2KW0A

Solution structure of n-terminal domain of ccmh from escherichia.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'TIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIATDLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcmH protein
publication title Biochemical properties and catalytic domain structure of the CcmH protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kw0A00
2HL7A 2KW0A
chains in the Genus database with same CATH superfamily
2EO2A 4WURA 2YNMD 2Y0TA 1OKSA 4DR4M 2K47A 1PM5A 3ILKA 1NHWC 2RKOA 4RKUF 4A3VB 4LGMA 1XMOM 5KO3A 3HGIA 3GLHB 2KZUA 2CUZA 1D2NA 2VDBB 3L25A 1R6BX 2A5YB 2VF7A 3U6CA 2KRUA 4F1IA 2C98A 4QNMA 2DNAA 1C1KA 5FTJA 1DGBA 4NSOB 3A45A 3ZCBB 3J27B 3J81S 1QDRA 3DFZA 1JR3D 5F3WA 2C96A 1K3WA 3VDUA 2J7OA 4R3DA 2O5RA 4CJ6A 1K3XA 2YR0A 1N77A 1ZMUA 1DGFA 3M6AA 5A2QS 5IZ7D 4CIZA 3T6PA 3MHVC 1ORYB 1HNWM 2V6ZM 4II7A 4GHAA 4FCVA 2XGNA 1HT1E 3LCVB 3HHWA 2QCUA 3Q8XA 1HNXM 3LMMA 1QANA 4FVMA 1JB0F 1NVMA 2QPAA 4I5SA 4IBEA 2E5LM 2KXEA 1TR8A 1W5TA 2KNZA 3K1JA 4L4UA 4I4LA 4LJ5A 3VLFB 2ERCA 2ZAMA 3B7QA 2G3QA 4BBAA 3KFUG 3EIHA 1RU3A 2W82A 4MH0E 4D82A 4GC9A 3J2PB 1IY1A 4HEOA 2DAKA 1IN7A 3GLIB 2H1RA 3AOEC 1WHCA 3SAWA 3QYEA 3U6EA 2XSZA 2VQFM 4D81A 4B3TM 2UUBM 4L8RC 4IBIA 1X37A 3Q8GA 5C1BA 5EXSA 3VK7A 1FNNA 1KYIA 1Z5BA 2DWZB 1S3SA 3JAMS 4MGIE 7CATA 1IBKM 1OAOC 2KW0A 3ZC7B 4MGZE 4AKGA 1DGHA 1JQJC 3W0FA 4G4QA 4MB7A 3SMPA 1K82A 3V76A 3GLFA 2J5YA 3C9PA 3I4VA 4JI0M 4IBGA 1ZAEA 1HQCA 4GHLA 2RGHA 3FUUA 4QOZC 2DWMA 1QAOA 1C7YA 4M0DA 1UM8A 1DO2A 3I04M 2FH0A 4LJAA 3ZH9B 2WSCF 4LJ9A 2N35A 3U6PA 4KLNA 3HHYA 1L1ZA 2XFTA 2DI0A 1J09A 1IM2A 2QHOB 2X8AA 1XXHE 4DV6M 3SYKA 3KOXE 4NXNM 1YUBA 2Y21A 3C3DA 2LVAA 2CHVA 2HWJA 2OQ4A 4IJFA 2H5XA 4D80A 1NHGC 2FOIC 3D8LA 3SFZA 4L15A 5E6JA 2GNOA 3QAUA 4NSRA 1MX0A 2DZNB 4P17A 3U61A 3R9XB 2B3TA 1SXJE 2Y20A 2WSEF 1IY2A 4AG6A 1IN5A 2EUCA 2CV1A 3DA1A 3E4RA 4IBJA 4BLCA 3KS8A 1EIJA 1NY5A 3FKEA 4HLQA 4CGYB 1WIVA 3UMMA 2G8LA 2KHHA 3E9SA 4XK8F 3T1HM 3FE3A 1G41A 1J7KA 3B89A 1OAIA 3KW6A 3HHXA 4LJ4A 3FRHA 2EA0A 3GO8A 4R71A 4AW4A 3AFHA 4IBCA 3GRVA 1TF0B 4MGYE 1EFUB 2GQFA 4NOOB 1IXRC 4DUYM 4B7HA 1OIPA 1XC8A 2K0BX 2XF3A 4JYAM 4DBGB 4JV5M 2DKLA 3C3EA 2Y0QA 2CHQA 3QWLA 3B7ZA 1NNUC 2DZLA 3T38A 1WR1B 2QBYB 3OTOM 3BOSA 1TGUA 4GH9A 2DAGA 5EP4A 4LF9M 1EE8A 3J80S 4LFAM 5KQDA 4LG2A 3L28A 1VEGA 2LVPC 1D0MA 3K2LA 3RFWA 2LNHC 3TWMA 4ANRA 2L2DA 3GRYA 1FJGM 1GABA 4DR3M 1UFZA 2FFJA 3PVSA 3UJNA 3SBJA 2DVWB 1OFHA 4EIWA 5EP2A 4X65M 2CV0A 5FTLA 2JP7A 1XXHA 2HAKA 4FWHA 4LGYA 3DZDA 1R2ZA 3I51A 2X49A 3HU2A 5H37D 5LMNM 2OOBA 4AKIA 2L4FA 2BWBA 2V1CA 1IXSA 4X66M 2P5TA 2O25A 4PDIA 4DV5M 1VDDA 3U6DA 1GO5A 3VKHA 1G8PA 4AI6A 5BR8M 2HCBA 5ITTA 3U5ZA 3U6OA 4KT0F 4M0WA 1NY6A 2D7GA 2VQEM 3L27A 4REZA 4B3SM 1IBMM 3GPXA 1R7RA 1SXJA 3W0LB 1WGNA 3L29A 4B3RM 2LXEA 4YY3M 3CTWB 2DAEA 3I4YA 4M9XA 3T15A 1NV9A 1PJSA 3I01M 5FSWA 4DR2M 5KPRA 1T6OA 1Z5CA 3KVWA 2C9CA 5DYGA 2R45A 1G71A 1D0KA 5JI2E 3T1YM 4OU7A 3UGJA 1V33A 1QZMA 1Z59A 5FLXS 2ZM6M 1ZQ9A 2MJ5B 1H6UA 4IBBA 1PJQA 3KP1E 4QHSA 3SMSA 3KDSE 3W68A 3TL4X 1WJ7A 2JA2A 4NRVA 5FTKA 1XHBA 3E21A 3A46A 1L2CA 2J7NA 3KXEC 1GJTA 5EXTA 2DAMA 1Q3CA 2FS1A 2D7HA 1I4WA 3CF6E 1R4GA 5EXPA 4DV1M 1VG5A 3VFDA 2DZOB 4FD2A 1N36M 1G4AE 3J7AS 3LQQA 4FWGA 4G6ZA 4JI7M 4NXMM 5IWAM 3SARA 4JI5M 4GEWA 3NBXX 1QZEA 1TH2A 2I7NA 2JZ0A 3BXWA 3K8ZA 1E9RA 3TE6A 3M7GA 3TQSA 1NV8A 2V1UA 3HY5A 3GRRA 1Q3BA 2G5GX 3GLIE 3B7NA 1V92A 4L6V6 3K9OA 2VF8A 3HWSA 4Y28F 2DHRA 4JN6A 1DV0A 2KDLA 3U60B 3FUVA 4OVZA 1Y8GA 3AKZA 2CWBA 1F4IA 2AHMA 1VDLA 1L1TA 2LTUA 4KODA 1T43A 1TTEA 2LBCA 3SASA 2Z8YM 4F2LA 4PD2A 1LV7A 1L2BA 3GQ3A 4KO8A 1HJPA 1L8QA 3M0EA 4AZFA 1ZMVA 2BJVA 3HJ8A 3HU3A 4MGKE 4RF1A 4LF8M 2L4EA 1TDHA 4GIPA 3KOWE 2VIIA 4PDGA 4X62M 1OIZA 3DOAA 3VDPA 5BPVA 4MGHA 5IREB 1GKIA 2KEBA 2EJSA 4M9ZA 2DXIA 3KSJA 4FCTA 1SXJC 1BVSA 4R7GA 3MK6A 1D0LA 1TH3A 2BJWA 1GL6A 3NWLA 3GLHA 3L26A 3GPUA 3U5ZB 2QZ4A 3IHPA 3HKPA 5DYIA 1NNJA 2CV2A 2UXCM 4IJEA 1L2DA 2KRKA 1ZV1A 2D7EA 2OO9A 2FE8A 2JZ1A 2XH9A 3PXGA 5DNYA 4WW0A 1QQWA 3BBZA 2QP9X 4L78A 3K9PA 2L7HA 2BWEA 2JY6B 4JI2M 1AIPC 1OQYA 4IBFA 3RE8A 2JY5A 2Z3XA 4I81A 3UK6A 2UUAM 2HL7A 3IECA 3GPYA 4ITQA 4ZPXA 2JNHA 2L7IA 1V34A 2Z4RA 4M9SA 4G4RA 2R4EA 1NJFA 3KOZE 1JR3A 4IIWA 5C18A 1MJGM 2XSZD 4LFBM 4W5WA 3SAUA 1HR0M 1N33M 5ITQA 4JI4M 3NBIA 3HJSA 2KA6B 2RGOA 3CGWA 3KS4A 3TWKA 3SATA 1YLAA 1CUKA 3HU1A 3GLIA 3B9PA 4XBOA 4RNAA 3HHZA 4NC6A 3CF2A 4GMQA 2L6OA 4DUZM 3U6MA 1DGHB 4QHTA 1OFIA 2QNJA 4AKHA 4UN2B 3FTEA 3GLFB 1GLNA 2CEAA 4LY6A 2LHCA 2XEPA 3WHKA 3AV0A 3GLGE 2QSFX 4BB9A 2LVNC 1W5SA 2R0IA 4OVZB 1A5TA 1XWIA 5L8RF 3U6SA 2HKJA 4DR1M 4L16A 5GKNA 1GJSA 4MM3B 2F5SA 2DHYA 4GITA 3FUTA 1R2YA 3SHFA 2EKFA 1HNZM 2K6BA 3E46A 2O01F 1GL7A 1NJGA 3PNYA 1QVRA 2OPFA 2L09A 4IBDA 3FYDA 4IBKA 4GC5A 3LVVA 4DV2M 1I94M 3FRIA 3LW5F 3GLHE 1HT2E 3JR5A 5ITXA 2CP8A 4JI3M 4CHTB 3HZJA 2YFQA 5KPTA 3U61B 2OOAA 5KQ8A 4G3OA 1VEKA 2R62A 4QOSA 5FTNA 3JR4A 1YSYA 1WGLA 4DR7M 2UXBM 1IY0A 1QAMA 4LF5M 1XMQM 3EIEA 1NO1A 1AUAA 4JI6M 3B74A 3UZUA 1PGYA 4LJ7A 3J7BA 3C58A 4LFCM 4AQYM 2F5QA 4LCBA 2BNKA 2X4AA 2MR9A 2ZTDA 1N34M 1JR3E 1XNQM 2DAIA 3PFIA 1QUTA 3SC3A 8CATA 4AG5A 2Z4SA 1OTRA 4X64M 3SAVA 2F5NA 3LVWA 3D8BA 2Z7JA 2LVQD 5ITUA 1IN4A 1DGGA 3WHLA 3R8FA 4WP2A 4DV7M 4CISA 3MMPA 2JXNA 4LZZA 3RGSA 1Z6TA 5EXXA 3GQ5A 2FNAA 4DV4M 2UU9M 2QENA 4OW0A 3SHGB 3U6QA 3FD9A 2ZBKB 4PT5A 2JY7A 2C9OA 2CRUA 1QUSA 4DV0M 2QBYA 3AJIB 3U6LA 4DR6M 4LJ8A 1PJJA 4FW9A 1N75A 5EP3A 1YE9A 5ITYA 1PJTA 2KNVA 1QYRA 3MJ5A 3KP0E 4S12A 4NRWA 1VQ1A 4FCWA 1GVNA 1R5LA 3GLGA 4Q7JA 3QYBA 3H4MA 3FUXA 3KSXA 3RGPA 4LF6M 5KPZA 5EJCA 2ZTCA 3SYLA 2JWSA 5E26A 1IN6A 1QAQA 3GPPA 1LTMA 1XXHB 3FTCA 2K9DA 3LQRA 4PCZA 3GP1A 2F5PA 3A98B 4QNRA 1MU5A 4G4NA 3A42A 1IXSB 5LMUM 1SXJD 4JI8M 2DWNA 4JI1M 2UXDM 1E32A 4DR5M 4P16A 2KNAA 2MH8A 2ZANA 4B08A 1HQYE 3FUWA 3H4JA 5ITXE 2F4VM 3IG8A 4KHPM 2ZAOA 1SXJB 2LVOC 2CFOA 1QDTA 1VEJA 3FYCA 4LRTA 2DENA 2WSFF 2Q2EB 2C99A 1IN8A 4NL4H 3W67A 2MROB 3THGA 5JI3E 2UUCM 4B7GA 1TH4A 4B3MM 2CHGA 4LZJA 5DFLA 4Z8XA 4B7FA 2R6FA 2KZSA 1TDZA 4OX9M 1MN3A 2I7PA 1G3IA 1PJIA 1G59A 2JY8A 3HJQA 1E9SA 2WZJA 2YQZA 2EKKA 3KOYE 4LRSA 1XNRM 3K92A 2HHHM 1Q02A 3TWLA 1IXZA 4GKKM 1IQPA 5FTMA 4G4OA 1KFVA 3TPZA 5IT9S 2R46A 4HL4A 4XGIA 3F92A 3ZQJA 2M60A 3VK8A 1P3QQ 2JUJA 4RF0A 2M5ZA 2XZUA 3AL0C 3VKGA 3FTDA 1OJLA 2CE7A 4DV3M 4LF4M 1SG9A 4I8OA 2XFSA 1DO0A 4Z6YA 1IBLM 1Z5AA 3LCUA 2DWLA 3L2AA 2XLJA 1WXQA 1KSFX 1IFYA 3AOEA 4FWDA 3AOGA 2R65A 1J5EM 4LF7M 4K0KM 2APLA 4TUWA 1E94E 4LJ6A 5EP1A 3GQ4A 2R44A 2LHGA 2QQ8A 3U60A 4GRIA 3HX3A 1N78A 1NSFA 3GLGB 4GKJM 3FTFA 5ITRA 3GLFE 4JXJA 2R18A 1XB2B 5EQTA 1ZMWA 1Q39A 2RRUA 2LWXA 3PNVA 2XZFA 2F5OA 1PRBA 2R4JA 3GRUA 4YHHM 2C5RA 1N32M 3IG5A 2LH0A 2NQ8C 2MGWA 1T3TA 3CF0A
chains in the Genus database with same CATH topology
2EO2A 4WURA 2YNMD 2Y0TA 4DR4M 2K47A 1PM5A 3ILKA 1NHWC 2RKOA 4A3VB 4LGMA 1XMOM 5KO3A 3HGIA 3GLHB 2KZUA 2CUZA 1D2NA 3L25A 1R6BX 2A5YB 3U6CA 2KRUA 2C98A 4QNMA 1C1KA 5FTJA 1DGBA 4NSOB 3A45A 3ZCBB 3J27B 3J81S 3DFZA 1JR3D 5F3WA 2C96A 1K3WA 3VDUA 2J7OA 4R3DA 2O5RA 1K3XA 2YR0A 1N77A 1DGFA 3M6AA 5A2QS 5IZ7D 3MHVC 1ORYB 1HNWM 2V6ZM 4II7A 4GHAA 4FCVA 2XGNA 1HT1E 3HHWA 2QCUA 3Q8XA 1HNXM 3LMMA 1QANA 4FVMA 2QPAA 1NVMA 4I5SA 2E5LM 4IBEA 4B3RM 2KXEA 1W5TA 4L4UA 4LJ5A 3K1JA 3VLFB 4I4LA 4BBAA 2ERCA 2ZAMA 3KFUG 3EIHA 2W82A 4MH0E 4D82A 4GC9A 3J2PB 1IY1A 1IN7A 3GLIB 2H1RA 3AOEC 3SAWA 3U6EA 4L8RC 2XSZA 2VQFM 4D81A 4B3TM 2UUBM 4IBIA 1X37A 5C1BA 3VK7A 5EXSA 1FNNA 1KYIA 1Z5BA 2DWZB 1S3SA 3JAMS 4MGIE 7CATA 1IBKM 2KW0A 3ZC7B 4MGZE 4AKGA 1DGHA 1JQJC 3W0FA 4G4QA 4MB7A 3SMPA 1K82A 3GLFA 4JI0M 3I4VA 4IBGA 1ZAEA 1HQCA 4GHLA 2RGHA 3FUUA 4QOZC 2DWMA 1QAOA 4M0DA 1UM8A 1DO2A 4LJAA 3ZH9B 4LJ9A 3U6PA 4KLNA 3HHYA 1L1ZA 2XFTA 1J09A 1IM2A 2X8AA 4DV6M 3SYKA 3KOXE 4NXNM 1YUBA 2Y21A 2CHVA 2OQ4A 4IJFA 4D80A 1NHGC 2FOIC 3D8LA 3SFZA 4L15A 5E6JA 3QAUA 4NSRA 1MX0A 2DZNB 3R9XB 3U61A 1SXJE 2Y20A 1IY2A 4AG6A 1IN5A 2EUCA 2CV1A 3DA1A 3E4RA 4IBJA 4BLCA 3KS8A 1NY5A 3FKEA 4HLQA 4CGYB 4LF9M 3UMMA 2G8LA 3E9SA 3T1HM 1G41A 1J7KA 3KW6A 3HHXA 4LJ4A 2EA0A 3GO8A 4AW4A 3AFHA 4IBCA 3GRVA 4MGYE 4NOOB 1IXRC 4DUYM 4B7HA 1XC8A 2XF3A 4JYAM 4JV5M 2Y0QA 2CHQA 3QWLA 1NNUC 3T38A 2QBYB 3OTOM 3BOSA 1TGUA 4GH9A 5EP4A 1EE8A 3J80S 4LFAM 5KQDA 4LG2A 3L28A 3K2LA 3RFWA 2LNHC 3TWMA 3GRYA 1FJGM 4DR3M 2FFJA 3PVSA 3UJNA 3SBJA 2DVWB 1OFHA 4EIWA 5EP2A 4X65M 2CV0A 5FTLA 1XXHA 4FWHA 4LGYA 3DZDA 1R2ZA 3I51A 2X49A 3HU2A 5H37D 5LMNM 2V1CA 4X66M 2P5TA 3U6DA 4PDIA 4DV5M 1VDDA 3VKHA 1G8PA 4AI6A 5BR8M 2HCBA 5ITTA 3U5ZA 3U6OA 4M0WA 2VQEM 1NY6A 2D7GA 4B3SM 3L27A 4REZA 1IBMM 3GPXA 1R7RA 1SXJA 3W0LB 3L29A 2LXEA 4YY3M 3CTWB 3I4YA 4M9XA 3T15A 4DR2M 5FSWA 5KPRA 1Z5CA 3KVWA 5DYGA 2C9CA 5JI2E 2R45A 3T1YM 4OU7A 3UGJA 1QZMA 1Z59A 5FLXS 2ZM6M 1ZQ9A 4IBBA 1H6UA 4QHSA 3KP1E 3SMSA 3KDSE 3TL4X 2JA2A 4NRVA 5FTKA 1XHBA 3A46A 1L2CA 2J7NA 3KXEC 5EXTA 1Q3CA 5EXPA 2D7HA 1I4WA 3CF6E 4DV1M 3VFDA 2DZOB 4FD2A 1N36M 1G4AE 3J7AS 3LQQA 4FWGA 4G6ZA 4JI7M 4NXMM 5IWAM 3SARA 4JI5M 1TH2A 2I7NA 3K8ZA 3TE6A 3TQSA 2V1UA 1E9RA 3M7GA 3GRRA 1Q3BA 2G5GX 3HWSA 2DHRA 4JN6A 3U60B 3FUVA 4OVZA 3AKZA 2AHMA 1L1TA 4KODA 3SASA 4PD2A 1LV7A 1L2BA 3GQ3A 4KO8A 1L8QA 3M0EA 4AZFA 2BJVA 3HJ8A 3HU3A 4MGKE 4RF1A 4LF8M 1TDHA 4GIPA 3KOWE 2VIIA 4PDGA 4X62M 5BPVA 3DOAA 3VDPA 4MGHA 5IREB 1GKIA 2KEBA 2DXIA 4M9ZA 3KSJA 4FCTA 1SXJC 4R7GA 3MK6A 1TH3A 2BJWA 1GL6A 3NWLA 3GLHA 3L26A 3GPUA 3U5ZB 2QZ4A 5DYIA 3HKPA 1NNJA 2CV2A 2UXCM 4IJEA 1L2DA 2KRKA 2D7EA 2FE8A 2XH9A 3PXGA 5DNYA 4WW0A 1QQWA 2QP9X 4L78A 2L7HA 4JI2M 4IBFA 3RE8A 2Z3XA 4I81A 3UK6A 2UUAM 2HL7A 3GPYA 4ITQA 4ZPXA 2L7IA 2Z4RA 4M9SA 4G4RA 2R4EA 1NJFA 3KOZE 1JR3A 4IIWA 5C18A 2XSZD 4LFBM 4W5WA 3SAUA 1HR0M 1N33M 5ITQA 4JI4M 3NBIA 3HJSA 2KA6B 2RGOA 3KS4A 3TWKA 3SATA 3HU1A 3GLIA 3B9PA 4XBOA 4RNAA 3HHZA 3CF2A 4GMQA 2L6OA 4DUZM 3U6MA 1DGHB 4QHTA 1OFIA 4AKHA 3FTEA 3GLFB 1GLNA 2CEAA 4LY6A 2XEPA 3WHKA 3AV0A 4BB9A 1W5SA 4OVZB 1XWIA 3U6SA 2HKJA 4DR1M 4L16A 5GKNA 4MM3B 2F5SA 4GITA 3FUTA 1R2YA 3SHFA 1HNZM 1GL7A 1NJGA 3PNYA 1QVRA 2OPFA 2L09A 4IBDA 3FYDA 4IBKA 4GC5A 3LVVA 4DV2M 1I94M 1HT2E 3JR5A 5ITXA 4JI3M 4CHTB 2YFQA 5KPTA 3U61B 5KQ8A 2R62A 4QOSA 5FTNA 3JR4A 1YSYA 4DR7M 2UXBM 1IY0A 1QAMA 4LF5M 1XMQM 3EIEA 4JI6M 3UZUA 4LJ7A 3J7BA 3C58A 4LFCM 4AQYM 2F5QA 4LCBA 2BNKA 2X4AA 1N34M 1XNQM 3PFIA 3SC3A 8CATA 4AG5A 2Z4SA 4X64M 3SAVA 2F5NA 3LVWA 3D8BA 2Z7JA 5ITUA 1IN4A 1DGGA 3WHLA 3R8FA 4DV7M 4CISA 4LZZA 3RGSA 1Z6TA 5EXXA 3GQ5A 2FNAA 4DV4M 2UU9M 2QENA 4OW0A 3SHGB 3U6QA 3FD9A 2ZBKB 4PT5A 2C9OA 4DR6M 4DV0M 2QBYA 3AJIB 3U6LA 4LJ8A 1PJJA 4FW9A 1N75A 5EP3A 1YE9A 5ITYA 4S12A 4AKIA 1QYRA 3MJ5A 3KP0E 4NRWA 4FCWA 1GVNA 3GLGA 3H4MA 3FUXA 3KSXA 3RGPA 4LF6M 5KPZA 5EJCA 3SYLA 5E26A 1QAQA 1IN6A 3GPPA 3FTCA 1XXHB 3LQRA 4PCZA 3GP1A 2F5PA 3A98B 4QNRA 1MU5A 4G4NA 3A42A 1IXSB 5LMUM 1SXJD 4JI8M 2DWNA 4JI1M 2UXDM 1E32A 4DR5M 4P16A 2ZANA 4B08A 1HQYE 3FUWA 5ITXE 2F4VM 4KHPM 3IG8A 2ZAOA 1SXJB 2CFOA 3FYCA 4LRTA 2Q2EB 2C99A 1IN8A 4NL4H 5JI3E 2UUCM 3THGA 4B7GA 1TH4A 4B3MM 2CHGA 4LZJA 4Z8XA 4B7FA 2KZSA 1TDZA 4OX9M 2I7PA 1G3IA 1PJIA 1G59A 3HJQA 1E9SA 2YQZA 3KOYE 4LRSA 1XNRM 3K92A 2HHHM 3TWLA 1IXZA 4GKKM 1IQPA 5FTMA 4G4OA 1KFVA 3TPZA 5IT9S 2R46A 4HL4A 4XGIA 2M60A 3VK8A 4RF0A 2M5ZA 2XZUA 3AL0C 3VKGA 3FTDA 1OJLA 2CE7A 4DV3M 4LF4M 4I8OA 2XFSA 1DO0A 4Z6YA 1IBLM 1Z5AA 2DWLA 3L2AA 2XLJA 1WXQA 1KSFX 3AOEA 4FWDA 3AOGA 2R65A 1J5EM 4LF7M 4K0KM 4TUWA 1E94E 4LJ6A 5EP1A 3GQ4A 3U60A 4GRIA 1N78A 1NSFA 3GLGB 4GKJM 3FTFA 5ITRA 4JXJA 2R18A 5EQTA 1Q39A 2LWXA 3PNVA 2XZFA 2F5OA 2R4JA 3GRUA 4YHHM 2C5RA 1N32M 3IG5A 2LH0A 2NQ8C 1T3TA 3CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL7 A;  2KW0 A; 
#chains in the Genus database with same CATH topology
 2EO2 A;  4WUR A;  2YNM D;  2Y0T A;  1OKS A;  4DR4 M;  2K47 A;  1PM5 A;  3ILK A;  1NHW C;  2RKO A;  4RKU F;  4A3V B;  4LGM A;  1XMO M;  5KO3 A;  3HGI A;  3GLH B;  2KZU A;  2CUZ A;  1D2N A;  2VDB B;  3L25 A;  1R6B X;  2A5Y B;  2VF7 A;  3U6C A;  2KRU A;  4F1I A;  2C98 A;  4QNM A;  2DNA A;  1C1K A;  5FTJ A;  1DGB A;  4NSO B;  3A45 A;  3ZCB B;  3J27 B;  3J81 S;  1QDR A;  3DFZ A;  1JR3 D;  5F3W A;  2C96 A;  1K3W A;  3VDU A;  2J7O A;  4R3D A;  2O5R A;  4CJ6 A;  1K3X A;  2YR0 A;  1N77 A;  1ZMU A;  1DGF A;  3M6A A;  5A2Q S;  5IZ7 D;  4CIZ A;  3T6P A;  3MHV C;  1ORY B;  1HNW M;  2V6Z M;  4II7 A;  4GHA A;  4FCV A;  2XGN A;  1HT1 E;  3LCV B;  3HHW A;  2QCU A;  3Q8X A;  1HNX M;  3LMM A;  1QAN A;  4FVM A;  1JB0 F;  1NVM A;  2QPA A;  4I5S A;  4IBE A;  2E5L M;  2KXE A;  1TR8 A;  1W5T A;  2KNZ A;  3K1J A;  4L4U A;  4I4L A;  4LJ5 A;  3VLF B;  2ERC A;  2ZAM A;  3B7Q A;  2G3Q A;  4BBA A;  3KFU G;  3EIH A;  1RU3 A;  2W82 A;  4MH0 E;  4D82 A;  4GC9 A;  3J2P B;  1IY1 A;  4HEO A;  2DAK A;  1IN7 A;  3GLI B;  2H1R A;  3AOE C;  1WHC A;  3SAW A;  3QYE A;  3U6E A;  2XSZ A;  2VQF M;  4D81 A;  4B3T M;  2UUB M;  4L8R C;  4IBI A;  1X37 A;  3Q8G A;  5C1B A;  5EXS A;  3VK7 A;  1FNN A;  1KYI A;  1Z5B A;  2DWZ B;  1S3S A;  3JAM S;  4MGI E;  7CAT A;  1IBK M;  1OAO C;  2KW0 A;  3ZC7 B;  4MGZ E;  4AKG A;  1DGH A;  1JQJ C;  3W0F A;  4G4Q A;  4MB7 A;  3SMP A;  1K82 A;  3V76 A;  3GLF A;  2J5Y A;  3C9P A;  3I4V A;  4JI0 M;  4IBG A;  1ZAE A;  1HQC A;  4GHL A;  2RGH A;  3FUU A;  4QOZ C;  2DWM A;  1QAO A;  1C7Y A;  4M0D A;  1UM8 A;  1DO2 A;  3I04 M;  2FH0 A;  4LJA A;  3ZH9 B;  2WSC F;  4LJ9 A;  2N35 A;  3U6P A;  4KLN A;  3HHY A;  1L1Z A;  2XFT A;  2DI0 A;  1J09 A;  1IM2 A;  2QHO B;  2X8A A;  1XXH E;  4DV6 M;  3SYK A;  3KOX E;  4NXN M;  1YUB A;  2Y21 A;  3C3D A;  2LVA A;  2CHV A;  2HWJ A;  2OQ4 A;  4IJF A;  2H5X A;  4D80 A;  1NHG C;  2FOI C;  3D8L A;  3SFZ A;  4L15 A;  5E6J A;  2GNO A;  3QAU A;  4NSR A;  1MX0 A;  2DZN B;  4P17 A;  3U61 A;  3R9X B;  2B3T A;  1SXJ E;  2Y20 A;  2WSE F;  1IY2 A;  4AG6 A;  1IN5 A;  2EUC A;  2CV1 A;  3DA1 A;  3E4R A;  4IBJ A;  4BLC A;  3KS8 A;  1EIJ A;  1NY5 A;  3FKE A;  4HLQ A;  4CGY B;  1WIV A;  3UMM A;  2G8L A;  2KHH A;  3E9S A;  4XK8 F;  3T1H M;  3FE3 A;  1G41 A;  1J7K A;  3B89 A;  1OAI A;  3KW6 A;  3HHX A;  4LJ4 A;  3FRH A;  2EA0 A;  3GO8 A;  4R71 A;  4AW4 A;  3AFH A;  4IBC A;  3GRV A;  1TF0 B;  4MGY E;  1EFU B;  2GQF A;  4NOO B;  1IXR C;  4DUY M;  4B7H A;  1OIP A;  1XC8 A;  2K0B X;  2XF3 A;  4JYA M;  4DBG B;  4JV5 M;  2DKL A;  3C3E A;  2Y0Q A;  2CHQ A;  3QWL A;  3B7Z A;  1NNU C;  2DZL A;  3T38 A;  1WR1 B;  2QBY B;  3OTO M;  3BOS A;  1TGU A;  4GH9 A;  2DAG A;  5EP4 A;  4LF9 M;  1EE8 A;  3J80 S;  4LFA M;  5KQD A;  4LG2 A;  3L28 A;  1VEG A;  2LVP C;  1D0M A;  3K2L A;  3RFW A;  2LNH C;  3TWM A;  4ANR A;  2L2D A;  3GRY A;  1FJG M;  1GAB A;  4DR3 M;  1UFZ A;  2FFJ A;  3PVS A;  3UJN A;  3SBJ A;  2DVW B;  1OFH A;  4EIW A;  5EP2 A;  4X65 M;  2CV0 A;  5FTL A;  2JP7 A;  1XXH A;  2HAK A;  4FWH A;  4LGY A;  3DZD A;  1R2Z A;  3I51 A;  2X49 A;  3HU2 A;  5H37 D;  5LMN M;  2OOB A;  4AKI A;  2L4F A;  2BWB A;  2V1C A;  1IXS A;  4X66 M;  2P5T A;  2O25 A;  4PDI A;  4DV5 M;  1VDD A;  3U6D A;  1GO5 A;  3VKH A;  1G8P A;  4AI6 A;  5BR8 M;  2HCB A;  5ITT A;  3U5Z A;  3U6O A;  4KT0 F;  4M0W A;  1NY6 A;  2D7G A;  2VQE M;  3L27 A;  4REZ A;  4B3S M;  1IBM M;  3GPX A;  1R7R A;  1SXJ A;  3W0L B;  1WGN A;  3L29 A;  4B3R M;  2LXE A;  4YY3 M;  3CTW B;  2DAE A;  3I4Y A;  4M9X A;  3T15 A;  1NV9 A;  1PJS A;  3I01 M;  5FSW A;  4DR2 M;  5KPR A;  1T6O A;  1Z5C A;  3KVW A;  2C9C A;  5DYG A;  2R45 A;  1G71 A;  1D0K A;  5JI2 E;  3T1Y M;  4OU7 A;  3UGJ A;  1V33 A;  1QZM A;  1Z59 A;  5FLX S;  2ZM6 M;  1ZQ9 A;  2MJ5 B;  1H6U A;  4IBB A;  1PJQ A;  3KP1 E;  4QHS A;  3SMS A;  3KDS E;  3W68 A;  3TL4 X;  1WJ7 A;  2JA2 A;  4NRV A;  5FTK A;  1XHB A;  3E21 A;  3A46 A;  1L2C A;  2J7N A;  3KXE C;  1GJT A;  5EXT A;  2DAM A;  1Q3C A;  2FS1 A;  2D7H A;  1I4W A;  3CF6 E;  1R4G A;  5EXP A;  4DV1 M;  1VG5 A;  3VFD A;  2DZO B;  4FD2 A;  1N36 M;  1G4A E;  3J7A S;  3LQQ A;  4FWG A;  4G6Z A;  4JI7 M;  4NXM M;  5IWA M;  3SAR A;  4JI5 M;  4GEW A;  3NBX X;  1QZE A;  1TH2 A;  2I7N A;  2JZ0 A;  3BXW A;  3K8Z A;  1E9R A;  3TE6 A;  3M7G A;  3TQS A;  1NV8 A;  2V1U A;  3HY5 A;  3GRR A;  1Q3B A;  2G5G X;  3GLI E;  3B7N A;  1V92 A;  4L6V 6;  3K9O A;  2VF8 A;  3HWS A;  4Y28 F;  2DHR A;  4JN6 A;  1DV0 A;  2KDL A;  3U60 B;  3FUV A;  4OVZ A;  1Y8G A;  3AKZ A;  2CWB A;  1F4I A;  2AHM A;  1VDL A;  1L1T A;  2LTU A;  4KOD A;  1T43 A;  1TTE A;  2LBC A;  3SAS A;  2Z8Y M;  4F2L A;  4PD2 A;  1LV7 A;  1L2B A;  3GQ3 A;  4KO8 A;  1HJP A;  1L8Q A;  3M0E A;  4AZF A;  1ZMV A;  2BJV A;  3HJ8 A;  3HU3 A;  4MGK E;  4RF1 A;  4LF8 M;  2L4E A;  1TDH A;  4GIP A;  3KOW E;  2VII A;  4PDG A;  4X62 M;  1OIZ A;  3DOA A;  3VDP A;  5BPV A;  4MGH A;  5IRE B;  1GKI A;  2KEB A;  2EJS A;  4M9Z A;  2DXI A;  3KSJ A;  4FCT A;  1SXJ C;  1BVS A;  4R7G A;  3MK6 A;  1D0L A;  1TH3 A;  2BJW A;  1GL6 A;  3NWL A;  3GLH A;  3L26 A;  3GPU A;  3U5Z B;  2QZ4 A;  3IHP A;  3HKP A;  5DYI A;  1NNJ A;  2CV2 A;  2UXC M;  4IJE A;  1L2D A;  2KRK A;  1ZV1 A;  2D7E A;  2OO9 A;  2FE8 A;  2JZ1 A;  2XH9 A;  3PXG A;  5DNY A;  4WW0 A;  1QQW A;  3BBZ A;  2QP9 X;  4L78 A;  3K9P A;  2L7H A;  2BWE A;  2JY6 B;  4JI2 M;  1AIP C;  1OQY A;  4IBF A;  3RE8 A;  2JY5 A;  2Z3X A;  4I81 A;  3UK6 A;  2UUA M;  2HL7 A;  3IEC A;  3GPY A;  4ITQ A;  4ZPX A;  2JNH A;  2L7I A;  1V34 A;  2Z4R A;  4M9S A;  4G4R A;  2R4E A;  1NJF A;  3KOZ E;  1JR3 A;  4IIW A;  5C18 A;  1MJG M;  2XSZ D;  4LFB M;  4W5W A;  3SAU A;  1HR0 M;  1N33 M;  5ITQ A;  4JI4 M;  3NBI A;  3HJS A;  2KA6 B;  2RGO A;  3CGW A;  3KS4 A;  3TWK A;  3SAT A;  1YLA A;  1CUK A;  3HU1 A;  3GLI A;  3B9P A;  4XBO A;  4RNA A;  3HHZ A;  4NC6 A;  3CF2 A;  4GMQ A;  2L6O A;  4DUZ M;  3U6M A;  1DGH B;  4QHT A;  1OFI A;  2QNJ A;  4AKH A;  4UN2 B;  3FTE A;  3GLF B;  1GLN A;  2CEA A;  4LY6 A;  2LHC A;  2XEP A;  3WHK A;  3AV0 A;  3GLG E;  2QSF X;  4BB9 A;  2LVN C;  1W5S A;  2R0I A;  4OVZ B;  1A5T A;  1XWI A;  5L8R F;  3U6S A;  2HKJ A;  4DR1 M;  4L16 A;  5GKN A;  1GJS A;  4MM3 B;  2F5S A;  2DHY A;  4GIT A;  3FUT A;  1R2Y A;  3SHF A;  2EKF A;  1HNZ M;  2K6B A;  3E46 A;  2O01 F;  1GL7 A;  1NJG A;  3PNY A;  1QVR A;  2OPF A;  2L09 A;  4IBD A;  3FYD A;  4IBK A;  4GC5 A;  3LVV A;  4DV2 M;  1I94 M;  3FRI A;  3LW5 F;  3GLH E;  1HT2 E;  3JR5 A;  5ITX A;  2CP8 A;  4JI3 M;  4CHT B;  3HZJ A;  2YFQ A;  5KPT A;  3U61 B;  2OOA A;  5KQ8 A;  4G3O A;  1VEK A;  2R62 A;  4QOS A;  5FTN A;  3JR4 A;  1YSY A;  1WGL A;  4DR7 M;  2UXB M;  1IY0 A;  1QAM A;  4LF5 M;  1XMQ M;  3EIE A;  1NO1 A;  1AUA A;  4JI6 M;  3B74 A;  3UZU A;  1PGY A;  4LJ7 A;  3J7B A;  3C58 A;  4LFC M;  4AQY M;  2F5Q A;  4LCB A;  2BNK A;  2X4A A;  2MR9 A;  2ZTD A;  1N34 M;  1JR3 E;  1XNQ M;  2DAI A;  3PFI A;  1QUT A;  3SC3 A;  8CAT A;  4AG5 A;  2Z4S A;  1OTR A;  4X64 M;  3SAV A;  2F5N A;  3LVW A;  3D8B A;  2Z7J A;  2LVQ D;  5ITU A;  1IN4 A;  1DGG A;  3WHL A;  3R8F A;  4WP2 A;  4DV7 M;  4CIS A;  3MMP A;  2JXN A;  4LZZ A;  3RGS A;  1Z6T A;  5EXX A;  3GQ5 A;  2FNA A;  4DV4 M;  2UU9 M;  2QEN A;  4OW0 A;  3SHG B;  3U6Q A;  3FD9 A;  2ZBK B;  4PT5 A;  2JY7 A;  2C9O A;  2CRU A;  1QUS A;  4DV0 M;  2QBY A;  3AJI B;  3U6L A;  4DR6 M;  4LJ8 A;  1PJJ A;  4FW9 A;  1N75 A;  5EP3 A;  1YE9 A;  5ITY A;  1PJT A;  2KNV A;  1QYR A;  3MJ5 A;  3KP0 E;  4S12 A;  4NRW A;  1VQ1 A;  4FCW A;  1GVN A;  1R5L A;  3GLG A;  4Q7J A;  3QYB A;  3H4M A;  3FUX A;  3KSX A;  3RGP A;  4LF6 M;  5KPZ A;  5EJC A;  2ZTC A;  3SYL A;  2JWS A;  5E26 A;  1IN6 A;  1QAQ A;  3GPP A;  1LTM A;  1XXH B;  3FTC A;  2K9D A;  3LQR A;  4PCZ A;  3GP1 A;  2F5P A;  3A98 B;  4QNR A;  1MU5 A;  4G4N A;  3A42 A;  1IXS B;  5LMU M;  1SXJ D;  4JI8 M;  2DWN A;  4JI1 M;  2UXD M;  1E32 A;  4DR5 M;  4P16 A;  2KNA A;  2MH8 A;  2ZAN A;  4B08 A;  1HQY E;  3FUW A;  3H4J A;  5ITX E;  2F4V M;  3IG8 A;  4KHP M;  2ZAO A;  1SXJ B;  2LVO C;  2CFO A;  1QDT A;  1VEJ A;  3FYC A;  4LRT A;  2DEN A;  2WSF F;  2Q2E B;  2C99 A;  1IN8 A;  4NL4 H;  3W67 A;  2MRO B;  3THG A;  5JI3 E;  2UUC M;  4B7G A;  1TH4 A;  4B3M M;  2CHG A;  4LZJ A;  5DFL A;  4Z8X A;  4B7F A;  2R6F A;  2KZS A;  1TDZ A;  4OX9 M;  1MN3 A;  2I7P A;  1G3I A;  1PJI A;  1G59 A;  2JY8 A;  3HJQ A;  1E9S A;  2WZJ A;  2YQZ A;  2EKK A;  3KOY E;  4LRS A;  1XNR M;  3K92 A;  2HHH M;  1Q02 A;  3TWL A;  1IXZ A;  4GKK M;  1IQP A;  5FTM A;  4G4O A;  1KFV A;  3TPZ A;  5IT9 S;  2R46 A;  4HL4 A;  4XGI A;  3F92 A;  3ZQJ A;  2M60 A;  3VK8 A;  1P3Q Q;  2JUJ A;  4RF0 A;  2M5Z A;  2XZU A;  3AL0 C;  3VKG A;  3FTD A;  1OJL A;  2CE7 A;  4DV3 M;  4LF4 M;  1SG9 A;  4I8O A;  2XFS A;  1DO0 A;  4Z6Y A;  1IBL M;  1Z5A A;  3LCU A;  2DWL A;  3L2A A;  2XLJ A;  1WXQ A;  1KSF X;  1IFY A;  3AOE A;  4FWD A;  3AOG A;  2R65 A;  1J5E M;  4LF7 M;  4K0K M;  2APL A;  4TUW A;  1E94 E;  4LJ6 A;  5EP1 A;  3GQ4 A;  2R44 A;  2LHG A;  2QQ8 A;  3U60 A;  4GRI A;  3HX3 A;  1N78 A;  1NSF A;  3GLG B;  4GKJ M;  3FTF A;  5ITR A;  3GLF E;  4JXJ A;  2R18 A;  1XB2 B;  5EQT A;  1ZMW A;  1Q39 A;  2RRU A;  2LWX A;  3PNV A;  2XZF A;  2F5O A;  1PRB A;  2R4J A;  3GRU A;  4YHH M;  2C5R A;  1N32 M;  3IG5 A;  2LH0 A;  2NQ8 C;  2MGW A;  1T3T A;  3CF0 A; 
#chains in the Genus database with same CATH homology
 2EO2 A;  4WUR A;  2YNM D;  2Y0T A;  4DR4 M;  2K47 A;  1PM5 A;  3ILK A;  1NHW C;  2RKO A;  4A3V B;  4LGM A;  1XMO M;  5KO3 A;  3HGI A;  3GLH B;  2KZU A;  2CUZ A;  1D2N A;  3L25 A;  1R6B X;  2A5Y B;  3U6C A;  2KRU A;  2C98 A;  4QNM A;  1C1K A;  5FTJ A;  1DGB A;  4NSO B;  3A45 A;  3ZCB B;  3J27 B;  3J81 S;  3DFZ A;  1JR3 D;  5F3W A;  2C96 A;  1K3W A;  3VDU A;  2J7O A;  4R3D A;  2O5R A;  1K3X A;  2YR0 A;  1N77 A;  1DGF A;  3M6A A;  5A2Q S;  5IZ7 D;  3MHV C;  1ORY B;  1HNW M;  2V6Z M;  4II7 A;  4GHA A;  4FCV A;  2XGN A;  1HT1 E;  3HHW A;  2QCU A;  3Q8X A;  1HNX M;  3LMM A;  1QAN A;  4FVM A;  2QPA A;  1NVM A;  4I5S A;  2E5L M;  4IBE A;  4B3R M;  2KXE A;  1W5T A;  4L4U A;  4LJ5 A;  3K1J A;  3VLF B;  4I4L A;  4BBA A;  2ERC A;  2ZAM A;  3KFU G;  3EIH A;  2W82 A;  4MH0 E;  4D82 A;  4GC9 A;  3J2P B;  1IY1 A;  1IN7 A;  3GLI B;  2H1R A;  3AOE C;  3SAW A;  3U6E A;  4L8R C;  2XSZ A;  2VQF M;  4D81 A;  4B3T M;  2UUB M;  4IBI A;  1X37 A;  5C1B A;  3VK7 A;  5EXS A;  1FNN A;  1KYI A;  1Z5B A;  2DWZ B;  1S3S A;  3JAM S;  4MGI E;  7CAT A;  1IBK M;  2KW0 A;  3ZC7 B;  4MGZ E;  4AKG A;  1DGH A;  1JQJ C;  3W0F A;  4G4Q A;  4MB7 A;  3SMP A;  1K82 A;  3GLF A;  4JI0 M;  3I4V A;  4IBG A;  1ZAE A;  1HQC A;  4GHL A;  2RGH A;  3FUU A;  4QOZ C;  2DWM A;  1QAO A;  4M0D A;  1UM8 A;  1DO2 A;  4LJA A;  3ZH9 B;  4LJ9 A;  3U6P A;  4KLN A;  3HHY A;  1L1Z A;  2XFT A;  1J09 A;  1IM2 A;  2X8A A;  4DV6 M;  3SYK A;  3KOX E;  4NXN M;  1YUB A;  2Y21 A;  2CHV A;  2OQ4 A;  4IJF A;  4D80 A;  1NHG C;  2FOI C;  3D8L A;  3SFZ A;  4L15 A;  5E6J A;  3QAU A;  4NSR A;  1MX0 A;  2DZN B;  3R9X B;  3U61 A;  1SXJ E;  2Y20 A;  1IY2 A;  4AG6 A;  1IN5 A;  2EUC A;  2CV1 A;  3DA1 A;  3E4R A;  4IBJ A;  4BLC A;  3KS8 A;  1NY5 A;  3FKE A;  4HLQ A;  4CGY B;  4LF9 M;  3UMM A;  2G8L A;  3E9S A;  3T1H M;  1G41 A;  1J7K A;  3KW6 A;  3HHX A;  4LJ4 A;  2EA0 A;  3GO8 A;  4AW4 A;  3AFH A;  4IBC A;  3GRV A;  4MGY E;  4NOO B;  1IXR C;  4DUY M;  4B7H A;  1XC8 A;  2XF3 A;  4JYA M;  4JV5 M;  2Y0Q A;  2CHQ A;  3QWL A;  1NNU C;  3T38 A;  2QBY B;  3OTO M;  3BOS A;  1TGU A;  4GH9 A;  5EP4 A;  1EE8 A;  3J80 S;  4LFA M;  5KQD A;  4LG2 A;  3L28 A;  3K2L A;  3RFW A;  2LNH C;  3TWM A;  3GRY A;  1FJG M;  4DR3 M;  2FFJ A;  3PVS A;  3UJN A;  3SBJ A;  2DVW B;  1OFH A;  4EIW A;  5EP2 A;  4X65 M;  2CV0 A;  5FTL A;  1XXH A;  4FWH A;  4LGY A;  3DZD A;  1R2Z A;  3I51 A;  2X49 A;  3HU2 A;  5H37 D;  5LMN M;  2V1C A;  4X66 M;  2P5T A;  3U6D A;  4PDI A;  4DV5 M;  1VDD A;  3VKH A;  1G8P A;  4AI6 A;  5BR8 M;  2HCB A;  5ITT A;  3U5Z A;  3U6O A;  4M0W A;  2VQE M;  1NY6 A;  2D7G A;  4B3S M;  3L27 A;  4REZ A;  1IBM M;  3GPX A;  1R7R A;  1SXJ A;  3W0L B;  3L29 A;  2LXE A;  4YY3 M;  3CTW B;  3I4Y A;  4M9X A;  3T15 A;  4DR2 M;  5FSW A;  5KPR A;  1Z5C A;  3KVW A;  5DYG A;  2C9C A;  5JI2 E;  2R45 A;  3T1Y M;  4OU7 A;  3UGJ A;  1QZM A;  1Z59 A;  5FLX S;  2ZM6 M;  1ZQ9 A;  4IBB A;  1H6U A;  4QHS A;  3KP1 E;  3SMS A;  3KDS E;  3TL4 X;  2JA2 A;  4NRV A;  5FTK A;  1XHB A;  3A46 A;  1L2C A;  2J7N A;  3KXE C;  5EXT A;  1Q3C A;  5EXP A;  2D7H A;  1I4W A;  3CF6 E;  4DV1 M;  3VFD A;  2DZO B;  4FD2 A;  1N36 M;  1G4A E;  3J7A S;  3LQQ A;  4FWG A;  4G6Z A;  4JI7 M;  4NXM M;  5IWA M;  3SAR A;  4JI5 M;  1TH2 A;  2I7N A;  3K8Z A;  3TE6 A;  3TQS A;  2V1U A;  1E9R A;  3M7G A;  3GRR A;  1Q3B A;  2G5G X;  3HWS A;  2DHR A;  4JN6 A;  3U60 B;  3FUV A;  4OVZ A;  3AKZ A;  2AHM A;  1L1T A;  4KOD A;  3SAS A;  4PD2 A;  1LV7 A;  1L2B A;  3GQ3 A;  4KO8 A;  1L8Q A;  3M0E A;  4AZF A;  2BJV A;  3HJ8 A;  3HU3 A;  4MGK E;  4RF1 A;  4LF8 M;  1TDH A;  4GIP A;  3KOW E;  2VII A;  4PDG A;  4X62 M;  5BPV A;  3DOA A;  3VDP A;  4MGH A;  5IRE B;  1GKI A;  2KEB A;  2DXI A;  4M9Z A;  3KSJ A;  4FCT A;  1SXJ C;  4R7G A;  3MK6 A;  1TH3 A;  2BJW A;  1GL6 A;  3NWL A;  3GLH A;  3L26 A;  3GPU A;  3U5Z B;  2QZ4 A;  5DYI A;  3HKP A;  1NNJ A;  2CV2 A;  2UXC M;  4IJE A;  1L2D A;  2KRK A;  2D7E A;  2FE8 A;  2XH9 A;  3PXG A;  5DNY A;  4WW0 A;  1QQW A;  2QP9 X;  4L78 A;  2L7H A;  4JI2 M;  4IBF A;  3RE8 A;  2Z3X A;  4I81 A;  3UK6 A;  2UUA M;  2HL7 A;  3GPY A;  4ITQ A;  4ZPX A;  2L7I A;  2Z4R A;  4M9S A;  4G4R A;  2R4E A;  1NJF A;  3KOZ E;  1JR3 A;  4IIW A;  5C18 A;  2XSZ D;  4LFB M;  4W5W A;  3SAU A;  1HR0 M;  1N33 M;  5ITQ A;  4JI4 M;  3NBI A;  3HJS A;  2KA6 B;  2RGO A;  3KS4 A;  3TWK A;  3SAT A;  3HU1 A;  3GLI A;  3B9P A;  4XBO A;  4RNA A;  3HHZ A;  3CF2 A;  4GMQ A;  2L6O A;  4DUZ M;  3U6M A;  1DGH B;  4QHT A;  1OFI A;  4AKH A;  3FTE A;  3GLF B;  1GLN A;  2CEA A;  4LY6 A;  2XEP A;  3WHK A;  3AV0 A;  4BB9 A;  1W5S A;  4OVZ B;  1XWI A;  3U6S A;  2HKJ A;  4DR1 M;  4L16 A;  5GKN A;  4MM3 B;  2F5S A;  4GIT A;  3FUT A;  1R2Y A;  3SHF A;  1HNZ M;  1GL7 A;  1NJG A;  3PNY A;  1QVR A;  2OPF A;  2L09 A;  4IBD A;  3FYD A;  4IBK A;  4GC5 A;  3LVV A;  4DV2 M;  1I94 M;  1HT2 E;  3JR5 A;  5ITX A;  4JI3 M;  4CHT B;  2YFQ A;  5KPT A;  3U61 B;  5KQ8 A;  2R62 A;  4QOS A;  5FTN A;  3JR4 A;  1YSY A;  4DR7 M;  2UXB M;  1IY0 A;  1QAM A;  4LF5 M;  1XMQ M;  3EIE A;  4JI6 M;  3UZU A;  4LJ7 A;  3J7B A;  3C58 A;  4LFC M;  4AQY M;  2F5Q A;  4LCB A;  2BNK A;  2X4A A;  1N34 M;  1XNQ M;  3PFI A;  3SC3 A;  8CAT A;  4AG5 A;  2Z4S A;  4X64 M;  3SAV A;  2F5N A;  3LVW A;  3D8B A;  2Z7J A;  5ITU A;  1IN4 A;  1DGG A;  3WHL A;  3R8F A;  4DV7 M;  4CIS A;  4LZZ A;  3RGS A;  1Z6T A;  5EXX A;  3GQ5 A;  2FNA A;  4DV4 M;  2UU9 M;  2QEN A;  4OW0 A;  3SHG B;  3U6Q A;  3FD9 A;  2ZBK B;  4PT5 A;  2C9O A;  4DR6 M;  4DV0 M;  2QBY A;  3AJI B;  3U6L A;  4LJ8 A;  1PJJ A;  4FW9 A;  1N75 A;  5EP3 A;  1YE9 A;  5ITY A;  4S12 A;  4AKI A;  1QYR A;  3MJ5 A;  3KP0 E;  4NRW A;  4FCW A;  1GVN A;  3GLG A;  3H4M A;  3FUX A;  3KSX A;  3RGP A;  4LF6 M;  5KPZ A;  5EJC A;  3SYL A;  5E26 A;  1QAQ A;  1IN6 A;  3GPP A;  3FTC A;  1XXH B;  3LQR A;  4PCZ A;  3GP1 A;  2F5P A;  3A98 B;  4QNR A;  1MU5 A;  4G4N A;  3A42 A;  1IXS B;  5LMU M;  1SXJ D;  4JI8 M;  2DWN A;  4JI1 M;  2UXD M;  1E32 A;  4DR5 M;  4P16 A;  2ZAN A;  4B08 A;  1HQY E;  3FUW A;  5ITX E;  2F4V M;  4KHP M;  3IG8 A;  2ZAO A;  1SXJ B;  2CFO A;  3FYC A;  4LRT A;  2Q2E B;  2C99 A;  1IN8 A;  4NL4 H;  5JI3 E;  2UUC M;  3THG A;  4B7G A;  1TH4 A;  4B3M M;  2CHG A;  4LZJ A;  4Z8X A;  4B7F A;  2KZS A;  1TDZ A;  4OX9 M;  2I7P A;  1G3I A;  1PJI A;  1G59 A;  3HJQ A;  1E9S A;  2YQZ A;  3KOY E;  4LRS A;  1XNR M;  3K92 A;  2HHH M;  3TWL A;  1IXZ A;  4GKK M;  1IQP A;  5FTM A;  4G4O A;  1KFV A;  3TPZ A;  5IT9 S;  2R46 A;  4HL4 A;  4XGI A;  2M60 A;  3VK8 A;  4RF0 A;  2M5Z A;  2XZU A;  3AL0 C;  3VKG A;  3FTD A;  1OJL A;  2CE7 A;  4DV3 M;  4LF4 M;  4I8O A;  2XFS A;  1DO0 A;  4Z6Y A;  1IBL M;  1Z5A A;  2DWL A;  3L2A A;  2XLJ A;  1WXQ A;  1KSF X;  3AOE A;  4FWD A;  3AOG A;  2R65 A;  1J5E M;  4LF7 M;  4K0K M;  4TUW A;  1E94 E;  4LJ6 A;  5EP1 A;  3GQ4 A;  3U60 A;  4GRI A;  1N78 A;  1NSF A;  3GLG B;  4GKJ M;  3FTF A;  5ITR A;  4JXJ A;  2R18 A;  5EQT A;  1Q39 A;  2LWX A;  3PNV A;  2XZF A;  2F5O A;  2R4J A;  3GRU A;  4YHH M;  2C5R A;  1N32 M;  3IG5 A;  2LH0 A;  2NQ8 C;  1T3T A;  3CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...