2KW0A

Solution structure of n-terminal domain of ccmh from escherichia.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIATDLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CcmH protein
publication title Biochemical properties and catalytic domain structure of the CcmH protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kw0A00
2KW0A 2HL7A
chains in the Genus database with same CATH superfamily
3TWKA 3KSJA 5JI3E 1QAMA 1Z6TA 2DAMA 1QQWA 4PD2A 3U6OA 2FFJA 2NQ8C 1J7KA 2EO2A 2HKJA 1XNQM 1IN7A 1IXZA 2DWMA 3VDUA 1MX0A 1NNJA 3KW6A 3FUTA 4GC9A 1XNRM 2J7OA 2FS1A 3A98B 3GLHA 4M0DA 4XK8F 4G4OA 4DR3M 1GKIA 3W67A 1L2BA 2QCUA 3ZQJA 3A46A 4QHTA 5BR8M 4JI2M 2QP9X 4KHPM 2GQFA 3FD9A 5F3WA 1Z59A 1HR0M 3TWLA 3KXEC 4AKHA 1TR8A 4NRVA 5FTNA 2CV0A 1GL6A 3FRIA 1Y8GA 4A3VB 2KEBA 2N35A 4X64M 3GPYA 2W82A 4R7GA 2WSEF 4NRWA 3GQ5A 4LGMA 1OIZA 4L78A 4M9ZA 3H4MA 3U5ZB 1NVMA 2HAKA 3J80S 4GRIA 3B7ZA 3GRRA 1IFYA 3PVSA 5EP4A 3CF0A 4L16A 2VQFM 3CF6E 4LJAA 3U6PA 4B3SM 2G8LA 3L2AA 1R2YA 1NY5A 2DAKA 3PNVA 1VEKA 4F1IA 3SFZA 4R71A 3U5ZA 3QAUA 4DR4M 5LMNM 1H6UA 4QOSA 3HY5A 3FUWA 4LF6M 4R3DA 1QVRA 2LTUA 2QSFX 4AW4A 4FCTA 4AI6A 3GLHE 1XWIA 4LJ4A 3HHXA 1E94E 3UMMA 4Z8XA 4Y28F 3KS4A 1DGFA 3GRYA 4DR5M 3SAWA 1NSFA 2LWXA 2OPFA 4X66M 1GO5A 2DZOB 3KP0E 4PT5A 3MJ5A 5DYIA 2A5YB 2F5OA 2AHMA 3ILKA 1I4WA 3I51A 2HCBA 2LBCA 1HT1E 2L4EA 4GH9A 2C98A 3LMMA 2JZ0A 4LJ9A 4Q7JA 3SYLA 1R4GA 1K82A 1L2DA 5ITRA 1TH2A 2R4EA 2ZTCA 3IHPA 4HLQA 3J7BA 3GLFB 2KW0A 3FTDA 1TGUA 4DR1M 1WR1B 2DHRA 1S3SA 4KT0F 3E46A 2KA6B 1OFIA 1UM8A 2C96A 3SC3A 4OVZB 3SAVA 1Q3BA 4X65M 2LVOC 2ZANA 4DUZM 3T15A 1PM5A 2R65A 2JUJA 2KHHA 2XFSA 4M9SA 1MU5A 1JR3A 3K2LA 2UUBM 3GLFA 2DHYA 2C99A 2DKLA 3PXGA 4PDGA 1IM2A 2X4AA 3TPZA 4AQYM 1N77A 1QYRA 2X8AA 3J2PB 3RGSA 2XSZD 4OVZA 3JAMS 2C9CA 3ZH9B 4NXNM 2ZBKB 2ERCA 3HU3A 1T3TA 3UK6A 1D0KA 1D2NA 4DBGB 4DUYM 4FCWA 4LF5M 3D8BA 1UFZA 3D8LA 1NHGC 1YUBA 2QENA 4IIWA 3GO8A 5IREB 4PCZA 4JYAM 4CJ6A 3QYBA 3VK7A 3FYCA 4CIZA 4DR7M 1GABA 3NBXX 3VK8A 3W0FA 3R8FA 3L25A 1GL7A 3MK6A 3UGJA 1C7YA 2I7NA 3QWLA 3ZC7B 3CGWA 3C3EA 1OTRA 2FE8A 3FKEA 2O5RA 3GPXA 2D7GA 4G4RA 4JI7M 2DWZB 2JY8A 2F4VM 4OX9M 1WHCA 2CHVA 1R6BX 4LZJA 3W68A 5DYGA 3SBJA 1IBMM 1Q3CA 4GIPA 1TDHA 2KNVA 3B74A 2OQ4A 1R2ZA 4IBDA 2JY7A 2R0IA 4I8OA 1R7RA 1YLAA 8CATA 2VIIA 4LRSA 2LVPC 2JY5A 4MGKE 1DO2A 3HHYA 4DV2M 1KSFX 4B7GA 4JI5M 1SXJE 3AFHA 5EXXA 1NHWC 4G6ZA 3M7GA 1Z5BA 2MH8A 3SHGB 3T6PA 2EKFA 5ITQA 1DGBA 3C58A 2L6OA 2CV1A 3L29A 4I81A 1XHBA 2CRUA 3SARA 2WZJA 3KOZE 4P16A 3U6QA 1W5SA 1IN4A 2Z7JA 2VQEM 4M0WA 3IECA 2UXBM 1YE9A 2UXDM 1GJSA 4LFAM 2CWBA 4L6V6 4GMQA 3HZJA 2LVAA 1G71A 2JP7A 3VKGA 1XXHE 4LCBA 2JWSA 2ZM6M 4LFBM 3K1JA 1G4AE 1XMQM 2QBYB 2FNAA 3MHVC 5H37D 5ITUA 5KO3A 3E21A 3GP1A 4AZFA 1N36M 2KNZA 1TF0B 2CV2A 1PJSA 1G8PA 1OFHA 2MR9A 4GHAA 4DV4M 3BXWA 5ITYA 2LXEA 3AOGA 1K3XA 3U6DA 2QBYA 2KXEA 1J09A 1N78A 2VF8A 4OU7A 3KOYE 2KNAA 3HJQA 3E9SA 4IBCA 5EP3A 4QHSA 3NBIA 3AOEA 1ZV1A 4S12A 4JI3M 3HHWA 4IBIA 3SMPA 1GVNA 2EA0A 5ITTA 3FUXA 1WIVA 2DENA 1DO0A 2KRKA 4LJ8A 1LV7A 2QZ4A 2O01F 3DFZA 3U6MA 1I94M 3TL4X 4LF4M 4DR2M 1DGGA 1XB2B 4IBBA 3C3DA 2Y20A 3UZUA 2FH0A 3QYEA 1IN8A 2I7PA 3J27B 2OO9A 1IQPA 1PJJA 1ZMWA 1IBKM 1HNWM 2R4JA 1VQ1A 1NO1A 1JR3D 3GLGB 2ZAOA 3HWSA 1MN3A 3BBZA 4KODA 5JI2E 2BWEA 3RGPA 1NV9A 1SG9A 4AG6A 4F2LA 2R45A 1VDDA 3RFWA 4AG5A 4DV0M 3L28A 2GNOA 3W0LB 1MJGM 5FSWA 2Y0TA 1OQYA 1N33M 3T38A 1GJTA 4W5WA 1LTMA 2OOAA 5IWAM 2LHCA 3GQ4A 3GLGA 1HNZM 3FTFA 2KZUA 5ITXA 4RF0A 2FOIC 5A2QS 4L4UA 2G3QA 4LZZA 4D81A 3GQ3A 1RU3A 1OKSA 1YSYA 1ZMUA 1PGYA 3AV0A 3C9PA 4TUWA 1WGNA 4QNRA 2R62A 4B08A 3SYKA 3HKPA 4CHTB 1HQCA 3HHZA 1G59A 2DXIA 1KYIA 2RKOA 1FJGM 4OW0A 1SXJB 1Q02A 3Q8GA 1CUKA 3KDSE 3EIEA 4FWHA 2G5GX 2XF3A 5KPTA 3KSXA 5DFLA 4IJEA 2APLA 1EE8A 2DAEA 5EP2A 3U61B 4AKIA 5IT9S 2L7IA 4II7A 4GITA 1SXJA 5FTJA 1Z5CA 3U6CA 1E9RA 3IG8A 3SAUA 4FD2A 4RKUF 1XXHB 5EJCA 1IBLM 3B7NA 1NY6A 2VDBB 2XLJA 4LG2A 3LVVA 5EP1A 3A45A 4LGYA 3U61A 3GLIB 2WSCF 4MGHA 1J5EM 2Z4SA 3B9PA 1ZMVA 4QOZC 3AOEC 1TH3A 1VEJA 4PDIA 2L2DA 5KQ8A 1XXHA 1HNXM 4GEWA 4B7HA 1AIPC 3GLGE 5ITXE 3KOXE 3GLIA 1F4IA 2KRUA 4NSOB 4L15A 1E32A 3OTOM 3RE8A 4B7FA 2EKKA 2HL7A 2OOBA 1NNUC 1IXRC 3FTEA 3KS8A 3MMPA 3GPUA 2B3TA 4KO8A 2RGOA 1BVSA 3M6AA 1QDTA 2L7HA 2CFOA 2X49A 5GKNA 2F5SA 4B3MM 4B3TM 1JQJC 5E26A 2DWLA 1ZAEA 3UJNA 2J5YA 3VDPA 4JI0M 4IBGA 1DGHB 1NJGA 2Q2EB 1G41A 3E4RA 3K9PA 4GC5A 3JR5A 2UU9M 1WJ7A 1OJLA 2QNJA 5FTMA 2DVWB 4JI4M 3PNYA 1QZEA 3TE6A 2XH9A 3R9XB 4FW9A 4DV6M 4G4NA 3FUUA 2YR0A 1DGHA 2CHQA 4K0KM 3I4YA 2YNMD 4HEOA 2JNHA 1OAOC 4G3OA 1EFUB 2K0BX 4I4LA 3LCUA 3B7QA 5EXTA 1QANA 3FUVA 2JA2A 2Z4RA 1EIJA 1OAIA 4UN2B 2M60A 4BB9A 3GLIE 5FTKA 1IXSB 4ZPXA 3HX3A 2V1CA 1V33A 5KPRA 2UUAM 5LMUM 2KZSA 1Z5AA 3CTWB 4DV1M 2XZUA 2LHGA 4MGZE 1L8QA 3CF2A 4WURA 1L1TA 2CP8A 2QQ8A 3AL0C 1SXJC 1N32M 4JV5M 4JXJA 1IXSA 1A5TA 2BNKA 2LVQD 2P5TA 2R18A 4D80A 3K8ZA 2DZNB 4KLNA 4CGYB 2V6ZM 1D0MA 3I4VA 3DZDA 4AKGA 1VEGA 2DI0A 3HJSA 2DAGA 4NXMM 3L27A 3K92A 4LRTA 2RGHA 2K9DA 3NWLA 2R6FA 1D0LA 4LJ5A 1P3QQ 1XMOM 4Z6YA 3U6EA 3B89A 4MH0E 1QUSA 4HL4A 4BLCA 3LQQA 4RNAA 2XGNA 4P17A 5IZ7D 3GPPA 4FWDA 4LY6A 3THGA 2MROB 3L26A 4JI1M 4DR6M 2DWNA 4D82A 7CATA 3KVWA 4ITQA 1XC8A 2JY6B 1T6OA 2YFQA 5C18A 4LF8M 3DA1A 3SHFA 4MM3B 1ZQ9A 2LVNC 5E6JA 1PJTA 2DZLA 2ZTDA 2XZFA 1IN6A 3I04M 1SXJD 3I01M 1N34M 4BBAA 2HHHM 1QAOA 2KDLA 4FWGA 2DNAA 2UUCM 3HGIA 2CEAA 4LFCM 2O25A 2E5LM 1R5LA 2LNHC 1L2CA 4NC6A 1IY2A 2Z3XA 4EIWA 1HT2E 3U6SA 3J7AS 3A42A 1L1ZA 1Q39A 2H5XA 2M5ZA 4YY3M 5KPZA 4JN6A 4DV3M 2Z8YM 2DAIA 1VDLA 2QPAA 1C1KA 1G3IA 4B3RM 1TDZA 1QUTA 4IBJA 2D7EA 3Q8XA 4MGIE 4IBFA 5DNYA 3FYDA 2WSFF 1NJFA 3TWMA 3T1HM 5BPVA 3KFUG 4REZA 5EXPA 1IY1A 3FRHA 2F5PA 2XEPA 3AKZA 2K6BA 1PRBA 4JI8M 4XGIA 2EUCA 2C9OA 4WW0A 2R44A 3LW5F 2MGWA 3VFDA 4ANRA 4L8RC 4IBKA 1HJPA 3GRVA 1JB0F 1K3WA 5FTLA 1N75A 2Y21A 3WHKA 2V1UA 1DV0A 1OIPA 1WXQA 2Y0QA 4LJ7A 4WP2A 2YQZA 4XBOA 3J81S 3SASA 1WGLA 1KFVA 2CHGA 3HU1A 4LF7M 2D7HA 2LH0A 2JZ1A 2MJ5B 3KP1E 3VLFB 1PJIA 2JXNA 1E9SA 1AUAA 3DOAA 3WHLA 2ZAMA 4G4QA 1IY0A 4LJ6A 3TQSA 4X62M 1HQYE 3LVWA 2CUZA 4IBEA 2BJWA 1X37A 2C5RA 4GHLA 3FE3A 4FVMA 4DV5M 1TTEA 1W5TA 3V76A 4DV7M 3H4JA 5L8RF 5C1BA 2UXCM 2HWJA 4GKJM 3IG5A 1VG5A 3LCVB 3JR4A 1IN5A 4CISA 2BWBA 2L09A 2J7NA 2RRUA 4I5SA 4MGYE 3EIHA 4NSRA 2EJSA 3U60B 2L4FA 1QAQA 3HU2A 1QZMA 2F5NA 3K9OA 2BJVA 1TH4A 4FCVA 1PJQA 2XFTA 3M0EA 4MB7A 2R46A 2XSZA 1GLNA 2QHOB 2VF7A 4M9XA 3T1YM 1NV8A 4JI6M 3SATA 3U60A 1V92A 3HJ8A 3LQRA 5FLXS 3PFIA 3FTCA 4YHHM 2F5QA 1JR3E 1V34A 1T43A 4NOOB 3GLFE 4RF1A 3SMSA 3GRUA 5EQTA 3U6LA 3BOSA 4QNMA 3ZCBB 4LF9M 3VKHA 4GKKM 3KOWE 5EXSA 2CE7A 4IJFA 3F92A 1ORYB 3AJIB 5KQDA 2K47A 3GLHB 2H1RA 1QDRA 1FNNA 4NL4H
chains in the Genus database with same CATH topology
3TWKA 3KSJA 5JI3E 1QAMA 1Z6TA 1QQWA 4PD2A 3U6OA 2FFJA 2NQ8C 1J7KA 2EO2A 2HKJA 1XNQM 1IN7A 1IXZA 2DWMA 3VDUA 1MX0A 1NNJA 3KW6A 3FUTA 4GC9A 1XNRM 2J7OA 3A98B 3GLHA 4M0DA 4G4OA 4DR3M 1L2BA 1GKIA 2QCUA 3A46A 4QHTA 5BR8M 4JI2M 2QP9X 4KHPM 3FD9A 5F3WA 1Z59A 1HR0M 3TWLA 3KXEC 4AKHA 5FTNA 4NRVA 2CV0A 1GL6A 4A3VB 2KEBA 4X64M 3GPYA 2W82A 4R7GA 4NRWA 3GQ5A 4LGMA 4L78A 4M9ZA 3H4MA 3U5ZB 1NVMA 3J80S 4GRIA 3GRRA 3PVSA 5EP4A 3CF0A 4L16A 2VQFM 3CF6E 4LJAA 3U6PA 4B3SM 2G8LA 3L2AA 1R2YA 1NY5A 3PNVA 3SFZA 3U5ZA 3QAUA 4DR4M 5LMNM 1H6UA 4QOSA 3FUWA 4LF6M 4R3DA 1QVRA 4AW4A 4FCTA 4AI6A 1XWIA 4LJ4A 3HHXA 1E94E 3UMMA 4Z8XA 3KS4A 1DGFA 3GRYA 4DR5M 3SAWA 1NSFA 2LWXA 2OPFA 4X66M 3KP0E 2DZOB 4PT5A 3MJ5A 5DYIA 2A5YB 2F5OA 2AHMA 3ILKA 1I4WA 3I51A 2HCBA 1HT1E 4GH9A 2C98A 3LMMA 4LJ9A 3SYLA 3J7AS 1K82A 1L2DA 5ITRA 1TH2A 2R4EA 4HLQA 3GLFB 3J7BA 2KW0A 3FTDA 1TGUA 4DR1M 2DHRA 1S3SA 2KA6B 1OFIA 1UM8A 2C96A 3SC3A 4OVZB 3SAVA 1Q3BA 4X65M 2ZANA 4DUZM 3T15A 1PM5A 2R65A 2XFSA 4M9SA 1MU5A 1JR3A 3K2LA 2UUBM 3GLFA 2C99A 3PXGA 4PDGA 4AQYM 1IM2A 2X4AA 3TPZA 1N77A 1QYRA 2X8AA 3J2PB 3RGSA 2XSZD 4OVZA 3JAMS 2C9CA 3ZH9B 4NXNM 2ZBKB 2ERCA 3HU3A 1T3TA 3UK6A 1D2NA 4DUYM 4FCWA 4LF5M 3D8BA 3D8LA 1NHGC 1YUBA 2QENA 4IIWA 3GO8A 5IREB 4PCZA 3VK7A 3FYCA 4DR7M 3VK8A 3W0FA 3L25A 1GL7A 3MK6A 3UGJA 2I7NA 3QWLA 3ZC7B 2FE8A 3FKEA 2O5RA 3GPXA 2D7GA 4G4RA 4JI7M 2DWZB 2F4VM 4OX9M 2CHVA 1R6BX 4LZJA 1IBMM 5DYGA 3SBJA 1Q3CA 4GIPA 1TDHA 2OQ4A 1R2ZA 4IBDA 4I8OA 1R7RA 8CATA 2VIIA 4LRSA 4MGKE 3HHYA 4DV2M 1DO2A 1KSFX 4B7GA 4JI5M 1SXJE 3AFHA 5EXXA 1NHWC 4G6ZA 3M7GA 1Z5BA 3SHGB 5ITQA 3C58A 1DGBA 2L6OA 2CV1A 3L29A 4I81A 1XHBA 3SARA 3KOZE 4P16A 3U6QA 1W5SA 1IN4A 2Z7JA 2VQEM 4M0WA 2UXBM 1YE9A 2UXDM 4LFAM 4GMQA 3VKGA 2ZM6M 4LCBA 4LFBM 3K1JA 1G4AE 1XMQM 2QBYB 2FNAA 3MHVC 5H37D 5ITUA 5KO3A 3GP1A 4AZFA 1N36M 2CV2A 1OFHA 1G8PA 4GHAA 4DV4M 5ITYA 2LXEA 3AOGA 1K3XA 3U6DA 2QBYA 2KXEA 1J09A 1N78A 4OU7A 3KOYE 3HJQA 4IBCA 3E9SA 5EP3A 4QHSA 3NBIA 3AOEA 4S12A 4JI3M 3HHWA 4IBIA 3SMPA 1GVNA 2EA0A 5ITTA 3FUXA 1DO0A 2KRKA 4LJ8A 1LV7A 2QZ4A 3DFZA 3U6MA 1I94M 4LF4M 3TL4X 4DR2M 1DGGA 4IBBA 2Y20A 3UZUA 1IN8A 2I7PA 3J27B 1IQPA 1PJJA 1IBKM 1HNWM 2R4JA 1JR3D 3GLGB 2ZAOA 3HWSA 5JI2E 4KODA 4AG6A 3RGPA 2R45A 1VDDA 3RFWA 4AG5A 4DV0M 3L28A 3W0LB 5FSWA 2Y0TA 1N33M 3T38A 4W5WA 5IWAM 4JYAM 3GLGA 3GQ4A 1HNZM 3FTFA 2KZUA 5ITXA 4RF0A 2FOIC 5A2QS 4L4UA 4LZZA 4D81A 3R8FA 3GQ3A 4TUWA 1YSYA 3AV0A 4QNRA 4B08A 2R62A 1G59A 3SYKA 3HKPA 4CHTB 1HQCA 3HHZA 2DXIA 4LF9M 2RKOA 1KYIA 1FJGM 4OW0A 1SXJB 3KDSE 3EIEA 4FWHA 2G5GX 2XF3A 5KPTA 3KSXA 4IJEA 1EE8A 5EP2A 3U61B 4AKIA 5IT9S 2L7IA 4II7A 4GITA 1SXJA 5FTJA 1Z5CA 3U6CA 1E9RA 3IG8A 3SAUA 4FD2A 1XXHB 5EJCA 1IBLM 1NY6A 2XLJA 4LG2A 3LVVA 5EP1A 3A45A 4LGYA 3U61A 3GLIB 4MGHA 1J5EM 2Z4SA 3B9PA 4QOZC 3AOEC 1TH3A 4PDIA 5KQ8A 1XXHA 1HNXM 4B7HA 5ITXE 3KOXE 3GLIA 2KRUA 4NSOB 4L15A 1E32A 3OTOM 3RE8A 4B7FA 2HL7A 1NNUC 1IXRC 3FTEA 3KS8A 3GPUA 4KO8A 2RGOA 3M6AA 2L7HA 2CFOA 2X49A 5GKNA 2F5SA 4B3MM 4B3TM 1JQJC 5E26A 2DWLA 1ZAEA 3UJNA 3VDPA 4JI0M 4IBGA 1DGHB 1NJGA 2Q2EB 1G41A 3E4RA 4GC5A 3JR5A 2UU9M 1OJLA 5FTMA 2DVWB 4JI4M 3PNYA 3TE6A 2XH9A 3R9XB 4FW9A 4DV6M 4G4NA 3FUUA 2YR0A 1DGHA 2CHQA 4K0KM 3I4YA 2YNMD 4I4LA 5EXTA 1QANA 3FUVA 2JA2A 2Z4RA 4BB9A 2M60A 5FTKA 1IXSB 4ZPXA 2V1CA 2UUAM 5KPRA 5LMUM 2KZSA 1Z5AA 3CTWB 4DV1M 2XZUA 4MGZE 1L8QA 3CF2A 4WURA 1L1TA 3AL0C 1SXJC 1N32M 4JV5M 4JXJA 4D80A 2BNKA 2R18A 2P5TA 3K8ZA 2DZNB 4KLNA 4CGYB 2V6ZM 3I4VA 3DZDA 4AKGA 3HJSA 4NXMM 3L27A 3K92A 4LRTA 2RGHA 3NWLA 4LJ5A 1XMOM 4Z6YA 3U6EA 4MH0E 4HL4A 4BLCA 3LQQA 4RNAA 2XGNA 5IZ7D 3GPPA 4FWDA 4LY6A 3THGA 3L26A 4JI1M 4DR6M 2DWNA 4D82A 7CATA 3KVWA 4ITQA 1XC8A 2YFQA 5C18A 4LF8M 3DA1A 3SHFA 4MM3B 1ZQ9A 5E6JA 1N34M 2XZFA 1IN6A 1SXJD 4BBAA 2HHHM 1QAOA 4FWGA 2UUCM 3HGIA 2CEAA 4LFCM 2E5LM 2LNHC 1L2CA 1IY2A 2Z3XA 4EIWA 1HT2E 3U6SA 3A42A 1L1ZA 1Q39A 2M5ZA 4YY3M 5KPZA 4JN6A 4DV3M 2QPAA 1C1KA 1G3IA 4B3RM 1TDZA 4IBJA 2D7EA 3Q8XA 4MGIE 4IBFA 5DNYA 3FYDA 3TWMA 1NJFA 3T1HM 3KFUG 5BPVA 4REZA 5EXPA 1IY1A 2F5PA 2XEPA 3AKZA 4JI8M 4XGIA 2EUCA 2C9OA 4WW0A 4L8RC 3VFDA 4IBKA 3GRVA 1K3WA 5FTLA 1N75A 2Y21A 3WHKA 2V1UA 1WXQA 2Y0QA 4LJ7A 4XBOA 3J81S 2YQZA 3SASA 1KFVA 2CHGA 3HU1A 4LF7M 2D7HA 2LH0A 3VLFB 1PJIA 3KP1E 3WHLA 1E9SA 3DOAA 2ZAMA 4G4QA 1IY0A 4LJ6A 3TQSA 4X62M 1HQYE 3LVWA 2CUZA 4IBEA 2BJWA 1X37A 2C5RA 4GHLA 4FVMA 4DV5M 1W5TA 4DV7M 5C1BA 2UXCM 4GKJM 3IG5A 4CISA 3JR4A 1IN5A 2L09A 2J7NA 4I5SA 4MGYE 3EIHA 4NSRA 3U60B 1QAQA 3HU2A 1QZMA 2F5NA 2BJVA 1TH4A 4FCVA 2XFTA 3M0EA 4MB7A 2R46A 2XSZA 1GLNA 4M9XA 3T1YM 4JI6M 3SATA 3U60A 3HJ8A 3LQRA 5FLXS 3PFIA 3FTCA 4YHHM 2F5QA 4NOOB 4RF1A 3SMSA 3GRUA 5EQTA 3U6LA 3BOSA 4QNMA 3ZCBB 3VKHA 4GKKM 3KOWE 5EXSA 2CE7A 4IJFA 1ORYB 3AJIB 5KQDA 2K47A 3GLHB 2H1RA 1FNNA 4NL4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW0 A;  2HL7 A; 
#chains in the Genus database with same CATH topology
 3TWK A;  3KSJ A;  5JI3 E;  1QAM A;  1Z6T A;  2DAM A;  1QQW A;  4PD2 A;  3U6O A;  2FFJ A;  2NQ8 C;  1J7K A;  2EO2 A;  2HKJ A;  1XNQ M;  1IN7 A;  1IXZ A;  2DWM A;  3VDU A;  1MX0 A;  1NNJ A;  3KW6 A;  3FUT A;  4GC9 A;  1XNR M;  2J7O A;  2FS1 A;  3A98 B;  3GLH A;  4M0D A;  4XK8 F;  4G4O A;  4DR3 M;  1GKI A;  3W67 A;  1L2B A;  2QCU A;  3ZQJ A;  3A46 A;  4QHT A;  5BR8 M;  4JI2 M;  2QP9 X;  4KHP M;  2GQF A;  3FD9 A;  5F3W A;  1Z59 A;  1HR0 M;  3TWL A;  3KXE C;  4AKH A;  1TR8 A;  4NRV A;  5FTN A;  2CV0 A;  1GL6 A;  3FRI A;  1Y8G A;  4A3V B;  2KEB A;  2N35 A;  4X64 M;  3GPY A;  2W82 A;  4R7G A;  2WSE F;  4NRW A;  3GQ5 A;  4LGM A;  1OIZ A;  4L78 A;  4M9Z A;  3H4M A;  3U5Z B;  1NVM A;  2HAK A;  3J80 S;  4GRI A;  3B7Z A;  3GRR A;  1IFY A;  3PVS A;  5EP4 A;  3CF0 A;  4L16 A;  2VQF M;  3CF6 E;  4LJA A;  3U6P A;  4B3S M;  2G8L A;  3L2A A;  1R2Y A;  1NY5 A;  2DAK A;  3PNV A;  1VEK A;  4F1I A;  3SFZ A;  4R71 A;  3U5Z A;  3QAU A;  4DR4 M;  5LMN M;  1H6U A;  4QOS A;  3HY5 A;  3FUW A;  4LF6 M;  4R3D A;  1QVR A;  2LTU A;  2QSF X;  4AW4 A;  4FCT A;  4AI6 A;  3GLH E;  1XWI A;  4LJ4 A;  3HHX A;  1E94 E;  3UMM A;  4Z8X A;  4Y28 F;  3KS4 A;  1DGF A;  3GRY A;  4DR5 M;  3SAW A;  1NSF A;  2LWX A;  2OPF A;  4X66 M;  1GO5 A;  2DZO B;  3KP0 E;  4PT5 A;  3MJ5 A;  5DYI A;  2A5Y B;  2F5O A;  2AHM A;  3ILK A;  1I4W A;  3I51 A;  2HCB A;  2LBC A;  1HT1 E;  2L4E A;  4GH9 A;  2C98 A;  3LMM A;  2JZ0 A;  4LJ9 A;  4Q7J A;  3SYL A;  1R4G A;  1K82 A;  1L2D A;  5ITR A;  1TH2 A;  2R4E A;  2ZTC A;  3IHP A;  4HLQ A;  3J7B A;  3GLF B;  2KW0 A;  3FTD A;  1TGU A;  4DR1 M;  1WR1 B;  2DHR A;  1S3S A;  4KT0 F;  3E46 A;  2KA6 B;  1OFI A;  1UM8 A;  2C96 A;  3SC3 A;  4OVZ B;  3SAV A;  1Q3B A;  4X65 M;  2LVO C;  2ZAN A;  4DUZ M;  3T15 A;  1PM5 A;  2R65 A;  2JUJ A;  2KHH A;  2XFS A;  4M9S A;  1MU5 A;  1JR3 A;  3K2L A;  2UUB M;  3GLF A;  2DHY A;  2C99 A;  2DKL A;  3PXG A;  4PDG A;  1IM2 A;  2X4A A;  3TPZ A;  4AQY M;  1N77 A;  1QYR A;  2X8A A;  3J2P B;  3RGS A;  2XSZ D;  4OVZ A;  3JAM S;  2C9C A;  3ZH9 B;  4NXN M;  2ZBK B;  2ERC A;  3HU3 A;  1T3T A;  3UK6 A;  1D0K A;  1D2N A;  4DBG B;  4DUY M;  4FCW A;  4LF5 M;  3D8B A;  1UFZ A;  3D8L A;  1NHG C;  1YUB A;  2QEN A;  4IIW A;  3GO8 A;  5IRE B;  4PCZ A;  4JYA M;  4CJ6 A;  3QYB A;  3VK7 A;  3FYC A;  4CIZ A;  4DR7 M;  1GAB A;  3NBX X;  3VK8 A;  3W0F A;  3R8F A;  3L25 A;  1GL7 A;  3MK6 A;  3UGJ A;  1C7Y A;  2I7N A;  3QWL A;  3ZC7 B;  3CGW A;  3C3E A;  1OTR A;  2FE8 A;  3FKE A;  2O5R A;  3GPX A;  2D7G A;  4G4R A;  4JI7 M;  2DWZ B;  2JY8 A;  2F4V M;  4OX9 M;  1WHC A;  2CHV A;  1R6B X;  4LZJ A;  3W68 A;  5DYG A;  3SBJ A;  1IBM M;  1Q3C A;  4GIP A;  1TDH A;  2KNV A;  3B74 A;  2OQ4 A;  1R2Z A;  4IBD A;  2JY7 A;  2R0I A;  4I8O A;  1R7R A;  1YLA A;  8CAT A;  2VII A;  4LRS A;  2LVP C;  2JY5 A;  4MGK E;  1DO2 A;  3HHY A;  4DV2 M;  1KSF X;  4B7G A;  4JI5 M;  1SXJ E;  3AFH A;  5EXX A;  1NHW C;  4G6Z A;  3M7G A;  1Z5B A;  2MH8 A;  3SHG B;  3T6P A;  2EKF A;  5ITQ A;  1DGB A;  3C58 A;  2L6O A;  2CV1 A;  3L29 A;  4I81 A;  1XHB A;  2CRU A;  3SAR A;  2WZJ A;  3KOZ E;  4P16 A;  3U6Q A;  1W5S A;  1IN4 A;  2Z7J A;  2VQE M;  4M0W A;  3IEC A;  2UXB M;  1YE9 A;  2UXD M;  1GJS A;  4LFA M;  2CWB A;  4L6V 6;  4GMQ A;  3HZJ A;  2LVA A;  1G71 A;  2JP7 A;  3VKG A;  1XXH E;  4LCB A;  2JWS A;  2ZM6 M;  4LFB M;  3K1J A;  1G4A E;  1XMQ M;  2QBY B;  2FNA A;  3MHV C;  5H37 D;  5ITU A;  5KO3 A;  3E21 A;  3GP1 A;  4AZF A;  1N36 M;  2KNZ A;  1TF0 B;  2CV2 A;  1PJS A;  1G8P A;  1OFH A;  2MR9 A;  4GHA A;  4DV4 M;  3BXW A;  5ITY A;  2LXE A;  3AOG A;  1K3X A;  3U6D A;  2QBY A;  2KXE A;  1J09 A;  1N78 A;  2VF8 A;  4OU7 A;  3KOY E;  2KNA A;  3HJQ A;  3E9S A;  4IBC A;  5EP3 A;  4QHS A;  3NBI A;  3AOE A;  1ZV1 A;  4S12 A;  4JI3 M;  3HHW A;  4IBI A;  3SMP A;  1GVN A;  2EA0 A;  5ITT A;  3FUX A;  1WIV A;  2DEN A;  1DO0 A;  2KRK A;  4LJ8 A;  1LV7 A;  2QZ4 A;  2O01 F;  3DFZ A;  3U6M A;  1I94 M;  3TL4 X;  4LF4 M;  4DR2 M;  1DGG A;  1XB2 B;  4IBB A;  3C3D A;  2Y20 A;  3UZU A;  2FH0 A;  3QYE A;  1IN8 A;  2I7P A;  3J27 B;  2OO9 A;  1IQP A;  1PJJ A;  1ZMW A;  1IBK M;  1HNW M;  2R4J A;  1VQ1 A;  1NO1 A;  1JR3 D;  3GLG B;  2ZAO A;  3HWS A;  1MN3 A;  3BBZ A;  4KOD A;  5JI2 E;  2BWE A;  3RGP A;  1NV9 A;  1SG9 A;  4AG6 A;  4F2L A;  2R45 A;  1VDD A;  3RFW A;  4AG5 A;  4DV0 M;  3L28 A;  2GNO A;  3W0L B;  1MJG M;  5FSW A;  2Y0T A;  1OQY A;  1N33 M;  3T38 A;  1GJT A;  4W5W A;  1LTM A;  2OOA A;  5IWA M;  2LHC A;  3GQ4 A;  3GLG A;  1HNZ M;  3FTF A;  2KZU A;  5ITX A;  4RF0 A;  2FOI C;  5A2Q S;  4L4U A;  2G3Q A;  4LZZ A;  4D81 A;  3GQ3 A;  1RU3 A;  1OKS A;  1YSY A;  1ZMU A;  1PGY A;  3AV0 A;  3C9P A;  4TUW A;  1WGN A;  4QNR A;  2R62 A;  4B08 A;  3SYK A;  3HKP A;  4CHT B;  1HQC A;  3HHZ A;  1G59 A;  2DXI A;  1KYI A;  2RKO A;  1FJG M;  4OW0 A;  1SXJ B;  1Q02 A;  3Q8G A;  1CUK A;  3KDS E;  3EIE A;  4FWH A;  2G5G X;  2XF3 A;  5KPT A;  3KSX A;  5DFL A;  4IJE A;  2APL A;  1EE8 A;  2DAE A;  5EP2 A;  3U61 B;  4AKI A;  5IT9 S;  2L7I A;  4II7 A;  4GIT A;  1SXJ A;  5FTJ A;  1Z5C A;  3U6C A;  1E9R A;  3IG8 A;  3SAU A;  4FD2 A;  4RKU F;  1XXH B;  5EJC A;  1IBL M;  3B7N A;  1NY6 A;  2VDB B;  2XLJ A;  4LG2 A;  3LVV A;  5EP1 A;  3A45 A;  4LGY A;  3U61 A;  3GLI B;  2WSC F;  4MGH A;  1J5E M;  2Z4S A;  3B9P A;  1ZMV A;  4QOZ C;  3AOE C;  1TH3 A;  1VEJ A;  4PDI A;  2L2D A;  5KQ8 A;  1XXH A;  1HNX M;  4GEW A;  4B7H A;  1AIP C;  3GLG E;  5ITX E;  3KOX E;  3GLI A;  1F4I A;  2KRU A;  4NSO B;  4L15 A;  1E32 A;  3OTO M;  3RE8 A;  4B7F A;  2EKK A;  2HL7 A;  2OOB A;  1NNU C;  1IXR C;  3FTE A;  3KS8 A;  3MMP A;  3GPU A;  2B3T A;  4KO8 A;  2RGO A;  1BVS A;  3M6A A;  1QDT A;  2L7H A;  2CFO A;  2X49 A;  5GKN A;  2F5S A;  4B3M M;  4B3T M;  1JQJ C;  5E26 A;  2DWL A;  1ZAE A;  3UJN A;  2J5Y A;  3VDP A;  4JI0 M;  4IBG A;  1DGH B;  1NJG A;  2Q2E B;  1G41 A;  3E4R A;  3K9P A;  4GC5 A;  3JR5 A;  2UU9 M;  1WJ7 A;  1OJL A;  2QNJ A;  5FTM A;  2DVW B;  4JI4 M;  3PNY A;  1QZE A;  3TE6 A;  2XH9 A;  3R9X B;  4FW9 A;  4DV6 M;  4G4N A;  3FUU A;  2YR0 A;  1DGH A;  2CHQ A;  4K0K M;  3I4Y A;  2YNM D;  4HEO A;  2JNH A;  1OAO C;  4G3O A;  1EFU B;  2K0B X;  4I4L A;  3LCU A;  3B7Q A;  5EXT A;  1QAN A;  3FUV A;  2JA2 A;  2Z4R A;  1EIJ A;  1OAI A;  4UN2 B;  2M60 A;  4BB9 A;  3GLI E;  5FTK A;  1IXS B;  4ZPX A;  3HX3 A;  2V1C A;  1V33 A;  5KPR A;  2UUA M;  5LMU M;  2KZS A;  1Z5A A;  3CTW B;  4DV1 M;  2XZU A;  2LHG A;  4MGZ E;  1L8Q A;  3CF2 A;  4WUR A;  1L1T A;  2CP8 A;  2QQ8 A;  3AL0 C;  1SXJ C;  1N32 M;  4JV5 M;  4JXJ A;  1IXS A;  1A5T A;  2BNK A;  2LVQ D;  2P5T A;  2R18 A;  4D80 A;  3K8Z A;  2DZN B;  4KLN A;  4CGY B;  2V6Z M;  1D0M A;  3I4V A;  3DZD A;  4AKG A;  1VEG A;  2DI0 A;  3HJS A;  2DAG A;  4NXM M;  3L27 A;  3K92 A;  4LRT A;  2RGH A;  2K9D A;  3NWL A;  2R6F A;  1D0L A;  4LJ5 A;  1P3Q Q;  1XMO M;  4Z6Y A;  3U6E A;  3B89 A;  4MH0 E;  1QUS A;  4HL4 A;  4BLC A;  3LQQ A;  4RNA A;  2XGN A;  4P17 A;  5IZ7 D;  3GPP A;  4FWD A;  4LY6 A;  3THG A;  2MRO B;  3L26 A;  4JI1 M;  4DR6 M;  2DWN A;  4D82 A;  7CAT A;  3KVW A;  4ITQ A;  1XC8 A;  2JY6 B;  1T6O A;  2YFQ A;  5C18 A;  4LF8 M;  3DA1 A;  3SHF A;  4MM3 B;  1ZQ9 A;  2LVN C;  5E6J A;  1PJT A;  2DZL A;  2ZTD A;  2XZF A;  1IN6 A;  3I04 M;  1SXJ D;  3I01 M;  1N34 M;  4BBA A;  2HHH M;  1QAO A;  2KDL A;  4FWG A;  2DNA A;  2UUC M;  3HGI A;  2CEA A;  4LFC M;  2O25 A;  2E5L M;  1R5L A;  2LNH C;  1L2C A;  4NC6 A;  1IY2 A;  2Z3X A;  4EIW A;  1HT2 E;  3U6S A;  3J7A S;  3A42 A;  1L1Z A;  1Q39 A;  2H5X A;  2M5Z A;  4YY3 M;  5KPZ A;  4JN6 A;  4DV3 M;  2Z8Y M;  2DAI A;  1VDL A;  2QPA A;  1C1K A;  1G3I A;  4B3R M;  1TDZ A;  1QUT A;  4IBJ A;  2D7E A;  3Q8X A;  4MGI E;  4IBF A;  5DNY A;  3FYD A;  2WSF F;  1NJF A;  3TWM A;  3T1H M;  5BPV A;  3KFU G;  4REZ A;  5EXP A;  1IY1 A;  3FRH A;  2F5P A;  2XEP A;  3AKZ A;  2K6B A;  1PRB A;  4JI8 M;  4XGI A;  2EUC A;  2C9O A;  4WW0 A;  2R44 A;  3LW5 F;  2MGW A;  3VFD A;  4ANR A;  4L8R C;  4IBK A;  1HJP A;  3GRV A;  1JB0 F;  1K3W A;  5FTL A;  1N75 A;  2Y21 A;  3WHK A;  2V1U A;  1DV0 A;  1OIP A;  1WXQ A;  2Y0Q A;  4LJ7 A;  4WP2 A;  2YQZ A;  4XBO A;  3J81 S;  3SAS A;  1WGL A;  1KFV A;  2CHG A;  3HU1 A;  4LF7 M;  2D7H A;  2LH0 A;  2JZ1 A;  2MJ5 B;  3KP1 E;  3VLF B;  1PJI A;  2JXN A;  1E9S A;  1AUA A;  3DOA A;  3WHL A;  2ZAM A;  4G4Q A;  1IY0 A;  4LJ6 A;  3TQS A;  4X62 M;  1HQY E;  3LVW A;  2CUZ A;  4IBE A;  2BJW A;  1X37 A;  2C5R A;  4GHL A;  3FE3 A;  4FVM A;  4DV5 M;  1TTE A;  1W5T A;  3V76 A;  4DV7 M;  3H4J A;  5L8R F;  5C1B A;  2UXC M;  2HWJ A;  4GKJ M;  3IG5 A;  1VG5 A;  3LCV B;  3JR4 A;  1IN5 A;  4CIS A;  2BWB A;  2L09 A;  2J7N A;  2RRU A;  4I5S A;  4MGY E;  3EIH A;  4NSR A;  2EJS A;  3U60 B;  2L4F A;  1QAQ A;  3HU2 A;  1QZM A;  2F5N A;  3K9O A;  2BJV A;  1TH4 A;  4FCV A;  1PJQ A;  2XFT A;  3M0E A;  4MB7 A;  2R46 A;  2XSZ A;  1GLN A;  2QHO B;  2VF7 A;  4M9X A;  3T1Y M;  1NV8 A;  4JI6 M;  3SAT A;  3U60 A;  1V92 A;  3HJ8 A;  3LQR A;  5FLX S;  3PFI A;  3FTC A;  4YHH M;  2F5Q A;  1JR3 E;  1V34 A;  1T43 A;  4NOO B;  3GLF E;  4RF1 A;  3SMS A;  3GRU A;  5EQT A;  3U6L A;  3BOS A;  4QNM A;  3ZCB B;  4LF9 M;  3VKH A;  4GKK M;  3KOW E;  5EXS A;  2CE7 A;  4IJF A;  3F92 A;  1ORY B;  3AJI B;  5KQD A;  2K47 A;  3GLH B;  2H1R A;  1QDR A;  1FNN A;  4NL4 H; 
#chains in the Genus database with same CATH homology
 3TWK A;  3KSJ A;  5JI3 E;  1QAM A;  1Z6T A;  1QQW A;  4PD2 A;  3U6O A;  2FFJ A;  2NQ8 C;  1J7K A;  2EO2 A;  2HKJ A;  1XNQ M;  1IN7 A;  1IXZ A;  2DWM A;  3VDU A;  1MX0 A;  1NNJ A;  3KW6 A;  3FUT A;  4GC9 A;  1XNR M;  2J7O A;  3A98 B;  3GLH A;  4M0D A;  4G4O A;  4DR3 M;  1L2B A;  1GKI A;  2QCU A;  3A46 A;  4QHT A;  5BR8 M;  4JI2 M;  2QP9 X;  4KHP M;  3FD9 A;  5F3W A;  1Z59 A;  1HR0 M;  3TWL A;  3KXE C;  4AKH A;  5FTN A;  4NRV A;  2CV0 A;  1GL6 A;  4A3V B;  2KEB A;  4X64 M;  3GPY A;  2W82 A;  4R7G A;  4NRW A;  3GQ5 A;  4LGM A;  4L78 A;  4M9Z A;  3H4M A;  3U5Z B;  1NVM A;  3J80 S;  4GRI A;  3GRR A;  3PVS A;  5EP4 A;  3CF0 A;  4L16 A;  2VQF M;  3CF6 E;  4LJA A;  3U6P A;  4B3S M;  2G8L A;  3L2A A;  1R2Y A;  1NY5 A;  3PNV A;  3SFZ A;  3U5Z A;  3QAU A;  4DR4 M;  5LMN M;  1H6U A;  4QOS A;  3FUW A;  4LF6 M;  4R3D A;  1QVR A;  4AW4 A;  4FCT A;  4AI6 A;  1XWI A;  4LJ4 A;  3HHX A;  1E94 E;  3UMM A;  4Z8X A;  3KS4 A;  1DGF A;  3GRY A;  4DR5 M;  3SAW A;  1NSF A;  2LWX A;  2OPF A;  4X66 M;  3KP0 E;  2DZO B;  4PT5 A;  3MJ5 A;  5DYI A;  2A5Y B;  2F5O A;  2AHM A;  3ILK A;  1I4W A;  3I51 A;  2HCB A;  1HT1 E;  4GH9 A;  2C98 A;  3LMM A;  4LJ9 A;  3SYL A;  3J7A S;  1K82 A;  1L2D A;  5ITR A;  1TH2 A;  2R4E A;  4HLQ A;  3GLF B;  3J7B A;  2KW0 A;  3FTD A;  1TGU A;  4DR1 M;  2DHR A;  1S3S A;  2KA6 B;  1OFI A;  1UM8 A;  2C96 A;  3SC3 A;  4OVZ B;  3SAV A;  1Q3B A;  4X65 M;  2ZAN A;  4DUZ M;  3T15 A;  1PM5 A;  2R65 A;  2XFS A;  4M9S A;  1MU5 A;  1JR3 A;  3K2L A;  2UUB M;  3GLF A;  2C99 A;  3PXG A;  4PDG A;  4AQY M;  1IM2 A;  2X4A A;  3TPZ A;  1N77 A;  1QYR A;  2X8A A;  3J2P B;  3RGS A;  2XSZ D;  4OVZ A;  3JAM S;  2C9C A;  3ZH9 B;  4NXN M;  2ZBK B;  2ERC A;  3HU3 A;  1T3T A;  3UK6 A;  1D2N A;  4DUY M;  4FCW A;  4LF5 M;  3D8B A;  3D8L A;  1NHG C;  1YUB A;  2QEN A;  4IIW A;  3GO8 A;  5IRE B;  4PCZ A;  3VK7 A;  3FYC A;  4DR7 M;  3VK8 A;  3W0F A;  3L25 A;  1GL7 A;  3MK6 A;  3UGJ A;  2I7N A;  3QWL A;  3ZC7 B;  2FE8 A;  3FKE A;  2O5R A;  3GPX A;  2D7G A;  4G4R A;  4JI7 M;  2DWZ B;  2F4V M;  4OX9 M;  2CHV A;  1R6B X;  4LZJ A;  1IBM M;  5DYG A;  3SBJ A;  1Q3C A;  4GIP A;  1TDH A;  2OQ4 A;  1R2Z A;  4IBD A;  4I8O A;  1R7R A;  8CAT A;  2VII A;  4LRS A;  4MGK E;  3HHY A;  4DV2 M;  1DO2 A;  1KSF X;  4B7G A;  4JI5 M;  1SXJ E;  3AFH A;  5EXX A;  1NHW C;  4G6Z A;  3M7G A;  1Z5B A;  3SHG B;  5ITQ A;  3C58 A;  1DGB A;  2L6O A;  2CV1 A;  3L29 A;  4I81 A;  1XHB A;  3SAR A;  3KOZ E;  4P16 A;  3U6Q A;  1W5S A;  1IN4 A;  2Z7J A;  2VQE M;  4M0W A;  2UXB M;  1YE9 A;  2UXD M;  4LFA M;  4GMQ A;  3VKG A;  2ZM6 M;  4LCB A;  4LFB M;  3K1J A;  1G4A E;  1XMQ M;  2QBY B;  2FNA A;  3MHV C;  5H37 D;  5ITU A;  5KO3 A;  3GP1 A;  4AZF A;  1N36 M;  2CV2 A;  1OFH A;  1G8P A;  4GHA A;  4DV4 M;  5ITY A;  2LXE A;  3AOG A;  1K3X A;  3U6D A;  2QBY A;  2KXE A;  1J09 A;  1N78 A;  4OU7 A;  3KOY E;  3HJQ A;  4IBC A;  3E9S A;  5EP3 A;  4QHS A;  3NBI A;  3AOE A;  4S12 A;  4JI3 M;  3HHW A;  4IBI A;  3SMP A;  1GVN A;  2EA0 A;  5ITT A;  3FUX A;  1DO0 A;  2KRK A;  4LJ8 A;  1LV7 A;  2QZ4 A;  3DFZ A;  3U6M A;  1I94 M;  4LF4 M;  3TL4 X;  4DR2 M;  1DGG A;  4IBB A;  2Y20 A;  3UZU A;  1IN8 A;  2I7P A;  3J27 B;  1IQP A;  1PJJ A;  1IBK M;  1HNW M;  2R4J A;  1JR3 D;  3GLG B;  2ZAO A;  3HWS A;  5JI2 E;  4KOD A;  4AG6 A;  3RGP A;  2R45 A;  1VDD A;  3RFW A;  4AG5 A;  4DV0 M;  3L28 A;  3W0L B;  5FSW A;  2Y0T A;  1N33 M;  3T38 A;  4W5W A;  5IWA M;  4JYA M;  3GLG A;  3GQ4 A;  1HNZ M;  3FTF A;  2KZU A;  5ITX A;  4RF0 A;  2FOI C;  5A2Q S;  4L4U A;  4LZZ A;  4D81 A;  3R8F A;  3GQ3 A;  4TUW A;  1YSY A;  3AV0 A;  4QNR A;  4B08 A;  2R62 A;  1G59 A;  3SYK A;  3HKP A;  4CHT B;  1HQC A;  3HHZ A;  2DXI A;  4LF9 M;  2RKO A;  1KYI A;  1FJG M;  4OW0 A;  1SXJ B;  3KDS E;  3EIE A;  4FWH A;  2G5G X;  2XF3 A;  5KPT A;  3KSX A;  4IJE A;  1EE8 A;  5EP2 A;  3U61 B;  4AKI A;  5IT9 S;  2L7I A;  4II7 A;  4GIT A;  1SXJ A;  5FTJ A;  1Z5C A;  3U6C A;  1E9R A;  3IG8 A;  3SAU A;  4FD2 A;  1XXH B;  5EJC A;  1IBL M;  1NY6 A;  2XLJ A;  4LG2 A;  3LVV A;  5EP1 A;  3A45 A;  4LGY A;  3U61 A;  3GLI B;  4MGH A;  1J5E M;  2Z4S A;  3B9P A;  4QOZ C;  3AOE C;  1TH3 A;  4PDI A;  5KQ8 A;  1XXH A;  1HNX M;  4B7H A;  5ITX E;  3KOX E;  3GLI A;  2KRU A;  4NSO B;  4L15 A;  1E32 A;  3OTO M;  3RE8 A;  4B7F A;  2HL7 A;  1NNU C;  1IXR C;  3FTE A;  3KS8 A;  3GPU A;  4KO8 A;  2RGO A;  3M6A A;  2L7H A;  2CFO A;  2X49 A;  5GKN A;  2F5S A;  4B3M M;  4B3T M;  1JQJ C;  5E26 A;  2DWL A;  1ZAE A;  3UJN A;  3VDP A;  4JI0 M;  4IBG A;  1DGH B;  1NJG A;  2Q2E B;  1G41 A;  3E4R A;  4GC5 A;  3JR5 A;  2UU9 M;  1OJL A;  5FTM A;  2DVW B;  4JI4 M;  3PNY A;  3TE6 A;  2XH9 A;  3R9X B;  4FW9 A;  4DV6 M;  4G4N A;  3FUU A;  2YR0 A;  1DGH A;  2CHQ A;  4K0K M;  3I4Y A;  2YNM D;  4I4L A;  5EXT A;  1QAN A;  3FUV A;  2JA2 A;  2Z4R A;  4BB9 A;  2M60 A;  5FTK A;  1IXS B;  4ZPX A;  2V1C A;  2UUA M;  5KPR A;  5LMU M;  2KZS A;  1Z5A A;  3CTW B;  4DV1 M;  2XZU A;  4MGZ E;  1L8Q A;  3CF2 A;  4WUR A;  1L1T A;  3AL0 C;  1SXJ C;  1N32 M;  4JV5 M;  4JXJ A;  4D80 A;  2BNK A;  2R18 A;  2P5T A;  3K8Z A;  2DZN B;  4KLN A;  4CGY B;  2V6Z M;  3I4V A;  3DZD A;  4AKG A;  3HJS A;  4NXM M;  3L27 A;  3K92 A;  4LRT A;  2RGH A;  3NWL A;  4LJ5 A;  1XMO M;  4Z6Y A;  3U6E A;  4MH0 E;  4HL4 A;  4BLC A;  3LQQ A;  4RNA A;  2XGN A;  5IZ7 D;  3GPP A;  4FWD A;  4LY6 A;  3THG A;  3L26 A;  4JI1 M;  4DR6 M;  2DWN A;  4D82 A;  7CAT A;  3KVW A;  4ITQ A;  1XC8 A;  2YFQ A;  5C18 A;  4LF8 M;  3DA1 A;  3SHF A;  4MM3 B;  1ZQ9 A;  5E6J A;  1N34 M;  2XZF A;  1IN6 A;  1SXJ D;  4BBA A;  2HHH M;  1QAO A;  4FWG A;  2UUC M;  3HGI A;  2CEA A;  4LFC M;  2E5L M;  2LNH C;  1L2C A;  1IY2 A;  2Z3X A;  4EIW A;  1HT2 E;  3U6S A;  3A42 A;  1L1Z A;  1Q39 A;  2M5Z A;  4YY3 M;  5KPZ A;  4JN6 A;  4DV3 M;  2QPA A;  1C1K A;  1G3I A;  4B3R M;  1TDZ A;  4IBJ A;  2D7E A;  3Q8X A;  4MGI E;  4IBF A;  5DNY A;  3FYD A;  3TWM A;  1NJF A;  3T1H M;  3KFU G;  5BPV A;  4REZ A;  5EXP A;  1IY1 A;  2F5P A;  2XEP A;  3AKZ A;  4JI8 M;  4XGI A;  2EUC A;  2C9O A;  4WW0 A;  4L8R C;  3VFD A;  4IBK A;  3GRV A;  1K3W A;  5FTL A;  1N75 A;  2Y21 A;  3WHK A;  2V1U A;  1WXQ A;  2Y0Q A;  4LJ7 A;  4XBO A;  3J81 S;  2YQZ A;  3SAS A;  1KFV A;  2CHG A;  3HU1 A;  4LF7 M;  2D7H A;  2LH0 A;  3VLF B;  1PJI A;  3KP1 E;  3WHL A;  1E9S A;  3DOA A;  2ZAM A;  4G4Q A;  1IY0 A;  4LJ6 A;  3TQS A;  4X62 M;  1HQY E;  3LVW A;  2CUZ A;  4IBE A;  2BJW A;  1X37 A;  2C5R A;  4GHL A;  4FVM A;  4DV5 M;  1W5T A;  4DV7 M;  5C1B A;  2UXC M;  4GKJ M;  3IG5 A;  4CIS A;  3JR4 A;  1IN5 A;  2L09 A;  2J7N A;  4I5S A;  4MGY E;  3EIH A;  4NSR A;  3U60 B;  1QAQ A;  3HU2 A;  1QZM A;  2F5N A;  2BJV A;  1TH4 A;  4FCV A;  2XFT A;  3M0E A;  4MB7 A;  2R46 A;  2XSZ A;  1GLN A;  4M9X A;  3T1Y M;  4JI6 M;  3SAT A;  3U60 A;  3HJ8 A;  3LQR A;  5FLX S;  3PFI A;  3FTC A;  4YHH M;  2F5Q A;  4NOO B;  4RF1 A;  3SMS A;  3GRU A;  5EQT A;  3U6L A;  3BOS A;  4QNM A;  3ZCB B;  3VKH A;  4GKK M;  3KOW E;  5EXS A;  2CE7 A;  4IJF A;  1ORY B;  3AJI B;  5KQD A;  2K47 A;  3GLH B;  2H1R A;  1FNN A;  4NL4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...