2KW0A

Solution structure of n-terminal domain of ccmh from escherichia.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIATDLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical properties and catalytic domain structure of the CcmH protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords CcmH protein
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kw0A00
2KW0A 2HL7A
chains in the Genus database with same CATH superfamily
2E5LM 1T6OA 1EFUB 1R2ZA 3AV0A 2KEBA 4QOSA 5EQTA 4KHPM 3A98B 3FUXA 3U61B 1OKSA 4DUYM 2QCUA 4JI7M 2JA2A 3TWKA 1G3IA 2YFQA 4P16A 2RKOA 3NBXX 3U6DA 2OOBA 2J7NA 2UUCM 3KXEC 3U6MA 5KPRA 3CTWB 2DVWB 2LXEA 1WXQA 2A5YB 3U60B 3U60A 1HNXM 7CATA 3SATA 5EJCA 2DWMA 1JR3A 5E6JA 4G6ZA 4CIZA 3C3DA 1FNNA 4B7GA 3WHKA 4DV6M 4NXMM 4LJ4A 4X66M 1HR0M 1DO2A 4IIWA 4LGYA 1QDTA 3GQ4A 3U6OA 3D8BA 4GC5A 3TQSA 2ZAOA 4DR7M 3HGIA 4S12A 3TWMA 3JR5A 3K1JA 1G4AE 3C58A 2MGWA 1HJPA 1NJFA 1TDHA 1IN8A 2DHYA 1E9RA 1ZV1A 3NWLA 3R9XB 4MGZE 5EXPA 4M9SA 3U61A 2R44A 1YSYA 1D0KA 2LNHC 3MK6A 4LF5M 4JI5M 2KDLA 4BB9A 2D7EA 3W67A 1OAOC 1V34A 3GPUA 1GLNA 2FOIC 1QAQA 2CUZA 4JI8M 2OQ4A 1QZEA 4FCTA 2G8LA 2EJSA 3SAVA 3HU3A 3TWLA 4LJ9A 2MR9A 1ZMUA 5DFLA 2UUAM 3RGPA 4LJ7A 4GKJM 2DHRA 3QWLA 3GLFA 4JI6M 1GJTA 3HU1A 3GO8A 3KS4A 1P3QQ 2LVQD 5IT9S 3ZH9B 3B9PA 1SXJD 1NY6A 4D82A 3IHPA 4MB7A 4QNRA 3AOGA 1BVSA 3VKHA 2Y20A 5KPTA 1NJGA 3M6AA 1JR3E 1IY2A 5DYIA 2P5TA 4BBAA 4I5SA 3K8ZA 3UJNA 1IY0A 4DV1M 2JZ1A 5ITQA 4IBBA 3C9PA 4YHHM 2RGOA 4IBGA 1IBLM 3KDSE 1F4IA 2DWZB 1XHBA 5ITYA 3T6PA 3GLHB 3T1YM 2CV0A 5FTKA 2CV1A 4JN6A 1WHCA 4L78A 4LFAM 1XMOM 4DBGB 4GHLA 3DOAA 3THGA 1LV7A 4MGKE 1GJSA 1S3SA 4PT5A 5FSWA 1NHGC 2X49A 4LZZA 2O25A 3KOZE 4GITA 4LJ8A 1K82A 3HHXA 2DAGA 3IECA 5IZ7D 3HHWA 2JNHA 4WURA 1R2YA 1Q02A 3HKPA 1ZQ9A 4D80A 3QYEA 2UUBM 4R3DA 4D81A 1NO1A 4LF4M 5A2QS 1YLAA 1SXJE 2JXNA 1V33A 2L2DA 3SHFA 1WR1B 1XB2B 2ZANA 1IBMM 4JV5M 3A46A 2QQ8A 2XSZA 4DUZM 1IN4A 4HEOA 4X64M 1NVMA 4G4RA 3GRVA 2WZJA 3KP0E 4NSOB 4B7FA 2G5GX 3FUUA 5LMUM 3EIHA 1MN3A 1YE9A 4NRWA 2AHMA 1KSFX 3LQQA 3W0FA 2X4AA 2XEPA 2QHOB 4XGIA 3GPXA 4JYAM 1TF0B 4RKUF 3FTDA 3MMPA 3VLFB 3FE3A 4IJFA 3L29A 4MGYE 2OO9A 4QHTA 3PFIA 1V92A 1QANA 2WSCF 5ITXE 1Q3CA 4NSRA 1AUAA 3L28A 2O01F 1HQYE 2XFTA 4B3TM 4KLNA 2APLA 1EE8A 4IBCA 2NQ8C 1E94E 2HL7A 3GLIA 4JI2M 3H4MA 2L4FA 2XF3A 2KNVA 4REZA 3J7BA 5EXSA 4M0WA 2CV2A 3FTCA 3TL4X 2UXCM 1IY1A 5ITTA 1GKIA 1Z5CA 3SAWA 2DWLA 4JI0M 4AI6A 3KS8A 2VDBB 4B08A 2DNAA 4GRIA 4AG6A 4AQYM 3RGSA 2D7HA 1WIVA 4PDIA 2C5RA 1JQJC 3C3EA 4TUWA 4DV2M 5EP1A 1E32A 1GVNA 1ORYB 2JZ0A 4GEWA 3QAUA 3E9SA 2DI0A 3W68A 1GABA 1TR8A 4DR6M 1RU3A 3BXWA 4AW4A 1L8QA 4FWDA 1SG9A 4NC6A 2R62A 4CGYB 4MH0E 3Q8XA 4Z8XA 4JI4M 5KQDA 2VQEM 3HX3A 2DZLA 2KW0A 3SFZA 3LVVA 3MJ5A 5H37D 2F5NA 1PRBA 3AFHA 1PJQA 1IXZA 3R8FA 1VDLA 4LF9M 1ZMWA 2OOAA 4FD2A 3GLIE 1NV9A 3LCVB 3KOYE 8CATA 3JR4A 1I94M 2EA0A 1IN7A 2JUJA 2BNKA 1DO0A 3B7NA 3E21A 2HAKA 2ZM6M 2R46A 3U6PA 5ITXA 3GLFB 2R45A 3GPYA 4F1IA 2YQZA 4OW0A 3ZQJA 1TTEA 1PJSA 2C9OA 1G71A 1R4GA 2C99A 4RF1A 1J5EM 1WGNA 1A5TA 2DWNA 2BWEA 4K0KM 2JWSA 3V76A 2LHCA 1R5LA 3I4VA 1OIZA 2R65A 4BLCA 3HHYA 4JI1M 1T43A 4QNMA 4IBDA 3FUTA 2DXIA 4R71A 3L2AA 1FJGM 1ZMVA 2KXEA 2N35A 2KZSA 2BJVA 3CGWA 3A45A 3GLGE 1PJIA 4YY3M 1IN5A 2MJ5B 3DA1A 2R6FA 3T1HM 4IBEA 2KZUA 2Y0QA 3GRYA 3AL0C 3T15A 4ITQA 3PNVA 3J80S 4M9ZA 1D2NA 3VKGA 5FTJA 1SXJA 4DR1M 1K3XA 3Q8GA 1VEJA 3UZUA 1XXHA 3I01M 5EXXA 1EIJA 2H1RA 3KOXE 3PVSA 2OPFA 2HWJA 3FYCA 4Y28F 3HWSA 2FH0A 2LH0A 3HJSA 2F5PA 1Z5BA 4R7GA 4L15A 1H6UA 2CHQA 4EIWA 2Q2EB 3GLHA 1QUTA 3GQ3A 3JAMS 2QBYB 3LQRA 3KFUG 2RRUA 1XXHB 4JXJA 1OFIA 1VDDA 4LRTA 2FNAA 2G3QA 1DGHB 4UN2B 3AJIB 2F5OA 1VQ1A 3PXGA 1DGGA 1OQYA 1Z59A 4B3SM 3K2LA 3KP1E 2V1UA 3RFWA 2Z3XA 3IG8A 2LTUA 3GLGB 1IXSB 1TH2A 3U6CA 1IXSA 4GC9A 3SC3A 1W5TA 2VIIA 4NXNM 2M60A 3KSXA 2HCBA 3U6EA 4NRVA 4ZPXA 2R4JA 3VK7A 2F5QA 1QAOA 3LVWA 1J09A 2EKFA 4LF7M 2Z7JA 1GO5A 2F4VM 5IWAM 2JP7A 3FYDA 3SASA 1D0MA 2XSZD 4L4UA 4AKIA 2EUCA 2Y0TA 3GLFE 4FWGA 2FS1A 3B7QA 3K92A 2HKJA 4GIPA 4Z6YA 4M9XA 1PJTA 5EP2A 4LJ6A 2BWBA 1VEGA 4OVZB 1HQCA 3NBIA 3FTEA 4A3VB 1NSFA 1WJ7A 2XH9A 3L25A 3SAUA 1IXRC 4B3RM 2V6ZM 5KQ8A 2ZBKB 3SARA 1N77A 4CISA 2LVNC 2ZTDA 4CHTB 1XMQM 1Q3BA 1KYIA 3B7ZA 3DZDA 3ILKA 4F2LA 1PM5A 1HT2E 1R6BX 3DFZA 3ZCBB 1G59A 2X8AA 2FE8A 4LY6A 1J7KA 4LJAA 5ITRA 3MHVC 2WSFF 3KSJA 4FCWA 2QZ4A 1N75A 3M0EA 4LJ5A 4KO8A 1XXHE 2LVPC 2Y21A 1NNJA 2UU9M 3U6LA 1HNWM 4FCVA 4AKHA 1IQPA 4DV0M 3A42A 4AKGA 2MROB 1JR3D 3U5ZB 4DV4M 3I04M 2GQFA 4LF6M 2DZNB 4OVZA 2YNMD 3UGJA 2KHHA 2FFJA 3AOEC 4I8OA 3GP1A 3U6QA 1WGLA 3WHLA 3FUWA 2CP8A 1L2CA 3CF2A 3IG5A 3QYBA 2JY8A 1HT1E 3J7AS 2CEAA 3HJQA 4X62M 4GH9A 4PCZA 4G3OA 1I4WA 4IBFA 3VDUA 2Z4RA 3K9OA 4WP2A 2Z4SA 2L7IA 4L6V6 4KODA 4AG5A 2LVAA 1GL6A 1OJLA 3J81S 1E9SA 2QPAA 5EP3A 2DENA 2JY5A 1NV8A 2CRUA 2L7HA 1W5SA 2C98A 5FTNA 2DKLA 4AZFA 4PD2A 1N78A 4DR3M 4XK8F 1Y8GA 2ZAMA 3PNYA 2L09A 2VQFM 2R18A 2LVOC 4FWHA 3OTOM 4DV7M 4QHSA 4HLQA 1IN6A 3FKEA 3U6SA 1QZMA 1K3WA 2V1CA 2CE7A 3HHZA 1N36M 2EKKA 1QYRA 1QVRA 4XBOA 3BBZA 1LTMA 2MH8A 4ANRA 4CJ6A 1Q39A 4GMQA 3FRHA 1IFYA 2UXDM 2K0BX 2GNOA 1L1TA 3LMMA 2WSEF 1AIPC 5EP4A 5JI3E 1SXJB 1OTRA 5FLXS 2B3TA 1TDZA 1Z5AA 1R7RA 3VFDA 3GLGA 4LF8M 2K6BA 1VG5A 2L4EA 2VF8A 2DAIA 2JY7A 3SMSA 1UM8A 2CFOA 4W5WA 2I7NA 4IJEA 4II7A 5E26A 3VDPA 5IREB 2M5ZA 4NOOB 3SBJA 4LG2A 3GLIB 1ZAEA 1IBKM 3W0LB 2KNAA 3HZJA 1XWIA 3FUVA 2I7PA 3B89A 3I51A 2K47A 4IBJA 1DGBA 1YUBA 4GHAA 5L8RF 5F3WA 2UXBM 1KFVA 3EIEA 2R0IA 3KOWE 2F5SA 1CUKA 1DGHA 2KRKA 3GLHE 4MGHA 3RE8A 2XZUA 4DR4M 4LZJA 2QP9X 3UMMA 1Z6TA 2YR0A 2XFSA 4IBIA 4DR5M 4QOZC 2L6OA 2BJWA 5ITUA 1DV0A 2QBYA 4LGMA 1QUSA 5DYGA 3CF6E 4RNAA 5BPVA 3TPZA 2QENA 5EXTA 1C7YA 3FD9A 4OU7A 2K9DA 4RF0A 2RGHA 1QAMA 3H4JA 3GRRA 5BR8M 4FVMA 5JI2E 4OX9M 3J2PB 1XNQM 2CHGA 3HY5A 1HNZM 1X37A 3B74A 5LMNM 5C1BA 3LW5F 4L16A 2QNJA 2XGNA 2HHHM 2LWXA 3SYKA 5DNYA 3J27B 1C1KA 3T38A 2KRUA 5KPZA 4LRSA 2H5XA 3SYLA 4GKKM 1PGYA 3D8LA 1QQWA 1OFHA 2ERCA 2D7GA 1L2DA 2CHVA 3I4YA 1N32M 3E46A 3SHGB 3ZC7B 1NY5A 3AKZA 4NL4H 5KO3A 4G4NA 2EO2A 3M7GA 1MX0A 4MM3B 2CWBA 2W82A 1JB0F 4I4LA 5C18A 4X65M 4IBKA 1NHWC 3KW6A 1VEKA 4P17A 3UK6A 2XZFA 1IM2A 2KNZA 3AOEA 1G41A 2J5YA 4M0DA 2QSFX 3FRIA 3KVWA 1TGUA 1GL7A 4L8RC 2Z8YM 3GQ5A 1NNUC 3F92A 3FTFA 3CF0A 1D0LA 1G8PA 5FTMA 2LHGA 4DV5M 4G4OA 4FW9A 3L26A 4DR2M 2DAMA 2XLJA 1QDRA 3LCUA 2LBCA 3TE6A 1L2BA 2J7OA 3K9PA 1N34M 1OIPA 2JY6B 2VF7A 4MGIE 4LCBA 1T3TA 3L27A 2DAKA 2C9CA 1MJGM 1SXJC 2O5RA 3GPPA 3E4RA 4PDGA 4B3MM 2C96A 4DV3M 4WW0A 4Q7JA 1PJJA 1XC8A 2KA6B 5GKNA 2R4EA 4B7HA 4I81A 4LFCM 4KT0F 1MU5A 1N33M 2DAEA 3SMPA 4G4QA 1OAIA 2DZOB 3HJ8A 2ZTCA 3VK8A 1TH4A 3BOSA 1TH3A 5FTLA 1L1ZA 4LFBM 1UFZA 3GRUA 3HU2A 1DGFA 4HL4A 4JI3M 3U5ZA 1XNRM
chains in the Genus database with same CATH topology
2E5LM 1R2ZA 3AV0A 2KEBA 4QOSA 5EQTA 4KHPM 3A98B 3FUXA 3U61B 4DUYM 2QCUA 4JI7M 2JA2A 3TWKA 1G3IA 2YFQA 4P16A 2RKOA 3U6DA 2J7NA 2UUCM 3KXEC 3U6MA 5KPRA 3CTWB 2DVWB 2LXEA 1WXQA 2A5YB 3U60B 3U60A 1HNXM 7CATA 3SATA 5EJCA 2DWMA 1JR3A 5E6JA 4G6ZA 1FNNA 4B7GA 3WHKA 4DV6M 4NXMM 4LJ4A 4X66M 1HR0M 1DO2A 4IIWA 4LGYA 3GQ4A 3U6OA 3D8BA 4GC5A 3TQSA 2ZAOA 4DR7M 3HGIA 4S12A 3TWMA 3JR5A 3K1JA 1G4AE 3C58A 1TDHA 1NJFA 3NWLA 1IN8A 1E9RA 3R9XB 4MGZE 5EXPA 4M9SA 3U61A 1YSYA 2LNHC 3MK6A 4LF5M 4JI5M 4BB9A 2D7EA 3GPUA 1GLNA 2FOIC 1QAQA 2CUZA 4JI8M 2OQ4A 4FCTA 2G8LA 3SAVA 3HU3A 3TWLA 4LJ9A 2UUAM 3RGPA 4LJ7A 4GKJM 2DHRA 3QWLA 3GLFA 4JI6M 3GO8A 3HU1A 3KS4A 5IT9S 3ZH9B 3B9PA 1SXJD 1NY6A 4D82A 4MB7A 4QNRA 3AOGA 3VKHA 2Y20A 5KPTA 1NJGA 3M6AA 5DYIA 1IY2A 4BBAA 2P5TA 3UJNA 4I5SA 3K8ZA 1IY0A 4DV1M 5ITQA 4IBBA 4YHHM 2RGOA 4IBGA 1IBLM 3KDSE 2DWZB 1XHBA 5ITYA 3GLHB 3T1YM 2CV0A 5FTKA 2CV1A 4JN6A 4L78A 1XMOM 4LFAM 4GHLA 3DOAA 3THGA 1LV7A 4MGKE 1S3SA 4PT5A 5FSWA 1NHGC 2X49A 4LZZA 3KOZE 4GITA 4LJ8A 1K82A 3HHXA 5IZ7D 3HHWA 4WURA 1R2YA 3HKPA 1ZQ9A 4D80A 2UUBM 4R3DA 4D81A 4LF4M 5A2QS 1SXJE 3SHFA 2ZANA 1IBMM 4JV5M 3A46A 4DUZM 2XSZA 1IN4A 4X64M 1NVMA 4G4RA 3GRVA 3KP0E 4NSOB 4B7FA 5LMUM 2G5GX 3FUUA 3EIHA 1YE9A 4NRWA 2AHMA 1KSFX 3LQQA 3W0FA 2X4AA 2XEPA 4XGIA 3GPXA 4JYAM 3FTDA 3VLFB 4IJFA 3L29A 4MGYE 4QHTA 3PFIA 1QANA 5ITXE 1Q3CA 4NSRA 3L28A 1HQYE 2XFTA 4B3TM 4KLNA 1EE8A 4IBCA 2NQ8C 1E94E 2HL7A 3GLIA 4JI2M 3H4MA 2XF3A 4REZA 3J7BA 5EXSA 4M0WA 2CV2A 3FTCA 3TL4X 2UXCM 1IY1A 5ITTA 1GKIA 1Z5CA 3SAWA 2DWLA 4JI0M 4AI6A 3KS8A 4B08A 4GRIA 4AG6A 4AQYM 3RGSA 2D7HA 4PDIA 2C5RA 1JQJC 4TUWA 4DV2M 5EP1A 1E32A 1GVNA 1ORYB 3QAUA 3E9SA 4DR6M 4AW4A 1L8QA 4FWDA 2R62A 4CGYB 4MH0E 3Q8XA 4Z8XA 4JI4M 5KQDA 2VQEM 2F5NA 2KW0A 3SFZA 5H37D 3LVVA 3MJ5A 3AFHA 1IXZA 3R8FA 4LF9M 4FD2A 3KOYE 8CATA 3JR4A 1I94M 2EA0A 1IN7A 2BNKA 1DO0A 2ZM6M 2R46A 3U6PA 5ITXA 3GLFB 2R45A 3GPYA 2YQZA 4OW0A 2C99A 2C9OA 4RF1A 4K0KM 1J5EM 2DWNA 3I4VA 2R65A 4BLCA 3HHYA 4JI1M 4QNMA 4IBDA 3FUTA 2DXIA 3L2AA 1FJGM 2KXEA 2KZSA 2BJVA 3A45A 1PJIA 4YY3M 1IN5A 3DA1A 3T1HM 4IBEA 2KZUA 2Y0QA 3GRYA 3AL0C 3T15A 4ITQA 3PNVA 3J80S 4M9ZA 1D2NA 3VKGA 5FTJA 1SXJA 4DR1M 1K3XA 3UZUA 1XXHA 5EXXA 2H1RA 3KOXE 3PVSA 2OPFA 3FYCA 3HWSA 3HJSA 2LH0A 2F5PA 1Z5BA 4R7GA 4L15A 1H6UA 2CHQA 4EIWA 2Q2EB 3GLHA 3GQ3A 3JAMS 2QBYB 3LQRA 3KFUG 1XXHB 4JXJA 1OFIA 1VDDA 4LRTA 2FNAA 1DGHB 2F5OA 3AJIB 3PXGA 1DGGA 1Z59A 4B3SM 3K2LA 3KP1E 2V1UA 3RFWA 2Z3XA 3IG8A 3GLGB 1IXSB 1TH2A 3U6CA 4GC9A 3SC3A 1W5TA 2VIIA 4NXNM 2M60A 3KSXA 2HCBA 3U6EA 4NRVA 4ZPXA 2R4JA 3VK7A 2F5QA 1QAOA 3LVWA 1J09A 4LF7M 2Z7JA 2F4VM 5IWAM 3FYDA 3SASA 2XSZD 4L4UA 4AKIA 2EUCA 2Y0TA 4FWGA 3K92A 4Z6YA 2HKJA 4GIPA 4M9XA 5EP2A 4LJ6A 3FTEA 4OVZB 1HQCA 3NBIA 4A3VB 1NSFA 2XH9A 3L25A 3SAUA 1IXRC 4B3RM 2V6ZM 5KQ8A 2ZBKB 3SARA 1N77A 4CISA 4CHTB 1XMQM 1Q3BA 1KYIA 3ILKA 3DZDA 1PM5A 1G59A 1HT2E 1R6BX 3DFZA 3ZCBB 2X8AA 2FE8A 4LY6A 1J7KA 4LJAA 5ITRA 3MHVC 3KSJA 4FCWA 3M0EA 1N75A 2QZ4A 4LJ5A 4KO8A 2Y21A 1NNJA 2UU9M 3U6LA 1HNWM 4FCVA 4AKHA 1IQPA 4DV0M 3A42A 4AKGA 1JR3D 3U5ZB 4DV4M 4LF6M 2DZNB 4OVZA 2YNMD 3UGJA 2FFJA 3AOEC 4I8OA 3GP1A 3U6QA 3WHLA 3FUWA 1L2CA 3CF2A 3IG5A 1HT1E 3J7AS 2CEAA 3HJQA 4X62M 4GH9A 4PCZA 1I4WA 4IBFA 3VDUA 2Z4RA 2Z4SA 2L7IA 4KODA 4AG5A 1GL6A 1OJLA 3J81S 1E9SA 2QPAA 5EP3A 2L7HA 1W5SA 2C98A 5FTNA 4AZFA 4PD2A 1N78A 4DR3M 2ZAMA 3PNYA 2L09A 2VQFM 2R18A 4FWHA 3OTOM 4DV7M 4QHSA 4HLQA 1IN6A 3FKEA 3U6SA 1QZMA 1K3WA 2V1CA 2CE7A 3HHZA 1N36M 1QYRA 1QVRA 4XBOA 1Q39A 4GMQA 2UXDM 1L1TA 3LMMA 5EP4A 5JI3E 1SXJB 5FLXS 1TDZA 1Z5AA 1R7RA 3VFDA 3GLGA 4LF8M 3SMSA 1UM8A 2CFOA 4W5WA 2I7NA 4IJEA 4II7A 5E26A 3VDPA 5IREB 2M5ZA 4NOOB 3SBJA 4LG2A 3GLIB 1ZAEA 1IBKM 3W0LB 1XWIA 3FUVA 2I7PA 3I51A 2K47A 4IBJA 1DGBA 1YUBA 4GHAA 5F3WA 2UXBM 1KFVA 3EIEA 3KOWE 2F5SA 1DGHA 4MGHA 2KRKA 3RE8A 2XZUA 4DR4M 4LZJA 2QP9X 3UMMA 1Z6TA 2YR0A 2XFSA 4IBIA 4DR5M 4QOZC 2L6OA 2BJWA 5ITUA 2QBYA 4LGMA 5DYGA 5BPVA 3CF6E 4RNAA 3TPZA 2QENA 5EXTA 3FD9A 4OU7A 4RF0A 2RGHA 1QAMA 3GRRA 5BR8M 4FVMA 5JI2E 4OX9M 3J2PB 1XNQM 2CHGA 1HNZM 1X37A 5LMNM 5C1BA 4L16A 2XGNA 2HHHM 2LWXA 3SYKA 5DNYA 3J27B 1C1KA 3T38A 2KRUA 5KPZA 4LRSA 4GKKM 3SYLA 3D8LA 1QQWA 1OFHA 2ERCA 2D7GA 1L2DA 2CHVA 3I4YA 1N32M 3SHGB 3ZC7B 1NY5A 3AKZA 4NL4H 5KO3A 4G4NA 2EO2A 3M7GA 1MX0A 4MM3B 4I4LA 2W82A 5C18A 4X65M 4IBKA 1NHWC 3KW6A 3UK6A 2XZFA 1IM2A 3AOEA 1G41A 4M0DA 3KVWA 1TGUA 1GL7A 4L8RC 3GQ5A 1NNUC 3FTFA 3CF0A 5FTMA 1G8PA 4G4OA 4DV5M 4FW9A 3L26A 4DR2M 2XLJA 3TE6A 1L2BA 2J7OA 1N34M 4MGIE 4LCBA 1T3TA 3L27A 2C9CA 1SXJC 2O5RA 3GPPA 3E4RA 4PDGA 4B3MM 2C96A 4DV3M 4WW0A 1PJJA 1XC8A 2KA6B 5GKNA 2R4EA 4B7HA 4I81A 4LFCM 1MU5A 1N33M 3SMPA 4G4QA 2DZOB 3HJ8A 3VK8A 1TH4A 3BOSA 1TH3A 5FTLA 1L1ZA 4LFBM 3GRUA 3HU2A 1DGFA 4HL4A 4JI3M 3U5ZA 1XNRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW0 A;  2HL7 A; 
#chains in the Genus database with same CATH topology
 2E5L M;  1T6O A;  1EFU B;  1R2Z A;  3AV0 A;  2KEB A;  4QOS A;  5EQT A;  4KHP M;  3A98 B;  3FUX A;  3U61 B;  1OKS A;  4DUY M;  2QCU A;  4JI7 M;  2JA2 A;  3TWK A;  1G3I A;  2YFQ A;  4P16 A;  2RKO A;  3NBX X;  3U6D A;  2OOB A;  2J7N A;  2UUC M;  3KXE C;  3U6M A;  5KPR A;  3CTW B;  2DVW B;  2LXE A;  1WXQ A;  2A5Y B;  3U60 B;  3U60 A;  1HNX M;  7CAT A;  3SAT A;  5EJC A;  2DWM A;  1JR3 A;  5E6J A;  4G6Z A;  4CIZ A;  3C3D A;  1FNN A;  4B7G A;  3WHK A;  4DV6 M;  4NXM M;  4LJ4 A;  4X66 M;  1HR0 M;  1DO2 A;  4IIW A;  4LGY A;  1QDT A;  3GQ4 A;  3U6O A;  3D8B A;  4GC5 A;  3TQS A;  2ZAO A;  4DR7 M;  3HGI A;  4S12 A;  3TWM A;  3JR5 A;  3K1J A;  1G4A E;  3C58 A;  2MGW A;  1HJP A;  1NJF A;  1TDH A;  1IN8 A;  2DHY A;  1E9R A;  1ZV1 A;  3NWL A;  3R9X B;  4MGZ E;  5EXP A;  4M9S A;  3U61 A;  2R44 A;  1YSY A;  1D0K A;  2LNH C;  3MK6 A;  4LF5 M;  4JI5 M;  2KDL A;  4BB9 A;  2D7E A;  3W67 A;  1OAO C;  1V34 A;  3GPU A;  1GLN A;  2FOI C;  1QAQ A;  2CUZ A;  4JI8 M;  2OQ4 A;  1QZE A;  4FCT A;  2G8L A;  2EJS A;  3SAV A;  3HU3 A;  3TWL A;  4LJ9 A;  2MR9 A;  1ZMU A;  5DFL A;  2UUA M;  3RGP A;  4LJ7 A;  4GKJ M;  2DHR A;  3QWL A;  3GLF A;  4JI6 M;  1GJT A;  3HU1 A;  3GO8 A;  3KS4 A;  1P3Q Q;  2LVQ D;  5IT9 S;  3ZH9 B;  3B9P A;  1SXJ D;  1NY6 A;  4D82 A;  3IHP A;  4MB7 A;  4QNR A;  3AOG A;  1BVS A;  3VKH A;  2Y20 A;  5KPT A;  1NJG A;  3M6A A;  1JR3 E;  1IY2 A;  5DYI A;  2P5T A;  4BBA A;  4I5S A;  3K8Z A;  3UJN A;  1IY0 A;  4DV1 M;  2JZ1 A;  5ITQ A;  4IBB A;  3C9P A;  4YHH M;  2RGO A;  4IBG A;  1IBL M;  3KDS E;  1F4I A;  2DWZ B;  1XHB A;  5ITY A;  3T6P A;  3GLH B;  3T1Y M;  2CV0 A;  5FTK A;  2CV1 A;  4JN6 A;  1WHC A;  4L78 A;  4LFA M;  1XMO M;  4DBG B;  4GHL A;  3DOA A;  3THG A;  1LV7 A;  4MGK E;  1GJS A;  1S3S A;  4PT5 A;  5FSW A;  1NHG C;  2X49 A;  4LZZ A;  2O25 A;  3KOZ E;  4GIT A;  4LJ8 A;  1K82 A;  3HHX A;  2DAG A;  3IEC A;  5IZ7 D;  3HHW A;  2JNH A;  4WUR A;  1R2Y A;  1Q02 A;  3HKP A;  1ZQ9 A;  4D80 A;  3QYE A;  2UUB M;  4R3D A;  4D81 A;  1NO1 A;  4LF4 M;  5A2Q S;  1YLA A;  1SXJ E;  2JXN A;  1V33 A;  2L2D A;  3SHF A;  1WR1 B;  1XB2 B;  2ZAN A;  1IBM M;  4JV5 M;  3A46 A;  2QQ8 A;  2XSZ A;  4DUZ M;  1IN4 A;  4HEO A;  4X64 M;  1NVM A;  4G4R A;  3GRV A;  2WZJ A;  3KP0 E;  4NSO B;  4B7F A;  2G5G X;  3FUU A;  5LMU M;  3EIH A;  1MN3 A;  1YE9 A;  4NRW A;  2AHM A;  1KSF X;  3LQQ A;  3W0F A;  2X4A A;  2XEP A;  2QHO B;  4XGI A;  3GPX A;  4JYA M;  1TF0 B;  4RKU F;  3FTD A;  3MMP A;  3VLF B;  3FE3 A;  4IJF A;  3L29 A;  4MGY E;  2OO9 A;  4QHT A;  3PFI A;  1V92 A;  1QAN A;  2WSC F;  5ITX E;  1Q3C A;  4NSR A;  1AUA A;  3L28 A;  2O01 F;  1HQY E;  2XFT A;  4B3T M;  4KLN A;  2APL A;  1EE8 A;  4IBC A;  2NQ8 C;  1E94 E;  2HL7 A;  3GLI A;  4JI2 M;  3H4M A;  2L4F A;  2XF3 A;  2KNV A;  4REZ A;  3J7B A;  5EXS A;  4M0W A;  2CV2 A;  3FTC A;  3TL4 X;  2UXC M;  1IY1 A;  5ITT A;  1GKI A;  1Z5C A;  3SAW A;  2DWL A;  4JI0 M;  4AI6 A;  3KS8 A;  2VDB B;  4B08 A;  2DNA A;  4GRI A;  4AG6 A;  4AQY M;  3RGS A;  2D7H A;  1WIV A;  4PDI A;  2C5R A;  1JQJ C;  3C3E A;  4TUW A;  4DV2 M;  5EP1 A;  1E32 A;  1GVN A;  1ORY B;  2JZ0 A;  4GEW A;  3QAU A;  3E9S A;  2DI0 A;  3W68 A;  1GAB A;  1TR8 A;  4DR6 M;  1RU3 A;  3BXW A;  4AW4 A;  1L8Q A;  4FWD A;  1SG9 A;  4NC6 A;  2R62 A;  4CGY B;  4MH0 E;  3Q8X A;  4Z8X A;  4JI4 M;  5KQD A;  2VQE M;  3HX3 A;  2DZL A;  2KW0 A;  3SFZ A;  3LVV A;  3MJ5 A;  5H37 D;  2F5N A;  1PRB A;  3AFH A;  1PJQ A;  1IXZ A;  3R8F A;  1VDL A;  4LF9 M;  1ZMW A;  2OOA A;  4FD2 A;  3GLI E;  1NV9 A;  3LCV B;  3KOY E;  8CAT A;  3JR4 A;  1I94 M;  2EA0 A;  1IN7 A;  2JUJ A;  2BNK A;  1DO0 A;  3B7N A;  3E21 A;  2HAK A;  2ZM6 M;  2R46 A;  3U6P A;  5ITX A;  3GLF B;  2R45 A;  3GPY A;  4F1I A;  2YQZ A;  4OW0 A;  3ZQJ A;  1TTE A;  1PJS A;  2C9O A;  1G71 A;  1R4G A;  2C99 A;  4RF1 A;  1J5E M;  1WGN A;  1A5T A;  2DWN A;  2BWE A;  4K0K M;  2JWS A;  3V76 A;  2LHC A;  1R5L A;  3I4V A;  1OIZ A;  2R65 A;  4BLC A;  3HHY A;  4JI1 M;  1T43 A;  4QNM A;  4IBD A;  3FUT A;  2DXI A;  4R71 A;  3L2A A;  1FJG M;  1ZMV A;  2KXE A;  2N35 A;  2KZS A;  2BJV A;  3CGW A;  3A45 A;  3GLG E;  1PJI A;  4YY3 M;  1IN5 A;  2MJ5 B;  3DA1 A;  2R6F A;  3T1H M;  4IBE A;  2KZU A;  2Y0Q A;  3GRY A;  3AL0 C;  3T15 A;  4ITQ A;  3PNV A;  3J80 S;  4M9Z A;  1D2N A;  3VKG A;  5FTJ A;  1SXJ A;  4DR1 M;  1K3X A;  3Q8G A;  1VEJ A;  3UZU A;  1XXH A;  3I01 M;  5EXX A;  1EIJ A;  2H1R A;  3KOX E;  3PVS A;  2OPF A;  2HWJ A;  3FYC A;  4Y28 F;  3HWS A;  2FH0 A;  2LH0 A;  3HJS A;  2F5P A;  1Z5B A;  4R7G A;  4L15 A;  1H6U A;  2CHQ A;  4EIW A;  2Q2E B;  3GLH A;  1QUT A;  3GQ3 A;  3JAM S;  2QBY B;  3LQR A;  3KFU G;  2RRU A;  1XXH B;  4JXJ A;  1OFI A;  1VDD A;  4LRT A;  2FNA A;  2G3Q A;  1DGH B;  4UN2 B;  3AJI B;  2F5O A;  1VQ1 A;  3PXG A;  1DGG A;  1OQY A;  1Z59 A;  4B3S M;  3K2L A;  3KP1 E;  2V1U A;  3RFW A;  2Z3X A;  3IG8 A;  2LTU A;  3GLG B;  1IXS B;  1TH2 A;  3U6C A;  1IXS A;  4GC9 A;  3SC3 A;  1W5T A;  2VII A;  4NXN M;  2M60 A;  3KSX A;  2HCB A;  3U6E A;  4NRV A;  4ZPX A;  2R4J A;  3VK7 A;  2F5Q A;  1QAO A;  3LVW A;  1J09 A;  2EKF A;  4LF7 M;  2Z7J A;  1GO5 A;  2F4V M;  5IWA M;  2JP7 A;  3FYD A;  3SAS A;  1D0M A;  2XSZ D;  4L4U A;  4AKI A;  2EUC A;  2Y0T A;  3GLF E;  4FWG A;  2FS1 A;  3B7Q A;  3K92 A;  2HKJ A;  4GIP A;  4Z6Y A;  4M9X A;  1PJT A;  5EP2 A;  4LJ6 A;  2BWB A;  1VEG A;  4OVZ B;  1HQC A;  3NBI A;  3FTE A;  4A3V B;  1NSF A;  1WJ7 A;  2XH9 A;  3L25 A;  3SAU A;  1IXR C;  4B3R M;  2V6Z M;  5KQ8 A;  2ZBK B;  3SAR A;  1N77 A;  4CIS A;  2LVN C;  2ZTD A;  4CHT B;  1XMQ M;  1Q3B A;  1KYI A;  3B7Z A;  3DZD A;  3ILK A;  4F2L A;  1PM5 A;  1HT2 E;  1R6B X;  3DFZ A;  3ZCB B;  1G59 A;  2X8A A;  2FE8 A;  4LY6 A;  1J7K A;  4LJA A;  5ITR A;  3MHV C;  2WSF F;  3KSJ A;  4FCW A;  2QZ4 A;  1N75 A;  3M0E A;  4LJ5 A;  4KO8 A;  1XXH E;  2LVP C;  2Y21 A;  1NNJ A;  2UU9 M;  3U6L A;  1HNW M;  4FCV A;  4AKH A;  1IQP A;  4DV0 M;  3A42 A;  4AKG A;  2MRO B;  1JR3 D;  3U5Z B;  4DV4 M;  3I04 M;  2GQF A;  4LF6 M;  2DZN B;  4OVZ A;  2YNM D;  3UGJ A;  2KHH A;  2FFJ A;  3AOE C;  4I8O A;  3GP1 A;  3U6Q A;  1WGL A;  3WHL A;  3FUW A;  2CP8 A;  1L2C A;  3CF2 A;  3IG5 A;  3QYB A;  2JY8 A;  1HT1 E;  3J7A S;  2CEA A;  3HJQ A;  4X62 M;  4GH9 A;  4PCZ A;  4G3O A;  1I4W A;  4IBF A;  3VDU A;  2Z4R A;  3K9O A;  4WP2 A;  2Z4S A;  2L7I A;  4L6V 6;  4KOD A;  4AG5 A;  2LVA A;  1GL6 A;  1OJL A;  3J81 S;  1E9S A;  2QPA A;  5EP3 A;  2DEN A;  2JY5 A;  1NV8 A;  2CRU A;  2L7H A;  1W5S A;  2C98 A;  5FTN A;  2DKL A;  4AZF A;  4PD2 A;  1N78 A;  4DR3 M;  4XK8 F;  1Y8G A;  2ZAM A;  3PNY A;  2L09 A;  2VQF M;  2R18 A;  2LVO C;  4FWH A;  3OTO M;  4DV7 M;  4QHS A;  4HLQ A;  1IN6 A;  3FKE A;  3U6S A;  1QZM A;  1K3W A;  2V1C A;  2CE7 A;  3HHZ A;  1N36 M;  2EKK A;  1QYR A;  1QVR A;  4XBO A;  3BBZ A;  1LTM A;  2MH8 A;  4ANR A;  4CJ6 A;  1Q39 A;  4GMQ A;  3FRH A;  1IFY A;  2UXD M;  2K0B X;  2GNO A;  1L1T A;  3LMM A;  2WSE F;  1AIP C;  5EP4 A;  5JI3 E;  1SXJ B;  1OTR A;  5FLX S;  2B3T A;  1TDZ A;  1Z5A A;  1R7R A;  3VFD A;  3GLG A;  4LF8 M;  2K6B A;  1VG5 A;  2L4E A;  2VF8 A;  2DAI A;  2JY7 A;  3SMS A;  1UM8 A;  2CFO A;  4W5W A;  2I7N A;  4IJE A;  4II7 A;  5E26 A;  3VDP A;  5IRE B;  2M5Z A;  4NOO B;  3SBJ A;  4LG2 A;  3GLI B;  1ZAE A;  1IBK M;  3W0L B;  2KNA A;  3HZJ A;  1XWI A;  3FUV A;  2I7P A;  3B89 A;  3I51 A;  2K47 A;  4IBJ A;  1DGB A;  1YUB A;  4GHA A;  5L8R F;  5F3W A;  2UXB M;  1KFV A;  3EIE A;  2R0I A;  3KOW E;  2F5S A;  1CUK A;  1DGH A;  2KRK A;  3GLH E;  4MGH A;  3RE8 A;  2XZU A;  4DR4 M;  4LZJ A;  2QP9 X;  3UMM A;  1Z6T A;  2YR0 A;  2XFS A;  4IBI A;  4DR5 M;  4QOZ C;  2L6O A;  2BJW A;  5ITU A;  1DV0 A;  2QBY A;  4LGM A;  1QUS A;  5DYG A;  3CF6 E;  4RNA A;  5BPV A;  3TPZ A;  2QEN A;  5EXT A;  1C7Y A;  3FD9 A;  4OU7 A;  2K9D A;  4RF0 A;  2RGH A;  1QAM A;  3H4J A;  3GRR A;  5BR8 M;  4FVM A;  5JI2 E;  4OX9 M;  3J2P B;  1XNQ M;  2CHG A;  3HY5 A;  1HNZ M;  1X37 A;  3B74 A;  5LMN M;  5C1B A;  3LW5 F;  4L16 A;  2QNJ A;  2XGN A;  2HHH M;  2LWX A;  3SYK A;  5DNY A;  3J27 B;  1C1K A;  3T38 A;  2KRU A;  5KPZ A;  4LRS A;  2H5X A;  3SYL A;  4GKK M;  1PGY A;  3D8L A;  1QQW A;  1OFH A;  2ERC A;  2D7G A;  1L2D A;  2CHV A;  3I4Y A;  1N32 M;  3E46 A;  3SHG B;  3ZC7 B;  1NY5 A;  3AKZ A;  4NL4 H;  5KO3 A;  4G4N A;  2EO2 A;  3M7G A;  1MX0 A;  4MM3 B;  2CWB A;  2W82 A;  1JB0 F;  4I4L A;  5C18 A;  4X65 M;  4IBK A;  1NHW C;  3KW6 A;  1VEK A;  4P17 A;  3UK6 A;  2XZF A;  1IM2 A;  2KNZ A;  3AOE A;  1G41 A;  2J5Y A;  4M0D A;  2QSF X;  3FRI A;  3KVW A;  1TGU A;  1GL7 A;  4L8R C;  2Z8Y M;  3GQ5 A;  1NNU C;  3F92 A;  3FTF A;  3CF0 A;  1D0L A;  1G8P A;  5FTM A;  2LHG A;  4DV5 M;  4G4O A;  4FW9 A;  3L26 A;  4DR2 M;  2DAM A;  2XLJ A;  1QDR A;  3LCU A;  2LBC A;  3TE6 A;  1L2B A;  2J7O A;  3K9P A;  1N34 M;  1OIP A;  2JY6 B;  2VF7 A;  4MGI E;  4LCB A;  1T3T A;  3L27 A;  2DAK A;  2C9C A;  1MJG M;  1SXJ C;  2O5R A;  3GPP A;  3E4R A;  4PDG A;  4B3M M;  2C96 A;  4DV3 M;  4WW0 A;  4Q7J A;  1PJJ A;  1XC8 A;  2KA6 B;  5GKN A;  2R4E A;  4B7H A;  4I81 A;  4LFC M;  4KT0 F;  1MU5 A;  1N33 M;  2DAE A;  3SMP A;  4G4Q A;  1OAI A;  2DZO B;  3HJ8 A;  2ZTC A;  3VK8 A;  1TH4 A;  3BOS A;  1TH3 A;  5FTL A;  1L1Z A;  4LFB M;  1UFZ A;  3GRU A;  3HU2 A;  1DGF A;  4HL4 A;  4JI3 M;  3U5Z A;  1XNR M; 
#chains in the Genus database with same CATH homology
 2E5L M;  1R2Z A;  3AV0 A;  2KEB A;  4QOS A;  5EQT A;  4KHP M;  3A98 B;  3FUX A;  3U61 B;  4DUY M;  2QCU A;  4JI7 M;  2JA2 A;  3TWK A;  1G3I A;  2YFQ A;  4P16 A;  2RKO A;  3U6D A;  2J7N A;  2UUC M;  3KXE C;  3U6M A;  5KPR A;  3CTW B;  2DVW B;  2LXE A;  1WXQ A;  2A5Y B;  3U60 B;  3U60 A;  1HNX M;  7CAT A;  3SAT A;  5EJC A;  2DWM A;  1JR3 A;  5E6J A;  4G6Z A;  1FNN A;  4B7G A;  3WHK A;  4DV6 M;  4NXM M;  4LJ4 A;  4X66 M;  1HR0 M;  1DO2 A;  4IIW A;  4LGY A;  3GQ4 A;  3U6O A;  3D8B A;  4GC5 A;  3TQS A;  2ZAO A;  4DR7 M;  3HGI A;  4S12 A;  3TWM A;  3JR5 A;  3K1J A;  1G4A E;  3C58 A;  1TDH A;  1NJF A;  3NWL A;  1IN8 A;  1E9R A;  3R9X B;  4MGZ E;  5EXP A;  4M9S A;  3U61 A;  1YSY A;  2LNH C;  3MK6 A;  4LF5 M;  4JI5 M;  4BB9 A;  2D7E A;  3GPU A;  1GLN A;  2FOI C;  1QAQ A;  2CUZ A;  4JI8 M;  2OQ4 A;  4FCT A;  2G8L A;  3SAV A;  3HU3 A;  3TWL A;  4LJ9 A;  2UUA M;  3RGP A;  4LJ7 A;  4GKJ M;  2DHR A;  3QWL A;  3GLF A;  4JI6 M;  3GO8 A;  3HU1 A;  3KS4 A;  5IT9 S;  3ZH9 B;  3B9P A;  1SXJ D;  1NY6 A;  4D82 A;  4MB7 A;  4QNR A;  3AOG A;  3VKH A;  2Y20 A;  5KPT A;  1NJG A;  3M6A A;  5DYI A;  1IY2 A;  4BBA A;  2P5T A;  3UJN A;  4I5S A;  3K8Z A;  1IY0 A;  4DV1 M;  5ITQ A;  4IBB A;  4YHH M;  2RGO A;  4IBG A;  1IBL M;  3KDS E;  2DWZ B;  1XHB A;  5ITY A;  3GLH B;  3T1Y M;  2CV0 A;  5FTK A;  2CV1 A;  4JN6 A;  4L78 A;  1XMO M;  4LFA M;  4GHL A;  3DOA A;  3THG A;  1LV7 A;  4MGK E;  1S3S A;  4PT5 A;  5FSW A;  1NHG C;  2X49 A;  4LZZ A;  3KOZ E;  4GIT A;  4LJ8 A;  1K82 A;  3HHX A;  5IZ7 D;  3HHW A;  4WUR A;  1R2Y A;  3HKP A;  1ZQ9 A;  4D80 A;  2UUB M;  4R3D A;  4D81 A;  4LF4 M;  5A2Q S;  1SXJ E;  3SHF A;  2ZAN A;  1IBM M;  4JV5 M;  3A46 A;  4DUZ M;  2XSZ A;  1IN4 A;  4X64 M;  1NVM A;  4G4R A;  3GRV A;  3KP0 E;  4NSO B;  4B7F A;  5LMU M;  2G5G X;  3FUU A;  3EIH A;  1YE9 A;  4NRW A;  2AHM A;  1KSF X;  3LQQ A;  3W0F A;  2X4A A;  2XEP A;  4XGI A;  3GPX A;  4JYA M;  3FTD A;  3VLF B;  4IJF A;  3L29 A;  4MGY E;  4QHT A;  3PFI A;  1QAN A;  5ITX E;  1Q3C A;  4NSR A;  3L28 A;  1HQY E;  2XFT A;  4B3T M;  4KLN A;  1EE8 A;  4IBC A;  2NQ8 C;  1E94 E;  2HL7 A;  3GLI A;  4JI2 M;  3H4M A;  2XF3 A;  4REZ A;  3J7B A;  5EXS A;  4M0W A;  2CV2 A;  3FTC A;  3TL4 X;  2UXC M;  1IY1 A;  5ITT A;  1GKI A;  1Z5C A;  3SAW A;  2DWL A;  4JI0 M;  4AI6 A;  3KS8 A;  4B08 A;  4GRI A;  4AG6 A;  4AQY M;  3RGS A;  2D7H A;  4PDI A;  2C5R A;  1JQJ C;  4TUW A;  4DV2 M;  5EP1 A;  1E32 A;  1GVN A;  1ORY B;  3QAU A;  3E9S A;  4DR6 M;  4AW4 A;  1L8Q A;  4FWD A;  2R62 A;  4CGY B;  4MH0 E;  3Q8X A;  4Z8X A;  4JI4 M;  5KQD A;  2VQE M;  2F5N A;  2KW0 A;  3SFZ A;  5H37 D;  3LVV A;  3MJ5 A;  3AFH A;  1IXZ A;  3R8F A;  4LF9 M;  4FD2 A;  3KOY E;  8CAT A;  3JR4 A;  1I94 M;  2EA0 A;  1IN7 A;  2BNK A;  1DO0 A;  2ZM6 M;  2R46 A;  3U6P A;  5ITX A;  3GLF B;  2R45 A;  3GPY A;  2YQZ A;  4OW0 A;  2C99 A;  2C9O A;  4RF1 A;  4K0K M;  1J5E M;  2DWN A;  3I4V A;  2R65 A;  4BLC A;  3HHY A;  4JI1 M;  4QNM A;  4IBD A;  3FUT A;  2DXI A;  3L2A A;  1FJG M;  2KXE A;  2KZS A;  2BJV A;  3A45 A;  1PJI A;  4YY3 M;  1IN5 A;  3DA1 A;  3T1H M;  4IBE A;  2KZU A;  2Y0Q A;  3GRY A;  3AL0 C;  3T15 A;  4ITQ A;  3PNV A;  3J80 S;  4M9Z A;  1D2N A;  3VKG A;  5FTJ A;  1SXJ A;  4DR1 M;  1K3X A;  3UZU A;  1XXH A;  5EXX A;  2H1R A;  3KOX E;  3PVS A;  2OPF A;  3FYC A;  3HWS A;  3HJS A;  2LH0 A;  2F5P A;  1Z5B A;  4R7G A;  4L15 A;  1H6U A;  2CHQ A;  4EIW A;  2Q2E B;  3GLH A;  3GQ3 A;  3JAM S;  2QBY B;  3LQR A;  3KFU G;  1XXH B;  4JXJ A;  1OFI A;  1VDD A;  4LRT A;  2FNA A;  1DGH B;  2F5O A;  3AJI B;  3PXG A;  1DGG A;  1Z59 A;  4B3S M;  3K2L A;  3KP1 E;  2V1U A;  3RFW A;  2Z3X A;  3IG8 A;  3GLG B;  1IXS B;  1TH2 A;  3U6C A;  4GC9 A;  3SC3 A;  1W5T A;  2VII A;  4NXN M;  2M60 A;  3KSX A;  2HCB A;  3U6E A;  4NRV A;  4ZPX A;  2R4J A;  3VK7 A;  2F5Q A;  1QAO A;  3LVW A;  1J09 A;  4LF7 M;  2Z7J A;  2F4V M;  5IWA M;  3FYD A;  3SAS A;  2XSZ D;  4L4U A;  4AKI A;  2EUC A;  2Y0T A;  4FWG A;  3K92 A;  4Z6Y A;  2HKJ A;  4GIP A;  4M9X A;  5EP2 A;  4LJ6 A;  3FTE A;  4OVZ B;  1HQC A;  3NBI A;  4A3V B;  1NSF A;  2XH9 A;  3L25 A;  3SAU A;  1IXR C;  4B3R M;  2V6Z M;  5KQ8 A;  2ZBK B;  3SAR A;  1N77 A;  4CIS A;  4CHT B;  1XMQ M;  1Q3B A;  1KYI A;  3ILK A;  3DZD A;  1PM5 A;  1G59 A;  1HT2 E;  1R6B X;  3DFZ A;  3ZCB B;  2X8A A;  2FE8 A;  4LY6 A;  1J7K A;  4LJA A;  5ITR A;  3MHV C;  3KSJ A;  4FCW A;  3M0E A;  1N75 A;  2QZ4 A;  4LJ5 A;  4KO8 A;  2Y21 A;  1NNJ A;  2UU9 M;  3U6L A;  1HNW M;  4FCV A;  4AKH A;  1IQP A;  4DV0 M;  3A42 A;  4AKG A;  1JR3 D;  3U5Z B;  4DV4 M;  4LF6 M;  2DZN B;  4OVZ A;  2YNM D;  3UGJ A;  2FFJ A;  3AOE C;  4I8O A;  3GP1 A;  3U6Q A;  3WHL A;  3FUW A;  1L2C A;  3CF2 A;  3IG5 A;  1HT1 E;  3J7A S;  2CEA A;  3HJQ A;  4X62 M;  4GH9 A;  4PCZ A;  1I4W A;  4IBF A;  3VDU A;  2Z4R A;  2Z4S A;  2L7I A;  4KOD A;  4AG5 A;  1GL6 A;  1OJL A;  3J81 S;  1E9S A;  2QPA A;  5EP3 A;  2L7H A;  1W5S A;  2C98 A;  5FTN A;  4AZF A;  4PD2 A;  1N78 A;  4DR3 M;  2ZAM A;  3PNY A;  2L09 A;  2VQF M;  2R18 A;  4FWH A;  3OTO M;  4DV7 M;  4QHS A;  4HLQ A;  1IN6 A;  3FKE A;  3U6S A;  1QZM A;  1K3W A;  2V1C A;  2CE7 A;  3HHZ A;  1N36 M;  1QYR A;  1QVR A;  4XBO A;  1Q39 A;  4GMQ A;  2UXD M;  1L1T A;  3LMM A;  5EP4 A;  5JI3 E;  1SXJ B;  5FLX S;  1TDZ A;  1Z5A A;  1R7R A;  3VFD A;  3GLG A;  4LF8 M;  3SMS A;  1UM8 A;  2CFO A;  4W5W A;  2I7N A;  4IJE A;  4II7 A;  5E26 A;  3VDP A;  5IRE B;  2M5Z A;  4NOO B;  3SBJ A;  4LG2 A;  3GLI B;  1ZAE A;  1IBK M;  3W0L B;  1XWI A;  3FUV A;  2I7P A;  3I51 A;  2K47 A;  4IBJ A;  1DGB A;  1YUB A;  4GHA A;  5F3W A;  2UXB M;  1KFV A;  3EIE A;  3KOW E;  2F5S A;  1DGH A;  4MGH A;  2KRK A;  3RE8 A;  2XZU A;  4DR4 M;  4LZJ A;  2QP9 X;  3UMM A;  1Z6T A;  2YR0 A;  2XFS A;  4IBI A;  4DR5 M;  4QOZ C;  2L6O A;  2BJW A;  5ITU A;  2QBY A;  4LGM A;  5DYG A;  5BPV A;  3CF6 E;  4RNA A;  3TPZ A;  2QEN A;  5EXT A;  3FD9 A;  4OU7 A;  4RF0 A;  2RGH A;  1QAM A;  3GRR A;  5BR8 M;  4FVM A;  5JI2 E;  4OX9 M;  3J2P B;  1XNQ M;  2CHG A;  1HNZ M;  1X37 A;  5LMN M;  5C1B A;  4L16 A;  2XGN A;  2HHH M;  2LWX A;  3SYK A;  5DNY A;  3J27 B;  1C1K A;  3T38 A;  2KRU A;  5KPZ A;  4LRS A;  4GKK M;  3SYL A;  3D8L A;  1QQW A;  1OFH A;  2ERC A;  2D7G A;  1L2D A;  2CHV A;  3I4Y A;  1N32 M;  3SHG B;  3ZC7 B;  1NY5 A;  3AKZ A;  4NL4 H;  5KO3 A;  4G4N A;  2EO2 A;  3M7G A;  1MX0 A;  4MM3 B;  4I4L A;  2W82 A;  5C18 A;  4X65 M;  4IBK A;  1NHW C;  3KW6 A;  3UK6 A;  2XZF A;  1IM2 A;  3AOE A;  1G41 A;  4M0D A;  3KVW A;  1TGU A;  1GL7 A;  4L8R C;  3GQ5 A;  1NNU C;  3FTF A;  3CF0 A;  5FTM A;  1G8P A;  4G4O A;  4DV5 M;  4FW9 A;  3L26 A;  4DR2 M;  2XLJ A;  3TE6 A;  1L2B A;  2J7O A;  1N34 M;  4MGI E;  4LCB A;  1T3T A;  3L27 A;  2C9C A;  1SXJ C;  2O5R A;  3GPP A;  3E4R A;  4PDG A;  4B3M M;  2C96 A;  4DV3 M;  4WW0 A;  1PJJ A;  1XC8 A;  2KA6 B;  5GKN A;  2R4E A;  4B7H A;  4I81 A;  4LFC M;  1MU5 A;  1N33 M;  3SMP A;  4G4Q A;  2DZO B;  3HJ8 A;  3VK8 A;  1TH4 A;  3BOS A;  1TH3 A;  5FTL A;  1L1Z A;  4LFB M;  3GRU A;  3HU2 A;  1DGF A;  4HL4 A;  4JI3 M;  3U5Z A;  1XNR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...