3HHZA

Complex of the vesicular stomatitis virus nucleocapsid and the nucleocapsid-binding domain of the phosphoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
AVSDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphoprotein
publication title Structure of the vesicular stomatitis virus nucleocapsid in complex with the nucleocapsid-binding domain of the small polymerase cofactor, P.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
molecule tags Viral protein/rna
total genus 9
structure length 73
sequence length 73
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhzA00
2K47A 3HHZA 3HHWA
chains in the Genus database with same CATH superfamily
1W5TA 1G8PA 2QZ4A 4B7HA 2ZTCA 1DGGA 1GVNA 2JY6B 5EXSA 1YE9A 4LCBA 3U6QA 2CV1A 3GP1A 5E6JA 2NQ8C 1TH3A 3SMSA 3PNVA 3Q8GA 2CV0A 4OU7A 1PJQA 4AKGA 3TWKA 3AL0C 2KXEA 2K47A 2QHOB 4D80A 5EJCA 3I4VA 1IN4A 4GH9A 4BBAA 1D2NA 1NNUC 3FTCA 4DR1M 4JI2M 4JYAM 4HLQA 1YLAA 3E9SA 2XZUA 4W5WA 5LMUM 4L8RC 1EE8A 3A45A 3HU1A 1AUAA 3M0EA 2MJ5B 5ITXE 3W68A 2X8AA 4X64M 3GLFB 3IHPA 1QAOA 1K3XA 3RGPA 1N33M 2J7OA 5FTLA 4PD2A 1QQWA 3I04M 5EP4A 1QUSA 2VF7A 5KPZA 3ILKA 4II7A 1E32A 1V33A 2EKFA 3K9PA 2XZFA 3E46A 3J27B 3LVVA 4JN6A 3A42A 2EKKA 3CTWB 2EUCA 3GQ4A 4PCZA 4LZZA 4FD2A 2JZ1A 4QOZC 1IN5A 2XFTA 2DWLA 3L26A 3GPYA 1DO0A 4IIWA 1RU3A 2QSFX 3LMMA 1K3WA 3T38A 3J2PB 2Y21A 3DA1A 3HJSA 2CWBA 2WSFF 3GLGA 5FSWA 1IXSB 3GLIE 3DZDA 4AG6A 5JI2E 5FLXS 2K9DA 2O5RA 1IQPA 3SC3A 4LFCM 2R18A 4AKIA 5FTMA 1XWIA 1NVMA 1WXQA 3WHLA 2DWMA 1P3QQ 4LFAM 4LFBM 1VEKA 1HJPA 3VDUA 1HR0M 1QUTA 2LHGA 3PNYA 4B08A 4RF0A 2QNJA 2Z8YM 2CHQA 4NSOB 3UJNA 1K82A 4NXMM 5H37D 4MGZE 1Q02A 1TH4A 3KXEC 2YNMD 3HGIA 1SXJB 5FTJA 1ZQ9A 2DZNB 3KP1E 1NV8A 2ZTDA 4S12A 5A2QS 2Z7JA 2L7HA 1Z5CA 3HWSA 1HQYE 2C98A 3RGSA 2CFOA 2XH9A 3KFUG 2A5YB 2KA6B 3T6PA 3J80S 5ITRA 4G3OA 4TUWA 4LJ5A 1ZMVA 5EXTA 2D7HA 3HY5A 4PDIA 2OQ4A 2Y20A 4DV4M 3VFDA 3WHKA 1KFVA 1E9SA 2KHHA 4JI5M 2MGWA 3GLHE 1L2BA 4P17A 4DUYM 5DYGA 1DGFA 4I5SA 1Z5BA 2DZLA 2JNHA 2L7IA 1JR3E 1IXZA 3FUTA 3W0FA 1MX0A 5BPVA 4DR6M 4MM3B 4JI6M 1ZMWA 5KPRA 4GKKM 3HKPA 2QCUA 3ZC7B 2MH8A 5KQDA 3GLIB 2CUZA 1N75A 4IJEA 1F4IA 1L2DA 3SMPA 1IFYA 2R4EA 4NC6A 2LTUA 4KO8A 4X66M 5IREB 2G5GX 3FYDA 4KODA 3C3EA 4A3VB 2CHVA 3MK6A 5EP1A 2F5SA 2QENA 1G71A 3C3DA 2XSZD 1VDDA 2Z4RA 1TTEA 3KOXE 4FW9A 5L8RF 2C99A 2V6ZM 3FTDA 1VQ1A 2DWZB 3GPXA 4MH0E 1XNRM 4PDGA 2YFQA 1D0MA 2BNKA 2KRKA 3R9XB 4IBBA 2DXIA 4JI4M 3BXWA 3U6SA 1IBMM 2BWEA 1XXHE 2RRUA 1G3IA 3SARA 2C96A 2G3QA 1G59A 3SATA 2JA2A 1HT1E 2Z3XA 4DV6M 3C58A 1FNNA 2JWSA 2X49A 4LF4M 3M7GA 4CISA 1Z6TA 3AOEA 1YSYA 2CHGA 2EO2A 1IXSA 3KDSE 3GLHB 4JI7M 1W5SA 3GRUA 4IBJA 4JI3M 3B7ZA 4GHAA 1NSFA 4MGHA 3U6EA 2JZ0A 4LF8M 4LF7M 2OOBA 2MR9A 3JR5A 1N77A 5BR8M 4XBOA 4NOOB 5IWAM 3KP0E 4GC5A 4LF5M 2LVQD 2R6FA 2LXEA 1L8QA 1SXJA 2R46A 2UUBM 1WGLA 3LW5F 2HAKA 1IY1A 1MN3A 3D8BA 2ZAMA 4G4OA 5F3WA 5ITXA 3GQ3A 5GKNA 5FTKA 2ERCA 2DVWB 2KEBA 1LV7A 1NHGC 4I4LA 4UN2B 2C9CA 4PT5A 1SXJD 3I01M 2OPFA 3U6CA 1PM5A 1FJGM 1PGYA 1XMQM 1OTRA 3A98B 2LWXA 3CF2A 3FYCA 3IG5A 5IT9S 1UM8A 4G4RA 1Z5AA 3GRRA 4DUZM 3HHYA 4G4NA 1WR1B 1MU5A 2BJVA 4GIPA 2I7NA 1XXHB 2JY8A 2K0BX 3KW6A 1E9RA 3CF6E 3ZQJA 1VEJA 4RNAA 2DNAA 2UUCM 1J7KA 3U6MA 1C7YA 4ZPXA 1G41A 3PFIA 4MGIE 4QNMA 3KOYE 4JI8M 1HNXM 4NRWA 2N35A 4IBEA 4QNRA 4BLCA 3U60B 1ZMUA 3I51A 3TE6A 3THGA 2F5OA 3GLIA 2DAKA 4G4QA 4FWGA 3U6OA 1L1TA 4G6ZA 1T3TA 1XC8A 1N78A 3TWMA 2UU9M 1GO5A 4XGIA 3E21A 4JV5M 4IBCA 2LH0A 4OW0A 3U6PA 2FNAA 3M6AA 3NBIA 2FFJA 1R2ZA 1WHCA 2FH0A 3VK8A 2QBYB 1IM2A 3PXGA 2KZSA 5KQ8A 3HHXA 1GJTA 1S3SA 3FUXA 1QANA 3D8LA 3QYBA 1XNQM 1X37A 2J7NA 5DYIA 4REZA 4AW4A 5ITQA 4DV1M 2V1UA 4X62M 3T1HM 2XFSA 4Z6YA 2YQZA 3JAMS 1I94M 3U61B 2YR0A 1D0KA 4I81A 4LJ6A 3W67A 4CIZA 2EA0A 4IBIA 4DV0M 3KSJA 1N36M 2H1RA 1NV9A 1SXJC 2DHYA 4AI6A 4DV3M 3J7AS 2F5PA 1DV0A 1BVSA 1J09A 1IY0A 1QDRA 4HL4A 3LCVB 1QAMA 2LVOC 3HX3A 2M5ZA 3GLHA 4LF9M 4JXJA 5LMNM 4Q7JA 4L15A 1JQJC 1JR3A 2KNAA 2L2DA 3VKGA 4FCWA 3JR4A 1UFZA 3MHVC 2Y0TA 2DHRA 3DFZA 4DBGB 2L4FA 1HQCA 2HWJA 4AZFA 1TR8A 1TDHA 1N32M 5ITUA 2JXNA 2J5YA 2RGOA 3GRYA 3T1YM 4ITQA 4KLNA 5EQTA 5EXXA 2R4JA 1YUBA 2KDLA 1WJ7A 3KSXA 4M9ZA 3TWLA 3OTOM 4DV5M 1TH2A 2DAGA 2QPAA 1XMOM 4F1IA 2KNVA 3AV0A 1KYIA 3Q8XA 4L78A 3A46A 4NRVA 3CF0A 4LJ9A 3FTEA 3KS4A 4WURA 2R44A 4WP2A 2D7EA 2UUAM 2KNZA 4LY6A 3SFZA 3GPUA 1VG5A 1XXHA 1E94E 3L25A 1Z59A 3L2AA 4M9XA 1OFHA 3SHGB 1OKSA 4LGYA 3GLFE 2HHHM 2LVPC 4B7GA 1ZAEA 1OAIA 3HJQA 4GRIA 1T6OA 2B3TA 4NSRA 3K9OA 3SAWA 2ZAOA 4M0WA 5FTNA 2W82A 4WW0A 4K0KM 3QAUA 1KSFX 3U60A 4B7FA 1L2CA 3FRIA 2M60A 3BBZA 3I4YA 1EFUB 1NY5A 5KO3A 3FUUA 1EIJA 4DR3M 2LVNC 4I8OA 4CHTB 1VDLA 4EIWA 5C1BA 1ORYB 2R45A 3K2LA 3DOAA 3VLFB 1OJLA 2R0IA 2H5XA 2WSCF 3ZCBB 2LHCA 4LGMA 1HNWM 5IZ7D 3U5ZB 2QBYA 1WGNA 3UMMA 2UXCM 3HZJA 1R6BX 2JY5A 3H4JA 1XHBA 1ZV1A 2CP8A 4L4UA 2G8LA 1DGHB 1GKIA 4M0DA 2I7PA 4QHSA 1Q39A 2HL7A 4XK8F 4IBKA 4JI0M 1Q3CA 4NL4H 5DNYA 1SG9A 1HNZM 3SYKA 3J81S 2ZANA 3KS8A 1PRBA 4IJFA 3FTFA 3U61A 2WSEF 2VQEM 1L1ZA 3CGWA 1GL6A 3GRVA 1J5EM 3SASA 2L09A 2GNOA 3AKZA 4R7GA 3H4MA 4AG5A 1PJTA 2DENA 1SXJE 3LVWA 5EXPA 3GQ5A 4CJ6A 1D0LA 2K6BA 2XF3A 3FUWA 4QOSA 4NXNM 2QQ8A 3L29A 2CE7A 1GLNA 2BWBA 3UK6A 2R62A 4HEOA 2JP7A 2RKOA 2X4AA 2BJWA 1PJSA 1OAOC 2KW0A 1IXRC 3R8FA 2C5RA 4X65M 3KVWA 2OO9A 2L4EA 3SYLA 1GABA 2C9OA 2XLJA 3UZUA 4OX9M 2D7GA 2HCBA 5DFLA 1H6UA 4AKHA 3IECA 2F4VM 1NHWC 4LF6M 1T43A 4KT0F 3FUVA 3VKHA 2LVAA 4R3DA 3ZH9B 4YY3M 3AOEC 4F2LA 1V92A 2VF8A 2DKLA 3AJIB 2P5TA 3AOGA 3NWLA 4LZJA 3B9PA 1PJIA 1A5TA 1OFIA 2XEPA 1QAQA 3B74A 4D82A 3GLGE 1MJGM 1WIVA 4DR2M 4R71A 3FKEA 3K92A 1PJJA 4OVZB 1TGUA 2JY7A 2EJSA 4GC9A 1NY6A 4DV7M 3AFHA 3MMPA 3LQRA 2DI0A 1IBLM 4B3MM 1G4AE 3J7BA 5EP3A 4GHLA 4GMQA 4L6V6 4QHTA 2L6OA 3U6LA 2ZBKB 4FWHA 4MGKE 3VK7A 1TDZA 4LG2A 1GJSA 1IBKM 3FD9A 1C1KA 4ANRA 2MROB 2LNHC 3W0LB 4IBDA 4D81A 1OIPA 1VEGA 4AQYM 5C18A 3K8ZA 4MGYE 2UXBM 4GKJM 3QWLA 2FS1A 3FE3A 3V76A 2LBCA 4P16A 5JI3E 1QVRA 4DR5M 3TL4X 3RE8A 2KRUA 8CATA 3KOZE 1R7RA 3GO8A 4DR4M 2RGHA 4M9SA 2O01F 2O25A 1R2YA 2FE8A 3U5ZA 2DWNA 5ITTA 2XGNA 4FVMA 1XB2B 4L16A 4GITA 4LJAA 3GPPA 1Q3BA 1JR3D 1R4GA 3MJ5A 4LJ4A 3RFWA 2UXDM 1DGHA 4LRSA 3E4RA 2DZOB 4FCTA 5KPTA 2KZUA 3HJ8A 4LJ8A 1CUKA 4YHHM 4Y28F 1NO1A 4DV2M 4B3SM 1NJGA 1IN6A 3C9PA 5E26A 3BOSA 5ITYA 1Y8GA 2Q2EB 2WZJA 3LCUA 3HHWA 2FOIC 2OOAA 4FWDA 1NNJA 4B3RM 3B7NA 2APLA 3B89A 3GLGB 3QYEA 2CV2A 4B3TM 2CEAA 4Z8XA 4BB9A 2VQFM 2R65A 2XSZA 4JI1M 1IY2A 3UGJA 1I4WA 1R5LA 1AIPC 3EIHA 1DGBA 2F5NA 4KHPM 1JB0F 2DAMA 4IBFA 4DR7M 3K1JA 1OIZA 1LTMA 3GLFA 2V1CA 3PVSA 3F92A 1IN7A 4LRTA 2CRUA 3FRHA 2Y0QA 2HKJA 1DO2A 4CGYB 3HHZA 1QDTA 1QYRA 1V34A 2QP9X 4RKUF 1QZMA 2VIIA 3IG8A 3L27A 3NBXX 4LJ7A 2E5LM 1TF0B 4IBGA 3L28A 3SHFA 3T15A 2AHMA 3KOWE 2ZM6M 3LQQA 2DAEA 2GQFA 4MB7A 3VDPA 1IN8A 3EIEA 4RF1A 3SAUA 2JUJA 3TPZA 3HU2A 2VDBB 1HT2E 1QZEA 4FCVA 1NJFA 1N34M 3HU3A 2F5QA 7CATA 1OQYA 4GEWA 3SBJA 3B7QA 4OVZA 3TQSA 5EP2A 2DAIA 2Z4SA 1GL7A 3SAVA 3U6DA
chains in the Genus database with same CATH topology
1W5TA 1G8PA 2QZ4A 4B7HA 1DGGA 1GVNA 5EXSA 1YE9A 4LCBA 3U6QA 2CV1A 3GP1A 5E6JA 2NQ8C 1TH3A 3SMSA 3PNVA 2CV0A 4OU7A 4AKGA 3TWKA 2KXEA 2K47A 4D80A 5EJCA 3I4VA 1IN4A 4GH9A 4BBAA 1D2NA 1NNUC 3FTCA 4DR1M 4JI2M 4JYAM 4HLQA 3E9SA 2XZUA 4W5WA 5LMUM 4L8RC 1EE8A 3A45A 3HU1A 3M0EA 5ITXE 4X64M 3GLFB 3AL0C 2X8AA 4GKJM 1QAOA 1K3XA 3RGPA 1N33M 2J7OA 5FTLA 4PD2A 1QQWA 5EP4A 5KPZA 3ILKA 4II7A 1E32A 2XZFA 3J27B 3LVVA 4JN6A 3A42A 3CTWB 2EUCA 3GQ4A 4PCZA 4LZZA 4FD2A 4QOZC 1IN5A 2XFTA 2DWLA 3L26A 3GPYA 1DO0A 4IIWA 3LMMA 1K3WA 3T38A 3J2PB 2Y21A 3DA1A 3HJSA 3GLGA 5FSWA 1IXSB 3DZDA 4AG6A 5JI2E 5FLXS 2O5RA 1IQPA 3SC3A 4LFCM 2R18A 4AKIA 5FTMA 1XWIA 1NVMA 1WXQA 3WHLA 2DWMA 4LFBM 4LFAM 3VDUA 1HR0M 4B08A 3PNYA 4RF0A 4NSOB 2CHQA 3UJNA 1K82A 4NXMM 5H37D 4MGZE 1TH4A 3KXEC 2YNMD 3HGIA 1SXJB 5FTJA 1ZQ9A 2DZNB 3KP1E 4S12A 5A2QS 2Z7JA 2L7HA 1Z5CA 3HWSA 1HQYE 2C98A 3RGSA 2CFOA 2XH9A 3KFUG 2A5YB 2KA6B 3J80S 5ITRA 4TUWA 4LJ5A 5EXTA 2D7HA 4PDIA 2OQ4A 2Y20A 4DV4M 3VFDA 3WHKA 1KFVA 1E9SA 4JI5M 1L2BA 4DUYM 5DYGA 1DGFA 4I5SA 1Z5BA 2L7IA 3FUTA 3W0FA 1IXZA 5BPVA 4DR6M 1MX0A 4MM3B 4JI6M 5KPRA 4GKKM 3HKPA 2QCUA 3ZC7B 5KQDA 3GLIB 2CUZA 1N75A 4IJEA 1L2DA 3SMPA 2R4EA 4X66M 4KO8A 5IREB 2G5GX 3FYDA 4KODA 4A3VB 2CHVA 3MK6A 5EP1A 2F5SA 2QENA 2XSZD 1VDDA 2Z4RA 3KOXE 4FW9A 2C99A 2V6ZM 3FTDA 2DWZB 3GPXA 4MH0E 1XNRM 4PDGA 2YFQA 3R9XB 2BNKA 2KRKA 4IBBA 2DXIA 4JI4M 3U6SA 1IBMM 3SARA 1G3IA 2C96A 3SATA 1G59A 2JA2A 1HT1E 2Z3XA 4DV6M 3C58A 1FNNA 2X49A 4LF4M 3M7GA 4CISA 1Z6TA 3AOEA 1YSYA 2CHGA 2EO2A 3KDSE 3GLHB 4JI7M 1W5SA 3GRUA 4IBJA 4JI3M 4GHAA 1NSFA 4MGHA 3U6EA 4LF8M 4LF7M 3JR5A 1N77A 5BR8M 4XBOA 4NOOB 5IWAM 3KP0E 4GC5A 4LF5M 2LXEA 1L8QA 1SXJA 2R46A 2UUBM 1IY1A 3D8BA 2ZAMA 4G4OA 5F3WA 5ITXA 3GQ3A 5GKNA 5FTKA 2ERCA 2DVWB 2KEBA 1LV7A 1NHGC 4I4LA 2C9CA 4PT5A 1SXJD 1PM5A 2OPFA 3U6CA 1FJGM 1XMQM 3A98B 2LWXA 3CF2A 3FYCA 3IG5A 5IT9S 1UM8A 4G4RA 1Z5AA 3GRRA 4DUZM 3HHYA 4G4NA 1MU5A 2BJVA 4GIPA 2I7NA 1XXHB 3KW6A 1E9RA 3CF6E 4RNAA 2UUCM 1J7KA 3U6MA 4ZPXA 1G41A 3PFIA 4MGIE 4QNMA 3KOYE 4JI8M 1HNXM 4NRWA 4IBEA 4QNRA 4BLCA 3U60B 3I51A 3TE6A 3THGA 2F5OA 3GLIA 4G4QA 4FWGA 3U6OA 1L1TA 4G6ZA 1T3TA 1N78A 3TWMA 2UU9M 4XGIA 4JV5M 4IBCA 2LH0A 4OW0A 3U6PA 2FNAA 3M6AA 3NBIA 2FFJA 1R2ZA 3VK8A 2QBYB 1IM2A 3PXGA 2KZSA 5KQ8A 3HHXA 1S3SA 3FUXA 1QANA 3D8LA 1XNQM 1X37A 2J7NA 5DYIA 4REZA 4AW4A 5ITQA 4DV1M 2V1UA 4X62M 3T1HM 2XFSA 4Z6YA 2YQZA 3JAMS 1I94M 3U61B 2YR0A 4LJ6A 4I81A 2EA0A 4IBIA 4DV0M 3KSJA 1N36M 2H1RA 1SXJC 4AI6A 4DV3M 3J7AS 2F5PA 1J09A 1IY0A 4HL4A 1QAMA 2M5ZA 3GLHA 4LF9M 4JXJA 5LMNM 4L15A 1JQJC 1JR3A 3VKGA 4FCWA 3JR4A 3MHVC 2Y0TA 2DHRA 3DFZA 1HQCA 4AZFA 1N32M 1TDHA 5ITUA 2RGOA 3GRYA 3T1YM 4ITQA 4KLNA 5EQTA 5EXXA 2R4JA 1YUBA 3KSXA 4M9ZA 3TWLA 3OTOM 4DV5M 1TH2A 1XMOM 2QPAA 3AV0A 1KYIA 3Q8XA 4L78A 3A46A 4NRVA 3CF0A 4LJ9A 3FTEA 3KS4A 4WURA 2D7EA 2UUAM 3SFZA 4LY6A 3GPUA 1XXHA 1E94E 3L25A 1Z59A 3L2AA 4M9XA 1OFHA 3SHGB 4LGYA 2HHHM 4B7GA 1ZAEA 4NSRA 3HJQA 4GRIA 3SAWA 2ZAOA 4M0WA 5FTNA 2W82A 4WW0A 4K0KM 3QAUA 1KSFX 3U60A 4B7FA 1L2CA 2M60A 3I4YA 1NY5A 5KO3A 3FUUA 4DR3M 4I8OA 4CHTB 4EIWA 5C1BA 1ORYB 2R45A 3K2LA 3DOAA 3VLFB 1OJLA 3ZCBB 4LGMA 1HNWM 5IZ7D 3U5ZB 2QBYA 2UXCM 3UMMA 1R6BX 1XHBA 4L4UA 2G8LA 1DGHB 1GKIA 4M0DA 2I7PA 4QHSA 1Q39A 2HL7A 1HNZM 4IBKA 4JI0M 1Q3CA 4NL4H 5DNYA 3SYKA 3J81S 2ZANA 3KS8A 4IJFA 3FTFA 3U61A 2VQEM 1L1ZA 1GL6A 3GRVA 1J5EM 3SASA 2L09A 3AKZA 4R7GA 3H4MA 4AG5A 1SXJE 3LVWA 5EXPA 3GQ5A 3FUWA 4QOSA 2XF3A 4NXNM 3L29A 2CE7A 1GLNA 3UK6A 2R62A 2RKOA 2X4AA 2BJWA 2KW0A 3R8FA 1IXRC 2C5RA 4X65M 3KVWA 3SYLA 2C9OA 2XLJA 3UZUA 4OX9M 2D7GA 2HCBA 1H6UA 4AKHA 2F4VM 1NHWC 4LF6M 3FUVA 3VKHA 4R3DA 3ZH9B 4YY3M 3AOEC 3AJIB 3AOGA 2P5TA 3NWLA 4LZJA 3B9PA 1PJIA 1OFIA 2XEPA 1QAQA 4D82A 4DR2M 3FKEA 3K92A 1PJJA 4OVZB 1TGUA 4GC9A 1NY6A 4DV7M 3AFHA 1IBLM 3LQRA 4B3MM 1G4AE 3J7BA 5EP3A 4GHLA 4GMQA 4QHTA 3U6LA 2L6OA 3VK7A 2ZBKB 4FWHA 4MGKE 1TDZA 4LG2A 1IBKM 3FD9A 1C1KA 2LNHC 3W0LB 4IBDA 4D81A 4AQYM 5C18A 3K8ZA 4MGYE 2UXBM 3QWLA 4P16A 5JI3E 1QVRA 4DR5M 3TL4X 3RE8A 2KRUA 8CATA 3KOZE 1R7RA 3GO8A 4DR4M 2RGHA 4M9SA 1R2YA 2FE8A 3U5ZA 2DWNA 5ITTA 2XGNA 4FVMA 4L16A 3GPPA 4GITA 4LJAA 1XC8A 1Q3BA 1JR3D 3MJ5A 4LJ4A 3RFWA 2UXDM 1DGHA 4LRSA 3E4RA 2DZOB 4FCTA 5KPTA 2KZUA 3HJ8A 4LJ8A 4YHHM 4B3SM 4DV2M 1NJGA 1IN6A 5E26A 3BOSA 5ITYA 2Q2EB 3HHWA 2FOIC 4FWDA 1NNJA 4B3RM 3GLGB 2CV2A 4B3TM 2CEAA 4Z8XA 4BB9A 2VQFM 2R65A 2XSZA 4JI1M 1IY2A 3UGJA 1I4WA 3EIHA 2F5NA 1DGBA 4KHPM 4IBFA 4DR7M 3K1JA 3GLFA 2V1CA 3PVSA 1IN7A 4LRTA 2Y0QA 2HKJA 1DO2A 4CGYB 3HHZA 1QYRA 2QP9X 1QZMA 2VIIA 3IG8A 3L27A 4LJ7A 2E5LM 4IBGA 3L28A 3SHFA 3T15A 2AHMA 3KOWE 2ZM6M 3LQQA 4MB7A 3VDPA 1IN8A 3EIEA 4RF1A 3SAUA 3TPZA 3HU2A 1HT2E 4FCVA 1N34M 1NJFA 3HU3A 2F5QA 7CATA 3SBJA 4OVZA 3TQSA 5EP2A 2Z4SA 1GL7A 3SAVA 3U6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K47 A;  3HHZ A;  3HHW A; 
#chains in the Genus database with same CATH topology
 1W5T A;  1G8P A;  2QZ4 A;  4B7H A;  2ZTC A;  1DGG A;  1GVN A;  2JY6 B;  5EXS A;  1YE9 A;  4LCB A;  3U6Q A;  2CV1 A;  3GP1 A;  5E6J A;  2NQ8 C;  1TH3 A;  3SMS A;  3PNV A;  3Q8G A;  2CV0 A;  4OU7 A;  1PJQ A;  4AKG A;  3TWK A;  3AL0 C;  2KXE A;  2K47 A;  2QHO B;  4D80 A;  5EJC A;  3I4V A;  1IN4 A;  4GH9 A;  4BBA A;  1D2N A;  1NNU C;  3FTC A;  4DR1 M;  4JI2 M;  4JYA M;  4HLQ A;  1YLA A;  3E9S A;  2XZU A;  4W5W A;  5LMU M;  4L8R C;  1EE8 A;  3A45 A;  3HU1 A;  1AUA A;  3M0E A;  2MJ5 B;  5ITX E;  3W68 A;  2X8A A;  4X64 M;  3GLF B;  3IHP A;  1QAO A;  1K3X A;  3RGP A;  1N33 M;  2J7O A;  5FTL A;  4PD2 A;  1QQW A;  3I04 M;  5EP4 A;  1QUS A;  2VF7 A;  5KPZ A;  3ILK A;  4II7 A;  1E32 A;  1V33 A;  2EKF A;  3K9P A;  2XZF A;  3E46 A;  3J27 B;  3LVV A;  4JN6 A;  3A42 A;  2EKK A;  3CTW B;  2EUC A;  3GQ4 A;  4PCZ A;  4LZZ A;  4FD2 A;  2JZ1 A;  4QOZ C;  1IN5 A;  2XFT A;  2DWL A;  3L26 A;  3GPY A;  1DO0 A;  4IIW A;  1RU3 A;  2QSF X;  3LMM A;  1K3W A;  3T38 A;  3J2P B;  2Y21 A;  3DA1 A;  3HJS A;  2CWB A;  2WSF F;  3GLG A;  5FSW A;  1IXS B;  3GLI E;  3DZD A;  4AG6 A;  5JI2 E;  5FLX S;  2K9D A;  2O5R A;  1IQP A;  3SC3 A;  4LFC M;  2R18 A;  4AKI A;  5FTM A;  1XWI A;  1NVM A;  1WXQ A;  3WHL A;  2DWM A;  1P3Q Q;  4LFA M;  4LFB M;  1VEK A;  1HJP A;  3VDU A;  1HR0 M;  1QUT A;  2LHG A;  3PNY A;  4B08 A;  4RF0 A;  2QNJ A;  2Z8Y M;  2CHQ A;  4NSO B;  3UJN A;  1K82 A;  4NXM M;  5H37 D;  4MGZ E;  1Q02 A;  1TH4 A;  3KXE C;  2YNM D;  3HGI A;  1SXJ B;  5FTJ A;  1ZQ9 A;  2DZN B;  3KP1 E;  1NV8 A;  2ZTD A;  4S12 A;  5A2Q S;  2Z7J A;  2L7H A;  1Z5C A;  3HWS A;  1HQY E;  2C98 A;  3RGS A;  2CFO A;  2XH9 A;  3KFU G;  2A5Y B;  2KA6 B;  3T6P A;  3J80 S;  5ITR A;  4G3O A;  4TUW A;  4LJ5 A;  1ZMV A;  5EXT A;  2D7H A;  3HY5 A;  4PDI A;  2OQ4 A;  2Y20 A;  4DV4 M;  3VFD A;  3WHK A;  1KFV A;  1E9S A;  2KHH A;  4JI5 M;  2MGW A;  3GLH E;  1L2B A;  4P17 A;  4DUY M;  5DYG A;  1DGF A;  4I5S A;  1Z5B A;  2DZL A;  2JNH A;  2L7I A;  1JR3 E;  1IXZ A;  3FUT A;  3W0F A;  1MX0 A;  5BPV A;  4DR6 M;  4MM3 B;  4JI6 M;  1ZMW A;  5KPR A;  4GKK M;  3HKP A;  2QCU A;  3ZC7 B;  2MH8 A;  5KQD A;  3GLI B;  2CUZ A;  1N75 A;  4IJE A;  1F4I A;  1L2D A;  3SMP A;  1IFY A;  2R4E A;  4NC6 A;  2LTU A;  4KO8 A;  4X66 M;  5IRE B;  2G5G X;  3FYD A;  4KOD A;  3C3E A;  4A3V B;  2CHV A;  3MK6 A;  5EP1 A;  2F5S A;  2QEN A;  1G71 A;  3C3D A;  2XSZ D;  1VDD A;  2Z4R A;  1TTE A;  3KOX E;  4FW9 A;  5L8R F;  2C99 A;  2V6Z M;  3FTD A;  1VQ1 A;  2DWZ B;  3GPX A;  4MH0 E;  1XNR M;  4PDG A;  2YFQ A;  1D0M A;  2BNK A;  2KRK A;  3R9X B;  4IBB A;  2DXI A;  4JI4 M;  3BXW A;  3U6S A;  1IBM M;  2BWE A;  1XXH E;  2RRU A;  1G3I A;  3SAR A;  2C96 A;  2G3Q A;  1G59 A;  3SAT A;  2JA2 A;  1HT1 E;  2Z3X A;  4DV6 M;  3C58 A;  1FNN A;  2JWS A;  2X49 A;  4LF4 M;  3M7G A;  4CIS A;  1Z6T A;  3AOE A;  1YSY A;  2CHG A;  2EO2 A;  1IXS A;  3KDS E;  3GLH B;  4JI7 M;  1W5S A;  3GRU A;  4IBJ A;  4JI3 M;  3B7Z A;  4GHA A;  1NSF A;  4MGH A;  3U6E A;  2JZ0 A;  4LF8 M;  4LF7 M;  2OOB A;  2MR9 A;  3JR5 A;  1N77 A;  5BR8 M;  4XBO A;  4NOO B;  5IWA M;  3KP0 E;  4GC5 A;  4LF5 M;  2LVQ D;  2R6F A;  2LXE A;  1L8Q A;  1SXJ A;  2R46 A;  2UUB M;  1WGL A;  3LW5 F;  2HAK A;  1IY1 A;  1MN3 A;  3D8B A;  2ZAM A;  4G4O A;  5F3W A;  5ITX A;  3GQ3 A;  5GKN A;  5FTK A;  2ERC A;  2DVW B;  2KEB A;  1LV7 A;  1NHG C;  4I4L A;  4UN2 B;  2C9C A;  4PT5 A;  1SXJ D;  3I01 M;  2OPF A;  3U6C A;  1PM5 A;  1FJG M;  1PGY A;  1XMQ M;  1OTR A;  3A98 B;  2LWX A;  3CF2 A;  3FYC A;  3IG5 A;  5IT9 S;  1UM8 A;  4G4R A;  1Z5A A;  3GRR A;  4DUZ M;  3HHY A;  4G4N A;  1WR1 B;  1MU5 A;  2BJV A;  4GIP A;  2I7N A;  1XXH B;  2JY8 A;  2K0B X;  3KW6 A;  1E9R A;  3CF6 E;  3ZQJ A;  1VEJ A;  4RNA A;  2DNA A;  2UUC M;  1J7K A;  3U6M A;  1C7Y A;  4ZPX A;  1G41 A;  3PFI A;  4MGI E;  4QNM A;  3KOY E;  4JI8 M;  1HNX M;  4NRW A;  2N35 A;  4IBE A;  4QNR A;  4BLC A;  3U60 B;  1ZMU A;  3I51 A;  3TE6 A;  3THG A;  2F5O A;  3GLI A;  2DAK A;  4G4Q A;  4FWG A;  3U6O A;  1L1T A;  4G6Z A;  1T3T A;  1XC8 A;  1N78 A;  3TWM A;  2UU9 M;  1GO5 A;  4XGI A;  3E21 A;  4JV5 M;  4IBC A;  2LH0 A;  4OW0 A;  3U6P A;  2FNA A;  3M6A A;  3NBI A;  2FFJ A;  1R2Z A;  1WHC A;  2FH0 A;  3VK8 A;  2QBY B;  1IM2 A;  3PXG A;  2KZS A;  5KQ8 A;  3HHX A;  1GJT A;  1S3S A;  3FUX A;  1QAN A;  3D8L A;  3QYB A;  1XNQ M;  1X37 A;  2J7N A;  5DYI A;  4REZ A;  4AW4 A;  5ITQ A;  4DV1 M;  2V1U A;  4X62 M;  3T1H M;  2XFS A;  4Z6Y A;  2YQZ A;  3JAM S;  1I94 M;  3U61 B;  2YR0 A;  1D0K A;  4I81 A;  4LJ6 A;  3W67 A;  4CIZ A;  2EA0 A;  4IBI A;  4DV0 M;  3KSJ A;  1N36 M;  2H1R A;  1NV9 A;  1SXJ C;  2DHY A;  4AI6 A;  4DV3 M;  3J7A S;  2F5P A;  1DV0 A;  1BVS A;  1J09 A;  1IY0 A;  1QDR A;  4HL4 A;  3LCV B;  1QAM A;  2LVO C;  3HX3 A;  2M5Z A;  3GLH A;  4LF9 M;  4JXJ A;  5LMN M;  4Q7J A;  4L15 A;  1JQJ C;  1JR3 A;  2KNA A;  2L2D A;  3VKG A;  4FCW A;  3JR4 A;  1UFZ A;  3MHV C;  2Y0T A;  2DHR A;  3DFZ A;  4DBG B;  2L4F A;  1HQC A;  2HWJ A;  4AZF A;  1TR8 A;  1TDH A;  1N32 M;  5ITU A;  2JXN A;  2J5Y A;  2RGO A;  3GRY A;  3T1Y M;  4ITQ A;  4KLN A;  5EQT A;  5EXX A;  2R4J A;  1YUB A;  2KDL A;  1WJ7 A;  3KSX A;  4M9Z A;  3TWL A;  3OTO M;  4DV5 M;  1TH2 A;  2DAG A;  2QPA A;  1XMO M;  4F1I A;  2KNV A;  3AV0 A;  1KYI A;  3Q8X A;  4L78 A;  3A46 A;  4NRV A;  3CF0 A;  4LJ9 A;  3FTE A;  3KS4 A;  4WUR A;  2R44 A;  4WP2 A;  2D7E A;  2UUA M;  2KNZ A;  4LY6 A;  3SFZ A;  3GPU A;  1VG5 A;  1XXH A;  1E94 E;  3L25 A;  1Z59 A;  3L2A A;  4M9X A;  1OFH A;  3SHG B;  1OKS A;  4LGY A;  3GLF E;  2HHH M;  2LVP C;  4B7G A;  1ZAE A;  1OAI A;  3HJQ A;  4GRI A;  1T6O A;  2B3T A;  4NSR A;  3K9O A;  3SAW A;  2ZAO A;  4M0W A;  5FTN A;  2W82 A;  4WW0 A;  4K0K M;  3QAU A;  1KSF X;  3U60 A;  4B7F A;  1L2C A;  3FRI A;  2M60 A;  3BBZ A;  3I4Y A;  1EFU B;  1NY5 A;  5KO3 A;  3FUU A;  1EIJ A;  4DR3 M;  2LVN C;  4I8O A;  4CHT B;  1VDL A;  4EIW A;  5C1B A;  1ORY B;  2R45 A;  3K2L A;  3DOA A;  3VLF B;  1OJL A;  2R0I A;  2H5X A;  2WSC F;  3ZCB B;  2LHC A;  4LGM A;  1HNW M;  5IZ7 D;  3U5Z B;  2QBY A;  1WGN A;  3UMM A;  2UXC M;  3HZJ A;  1R6B X;  2JY5 A;  3H4J A;  1XHB A;  1ZV1 A;  2CP8 A;  4L4U A;  2G8L A;  1DGH B;  1GKI A;  4M0D A;  2I7P A;  4QHS A;  1Q39 A;  2HL7 A;  4XK8 F;  4IBK A;  4JI0 M;  1Q3C A;  4NL4 H;  5DNY A;  1SG9 A;  1HNZ M;  3SYK A;  3J81 S;  2ZAN A;  3KS8 A;  1PRB A;  4IJF A;  3FTF A;  3U61 A;  2WSE F;  2VQE M;  1L1Z A;  3CGW A;  1GL6 A;  3GRV A;  1J5E M;  3SAS A;  2L09 A;  2GNO A;  3AKZ A;  4R7G A;  3H4M A;  4AG5 A;  1PJT A;  2DEN A;  1SXJ E;  3LVW A;  5EXP A;  3GQ5 A;  4CJ6 A;  1D0L A;  2K6B A;  2XF3 A;  3FUW A;  4QOS A;  4NXN M;  2QQ8 A;  3L29 A;  2CE7 A;  1GLN A;  2BWB A;  3UK6 A;  2R62 A;  4HEO A;  2JP7 A;  2RKO A;  2X4A A;  2BJW A;  1PJS A;  1OAO C;  2KW0 A;  1IXR C;  3R8F A;  2C5R A;  4X65 M;  3KVW A;  2OO9 A;  2L4E A;  3SYL A;  1GAB A;  2C9O A;  2XLJ A;  3UZU A;  4OX9 M;  2D7G A;  2HCB A;  5DFL A;  1H6U A;  4AKH A;  3IEC A;  2F4V M;  1NHW C;  4LF6 M;  1T43 A;  4KT0 F;  3FUV A;  3VKH A;  2LVA A;  4R3D A;  3ZH9 B;  4YY3 M;  3AOE C;  4F2L A;  1V92 A;  2VF8 A;  2DKL A;  3AJI B;  2P5T A;  3AOG A;  3NWL A;  4LZJ A;  3B9P A;  1PJI A;  1A5T A;  1OFI A;  2XEP A;  1QAQ A;  3B74 A;  4D82 A;  3GLG E;  1MJG M;  1WIV A;  4DR2 M;  4R71 A;  3FKE A;  3K92 A;  1PJJ A;  4OVZ B;  1TGU A;  2JY7 A;  2EJS A;  4GC9 A;  1NY6 A;  4DV7 M;  3AFH A;  3MMP A;  3LQR A;  2DI0 A;  1IBL M;  4B3M M;  1G4A E;  3J7B A;  5EP3 A;  4GHL A;  4GMQ A;  4L6V 6;  4QHT A;  2L6O A;  3U6L A;  2ZBK B;  4FWH A;  4MGK E;  3VK7 A;  1TDZ A;  4LG2 A;  1GJS A;  1IBK M;  3FD9 A;  1C1K A;  4ANR A;  2MRO B;  2LNH C;  3W0L B;  4IBD A;  4D81 A;  1OIP A;  1VEG A;  4AQY M;  5C18 A;  3K8Z A;  4MGY E;  2UXB M;  4GKJ M;  3QWL A;  2FS1 A;  3FE3 A;  3V76 A;  2LBC A;  4P16 A;  5JI3 E;  1QVR A;  4DR5 M;  3TL4 X;  3RE8 A;  2KRU A;  8CAT A;  3KOZ E;  1R7R A;  3GO8 A;  4DR4 M;  2RGH A;  4M9S A;  2O01 F;  2O25 A;  1R2Y A;  2FE8 A;  3U5Z A;  2DWN A;  5ITT A;  2XGN A;  4FVM A;  1XB2 B;  4L16 A;  4GIT A;  4LJA A;  3GPP A;  1Q3B A;  1JR3 D;  1R4G A;  3MJ5 A;  4LJ4 A;  3RFW A;  2UXD M;  1DGH A;  4LRS A;  3E4R A;  2DZO B;  4FCT A;  5KPT A;  2KZU A;  3HJ8 A;  4LJ8 A;  1CUK A;  4YHH M;  4Y28 F;  1NO1 A;  4DV2 M;  4B3S M;  1NJG A;  1IN6 A;  3C9P A;  5E26 A;  3BOS A;  5ITY A;  1Y8G A;  2Q2E B;  2WZJ A;  3LCU A;  3HHW A;  2FOI C;  2OOA A;  4FWD A;  1NNJ A;  4B3R M;  3B7N A;  2APL A;  3B89 A;  3GLG B;  3QYE A;  2CV2 A;  4B3T M;  2CEA A;  4Z8X A;  4BB9 A;  2VQF M;  2R65 A;  2XSZ A;  4JI1 M;  1IY2 A;  3UGJ A;  1I4W A;  1R5L A;  1AIP C;  3EIH A;  1DGB A;  2F5N A;  4KHP M;  1JB0 F;  2DAM A;  4IBF A;  4DR7 M;  3K1J A;  1OIZ A;  1LTM A;  3GLF A;  2V1C A;  3PVS A;  3F92 A;  1IN7 A;  4LRT A;  2CRU A;  3FRH A;  2Y0Q A;  2HKJ A;  1DO2 A;  4CGY B;  3HHZ A;  1QDT A;  1QYR A;  1V34 A;  2QP9 X;  4RKU F;  1QZM A;  2VII A;  3IG8 A;  3L27 A;  3NBX X;  4LJ7 A;  2E5L M;  1TF0 B;  4IBG A;  3L28 A;  3SHF A;  3T15 A;  2AHM A;  3KOW E;  2ZM6 M;  3LQQ A;  2DAE A;  2GQF A;  4MB7 A;  3VDP A;  1IN8 A;  3EIE A;  4RF1 A;  3SAU A;  2JUJ A;  3TPZ A;  3HU2 A;  2VDB B;  1HT2 E;  1QZE A;  4FCV A;  1NJF A;  1N34 M;  3HU3 A;  2F5Q A;  7CAT A;  1OQY A;  4GEW A;  3SBJ A;  3B7Q A;  4OVZ A;  3TQS A;  5EP2 A;  2DAI A;  2Z4S A;  1GL7 A;  3SAV A;  3U6D A; 
#chains in the Genus database with same CATH homology
 1W5T A;  1G8P A;  2QZ4 A;  4B7H A;  1DGG A;  1GVN A;  5EXS A;  1YE9 A;  4LCB A;  3U6Q A;  2CV1 A;  3GP1 A;  5E6J A;  2NQ8 C;  1TH3 A;  3SMS A;  3PNV A;  2CV0 A;  4OU7 A;  4AKG A;  3TWK A;  2KXE A;  2K47 A;  4D80 A;  5EJC A;  3I4V A;  1IN4 A;  4GH9 A;  4BBA A;  1D2N A;  1NNU C;  3FTC A;  4DR1 M;  4JI2 M;  4JYA M;  4HLQ A;  3E9S A;  2XZU A;  4W5W A;  5LMU M;  4L8R C;  1EE8 A;  3A45 A;  3HU1 A;  3M0E A;  5ITX E;  4X64 M;  3GLF B;  3AL0 C;  2X8A A;  4GKJ M;  1QAO A;  1K3X A;  3RGP A;  1N33 M;  2J7O A;  5FTL A;  4PD2 A;  1QQW A;  5EP4 A;  5KPZ A;  3ILK A;  4II7 A;  1E32 A;  2XZF A;  3J27 B;  3LVV A;  4JN6 A;  3A42 A;  3CTW B;  2EUC A;  3GQ4 A;  4PCZ A;  4LZZ A;  4FD2 A;  4QOZ C;  1IN5 A;  2XFT A;  2DWL A;  3L26 A;  3GPY A;  1DO0 A;  4IIW A;  3LMM A;  1K3W A;  3T38 A;  3J2P B;  2Y21 A;  3DA1 A;  3HJS A;  3GLG A;  5FSW A;  1IXS B;  3DZD A;  4AG6 A;  5JI2 E;  5FLX S;  2O5R A;  1IQP A;  3SC3 A;  4LFC M;  2R18 A;  4AKI A;  5FTM A;  1XWI A;  1NVM A;  1WXQ A;  3WHL A;  2DWM A;  4LFB M;  4LFA M;  3VDU A;  1HR0 M;  4B08 A;  3PNY A;  4RF0 A;  4NSO B;  2CHQ A;  3UJN A;  1K82 A;  4NXM M;  5H37 D;  4MGZ E;  1TH4 A;  3KXE C;  2YNM D;  3HGI A;  1SXJ B;  5FTJ A;  1ZQ9 A;  2DZN B;  3KP1 E;  4S12 A;  5A2Q S;  2Z7J A;  2L7H A;  1Z5C A;  3HWS A;  1HQY E;  2C98 A;  3RGS A;  2CFO A;  2XH9 A;  3KFU G;  2A5Y B;  2KA6 B;  3J80 S;  5ITR A;  4TUW A;  4LJ5 A;  5EXT A;  2D7H A;  4PDI A;  2OQ4 A;  2Y20 A;  4DV4 M;  3VFD A;  3WHK A;  1KFV A;  1E9S A;  4JI5 M;  1L2B A;  4DUY M;  5DYG A;  1DGF A;  4I5S A;  1Z5B A;  2L7I A;  3FUT A;  3W0F A;  1IXZ A;  5BPV A;  4DR6 M;  1MX0 A;  4MM3 B;  4JI6 M;  5KPR A;  4GKK M;  3HKP A;  2QCU A;  3ZC7 B;  5KQD A;  3GLI B;  2CUZ A;  1N75 A;  4IJE A;  1L2D A;  3SMP A;  2R4E A;  4X66 M;  4KO8 A;  5IRE B;  2G5G X;  3FYD A;  4KOD A;  4A3V B;  2CHV A;  3MK6 A;  5EP1 A;  2F5S A;  2QEN A;  2XSZ D;  1VDD A;  2Z4R A;  3KOX E;  4FW9 A;  2C99 A;  2V6Z M;  3FTD A;  2DWZ B;  3GPX A;  4MH0 E;  1XNR M;  4PDG A;  2YFQ A;  3R9X B;  2BNK A;  2KRK A;  4IBB A;  2DXI A;  4JI4 M;  3U6S A;  1IBM M;  3SAR A;  1G3I A;  2C96 A;  3SAT A;  1G59 A;  2JA2 A;  1HT1 E;  2Z3X A;  4DV6 M;  3C58 A;  1FNN A;  2X49 A;  4LF4 M;  3M7G A;  4CIS A;  1Z6T A;  3AOE A;  1YSY A;  2CHG A;  2EO2 A;  3KDS E;  3GLH B;  4JI7 M;  1W5S A;  3GRU A;  4IBJ A;  4JI3 M;  4GHA A;  1NSF A;  4MGH A;  3U6E A;  4LF8 M;  4LF7 M;  3JR5 A;  1N77 A;  5BR8 M;  4XBO A;  4NOO B;  5IWA M;  3KP0 E;  4GC5 A;  4LF5 M;  2LXE A;  1L8Q A;  1SXJ A;  2R46 A;  2UUB M;  1IY1 A;  3D8B A;  2ZAM A;  4G4O A;  5F3W A;  5ITX A;  3GQ3 A;  5GKN A;  5FTK A;  2ERC A;  2DVW B;  2KEB A;  1LV7 A;  1NHG C;  4I4L A;  2C9C A;  4PT5 A;  1SXJ D;  1PM5 A;  2OPF A;  3U6C A;  1FJG M;  1XMQ M;  3A98 B;  2LWX A;  3CF2 A;  3FYC A;  3IG5 A;  5IT9 S;  1UM8 A;  4G4R A;  1Z5A A;  3GRR A;  4DUZ M;  3HHY A;  4G4N A;  1MU5 A;  2BJV A;  4GIP A;  2I7N A;  1XXH B;  3KW6 A;  1E9R A;  3CF6 E;  4RNA A;  2UUC M;  1J7K A;  3U6M A;  4ZPX A;  1G41 A;  3PFI A;  4MGI E;  4QNM A;  3KOY E;  4JI8 M;  1HNX M;  4NRW A;  4IBE A;  4QNR A;  4BLC A;  3U60 B;  3I51 A;  3TE6 A;  3THG A;  2F5O A;  3GLI A;  4G4Q A;  4FWG A;  3U6O A;  1L1T A;  4G6Z A;  1T3T A;  1N78 A;  3TWM A;  2UU9 M;  4XGI A;  4JV5 M;  4IBC A;  2LH0 A;  4OW0 A;  3U6P A;  2FNA A;  3M6A A;  3NBI A;  2FFJ A;  1R2Z A;  3VK8 A;  2QBY B;  1IM2 A;  3PXG A;  2KZS A;  5KQ8 A;  3HHX A;  1S3S A;  3FUX A;  1QAN A;  3D8L A;  1XNQ M;  1X37 A;  2J7N A;  5DYI A;  4REZ A;  4AW4 A;  5ITQ A;  4DV1 M;  2V1U A;  4X62 M;  3T1H M;  2XFS A;  4Z6Y A;  2YQZ A;  3JAM S;  1I94 M;  3U61 B;  2YR0 A;  4LJ6 A;  4I81 A;  2EA0 A;  4IBI A;  4DV0 M;  3KSJ A;  1N36 M;  2H1R A;  1SXJ C;  4AI6 A;  4DV3 M;  3J7A S;  2F5P A;  1J09 A;  1IY0 A;  4HL4 A;  1QAM A;  2M5Z A;  3GLH A;  4LF9 M;  4JXJ A;  5LMN M;  4L15 A;  1JQJ C;  1JR3 A;  3VKG A;  4FCW A;  3JR4 A;  3MHV C;  2Y0T A;  2DHR A;  3DFZ A;  1HQC A;  4AZF A;  1N32 M;  1TDH A;  5ITU A;  2RGO A;  3GRY A;  3T1Y M;  4ITQ A;  4KLN A;  5EQT A;  5EXX A;  2R4J A;  1YUB A;  3KSX A;  4M9Z A;  3TWL A;  3OTO M;  4DV5 M;  1TH2 A;  1XMO M;  2QPA A;  3AV0 A;  1KYI A;  3Q8X A;  4L78 A;  3A46 A;  4NRV A;  3CF0 A;  4LJ9 A;  3FTE A;  3KS4 A;  4WUR A;  2D7E A;  2UUA M;  3SFZ A;  4LY6 A;  3GPU A;  1XXH A;  1E94 E;  3L25 A;  1Z59 A;  3L2A A;  4M9X A;  1OFH A;  3SHG B;  4LGY A;  2HHH M;  4B7G A;  1ZAE A;  4NSR A;  3HJQ A;  4GRI A;  3SAW A;  2ZAO A;  4M0W A;  5FTN A;  2W82 A;  4WW0 A;  4K0K M;  3QAU A;  1KSF X;  3U60 A;  4B7F A;  1L2C A;  2M60 A;  3I4Y A;  1NY5 A;  5KO3 A;  3FUU A;  4DR3 M;  4I8O A;  4CHT B;  4EIW A;  5C1B A;  1ORY B;  2R45 A;  3K2L A;  3DOA A;  3VLF B;  1OJL A;  3ZCB B;  4LGM A;  1HNW M;  5IZ7 D;  3U5Z B;  2QBY A;  2UXC M;  3UMM A;  1R6B X;  1XHB A;  4L4U A;  2G8L A;  1DGH B;  1GKI A;  4M0D A;  2I7P A;  4QHS A;  1Q39 A;  2HL7 A;  1HNZ M;  4IBK A;  4JI0 M;  1Q3C A;  4NL4 H;  5DNY A;  3SYK A;  3J81 S;  2ZAN A;  3KS8 A;  4IJF A;  3FTF A;  3U61 A;  2VQE M;  1L1Z A;  1GL6 A;  3GRV A;  1J5E M;  3SAS A;  2L09 A;  3AKZ A;  4R7G A;  3H4M A;  4AG5 A;  1SXJ E;  3LVW A;  5EXP A;  3GQ5 A;  3FUW A;  4QOS A;  2XF3 A;  4NXN M;  3L29 A;  2CE7 A;  1GLN A;  3UK6 A;  2R62 A;  2RKO A;  2X4A A;  2BJW A;  2KW0 A;  3R8F A;  1IXR C;  2C5R A;  4X65 M;  3KVW A;  3SYL A;  2C9O A;  2XLJ A;  3UZU A;  4OX9 M;  2D7G A;  2HCB A;  1H6U A;  4AKH A;  2F4V M;  1NHW C;  4LF6 M;  3FUV A;  3VKH A;  4R3D A;  3ZH9 B;  4YY3 M;  3AOE C;  3AJI B;  3AOG A;  2P5T A;  3NWL A;  4LZJ A;  3B9P A;  1PJI A;  1OFI A;  2XEP A;  1QAQ A;  4D82 A;  4DR2 M;  3FKE A;  3K92 A;  1PJJ A;  4OVZ B;  1TGU A;  4GC9 A;  1NY6 A;  4DV7 M;  3AFH A;  1IBL M;  3LQR A;  4B3M M;  1G4A E;  3J7B A;  5EP3 A;  4GHL A;  4GMQ A;  4QHT A;  3U6L A;  2L6O A;  3VK7 A;  2ZBK B;  4FWH A;  4MGK E;  1TDZ A;  4LG2 A;  1IBK M;  3FD9 A;  1C1K A;  2LNH C;  3W0L B;  4IBD A;  4D81 A;  4AQY M;  5C18 A;  3K8Z A;  4MGY E;  2UXB M;  3QWL A;  4P16 A;  5JI3 E;  1QVR A;  4DR5 M;  3TL4 X;  3RE8 A;  2KRU A;  8CAT A;  3KOZ E;  1R7R A;  3GO8 A;  4DR4 M;  2RGH A;  4M9S A;  1R2Y A;  2FE8 A;  3U5Z A;  2DWN A;  5ITT A;  2XGN A;  4FVM A;  4L16 A;  3GPP A;  4GIT A;  4LJA A;  1XC8 A;  1Q3B A;  1JR3 D;  3MJ5 A;  4LJ4 A;  3RFW A;  2UXD M;  1DGH A;  4LRS A;  3E4R A;  2DZO B;  4FCT A;  5KPT A;  2KZU A;  3HJ8 A;  4LJ8 A;  4YHH M;  4B3S M;  4DV2 M;  1NJG A;  1IN6 A;  5E26 A;  3BOS A;  5ITY A;  2Q2E B;  3HHW A;  2FOI C;  4FWD A;  1NNJ A;  4B3R M;  3GLG B;  2CV2 A;  4B3T M;  2CEA A;  4Z8X A;  4BB9 A;  2VQF M;  2R65 A;  2XSZ A;  4JI1 M;  1IY2 A;  3UGJ A;  1I4W A;  3EIH A;  2F5N A;  1DGB A;  4KHP M;  4IBF A;  4DR7 M;  3K1J A;  3GLF A;  2V1C A;  3PVS A;  1IN7 A;  4LRT A;  2Y0Q A;  2HKJ A;  1DO2 A;  4CGY B;  3HHZ A;  1QYR A;  2QP9 X;  1QZM A;  2VII A;  3IG8 A;  3L27 A;  4LJ7 A;  2E5L M;  4IBG A;  3L28 A;  3SHF A;  3T15 A;  2AHM A;  3KOW E;  2ZM6 M;  3LQQ A;  4MB7 A;  3VDP A;  1IN8 A;  3EIE A;  4RF1 A;  3SAU A;  3TPZ A;  3HU2 A;  1HT2 E;  4FCV A;  1N34 M;  1NJF A;  3HU3 A;  2F5Q A;  7CAT A;  3SBJ A;  4OVZ A;  3TQS A;  5EP2 A;  2Z4S A;  1GL7 A;  3SAV A;  3U6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...