2KW0A

Solution structure of n-terminal domain of ccmh from escherichia.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIATDLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcmH protein
publication title Biochemical properties and catalytic domain structure of the CcmH protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kw0A00
2HL7A 2KW0A
chains in the Genus database with same CATH superfamily
2XFSA 4UN2B 4QHTA 4TUWA 1IXZA 5FSWA 1K82A 1N77A 1V92A 2MROB 2HCBA 3W0LB 2QCUA 3GPYA 1NVMA 3KOZE 1VQ1A 2QBYB 4L78A 4B3RM 3ZH9B 1IXSA 1UM8A 4GC5A 1IBMM 1D2NA 2EKKA 2DAGA 4FCVA 1DO0A 3GLHB 2KNVA 3GLHE 3T6PA 1YSYA 4GITA 1DO2A 3U60B 3J2PB 4OU7A 3Q8GA 2CE7A 3L26A 2R65A 3SYLA 3AOEA 4NXMM 1DV0A 2Y0QA 1JR3A 1D0MA 2L7HA 2R0IA 4WP2A 3C58A 4B7FA 3FD9A 4D80A 4MGYE 3D8BA 4LJ9A 1JB0F 3JR4A 4DV0M 2ZTCA 3KOWE 1TGUA 2C9OA 3RFWA 4B3TM 4JI2M 2Q2EB 4JI0M 1OIPA 5IT9S 2F5PA 5DFLA 3GPXA 3J80S 2UUBM 3AOGA 4NSOB 3GLFB 3GLFE 4GKKM 2UU9M 2DAIA 1YLAA 3K8ZA 3GPUA 4IBKA 3FUTA 3C9PA 1GKIA 4M9SA 3KP1E 1XNQM 1GO5A 3J81S 2FFJA 3HU3A 2CFOA 2YFQA 2C96A 2HL7A 4I4LA 4I8OA 1HR0M 4DV2M 3J7AS 4F2LA 3FTFA 1IN8A 4RNAA 4AKHA 1QYRA 4JI4M 4KODA 2XZFA 1ZMWA 4PT5A 1IY0A 4GC9A 4IBDA 4OVZB 3AOEC 3CF0A 2Z4SA 1QVRA 1ZAEA 3DOAA 4XK8F 5ITUA 3A46A 5FTKA 1IFYA 1VEGA 3ZQJA 1NNJA 2H1RA 4B7GA 4DR1M 3KS4A 2O5RA 4WW0A 1R2YA 4HEOA 2LHGA 3K9OA 3TPZA 3C3DA 4LZZA 1IN5A 3PFIA 1Q02A 3HX3A 3V76A 1ZQ9A 3FTCA 3LCVB 1H6UA 4AKGA 3L2AA 4JI5M 2JA2A 2XF3A 2A5YB 4GRIA 3U5ZA 1L1TA 4IJEA 4RF1A 2CV1A 2JUJA 3U6CA 2D7HA 2HWJA 1EIJA 4S12A 2BWBA 2DAEA 5KPZA 1KSFX 3FE3A 3LMMA 4LF7M 5FLXS 1LTMA 3GLGA 2UUAM 2LVQD 1HNWM 2F4VM 3CF6E 3UMMA 4DR4M 4GEWA 3T15A 5KO3A 3TWMA 3VK7A 3RGPA 2ZM6M 2L7IA 4KT0F 2F5NA 4DR2M 2L09A 3IG8A 2D7GA 3WHLA 2JWSA 3VFDA 4YY3M 1SXJC 3W0FA 4DV4M 1WIVA 2DHRA 3SARA 4B3MM 5LMNM 3SATA 4OX9M 4LF4M 2X49A 3MJ5A 1XWIA 2F5SA 3LVWA 2DZNB 4FW9A 2QBYA 4DUZM 1T6OA 4G4OA 2R4EA 3QYBA 1OAOC 2GNOA 4KHPM 2KEBA 4LF8M 2G5GX 3U60A 2RGHA 2EO2A 3K1JA 3B9PA 4IBJA 1IY2A 2CV0A 1ZV1A 5IZ7D 4LF9M 2RKOA 3UJNA 5EP4A 3GRUA 1XC8A 2XFTA 3EIEA 1ZMUA 3T1YM 2Y21A 2BJWA 3SFZA 3KOYE 2FOIC 7CATA 1PJTA 3LQRA 3U6OA 1RU3A 4I5SA 4MM3B 1G59A 2YQZA 2P5TA 2JXNA 3HGIA 4DBGB 4DR5M 2DAMA 4M9ZA 4LFBM 2O01F 2L4EA 4FWDA 2DI0A 1L2BA 1SXJB 1SXJE 4AG6A 4P17A 3JR5A 1Q3BA 1NNUC 3NBIA 2VF8A 5JI2E 1VEKA 1TDHA 1NY5A 4NSRA 4L6V6 2QHOB 4NC6A 1N36M 4LCBA 4LRSA 3QWLA 4X66M 4II7A 1QAMA 4MGKE 2JY6B 2LXEA 3I04M 4AG5A 2DAKA 1S3SA 1WXQA 1QANA 1DGFA 5FTMA 1XB2B 2LH0A 1GL6A 2VF7A 3I4VA 3KOXE 3GQ5A 1Y8GA 2KXEA 2QPAA 1N75A 4RKUF 4WURA 1MJGM 4DV3M 2K9DA 3HHWA 4K0KM 4OVZA 4NRVA 1MU5A 3GLIB 3GLIE 1R2ZA 3A98B 1IN4A 2UXDM 3TE6A 1OTRA 4A3VB 5EQTA 3FYDA 2EUCA 1QUSA 3NWLA 2ZAMA 4ITQA 1J7KA 2ZBKB 3FUWA 4KLNA 3DZDA 1K3WA 3ILKA 3K2LA 4L16A 1NHGC 1XXHB 1Z5BA 4B3SM 1XXHE 2Z7JA 2C5RA 4DV1M 4CJ6A 3AKZA 2JY5A 5ITQA 2LNHC 2XH9A 3HHYA 2EA0A 3LCUA 3D8LA 4GIPA 4GKJM 1JQJC 2KDLA 4FWHA 1V34A 3B7QA 1E9SA 4CGYB 2WSCF 3GP1A 4DR7M 2I7NA 1IXRC 1HQYE 3HJQA 4JN6A 4X62M 3R9XB 1GVNA 3DA1A 1YUBA 4IIWA 4LGYA 3VK8A 3T1HM 2OOBA 4DUYM 5ITXA 4YHHM 3U6QA 2O25A 3I01M 1HJPA 2BNKA 4I81A 3DFZA 3E4RA 2DVWB 5A2QS 1IY1A 1TTEA 2XZUA 1OFIA 2V1UA 4B7HA 3RGSA 4LJ5A 1DGHB 2CP8A 2OQ4A 2R62A 2N35A 1G8PA 1WGNA 4JV5M 2LWXA 3J27B 3GO8A 4NXNM 1E94E 4JYAM 1HT2E 4AI6A 2C99A 4GMQA 5ITTA 1N33M 2J5YA 2Y0TA 3KFUG 2GQFA 1HT1E 4R3DA 1G4AE 1R6BX 1NSFA 2XSZD 2V6ZM 4IBBA 1OAIA 2CUZA 2XGNA 1IN7A 1VEJA 2BWEA 4XBOA 1SXJD 1N78A 2K47A 4L8RC 1NV8A 1FNNA 2CHVA 2WZJA 1C7YA 3GRVA 4GH9A 4LFAM 1NV9A 4CHTB 3ZC7B 3F92A 2F5OA 1VDLA 2I7PA 3W68A 4PDIA 2LTUA 5IREB 3KXEC 2XEPA 3LQQA 3J7BA 1AUAA 2DENA 2KRUA 1IM2A 5EP1A 2WSEF 1GJSA 2X4AA 5DYGA 1DGBA 4R71A 1R4GA 1JR3E 3M7GA 2CHGA 4QHSA 3U6MA 2XLJA 4P16A 1VDDA 4QOSA 2LVAA 1P3QQ 1T43A 2KNAA 3GLHA 3BXWA 5LMUM 3HJSA 3VLFB 3HHZA 3SMSA 1FJGM 2VQEM 3H4MA 3SC3A 3LVVA 1W5SA 3HWSA 3CGWA 3PXGA 3B7ZA 2YNMD 3TWLA 1TH3A 5L8RF 3KS8A 1G41A 1Q3CA 1WR1B 3U6LA 4QNRA 2ZTDA 1MX0A 2DNAA 2R18A 3E46A 3IG5A 1R5LA 2ERCA 3LW5F 3MHVC 4LJ4A 2VIIA 5EXTA 4DV5M 3HKPA 3U61B 4FCWA 4DV7M 3VDPA 3JAMS 4F1IA 3E21A 3GLFA 2JY7A 1PJIA 1YE9A 1QQWA 5E6JA 3I51A 1W5TA 3FRIA 4FVMA 3RE8A 4LRTA 4L15A 2UXCM 1J5EM 5FTLA 2L4FA 2RRUA 3UZUA 2KNZA 2MGWA 4Z8XA 5ITYA 4AW4A 1N34M 1J09A 3I4YA 1PJJA 4LJ8A 3KSJA 3B89A 4MGZE 4ZPXA 3T38A 5KQDA 3U5ZB 1IBKM 5EJCA 2HKJA 4IBEA 4DR6M 4G4RA 2KRKA 1QAOA 3KP0E 4FCTA 3QAUA 3U6PA 4HLQA 4PD2A 1CUKA 5EXXA 3L25A 1DGHA 1HQCA 1TH2A 1DGGA 4GHAA 4IBGA 1PJSA 1PJQA 5EXSA 4BLCA 2V1CA 2DWLA 2L2DA 3GLGE 4LJ7A 4MB7A 1D0LA 2J7NA 4L4UA 5KPTA 2E5LM 3SASA 3A42A 3M6AA 1QAQA 1G3IA 2Y20A 2DZLA 4HL4A 1EE8A 4Y28F 2JY8A 4LJ6A 1VG5A 3W67A 2LBCA 1HNXM 3GQ4A 2CHQA 4IBFA 4W5WA 2B3TA 2QENA 1Q39A 4Z6YA 2DWMA 2ZAOA 3GRYA 4GHLA 1I4WA 3U6SA 4MGHA 3THGA 1UFZA 2Z4RA 5BR8M 3FKEA 5ITRA 4D81A 1OJLA 4CIZA 1LV7A 1KFVA 2UUCM 3VKHA 2MR9A 2D7EA 4DV6M 1G71A 5IWAM 1L2CA 4FD2A 2QQ8A 2VQFM 4IBCA 2MJ5B 1JR3D 2CRUA 1IN6A 2LHCA 2F5QA 4JI1M 1IQPA 2APLA 2HHHM 3HU1A 4AZFA 2W82A 2JP7A 4MH0E 5EXPA 4R7GA 2FS1A 2OPFA 1TDZA 3HY5A 3K9PA 1Z6TA 2M60A 1PGYA 2L6OA 4QOZC 3H4JA 1NJGA 4G3OA 1ORYB 4PCZA 2M5ZA 2Z3XA 4BB9A 2JZ0A 4ANRA 1K3XA 5BPVA 1X37A 4M0DA 2ZANA 2FNAA 4RF0A 1IBLM 3R8FA 3VDUA 2NQ8C 3HU2A 3L27A 2CWBA 2OO9A 3M0EA 4LJAA 1WGLA 2KZSA 2DKLA 4JI3M 5C18A 3FUUA 1TH4A 2KHHA 5JI3E 3IECA 3HZJA 1GABA 3E9SA 2JNHA 1QZEA 3SHFA 1NO1A 4IJFA 1PM5A 2FE8A 2G3QA 2Z8YM 2XSZA 1IXSB 4G4QA 3U61A 1SG9A 1SXJA 4EIWA 3SHGB 2J7OA 4LFCM 1L2DA 1F4IA 4G6ZA 4NL4H 5EP3A 3ZCBB 1E32A 5F3WA 3EIHA 1WJ7A 3PNVA 2R45A 1NY6A 3PNYA 5FTJA 2G8LA 2DWZB 5H37D 2DXIA 3FTEA 3GPPA 3TL4X 2R46A 4FWGA 3FRHA 3AV0A 5C1BA 2C98A 2LVNC 3KVWA 1KYIA 1QDRA 2CEAA 4XGIA 2RGOA 1BVSA 4AQYM 1GJTA 3PVSA 1OQYA 3MMPA 2VDBB 3SAUA 3OTOM 3QYEA 1N32M 2AHMA 1Z59A 3BBZA 3NBXX 3U6DA 3CF2A 2KW0A 3IHPA 4NOOB 5KPRA 3GLIA 1C1KA 1E9RA 2CV2A 1GL7A 4CISA 4PDGA 4LF6M 4OW0A 2UXBM 3SAVA 2JZ1A 2QP9X 3FTDA 1OIZA 2DHYA 3U6EA 2EJSA 1A5TA 1XMOM 1NJFA 5FTNA 4JI8M 4JI7M 1L8QA 3AL0C 3WHKA 1GLNA 3KSXA 1HNZM 4MGIE 3UGJA 3FYCA 4LF5M 4REZA 1QZMA 4BBAA 3UK6A 3VKGA 3BOSA 1AIPC 4IBIA 1T3TA 1OFHA 5GKNA 3SMPA 5KQ8A 4NRWA 1Z5CA 4LGMA 2H5XA 2K0BX 3K92A 1XXHA 5ITXE 1L1ZA 1PRBA 2OOAA 3KDSE 5E26A 3B74A 1TR8A 4LY6A 2LVOC 1R7RA 1QUTA 3FUVA 4DR3M 2EKFA 2BJVA 2QZ4A 2WSFF 3MK6A 3L29A 2DWNA 3Q8XA 3A45A 1V33A 1EFUB 4LZJA 4Q7JA 1NHWC 2QNJA 4LG2A 1ZMVA 2R44A 2X8AA 4D82A 3AFHA 3B7NA 3AJIB 3KW6A 3TWKA 2R6FA 3SYKA 4B08A 3SBJA 2DZOB 4AKIA 1QDTA 1I94M 2C9CA 2HAKA 4KO8A 3GRRA 4QNMA 1XNRM 1WHCA 3L28A 3SAWA 1TF0B 4JI6M 5DYIA 2FH0A 2LVPC 4JXJA 2KZUA 4M9XA 4X65M 1Z5AA 2MH8A 2R4JA 3GQ3A 2K6BA 1D0KA 4X64M 2KA6B 3CTWB 3HJ8A 3TQSA 8CATA 4G4NA 3GLGB 1OKSA 5EP2A 1XMQM 3C3EA 3HHXA 1XHBA 2QSFX 3FUXA 4M0WA 2YR0A 5DNYA 1MN3A
chains in the Genus database with same CATH topology
2XFSA 4QHTA 4TUWA 1IXZA 5FSWA 1K82A 1N77A 2HCBA 3W0LB 2QCUA 3GPYA 1NVMA 3KOZE 2QBYB 4L78A 4B3RM 3ZH9B 1UM8A 4GC5A 1IBMM 1D2NA 4FCVA 1DO0A 3GLHB 1YSYA 4GITA 1DO2A 3U60B 3J2PB 4OU7A 2CE7A 3L26A 2R65A 3SYLA 3AOEA 4NXMM 2Y0QA 1JR3A 2L7HA 3C58A 4B7FA 3FD9A 4D80A 4MGYE 3D8BA 4LJ9A 3JR4A 4DV0M 3KOWE 1TGUA 2C9OA 3RFWA 4B3TM 4JI2M 2Q2EB 4JI0M 5IT9S 2F5PA 3GPXA 3J80S 2UUBM 3AOGA 4NSOB 3GLFB 4GKKM 2UU9M 3K8ZA 3GPUA 4IBKA 3FUTA 1GKIA 4M9SA 3KP1E 1XNQM 3J81S 2FFJA 3HU3A 2CFOA 2YFQA 2C96A 2HL7A 4I4LA 4I8OA 1HR0M 4DV2M 3J7AS 3FTFA 1IN8A 4RNAA 4AKHA 1QYRA 4JI4M 4KODA 2XZFA 4PT5A 1IY0A 4GC9A 4IBDA 4OVZB 3AOEC 3CF0A 2Z4SA 1QVRA 1ZAEA 3DOAA 5ITUA 3A46A 5FTKA 1NNJA 2H1RA 4B7GA 4DR1M 3KS4A 2O5RA 4WW0A 1R2YA 3TPZA 4LZZA 1IN5A 3PFIA 1ZQ9A 3FTCA 1H6UA 4AKGA 3L2AA 4JI5M 2JA2A 2XF3A 2A5YB 4GRIA 3U5ZA 1L1TA 4IJEA 4RF1A 2CV1A 3U6CA 2D7HA 4S12A 5KPZA 1KSFX 3LMMA 4LF7M 5FLXS 3GLGA 2UUAM 1HNWM 2F4VM 3CF6E 3UMMA 4DR4M 3T15A 5KO3A 3TWMA 3VK7A 3RGPA 2ZM6M 2L7IA 2F5NA 4DR2M 2L09A 3IG8A 2D7GA 3WHLA 3VFDA 4YY3M 1SXJC 3W0FA 4DV4M 4B3MM 2DHRA 3SARA 4OX9M 5LMNM 3SATA 4LF4M 2X49A 3MJ5A 1XWIA 2F5SA 3LVWA 2DZNB 4FW9A 2QBYA 4DUZM 4G4OA 2R4EA 4KHPM 2KEBA 4LF8M 2G5GX 3U60A 2RGHA 2EO2A 3K1JA 3B9PA 4IBJA 1IY2A 2CV0A 5IZ7D 4LF9M 2RKOA 3UJNA 5EP4A 3GRUA 1XC8A 2XFTA 3EIEA 3T1YM 2Y21A 2BJWA 3SFZA 3KOYE 2FOIC 7CATA 3LQRA 3U6OA 4I5SA 4MM3B 1G59A 2YQZA 2P5TA 4DR5M 3HGIA 4M9ZA 4LFBM 4FWDA 1L2BA 1SXJB 1SXJE 4AG6A 3JR5A 1Q3BA 1NNUC 3NBIA 5JI2E 1TDHA 1NY5A 4NSRA 1N36M 4LCBA 4LRSA 3QWLA 4X66M 4II7A 1QAMA 4MGKE 2LXEA 4AG5A 1S3SA 1WXQA 1QANA 1DGFA 5FTMA 2LH0A 1GL6A 3I4VA 3KOXE 3GQ5A 2KXEA 2QPAA 1N75A 4WURA 4DV3M 4K0KM 3HHWA 4OVZA 4NRVA 1MU5A 3GLIB 1R2ZA 3A98B 1IN4A 2UXDM 3TE6A 4A3VB 5EQTA 3FYDA 2EUCA 3NWLA 2ZAMA 4ITQA 1J7KA 2ZBKB 3FUWA 4KLNA 3DZDA 1K3WA 3ILKA 3K2LA 4L16A 1NHGC 1XXHB 1Z5BA 4B3SM 2Z7JA 2C5RA 4DV1M 3AKZA 2LNHC 2XH9A 3HHYA 2EA0A 3D8LA 4GIPA 4GKJM 1JQJC 4FWHA 1E9SA 4CGYB 3GP1A 4DR7M 2I7NA 1IXRC 1HQYE 3HJQA 4JN6A 4X62M 3R9XB 1GVNA 3DA1A 1YUBA 4IIWA 4LGYA 3VK8A 3T1HM 4DUYM 5ITXA 4YHHM 3U6QA 2BNKA 4I81A 3DFZA 3E4RA 2DVWB 5A2QS 1IY1A 2XZUA 1OFIA 2V1UA 4B7HA 3RGSA 4LJ5A 1DGHB 2OQ4A 2R62A 1G8PA 4JV5M 2LWXA 3J27B 3GO8A 4NXNM 1E94E 4JYAM 1HT2E 4AI6A 2C99A 4GMQA 5ITTA 1N33M 2Y0TA 3KFUG 4R3DA 1HT1E 1G4AE 1R6BX 1NSFA 2XSZD 2V6ZM 4IBBA 2CUZA 2XGNA 1IN7A 4XBOA 1SXJD 1N78A 2K47A 4L8RC 1FNNA 2CHVA 3GRVA 4GH9A 4LFAM 4CHTB 3ZC7B 2F5OA 2I7PA 4PDIA 5IREB 3KXEC 2XEPA 3LQQA 3J7BA 2KRUA 1IM2A 5EP1A 2X4AA 5DYGA 1DGBA 3M7GA 2CHGA 4QHSA 3U6MA 2XLJA 4P16A 1VDDA 4QOSA 3GLHA 5LMUM 3HJSA 3VLFB 3HHZA 3SMSA 1FJGM 2VQEM 3H4MA 3SC3A 3LVVA 1W5SA 3HWSA 3PXGA 3TWLA 2YNMD 1TH3A 3KS8A 1G41A 1Q3CA 3U6LA 4QNRA 1MX0A 2R18A 3IG5A 5EXTA 2ERCA 3MHVC 4LJ4A 4DV5M 2VIIA 3HKPA 3U61B 4FCWA 4DV7M 3VDPA 3JAMS 3GLFA 1PJIA 1YE9A 1QQWA 5E6JA 3I51A 1W5TA 4FVMA 3RE8A 4LRTA 4L15A 2UXCM 1J5EM 5FTLA 3UZUA 4Z8XA 5ITYA 4AW4A 1N34M 1J09A 3I4YA 1PJJA 4LJ8A 3KSJA 4MGZE 4ZPXA 3T38A 5KQDA 3U5ZB 1IBKM 5EJCA 2HKJA 4IBEA 4DR6M 4G4RA 2KRKA 1QAOA 3KP0E 4FCTA 3QAUA 3U6PA 4HLQA 4PD2A 5EXXA 3L25A 1DGHA 1HQCA 1TH2A 1DGGA 4GHAA 4IBGA 5EXSA 4BLCA 2DWLA 2V1CA 4LJ7A 4MB7A 2J7NA 4L4UA 5KPTA 2E5LM 3SASA 3A42A 3M6AA 1QAQA 1G3IA 2Y20A 4HL4A 1EE8A 4LJ6A 1HNXM 3GQ4A 2CHQA 4IBFA 4W5WA 2QENA 1Q39A 4Z6YA 2DWMA 2ZAOA 3GRYA 4GHLA 1I4WA 3U6SA 4MGHA 3THGA 2Z4RA 5BR8M 1KFVA 3FKEA 5ITRA 4D81A 1OJLA 1LV7A 3VKHA 2UUCM 2D7EA 4DV6M 5IWAM 1L2CA 4FD2A 2VQFM 4IBCA 1JR3D 1IN6A 2F5QA 4JI1M 1IQPA 2HHHM 3HU1A 4AZFA 2W82A 4MH0E 5EXPA 2OPFA 4R7GA 1TDZA 1Z6TA 2M60A 2L6OA 4QOZC 1NJGA 1ORYB 4PCZA 2M5ZA 2Z3XA 4BB9A 1K3XA 5BPVA 1X37A 4M0DA 2ZANA 2FNAA 4RF0A 1IBLM 3R8FA 3VDUA 2NQ8C 3HU2A 3L27A 3M0EA 4LJAA 4JI3M 2KZSA 5C18A 3FUUA 1TH4A 5JI3E 3E9SA 3SHFA 4IJFA 1PM5A 2FE8A 2XSZA 1IXSB 4G4QA 3U61A 1SXJA 4EIWA 3SHGB 2J7OA 4LFCM 1L2DA 4G6ZA 4NL4H 5EP3A 3ZCBB 1E32A 5F3WA 3EIHA 3PNVA 2R45A 1NY6A 3PNYA 5FTJA 2G8LA 2DWZB 5H37D 2DXIA 3FTEA 3GPPA 3TL4X 2R46A 4FWGA 3AV0A 5C1BA 2C98A 3KVWA 1KYIA 2CEAA 4XGIA 2RGOA 4AQYM 3PVSA 3SAUA 3OTOM 1N32M 2AHMA 1Z59A 3U6DA 3CF2A 2KW0A 4NOOB 3GLIA 5KPRA 1C1KA 1E9RA 2CV2A 1GL7A 4CISA 4PDGA 4LF6M 4OW0A 2UXBM 3SAVA 2QP9X 3FTDA 3U6EA 1XMOM 1NJFA 5FTNA 4JI8M 4JI7M 1L8QA 3AL0C 3WHKA 1GLNA 3KSXA 1HNZM 4MGIE 3UGJA 3FYCA 4LF5M 4REZA 1QZMA 4BBAA 3UK6A 3VKGA 3BOSA 4IBIA 5GKNA 1T3TA 1OFHA 5KQ8A 3SMPA 4NRWA 1Z5CA 4LGMA 3K92A 1XXHA 5ITXE 1L1ZA 3KDSE 5E26A 4LY6A 1R7RA 3FUVA 4DR3M 2QZ4A 2BJVA 3MK6A 2DWNA 3L29A 3Q8XA 3A45A 4LZJA 1NHWC 4LG2A 2X8AA 4D82A 3AFHA 3AJIB 3KW6A 3TWKA 4B08A 3SYKA 4AKIA 3SBJA 2DZOB 1I94M 2C9CA 4KO8A 3GRRA 4QNMA 1XNRM 3SAWA 3L28A 4JI6M 5DYIA 4JXJA 2KZUA 4M9XA 4X65M 1Z5AA 2R4JA 3GQ3A 4X64M 2KA6B 3CTWB 3HJ8A 3TQSA 8CATA 4G4NA 3GLGB 5EP2A 1XMQM 3HHXA 1XHBA 3FUXA 4M0WA 2YR0A 5DNYA 5ITQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL7 A;  2KW0 A; 
#chains in the Genus database with same CATH topology
 2XFS A;  4UN2 B;  4QHT A;  4TUW A;  1IXZ A;  5FSW A;  1K82 A;  1N77 A;  1V92 A;  2MRO B;  2HCB A;  3W0L B;  2QCU A;  3GPY A;  1NVM A;  3KOZ E;  1VQ1 A;  2QBY B;  4L78 A;  4B3R M;  3ZH9 B;  1IXS A;  1UM8 A;  4GC5 A;  1IBM M;  1D2N A;  2EKK A;  2DAG A;  4FCV A;  1DO0 A;  3GLH B;  2KNV A;  3GLH E;  3T6P A;  1YSY A;  4GIT A;  1DO2 A;  3U60 B;  3J2P B;  4OU7 A;  3Q8G A;  2CE7 A;  3L26 A;  2R65 A;  3SYL A;  3AOE A;  4NXM M;  1DV0 A;  2Y0Q A;  1JR3 A;  1D0M A;  2L7H A;  2R0I A;  4WP2 A;  3C58 A;  4B7F A;  3FD9 A;  4D80 A;  4MGY E;  3D8B A;  4LJ9 A;  1JB0 F;  3JR4 A;  4DV0 M;  2ZTC A;  3KOW E;  1TGU A;  2C9O A;  3RFW A;  4B3T M;  4JI2 M;  2Q2E B;  4JI0 M;  1OIP A;  5IT9 S;  2F5P A;  5DFL A;  3GPX A;  3J80 S;  2UUB M;  3AOG A;  4NSO B;  3GLF B;  3GLF E;  4GKK M;  2UU9 M;  2DAI A;  1YLA A;  3K8Z A;  3GPU A;  4IBK A;  3FUT A;  3C9P A;  1GKI A;  4M9S A;  3KP1 E;  1XNQ M;  1GO5 A;  3J81 S;  2FFJ A;  3HU3 A;  2CFO A;  2YFQ A;  2C96 A;  2HL7 A;  4I4L A;  4I8O A;  1HR0 M;  4DV2 M;  3J7A S;  4F2L A;  3FTF A;  1IN8 A;  4RNA A;  4AKH A;  1QYR A;  4JI4 M;  4KOD A;  2XZF A;  1ZMW A;  4PT5 A;  1IY0 A;  4GC9 A;  4IBD A;  4OVZ B;  3AOE C;  3CF0 A;  2Z4S A;  1QVR A;  1ZAE A;  3DOA A;  4XK8 F;  5ITU A;  3A46 A;  5FTK A;  1IFY A;  1VEG A;  3ZQJ A;  1NNJ A;  2H1R A;  4B7G A;  4DR1 M;  3KS4 A;  2O5R A;  4WW0 A;  1R2Y A;  4HEO A;  2LHG A;  3K9O A;  3TPZ A;  3C3D A;  4LZZ A;  1IN5 A;  3PFI A;  1Q02 A;  3HX3 A;  3V76 A;  1ZQ9 A;  3FTC A;  3LCV B;  1H6U A;  4AKG A;  3L2A A;  4JI5 M;  2JA2 A;  2XF3 A;  2A5Y B;  4GRI A;  3U5Z A;  1L1T A;  4IJE A;  4RF1 A;  2CV1 A;  2JUJ A;  3U6C A;  2D7H A;  2HWJ A;  1EIJ A;  4S12 A;  2BWB A;  2DAE A;  5KPZ A;  1KSF X;  3FE3 A;  3LMM A;  4LF7 M;  5FLX S;  1LTM A;  3GLG A;  2UUA M;  2LVQ D;  1HNW M;  2F4V M;  3CF6 E;  3UMM A;  4DR4 M;  4GEW A;  3T15 A;  5KO3 A;  3TWM A;  3VK7 A;  3RGP A;  2ZM6 M;  2L7I A;  4KT0 F;  2F5N A;  4DR2 M;  2L09 A;  3IG8 A;  2D7G A;  3WHL A;  2JWS A;  3VFD A;  4YY3 M;  1SXJ C;  3W0F A;  4DV4 M;  1WIV A;  2DHR A;  3SAR A;  4B3M M;  5LMN M;  3SAT A;  4OX9 M;  4LF4 M;  2X49 A;  3MJ5 A;  1XWI A;  2F5S A;  3LVW A;  2DZN B;  4FW9 A;  2QBY A;  4DUZ M;  1T6O A;  4G4O A;  2R4E A;  3QYB A;  1OAO C;  2GNO A;  4KHP M;  2KEB A;  4LF8 M;  2G5G X;  3U60 A;  2RGH A;  2EO2 A;  3K1J A;  3B9P A;  4IBJ A;  1IY2 A;  2CV0 A;  1ZV1 A;  5IZ7 D;  4LF9 M;  2RKO A;  3UJN A;  5EP4 A;  3GRU A;  1XC8 A;  2XFT A;  3EIE A;  1ZMU A;  3T1Y M;  2Y21 A;  2BJW A;  3SFZ A;  3KOY E;  2FOI C;  7CAT A;  1PJT A;  3LQR A;  3U6O A;  1RU3 A;  4I5S A;  4MM3 B;  1G59 A;  2YQZ A;  2P5T A;  2JXN A;  3HGI A;  4DBG B;  4DR5 M;  2DAM A;  4M9Z A;  4LFB M;  2O01 F;  2L4E A;  4FWD A;  2DI0 A;  1L2B A;  1SXJ B;  1SXJ E;  4AG6 A;  4P17 A;  3JR5 A;  1Q3B A;  1NNU C;  3NBI A;  2VF8 A;  5JI2 E;  1VEK A;  1TDH A;  1NY5 A;  4NSR A;  4L6V 6;  2QHO B;  4NC6 A;  1N36 M;  4LCB A;  4LRS A;  3QWL A;  4X66 M;  4II7 A;  1QAM A;  4MGK E;  2JY6 B;  2LXE A;  3I04 M;  4AG5 A;  2DAK A;  1S3S A;  1WXQ A;  1QAN A;  1DGF A;  5FTM A;  1XB2 B;  2LH0 A;  1GL6 A;  2VF7 A;  3I4V A;  3KOX E;  3GQ5 A;  1Y8G A;  2KXE A;  2QPA A;  1N75 A;  4RKU F;  4WUR A;  1MJG M;  4DV3 M;  2K9D A;  3HHW A;  4K0K M;  4OVZ A;  4NRV A;  1MU5 A;  3GLI B;  3GLI E;  1R2Z A;  3A98 B;  1IN4 A;  2UXD M;  3TE6 A;  1OTR A;  4A3V B;  5EQT A;  3FYD A;  2EUC A;  1QUS A;  3NWL A;  2ZAM A;  4ITQ A;  1J7K A;  2ZBK B;  3FUW A;  4KLN A;  3DZD A;  1K3W A;  3ILK A;  3K2L A;  4L16 A;  1NHG C;  1XXH B;  1Z5B A;  4B3S M;  1XXH E;  2Z7J A;  2C5R A;  4DV1 M;  4CJ6 A;  3AKZ A;  2JY5 A;  5ITQ A;  2LNH C;  2XH9 A;  3HHY A;  2EA0 A;  3LCU A;  3D8L A;  4GIP A;  4GKJ M;  1JQJ C;  2KDL A;  4FWH A;  1V34 A;  3B7Q A;  1E9S A;  4CGY B;  2WSC F;  3GP1 A;  4DR7 M;  2I7N A;  1IXR C;  1HQY E;  3HJQ A;  4JN6 A;  4X62 M;  3R9X B;  1GVN A;  3DA1 A;  1YUB A;  4IIW A;  4LGY A;  3VK8 A;  3T1H M;  2OOB A;  4DUY M;  5ITX A;  4YHH M;  3U6Q A;  2O25 A;  3I01 M;  1HJP A;  2BNK A;  4I81 A;  3DFZ A;  3E4R A;  2DVW B;  5A2Q S;  1IY1 A;  1TTE A;  2XZU A;  1OFI A;  2V1U A;  4B7H A;  3RGS A;  4LJ5 A;  1DGH B;  2CP8 A;  2OQ4 A;  2R62 A;  2N35 A;  1G8P A;  1WGN A;  4JV5 M;  2LWX A;  3J27 B;  3GO8 A;  4NXN M;  1E94 E;  4JYA M;  1HT2 E;  4AI6 A;  2C99 A;  4GMQ A;  5ITT A;  1N33 M;  2J5Y A;  2Y0T A;  3KFU G;  2GQF A;  1HT1 E;  4R3D A;  1G4A E;  1R6B X;  1NSF A;  2XSZ D;  2V6Z M;  4IBB A;  1OAI A;  2CUZ A;  2XGN A;  1IN7 A;  1VEJ A;  2BWE A;  4XBO A;  1SXJ D;  1N78 A;  2K47 A;  4L8R C;  1NV8 A;  1FNN A;  2CHV A;  2WZJ A;  1C7Y A;  3GRV A;  4GH9 A;  4LFA M;  1NV9 A;  4CHT B;  3ZC7 B;  3F92 A;  2F5O A;  1VDL A;  2I7P A;  3W68 A;  4PDI A;  2LTU A;  5IRE B;  3KXE C;  2XEP A;  3LQQ A;  3J7B A;  1AUA A;  2DEN A;  2KRU A;  1IM2 A;  5EP1 A;  2WSE F;  1GJS A;  2X4A A;  5DYG A;  1DGB A;  4R71 A;  1R4G A;  1JR3 E;  3M7G A;  2CHG A;  4QHS A;  3U6M A;  2XLJ A;  4P16 A;  1VDD A;  4QOS A;  2LVA A;  1P3Q Q;  1T43 A;  2KNA A;  3GLH A;  3BXW A;  5LMU M;  3HJS A;  3VLF B;  3HHZ A;  3SMS A;  1FJG M;  2VQE M;  3H4M A;  3SC3 A;  3LVV A;  1W5S A;  3HWS A;  3CGW A;  3PXG A;  3B7Z A;  2YNM D;  3TWL A;  1TH3 A;  5L8R F;  3KS8 A;  1G41 A;  1Q3C A;  1WR1 B;  3U6L A;  4QNR A;  2ZTD A;  1MX0 A;  2DNA A;  2R18 A;  3E46 A;  3IG5 A;  1R5L A;  2ERC A;  3LW5 F;  3MHV C;  4LJ4 A;  2VII A;  5EXT A;  4DV5 M;  3HKP A;  3U61 B;  4FCW A;  4DV7 M;  3VDP A;  3JAM S;  4F1I A;  3E21 A;  3GLF A;  2JY7 A;  1PJI A;  1YE9 A;  1QQW A;  5E6J A;  3I51 A;  1W5T A;  3FRI A;  4FVM A;  3RE8 A;  4LRT A;  4L15 A;  2UXC M;  1J5E M;  5FTL A;  2L4F A;  2RRU A;  3UZU A;  2KNZ A;  2MGW A;  4Z8X A;  5ITY A;  4AW4 A;  1N34 M;  1J09 A;  3I4Y A;  1PJJ A;  4LJ8 A;  3KSJ A;  3B89 A;  4MGZ E;  4ZPX A;  3T38 A;  5KQD A;  3U5Z B;  1IBK M;  5EJC A;  2HKJ A;  4IBE A;  4DR6 M;  4G4R A;  2KRK A;  1QAO A;  3KP0 E;  4FCT A;  3QAU A;  3U6P A;  4HLQ A;  4PD2 A;  1CUK A;  5EXX A;  3L25 A;  1DGH A;  1HQC A;  1TH2 A;  1DGG A;  4GHA A;  4IBG A;  1PJS A;  1PJQ A;  5EXS A;  4BLC A;  2V1C A;  2DWL A;  2L2D A;  3GLG E;  4LJ7 A;  4MB7 A;  1D0L A;  2J7N A;  4L4U A;  5KPT A;  2E5L M;  3SAS A;  3A42 A;  3M6A A;  1QAQ A;  1G3I A;  2Y20 A;  2DZL A;  4HL4 A;  1EE8 A;  4Y28 F;  2JY8 A;  4LJ6 A;  1VG5 A;  3W67 A;  2LBC A;  1HNX M;  3GQ4 A;  2CHQ A;  4IBF A;  4W5W A;  2B3T A;  2QEN A;  1Q39 A;  4Z6Y A;  2DWM A;  2ZAO A;  3GRY A;  4GHL A;  1I4W A;  3U6S A;  4MGH A;  3THG A;  1UFZ A;  2Z4R A;  5BR8 M;  3FKE A;  5ITR A;  4D81 A;  1OJL A;  4CIZ A;  1LV7 A;  1KFV A;  2UUC M;  3VKH A;  2MR9 A;  2D7E A;  4DV6 M;  1G71 A;  5IWA M;  1L2C A;  4FD2 A;  2QQ8 A;  2VQF M;  4IBC A;  2MJ5 B;  1JR3 D;  2CRU A;  1IN6 A;  2LHC A;  2F5Q A;  4JI1 M;  1IQP A;  2APL A;  2HHH M;  3HU1 A;  4AZF A;  2W82 A;  2JP7 A;  4MH0 E;  5EXP A;  4R7G A;  2FS1 A;  2OPF A;  1TDZ A;  3HY5 A;  3K9P A;  1Z6T A;  2M60 A;  1PGY A;  2L6O A;  4QOZ C;  3H4J A;  1NJG A;  4G3O A;  1ORY B;  4PCZ A;  2M5Z A;  2Z3X A;  4BB9 A;  2JZ0 A;  4ANR A;  1K3X A;  5BPV A;  1X37 A;  4M0D A;  2ZAN A;  2FNA A;  4RF0 A;  1IBL M;  3R8F A;  3VDU A;  2NQ8 C;  3HU2 A;  3L27 A;  2CWB A;  2OO9 A;  3M0E A;  4LJA A;  1WGL A;  2KZS A;  2DKL A;  4JI3 M;  5C18 A;  3FUU A;  1TH4 A;  2KHH A;  5JI3 E;  3IEC A;  3HZJ A;  1GAB A;  3E9S A;  2JNH A;  1QZE A;  3SHF A;  1NO1 A;  4IJF A;  1PM5 A;  2FE8 A;  2G3Q A;  2Z8Y M;  2XSZ A;  1IXS B;  4G4Q A;  3U61 A;  1SG9 A;  1SXJ A;  4EIW A;  3SHG B;  2J7O A;  4LFC M;  1L2D A;  1F4I A;  4G6Z A;  4NL4 H;  5EP3 A;  3ZCB B;  1E32 A;  5F3W A;  3EIH A;  1WJ7 A;  3PNV A;  2R45 A;  1NY6 A;  3PNY A;  5FTJ A;  2G8L A;  2DWZ B;  5H37 D;  2DXI A;  3FTE A;  3GPP A;  3TL4 X;  2R46 A;  4FWG A;  3FRH A;  3AV0 A;  5C1B A;  2C98 A;  2LVN C;  3KVW A;  1KYI A;  1QDR A;  2CEA A;  4XGI A;  2RGO A;  1BVS A;  4AQY M;  1GJT A;  3PVS A;  1OQY A;  3MMP A;  2VDB B;  3SAU A;  3OTO M;  3QYE A;  1N32 M;  2AHM A;  1Z59 A;  3BBZ A;  3NBX X;  3U6D A;  3CF2 A;  2KW0 A;  3IHP A;  4NOO B;  5KPR A;  3GLI A;  1C1K A;  1E9R A;  2CV2 A;  1GL7 A;  4CIS A;  4PDG A;  4LF6 M;  4OW0 A;  2UXB M;  3SAV A;  2JZ1 A;  2QP9 X;  3FTD A;  1OIZ A;  2DHY A;  3U6E A;  2EJS A;  1A5T A;  1XMO M;  1NJF A;  5FTN A;  4JI8 M;  4JI7 M;  1L8Q A;  3AL0 C;  3WHK A;  1GLN A;  3KSX A;  1HNZ M;  4MGI E;  3UGJ A;  3FYC A;  4LF5 M;  4REZ A;  1QZM A;  4BBA A;  3UK6 A;  3VKG A;  3BOS A;  1AIP C;  4IBI A;  1T3T A;  1OFH A;  5GKN A;  3SMP A;  5KQ8 A;  4NRW A;  1Z5C A;  4LGM A;  2H5X A;  2K0B X;  3K92 A;  1XXH A;  5ITX E;  1L1Z A;  1PRB A;  2OOA A;  3KDS E;  5E26 A;  3B74 A;  1TR8 A;  4LY6 A;  2LVO C;  1R7R A;  1QUT A;  3FUV A;  4DR3 M;  2EKF A;  2BJV A;  2QZ4 A;  2WSF F;  3MK6 A;  3L29 A;  2DWN A;  3Q8X A;  3A45 A;  1V33 A;  1EFU B;  4LZJ A;  4Q7J A;  1NHW C;  2QNJ A;  4LG2 A;  1ZMV A;  2R44 A;  2X8A A;  4D82 A;  3AFH A;  3B7N A;  3AJI B;  3KW6 A;  3TWK A;  2R6F A;  3SYK A;  4B08 A;  3SBJ A;  2DZO B;  4AKI A;  1QDT A;  1I94 M;  2C9C A;  2HAK A;  4KO8 A;  3GRR A;  4QNM A;  1XNR M;  1WHC A;  3L28 A;  3SAW A;  1TF0 B;  4JI6 M;  5DYI A;  2FH0 A;  2LVP C;  4JXJ A;  2KZU A;  4M9X A;  4X65 M;  1Z5A A;  2MH8 A;  2R4J A;  3GQ3 A;  2K6B A;  1D0K A;  4X64 M;  2KA6 B;  3CTW B;  3HJ8 A;  3TQS A;  8CAT A;  4G4N A;  3GLG B;  1OKS A;  5EP2 A;  1XMQ M;  3C3E A;  3HHX A;  1XHB A;  2QSF X;  3FUX A;  4M0W A;  2YR0 A;  5DNY A;  1MN3 A; 
#chains in the Genus database with same CATH homology
 2XFS A;  4QHT A;  4TUW A;  1IXZ A;  5FSW A;  1K82 A;  1N77 A;  2HCB A;  3W0L B;  2QCU A;  3GPY A;  1NVM A;  3KOZ E;  2QBY B;  4L78 A;  4B3R M;  3ZH9 B;  1UM8 A;  4GC5 A;  1IBM M;  1D2N A;  4FCV A;  1DO0 A;  3GLH B;  1YSY A;  4GIT A;  1DO2 A;  3U60 B;  3J2P B;  4OU7 A;  2CE7 A;  3L26 A;  2R65 A;  3SYL A;  3AOE A;  4NXM M;  2Y0Q A;  1JR3 A;  2L7H A;  3C58 A;  4B7F A;  3FD9 A;  4D80 A;  4MGY E;  3D8B A;  4LJ9 A;  3JR4 A;  4DV0 M;  3KOW E;  1TGU A;  2C9O A;  3RFW A;  4B3T M;  4JI2 M;  2Q2E B;  4JI0 M;  5IT9 S;  2F5P A;  3GPX A;  3J80 S;  2UUB M;  3AOG A;  4NSO B;  3GLF B;  4GKK M;  2UU9 M;  3K8Z A;  3GPU A;  4IBK A;  3FUT A;  1GKI A;  4M9S A;  3KP1 E;  1XNQ M;  3J81 S;  2FFJ A;  3HU3 A;  2CFO A;  2YFQ A;  2C96 A;  2HL7 A;  4I4L A;  4I8O A;  1HR0 M;  4DV2 M;  3J7A S;  3FTF A;  1IN8 A;  4RNA A;  4AKH A;  1QYR A;  4JI4 M;  4KOD A;  2XZF A;  4PT5 A;  1IY0 A;  4GC9 A;  4IBD A;  4OVZ B;  3AOE C;  3CF0 A;  2Z4S A;  1QVR A;  1ZAE A;  3DOA A;  5ITU A;  3A46 A;  5FTK A;  1NNJ A;  2H1R A;  4B7G A;  4DR1 M;  3KS4 A;  2O5R A;  4WW0 A;  1R2Y A;  3TPZ A;  4LZZ A;  1IN5 A;  3PFI A;  1ZQ9 A;  3FTC A;  1H6U A;  4AKG A;  3L2A A;  4JI5 M;  2JA2 A;  2XF3 A;  2A5Y B;  4GRI A;  3U5Z A;  1L1T A;  4IJE A;  4RF1 A;  2CV1 A;  3U6C A;  2D7H A;  4S12 A;  5KPZ A;  1KSF X;  3LMM A;  4LF7 M;  5FLX S;  3GLG A;  2UUA M;  1HNW M;  2F4V M;  3CF6 E;  3UMM A;  4DR4 M;  3T15 A;  5KO3 A;  3TWM A;  3VK7 A;  3RGP A;  2ZM6 M;  2L7I A;  2F5N A;  4DR2 M;  2L09 A;  3IG8 A;  2D7G A;  3WHL A;  3VFD A;  4YY3 M;  1SXJ C;  3W0F A;  4DV4 M;  4B3M M;  2DHR A;  3SAR A;  4OX9 M;  5LMN M;  3SAT A;  4LF4 M;  2X49 A;  3MJ5 A;  1XWI A;  2F5S A;  3LVW A;  2DZN B;  4FW9 A;  2QBY A;  4DUZ M;  4G4O A;  2R4E A;  4KHP M;  2KEB A;  4LF8 M;  2G5G X;  3U60 A;  2RGH A;  2EO2 A;  3K1J A;  3B9P A;  4IBJ A;  1IY2 A;  2CV0 A;  5IZ7 D;  4LF9 M;  2RKO A;  3UJN A;  5EP4 A;  3GRU A;  1XC8 A;  2XFT A;  3EIE A;  3T1Y M;  2Y21 A;  2BJW A;  3SFZ A;  3KOY E;  2FOI C;  7CAT A;  3LQR A;  3U6O A;  4I5S A;  4MM3 B;  1G59 A;  2YQZ A;  2P5T A;  4DR5 M;  3HGI A;  4M9Z A;  4LFB M;  4FWD A;  1L2B A;  1SXJ B;  1SXJ E;  4AG6 A;  3JR5 A;  1Q3B A;  1NNU C;  3NBI A;  5JI2 E;  1TDH A;  1NY5 A;  4NSR A;  1N36 M;  4LCB A;  4LRS A;  3QWL A;  4X66 M;  4II7 A;  1QAM A;  4MGK E;  2LXE A;  4AG5 A;  1S3S A;  1WXQ A;  1QAN A;  1DGF A;  5FTM A;  2LH0 A;  1GL6 A;  3I4V A;  3KOX E;  3GQ5 A;  2KXE A;  2QPA A;  1N75 A;  4WUR A;  4DV3 M;  4K0K M;  3HHW A;  4OVZ A;  4NRV A;  1MU5 A;  3GLI B;  1R2Z A;  3A98 B;  1IN4 A;  2UXD M;  3TE6 A;  4A3V B;  5EQT A;  3FYD A;  2EUC A;  3NWL A;  2ZAM A;  4ITQ A;  1J7K A;  2ZBK B;  3FUW A;  4KLN A;  3DZD A;  1K3W A;  3ILK A;  3K2L A;  4L16 A;  1NHG C;  1XXH B;  1Z5B A;  4B3S M;  2Z7J A;  2C5R A;  4DV1 M;  3AKZ A;  2LNH C;  2XH9 A;  3HHY A;  2EA0 A;  3D8L A;  4GIP A;  4GKJ M;  1JQJ C;  4FWH A;  1E9S A;  4CGY B;  3GP1 A;  4DR7 M;  2I7N A;  1IXR C;  1HQY E;  3HJQ A;  4JN6 A;  4X62 M;  3R9X B;  1GVN A;  3DA1 A;  1YUB A;  4IIW A;  4LGY A;  3VK8 A;  3T1H M;  4DUY M;  5ITX A;  4YHH M;  3U6Q A;  2BNK A;  4I81 A;  3DFZ A;  3E4R A;  2DVW B;  5A2Q S;  1IY1 A;  2XZU A;  1OFI A;  2V1U A;  4B7H A;  3RGS A;  4LJ5 A;  1DGH B;  2OQ4 A;  2R62 A;  1G8P A;  4JV5 M;  2LWX A;  3J27 B;  3GO8 A;  4NXN M;  1E94 E;  4JYA M;  1HT2 E;  4AI6 A;  2C99 A;  4GMQ A;  5ITT A;  1N33 M;  2Y0T A;  3KFU G;  4R3D A;  1HT1 E;  1G4A E;  1R6B X;  1NSF A;  2XSZ D;  2V6Z M;  4IBB A;  2CUZ A;  2XGN A;  1IN7 A;  4XBO A;  1SXJ D;  1N78 A;  2K47 A;  4L8R C;  1FNN A;  2CHV A;  3GRV A;  4GH9 A;  4LFA M;  4CHT B;  3ZC7 B;  2F5O A;  2I7P A;  4PDI A;  5IRE B;  3KXE C;  2XEP A;  3LQQ A;  3J7B A;  2KRU A;  1IM2 A;  5EP1 A;  2X4A A;  5DYG A;  1DGB A;  3M7G A;  2CHG A;  4QHS A;  3U6M A;  2XLJ A;  4P16 A;  1VDD A;  4QOS A;  3GLH A;  5LMU M;  3HJS A;  3VLF B;  3HHZ A;  3SMS A;  1FJG M;  2VQE M;  3H4M A;  3SC3 A;  3LVV A;  1W5S A;  3HWS A;  3PXG A;  3TWL A;  2YNM D;  1TH3 A;  3KS8 A;  1G41 A;  1Q3C A;  3U6L A;  4QNR A;  1MX0 A;  2R18 A;  3IG5 A;  5EXT A;  2ERC A;  3MHV C;  4LJ4 A;  4DV5 M;  2VII A;  3HKP A;  3U61 B;  4FCW A;  4DV7 M;  3VDP A;  3JAM S;  3GLF A;  1PJI A;  1YE9 A;  1QQW A;  5E6J A;  3I51 A;  1W5T A;  4FVM A;  3RE8 A;  4LRT A;  4L15 A;  2UXC M;  1J5E M;  5FTL A;  3UZU A;  4Z8X A;  5ITY A;  4AW4 A;  1N34 M;  1J09 A;  3I4Y A;  1PJJ A;  4LJ8 A;  3KSJ A;  4MGZ E;  4ZPX A;  3T38 A;  5KQD A;  3U5Z B;  1IBK M;  5EJC A;  2HKJ A;  4IBE A;  4DR6 M;  4G4R A;  2KRK A;  1QAO A;  3KP0 E;  4FCT A;  3QAU A;  3U6P A;  4HLQ A;  4PD2 A;  5EXX A;  3L25 A;  1DGH A;  1HQC A;  1TH2 A;  1DGG A;  4GHA A;  4IBG A;  5EXS A;  4BLC A;  2DWL A;  2V1C A;  4LJ7 A;  4MB7 A;  2J7N A;  4L4U A;  5KPT A;  2E5L M;  3SAS A;  3A42 A;  3M6A A;  1QAQ A;  1G3I A;  2Y20 A;  4HL4 A;  1EE8 A;  4LJ6 A;  1HNX M;  3GQ4 A;  2CHQ A;  4IBF A;  4W5W A;  2QEN A;  1Q39 A;  4Z6Y A;  2DWM A;  2ZAO A;  3GRY A;  4GHL A;  1I4W A;  3U6S A;  4MGH A;  3THG A;  2Z4R A;  5BR8 M;  1KFV A;  3FKE A;  5ITR A;  4D81 A;  1OJL A;  1LV7 A;  3VKH A;  2UUC M;  2D7E A;  4DV6 M;  5IWA M;  1L2C A;  4FD2 A;  2VQF M;  4IBC A;  1JR3 D;  1IN6 A;  2F5Q A;  4JI1 M;  1IQP A;  2HHH M;  3HU1 A;  4AZF A;  2W82 A;  4MH0 E;  5EXP A;  2OPF A;  4R7G A;  1TDZ A;  1Z6T A;  2M60 A;  2L6O A;  4QOZ C;  1NJG A;  1ORY B;  4PCZ A;  2M5Z A;  2Z3X A;  4BB9 A;  1K3X A;  5BPV A;  1X37 A;  4M0D A;  2ZAN A;  2FNA A;  4RF0 A;  1IBL M;  3R8F A;  3VDU A;  2NQ8 C;  3HU2 A;  3L27 A;  3M0E A;  4LJA A;  4JI3 M;  2KZS A;  5C18 A;  3FUU A;  1TH4 A;  5JI3 E;  3E9S A;  3SHF A;  4IJF A;  1PM5 A;  2FE8 A;  2XSZ A;  1IXS B;  4G4Q A;  3U61 A;  1SXJ A;  4EIW A;  3SHG B;  2J7O A;  4LFC M;  1L2D A;  4G6Z A;  4NL4 H;  5EP3 A;  3ZCB B;  1E32 A;  5F3W A;  3EIH A;  3PNV A;  2R45 A;  1NY6 A;  3PNY A;  5FTJ A;  2G8L A;  2DWZ B;  5H37 D;  2DXI A;  3FTE A;  3GPP A;  3TL4 X;  2R46 A;  4FWG A;  3AV0 A;  5C1B A;  2C98 A;  3KVW A;  1KYI A;  2CEA A;  4XGI A;  2RGO A;  4AQY M;  3PVS A;  3SAU A;  3OTO M;  1N32 M;  2AHM A;  1Z59 A;  3U6D A;  3CF2 A;  2KW0 A;  4NOO B;  3GLI A;  5KPR A;  1C1K A;  1E9R A;  2CV2 A;  1GL7 A;  4CIS A;  4PDG A;  4LF6 M;  4OW0 A;  2UXB M;  3SAV A;  2QP9 X;  3FTD A;  3U6E A;  1XMO M;  1NJF A;  5FTN A;  4JI8 M;  4JI7 M;  1L8Q A;  3AL0 C;  3WHK A;  1GLN A;  3KSX A;  1HNZ M;  4MGI E;  3UGJ A;  3FYC A;  4LF5 M;  4REZ A;  1QZM A;  4BBA A;  3UK6 A;  3VKG A;  3BOS A;  4IBI A;  5GKN A;  1T3T A;  1OFH A;  5KQ8 A;  3SMP A;  4NRW A;  1Z5C A;  4LGM A;  3K92 A;  1XXH A;  5ITX E;  1L1Z A;  3KDS E;  5E26 A;  4LY6 A;  1R7R A;  3FUV A;  4DR3 M;  2QZ4 A;  2BJV A;  3MK6 A;  2DWN A;  3L29 A;  3Q8X A;  3A45 A;  4LZJ A;  1NHW C;  4LG2 A;  2X8A A;  4D82 A;  3AFH A;  3AJI B;  3KW6 A;  3TWK A;  4B08 A;  3SYK A;  4AKI A;  3SBJ A;  2DZO B;  1I94 M;  2C9C A;  4KO8 A;  3GRR A;  4QNM A;  1XNR M;  3SAW A;  3L28 A;  4JI6 M;  5DYI A;  4JXJ A;  2KZU A;  4M9X A;  4X65 M;  1Z5A A;  2R4J A;  3GQ3 A;  4X64 M;  2KA6 B;  3CTW B;  3HJ8 A;  3TQS A;  8CAT A;  4G4N A;  3GLG B;  5EP2 A;  1XMQ M;  3HHX A;  1XHB A;  3FUX A;  4M0W A;  2YR0 A;  5DNY A;  5ITQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...