4LZZA

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 57
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lzzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lzzA01
1YKSA 3MD0A 4ZV4A 3OAAA 3RVBA 5CDFA 3U4QA 4OI0A 3QKUA 1LFDB 4CEHB 4HB4A 1P60A 1GKIA 1OYWA 3CX6A 2AKYA 1BMFA 1SXJA 4V0MA 2F43B 4ZCLA 4CIDA 3BK7A 2ODEA 2AD5A 2WOOA 2CDNA 4L9SA 1JI0A 1O87A 5K8TA 4A3VB 4KV9A 1GRNA 4Q4AA 2PT5A 5FOTA 5JWRA 3WMGA 1KKMA 1US8B 3I3SR 3KTAA 4IXMA 3DPUA 4L8GA 4M8NE 3Q3JB 4YDHB 4GRAA 4HAYA 3CR7A 1PJRA 5P21A 4GI7A 2ZEJA 4FWTA 3TMKA 4GL2A 4OQFA 2DB3A 3SBDA 1NBME 2D7DA 3CF2A 3AB3A 4NBSA 3KUCA 4KAXA 5IF9A 1ZM4A 1SKQA 3EARA 3QQ5A 2BWJA 3LWNA 5L3QB 1JR3E 1OPXA 4D81A 1AM4D 2QE7A 1FUUA 2HT6A 1XEWX 4IRUB 5KPJA 4JT2A 3ZJYA 3TH5A 3C15C 2O8CB 3TJZA 3K53A 3WP0A 1VYUA 2WJJA 3KJEA 3CM0A 2VQSA 1RE0A 3TSZA 1RZ3A 1KOFA 1XMVA 4JVLA 1P2VA 1Q1BA 1QHSA 4UNQA 1V43A 5DE3A 1COWD 3SYNA 1E2LA 1S8FA 1U2RA 4TT3D 1KK2A 1OKKD 2XGJA 1MH1A 1NJGA 1ZD9A 4IOJA 3L0PA 1ZD8A 4V0NA 2GVZC 1AGPA 3E5HA 4XH9B 4XVRA 2KRKA 1X8JA 3GLFB 5D3MB 3WYAA 3NDBB 1SHKA 3VR1A 1M8PA 3KQUA 1CKEA 1GNPA 2CCJA 2I4IA 3RABA 4KFTA 2NZ8A 1TQ4A 2OUKA 1VPLA 2O8EA 1ZM9A 3CRQA 3B13B 3FKQA 4M1SA 3ZQJA 1N6HA 2IL1A 3QPVA 4CEIB 3KDSE 1T8TA 1G6HA 4D80A 1MO5A 1FX0A 1J7KA 1Q3TA 1XB2A 1XTIA 3AVQA 2HYIC 3MWKA 3L0SA 3IIKA 3K0AB 2IBMA 2IUUA 3TSOA 4FINA 3QOFA 4KITB 3EX7C 2BMJA 4G3XA 4PPFA 4ZPXA 3GPLA 2B7BA 3FHCB 2YOFA 4A2WA 4YDSA 4QL3A 1NBMA 2WSSD 4QJ5A 4WBSA 4C2UA 3T06B 3EG5A 5A4JA 1CXZA 3GJ6A 1XDBA 1T0HB 3W5JA 5IDVA 4E03A 2Z4SA 4AG5A 1JR3A 3LLUA 2IC5A 4Z1MA 1N5KA 3AV0B 1DAMA 1ZP6A 3GP8A 2VSOA 3CUEF 2H57A 1U0LA 4A0HA 1VYVA 1Q22A 2HCJB 5IRCD 1U94A 2EWVA 2ZRPA 1E0JA 2R6CA 4DIEA 5FBVB 1IN8A 1XEFA 2F1HA 3CBQA 3PQCA 5AJXA 3Q72A 4RD4A 4V0KA 1UBGA 1E2NA 3TUJC 1MOZA 3K9LA 4D4KA 3QBVA 1EFCA 1Z2CA 3BB3A 1IQPA 3KJHA 4TSFD 1NY5A 3A1WA 1G7CA 3T35A 1Z63A 1KI3A 1RRPA 4B48A 1S9HA 1DBSA 2ZRBA 4A9AA 2NTYC 3B1VA 4Q4JA 5JHHB 4X8MA 2NZJA 2MMGA 4XVUA 2FEMA 4JLKA 1KTVA 1YU9A 2V55B 4DC9A 3CW2A 4FIDA 4GOJA 4YMTA 4HLDA 2BMDA 2QRZA 2OLJA 4LUCA 4EQ6B 5J40A 1S9DA 2DCUA 1EESA 2GXAA 1QZXA 3EPLA 4B35A 4BLTA 2NO7A 1T5LA 3CNLA 1IN4A 2ZJYA 4FMBB 3K1JA 1GSIA 1HEIA 2GEDA 3HP1A 2O0KA 2R65A 2HJVA 2IYTA 5IK2D 4URWR 4GT1A 4N0DA 1N5JA 2KBFA 4JBXA 3K0FB 5B2ZA 3MHVC 4MGKR 1BOFA 1XTQA 3R9IA 1N6NA 5KNCA 1I2DA 3HR7A 2R44A 5CYOA 1W48A 3FMIA 2O8FA 2J5XA 5BW8A 2BEJA 3PEVA 2ZYTX 3U7GA 3GEIA 3WBJA 2C2HA 2GNOA 5DIFA 5A0FA 4EIWA 2PMKA 3OEED 4US2R 4AG6A 5KTYA 3K9GA 3RRNA 1U8AA 4JIMA 2QTFA 3QEJA 4EKDA 2W0SA 1UDXA 2CL6X 2W0MA 4BWYA 5KYKA 2AK2A 1T6NA 4NYJQ 4U7DA 2ORWA 4ZKEA 4HDCA 1KI7A 2JDID 1R10A 4LJ6A 1H8HD 2IEZA 3CR8A 1D2EA 2BBTA 3T61A 3LD9A 2DY1A 5JLJA 1AS0A 2Z4RA 3BB4A 3EPJA 4CRWB 3QKRB 3ZD7A 2GTPA 4KYIB 1KYIA 5DH9A 1NVVQ 1ZCBA 2YHSA 3VKGA 1KK0A 2IXFA 2DVWB 1N6OA 3G5UA 3VX3A 1G6OA 3K0SA 1E9BA 2R6DA 3D6TB 2ZYUX 2V6ZM 1X1RA 2C78A 2VF7A 1GTVA 3W3ZB 2ZSDA 2ECKA 4AC9A 2ODWA 1OFIA 2AR7A 4Q01A 5JFGA 4NZYA 1E6CA 3AVUA 2OAP1 1W4BA 2IUSA 4JVSB 4LY6A 5TY0A 4DLWA 1MABB 1GRRA 4LBZA 1XMJA 3F0TA 2ZUBA 3IBGA 1KK3A 2ZROA 1H8ED 4JL5A 5KSPA 3LLMA 4FMCF 1OFHA 2EFHB 2GF0A 5F9FA 1UBEA 1S4QA 1T8UA 2FFAA 1KGDA 3NKVA 1KZGB 5E7JA 1E79A 1E3MA 3B6EA 5L3RA 3IO5A 1SXJC 5GJWC 1WA5A 3AP1A 3NEYA 3B9QA 4OKSA 4FWIB 5FUYA 1KIMA 4U5XA 1D2NA 4D4LA 1TUIA 1XCPA 2O52A 3ASZA 1I4LD 1YJ5A 3C4JA 1KJZA 1NN0A 1FL9A 1E94E 1L2TA 2NG1A 2BM1A 2ZRAA 1T9HA 5LB4A 2E9SA 3QVUA 4JSYA 3JZAA 4CW7A 1PUIA 1G5RA 2HXYA 4PZYA 1COWA 4MRRA 4B71A 2F1JA 3ZQ6A 4TT3A 1OKKA 2IX3A 1QG4A 2B92A 2ZRCA 4HEJA 1P72A 4W5JA 1FTNA 3A36A 1YZUA 2OAQ1 1Q1ZA 2DWOA 3HPQA 3KQHA 4KBGA 1S3SA 5LD2C 3R8CA 2VLIA 2V4ZA 5CIWA 1LS6A 1P62B 3BAFA 4OL0A 4ZIRA 1N6PA 3IIMA 1V5WA 3NC0C 4NKRA 1DAEA 3VKWA 1EX6A 4D82A 1E98A 1IAQA 2VO1A 1Z28A 1OB2A 4LJ9A 2W83A 4WVFA 1Z0DA 2F55A 3SJAA 4DT1A 1Z0AA 1VKJA 1CTQA 1R5BA 4ZI2A 2V1XA 2KE5A 2HCBA 3AP3A 4BFWA 1FFHA 5EZ6B 1NKSA 1DG3A 1P75A 2GCOA 4ZCIA 2Q9AA 5BN5A 1UM8A 3NXSA 1IXRC 1X3SA 2CHGA 1E2JA 1EWRA 4C30A 4M1TA 4NCJA 2J45A 5KNDA 4RCZA 2QUZA 1HUQA 2YWFA 1YZNA 4ITRC 5GJVC 5G53C 3EC2A 1U0HC 1RIFA 4B6EA 2GKSA 1GG2A 3JVUA 3SYLA 4QJ3A 4QM7A 4F93B 1OXTA 3PG5A 1QHHA 2WSSA 3AQ4A 4IJMA 5FUVA 3GJ4A 5C1BA 1FQKA 2FSGA 1FZQA 1XTKA 4TTPA 4A6PA 4KLZA 3PEYA 1E99A 5J4LA 1KJWA 3ASYA 1C1YA 4WZ6A 3VR3A 1M2OB 1TUEA 3Q7PA 4OJQA 1KO4A 2GZAA 1PLKA 3WYGA 2IHYA 4EJSA 4LRTA 2GJKA 4NYJR 3I1FA 1WE2A 4P4SA 2V8OA 3BIFA 4DSOA 5EE5B 5DYIA 3O8CA 4QKQA 4A82A 2FN4A 2XNDD 1N0WA 4PX9A 1XTJA 4Q1CA 3EIHA 1XZQA 4Q9HA 4TSFA 3CF0A 3BFXA 2Q9CA 2XXAA 2BBSA 1QVAA 2N42A 2RCNA 1X86B 3KQKA 1NVVR 4BZQA 4HYYA 4PSKA 3RRMA 2ZI7A 3B78A 3FFBA 1TF7A 5JRJA 4D4JA 2B6HA 1FW6A 3C14C 1KAOA 1AZTA 1DAIA 1WCV1 4BE7B 2P67A 4BPBA 1CULC 4KSCA 4UXIA 4L16A 4KI0A 1D5CA 4FWGA 1OFUX 4W5HA 3W6PA 2ZU0C 3IEUA 3ND9A 721PA 1NMXA 4GP6A 1IJFA 3QF4B 4ARZB 2GK7A 2WBLC 2N1BA 1W49A 2R9VA 1VTKA 1XEXA 3IHLA 1P9NA 2NPFA 3ND8A 4Q9KA 5J4KA 5IK2A 1JJVA 2QU8A 4PR0A 3CX8A 2VP9A 2WWHA 4B43A 4ZDIA 1OXVA 3SFVA 3X1YA 4IEEA 1N6LA 2O5VA 1DAHA 3TW8B 5J5CA 3QBTA 1VG8A 1NG9A 3VNUA 4IXNA 1CBUA 1C4OA 2XB4A 4IVPA 5TDHA 3THXA 3MFYA 1DG1G 2GETA 2R6FA 4QHYA 3OFND 2XAUA 2H5EA 5FBWB 3KXKA 4GITA 1ANKA 3NEJA 1NVMA 3T1QA 4B3DA 3OESA 3ICQB 2C77A 2YYZA 4ZCMA 4ESVA 1Z22A 4M1KA 3OEEA 2Q21A 2UKDA 1JAHA 5CJ2A 1KNXA 1W36B 4LDJA 1F5NA 1NLZA 5AUNB 3Q9LA 1ZRHA 2ZVPX 3RS7A 4WA7A 1E0SA 3RSOA 3TRFA 2JDIA 1SVIA 4PC1A 5KSZA 1S3GA 1C9KA 1H8HA 4DCUA 5JZVA 1OH8A 2XJ9A 2AK3A 2BJWA 3THYA 2CJWA 5BWMA 4HSEA 1E9DA 1WB9A 2A7QA 4BFVA 3L0OA 4AIIA 4BECA 2HEIA 1ZU5A 4OBEA 1BYUA 2ZJBA 3WXMA 2XZOA 4TZ6A 4F4CA 2QRNA 2FWRA 2J0SA 1SVWA 2CNWA 2NO6A 3IKJA 3SJBA 3W8RA 2E1RA 3ZVLA 3H86A 4U00A 1YRBA 2EU8A 2QM8A 3A37A 3EC1A 2H1LA 3LX8A 4JSTA 4Q02A 3U6BA 1A82A 4JLBA 1KO5A 4P32A 4Q1AA 4UXJA 3QUSA 3NG1A 4Z8XA 3BERA 1UBCA 4LBYA 3ZH9B 1JXOA 2ZJZA 3QKSB 1DEKA 2ZI4A 3B7GA 1NJFA 3CWQA 5TV2A 3PENA 2X2FA 3D8BA 2XNSA 4RD1A 4LBWA 2LCFA 1TF5A 4KXFB 4BEJA 3ZGXA 3ZDQA 2ZI3A 2QA5A 5C4GB 4K81B 4IDNA 5DISB 1I4DD 2FDCA 4O3MA 1KI9A 2ORIA 4V02A 5DYGA 4MGIR 3R7WB 3RLFA 4I4LA 4TQUS 4FI3C 2WWXA 5SZHB 5H68A 3FMFA 3Q5EA 4QFMA 2VSXA 2FFBA 4NL4H 1OH5A 3CPHA 4GDFA 1NMYA 5JEEA 2VL7A 5KOYA 4PPNA 4W5WA 4NCHA 2GILA 4I81A 1SGWA 3CLVA 4O0MA 1AQUA 2OE2A 3DM5A 1VMAA 4A92A 1QRAA 1S1CA 3LAWA 1ZM7A 3BH6A 4JZKA 4EAQA 3U3JA 3K70D 4XSHA 1X6VA 4QOSA 3H1TA 2IWHA 1G21E 2PJRA 3CWZA 2WJIA 3R9WA 3NHAA 3WYFA 1PLLA 2ZI6A 3CPJB 3FMOB 4P33A 1U0JA 1OB5A 3GFPA 2O8EB 1L8QA 2C99A 1R5OA 3THOA 2I3BA 4PTLA 1QVRA 1L7VC 1U8YA 4ILEA 1LF5A 4BGDA 1EFRD 4KCGA 5HPYB 4DLSA 1HE1C 1C1KA 2P0EA 3OE7D 4URZR 1FX0B 4JBWA 3FFAA 3BFVA 3PUXA 1BH2A 1W4AA 4QM6A 3TQFA 4BFYA 5M04A 3OZXA 3LO5A 5DHAA 2DR3A 2HJGA 3BGWA 1U9IA 1U81A 3SJZA 5FPTA 1X8KA 4Z8YA 2C95A 2R6GA 4PPGA 2RKOA 2FNAA 1GAJA 2NOAA 2O0HA 1OXSC 4HI0E 4UJ5A 4NPHA 2LKCA 5K8UA 2ODNA 1KZ7B 3SI7A 5JCPA 3KZ1E 2CXXA 2WJYA 2PMDA 3KW6A 3I5YA 4OQXA 1JQLB 4DSTA 3PUZA 2OO7A 1A1VA 1QHGA 2A3RA 3T1OA 2FE4A 1FQJA 2QI9C 1VIAA 2QM7A 2YOGA 4ZI3A 5LDDC 4AWXA 3LY5A 1TL7C 3KKQA 3NBZC 1XD8A 4OHVA 2FJUA 4HLCA 5HZHA 2KSQA 3QJYA 1W44A 3QPUA 3GLGB 4B3XA 4MYHA 3FKSD 3ICEA 2ZS7A 1OLOA 2WZQA 4YXWD 1X37A 1E2HA 5FR2A 5JI3E 1IY0A 1NI3A 2XZLA 3K9NA 2F9LA 1XXHE 1Z83A 2ZAOA 2ZE7A 1AQYA 3H2YA 4KVAA 1BIFA 3U3KA 1QHXA 2F9MA 2ZETA 4FMDF 1J99A 2FA9A 3CKLA 4MH0R 4GNKA 4UNRA 4HZUA 2VH5R 1KO1A 1ZW6A 2D2EA 3W9YA 2XNDA 1EFUA 2OCYC 2REOA 3AEZA 1XJCA 3VU9A 3NVAA 3I73A 3NBYC 4TL7A 4ZO4A 1XEWY 3QIAA 2XITA 3A4LA 2QAGB 4YQFA 1TF2A 4A8JC 2XTMA 4JLAA 1R0YA 4UQOA 4Y0AA 3GD7A 5EXXA 3I8XA 3RWMB 4KSBA 4YLGA 4EJSC 4D0NA 1EGAA 2OBLA 4KHZA 3IDQA 3H84A 4V0OA 2UZ3A 4OYHA 1UDWA 4Q1BA 3LQQA 4LJAA 4IDHA 3DOFA 2XOKD 4PZLA 1XPUA 3KUDA 2IYZA 4AKGA 2FF7A 2ZJOA 4JMPA 1HT2E 4CDGA 2GESA 5AJWA 4QNMA 1LB1B 3UIEA 2VF8A 4QGHA 3MMPA 1OE0A 3QPWA 2GA8A 1E1QA 1VHTA 4QBHA 4QHSA 1N2CE 2ZU6A 4I1OA 5HTKA 1OSNA 2WOJA 3AF3A 5BYKA 1XPRA 2E87A 3OEHD 1QF9A 3KKNA 4LRWA 4H1UA 1SKYE 4EUNA 4GPTA 2J7PD 3AKDA 3EA5A 4BFUA 1XBTA 3OFNA 4DLUA 2GK6A 3NH9A 1XU4A 3PV0A 3B9PA 1GILA 2VHTA 4Q1FA 3EA0A 4R98A 4GFDA 3SYKA 4B34A 4JN6A 1MRSA 2CVHA 2X77A 3ZS8A 4ZDWA 1NN1A 3B1ZA 1XTSA 1W0KA 2N46A 4Q21A 1RVDA 5DLQC 1XXHA 1ZNYA 2OFOA 5FUWA 5E7IA 1LNZA 1G8HA 3U4QB 2Z83A 4FMDB 4RD0A 3CONA 4RZUA 4TL8A 3HR8A 821PA 4W7SA 2OFXA 1ODFA 2J59A 4C0QC 3GEEA 5BYJA 1GNRA 4DLRA 1CLUA 1MO6A 2PL3A 3EZFA 3KXLA 4Q1EA 4II7A 2W6IA 4OQNA 2RMKA 3A4NA 1UBFA 2QL6A 3SJCA 1P61B 3ZVRA 1AK2A 1GM5A 2WAYA 2QP4A 2ZTSA 4EPWA 2JLSA 5EXPA 3IPYA 4MRVA 3V9PA 2MMCA 1FOEB 1DAKA 4LWZA 2V9PA 1QHIA 4PAQA 2GJ8A 3PFIA 1XD2B 1ZC3A 1ZM2A 2DPXA 4Y0VA 2XTNA 2FG5A 5D3QA 2JASA 4MKIA 2ZRJA 2VSFA 4TLDA 1LVGA 3CNNA 1YQTA 1UKZA 4OHWA 1VDZA 3ZZTA 2WWIA 1T0JB 5GJBA 1DELA 2BKEA 1OHHD 2H92A 3AUYA 5BN3A 3VLFB 4XJXA 2G1JA 2CBZA 3UWOA 1NF3A 3UATA 5L3SB 1E9CA 1EFTA 4M2LA 4QBIA 3ZVMA 4E07A 1AS3A 2OZEA 2VA8A 1G8PA 2KB0A 1SVKA 3P20A 1HY3A 1EX7A 4TTRA 2IA5A 1E4YA 1Z06A 4F7WA 4MGZR 4TYPA 4Q48A 3RS4A 1Q12A 2P2LA 2P5TB 2GVDC 3T5DA 2VP4A 3GJXC 3A1TA 1N0VC 1M6NA 3IPXA 1F48A 2VPPA 4HDOB 5E4FA 3G82C 2O8BA 4LRSA 4ZIRB 3VTKA 2H17A 4LJ8A 1Z5ZA 2EFCB 2CVFA 3HU2A 3VFDA 2WV9A 1E2GA 4DKXA 4UNSA 1FMJA 2P6UA 3WY9A 5EXSA 1TEXA 4DT1B 1P4SA 2WVJA 1YVDA 4TMTA 2IYQA 1E2QA 1OV4A 1G4AE 1EFRA 3LV8A 1RKBA 4AYXA 2HLDD 3PR1A 2CCKA 2DFLA 2GCOB 3OE7A 1KJYA 4GOKA 3B8HA 4POAA 3UMFA 4BFSA 1FP6A 3VMFA 3UWKA 3ECCA 1HV8A 1KI8A 4QJ4A 4A0FA 4W9MC 3UG7A 3MSXA 4JLPA 1DE0A 2WM9B 2YJTD 1QHNA 2QMOA 4D2IA 3PUVA 1LS1A 4PHHA 3TK1A 2F3RA 1CRPA 4LJ5A 1N0UA 5EUMA 1VG0B 2OT3B 3TVTA 2B7CA 4J0QA 4Q9IA 4BRWA 2W2VA 2CE2X 4B2LA 2BOVA 4NE2A 3QE0A 4TQ9A 3DHWC 2OCAA 1NNEA 3RYTC 3RS2A 1MT0A 2KI5A 1VCNA 1ZNXA 2C98A 4FCWA 4V03A 4UKDA 3FHOA 2DHRA 2J0UB 1CR4A 3HPRA 5FR1A 1KI6B 1NKTA 4LHYA 1GFIA 2X2EA 1N6KA 1ZCAA 1U9IC 2ZAMA 1Q0UA 4JL8A 3KQNA 3BBPA 4RSGA 5DGXA 4PQFA 2RB4A 4TN1A 3FKSA 5G41A 3TW4A 4ACAA 2JLWA 3DVLA 3CNOA 4KBFA 1WF3A 4Q5IA 3RANA 5FTKA 4YXWA 5DN6D 2GDJA 3GLHB 3WRXC 3P26A 2X8AA 4LJYA 4CEHA 4JLJA 3T34A 3B5JA 1P5ZB 3N2IA 2Q3FA 4F92B 2IYLD 3FOZA 2F43A 4LPKA 3QG5A 4D6PA 1QHYA 4BZXA 5EE0A 4NCKA 4QXAA 4C9BA 1KDRA 4MKFA 4D26A 5EP1A 2VIIA 4AKHA 3VR6A 5C18A 4RD2A 3QXCA 4QNRA 3ZIAD 1SQ5A 3RS3A 4KU4A 5EP2A 2G83A 3A8TA 4UXHA 3U3OA 2CEAA 3HU3A 3MLEA 3LX5A 2ZUDA 3WNDA 1DAFA 5CM8B 5F9HA 3B1YA 4XSGA 1JAIA 2C04A 4JVNA 4HZIA 4QGAA 3VHXA 2A78A 3C8UA 3SS8A 3X1XA 4C3ZA 3AGPA 1XP8A 2WKPA 4A2QA 1A2BA 1W0JD 2BM0A 3M1IA 1RRCA 4C7OB 2FZ4A 4RD3A 5L3QA 3D31A 4I1UA 2RGCA 2FFQA 5ANRB 3DKVA 1SHZA 1DTSA 3X1DA 3WMFA 2FFHA 3O8BA 2RGXA 5FPHA 2XOKA 3FHTA 1JQJC 4RKFA 4X8HA 1W4RA 2BDTA 4US1R 3UXMA 3VAAA 3QF7A 3I62A 2W2TA 4PAMA 4TL9A 1ZM3A 1G5TA 4GSYA 4NCNA 1II8A 4Q03A 2XSZD 2GHIA 2JLQA 3JZMA 4RVCA 1NG1A 4IDOA 3OHMA 3OIVA 4RFSB 1NMZA 3OEHA 3RS5A 2CJWB 3ZD6A 1NLFA 3NC1C 4LYAA 2WWGA 3CH5A 1YZQA 2BVNA 5EE3A 1Z07A 4RKEA 4ZDKA 2X1VA 4CVNA 2BC9A 3QKTA 5DI3A 3WP1B 1N5IA 2G3YA 2K5UA 1IBRA 5FTLA 2NQ2C 4PC3A 4KO8A 1TAGA 3LQRA 3TUZC 3QVVA 2OSBA 3GJ8A 1E2KA 2PCLA 4DLXA 2QY9A 1NP6A 4M1YA 1LF0A 2FGJA 4IOLA 4CEIA 1GNQA 4XTCS 3SHWA 3QXXA 3W6OA 1KY3A 1RYFA 2FEOA 4Q66C 2GWHA 3CF6R 3K0AA 5J4VA 1II9A 2I1QA 3LVQE 4NYIQ 3KQLA 3CRVA 4RJLA 1NRJB 1CRQA 1T3LA 4QC2A 1XWIA 3HDTA 2GZDA 3OIYA 2IHBA 3AVTA 1ESNA 1O3YA 2J3EA 2ZJ2A 2ZR0A 4A36A 2ASEA 1GWNA 3K0CA 3U60B 1G291 3CZQA 2A5GA 2ODBA 4RCYA 2V7QD 1UEJA 2QPTA 3NBXX 3PVSA 2EFEB 3LA6A 3U3RA 5KO2A 1IY1A 4BFTA 1OHHA 1XTRA 3VNVA 1AZSC 2NO9A 1ZUIA 2OM2A 4TLCA 4TZ0A 4L9WA 5F2EA 1VG1A 3ETLA 3NTUA 1KSHA 1TEVA 4BUJA 1G3QA 4O25A 2G0NA 3SR0A 2WHXA 2PCJA 4LV5B 4MA4A 2YZ2A 3K8YA 4FMCB 2WJGA 4EPYA 5IHPA 1CU1A 4AI6A 4HB0A 2QG6A 3C16C 1TU3A 5FBRB 1XF9A 1P2SA 1Z0KA 1RJ9B 3BB1A 2DWZB 3GLIB 5GJCA 3U7HB 3DMNA 2AWNA 4Q19A 2FMXA 4A8JA 1EWQA 1TQ2A 5IT5A 2QT0A 1KO8A 4OK5A 3P4XA 4B2PA 3EPHA 3CPEA 4LGMA 4DB4A 2QTHA 4P31A 1KDPA 5JECA 2ZPTX 3THWB 4LOAA 5BN4A 4OHYA 2J0QA 4D0GA 5H8WA 1ZUHA 4RFVA 3PIRA 2JLRA 1GVNB 1AGRA 2BBWA 5AUOB 2JAQA 3PJRA 3A1SA 2ZITA 4B3FX 3TR5A 2JLVA 5BQ5A 4NP6A 1IY2A 4PSVA 2HLDA 4Q00A 3NBFA 4DIDA 2WICA 1T3HA 3E2IA 4DLTA 4JS0A 2WIBA 4FCTA 3K0FA 3NDPA 1XCMA 1E9AA 5B58C 2RGBA 4GZLA 2H18A 3F8TA 4PHTA 4N1AA 3K70C 3I32A 3S1AB 4ERNA 1WRBA 3DKPA 1PZNA 1RRFA 3PUYA 3BH0A 2BBOA 2QAJA 4LX0A 4FWHA 1A5TA 1SULA 5KNBA 2W6JD 1N6IA 4M9QA 3CO5A 4OK6A 1E9EA 3OAAD 4JJZA 1GZSA 2QN6A 5FOVA 1N5LA 3QXJA 3O8RA 3WNBA 2V54A 2WKQA 3DOEA 1E2EA 1G8GA 2GJAA 5HE9A 5SZKB 4K46A 4LYHA 1OYYA 1WBBA 1BMFD 1OT3A 1CS4C 2ZUCA 1G20E 1YHNA 1W36D 4H1VA 2ZE6A 1Z6YA 1E4VA 4PC7A 1D6JA 3BOSA 1T4GA 2BHRA 4PSAA 4EPRA 4DCTA 5CYPA 4A6XA 2QBYB 3GJ0A 4M21A 1K6MA 1E1RD 5KDLA 4EFLA 3AP2A 4M1WA 3I61A 2O8DA 3EIQA 4FN5A 3WHLA 2IT1A 1D8TA 1NY6A 3QKRA 2FH5B 2TMKA 5CJPA 1U90A 1UF9A 2HV8A 2KBEA 3DDCA 1CIPA 5FBLB 2ZSBA 4B44A 1RW4A 2PEYA 2H8KA 3BWDD 4Q9JA 1Z6XA 2WIAA 1U99A 3MCAA 3A58B 1SXJB 1LTQA 3AH8A 3LBNA 2FZLA 4HLUC 2GXQA 3P4YA 4BLOA 4TL6A 3GJ7A 2Q6TA 4Q4AB 2P3SA 3KFXA 1G1MA 3CRRA 2GEUA 1MABA 3KTAB 1S2MA 1CJUC 4NCIA 3ZIAA 2ZJAA 4BLPA 4DDTA 1H65A 2BMFA 3U6KA 4H9GA 2AXPA 5FI1B 2VHCA 4LV6A 1TPZA 521PA 2F6RA 4NYIR 4OHXA 1XJ0A 4M1MA 2I1VB 4KFUA 1NIJA 3UPUA 2QZ4A 3HWSA 1CR2A 1HH4A 3QENA 5LB2A 4DSNA 3SQXA 5E95A 1P9RA 3NWJA 1IM2A 2DBYA 2ZR9A 2R2AA 2ZI5A 4R7ZA 2QROA 4URVR 4P3YA 4JLNA 1Z47A 1A4RA 5LD2B 4GBMA 3T15A 2WPDD 1ZINA 4FWDA 4DJTA 1G18A 1TMKA 3HJNA 3NH6A 3RAPR 1L4YA 1NL3A 1XNJA 1GL7A 1H8EA 5FOXA 1ESMA 1MO4A 2ATXA 2ZRNA 3OIWA 4DBLC 3ADDA 3CIOA 2IS6A 5JJIA 1KK1A 3B2EA 1XXHB 4TYNA 3CX7A 2XJ4A 2ZE8A 2YWEA 5JWHA 3VR5A 3REFA 1NSFA 3ZZ0A 2XEXA 1E9RA 4IVQA 1NN3A 4P4UA 5EXTA 1BS1A 1F2UA 2FPMA 4FCVA 1N6RA 4C0KA 4LK2A 3LXXA 3FVQA 2RHMA 2FGKA 5CIQA 1II0A 2G6BA 3ADKA 4G01B 1GIAA 2VRWA 2ZANA 1HTWA 1BKDR 3KXIA 3PCRB 4WXPA 2PZEA 4IEIA 4WZAE 1K8RA 2REXB 4AD8A 5CITA 3PXGA 2A9KA 1CJVC 5J47A 4IDQA 3IGFA 3FDIA 1NBMD 3LDAA 1GDDA 3L43A 1R8SA 1GRQA 1E0KA 1ZJ6A 2FSFA 2LWIA 4R2HA 5JSZA 3IQXA 4MDFA 2GF9A 3SE0A 5G40A 1N25A 2F1RA 4HAUA 1JR3D 2QT1A 1ZVQA 1F60A 4LYJA 4TMVA 1OIVA 1P6XA 1DVRA 1E2PA 1FNNA 2OILA 2OLKA 2P5SA 2ZJ8A 1DO0A 4HAXA 4UNPA 4DSUA 2Y8EA 1XX6A 4IHQA 2GAAA 3AF1A 5EZ5A 4LC0A 3RC8A 2BCGY 3MJHA 3D7MA 2HYDA 3QXSA 1OH7A 5ELXA 3K0EA 3GQBA 4XD7D 2QENA 2QMUA 3DEFA 2D3WA 1MV5A 3KKMA 4HUTA 3BS4A 5B57C 3ZLJA 4QBGB 4PC2A 2MSEB 5FOSA 5JJLA 3O47A 3NHBA 4IDPA 1XZPA 4FXPA 1YE8A 1KKLA 1Y3AA 1E2DA 2DZNB 2JATA 4C0AC 1SKYB 1Z08A 4LHXA 2A5FA 4MUAA 3REGA 3WHKA 2QMEA 2BEKA 1P7CA 3AJIB 2VHUA 4DCSA 1G7TA 2YNMA 1CR0A 4HUQA 4Q4HA 2VHQA 4BFZA 3LFUA 3JVVA 4ESHA 5HCNA 5TXGA 4CEJA 2A30A 3FTQA 3FMPB 3I8SA 3Q7QA 2FV8A 3OF5A 4DEXA 4EPVA 3C5CA 4MRNA 3SDZA 4JYCA 2YOHA 2HF9A 2H7VA 1KNQA 2V6IA 3K0CC 4TYWA 4A1FA 1VCOA 3K09A 5LPNA 3BH7A 2D7CA 3SU8A 2JLXA 1J2JA 4Q4JB 4JYBA 1OH6A 5KHOC 4NMMA 4C0HA 1T91A 4FW9A 4KLNA 4CT4B 2YKGA 5FOWA 4M9ZA 2C03A 2BKUA 3PEUA 2JLZA 4JT4A 4NDZA 3VKHA 2VHJA 1KY2A 4DXAA 1U8ZA 3MRSA 3U2QA 2IYRA 2GXUA 1YZGA 1UKYA 2JLYA 3QF4A 1K5GA 3KJIA 4ARZA 4RZ2A 4LCBA 2R62A 2J1LA 4M9XA 3P1JA 4PHGA 2BIFA 1WXQA 1W1WA 2P65A 1MO3A 3MWYW 4EPTA 2Q3HA 3V4RA 1IOZA 4D25A 4M4SA 1SZPA 2G0TA 4YMVA 2REBA 3HYRA 4YONB 1Z6GA 1LV7A 1DARA 2YC2C 1VYTA 4OQLA 2O8FB 3O8DA 2C9OA 4E5UA 5KSYA 1EK0A 3SZRA 4DLZA 2JJ2D 1B0UA 1NVXQ 3IQWA 4WOPA 4PAOA 4LBVA 5G3ZA 4DCVA 3EIEA 3D3QA 4OI1A 1JR6A 2IW3A 1R4AA 2VP2A 2JCSA 3MUFA 2IXGA 2DFTA 1YZKA 3QG1A 2C8VA 1F2TA 2IYYA 3CH4B 2D06A 3ADBA 3AKCA 1QDEA 2PBRA 1OIXA 4OI4A 4B76A 2PJZA 1E1RA 2G9NA 1F3OA 1IN6A 4LHZA 4DCNA 2GCNA 4BLSA 1IN5A 1W5TA 2ZSEA 3R20A 5C2JB 1HT1E 4NYMR 4U02A 3TQCA 121PA 4MYCA 4CZ2A 2F1IA 4A0GA 3G0HA 1JEDA 4GZMA 1CJMA 1KHTA 2RGEA 5KDOA 1XJQA 1EG7A 2R6AA 1E79D 4I1SA 2OHFA 1YRAA 4IVRA 4B47A 4JLDA 3FPAA 5AUQA 1XD9A 2ZE5A 3BE4A 1VG9B 4CT5A 2Z43A 1AKEA 1KI4A 1OFTA 2OXCA 3RHFA 2OCPA 3TBKA 4K8OA 3SHFA 3QKSA 2ZXUA 2W58A 3E70C 5JS8A 1Z6TA 2ZJ5A 3E1SA 4DRZA 1AIPA 1RRGA 2OFWA 3CRMA 4PO8A 4EFNA 4OK3A 4P0TA 4F38A 2XTZA 4TLAA 1G3UA 1DOAA 2RGNA 4B3CA 1MKYA 1Q57A 3AF2A 1II8B 4LI0A 2YV5A 4F4IA 2YINC 5AR1A 3R7WA 2A5DA 3UMRA 5EQTA 1YR7A 3GLGE 1UKEA 1JECA 3DZ8A 1NN5A 1G64A 4GMDA 4CF7A 3EZ7A 5JBQA 1G9XA 1CF4A 5EP3A 2WPDA 4I99A 4JLMA 1MR3F 1PLJA 5DI3B 4MITA 5B64A 3CB4A 4ASUD 1OIWA 4MRPA 4Q47A 1X1SA 3DMDA 1P73A 2D2FA 1JPJA 4WAUA 4BFXA 4BEBA 2QSZA 3BD9A 1M34E 3SOPA 1ZMXA 1SVMA 2DZOB 4M22A 4PHFA 4R71A 3R9XA 4G5SA 2SHKA 1YZTA 2H16A 1E9SA 2CMKA 2CHVA 4BLRA 4EPXA 3MWJA 1ZBDA 2ZRDA 4A2PA 5H1YA 3IBYA 3Q85A 1NSTA 3C5HA 1VECA 2RHDA 3CRW1 4BASA 1AN0A 3KFVA 3RDPA 4C4PA 1GP2A 3C7KA 1KI1A 5SZJA 3MWLA 2ORVA 1XFAA 3UG6A 5TVKA 1NIPA 4B75A 4C0BA 1NLYA 5JHGB 3L82B 1CJKC 5FL3A 2GRJA 5F98A 5E7MA 4DDVA 2QQ0A 2DFNA 3N70A 1G8YA 3LXRA 4G5QA 5CK4A 2XX3A 1E9FA 1G8FA 2A5JA 3AGQA 2WWYA 2CLSA 2NGRA 5J4HA 2ANCA 3K9HA 1M74A 5FI0B 5J4YA 4GP7A 3FGNA 3BXZA 4XD7A 3LW7A 2ERXA 2IEYA 4HAVA 4Q9LA 2O0JA 3B1WA 4IOKA 2DFKB 4KVGA 4MQBA 3GLGA 2GBLC 1GKYA 1QHHB 2VTKA 2JJ1D 3U61B 1P2UA 1ZAKA 3EW9A 1AS2A 1Z29A 3EXAA 4RZXA 3TIFA 1Q44A 4MUBA 1KO7A 4N0EA 1KSJA 5TB5A 4A8JB 4TMZA 1JXMA 2F7SA 3LBHA 4PQRA 5A5GA 5AUPB 4CGZA 1R5NA 4HLUA 5JRZA 2CLCX 2AXNA 3QY0A 4V0LA 1QBKC 2UVQA 5AJYA 1MRNA 1G19A 3UMSA 4EJSB 2YWGA 2ZREA 2EQBA 2IK8A 2VP0A 3ZVNA 3R8FA 1WMSA 1KMHA 3KB1A 4P4SB 2EWWA 4G5OA 3F3YA 1AJEA 1FPMA 4MYTA 2QSYA 3KX2A 1SVOA 5H70A 3A1UA 4KFRA 5FPSA 2OV2A 3L8YA 4B2IA 3GLFE 2G77B 2XXAB 4QGGA 3EZ6A 2QAGA 4XIGS 3SC3A 4C0LA 1GL6A 1G17A 3KKOA 1G3IA 5EP4A 3P32A 4JVMA 1F6BA 5EJEA 2F3TA 4JBYA 3ONWA 5FH9A 3AVYA 4GMXA 1UFQA 2EFDB 5FUXA 2NO1A 2IF0A 3QI2A 4G0NA 2JGNA 4URYR 2C9CA 3F5FA 1ZIOA 4OI2A 1CEEA 1IXZA 2ZSAA 2B8TA 1US8A 1HYQA 4XWKA 2HDNB 2ZM5A 2ZR7A 4AYWA 3A1VA 4NHOA 3TAHA 3KB2A 4TLEA 4M1OA 1XEXB 2FOLA 2L0XA 1Q20A 2AN9A 3AVWA 1G4UR 1I4TD 1HURA 2HUPA 4AYTA 2J41A 4MKGA 2LKDA 1G16A 1D2MA 3K09C 3TUIC 2WWWA 1K5DA 1OJLA 4JLVA 1E32A 2NIPA 4MRSA 1TNDA 4AKEA 4DB2A 2D74A 2FSHA 3UANA 1J90A 2MSDB 2OXRA 4QRHA 1YR6A 2O8DB 1TX4B 1NVUQ 5JI2E 3THXB 1B23P 2IYWA 3AVPA 4LPSA 5AK0A 4DUGD 221PA 3ZS9A 1Z3IX 2IF2A 2Z0MA 3EZ9A 2JLUA 1JALA 2JJ2A 1EXMA 8OHMA 2AX4A 2FX3A 4TQAA 3U44A 2O8CA 5FL7D 2RGGA 3I92A 3PUWA 3Q5DA 3VR4A 2CNWD 3X2SA 4ZDJA 1VIYA 1KSGA 3RRZA 2BV3A 2DYKA 3AF0A 2CL0X 3LVRE 3LBIA 3DL0A 1OXUA 1KSFX 3TE6A 3AF4A 1RPZA 2PZFA 4JL6A 3U7FB 4ABYA 4IFEA 1P9WA 3TNFA 5GVRA 5CB8A 1R7RA 3AVOA 3AM1A 2CCGA 5E3HA 1GUAA 1J70A 4UNNA 3THYB 1FUKA 2J7PA 3DZDA 2FSIA 5GADl 4NU0A 1RFLA 1R8QA 2AHOA 4XOIA 5UKDA 1UKVY 3GLFA 3FE2A 5D3MA 3KJGA 5HKKD 3VR2A 3C41J 4US0R 3LNCA 2W2XA 5KUTA 3H0KA 4PFSA 1FP7A 2ZRKA 4YC7A 3W8NA 3IILA 2ZS9A 5JJKA 2CHQA 1YR8A 4YMSA 1W36C 1XD2A 2JEOA 2R8RA 5LBIA 2XZPA 3GFTA 4PANA 5HR5A 1P2TA 1JEEA 4I1VA 1BO6A 1WP9A 2NO0A 4XTRA 2WWFA 4BLQA 4TMXA 3EASA 4BZPA 4DZZA 621PA 2PZGA 5L3VA 1Q21A 1AKYA 4HB2A 4LJ4A 4L5BA 3M4YA 1E2FA 4Z54A 5BXQC 3HU1A 1XMSA 4B74A 4HLQB 1ZIPA 1N3BA 5L3SA 1Z6AA 4P4TA 1HE8B 2IYVA 2WTUA 1M7HA 2CLDX 2GEVA 2OG2A 2YVUA 3AKEA 4HATA 3LW8A 2C96A 2JIZD 2ZQ5A 3U7EB 4C0SA 2PT7A 4YMWA 3W90A 5KU1A 1IN7A 3BFKA 3LRPA 4Q18A 2OBMA 4R2IA 1Q1EA 5JS7A 5K8LA 4LSGA 4A15A 3L8ZA 3MGCA 3PITA 4C0JA 1A7JA 3V4FA 1J8YF 3GLHE 1F2UB 5KDDA 1VCMA 3QEOA 1WDTA 4WXRA 6Q21A 3OIUA 1TQDA 4DLVA 1KAGA 2Z6VA 5FOUA 1Z0IA 1Q1QA 1R0XA 4ASUA 3L2OB 5HCIA 3GJ5A 4Q7LA 4WIAA 2AWOA 5TARA 2OESA 4PQYA 2RGNC 4OQMA 5C46F 4KODA 5B30A 4O2LA 4X8LA 5CB6A 1NVWQ 3KKPA 1G41A 2IS4A 2UZIR 3B82A 2P6RA 5JSZB 3DM9B 4X8OA 1W47A 2P6NA 4KFSA 4KJZA 3TVDA 2FU5C 2QP3A 2W00A 4DDUA 4LHVA 3VQTA 4HDQB 4DLYA 3AVVA 4RZ3A 4D4MA 4AK9A 3TSWA 1G7RA 1XMIA 1PVOA 1UEIA 4JLOA 3T5GA 2V3CC 5AJVB 3TKLA 1XRJA 3IEVA 5HE8A 3BJIC 4PZZA 3B1XA 2HF8A 2RGAA 3AUXA 2PEZA 4JKIA 5GVSA 3U5ZB 4XVQA 2GCPA 5K8IA 1W46A 3MG9A 4YMUA 2IS2A 3QXHA 3P27A 1TQ6A 2QEQA 5JMTA 5DI9A 2KWIA 4EQ6A 4AKIA 2MSCB 4QGFA 1Z2AA 1ONBA 4B6FA 1OF1A 1UPTA 5KPDA 5EUQB 1HQYE 4OHZA 3V00A 1DO2A 1Z8FA 2C5LA 2HT1A 4LZZA 3TGPA 3UKDA 1WBDA 5AJZA 3ADCA 3T1VA 3RNLA 1JPNA 3VHLB 4B32A 4NH0A 5CM9C 2ZRHA 1E0AA 4HUQB 4B73A 2QQEA 1FMLA 4Q4HB 4BRUA 5JCZA 2J0UA 1KI6A 1PUJA 2Q9BA 2VP5A 4F4JA 2NMVA 4DHEA 4M9SA 3WMEA 4CEJB 2PX3A 1AA9A 3WBKA 4G5RA 4OJKA 2CK3D 421PA 4L15A 4QG7A 3HYTA 5C4MA 2JJ1A 3SNHA 1ZU4A 2DWQA 2EW1A 2EVWX 2C9YA 1R6BX 4D0LB 1PV4A 4L4UA 3GLHA 4DVGA 3NIBA 3RC3A 3W6NA 3RS0A 1DS6A 3IO3A 4AY2A 3QNUA 2JA1A 2IS1A 1I2MA 1Q3HA 4A0RA 1SXJD 1E2IA 5DSZA 3N5CA 3RWOA 1HA3A 1JJ7A 2ONKA 4EDHA 2QPAA 4HZUB 3GEHA 4DEYA 4WW0A 1U98A 4B3GA 3SQWA 2VYFA 5DNYB 1FTSA 4Z51A 2HXSA 2QNRA 3VU9B 3IHWA 1G3RA 3SBEA 3EPKA 4BQSA 4NTZA 2PX0A 1M7GA 4PXAA 5CLLA 5DN6A 1KDTA 2AFHE 4QBFA 2ERYA 3U44B 3GMTA 5G3YA 3PEWA 4TYYA 4XWAA 3LH5A 2AL7A 2OBNA 3FB4A 3EAQA 2ZSFA 1XPOA 1E1QD 3B60A 3EWAA 3AKYA 2WKRA 2OCBA 4TMKA 2BCJQ 2JJ8A 1IXSB 4C7OA 3QSYA 3VX4A 3N2EA 1R0ZA 1T3SA 2GZHA 3I4LA 2XB2A 3X1WA 1T5IA 4TWZA 2YWHA 2QE7D 4R9UC 1IONA 4ZKDA 4G1UC 4EFMA 4HAWA 2FPKA 2G1KA 2RGDA 2ZI9A 2IYUA 3AVXA 1UAAA 2ZRFA 2D62A 1VCIA 2EYUA 1F2TB 1W0KD 2QAGC 4URXR 5SZIA 2RH5A 3W3AA 4B33A 1JB1A 1R2QA 2ZRGA 1ZNWA 3GFOA 5FTMA 2ZYVX 4PO9A 2G88A 1Y63A 5TMPA 3GLIE 4RFSA 3UK6A 1W0JA 2IXEA 1QG2A 1ZNZA 2IWRA 2B21A 1L4UA 1W2HA 1X8LA 3MJRA 4DUGA 2V6JA 1Z0FA 4A4DA 4LYFA 3Q8XB 2W6ID 4LV8B 5JEDA 4DWJA 5EE1A 5F3WB 2AFIE 5FL7A 2VP6A 2IYXA 1GKUB 1HQCA 2OEPA 4M0LA 4S2EA 4NONA 3BRWD 1TADA 1P3JA 4E22A 1KI2A 3J81k 2QPOA 1GITA 2FPLA 2KJQA 1IHUA 1FNMA 1SVLA 2XSZA 3M6AA 2NPIA 1GL9B 2QGNA 3GCGA 4MKHA 2WMNB 3U3MA 4CYMA 3A4MA 1W7AA 2GXSA 1JNYA 2VBCA 4AURA 2IUTA 1ZD1A 3I72A 3WRYC 4NYMQ 1CR1A 3BORA 1W5SA 2WMOB 4TTQA 1E2MA 3FYHA 3M0EA 2J9RA 1ZC4A 4G5GA 4E09A 3ZZUA 3MAAC 1E69A 5HKKA 2ZS8A 1M7BA 2V1UA 3H4MA 4KYUA 3SEAA 1DADA 2AD1A 2ZRLA 2ANBA 3IUYA 5CK5A 4HB3A 1A2KC 1YR9A 2J7KA 4MGYR 2GBLA 4Q7KA 2ZRIA 1QZMA 1IJEA 1KMQA 2X19A 2YC4C 4URUR 1E96A 4Q4LA 4UJ3A 5FBQB 4DDWA 5FPKA 1VHLA 3IIJA 4PPQA 1KDOA 2WJHA 2PH1A 4JKYA 2Z5FA 1R0WA 4LHWA 4LJ7A 4B3BA 3FWYA 1WQ1R 2EFGA 3X1ZA 4Z1MD 3B85A 2EYQA 1G7SA 4WZBE 2VEDA 2WJVA 1G3MA 1ZUNB 2CL7X 4JJKA 2RAPA 3WNCA 4Q1DA 4GOXA 4M53A 4O2RA 4ACBA 1J8MF 2JIZA 3T12A 2AKAB 2D4HA 4XWOA 2ZYWX 3EZ2A 4FD2A 5CDFE 4MYUA 1EFHA 4S35A 2QGZA 1RJ9A 2ZVQX 3GLIA 5FFMA 2PLFA 4TLBA 2WAXA 4F91B 2V7QA 4Q7MB 2GJ9A 1TTTA 1SXJE 1GOTA 4V0ME 4PC6A 2Q0HA 3DO6A 3K70B 4Q7JB 4C2TA 2O8BB 4IKEA 2BJVA 2BMEA 3BC1A 1M1YE 2B8WA 3THWA 5EE9A 2GAOA 2DWPA 1LW7A 2GJSA 2CE7A 5AWFC 5KSOA 2J46A 1XCGB 1W2GA 2A2ZA 2J87A 4IFBA 3RSLA 4LC1A 5FTJA 4IW3B 1UJ2A 2ZRMA 2IYSA 3W5IA 5HZKA 3T1TA 1Z0JA 4RD6A 4MDEA 2QMHA 2PLRA 4HAZA 5L8VA 1RC8A 1G5PA 4PO1A 3TLXA 2ONJA 1UADA 5CLQA 1ELOA 4QHTA 5FTNA 1OXXK 1D9XA 3RRYA 3S1AA 1ZYUA 4RY2A 3TAUA 1DPFA 1S96A 5DO9A 3ZYCA 2ATVA 3KL4A 1S1MA 1YZLA 3CZPA 3TR0A 2ZIAA 1JBKA 1W4CA 2QORA 4ON9A 3SN6A 1CJTC 1TU4A 4N3NA 2A5YB 4TYQA 1BYIA 3GJ3A 3L0IB 1CP2A 1LY1A 3W34A 1DAGA 5FPYA 2WSMA 1KMHB 1S0UA 4TMWA 3SFZA 1SVSA 2QBYA 2Q3MA 5JWOA 3EWSA 2J0VA 5DHFA 3A6PC 1D9ZA 3I5XA 1OW3B 1RYHA 2CK3A 2W6JA 4IOMA 2QP9X 1ETUA 2QTVB
chains in the Genus database with same CATH superfamily
3H04A 4CMGA 5JD5A 3VYRB 1P60A 1K8QA 2OV3A 1SXJA 4ZCLA 4L9SA 2CDNA 4A3VB 5F33A 4C6HA 3Q7EA 3KTAA 3HKEA 3VZSA 3I9LA 3NEAA 1AY0A 3PKJA 4FQ8A 3IOCA 2ZEJA 4GL2A 1CP3A 2ZZKA 2OAGA 2JLCA 4PQEA 4BC1A 5KPRA 1E1YA 5K1ZA 2QGFA 1W59A 1ZHHA 1AM4D 3G5TA 5TPWA 3MN1A 3T3IA 1AQIA 2WJJA 3KJEA 2VH2A 2FLWA 2WHPB 1N2JA 4RIGA 4M0DA 1U2RA 1OKKD 3ZX5A 1IBMB 4V0NA 3F67A 3TF5A 3WL7A 4JLWA 4HG2A 3I58A 4UMFA 2HRQA 2C54A 3GVXA 3JD3A 4M54A 1CKEA 2OUKA 3FOFC 1Z4QA 4U3JB 2CXQA 4JYMA 3JWEA 3AVQA 3E3NA 3PFWO 3DL2A 3EX7C 2Q3CA 3VTFA 2B7BA 1ZK2A 5D3KA 3PDIA 3BA1A 4QJ5A 3T06B 5K6TA 4FIZA 5JE8A 2IZ0A 5CG2A 3GCXA 5K3SA 2VTEA 2HBZA 3R3WA 1D1SA 1XEFA 4MA5A 1G0NA 1WMFA 3PQ6A 5FUQA 1YRQA 1Z5UA 1ISHA 5K2OA 3D4IA 4ZVQA 2ID9A 2YHIA 3GEGA 3FZQA 4L02A 3NTVA 5HGJA 2CC2A 2QRZA 1PJLA 3EXG2 1EESA 5TQ0A 1JLKA 1OZHA 1UXKA 1T5LA 3CNLA 3L7IA 3HP1A 2G1PA 4URWR 1HYBA 3HA2A 3KCQA 4K3VA 2YQ5A 2RFLA 3UWDA 2FSSA 3ORQA 2HMYB 3ZHYA 3E7XA 3PEVA 5JASA 3HV2A 2HQOA 1J5XA 1F0PA 4JP8A 4TQGA 3KKKA 3K8OE 5KTYA 4L6V6 4UUNA 5IAGA 1B00A 3V7NA 4TS3A 4U7DA 3NWPA 4X1IB 4YASA 2EIXA 3ZD7A 4AX4A 4ZZ2A 3FZGA 1UK8A 4Z49A 3VKGA 1KK0A 3K0SA 1E9BA 4FILA 2XWPA 3H4VA 5AJUA 2I65A 3W3ZB 1I3MA 1U1GA 4YBRA 5J1SB 2I29A 1MABB 5JXGA 3NKVA 1PQUA 2COKA 5D6OA 5H3HA 3U6LA 1XCPA 4BDSA 1PP4A 3C4JA 1FP2A 3D4OA 3OLWA 4G89A 2FAXA 5HTOA 1VZ3A 4PCZA 1YZUA 2R25B 1NZDA 4CLRA 2LTAA 1WW8A 4OATA 1P7ZA 1N6PA 2AXQA 3OLYA 1EX6A 1WY7A 2AUMA 3CW8X 2QN8A 3JWHA 3EW7A 3C7CB 1A96A 4TKMA 2MR9A 2AF4C 4GPIB 4M1TA 1L5MA 4RCZA 3P4UA 1A7AA 4G8JA 1NXPA 2O3TA 3CZAA 4F93B 2Q1TA 3DYVA 4XDYA 2ZLBA 1FQKA 1Q11A 4N8SA 1DKLA 3PEYA 5J4LA 3RT1A 1UXGA 4OJQA 1TRKA 4ETIA 3WYGA 3EUFA 1V37A 3QUCA 4DSOA 2HWKA 4G0UA 4QKQA 1QRTA 3N74A 5E4YA 1QVAA 3AILA 3LKVA 5JNTA 3P2IA 2DSNA 1E2BA 3ZWYA 2WNSA 2HWWA 4L07A 1EJBA 3SXPA 2JY6B 5FD8A 2WJAA 2GK7A 4Q9KA 3KV3O 3E8MA 2IX9A 4F4FA 1JHDA 1IJKA 2XAUA 3OEEA 3F9RA 1TIBA 1QIIA 1F5NA 5LKRA 1F8YA 2KLBA 1K86A 1XRSB 3IBCA 4F6CA 2CDCA 1H8HA 2XY4A 1E9DA 1PUXA 4J7CA 4BECA 5KJFA 2ZJBA 2Q2NA 3CLUD 3W1WA 3WXMA 4ZU6X 4AZSA 3TG2A 4N5MA 4GH9A 1FTWA 3LX8A 5D86A 2H9YA 2FS1A 1OMOA 1EE1A 2VDWB 1C41A 2Y0PA 3GUCA 3GFBA 3UWSA 5IUJC 3JYQA 4UPVA 3MOIA 2BZSA 2FUG6 4PIVA 5THQA 3WWDA 4O3MA 4YAOA 2ZWOA 4L4ZA 1RCUA 2KZSA 5GZ1A 1VGQA 1E1CA 1CFJA 1RI4A 5EYPA 1C8BA 4O0MA 2HGSA 1NDHA 2BGGA 2GA9A 2FDXA 2PL9A 5H83A 1QFSA 3QQPA 4M86A 2FP3A 4JUFA 5E6RB 4ZGWA 1HE1C 1LLQA 1KDZA 1NOJA 3L41A 4R4JA 3VYUB 3R74A 1LLUA 4AO8A 3R9KA 1I13A 1R50A 4DY4A 1ZCZA 1JEJA 1GVNA 4NPHA 2XBLA 1T2VA 3A6ZA 3TWLA 1JQLB 2ZYRA 4TVKA 1Z2OX 1MA3A 1JSXA 3QJYA 1HDCA 3CSUA 2XMDA 3OMLA 2QVBA 1NP7A 3TX6A 1FDTA 4IF6A 2NZXA 4MS3A 3SAJA 2GMWA 4HZUA 1M1NA 4UNRA 2X0JA 1NWHA 4QD3A 3H5OA 3DHVA 3JZDA 2CYAA 2UYOA 3RSHA 1HLGA 4FDAA 4FYXA 2RK4A 4IHJA 5A7FA 1BCRB 3ISVA 3SICE 3T8YA 5F4BA 1SELA 5DWDA 1XPUA 4AKGA 2Q62A 3R4CA 4CMAA 1BE0A 3JVDA 4QGHA 3EQ9A 1N2CE 3V8BA 1WEHA 1A2QA 2DXIA 3BEOA 4DLUA 2VAXA 4KLCA 3DBHA 4L9RA 3BHMA 1LX6A 4NIMA 3MWFA 1LI5A 3GEEA 1AT1A 2EGHA 1T0IA 3CGGA 5T3YA 5I8ZA 2G7ZA 1VJ1A 3LPCA 4K26A 2FZVA 1ACMA 2O23A 5IZCC 4OHWA 1A8IA 2BKEA 1AV7A 5D6NA 3HJBA 1BWQA 1NF3A 1DRKA 4G8DA 5DX0A 3L04A 5E3JA 1G8PA 2D1RA 4YJFB 3NP7A 3C8ZA 4QUGA 4F7WA 1TZCA 3WQHA 2XGNA 1H2BA 2PIAA 1GTZA 3WB2A 1N5RA 5DOZA 4UHHA 4P81A 4EY5A 4BV9A 1ST3A 1HV8A 1RJGA 4IXTA 1U7TA 1DE0A 3PUVA 1TGVA 3TDNA 2PNFA 4EGJA 1NNEA 1LLDA 4PXSA 3RS2A 1MT0A 4X93A 1O0BA 2Z2JA 3IESA 3FHOA 1WABA 5E6JA 4XGNA 5DGXA 1AB5A 3N3AC 4KRYA 4D9GA 4IIJA 4BWVA 5IVDA 1ULUA 3ZDDA 4NRWA 1TYCA 6REQA 1QHYA 2XFTA 1SXIA 1AXRA 3CNHA 3V4LA 4GQAA 5JS1A 2Z8YM 4KMMA 1SCBA 5CM8B 1GPNA 2P9BA 3M6WA 4XSGA 1KJQA 3C8UA 4CQLA 2PQMA 2HUNA 3KOMA 4NOLA 4RKFA 5HF8A 2BEWA 1XU9A 4YJGA 5C8DA 1NG1A 2Y1KA 1A8HA 3W7AA 1LBIA 4BMSA 4C0WA 4LYAA 3KHTA 4KO8A 3HE3A 3OOWA 2DZDA 3TUZC 4AY6A 1P5FA 1H6CA 2OCDA 1AH2A 3NLLA 4ID3A 4HHEA 3ROEA 5BNIA 2PRKA 3CF6R 4BN0A 3AINA 1ZI9A 2X40A 4ZXPA 3CZ9A 1OBOA 1AVTA 2ZJ2A 3KT6A 3LUJA 1C5KA 4QAQA 4YRMA 5KO2A 1QZUA 4X5OA 5EIAA 2JH9A 1A9XB 1ZGBA 1ODIA 3SR0A 3LUKA 1JS1X 1CU1A 1XF9A 2GSWA 2UUOA 4LQLA 3BB1A 2JA2A 2F17A 3NHYA 3WIVA 4IHJF 3RVKA 4BYMA 2ZJ3A 4RS4A 3P5SA 1LCIA 3IXQA 3ZKAA 2JLRA 3TR5A 3P2OA 2ORYA 4M99A 3ENWA 1BQ3A 4IZIA 1RP7A 1W25A 1XVVA 3K70C 3F8TA 3DKPA 3SASA 4FWHA 1SULA 1K3WA 4OXNA 4UAVA 3OAAD 2QN6A 4EYEA 1BVRA 1G8GA 3F6EX 2VJMA 4LMAA 4H1VA 2ZE6A 1T4GA 1UBLS 1M8KA 4DCTA 4GYJA 3MPOA 3L8GA 3RVPA 3AFIA 2CXNA 1YK0A 1UF9A 1T1RA 3OSZA 4OHKA 2MR5A 1ZJZA 2QRMA 4PDIA 3STUA 3BCHA 3ZJVA 3I51A 2IXBA 2IY8A 1MJFA 4HGNA 3A9RA 9ATCA 4ZYUA 4MAMA 4QDZA 4BZZA 2JCXA 3QAUA 1OFGA 4P54A 4J16C 3CA8A 3OF3A 1XXHB 4TYNA 1RI2A 2V4MA 3L0CA 1B26A 1NN3A 4ALIA 1GU1A 1KE1A 2C82A 3ITDA 3IULA 3GLVA 2G6BA 3MT0A 2REXB 3IGFA 2DHQA 3TLGA 2V3WA 1QTIA 3QVMA 3UENA 5KKCA 3ESAA 2QX8A 1O2DA 3L40A 4GSKA 1JMKC 3P2YA 3TW6A 1FNNA 1XX6A 1A9YA 3E8XA 1ADGA 2HYDA 1TM5E 3P5BA 1HMYA 1VL0A 3A9WA 5CHYA 4WMLA 1JSCA 3A3YA 3BS4A 4IIJF 4NVRA 2IOYA 2R48A 1SKYB 2Q2WA 4ZOCA 3C7TA 3RSCA 1P7CA 5T8KA 5DZSA 1GSHA 3L4BA 3C8DA 3MK6A 5FT9A 2UVPB 5TXGA 5JISA 3RUDA 3OF5A 5AVVA 2I9PA 5GV7A 3OJFA 1AXGA 2G5CA 2JLXA 4Q4JB 5U9CA 1AUPA 4NU5A 5BYBA 2BKUA 5IMSA 1V6SA 4JUDX 3ZCXA 1GZ3A 3Q87B 4R68A 2B5OA 3O73A 4O1IA 2JLYA 2WU3A 4ARZA 2IE8A 2BIFA 4YPOA 5A62A 4UOQA 3PGKA 3TMAA 1YJBA 3JQDA 4QECA 2IP4A 2C9OA 1JH9A 3U19A 1MX9A 1CS0B 2VP2A 3DV2A 4B1FA 1I6MA 4PAGA 4PRZA 3KO8A 4NYMR 3MINB 4HNGA 1CJMA 2FWBA 3NTLA 4YCDA 1XJQA 1FB5A 3FPAA 3BE4A 4X3PA 1QIJA 1M75A 3QKSA 2OB2A 1R0SA 1N7GA 4PGAA 3T94A 1M6WA 1RJFA 1RRGA 3HV0A 1L5SA 1I7DA 4O08A 4TLAA 5JANA 1APBA 4FDVA 3MOSA 1IY9A 2AHRA 2A5DA 2R4QA 2R8XA 1L5GB 4O8CA 3DZ8A 3VPBA 5JBQA 1NFQA 2PRJA 5EP3A 4ASUD 1SUBA 3D8LA 5BMVB 1S2NA 3HJAA 2CMKA 2C0CA 3KQSA 4BO6A 1AQNA 1ACJA 5C32A 2HLNA 3RF7A 3V1NA 1L1RA 3MBIA 2WIGA 1RADA 3W3AH 3HZHA 2NZ2A 3CUKA 2ZFUA 1R27A 5E7MA 3IUBA 5ILQA 5I7FA 4MP8A 1Y6RA 1H1TA 1DC4A 4HAVA 4Q9LA 2DFKB 4AJJA 2PLNA 1AS2A 3CUWA 3CF6E 4BDTA 1BDHA 4WVLA 1T3GA 4V0LA 3UFXA 3L92A 4EJSB 2PLWA 2QQGA 3M1AA 3KX2A 1SVOA 3IOBA 5J43A 4LNUA 1QRSA 4KQXA 4DTIA 4AZTA 3NMUF 4R0NA 3P32A 1NI5A 1B8OA 3ANTA 5B3AA 2CFSA 4DJ5X 3KKZA 3BWCA 1E8MA 3HI6A 2EJBA 3BXEA 1EEHA 3Q2IA 1XDZA 1HX7A 1QR6A 2XMCA 4XWKA 2FOLA 2HRRA 2ZWMA 1T2EA 3D8HA 2ISQA 2E2WA 1K5DA 2QLTA 3MMNA 1QYVA 4DV2B 2MSDB 3FYSA 4BB6A 2J3JA 1NVUQ 1JIUA 3KYDA 4DUGD 4LJKA 3PUWA 1SBNE 1NULA 1O5TA 3D8TA 3TE6A 3LVRE 3DL0A 4G86A 1RPZA 2UZ4A 2L19A 4JB8A 1U4OA 4EO7A 2QRVB 1RFLA 2BF4A 2A1TS 4BRZA 3IIIA 1X42A 2WTMA 5DVZA 1E7WA 3QELB 3HRIA 2Q6VA 1QYCA 4AW9A 621PA 2OGUA 1P6QA 3DMHA 1RQNA 1QIKA 5HBRA 1Q7TA 2BAGA 3MGCA 2Z9BA 1ND6A 4BFLA 3QEOA 6Q21A 3OIUA 3EIWA 5HCIA 3TB6A 3BRSA 3IUNA 4MP3A 2JVJA 2AA3A 2OK7A 1WBJB 3FYDA 3CGWA 2PY6A 1FJXA 5ALTA 5DI9A 3WBBA 2PVSA 5KPDA 5KEIA 2W42A 1UIRA 3GELA 1W19A 3DBLA 2J0UA 4U9UA 2Q9BA 3WMEA 3WBKA 1X1TA 2BZ0A 1XNHA 5J3JA 5AVZA 3NZEA 2WY2D 1JUDA 3FWNA 1SXJD 3UTCA 4GKVA 1G63A 2BH9A 4JJ6A 2R00C 1FVOA 5EZQA 4EB6A 3OZRA 3PEWA 3AKYA 2J9XB 3B70A 2YVQA 2XB2A 3WKEA 3AU8A 2YWHA 2J3DA 4ZKDA 1TUBA 1VPEA 3RIMA 2EKFA 5CDUA 1OI3A 1UAAA 4PNEA 2ZRGA 2PZAA 3U6OA 2B21A 2QM3A 2VKTA 4X9XA 3NHUA 2EG9A 1TE2A 1Z56C 1VSQA 4S2EA 1P3JA 4OLJA 3PYXA 3GVHA 3A4MA 4A26A 5KNCH 2IUTA 3JQFA 1B15A 3QU9A 3WLOA 1E69A 5HKKA 5FV7A 2AFHA 1HPLA 2I4NA 1DADA 5CK5A 3GRUA 3SZGA 1MAWA 4X1OA 2QZZA 6CHYA 3ISTA 3O8LA 2HR1A 3QBDA 3OLQA 3VZBA 1G7SA 4WZBE 3PHJA 1OLXA 2FRDC 2IOQA 4ACBA 2G9RA 3IYLW 3O1IC 2WJ3A 1A97A 1HLPA 1XZMA 4NXMB 1R74A 2C4TA 2EJVA 2GAOA 3NWBA 3E03A 1JTEA 4RQAA 4J7AA 2QAIA 4O29A 4DA7A 1EBUA 5E9WA 2O01F 1WUKS 3OLZA 3V8EA 5FTNA 1UJMA 5BO5A 3VMMA 2KRUA 1KEUA 3KL4A 3QRWA 1L6IA 1JBKA 4ZT2A 5DN9A 5AQEA 1ZZEA 3FGPA 2Q3MA 2KW5A 4I55A 2ETXA 1ETUA 2QTVB 5T4BA 2DETA 5CDFA 4CDNA 1H2XA 1Z4OA 5MDHA 4HB4A 1GPJA 1GKIA 2GEFA 2I6SA 4FE7A 4Q4AA 2NSDA 2FQXA 2F00A 4IXMA 1U7WA 3G9UA 1H0HA 3ETGA 3VDQA 2DB3A 4A03A 2V1CA 5F51A 2HMWA 3D3KA 3LWNA 2ZJ4A 3TQQA 4IRUB 3ZJYA 3HY5A 4NECA 4Q3LA 3LHDA 4JVLA 4IDDA 1Y6ZA 2H9AA 4DLPA 3U1TA 2C88A 4MI6A 1SC6A 3ACBA 4U39A 2GVZC 5CX1A 2IV2X 4F2DA 1N77A 1HL7A 1X9HA 4UFPA 4KK4A 5CDGA 3OM0A 1B73A 4ZYYA 1SB8A 4N7MA 2FTKE 3B7QA 1Q3TA 2VXBA 3L0SA 2X58A 3TL3A 3OM1A 2YDXA 4B82A 3I5UA 4LSZA 1FBNA 3N0RA 2YOFA 2DLCX 3D6MA 5IZ7D 3AEKA 3UMCA 1GU7A 3JQPA 1AK1A 4AJEA 4JJFA 1KAMA 4HGPA 3CUEF 1SD5A 3A0RB 4MR8B 1IN8A 3Q2KA 3PQCA 3GP3A 3GN2A 2KXEA 3K9LA 5BOSA 4FGZA 4WXMA 1GEGA 2DEUA 2XDQB 5K6RA 3SYRA 5J40A 4FGLA 2GXAA 4MVJP 3K1JA 5GOZA 3QOYA 3K96A 2IH4A 1YLAA 1N6NA 4I66A 2ZVDA 3L77A 2X14A 4WHMA 3IDSA 3UK7A 3RIGA 4DMKA 4KYTA 3OEED 4DV3M 4U4AA 4NYJQ 1CERA 2ZUTA 3KPYA 3ZY3A 1TRHA 1H8HD 4GM1A 2ZDGA 2HTFA 5KPTA 4JT8A 3G23A 2IXFA 3OCWA 1I80A 5JPCA 1COZA 1M1UA 4QU9A 3AVUA 5AKHA 4DJEC 4QUAA 2DHDA 3FTDA 3ESCA 1E1KA 4MW4A 5AKLA 1UOOA 2EFHB 1KGDA 5E7JA 1IBMM 4AZ0A 1Q2XA 5H37D 1WA5A 3IAS1 4FWIB 3H5AA 4OAOA 1CQPA 4UM9B 1ECGA 1E94E 1RWKA 2UUPA 3RUIA 3L0BA 3W2EA 1E59A 1EFDN 2AQKA 4WFIA 4D9EA 4WOBA 4Y1RB 3F97A 1ZRSA 4FOSA 4UCXA 4UVIA 3VHRA 3MWDA 1M6EX 2VLIA 5EEHA 3B89A 4ABTA 2F55A 1EGQA 1UIMA 4ZCSA 4LOJA 1ISJA 1J0DA 1LWNA 4I55F 4YQYA 2R8ZA 2VSQA 1RIFA 1GG2A 3MT7A 2WU8A 2JGAA 1FZQA 3ONNA 3IQDB 5CFNA 3FCAA 4HT3B 3ASYA 1C1YA 4CIWA 5HOEA 2WD8A 3LT4A 4FUQA 4ZVNA 4D4GA 2ZYDA 1JHXA 1ZKMA 3U40A 3IP3A 3IHKA 2N42A 4ER3A 1NVVR 4BZQA 4HYYA 3IAHA 5J5AA 3H8WA 3I1JA 4JASB 5IU6A 2ALJA 1DAIA 3A2LA 4TKVA 3NWLA 2I2BA 2IPOA 4KI0A 4FWGA 2PKWA 2ZB2A 4C03A 3Q3CA 4NLLA 2O5VA 4JGGA 2IUYA 5D5HA 4IXNA 2ZULA 3AHEA 4UDOA 3E53A 2C77A 2P9ZA 4ZCMA 2UKDA 4BPRA 4NK4A 1Z82A 3STWA 1ZMWA 4RA9B 4UQPA 2D8AA 4QU8A 3O8NA 2JD1A 3VPCA 3F92A 4IWNA 2JUJA 3RRBA 3U1VA 1FFBA 4I5DA 1GPLA 3AONB 3D5QA 4Q1AA 4IIHA 5IBPA 4GXNA 1UBCA 3ZH9B 1PZGA 3PPYA 1U7HA 5H5JA 4QT0A 1MEJA 1PK8A 2H31A 1P8AA 1TF5A 4WNAB 5C4GB 1C3JA 2O8VA 1NC1A 3HHZA 4NL4H 1OH5A 5KOYA 1C7ZA 3K05A 3NKLA 3NXKA 3OQBA 1QRAA 2OZKA 2ODPA 2IZ1A 2VJQA 3H1TA 2IWHA 1PLLA 4P33A 1ZH8A 3E0QA 4WBXC 5DTMA 4DADA 2XWJI 4BUZA 4DLSA 5ENZA 1V8OA 1YKGA 3PUXA 3EBLA 3BGWA 2BPOA 4EB3A 1X8KA 3PKZA 1Y8AA 2VYQA 2NOAA 1UK9A 2Q8NA 1MTZA 1CQWA 1TGUA 4KGVA 2IELA 5K45A 3LDHA 1AURA 1TL7C 1RYMA 4WESB 1FRFS 3VAZA 1YMQA 2JI9A 4N54A 2W8ZA 2R7MA 4MCIA 5I3ZA 2QMYA 5A9TA 2PGLA 2BHTA 1FS4A 1ODCA 2FA9A 4NF2A 1E7RA 2REOA 4JMLA 2GPBA 1OBVA 3G6WA 3WLHA 4DCMA 3P7MA 1XZKA 5CVCA 4D9KA 3RWMB 4MKRA 3P9YA 1M5TA 5DMHA 4P7BA 1KH2A 3LX6A 4QX6A 3T5MA 4B83A 2BEVB 3WQRA 3EHEA 5C34B 1HT2E 4K9MA 4QNMA 3HUUA 3DUFA 1O0CA 2WZJA 1E1QA 4QBHA 4DQLA 1XE3A 4PVCA 3W2HA 3QFHA 2J7PD 3AKDA 2PUDA 4YCAA 2QVYX 1DUVG 2GK6A 2VHTA 4R98A 3VR2D 1U8FO 1K7XB 1MHTA 2IZ7A 1T3TA 1POXA 4E13A 1SVNA 4C0QC 1RQRA 5EJIA 4H15A 2LIVA 4BJHB 1E5XA 2QL6A 1NPTO 1E60A 2JLSA 4DC0A 3CTPA 3ITKA 4C1NA 1ZXLA 3HSYA 5FB3A 1LBHA 4D4IA 1OA0A 3UWOA 1SY7A 2H00A 2C83A 2ZIXB 2IA5A 3MCWA 1GSAA 3T5DA 4P4NA 3G82C 3ZNPA 1VB3A 4ENQA 2WUEA 4ND1A 1I7SB 1ZA1A 3LO8A 5EXSA 1E2QA 4G37A 4IYJA 2DFLA 4IIDA 1KJYA 1JQEA 3B8HA 2QTWB 1FP6A 2I7NA 1FSSA 2BFEB 3UH1A 4UASA 1GUFA 1XVUA 3R3VA 1GTRA 3RODA 1T29A 1NMEA 1VJTA 5AXCA 5K3CA 1VCNA 2C98A 3RROA 5F7XA 3B12A 1GFIA 2X1MA 4I1IA 1EK6A 4JL8A 3ZCRA 4TN1A 3CLRD 2D00A 5FTKA 5TEVA 4CEHA 4OGGA 2JFOA 5A5DA 1D0MA 4RNAA 3WL6A 2IYLD 2H1OA 1YK1A 4M9CA 1QK4A 4NCKA 2TMYA 1KDRA 4ETMA 1MH9A 2NV2B 3RS3A 3Q0EA 5FEUA 5TT0A 4OHCA 1JAXA 2AOWA 1IUNA 4CU2A 3VOSA 2WKPA 4C7OB 3AHGA 1SHZA 1DTSA 1NVMB 2RGXA 3GV0A 3CS3A 4X8HA 1NQOA 2GX6A 3B2NA 5EUBA 1BG6A 3O9MA 3IUSA 3JZMA 3ZC3A 4IDOA 2QUJA 4R54A 3K94A 3RJZA 3WV5A 3ZDCA 3DE0X 3GPXA 5AW9A 3COVA 3OZBA 4CVNA 4E21A 2NQ2C 4IRMA 5M2QA 4ZVMA 5ICCA 2R5NA 1FYFA 2I8AA 3HGQA 4ZCRA 2PYIA 1YB1A 4W9NA 2WFLA 5MGNA 2ZATA 1IAVA 1EE8A 2XYVA 3IQFA 4LCEA 2OOAA 3BL6A 5DOVA 1WPGA 2Q6OA 1NRJB 4QC2A 4N5NA 1GPAA 4B3SB 1N32B 4BFTA 3IUMA 1XTRA 3RS9A 4QRDA 3UK2A 3ETLA 3MJEA 4FWBA 3X1JA 1CV2A 2WHXA 4C4RA 4R6XA 2W6CX 4MAFA 3REQA 5IT5A 2B2CA 4MVJM 2DWNA 1TC2A 1UDCA 4KKVA 3P9SA 4DGSA 3NOQA 2XNJA 3PIRA 2WJPA 1P2BA 2JAQA 5LP6C 3IQGX 1V3VA 5BQ5A 2HLDA 1XKXA 3WLQA 3WRWA 2FI1A 3RHSA 1JI3A 1MFPA 1N2IA 5KYXA 2FK7A 1YS6A 2VWQA 3AF6A 4I36A 4HQFA 4RXTA 4HNRA 4OK6A 2E49A 3JQ6A 3TLKA 5BOVA 3VC7A 2OORC 3WA7A 3PCXA 1C2TA 1YMVA 1NQAO 3WK6A 1DQRA 3U4QB 3DDCA 5ED0A 1AXEA 4HL4A 3LBNA 1JHQA 2EKLA 1FLDA 2JH8A 2WT4A 1P74A 3OY2A 4FR5A 4Q7EA 4IKOA 4Y0NA 2VLBA 2BMFA 2XMSA 2EUCA 2GD1O 2VHCA 3EY4A 2WMDA 1XJ0A 4ZTZB 3F5MA 3G2JA 1RWPA 3VRHA 4BL5A 3CSDA 3IQZA 5E95A 2H5LA 3E3LA 3L1KA 1K0UA 3EXFA 4NSNA 1P1CA 1ESMA 1EUQA 2VK8A 4BU0A 3H2SA 3VR5A 2YWEA 1BXGA 1KXZA 1GQ2A 5TQ2B 2C8JA 2AE2A 2RHMA 4G01B 3T7SA 5CLIA 2GO7A 4IEIA 1HDGO 4BAGA 1D4FA 1P80A 1FYEA 1SVUA 2FUG1 3IUEA 1GGEA 1D3AA 3GPBA 1RKUA 4DSUA 2ZJ8A 3JQGB 1V5GA 2YS6A 4NENA 3DTTA 5KYUB 1FFYA 2PUWA 2D3WA 3KKMA 3KQPA 3T6KA 2I6FA 5LYJF 3FETA 2JATA 2A5FA 2BEKA 4YRBA 2R6ZA 1E7YA 4B46A 2A30A 3FMPB 3EG9A 4LDAA 4QODA 4R1TA 3I05A 4LDQA 2R3SA 1KNQA 2IEDA 3BH7A 1O03A 4G24A 4RQBA 4JYBA 3ZCBB 3M6IA 1O94C 3NAMA 1R9JA 1T91A 2QD3A 4FW9A 3T9DA 1VMEA 4Y9RA 3R24A 4EMSA 1KVQA 4RZ2A 3VNSA 4M60A 2Q3HA 1SZPA 3DH0A 3MZ0A 3U4MA 1ULTA 1D1QA 2EDAA 1VJGA 3TW8A 1LV7A 4CMIB 5CNKA 3CLKA 3I2YX 4OG2A 3H4JA 1NHWC 4DJDC 1GT91 4UOEA 3NUZA 3EIEA 3QVLA 5FV4A 2DFTA 4LZAA 1STOA 3NUGA 4K7JA 3OTOB 2D06A 3ETCA 4EYQA 2YMQA 2QLNA 4RVNA 4R2JA 5CEJA 3OZTA 5AM1A 4DEVA 4A0GA 3GBPA 1THMA 1E3IA 3D1JA 3QWAA 4BBZA 4J0HA 1TZKA 5ALMA 4IVRA 1Z7EA 3PX2A 1AKEA 2NZYA 3RHFA 1UMCB 1Y3CE 1X9IA 5FORA 1BOOA 1XZDA 3E1SA 4DRZA 2OFWA 1V6CA 1A04A 4AMUA 5JZMA 1Q57A 3GLGE 2H4HA 4RJIA 3AX6A 3W5UA 1HZZC 1IEQA 3GW8A 4CM7A 4REQB 1QKJA 4RORA 4E5PA 4MRPA 2X3UA 3DMDA 4WI1A 1L5HA 4RF3A 1BRTA 4PHFA 3IAUA 2P8JA 4NS4A 4CLHA 1FTGA 4OQYA 5G4KB 4ZFNA 2J32A 4EI9A 3CRW1 1AN0A 3H9BA 5HILA 2ORVA 5SZJA 4DYDA 3ZHTA 3EGXB 5DBOA 1H05A 2A5JA 1Q7GA 2EERA 3SKXA 4KSYA 2OGSA 3SKYA 1HJPA 5DLPA 2IRWA 5BORA 2R47A 1V1RB 3GZNB 4HYTA 2ZYSA 3OTGA 1RCTE 5ED4A 3WICA 4MKZA 4AN1A 3FD8A 4AT1A 4JOQA 1N75A 3IEIA 4MWOA 5CP8A 3FHJA 5ERGB 5DGCA 4N48A 1UWKA 5ILGA 2C97A 3JQAA 3RAGA 5C5DA 3GPCA 4HAOA 3N8HA 5KTNA 5IJ9B 4W7HA 5LM3A 2DWUA 1UKAA 2ZR7A 3A1VA 4AYWA 2DAMA 4TWAA 3I01M 1HURA 4B0OA 3ETJA 1GCAA 1ONPA 2G76A 2AMFA 1QH1B 2F3QA 3BK2A 4RK0A 3LWZA 4IBIA 1R12A 1DG9A 2IF2A 4IPTA 3GUUA 3V8QA 6PFKA 1NXTA 5A7GA 4UVDA 3AF0A 4EHNA 5GVRA 3GZ4A 4XOIA 1M5RA 1O9HA 3GLFA 2IHVA 2YVAA 5HKKD 2QX4A 3R7LA 4I5IA 2ZRKA 4PO3X 3CKMA 2MU1A 4I8OA 1SURA 2Q7XA 4CLOA 4I1VA 1Y1KE 1JGTA 5JCXA 3IQEA 5BT8A 4L5BA 5C4IA 5L3SA 4O5OA 2FX2A 2IYVA 2WTUA 3NDIA 3LJKA 1G20B 1LNQA 2XMBA 1C9MA 1ZO8A 3BE5A 4XQ9A 2QUKA 3C6QA 2VA9A 1TQDA 1T0BA 5KTOA 4PQYA 1ZD5A 5AVSA 4D43A 3UY4A 4D4MA 3H0CA 2FX5A 2C2YA 4O4IB 1EFPA 1YDHA 3BJIC 3K2IA 3G89A 1MG5A 2F5QA 1LH0A 1N1GA 1CQJB 3S8MA 5C5CA 3TWOA 5EUQB 1PM5A 2VR1A 3QKWA 4NH0A 3L18A 3U6PA 1E0AA 4B73A 4UMDA 5FLEX 1PUJA 3UB4A 1AA9A 2NZVG 5LQDA 4BVFA 2OLEA 5JBIA 3AHJA 1E2IA 3JWGA 3WZ2A 4RTJA 5EHNA 3WQSB 4X1YA 4A91A 4FFPA 4B6RA 3LGAA 4I5GA 1OAAA 2ERYA 3V8PA 5ALJA 4DV2M 4R9VA 3EAQA 2D3TA 3R3ZA 1K6IA 4OFZA 3I34X 3OUZA 3TAXA 2GASA 5BW5A 3A25A 3WGOA 2FPKA 2E0IA 5KWIA 5DRTA 3EK2A 2RGDA 2ZI9A 2ZSJA 1K4YA 2C4HA 4ZU1X 1UL1X 1Y89A 2H4FA 3LUFA 4FKZA 3MTQA 4GWKA 3ZHCA 4LYYA 2C4VA 4E22A 1RYBA 1QG0A 3M6AA 3EGVA 4ZVUA 3GFVA 4TS9A 1XNRB 4NYMQ 1YNOA 3HCCA 2J9RA 3L02A 4RTLA 3MAAC 1PFGA 1Z0UA 4HB3A 5C8VA 3O4GA 2ZRIA 1WDKA 2ZQZA 2WJHA 3FWYA 3O82A 5L7WA 1RIIA 4K6KA 1PG5A 1TZMA 1RM5A 2GBPA 1DU4A 4HR7A 1M1ZA 4DM7A 3LVWA 3HCEA 3KPVA 1RRVA 5EUCA 3TTTA 1KIAA 3LF2A 2AFIA 1SHTX 4CKEA 4NZMA 4I2VA 3T1TA 1Z0JA 4URFA 5TSDA 1NT4A 3QX8A 4UDNA 5EAIA 2ONJA 5DU2A 3RRYA 1O77A 1OZGA 4TKLA 8GPBA 1YZLA 4RAOA 2EKKA 3H2BA 2PL5A 3NT4A 1DKMA 3U6DA 4IV8A 4C06A 3OT1A 2CK3A 3E48A 1JEYB 3N6XA 2OHVA 4J91A 4HGYA 4E5KA 1EE2A 4CM6A 3T7JA 2NZWA 1QIHA 4PYLA 2AD5A 5FOTA 1MN6A 3NYIA 3BFJA 3QYEA 4K9SA 3DPUA 4LG1A 3VSBA 3SMPA 1CB0A 3CEPB 3BD6A 1IXYA 2PG3A 4QWWA 5HQ3B 2WUGA 1KQGA 3KUCA 4CM8B 3IOEA 5T6BA 3TN7A 2BFOA 5CM2Z 2HT6A 1K08A 3WP0A 1OU0A 1Q39A 4P86A 5PGMA 3I28A 3P0IA 3UO8B 1KEEA 2GZRA 1ZD9A 1K92A 4XVRA 4PGMA 1AKRA 3UV7A 5IDQA 4N5LA 2O3UA 1PR3A 2CMDA 1RXIA 1L5VA 1U0EA 1AX9A 5L51A 2I03A 2ZKLA 1FDVA 3TPZA 2B2NA 2HMVA 3EG5A 5A4JA 4NXMM 1ONNA 4DRXB 4Z1MA 5J9FA 1QYXA 2GHRA 3DFIA 5FHRA 3HU5A 3IJPA 4GVXA 1W88B 2H57A 2JFQA 3U7QA 3HC7A 2R6CA 2RBKA 3CBQA 3IP9A 5GWXA 4RD4A 5JC8A 1GVHA 4G63A 1QNLA 1BVUA 1TK3A 4GLBA 4ZHQB 5I6DA 2FEMA 2YIMA 1KTVA 4HN4B 3WWEA 1SD2A 3UK0A 1JBQA 1Y3DE 2HA5A 2D1FA 3A6HA 2PGIA 4JX9A 3ANMA 3MTGA 3ND7A 3OP4A 3RIEA 1VDMA 2HH9A 5K9ZA 1QZZA 2GEKA 1BWRA 1DQYA 3N6RA 5EFOA 3S0JA 3MGBA 3QEJA 4BWYA 4NHEA 4UVHA 3ZLTA 2V6FA 2A88A 2IEZA 3ONVA 5IDXA 1MJGA 5ALWA 5JPIA 1Q7EA 2OXEA 2DY1A 4YBZA 2OPHA 3WK9A 3EPJA 1M6VB 4KYIB 2QD5A 3OICA 2FDRA 4IFTA 3AL2A 2IUSA 3ZWMA 3CB2A 2O20A 3HQ4O 5GY7A 3QLVA 1PZEA 5FBKA 5FNZA 1Y8GA 1LW6E 4DNXA 4AZVA 2VYCA 3IO5A 4OO3A 1UMBA 4HQ6A 1FMCA 3DCIA 4LS3A 3GPDG 1Q2UA 3TSYA 4CW7A 3RASA 2HF7A 4FOLA 4BAUA 5KZMB 1JDUA 4AS1A 3KQHA 1EIZA 1E4EA 4LG2A 1DAEA 1GG9A 4WVFA 2CT8A 2HSGA 3VV3A 2HCBA 3AP3A 1FFHA 1F51E 2Q9AA 1ISSA 3FUUA 2AEMA 3VOBA 3KL2A 1WX1A 4NCJA 3FSGA 3L6OO 2P7HA 3OE4A 3OF2A 2JK0A 4OMFG 1R4GA 3G3EA 2E3JA 3IODA 1VBFA 5C1BA 1QF6A 3GNSA 3BWVA 2FPUA 4A6PA 4BJ6A 1YJCA 4HUJA 1PLKA 3NB0A 2SKEA 4C01A 1XQ1A 5DPMA 1CUCA 3KOWE 2XMRA 4NI5A 4XUDA 2O07A 5IULC 3EIHA 2Z6UA 4YV7A 4EI8A 3HXQA 4MQEA 3WYBA 1YBVA 1B3BA 4PSKA 3TDKA 3FFBA 4H0FA 5KVVA 3LPAA 1AZTA 1ADFA 4BPBA 4QXMA 4L16A 4IJKA 4P3XA 3L9WA 1Z6PA 2P5YA 1P9NA 3CZCA 3QP9A 1L5YA 1XUOA 5IK2A 4DFDA 1WTCA 5ES4B 3C2QA 4PR0A 3CX8A 1T36B 3ROQA 4XA8A 1Q0SA 1SU4A 2RC5A 3WAJA 4JV5B 1EGVB 4HWKA 3RFTA 2Z95A 1JHUA 4WLOA 1CVLA 3R0ZA 5CJ2A 2C1ZA 4CKXA 2ZVPX 2OV1A 4BB5A 1DIHA 4HSEA 2LHCA 1E1LA 3LS2A 4BMXA 1KORA 3SSOA 2XZOA 2FEAA 3DE7X 3AEXA 4DCJA 3HHWA 1ID1A 1GFSA 1Z34A 1FZTA 1JIQA 4MUMA 1MA0A 2RK3A 3ZGXA