE2A 1QF9A 1G6OA 1KZ7B 4MKFA 4M1MA 2WIAA 1TEVA 4URVR 4M22A 3QXXA 4Q9IA 2BHRA 3IPYA 4GSYA 2IEYA 2P2LA 2ZRAA 1T5IA 2YJTD 3LBIA 4XSGA 3U5ZB 2HT6A 2Q9BA 5CDFE 4HAYA 1CKEA 2W83A 4Q1FA 3BFKA 3RABA 4LV6A 2EFEB 4M1OA 3RS4A 3FMPB 3U3MA 4CGZA 4WXPA 2V55B 2WWHA 2XTNA 1W5TA 1R5OA 3W6NA 4ASUA 1OXXK 4TYNA 4E09A 3KUDA 1YE8A 1UBEA 4P4SB 5JCZA 2G0TA 1SXJC 3KTAB 4LRTA 1KSGA 2Q6TA 2FPMA 1Z06A 3B1ZA 4Q4AA 3W3ZB 3DZDA 1R7RA 4TLBA 1J90A 3U3RA 2IW3A 3EC2A 2XOKD 5CJPA 3BJIC 2VL7A 4PHFA 3LRPA 1GOTA 5H70A 1NNEA 5LB4A 2ZITA 2BOVA 4OQXA 1DELA 1CJMA 4PTLA 2C78A 2QBYB 2KBFA 2EYUA 2G83A 2ZJBA 2ZRDA 2LWIA 4O0MA 2G0NA 4ZDIA 4ZCLA 3B8HA 2ZU0C 1KTVA 1Z0FA 3L2OB 1AN0A 5D3MA 1CP2A 4QBGB 3CPJB 2FU5C 1DG1G 2O0JA 1KO1A 3SEAA 2JIZA 3DMNA 3FKQA 4CRWB 4CDGA 1X1RA 3UWKA 1XPOA 2HT1A 1X6VA 1VYVA 1OT3A 3FTQA 2VEDA 3K0FB 3ND8A 5K8UA 4MDFA 4DCTA 4HATA 4EPRA 1RYFA 4XJXA 1W44A 1BYIA 3BD9A 1U9IA 1WDTA 2BDTA 4BRUA 2MSDB 2RGBA 4BE7B 4DVGA 1OFUX 5FBVB 1CEEA 3CX6A 4YMUA 2P6UA 3ZIAD 3RRZA 5EE1A 2A5FA 1EFUA 1IJFA 1N5JA 5HCIA 2JDID 4M2LA 1OYWA 1OW3B 1NVXQ 3VKGA 4KXFB 2PX3A 3HU3A 4LBVA 2A5YB 2QGNA 3BC1A 1E0JA 2NO6A 1ZC3A 2G1JA 2ZI4A 4NCKA 4JIMA 3UMFA 2VLIA 4FMCF 1WF3A 3BB3A 2R6DA 2OILA 2GCOA 4GITA 1HQCA 4DDWA 5L3QB 1EWRA 4Q9JA 2H8KA 2RMKA 3QG5A 4TMXA 1E3MA 1N0WA 3EIHA 2FN4A 3AB3A 1TADA 4ARZB 1PLJA 2ZI3A 5EJEA 2NPIA 3R20A 4JVLA 5C46F 2QMEA 4OBEA 3DM9B 3OEEA 3QPWA 5EP3A 1JR3D 2GJAA 4POAA 5B64A 2YHSA 1P72A 1Q1BA 3TH5A 3E1SA 3H84A 4M1YA 2D7CA 1MO4A 4R2HA 1P73A 3RS3A 3RSLA 2BV3A 3PUWA 1OF1A 2AR7A 5AJYA 4DIEA 4Q18A 5CYPA 4I81A 1E2LA 3C4JA 3DVLA 4TYPA 1N0UA 4RZ3A 2ZROA 2ZSEA 3UK6A 1BKDR 4A3VB 4EPWA 2PX0A 1NVVR 3AKDA 1E9DA 1H8HA 1YR8A 5J40A 4KFSA 5BWMA 2B8TA 3THWA 2ZVPX 1CTQA 4ILEA 2OFXA 5KU1A 4F4CA 3GJ0A 1BH2A 2WJHA 3DEFA 4HYYA 4O2LA 1AZTA 4YMTA 1XD9A 2JJ1D 2H17A 1E4VA 2IYXA 1S4QA 1KKLA 2BMEA 3MWKA 3ZIAA 1KSJA 3PUXA 1Z2AA 2BIFA 1IXRC 1FFHA 5FPKA 2J0VA 3TNFA 2J46A 1TF5A 3FHCB 1VECA 2VSXA 3EXAA 2QZ4A 3OIWA 4P4SA 3CR7A 3T1VA 3A8TA 1W36C 2OCBA 1ZRHA 4DCVA 1ZUHA 3I1FA 2XZOA 4PC2A 1G8HA 2WJIA 3AEZA 1UKZA 3OFND 5AR1A 1M2OB 4E22A 3QI2A 1P61B 1S1MA 1GKYA 1Z29A 3O8CA 3AVYA 4W9MC 4AWXA 3BOSA 3UATA 4EPXA 3IHWA 3SYLA 4PHHA 2NO1A 4LRSA 4BZQA 4P3YA 2OLJA 1IJEA 1L7VC 1N0VC 4FWHA 3VKHA 2GXUA 5EQTA 2AFIE 3T06B 4LC1A 1H65A 3X1WA 4AYWA 3QEJA 1NJGA 1X3SA 4C0SA 5ANRB 4HZUA 2P3SA 1OPXA 3GFOA 3BB1A 3KFVA 2FV8A 3EPKA 4NCIA 1PLKA 5EXPA 4M53A 3RYTC 4A4DA 2PMKA 3SJCA 1EXMA 1WMSA 4WAUA 2QAJA 3WHKA 1VG1A 2ZUCA 4B43A 3LD9A 4TL8A 4OI1A 4EPYA 4BFTA 3PENA 1IXSB 2G88A 2J1LA 5GVSA 1XXHA 3MWJA 3D8BA 1ZMXA 2XAUA 5P21A 4AYTA 4HDQB 2O52A 2JLVA 4Q4HA 4GDFA 1SKYE 4ZI3A 1IY2A 1YJ5A 5C2JB 4I99A 1XD8A 4KVGA 4H9GA 4NKRA 3CLVA 1BYUA 4U02A 4G01B 3ZQJA 4S35A 1F3OA 5DSZA 1DE0A 4OQLA 2HLDA 2ZR0A 1OKKD 1MRNA 5IDVA 1G7RA 4FIDA 4LV5B 3P26A 3UKDA 1OV4A 4NYIR 4OKSA 2OXCA 2EYQA 2IUSA 4BZPA 1KYIA 3B5JA 2H16A 2OXRA 2WJGA 4QC2A 5EE9A 2WMOB 2G77B 3QXCA 2WV9A 3L0OA 2REOA 5DIFA 3BB4A 1MOZA 1W4AA 3IHLA 2WKRA 3G82C 4M8NE 4TWZA 1T4GA 3HU1A 4LPSA 5FOWA 1ODFA 2ZYWX 4UJ5A 2RGXA 4B71A 5TXGA 4KV9A 1TQ6A 4DWJA 1RKBA 3K0CC 4QBIA 4ZCIA 2VHCA 1JQJC 2J0QA 1VIAA 4FD2A 3NDBB 4PC6A 3DZ8A 1Q21A 3OZXA 4TL9A 2JGNA 2QUZA 1CR1A 4AKEA 2A9KA 3RRYA 4Z51A 4IOMA 4QM6A 1A2KC 1V43A 3I62A 5KDOA 5AJZA 2ZYTX 1KK3A 2C8VA 2CDNA 5KNDA 1CR0A 2LKDA 3R7WB 4D2IA 2ZVQX 2QE7A 4IOLA 1II8A 5EXTA 1KKMA 1TUIA 1GILA 1D9ZA 1E9SA 5JS7A 1IXZA 1FPMA 3AP1A 2GZAA 5DI3A 1GAJA 2FE4A 2VYFA 5H1YA 1A5TA 1CJVC 2GILA 3T1QA 3KFXA 2VA8A 1NVMA 1G5TA 3LLUA 2FEMA 3HYTA 4PQFA 2IK8A 3IEVA 2W6IA 2UKDA 5FPYA 3KXIA 4RD2A 4RD6A 2CLDX 2GF0A 2QP3A 5FOXA 1G18A 5AUPB 1KO4A 2VP0A 5E95A 3UIEA 2H1LA 4B3DA 4A8JC 4ZI2A 1AIPA 1SVSA 5EZ5A 2XSZA 1KK0A 4NONA 2QU8A 3VR4A 2XZPA 2CK3D 4FMCB 3KUCA 5DI3B 1EFRD 4A8JA 4DC9A 3CF2A 3GEIA 2V7QD 4ZO4A 1TAGA 2NIPA 5DNYB 4LJ7A 1DOAA 3B2EA 4UNPA 2WSSA 4HUQA 2O8FA 2ZS8A 1X8LA 3OE7A 3QXHA 2WHXA 1NMYA 2OSBA 5TB5A 4IVPA 3OEHD 5JJKA 1MR3F 3K0SA 4FMDB 1KO7A 3FOZA 3KDSE 2RKOA 2FOLA 2GK7A 4QG7A 2HEIA 5DGXA 3U6BA 1GRNA 1N6LA 3B13B 4JJZA 3U2QA 1Q3TA 4LYJA 4Q01A 1U98A 2K5UA 2LKCA 1W0KD 4LYAA 2PZFA 1S9HA 4JS0A 1GP2A 4LHWA 4M1WA 4IDOA 4W5HA 3GJXC 1DG3A 5DHAA 1ZIPA 2E9SA 5AUQA 5J5CA 3K0EA 821PA 3QKRB 1QHHB 2W00A 1M8PA 1R6BX 1ZBDA 1HUQA 2OFWA 4ON9A 2EFGA 1J70A 3SU8A 1M1YE 2AL7A 3QF4B 1BOFA 2AWOA 1AQUA 2CHQA 2PL3A 1NG1A 4NYMQ 2G3YA 4OK6A 1GTVA 2CNWA 2B21A 2PT7A 3SZRA 5FR1A 4ESHA 1KI7A 1SKYB 2B6HA 4MUBA 1VIYA 4BQSA 2NZJA 3K70C 1TU4A 3GD7A 1QG4A 4EQ6A 3U4QA 2FFQA 1R8QA 4I1UA 3LDAA 5IT5A 2BKEA 2FDCA 1YRAA 4HAZA 4DUGD 1D5CA 1FP6A 1Z0KA 2ZRMA 4JSYA 1XMSA 2D62A 4HLQB 2OCYC 1COWD 4E07A 3MD0A 4URZR 4GFDA 1VKJA 2FSFA 1OIWA 2GRJA 4OHZA 2C9CA 3GJ6A 3ZQ6A 4IOJA 4Q7MB 2YNMA 1Z3IX 3IILA 3GJ5A 4LBZA 1YZNA 3VNVA 4LOAA 4R7ZA 3LVRE 3VR2A 4WW0A 3QF7A 3QBVA 3BK7A 3J81k 3GPLA 1R5BA 1N6OA 3B85A 2C04A 2DCUA 5G3YA 4HB0A 2AK3A 4WOPA 3TKLA 4M1TA 1PV4A 4AURA 1TMKA 4M9XA 4QRHA 5F9HA 1OXSC 2D2FA 4CEHB 4F91B 1KJYA 4A2QA 5BXQC 3K9HA 4LHZA 4BFWA 4DBLC 2CJWA 4BFXA 3B9PA 1ZNWA 2CCJA 5FUWA 2GHIA 5JRZA 3R7WA 1R0YA 3B1VA 3BS4A 1PUIA 4YXWA 3U60B 3VFDA 2ZYVX 3GJ3A 3LXXA 4JLNA 1U99A 4B33A 1OH5A 3TJZA 3KKPA 2A3RA 1GNQA 2RGNC 1SVKA 5JS8A 2BBSA 1KMHA 5FTJA 5CDFA 4DXAA 4ZIRA 3LQQA 2X2EA 4C7OB 1UPTA 2CJWB 2HYDA 1FNNA 1EFHA 3GP8A 2IS2A 4CIDA 4A6XA 1JR3E 4TL6A 5HZHA 1OHHA 2BBWA 2QQ0A 1CJTC 3A1UA 5KSZA 2XXAA 2JDIA 3DKPA 1MO6A 4C2UA 2O8BB 3A6PC 1XNJA 4B2IA 4NTZA 4PPNA 4A6PA 1HEIA 3GLGE 1JB1A 1GL6A 2GEDA 3GLGB 3CRW1 3CPEA 3B82A 2GNOA 4FI3C 4JVSB 2Z83A 2H7VA 2NGRA 1XDBA 2V7QA 1DAHA 2HF8A 1CRQA 3CM0A 4PC1A 4ERNA 4R71A 2L0XA 4V0OA 4MYHA 2AN9A 3TAUA 1E2EA 1P2VA 1FTSA 4I1VA 4E5UA 4Z1MA 3OFNA 1G20E 4M1SA 4F4JA 3FMIA 3IUYA 4DT1A 1ZD9A 4DZZA 1FQJA 1IOZA 3VX4A 5DH9A 1XEWY 2EFDB 1DAGA 1M74A 2QTFA 2CCKA 1ZU4A 2FSGA 3LX8A 4KU4A 4HLDA 1E0KA 3GLFB 4JT4A 1G8GA 3UWOA 1F5NA 4HI0E 3W3AA 5HZKA 2FSHA 3ZD6A 2UZ3A 4JLVA 3T5GA 4BASA 2EU8A 3M6AA 4MYCA 2AWNA 2RGNA 4TZ6A 2O8CA 5SZHB 5C4GB 3VR3A 2D2EA 2GAOA 3CB4A 4DCNA 1NN3A 1KDOA 1P75A 2IA5A 3REGA 2CL7X 5LB2A 4LHYA 4R98A 5FI0B 1LY1A 1U0LA 1B23P 3SYKA 5CIWA 3MFYA 4C0KA 3WNCA 3RLFA 1SVLA 1KDTA 4JYCA 1E1RD 1TPZA 4Q4JB 4CVNA 4HEJA 4AKHA 1CIPA 1LW7A 4C0BA 4MRPA 1HT1E 1NY6A 4Q7KA 4Q7LA 3CWZA 4OHXA 1SVWA 5EE5B 2IXEA 4F92B 2BM0A 1X37A 2ERXA 3BORA 2GBLC 4LK2A 3MGCA 3TR0A 2D3WA 2GVDC 4YXWD 2JAQA 5BQ5A 3UXMA 3LNCA 1DAFA 3TGPA 4C4PA 3ETLA 4MRNA 2DR3A 4FCWA 1Z07A 3DM5A 4ZDJA 1KI6A 2CVHA 1TF2A 3SE0A 2OZEA 1VTKA 3K0AB 4GZMA 2GF9A 1J7KA 3MJHA 2Q9AA 1ZM7A 2DFNA 2JATA 5JBQA 2AFHE 4RFSB 2JLQA 2IXGA 3QVUA 2F1IA 1NN5A 4PSAA 1WE2A 4TYQA 4DLZA 3HJNA 4KHZA 1RRGA 1W46A 2KB0A 2OAQ1 1QHGA 1IY0A 3K70B 4URYR 2A78A 1QVRA 4CEHA 2F43A 3AVOA 3IPXA 2XNDA 2ZJOA 1GUAA 3WYAA 2OCPA 4B48A 1XTKA 2XEXA 2MMGA 2AKYA 2ZANA 1RRFA 2ZS7A 4BECA 4Q7JB 4B75A 3T35A 4OQMA 5H68A 2I4IA 2FGKA 2IHYA 3KKMA 4JN6A 1GSIA 4A36A 1E2MA 5IK2D 2Z4SA 1DBSA 4HAWA 3E5HA 2G9NA 2ZSDA 1SXJA 4XWKA 3R9XA 3GFTA 1XXHB 1LV7A 2ZU6A 3QOFA 1OYYA 4TQUS 1NF3A 3TSZA 1XF9A 2QMOA 4XVUA 1JBKA 2AK2A 2OLKA 3A58B 1OB5A 3EWAA 3SBEA 4LYHA 4PO9A 2AX4A 4NDZA 1YR6A 3PIRA 4NU0A 1RJ9B 2QTHA 2X8AA 4DLWA 4NHOA 4JVMA 4PXAA 1G21E 3JZAA 4QGHA 3U7GA 1T8UA 3DKVA 1NBMA 3AQ4A 1T3SA 4R2IA 1MO5A 2ZTSA 1ZAKA 5E7JA 1D2MA 5DN6A 3ZZTA 3U7EB 1G3IA 5KPDA 3PITA 3ZZUA 3K09C 2KJQA 4Z8XA 1MKYA 1XEXB 3PQCA 4OHVA 4MH0R 3QXJA 3I8SA 3PUYA 3L8YA 2ZE7A 1RVDA 5TMPA 3K53A 1GIAA 4JLOA 3GEEA 1H8EA 3TIFA 2YWFA 3HU2A 3L82B 3W8RA 4M9ZA 3P32A 4P0TA 5AUNB 3L8ZA 4JBWA 1U81A 4WZAE 3PG5A 1XTIA 2E87A 1IQPA 1KAOA 2J0UA 2VHQA 4MA4A 4NH0A 3OIYA 4YONB 4B32A 4RCYA 1IAQA 4NYIQ 4TZ0A 1EG7A 1WRBA 6Q21A 5F2EA 2R6FA 5B2ZA 2GBLA 4AI6A 2WWIA 1KOFA 3LBNA 2VHTA 4RKEA 1W36D 3QIAA 5KTYA 2BJWA 5FH9A 1G7SA 4BLTA 3UPUA 2VPPA 3CONA 2Q21A 3CWQA 4ACAA 4MKIA 3B60A 1QHXA 2BMJA 4GNKA 2ZRKA 5FUVA 3NBYC 2CBZA 3W6PA 1Z8FA 4UNQA 2W6JD 4CEJB 1XCPA 2O8DA 4UKDA 1YZQA 4NBSA 3AKYA 2WZQA 3L43A 3SFZA 1R0ZA 2CL0X 5CK4A 1J99A 5TV2A 2HCBA 3AGQA 2UZIR 3OEED 1FP7A 3FPAA 1E79D 4LJYA 4BEJA 3CX7A 5C4MA 1N6HA 4D81A 3RHFA 4F4IA 4IXNA 5JWHA 4A2PA 3VQTA 1KHTA 3EPLA 2V6JA 2EFCB 3I8XA 2P5SA 3FFAA 3PCRB 2PLRA 4LBWA 1EFCA 1W49A 1Y63A 1DARA 3TUJC 2IF2A 4CEJA 3U7HB 3GMTA 4L5BA 1XEFA 4XOIA 3UG6A 2KRKA 3PVSA 2X1VA 3CH5A 4JMPA 1NLZA 5G53C 1S2MA 1KMQA 1SULA 5FR2A 2JLYA 4TSFA 3R8FA 4YMVA 1YQTA 4M9SA 4UXHA 4B3FX 1XEWX 1Q22A 4LI0A 3GLIE 2GVZC 2JJ1A 4RZXA 2D06A 4FCTA 5HE9A 1P9RA 1KMHB 2QY9A 4EPVA 3OIUA 1QZMA 4ZPXA 3PR1A 4S2EA 2GJKA 4KLNA 3A4NA 1WP9A 3K1JA 4YMWA 4BUJA 1FNMA 4D4KA 1G3RA 1KY3A 3BXZA 3ZVMA 3LVQE 1DTSA 1Y3AA 3VX3A 3EZ2A 2VHJA 4AG5A 1EX6A 2ECKA 2C9OA 2ORVA 3NG1A 2IEZA 2G1KA 1X86B 1XTSA 1NIPA 1CR4A 1FX0A 4C0HA 4Q21A 1Q20A 3KQUA 4GOKA 3H86A 1G3UA 1D6JA 4LUCA 5K8TA 3DDCA 5J4VA 3OAAD 3Q7QA 2I1QA 3I4LA 4TL7A 1E2JA 4N1AA 2ZRHA 3WBKA 1M34E 4HAVA 3HR7A 2NQ2C 1I4LD 4W5WA 1JPJA 4DKXA 1F48A 1I2MA 2V6IA 1KI2A 4IVRA 4LPKA 3H0KA 3CZQA 2PT5A 3THXB 3R9WA 1TF7A 4GRAA 3AJIB 4U7DA 2GZDA 3H1TA 5LBIA 2VSOA 1IN8A 2C03A 2RB4A 1MRSA 3WXMA 2V9PA 2QE7D 1EESA 3O47A 2ZRFA 1E9AA 4JLJA 4AC9A 4GOJA 3SHWA 1U9IC 2WWXA 1Z0IA 1MABB 2WIBA 1N6PA 3R9IA 1JXMA 1ZW6A 3IQWA 1P2SA 4C0QC 4D80A 3GLIA 5FUXA 4YDSA 4EJSB 3TUZC 2F6RA 1BMFD 1OIVA 1IN5A 5KYKA 1NN1A 3M0EA 2FG5A 3BIFA 3MG9A 4G5OA 3HPRA 3V4RA 3GLFE 4JSTA 3LO5A 1JXOA 2PBRA 3ZH9B 3AV0B 2HXSA 2QG6A 3QJYA 3UMRA 3ZS9A 3LQRA 3SC3A 1R0WA 3A4MA 4Q4AB 1M7BA 1ZM3A 1D9XA 2VBCA 2ZJAA 4FINA 2QL6A 5LPNA 1ZNXA 2H5EA 4DRZA 4QXAA 1A4RA 4QGFA 3B78A 4B3BA 1W0KA 3M1IA 3D3QA 4QL3A 2NO0A 2H18A 4EAQA 3AKCA 2PZGA 3M4YA 1UBGA 2PJZA 1UF9A 4KFUA 5DLQC 4BFUA 4C0AC 1W4CA 3NEYA 4UXJA 3FDIA 3KKOA 3K0CA 2FNAA 3SDZA 2A30A 2QMHA 5JRJA 3SQWA 2ODWA 2EWVA 4RFSA 2VQSA 4WZBE 4WVFA 4BZXA 2Q0HA 1KJZA 4LHVA 3DOEA 3WBJA 3WY9A 2FFAA 5CB8A 4XVRA 4RCZA 2F3RA 4B76A 4KI0A 4U5XA 3Q8XB 3W5JA 3ND9A 1U2RA 2W0MA 2ODEA 2R6AA 4HDOB 2MSEB 4D4LA 1J8MF 4TTQA 3VR5A 3IDQA 2VP2A 1VPLA 2FZLA 2OE2A 3AVQA 4Q1BA 2J7PD 5F98A 2V8OA 1EX7A 2QAGA 3TSOA 4A9AA 4Q5IA 1ZVQA 4Q03A 1FW6A 1E2KA 3BFVA 1TL7C 4Q66C 4K8OA 1TX4B 4Q1AA 1JEEA 4G3XA 3SS8A 1NJFA 3FYHA 4Y0VA 3WYFA 1DAMA 4TMZA 2PLFA 3WRYC 5JWOA 4NCJA 4RJLA 4TMTA 2EWWA 3KTAA 2GXAA 1F60A 3LAWA 5GVRA 3W90A 3T1TA 1IN6A 2YC2C 4M9QA 1XZPA 2XXAB 5CJ2A 4DB4A 4RD1A 1ZD1A 3L0IB 4P4UA 4QKQA 3B9QA 1ZCBA 5JI2E 4X8OA 3FVQA 2XX3A 5KSYA 4BRWA 2IYLD 3OAAA 2HCJB 1JAHA 1UBFA 4C2TA 2B92A 3OHMA 2WAXA 3AF0A 1CJUC 4IDQA 4DEYA 5JZVA 2QRZA 3A1SA 2QEQA 3NC0C 3BGWA 1AS3A 3IKJA 2IX3A 721PA 1G16A 1E94E 3A1VA 2RGAA 2WWYA 4OHYA 4L16A 4IFBA 3BWDD 2V1UA 5LDDC 1QHYA 2AXNA 3RS7A 3QG1A 2QMUA 2ZI6A 4TLAA 4OHWA 2OG2A 3N5CA 4I1OA 1G64A 1OE0A 2C2HA 4BFSA 2P0EA 1X8KA 1ZYUA 1T6NA 2FFBA 3KKQA 2ANCA 3E2IA 1B0UA 5EP4A 1E6CA 3BAFA 5LD2C 1IN7A 2GJSA 4D4MA 1G8YA 1JQLB 1N3BA 3ZVRA 4BLSA 2Z4RA 1NL3A 1KK2A 4QOSA 3QKSB 3ZJYA 2AHOA 1KNQA 3X1XA 2DFLA 3MCAA 3QKTA 3IIJA 2RGGA 1M6NA 2OCAA 4B35A 2ZXUA 3AP2A 3GLHA 1F6BA 2D4HA 3FB4A 2OM2A 4DDTA 4TQ9A 2GEVA 3A4LA 2PZEA 2VP6A 4M21A 3LW7A 3RDPA 1FQKA 2QNRA 4LJ5A 5E3HA 2ZETA 4DLXA 4ACBA 4YQFA 5FTLA 1R2QA 1RIFA 1KI3A 4FWGA 2BEKA 3LV8A 3VU9A 3RWOA 1ZM9A 3X1ZA 3A1TA 1SVOA 2D74A 4IHQA 2PEYA 4MITA 2QI9C 1NRJB 2IS1A 2AD5A 3AUXA 3EASA 2YWGA 1ELOA 4MDEA 1JNYA 5SZIA 5BN4A 2V6ZM 1WBBA 5HKKD 1Z6GA 4PPQA 1II9A 1BO6A 3Q5EA 2R2AA 5FL3A 1E2QA 2R44A 1OXUA 2ZI9A 4GL2A 3NH6A 1U8ZA 1ONBA 2FF7A 2QSYA 3LFUA 1FX0B 4HUTA 5JECA 3DL0A 3IBGA 1NVVQ 4AD8A 1P7CA 1MT0A 1YHNA 2ZPTX 3K9LA 1V5WA 4CZ2A 1E98A 1K6MA 3X2SA 1KNXA 4U00A 2C98A 1Z63A 4GPTA 2FH5B 4DLTA 1N25A 4O2RA 221PA 1KIMA 1UJ2A 4MQBA 1E99A 3H4MA 1C1KA 1T5LA 1US8A 3WP1B 2F9LA 1JPNA 1IONA 1E1RA 2ZSFA 2O5VA 4PQYA 1GVNB 1OH6A 1JJVA 1NIJA 4HLUA 1GWNA 1U8AA 4LCBA 3AVUA 1HYQA 1LF0A 1SHZA 1Z0JA 2ZE6A 3EG5A 4JYBA 421PA 1JR6A 2FMXA 4B74A 4HAUA 3HWSA 1P6XA 3IO3A 1T9HA 2NMVA 3EA0A 2DYKA 3QBTA 1CU1A 2NO7A 1E2PA 3BBPA 4V0MA 3EPHA 3DHWC 3ZZ0A 2RAPA 2W2VA 2TMKA 2J59A 1NN0A 3U3JA 2ORWA 4PPGA 2R62A 3VKWA 2QT0A 2GCPA 2WM9B 2QROA 2WWWA 3TUIC 4ARZA 2ZUDA 2P65A 4Q4JA 1XXHE 3PFIA 1W36B 1XZQA 3HYRA 1XB2A 2ZRJA 5SZJA 4OI2A 1LVGA 2J41A 3PEYA 5HTKA 4FWIB 4HUQB 4KFRA 2O8CB 3LLMA 1ZM2A 4NZYA 4OJKA 3ICQB 4V0NA 1NY5A 2LCFA 4RZUA 1OFTA 2ATVA 2ZJ2A 3AVXA 3DPUA 2FEOA 3DO6A 1NP6A 1GNRA 2XTZA 2GEUA 3ADKA 3F0TA 4RSGA 4HLUC 5L3SA 1Q1ZA 2XITA 2ZRCA 1LB1B 2I3BA 2IHBA 2CVFA 4QGGA 5CM8B 2DB3A 2ZM5A 1RRCA 1YZUA 5G41A 3CIOA 2N42A 4JBXA 1Q57A 3EIQA 2WJYA 1PVOA 3ASYA 5BYJA 4WZ6A 1YR9A 2IUUA 1JEDA 5FBRB 5CB6A 5CLLA 4URWR 4JLMA 5M04A 3SJAA 1NVUQ 3VTKA 1TNDA 3VHLB 1I2DA 4TSFD 4II7A 1RRPA 1A82A 3TQFA 1ZP6A 1AA9A 1CR2A 2J5XA 3MJRA 1W4BA 2WJVA 3KJIA 4IDPA 4J0QA 5A0FA 2RCNA 3K0FA 4GMDA 2YC4C 3MSXA 4EUNA 1SXJB 3MWLA 2BM1A 2UVQA 5E7MA 1Z2CA 4HZIA 4V0ME 1OKKA 3UANA 2QAGB 1D2NA 3SI7A 1WQ1R 4BFYA 2RGEA 3CO5A 4PAMA 2JJ2A 2ZI5A 5AK0A 3BE4A 4L4UA 2JIZD 4CT5A 1VG0B 3TMKA 1JALA 3FKSD 4UNSA 1J8YF 1P2UA 1E9FA 4MYUA 3QEOA 4WA7A 4EJSC 1Q1QA 3I5YA 4AKGA 2IL1A 4AIIA 2RGDA 4ZCMA 3NBFA 4QGAA 1YZGA 1RJ9A 3GQBA 3O8BA 3OIVA 1QBKC 5GJVC 3PV0A 1AJEA 2REBA 2QSZA 2ZUBA 2ZRIA 2WWGA 1XPRA 1GKUB 2C9YA 4BLRA 1HT2E 1MH1A 2FJUA 5BN3A 2JLWA 2VP5A 5JJLA 4FMDF 3CRMA 3EIEA 1XCMA 2GCNA 1G41A 1FUKA 1SHKA 2QP9X 3KJEA 4DLUA 4GBMA 5IK2A 3QSYA 3JZMA 5FTNA 2ZE5A 3BH0A 1VCMA 1PZNA 4P4TA 5L3QA 2O8EA 2P67A 4HDCA 1FZQA 2DZNB 1AGPA 3BH7A 2ZS9A 4C30A 1Q12A 2ZQ5A 4R9UC 2G6BA 1Z47A 1W0JA 4Q9KA 2YWHA 5BYKA 2C95A 4EFLA 1W47A 1DADA 1HURA 4HB2A 5CLQA 3PEUA 1K8RA 3GJ7A 4IEIA 2A5DA 3ADCA 5B30A 3ZS8A 1GL9B 1RZ3A 3GLHE 1OIXA 1EGAA 1W4RA 4C3ZA 2J7KA 4QBFA 521PA 4ZDKA 4M4SA 3VR6A 1YKSA 2WKPA 4P31A 3NC1C 1HQYE 1OLOA 1TEXA 5FBLB 2XJ4A 1FMLA 2F1RA 2WKQA 1R4AA 3DOFA 1IHUA 2FGJA 4QHYA 1OSNA 1HV8A 5DHFA 2XSZD 5GADl 4Q19A 3LBHA 3NBXX 5TVKA 2WSSD 4K81B 1CBUA 3P4YA 4LY6A 2IF0A 5AJVB 4NYJR 3THXA 3I32A 1FTNA 4FW9A 3KB1A 4RY2A 2XNSA 4LZZA 1VDZA 3VHXA 1LFDB 3KQLA 1G8PA 1XMVA 2NOAA 3C41J 4ABYA 3OF5A 2QA5A 2QENA 4KJZA 1I4TD 2ZRNA 1GL7A 1VHLA 2IT1A 3VNUA 1OXVA 2R8RA 2WWFA 3K09A 2OEPA 4LGMA 121PA 2F1HA 2QN6A 3EZ7A 4P33A 4BFZA 2ZSBA 5JLJA 1QHHA 4LBYA 1JR3A 1D8TA 3LW8A 1XJ0A 1ZJ6A 2NZ8A 4NE2A 1N6RA 4W7SA 4YMSA 1CRPA 1WA5A 4PAQA 4YLGA 4BLPA 3RC8A 3I3SR 1WBDA 4PHTA 3EZ6A 3ZYCA 1N5IA 1N6IA 1BS1A 1G8FA 1UDXA 2YWEA 3LWNA 4O25A 2DHRA 2PEZA 4TLCA 4XD7A 5J47A 2VTKA 3THYB 1WCV1 4G5GA 1Q3HA 2PH1A 2QORA 4RFVA 2KI5A 5H8WA 2BMFA 4FWTA 4EIWA 4V02A 4B47A 4E03A 3AF3A 1EK0A 4A8JB 2B7BA 2OBNA 5A5GA 2R6CA 3F3YA 3CNOA 4XTCS 1XD2A 2MMCA 4PO8A 1DO2A 1QG2A 3PXGA 1XWIA 4IEEA 4D6PA 4IDNA 3CKLA 1Z83A 3THWB 2ZJ8A 1FMJA 5DI9A 1XTRA 4A1FA 2QPOA 3EPJA 1SKQA 2W0SA 4PX9A 1XJQA 3AVWA 4D0NA 1E4YA 3HR8A 5JSZB 4KO8A 2BBOA 3E70C 3B1XA 1XMJA 1W7AA 4QJ4A 5J4LA 1SZPA 3D6TB 1XJCA 2GTPA 4Q1EA 1KJWA 5EUQB 3SHFA 3U44B 4L9SA 5JEDA 1S1CA 4G1UC 4ZKEA 3C8UA 5AWFC 4PO1A 4C7OA 1KSHA 1XD2B 2BCJQ 4IW3B 4XWAA 2DVWB 5EP1A 2CLSA 4PPFA 3RC3A 2WPDA 1S96A 3GLHB 2QQEA 4DUGA 4JT2A 3K70D 1T0JB 4ESVA 1XX6A 5IRCD 2I1VB 1KZGB 3C5HA 2DWZB 4OYHA 3KW6A 2CCGA 2CLCX 1VMAA 2ZEJA 2NPFA 5FUYA 2ANBA 2NTYC 2E1RA 4UNRA 1OJLA 1P2TA 3ZVNA 1R8SA 2FPLA 3PUZA 4PFSA 1W1WA 4OI0A 1K5DA 1NSTA 2GJ8A 4YC7A 2ZRGA 5L8VA 4PHGA 4QHTA 1UAAA 2KBEA 2GZHA 2N46A 1U0HC 3N70A 4H1UA 1TU3A 3U7FB 2PJRA 5B57C 3SN6A 3JVVA 2ORIA 4DT1B 2Z5FA 4V0KA 1HA3A 1P62B 2ATXA 2XB4A 1GITA 2ZAMA 1E2HA 1HE8B 4LYFA 2CE7A 5EXSA 3KB2A 4Q9HA 3UG7A 3GLIB 1ZUIA 3MMPA 1X8JA 4JVNA 1DEKA 4LHXA 3FMFA 3H2YA 4K46A 4Q4HB 3ADDA 3WMFA 3JVUA 1AGRA 4MGKR 4IOKA 2JLZA 3EX7C 4WXRA 2HF9A 4V03A 1E79A 4LRWA 3D7MA 2ZJZA 3W6OA 3IEUA 2ONJA 1T8TA 2A5JA 1XBTA 1MO3A 2CL6X 1T91A 1GDDA 5EE3A 1XPUA 4QJ3A 3BH6A 3C14C 4A0FA 4TTRA 5B58C 3TBKA 3RS5A 1RPZA 3NHBA 5G3ZA 3WNDA 1WB9A 1AKEA 4PR0A 2YV5A 3EARA 3I92A 5JFGA 2FWRA 2VF8A 2QPAA 1GZSA 2IYSA 1RE0A 4EJSA 4NP6A 3GJ4A 3W34A 3MWYW 2IWRA 1E1QA 4IXMA 1P60A 5HR5A 2CHVA 1IBRA 1JJ7A 4YDHB 3BERA 2OT3B 4TYYA 2WSMA 4M0LA 4EPTA 3ICEA 1U8YA 2HDNB 1CS4C 2W6ID 4HZUB 1NBME 3TQCA 4PZLA 3T12A 4QFMA 5J4YA 1VCIA 1VYUA 3EAQA 3LX5A 2XB2A 4NL4H 4UXIA 4IFEA 5IHPA 2ZIAA 4KCGA 4G5QA 1SQ5A 2IS6A 4JLPA 3IGFA 2JLSA 2GWHA 3RAPR 4G0NA 1TQ2A 5FPTA 2ERYA 1CJKC 3CF6R 4LJAA 4BLOA 4WBSA 2DZOB 2BMDA 4PC3A 1UKYA 3VU9B 1DAKA 4N3NA 2OAP1 4EFMA 2YVUA 3HP1A 3Q3JB 4KYUA 1DAIA 4MKGA 1AKYA 4BLQA 4KSCA 4JLKA 4KFTA 1YVDA 5CITA 4MUAA 2DWQA 2VHUA 4AY2A 3RWMB 2O0KA 1PJRA 3RNLA 4AK9A 3SJBA 5JSZA 1UEJA 3KJHA 3QY0A 3FFBA 1KI6B 3FKSA 4PQRA 3IBYA 3WMEA 3O8RA 2RHDA 2YZ2A 3IO5A 2GK6A 2GETA 3K8YA 3K0AA 3ADBA 1ZNYA 2VP4A 4IVQA 3T5DA 3TR5A 4B34A 5J4KA 4BEBA 2GCOB 5FI1B 3AF2A 1QZXA 2IYWA 1ZIOA 3VLFB 4L9WA 4FCVA 1QHSA 4B6EA 2O8EB 5KPJA 2HJGA 1CULC 1NSFA 2QRNA 2R6GA 3PEVA 2W2XA 2QM7A 3CNNA 4FWDA 5DO9A 2VSFA 3THOA 4JBYA 1H8HD 4PSVA 2ZE8A 1Q1EA 2EQBA 5JCPA 2KSQA 4NMMA 5FTMA 1L4UA 2DWPA 1G4UR 3WMGA 3NTUA 3CUEF 1P4SA 2QAGC 3G5UA 2DWOA 4CW7A 2DY1A 3G0HA 2XGJA 4OQFA 2ASEA 1IM2A 4XSHA 3KKNA 2YKGA 2J45A 3NBZC 2QM8A 1COWA 1TQDA 3KZ1E 4FN5A 3F8TA 4A92A 3I61A 4HB3A 2REXB 1N6NA 3U61B 2QTVB 3QF4A 2JLXA 2J0SA 2CHGA 1UM8A 1ESMA 1GNPA 4QJ5A 3X1DA 4BPBA 8OHMA 2X2FA 1E9EA 4DCSA 5HKKA 1ZD8A 3P27A 2C96A 4XIGS 5K8IA 1KI1A 2B7CA 2DBYA 4X8LA 5AJWA 5JJIA 5JHGB 5C1BA 1H8ED 4GI7A 4GT1A 4US1R 1KI4A 3EA5A 4JLAA 3I5XA 3K9NA 2HYIC 4D25A 5E4FA 4MRVA 1RYHA 3MUFA 4DEXA 5KNCA 4I4LA 2XJ9A 1JI0A 5JI3E 2MSCB 1A1VA 5EE0A 4RKFA 1E2DA 4B2LA 1XEXA 4LC0A 4ASUD 4OK3A 2FA9A 3ONWA 3GCGA 4RD4A 5LD2B 3N2IA 1SXJD 1KO5A 1Z6AA 4TLDA 4KAXA 3IIMA 4BFVA 2Z6VA 4CT4B 4TT3D 1CXZA 1IN4A 2V54A 4Q4LA 3REFA 2AD1A 4Z1MD 4GP7A 1E0SA 3AGPA 2A5GA 4JL8A 3Q72A 5IF9A 4Q9LA 4DSTA 1O3YA 3MLEA 2OBLA 3TE6A 2IS4A 3GLGA 5FOVA 2ZYUX 2IYRA 2JLUA 4D0LB 4KBGA 1XFAA 2VF7A 3TK1A 1BIFA 3V4FA 5FPSA 3FWYA 1DPFA 3RS2A 2JJ8A 1Q0UA 1ZU5A 5JEEA 1GFIA 1W48A 4DSUA 5FOSA 2JCSA 5EZ6B 4KBFA 5DN6D 1K5GA 3RSOA 4O3MA 1KO8A 4CYMA 2XZLA 2ZREA 4LJ8A 2HXYA 2VRWA 3CF0A 2X77A 1OB2A 1G5PA 1US8B 4IDHA 4TMWA 3NEJA 3T1OA 1QRAA 3AP3A 3QENA 2ZRBA 4LWZA 1Q44A 1FL9A 1SGWA 1UFQA 5TARA 1T0HB 3AM1A 5ELXA 2ZSAA 3EC1A 1NMZA 5FOUA 3IIKA 3RANA 1ZCAA 1YZTA 4ZDWA 4HB4A 1W2GA 4XTRA 3C15C 1AK2A 2BWJA 2VH5R 4LX0A 5BN5A 1C4OA 2WPDD 4LV8B 1R0XA 2WICA 4X8MA 2V1XA 1UKEA 4M1KA 4Z54A 1YU9A 1DS6A 2BBTA 4HLCA 1A7JA 2NG1A 3WYGA 4CF7A 3W9YA 1P3JA 4URUR 4QHSA 5DYGA 3NXSA 1SVIA 4RD3A 2OO7A 1P9NA 1AS2A 2W2TA 4ITRC 4KSBA 2P5TB 2J3EA 3TVDA 3K9GA 2GAAA 4D4JA 4EDHA 1KDRA 2OHFA 4Q1CA 4IKEA 2IYQA 1AS0A 4OI4A 1PUJA 1QDEA 1G3MA 4B3CA 4QM7A 2C5LA 3O8DA 1OHHD 5DISB 1GRQA 2FZ4A 4DLYA 3KL4A 4XWOA 3SJZA 1LTQA 3MHVC 3QKRA 2O8DB 1GRRA 2ODBA 2WBLC 1ZUNB 4C9BA 1OH7A 2CMKA 4FMBB 4A82A 3QPVA 4Y0AA 2YYZA 2OUKA 2ZR9A 3W8NA 1OXTA 3CRRA 1G3QA 1KAGA 1KGDA 1Z0DA 1VHTA 3AF4A 4OJQA 2WVJA 1W5SA 3D31A 4MGIR 4D0GA 2R65A 1S0UA 3T61A 4PZYA 4UJ3A 1VG9B 1NG9A 4L15A 3SNHA 1ANKA 4A0GA 4KLZA 3CZPA 5TDHA 4B73A 4TT3A 2JJ2D 2P6RA 2ZJ5A 2P6NA 4EQ6B 3U4QB 4C0JA 5HCNA 3P20A 1N5LA 3V00A 1GM5A 3T34A 3CBQA 2IWHA 4A0HA 3X1YA 1G291 2AXPA 4I1SA 3B6EA 2V3CC 5FBWB 3S1AB 1AM4D 1I4DD 1A2BA 3GJ8A 2ONKA 4TQAA 4TTPA 2GA8A 3GLFA 1TUEA 4X8HA 1ZNZA 2ZRLA 4UNNA 5E7IA 3HPQA 1M7HA 1AQYA 2IBMA 2OV2A 2BEJA 2X19A 4OK5A 4GOXA 5TY0A 2CE2X 4OQNA 4D82A 2HV8A 3RVBA 3UMSA 3PJRA 3SBDA 3A1WA 5JHHB 2O0HA 3Q85A 3AH8A 4PC7A 1YR7A 2JLRA 1MV5A 3TW8B 4Z8YA 2DFKB 1CLUA 621PA 2XOKA 5UKDA 1OFHA 1FUUA 1UDWA 2HUPA 4IRUB 1ETUA 1XU4A 4MRRA 1G4AE 1WXQA 3Q9LA 2BC9A 4TMVA 3SOPA 4AYXA 3QNUA 1G19A 3KJGA 3NWJA 4G5RA 4Q00A 5HPYB 5CIQA 4ZIRB 3TRFA 5FL7A 1FOEB 1G1MA 2HJVA 4HSEA 2XNDD 4PZZA 2OBMA 5L3RA 1RW4A 5CM9C 5BW8A 5KDLA 1G7TA 2GJ9A 1QVAA 1LS6A 1UEIA 4KODA 4DLSA 3TVTA 1NKSA 4MGYR 2O8BA 4A2WA 3QKUA 2GDJA 2Y8EA 5D3MB 3WHLA 4D26A 2ZRPA 5CK5A 5AJXA 4DLRA 3QXSA 3CX8A 4LDJA 1X1SA 3PUVA 2WTUA 1XTQA 2CXXA 4Q1DA 3NDPA 2RGCA 2Q3HA 3AF1A 1RC8A 1U90A 1ESNA 2OFOA 2WMNB 3EW9A 5FPHA 3R8CA 1KK1A 5EP2A 3W5IA 1R10A 1XTJA 3TLXA 3IQXA 1XCGB 1S3SA 4NCHA 1II8B 1G5RA 3CRQA 3B1YA 1Z6YA 3EZ9A 2IYTA 2WJJA 3QVVA 1F2TA 2N1BA 4MYTA 1NVWQ 3LH5A 4OL0A 3N2EA 4DB2A 2IYYA 2KE5A 4DIDA 3L0SA 3P4XA 4NYJQ 1XP8A 3LXRA 4XVQA 2QP4A 4DSNA 3SQXA 2F1JA 1N6KA 2W58A 3WNBA 5FTKA 1G9XA 4LJ4A 4W5JA 5FFMA 1UBCA 5G40A 5KUTA 2ZR7A 2F55A 1RFLA 1AZSC 3BFXA 5JWRA 1TTTA 1NI3A 1PLLA 4LJ6A 3Q7PA 3A37A 5GJWC 1E96A 3NIBA 1KDPA 1ZC4A 1OFIA 5JMTA 1S8FA 2AKAB 2R9VA 3KQNA 2Z43A 4B6FA 2D7DA 4PAOA 4B2PA 3BRWD 2QPTA 4RVCA 3B7GA 1Z0AA 3RRMA 5EUMA 3FGNA 2QBYA 2JA1A 3LA6A 2ZI7A 5KDDA 5A4JA 3WP0A 5K8LA 1QHNA 1C9KA 4AKIA 1II0A 3P1JA 4LJ9A 4TN1A 1N5KA 1L4YA 1W2HA 1HE1C 2QGZA 1KI9A 1U0JA 2BCGY 2W6JA 1R5NA 3WRXC 2Z0MA 1S3GA 3OEHA 2Q9CA 2PCJA 3QKSA 2CNWD 2RH5A 3I72A 1P5ZB 4KITB 2WAYA 1GG2A 1Z08A 3NKVA 1XMIA 2WOOA 2EVWX 1EFRA 1NKTA 1DVRA 1T3HA 2C77A 3A36A 1E32A 1QHIA 4JKYA 1DAEA 4B44A 4BGDA 1JECA 4JLBA 1C1YA 5J4HA 3U3OA 5DYIA 1Z6TA 4US2R 3AVTA 1D2EA 1OH8A 5AUOB 3KQHA 3DMDA 2PMDA 2DFTA 1ZINA 2VO1A 4JJKA 4MRSA 4B3XA 1E9RA 3TAHA 3GEHA 4UQOA 4CEIB 1HH4A 3CR8A 4DDVA 3ZD7A 3MAAC 1VCOA 1UADA 3EZFA 4NCNA 2PCLA 2VP9A 4ZKDA 4DJTA 3CRVA 4BWYA 3U3KA 4TYWA 1YRBA 1NMXA 3AUYA 2F7SA 2F9MA 2IYZA 2IUTA 1S9DA 1SXJE 5EXXA 1BMFA 3CNLA 1VYTA 4AG6A 3FMOB 2CK3A 4DHEA 4F7WA 4XH9B 3NVAA 2Q3MA 3SFVA 1HTWA 4PANA 1SVMA 1E0AA 3GFPA 5KNBA 4DCUA 4TMKA 2B8WA 2CEAA 3FHTA 1LNZA 1IY1A 1U94A 2H57A 2J87A 4FXPA 4GZLA 2ODNA 4HAXA 1DO0A 4IJMA 2SHKA 4Q47A 4N0DA 4ZV4A 4A0RA 3VAAA 2GKSA 3ZDQA 4DDUA 1JAIA 3HDTA 3L0PA 3VR1A 3VMFA 1LS1A 5FOTA 2J9RA 3QUSA 3KX2A 5KHOC 5DE3A 2A2ZA 1Z5ZA
chains in the Genus database with same CATH superfamily
1F4PA 1IBLM 2BCEA 1NLFA 4QPJC 2E7ZA 3ZE2B 3V34A 5K4AA 3GBSA 3WRWA 5EG5A 3TW4A 3A6HA 1ZMWA 4JL5A 3S8MA 2JP7A 3FUXA 1RFGE 2E1PA 3DBVO 2IYUA 4B3GA 3KQKA 2V74B 3EYWA 1ZBQA 1TYDE 3ESAA 4DSOA 2FPKA 5A06A 1IU9A 3D4IA 1Z28A 5KTTA 5ALQA 3ZHTA 3QFTA 3JS5A 5TC4A 5IFLA 3CH4B 4KYIB 1QNFA 4O2AF 3GLTA 1CF9A 5EKTA 1P9WA 2H2HA 3C8HA 2FSIA 2VYNA 4G5SA 3PL1A 1KQFA 4F93B 1J56A 1PX0A 3WWOA 3ZW9A 3MGBA 1I7PA 1D2AA 3C7KA 1W0JD 4FDUA 4OYYA 5IBRA 1QGZA 3VO1A 1NURA 1CEXA 5KSPA 1PJTA 2VAXA 4LF5M 3THYA 1Q91A 2G7ZA 1FXWF 3FY4A 3PXEA 2CVPA 1EAYA 2YOFA 4AZ0A 2IP2A 1X0VA 2Q41A 2CD7A 1XZEA 1Z0SA 1CUXA 2WHPA 2PZ8A 1P4RA 3OZEA 5KNDH 1N9GA 4ZGGA 4HGQA 5BN4B 3ZV3A 3NHKA 3PWSA 5CYOA 5JZMA 3L7MA 5L3SB 1C4KA 1QH0A 1W34A 4J1TA 1JIUA 4QTYA 1EM6A 4QECA 4OFZA 2YINC 1H0RA 2HWXA 1KVTA 5A9SA 3LHSA 2ATEA 3U6CA 4YUVA 3ZCVA 5L95A 4IJVA 5ESWA 4JL6A 4KN8A 3TIVA 4F9EA 5LWHA 4CKWA 3H4TA 1DCTA 3W1VA 2YFYA 2RHMA 2I7DA 1XZLA 3H8VA 5E3IA 3U7RA 5AHOA 3ND7A 2JJYA 1M54A 3T5TA 4LKRA 4GP6A 5FO0A 2R1VB 3P7MA 4U63A 4D41A 3CSDA 2G9RA 3I3OA 3Q0TA 1WPQA 1GEGA 2AOTB 3EEBA 2UZ0A 1SZJG 5SZKB 4FZVA 3LFHA 5BW5A 5I9IA 1L8LA 2BKUA 2JEOA 3HDVA 1JEJA 2C00A 1T26A 5KYGA 3S4YA 4BNNA 1UL1X 2BVNA 3RUAA 1MBZA 3G2PA 2EQAA 3W6UA 5C8ZA 5D3QA 4MUGA 3TTXA 4LSGA 4E2ZA 1KY2A 1Y9ZA 4CKCB 1TLTA 3P96A 1ZR2A 3RAEC 4EVIA 1X7GA 3UVEA 5AI8A 2BWBA 1AMOA 3C7DB 1CF4A 5H59A 2QUKA 5CXXA 3C5CA 5HQJA 2LHGA 2ZSIA 1WUKS 2IC5A 4E08A 2X41A 5AKKA 4QOFA 2Y0EA 4QASA 2VTEA 3IR5A 2CDBA 3O31A 4US0R 3UKOA 4CLXA 2V4ZA 2MIIA 2WTMA 2Y99A 3PJEA 3LY5A 3PT5A 4P92A 3KVRA 5GP1A 3SYNA 3WGVA 2QN2A 4C4XA 4CEIA 2P4UA 5CCDA 2PWYA 4O4IB 5COBA 5EJIA 4UE3S 1J2JA 1HC7A 1D8AA 1J49A 1L7DA 1PSZA 3L5OA 3N8HA 3DW3X 4H1VA 4XX1A 5AKXA 4F4DA 1FU8A 1M73E 2RAUA 4RMNA 1QF9A 4WCDA 4WLUA 3DZCA 1RYEA 3F2IA 4ZO7A 3RHSA 4KFCA 3RFFA 2AJLI 4GSYA 4HYTA 5JAMA 3LBIA 2YJTD 5CDFE 2BMWA 4PM4A 1RHMA 4G23A 2V6FA 3JYHA 4IIGA 1PEAA 4OP3A 3KPVA 3RS4A 1LPSA 2VR1A 2WVAA 3U3MA 4CGZA 1C0PA 3EVEA 4XD2A 2D5IA 1W5TA 1R5OA 2ZIGA 4HNRA 2OO3A 1ZRMA 5YASA 3W6NA 4X64B 3KFUG 2FWIA 5JCZA 4P4SB 2LP4Y 3CO0S 2PG3A 2HAEA 3O8OB 4FC6A 1FXWA 1P7WA 2Q6TA 3QX8A 2DECA 1SC3A 1H22A 3B1ZA 3N8NA 4NR0A 4Q4AA 3VH2A 3W3ZB 4QZVA 4XIIA 3U3RA 1PR0A 3IUEA 1XSEA 3U6MA 2IW3A 1K3XA 2XOKD 4MQMA 1UZAA 5CJPA 5I9SA 2VL7A 4PHFA 3E6AA 4GM1A 3LRPA 4CR6A 2HUNA 5H70A 2C1EA 1ITZA 2IHVA 5LB4A 1D0IA 4BAGA 2BOVA 1NQ5A 3H5LA 3AJAA 3H2JA 5IBCA 4RTMA 4PTLA 2OCLA 4K05A 1QC5A 2XCTB 1NJ2A 2BTEA 2IFTA 3H5RA 4UOZA 4OMDA 1QYRA 1DQPA 2H2WA 2LWIA 4O1HA 3HKCA 1BDJA 4D45A 1Z88A 1DDOA 1WW3A 3D1JA 1NXVA 4N82A 1G4HA 1FJHA 4HVTA 2OCGA 4F06A 2YDYA 3IP8A 1CP2A 1MOSA 3L93A 4U7HA 1ZMUA 2BP7A 3U3ZA 2BKAA 4BMZA 2FU5C 5CEEA 1KO1A 1IXSA 4COKA 6NULA 3R6LA 2JKYA 4BQPA 3KEGA 1Y37A 1OT3A 3FTQA 4L8LA 4BB6A 2VEDA 3A7DA 1CQPA 1XQ1A 3P0FA 6YASA 4MDFA 1L9XA 3DDOA 3R3JA 1O9GA 3DAYA 1I7SB 4DR5B 1RYFA 2JH9A 4NAUA 1DCMA 2ZDQA 3G1UA 1BE1A 2XT9A 2P35A 3PF9A 4N0PA 4QDJA 5K3SA 3I01M 4H6PA 3OQBA 4HNUA 2V7WA 2IBTA 1ECCA 1GZ3A 1SXIA 4BE7B 2ZJ1A 4ALNA 1JFFB 4L5CA 1OFUX 2CL5A 1RE1A 1TEHA 1UOQA 2P6UA 3ISJA 4G1MB 1W581 2YIVX 4PYQA 5EE1A 4DTIA 1FJGM 1N5JA 2LPMA 5HCIA 2JDID 4DA4A 1UK9A 2EX4A 5J2TF 4ZYXA 5FPQA 1OXMA 2HW8A 3BRWA 3A9TA 3GF4A 1CF2O 3L7YA 3ED1A 1XA4A 1Y8RB 3FNIA 4MVJF 4Z9XA 4DMUB 3DZHA 3DDNA 3W5CA 4R1UA 2AG0A 3Q2IA 1RYZA 4BKOA 1KAEA 4IHJA 1ZC3A 4IAOA 2PH7A 1TK3A 4HWSA 3SKXA 4JIMA 3MPOA 4FMCF 1RKVA 1NDQA 1WF3A 3BB3A 4C4ZA 2F4NA 4GITA 4AN4A 1HQCA 3KT6A 5EWLB 3M6MD 5L3QB 3I2IA 3WWEA 3F49S 3M9WA 4YQEA 3RU2A 2VVTA 3UMVA 3HFRA 5AXCA 7ADHA 5IVKA 2OZLB 1NE7A 3UPDA 3SS9X 4EFDA 4NNJA 1PLJA 2I99A 1MC4A 1SUFA 2ZI3A 5D1NA 3DZBA 4JVLA 5C46F 5CFLA 5KCZA 3WIEA 4WXHA 4OBEA 1E6WA 3TN7A 4LFBM 1KZ1A 1F9EA 5AVVA 3TWMA 3L01A 3OEEA 3FNQA 3PDJA 4TTAA 1JR3D 3IDOA 4XK8F 3DT9A 3VHQA 1F0KA 1L5RA 3H84A 5JZOA 4KXYA 2CY0A 4JCOA 3EVTA 2BEUB 4QRIA 5EMLA 1P73A 1Z6QA 3SQDA 2ZCJA 3W5HA 4QUJA 4RVNA 2ORYA 4OGFA 4YPFA 3RSLA 3PUWA 5FA6A 2AR7A 1C0EA 3NTOA 3E7FA 4Q18A 5CYPA 5AJYA 3L8HA 4HL4A 1UFZA 1T5TA 3NUZA 1HK7A 4TXHA 4A8TA 3G9UA 2RI0A 1Y1RA 1D6SA 1A2OA 4BMOB 4AVYA 4EPWA 1J4AA 3F5SA 1E9DA 3ZUGA 1RVV1 4KFSA 1PUXA 1LEHA 3TLCA 1E3WB 4ILEA 4KBYA 4ZJYA 3OJLA 4F4CA 4EDFA 1WCYA 1BH2A 3COPA 3L1UA 1AZTA 3IEXA 4O2LA 4QSHA 5CVDA 5HILA 5KWVA 3KDAA 2H1FA 2IYXA 1IPFA 2C2MA 2O05A 3BSWA 2PDAA 4DBVO 1IM8A 1KSJA 1G63A 1LKZA 1IXRC 1N7IA 2AC4A 5JV5A 4MWSA 4RPCA 1H1LA 3D7KA 2EZ9A 1TF5A 1A9XB 3FHCB 4MUIA 4ZVKA 3OECA 2PT6A 1KQGA 1T43A 4OXQA 3PD1A 1Y8QB 1UKZA 1K6EA 2DXIA 4HEHA 4BBZA 2MSNA 3F6EX 3OZVA 1TTPB 3O8CA 2YV2A 3CJQA 2FR1A 2PIDA 3LA8A 4IDAA 2G80A 3UATA 4BE9A 4DV4B 2OCXA 2SNIE 3JR5A 4LRSA 5E2IA 4LE2A 3L07A 4KXWA 3PQ2A 4P3YA 4S2UA 4Y9RA 5KJFA 3SVTA 3BDIA 1N0VC 3O2SB 2Y76A 4N01A 3JD1A 1EVZA 3O91A 3B20A 4U7FA 1ZOPA 3DXZA 3R44A 3TKAA 3VV3A 3QEJA 4JC5A 2O9JA 1KE1A 2KA6B 2B5WA 3FDZA 4Y2SA 1OPXA 4N39A 2NX2A 5LBTA 1Z56C 4BEVA 3D6UA 1PLKA 4A4DA 4QLBA 3F71A 3R77A 3EJWA 1Q7BA 3ZDRA 3L7KA 1OLXA 2QW8A 3OEWA 2ZUCA 1VG1A 2H48A 1N2OA 3LD9A 3ECSA 3KOZA 4QWWA 4TL8A 3A27A 1QFYA 3DMTA 5IT0A 3CX4A 3WIBA 2KEBA 4BFTA 1ZWKA 1D5WA 1JG7A 1JU4A 1TW3A 3PENA 4UHFA 4F56A 3RYIA 1JFTA 2C3MA 3MWJA 3D8BA 1ZMXA 4EB6A 1FJXA 3AY7A 4TLLB 2JLVA 2J7NA 4CG1A 3A9UA 4GDFA 4RPJA 1QR6A 3ZLTA 4EGFA 3LJKA 1JZTA 3IOCA 3GXBA 4BV8A 4U02A 1BYUA 2PHZA 4G01B 2G3QA 1V3UA 4R05A 4S35A 3ZXYA 1ZMTA 4FFWA 5IMSA 1NRXA 4X54A 4NDAA 1TGUA 2PJDA 3DHVA 3IAS6 1TH3A 4UHBA 1U8UA 5A04A 1TJ5A 3UJHA 1ISIA 2FI1A 3BZUA 5IDVA 3KAQA 1FRFS 1HOTA 3GCZA 4FDTA 2IY7A 1PQWA 1Y4SA 3R7FA 1SBCA 2C4UA 2HIGA 1JWLA 1NQVA 2A1TS 1IZZA 2HRCA 3B5JA 2HRBA 1V7PC 2OXRA 4MIYA 4Q0MA 2WJGA 2XVXA 2WE8A 1MNAA 2WV9A 3L0OA 3ZEIA 5DIFA 4RS3A 3SASA 3QELB 3E9CA 1W4AA 4I1RA 4QRDA 2WKRA 4M8NE 5FOWA 3AR5A 2VJMA 5FHRA 2XIJA 1R6XA 3GWZA 4FFMA 2ECOA 4M55A 4UJ5A 3PXBA 4B71A 1TZCA 1F4IA 1FCJA 3OTQA 4YWJA 4IZIA 2Q0SA 4KV9A 2J6IA 2IUFA 8ADHA 3MTAA 1FUEA 4DWJA 3QEBZ 3EXHC 3E03A 3WLQA 2VHCA 2XUJA 4ZCIA 2XUOA 1HRKA 4FD2A 3BD7A 1YQUA 2G36A 4RV5A 3DZ8A 3O9ZA 2ZIVB 3TZKA 3JATB 2WVGA 1IQRA 4AKEA 2QUZA 4B3IA 2GN9A 4O6VA 2ZIXA 1V43A 2M32A 3B7PA 1LTKA 4REOA 5AJZA 3COVA 4BLWA 1ZK0A 5LOVA 3OCUA 4MKRA 5CBPB 4RLFA 2X8LA 3DB1A 3NYIA 2VPXA 1NJ5A 1CR0A 3JALA 3R7WB 2LNDA 3H7IA 4E4YA 3OE5A 4L4RA 3UFXA 3A1NA 5BVGB 5JSQA 3P9QA 3H9EO 4U2CA 3SBJA 2EKLA 2JJQA 3C3CA 1E9SA 2H2IA 1FPMA 2DR0A 3E27A 2AYZA 4TPKA 5T8KC 3T6KA 1A5TA 5HZMA 2QLTA 4HD8A 5D3ZA 3JQ9A 4HJRA 3ROQA 3KFXA 1G5TA 2ADFA 1VMIA 2NUAB 3RYFB 3T9AA 4AJ9A 2EBFX 4X62M 3GY0A 4Z4IA 3O4JA 4MQFB 3DKIA 5JXHA 1V0JA 3IQEA 1FYWA 3IEVA 2Q8PA 4YRRA 1DX9A 2I4OA 1ARZA 3W2FA 4YI3A 2C7BA 5FOXA 3T3HA 4B0PA 4EHFA 2HH9A 1KO4A 2VP0A 4L6CA 1IY8A 3TS1A 2EJUA 2QUAA 4AY4A 2OAEA 2GR9A 2XSZA 3Q9SA 4JB8A 5EZ5A 5FA8A 1XDDA 2CK3D 3A6KA 4MWEA 5DI3B 4EGAA 3DMPA 5IJWA 1TF0B 4C2BA 2H9AA 2GX6A 3HG7A 5JD6A 1DOAA 3B2EA 2WSSA 3JTEA 2QD4A 4CR7A 2O8FA 2QE6A 2YNMD 1X8LA 3QXHA 4RTNA 2R85A 1RI3A 3MRVA 2I2CA 5TB5A 4MQFA 2YZMA 3ZE7A 1EXVA 3PJDA 4B4UA 5JJKA 2C4VA 1TVCA 1MR3F 1VPVA 3JQBC 3L6DA 3K0SA 4JODA 4LZWA 5HG0A 2NZYA 1J23A 1E8NA 2BKXA 2FOLA 2QAIA 4QG7A 5DGXA 4ZZ0A 2VJOA 5FWNA 4YPVA 3ZE0B 1V11A 1YOVB 3IP3A 4WK0B 4WNAB 4DV2B 2K5UA 2LKCA 1GLGA 3DNMA 1W0KD 4RVSA 4WBXC 2PZFA 3DPIA 3VJLA 2EJCA 5ICEA 4OAQA 5DBHX 1FFCA 4M1WA 4QLAA 5CPFA 2IZOA 3TPZA 1HTBA 1DG3A 2HHJA 2QY6A 3FGZA 1A5BB 1EK2A 4NWIA 3Q0IA 5DHAA 3K0EA 3USCS 4BX3A 1CG6A 1IDOA 1U0SY 4FFBA 1FDIA 1M8PA 5TPWA 3QFFA 5AVXA 4HLQA 4J1SA 4IIJF 4I5SA 3GVCA 3LRTA 2OFWA 4I1IA 3SU8A 1J70A 5BV7A 2AL7A 2W5UA 4KPFC 2QTVA 1BOFA 5KHLB 2OKGA 1T0PA 5DHUA 5J2UB 3H1FA 1GTVA 1M8FA 1YMVA 1QS0A 1Y8RA 2QKYA 2B21A 5AI5A 5FR1A 3RTCA 1JU9A 4ZT5A 3VK7A 4MUBA 1VIYA 2CXOA 1JS1X 3DMFA 1BGVA 3RQIA 3IT1A 1YV9A 3LX4A 1TU4A 3H18A 4ZRMA 3FOEC 1QG4A 1VMEA 1E5LA 2AQIA 4I1UA 4DJEC 1DBPA 5A4FS 1R74A 1EPUA 1VLJA 3BF7A 4HAZA 4DUGD 3SZLA 1M2GA 3IPCA 2XYVA 1L7PA 3AM3A 4GYKA 5E1DA 5H82A 4HLQB 4E07A 3O9MA 1VKJA 1UC8A 3AUJB 3MCZA 2PGJA 3SM3A 2C9CA 3ZZMA 1UZLA 2WP0A 2QWXA 2W7TA 3G79A 3QUTA 2P68A 3HZRA 7REQA 2YNMA 3FUWA 3GJ5A 1UP6A 5ITXA 4IQFA 3U6LA 2R8ZA 4LBZA 4B6JA 1YZNA 1FVFA 1MZVA 1YQQA 3N8KA 4LOAA 4R7TA 5IW8A 3IXLA 4X44A 3VR2A 2DHEA 4WW0A 3IX7A 1O1YA 4TKVA 3OZCA 3KQMA 1C80A 4P4NA 5FI3A 4EKYA 3J81k 3GPLA 1WHSA 2C04A 1L0BA 2VDWB 4M98A 1CUUA 4WX2B 2BFAA 5G3YA 3V33A 2UUAB 1EFLA 1SUPA 1YASA 4TWAA 3TKLA 4EENA 4QRHA 1IVYA 4XCVA 1JZSA 2LVPC 3H8WA 1DEXA 4L0CA 1ZJ5A 4ND1A 1OXSC 2D2FA 1QPZA 1R6AA 4H7KA 4RMHA 3RSFA 3G9QA 2YUIA 3L8DA 1OLXB 4MEAA 1AMNA 1OAAA 4IO0A 4LHZA 4MV9A 4NK5A 4UVEA 3AY3A 2EV9A 4DV2M 1G8JA 1DO8A 1F4VA 1EE9A 1ZNWA 4NXMM 2GHIA 3K31A 5FUWA 3W2GA 3LYUA 4QREA 4CG0A 2D5AA 2NYRA 5JC8A 2AXEA 1WMAA 1PUIA 1ZK1A 2C7VA 3P9CA 4ND2A 5C32A 2IGTA 2QG9A 4MICA 3D3WA 3WB2A 4QT4A 2YY6A 1P17A 1FB5A 2G9ZA 1OZHA 1RJEA 2POCA 5HP4A 3BIWA 4XR4A 3TLKA 1KMHA 5FTJA 4GC9A 3EVNA 4CMKA 2G4VA 2HYDA 3CJRA 3LQFA 3E84A 4IH9A 4JX8A 4PLWA 1GV1A 2QSJA 2JANA 1VL6A 3WTCA 3LC2O 3BD8A 2JFGA 5HZHA 3C5WP 3EJ6A 3KSXA 3KSDO 2MYUA 2QQ0A 1CJTC 2X0IA 5ALLA 1X87A 3DUFA 2JDIA 2GRUA 3MD9A 3NT2A 2PNJA 2XXAA 1K7FB 1RHRA 1XTPA 4A0QA 1XNJA 4ZVPA 1UBMS 2FWPA 2PLNA 4GS5A 4PPNA 4A6PA 1HEIA 2PX4A 1LX7A 3HKEA 1OPRA 3FZQA 4GI3A 4I55B 5TF0A 4JVSB 5AMXA 5I3CA 3B3FA 1WZ2A 2Z83A 2NGRA 4FGLA 1XDBA 4MA0A 1C3OA 1L5OA 5HVNA 3CM0A 4OGGA 4R71A 2YBEA 2G72A 3TAUA 4Z1MA 1MA0A 1X92A 3OFNA 1N5DA 1K7SN 3FMIA 1PD0A 1VIMA 4E6PA 1IOZA 1EWYA 1ZX1A 2CYCA 2G70A 3GUVA 4UPDA 3HY6A 1XEWY 5DH9A 1QTIA 3F7MA 4JEHA 5LA6A 3VX4A 1J9GA 1WG8A 1DAGA 2CZGA 4LDPA 1M74A 1K4YA 2Q2WA 5CW1A 3VR6D 2AZTA 1SHJA 4NOLA 2QG4A 3EGDA 3KZXA 1C8VB 3O2NA 5L9AA 2YJ4A 3RWBA 4ES6A 5KVVA 5FUQA 1KFBB 5E3JA 3HX3A 2P0AA 3NNSA 1YT5A 1FC0A 3M49A 5DLYA 4G6ZA 3HBMA 1T6ZA 3ZWCA 1F5NA 3TFWA 4HI0E 1XDZA 3W3AA 5ULLA 5HZKA 4NESA 4FR5A 2Q4EA 4CQMD 1VQ1A 1YBHA 1FBNA 2IP4A 2CJYA 1VDMA 2UZ3A 2W2KB 3A7EA 3LM8A 3MQ4A 4JLVA 4EJ6A 4IYJA 2EU8A 3M6AA 4MYCA 1UWCA 2KQUA 4OBWA 3QFCA 5A0VA 5SZHB 1T29A 1T8SA 2D2EA 2J9FA 3ICOA 1U2GC 4GR5A 4ZAWA 3RYFA 3BK2A 3REGA 1TOAA 1ZH6A 2LVOC 1WMDA 4XDZA 4R98A 3E48A 4CLOB 1A7KA 4QTXA 1B23P 2IHJA 4Y6RA 2RE8A 1Q50A 3UICA 4KQJA 3N2ZB 3WNCA 4NBNA 1XA0A 1DWUA 1ICIA 2EQ5A 5E26A 1WUJS 1KDTA 2GD1O 2VP3A 2WAOA 4LXQA 4KHPM 1LPPA 3M5CA 1O6CA 4I36A 1ULHA 1TPZA 1JH8A 4RE5A 1ZCFA 4MWGA 3LL4A 1A4UA 1IBCA 5KKNB 1M5UA 1O2DA 1A5AB 3O8QA 1HT1E 3JSAA 4L6V6 2B6NA 2Q5FA 3R09A 3OQJA 4JR1A 4YQZA 1K5HA 4F92B 4X20A 3A45A 1OZ0A 2ERXA 2OBXA 3BE6A 3BORA 2REQA 2QF7A 3K2IA 1X9IA 4LK2A 4UMEA 1T2EA 4L6AA 4YXWD 4ERXA 1FLDA 4BKMA 4IHAA 2YJ3A 1DAFA 3V7WA 1C7YA 2FSPA 4C4PA 4TTVA 2A92A 3T3GA 3TGPA 4LFAM 4MRNA 3AB7A 4ZZ3A 1RPTA 1PG5A 2DR3A 3IV9A 3CVJA 3L1VA 3GZNA 1VJCA 4HY3A 3DM5A 2L18A 3LCVB 1JG4A 1TF2A 1HNXM 3G2JA 2YL2A 4X7RA 4GZMA 3CT6A 1D1PA 4HX5A 4RZSA 3V8QA 3MJHA 3J81A 2E4XA 1EUQA 2Q9AA 4E3WA 4ZZ1A 2EBUA 3DWIA 3ESBA 4UVIA 2AW3A 1RQ7A 2LXEA 1LA2A 1MX1A 1XHLA 1TJPB 3O2JA 3QVUA 1I5RA 1NN5A 3HEAA 4JC4A 3EXFA 4DLZA 1Z5UA 5BW4A 1CY4A 6PFKA 1X2EA 3S28A 2HV9A 1RRGA 3DTVB 5DGIA 2KB0A 1DKMA 2OAQ1 2W2MA 4YCMA 1G2PA 1PR1A 4URYR 4OD0A 4R8SA 1XL1A 3O74A 5JNTA 1DKUA 2WDZA 2ZJOA 3KP1A 4JEMA 4B48A 2B8NA 4R2KA 4HH4A 1RRFA 1YS4A 2X1LA 3K92A 1DQNA 2VAPA 3KLBA 4OQMA 5H68A 2HK7A 3WLOA 4EB8A 1J5PA 4KLCA 4PIMA 4XX0A 5I45A 2GFHA 5F51A 4HAWA 3E5HA 2M1XA 3MWEB 1SXJA 2BWEA 1D0VA 2G9NA 2R4QA 2MCFA 1EB9A 2ZU6A 3C3KA 4ZOQI 4IBJA 4TQUS 4BC0A 1XF9A 2QMOA 1WABA 4IP0A 1NUQA 3LIIA 4BUCA 2OLEA 5EVCA 1QM5A 2HBYA 4LXGA 5FJJA 1Z13A 2ZT8A 1RJ9B 5FADA 1RWOA 3AK4A 1X7YA 5CD1A 1AG9A 4NHOA 4YCDA 2EFYA 2NZUG 2QTBA 3GGGA 1NU6A 3COSA 3JZAA 1TZMA 1N8TA 3I37X 4C7JA 4EX6A 4L51A 1NBMA 1HL7A 1GGMA 3CZ9A 3FPLA 3PEFA 4QTZA 1WMEA 1HE2A 1NXPA 5ELLA 1WPGA 5HYVA 1AKUA 4O4HF 3WDMA 3M2TA 4OMCA 4IICA 3U7EB 4P83A 3ZZUA 4IGIA 2JKVA 3N1UA 4CM8B 3HGIA 1N7GA 1U8EA 3PQCA 4WECA 3D0RA 3I8SA 1WR1B 3PUYA 3PD7A 4OLFA 3L8YA 3MXOA 3NTRA 1USIA 4DL9A 1PWYE 5B5SA 3K53A 1H8EA 4HQKA 2NSYA 3SCZA 2KNAA 1VEGA 4Y9SA 3L82B 2YR0A 3V4SA 3W8RA 1T2VA 1GPLA 1AKVA 1UQRA 3G8YA 4L22A 2VF4X 1RLIA 1WUHS 4KO2S 3KPWA 4MUKA 4AB1A 1QP0A 1ZXXA 4RGYA 1GG9A 3PG5A 3W0LB 3T5AA 1I33A 1EVQA 1CRWG 1KAOA 1NPYA 2E87A 2B61A 2J0UA 2PMFA 3HXTA 3JASB 2BONA 3OIYA 3PI6A 4NH0A 3DV0A 5B3KA 3K8QA 2C54A 4JUFA 2X0RA 1X1QA 1BEEA 2HMYB 4FZJA 4NOJA 2OKCA 3WGLA 1UAYA 1JG1A 3LBNA 1JR4A 1YL7A 4ISBA 4RKEA 2WIFA 2V6BA 4M6WB 2B7LA 1DB3A 2VC2B 4GKVA 4C6TB 1WCIB 5IN4A 3ZDAA 4FKZA 3LYLA 3FRIA 1VCHA 3UPUA 1BX0A 4ZO6A 3CWQA 1WMBA 1A8UA 2Q21A 3B60A 4OLJA 3IE2A 1PJAA 2HRQA 3R3WA 4G0OA 1UM9A 2JY6B 1TGYA 2ZRKA 1VLQA 5T8KA 3KXDA 1Z8DA 2DPHA 5F7XA 2G6TA 2LCIA 1OU0A 2CJFA 1EUCA 2W6JD 2R7NA 5TMEA 5E8RA 1AGYA 3P2IA 2J30A 1RLMA 2VDNB 4UKDA 5LZ5A 4NBSA 4EMTA 3L43A 3HI6A 3IESA 4JUBA 1R5JA 5TPZA 5EJFA 4O63O 4PY2A 3UW1A 3N86A 3DJYA 3LQ2A 1XTUA 1GPYA 2MYPA 3BTOA 2D2XA 3HVRA 2NNLD 1E79D 3ZI7A 1NATA 4BEJA 4LSZA 3LF1A 3EHDA 3VQTA 4A7PA 1J8QA 4LXTA 3EPLA 1R1DA 1L8OA 1T6XA 4PQEA 5B58T 4B85A 4L74A 5IARA 3PCRB 4B7XA 4EDHA 3SSNA 1EFCA 1Y63A 4KGZA 3WV4A 2X58A 2P7HA 1ILEA 3V4OA 4R9SA 3UUFA 4IEFB 4DLKA 3U7HB 4EHIA 1YUNA 2C8JA 1RXSA 2IPMA 3H75A 5TE9A 5C51B 2DZDA 4LDZA 4GAEA 3CLTC 1BKSB 3BSFA 1KMQA 3ACCA 3JALB 1JEQA 3UUGA 4EARA 5HHTA 5GZ1A 2RGHA 2G5GX 4WXEA 1TTEA 3ZDDA 3HJQA 2WA1A 5BP7A 1YXMA 4FCTA 3MT8A 4W63A 4BS9A 2C07A 2XY4A 2B35A 5HE9A 1KMHB 2QY9A 4AG3A 2PKQO 2WDPA 5IJZA 1E1YA 1T1IA 3GJZA 3PR1A 1JLSA 3AWDA 4HXFB 1EZ4A 5DTQA 5LU8A 4F46A 3A4NA 1O77A 3KG2A 3K1JA 3HZJA 1PYOA 1FNMA 4L7VA 5CX1B 1A9YA 4EITA 1KY3A 2WNHA 3BXZA 3GUYA 3ROKA 4DIFA 1DTSA 4FDAA 3DT6A 5CCXA 5CVJA 5BUQA 5EXDA 2VHJA 4WE3A 3IJEB 3ZV4A 4NSOB 2ECKA 2F2TA 4L9RA 3E61A 4N8DA 3I9MA 1L9KA 1XTSA 3ZK7A 1FX0A 2Y20A 4C0HA 4JDUA 2BFOA 4GOKA 4E46A 1VLMA 3ET5A 1T2FA 4L73A 2H9IA 2AUNA 3EUFA 3AR8A 4LUCA 3ZU2A 2W2PA 4WK2B 3BKXA 1N2ZA 1ZWLA 1NTRA 2GK4A 2P9YA 3A6EA 3OAAD 2I1QA 2RBGA 4WURA 3N8IA 4D9HA 4Q3KA 2FQWA 3BN3A 4ZYYA 5KPTA 1DCFA 3L7DA 2NADA 4RE6A 5A1TA 2A86A 3SEQA 4F9GA 4HAVA 1ILWA 1NUHA 1XMQB 4W5WA 1WTAA 4EH1A 4G1CA 4RZIA 4RXTA 5BMVA 1F48A 3LY8A 1FY2A 2HQ1A 2V6IA 3HH8A 4LPKA 2ZWIA 4BVEA 4JFAA 1A72A 1JHOA 2P1DA 3H0KA 6LDHA 3R9WA 1SIUA 2EEPA 2VUUA 2WJ3A 1MC5A 2GZDA 1KH3A 1XAHA 2AIRA 2YY5A 3WXMA 1YDGA 1R4MA 4BV2A 4I8IA 2VQFM 2V9PA 5ELMA 3AONB 4RY9A 3HGTA 1KDYA 1RTTA 5LQCA 1E9AA 1FIUA 2I7TA 4ODIA 2D1QA 3CX3A 1ATIA 1TQHA 3OP1A 3ITEA 1HYHA 3HA2A 3R9IA 4UC0A 2DX7A 1AZWA 1DUVG 2QIOA 1JXMA 2Y9PB 4OXXA 1WHTB 3EULA 1I13A 3EGWA 1R2ZA 2HNAA 1JTEA 3GLIA 3KEOA 4PGMA 4EJSB 5AVZA 1LK7A 2DHCA 2F6RA 1XYYA 1N34B 1UMDB 2YICA 4FEGA 1IN5A 1NN1A 3M0EA 1M34B 1QFXA 1Q16A 1WZIA 4H60A 1QYXA 2RB5A 3HPRA 4RH3A 1Q7TA 3KELA 3W0FA 4LISA 2Y6VA 3AIIA 1I4OA 2ZXFA 2W8BA 1FFSA 4CCYA 2H1IA 2PBRA 3OQ1A 4WDQA 2E5LM 3F90A 2IPXA 3E2MA 4G97A 3F73A 1YE5A 1Z39A 1I32A 4Z9AA 4EI8A 3TKYA 4DA0A 1C9DB 1DU4A 3LQRA 3ITNA 3N6VA 2IEGA 4RADA 1M7BA 1ZM3A 4PNHA 4O4IA 4EGQA 1Y8QA 4OA8A 5HM8A 1QK3A 2WVHA 1JE1A 1OZFA 2QL6A 4LMAA 5LPNA 3KAJA 1PL8A 1BWPA 3RARA 3KBOA 4X91A 1L4LA 4EBFA 1A4RA 4NMWA 3W04A 3ENQA 3LWDA 5EHGA 1JMYA 3WK7A 4EM6A 5TF4A 1E64A 4ZVOA 1SK8A 4EAQA 3AKCA 3V3TA 5DLQC 3UB4A 1UBGA 4BFUA 2UXDB 1E77A 1KYWA 5T3YA 3W5SA 4BB0A 2FNAA 1JAZA 1RJFA 4FS8A 2H1RA 2BGUA 1MD9A 1YB1A 3P9ZA 2V1CA 1CZUA 3PXCX 4NAHA 4RFSA 2I03A 4JP5A 4R5MA 3UF0A 4BZXA 2Q0HA 2ZYRA 4C21A 1UPXA 1KJZA 4LHVA 3DOEA 5CVVA 2DTEA 1N2IA 5G1PA 2F3RA 2FZGA 4B7AA 3QPAA 5KYWB 3AUSA 4D8WA 3WKCA 1I1NA 2RGYA 2Q50A 1FU4A 3TZEA 5CNKA 1U2RA 5HSGA 3F67A 2OPFA 4ENWA 1TVKB 4BB9A 1TC2A 2X8BA 2GZSA 1Z7GA 2ZTLA 3MS7A 3VHRA 4CL8A 2NUTA 3ZXSA 3I34X 4RYDA 4BRZA 2VQ6A 2J7PD 4JQCA 2V8OA 3E4DA 4L08A 2H4JA 3F3SA 2Z2KA 3SLKA 1WL8A 3OZTA 2WPNA 4Q5IA 3M7GA 3F9RA 4V38A 3BFVA 1YKGA 3TLXA 3T9EA 3E7XA 1VIVA 4Q66C 4K8OA 4DG5A 5A9TA 3IB3A 1JEEA 4DREA 2PV7A 3F6PA 3ANLA 3L9XA 3A6FA 4TVBA 4MHSA 4U7PB 4X65B 5JWOA 1S7CA 4A5SA 4NCJA 1CETA 3ETHA 4P22A 3ZD9A 1WU7A 4XI9A 1F60A 1JSXA 1XXLA 3A6GA 5CJJA 3SEZA 2YC2C 3W90A 4F84A 2WNSA 3T1TA 1Y8CA 4B0OA 1YQDA 4R2JA 1XNRM 5CJ2A 4YFVA 3VR6H 4YRBA 2JB9A 3L0IB 4LXUA 1QIJA 3VYVA 1SCUA 1UIMA 3E15A 3OHSX 3THSA 1ABFA 4F1KA 3R0QA 4RO0A 3AR3A 4LOIA 3R76A 4C2TA 2B92A 4RDXA 1RIIA 1UKAA 2HSDA 3PKJA 4RTJA 3DHNA 4DEYA 4O4LA 3EAGA 1TCBA 2LBPA 3A1SA 1PWHA 3BIXA 1YIAA 1F20A 4JI8B 3PTLA 4NMHA 3U37A 4YBRA 4AQ7A 4JHLA 1TO6A 3QYPA 1G16A 1RACA 1XMPA 1E94E 3A1VA 3RSSA 4G07A 3WK4A 4AY6A 1N2EA 1PJZA 2RGAA 4I6EA 2QJTA 1IRXA 5E9JA 5G4LA 2WWYA 2PVCA 3O26A 4OHYA 3RUEA 3TW0A 4DPLA 2HDHA 1J2YA 3E5MA 3HFSA 4ND6A 4ZU1X 1N2HA 1JUDA 2B99A 4TLAA 1G6Q1 1S2IA 1ULZA 4FDLA 2ZIXB 4OHWA 1AF4A 4HXYA 3CLRD 3N7AA 1PGQA 1HG1A 2C2HA 2IKSA 1SQFA 5EIOA 2P9HA 1OI3A 2C5GA 3ENKA 3GDHA 3NB0A 4RHUA 3E3OA 3WGJA 1EAMA 1JVNA 1LSJA 1XNGA 3IVMA 4QICA 4E4TA 3T7TA 3B36A 3KKQA 2ZQZA 1UOEA 4UAVA 1B0UA 1VSBA 2P2YA 1E6CA 1FNDA 2WKWA 2AXQA 1JQKA 3JZFA 4NJEB 3RO7A 1FSPA 1YS6A 2GJSA 3HRKA 3KZCA 1YVEI 4FZRA 2WKSA 4ID3A 1YJAA 1N3BA 4NRVA 3DDUA 3K2QA 1GDHA 2ZAYA 2ZT7A 5AKLA 4TYMA 3P9IA 3NFYA 3FFTA 1NL3A 4E15A 4QVKA 1GJSA 1KK2A 1CFZA 5ARDA 3RU3A 3LT1A 5BSEA 1XZGA 2P9ZA 3HS3A 4NRWA 4RHCA 3DW1X 2ZIFA 3DOCA 2E5FA 4X6YA 3VTFA 2RGGA 4CMEA 4CMCA 2GAFA 1VMKA 2QTAA 1RI5A 1M6NA 3GN2A 2OCAA 3HUTA 4NPCA 3GLHA 4M0KA 4CCYB 2WW8A 4KIWA 3AY6A 4AUNA 2OHXA 1GPUA 3LW7A 1D7OA 2VQEM 4CIYA 1PK9A 4YV1A 5F4ZA 5FF9A 5CXUA 3CPSA 5KJ1A 4YPOA 4DLXA 4ZYWA 4O59O 1EUDB 2J3QA 4LQCA 1D0MA 3S81A 2P27A 5FTLA 1KI3A 4FWGA 4IXTA 5FI5A 4DSZA 1AURA 4Q12A 5BO5A 1DMRA 5LC1A 2FQXA 2PEYA 2ZM6B 4HFRA 5J23A 1OTXA 2I2FA 1LPNA 2VH2A 2RJ3A 3EASA 1FRZA 4J49A 3ZE6A 1JAYA 1DKNA 4C03A 3Q98A 1JNYA 1EGQA 3T9CA 2O3UA 1WBBA 4B80A 4KHPB 3T7DA 3HXKA 3FFXA 3UT5B 5GINE 3H11B 3DZJA 1EX9A 2R2AA 1KJQA 1E2QA 1M6YA 1QRRA 2Z98A 4UAJA 2RHRA 5MN6A 3OIGA 4ETWA 1ONBA 2LR0A 2PH5A 3BCUA 4CIAA 4GL4A 4BN0A 4D0SA 3ODPA 4E2WA 3AUFA