3HHZA

Complex of the vesicular stomatitis virus nucleocapsid and the nucleocapsid-binding domain of the phosphoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
AVSDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/rna
molecule keywords Phosphoprotein
publication title Structure of the vesicular stomatitis virus nucleocapsid in complex with the nucleocapsid-binding domain of the small polymerase cofactor, P.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
total genus 9
structure length 73
sequence length 73
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhzA00
2K47A 3HHZA 3HHWA
chains in the Genus database with same CATH superfamily
1EIJA 3HY5A 3GLIA 3T1YM 4MM3B 4FW9A 2JNHA 3B7NA 5E6JA 1K3WA 3ZC7B 1IBLM 4D80A 1KYIA 2BNKA 2UUBM 4W5WA 1VEKA 3K9OA 5LMNM 1ZQ9A 4IJEA 2QBYA 1UM8A 1XXHE 4FCWA 4LJ4A 2LVQD 1C1KA 1JQJC 1L2BA 1PJQA 1WJ7A 4TUWA 2LWXA 1IN8A 2JP7A 3KOZE 3K2LA 3FTCA 5E26A 1V33A 2HL7A 2XSZA 2XH9A 2DWMA 3GRYA 1NV9A 4S12A 1IXRC 3I51A 1EE8A 3CTWB 3IG5A 1QZMA 1R6BX 2EA0A 3L25A 4M0WA 4LF5M 1Z5CA 1OIZA 3HU2A 5IZ7D 1YLAA 2NQ8C 4Q7JA 5ITRA 4YHHM 2E5LM 1NY5A 4MB7A 4LJ9A 1HJPA 3FRHA 4DUZM 3KXEC 2UXDM 2FNAA 3LMMA 2Y21A 4FWGA 3W68A 3AKZA 4G6ZA 1HNXM 3E9SA 4OX9M 2DZNB 3GQ5A 2F5OA 4QNRA 2R45A 1IQPA 3BOSA 3U5ZA 1J5EM 3AV0A 1E9SA 3QYBA 3T6PA 4DV2M 1R4GA 2ZBKB 4NL4H 2KZUA 3B89A 2DWZB 5LMUM 1TF0B 3FTEA 4JI1M 5KO3A 1D0LA 3GPYA 3GLFA 3KDSE 5DYGA 1W5TA 1GABA 1N75A 2QPAA 1E32A 2JWSA 3NBXX 2WSEF 2CRUA 2DAGA 3WHKA 2M60A 4M0DA 4BLCA 4QHTA 2Z4RA 3U61A 3U6QA 1QAQA 3U6OA 2R6FA 3B74A 5EJCA 5KQDA 3U6SA 4GC5A 2DAEA 3W67A 1GLNA 2FOIC 2QP9X 2Z4SA 1E94E 2J5YA 4KT0F 3W0FA 4RNAA 2Z8YM 4G4QA 1K82A 3SARA 3KS8A 2JXNA 3UZUA 1SXJD 2CP8A 3U6EA 1PJSA 3DZDA 1ORYB 1TH3A 2OO9A 2J7OA 4IBIA 1NNUC 4B3RM 1G4AE 2DNAA 2G3QA 3GLGE 3RE8A 3UK6A 4JI5M 2L09A 1GL6A 2JUJA 1J7KA 1MN3A 2L7HA 3D8LA 5ITXA 1PM5A 1IM2A 2F4VM 1G8PA 3GQ3A 3KOXE 5EXPA 3JAMS 3LQQA 1H6UA 1OQYA 3DA1A 3LQRA 3L29A 2KNAA 3OTOM 4RF1A 3SAWA 5BPVA 2KRUA 4DV1M 1JR3E 2RGOA 1R2YA 2K6BA 3GLHB 4LCBA 1HNZM 5KPTA 2CUZA 2C98A 2O01F 2WZJA 3J80S 2FS1A 2L2DA 1IBMM 2DENA 1IXSB 1HR0M 4OU7A 3KW6A 1Q02A 1D0MA 2CEAA 1HNWM 1L1ZA 3ZCBB 1DV0A 2L6OA 4M9ZA 3GPUA 2GQFA 1HQCA 4G4RA 4YY3M 2JY8A 1OTRA 3KVWA 3SAUA 4ANRA 3TWLA 2K47A 4IBKA 4RKUF 4DR2M 1TR8A 3MK6A 2QQ8A 4MGZE 4RF0A 1IFYA 1G71A 4B3MM 1L2CA 3PVSA 5F3WA 1TGUA 3C58A 1PJIA 3GPXA 3HJQA 4D81A 1XWIA 1N34M 1GJTA 2KNVA 4AKIA 3VKHA 2CV1A 4X66M 3LVVA 3HHZA 3VKGA 1Q39A 1S3SA 4AKHA 2XF3A 5FTNA 4MGIE 1QDRA 2A5YB 4CGYB 4IBGA 4LF7M 3SC3A 1XMOM 1NV8A 4JYAM 1DGFA 3I4YA 3GRVA 4OVZB 1TTEA 3U6LA 2LTUA 3IHPA 1HQYE 2C9CA 4LJ7A 3TWMA 3VK7A 3R9XB 3GLHA 3T1HM 1HT2E 4GC9A 2CV0A 1XXHB 2N35A 3F92A 1ZMVA 4HL4A 2LNHC 1IXSA 1N36M 2JZ1A 3TL4X 3ZQJA 3J27B 3VLFB 3PNYA 2XFSA 4LY6A 1WGLA 2KXEA 3ZH9B 1DGHA 4A3VB 3LCUA 5EP4A 1WXQA 4FD2A 3GLIE 2DHYA 3SATA 2D7GA 3CGWA 4QOZC 3SASA 3L2AA 1NJFA 5ITYA 2QHOB 2OOAA 4GEWA 3GQ4A 2DWNA 4R7GA 4HLQA 2ZTDA 1YSYA 5EXTA 2MJ5B 1QZEA 4LF6M 1Z59A 1SXJE 4PD2A 4REZA 2DVWB 3CF0A 1NHGC 4IBEA 4MGYE 1IY1A 4B7GA 3GRUA 4JI7M 8CATA 2I7PA 4G4NA 2R62A 2EKKA 3A98B 2H1RA 1DGGA 3FYDA 1D0KA 4IBDA 4AZFA 4PCZA 3GPPA 3J7AS 3V76A 2J7NA 2HWJA 2QCUA 1BVSA 4JV5M 2ERCA 3FYCA 3KOWE 2FH0A 1XXHA 3CF2A 3IECA 3J7BA 3K8ZA 2LVOC 3RGSA 4G4OA 4JXJA 4IJFA 3KOYE 4QOSA 1QUTA 2F5SA 1VEGA 3HHXA 4IIWA 3U60B 2JY7A 3LW5F 3VFDA 3U6CA 3E46A 1NVMA 3QYEA 4P16A 2KEBA 3HJSA 3FUWA 1SG9A 3QWLA 4MH0E 3E21A 4FWHA 4LGYA 2DWLA 3GLGB 4F2LA 4LFAM 1I4WA 1L2DA 1XNRM 4LJAA 3GRRA 3H4JA 4DR5M 4JI3M 3Q8XA 2CV2A 3AJIB 2C9OA 3HJ8A 1HT1E 4XGIA 2GNOA 2Z7JA 3GP1A 2HHHM 4JI2M 5ITQA 2UXBM 4JI0M 2UUCM 2OQ4A 5IWAM 3I4VA 3CF6E 3AFHA 4LZZA 4DV3M 4NRVA 2L4EA 2L7IA 1WIVA 2CE7A 4II7A 4L4UA 2VQFM 2HKJA 1P3QQ 2MR9A 1AUAA 2XFTA 2K0BX 4MGKE 2F5NA 1OIPA 3AL0C 1N32M 1DO2A 3C9PA 4GIPA 2XSZD 3NBIA 3PXGA 1T43A 1V34A 3BXWA 5DFLA 5ITXE 1MJGM 3A42A 4LF8M 1D2NA 1NSFA 2DAIA 3U6MA 3I01M 1VEJA 3KFUG 3FD9A 4CHTB 3AOEC 4FWDA 1IXZA 3TQSA 4MGHA 3JR4A 2DHRA 2ZTCA 3M0EA 3T38A 3HKPA 1R7RA 3U60A 1Q3BA 1I94M 1IN5A 2V1UA 4GKKM 1RU3A 2HCBA 2RKOA 2XZUA 2LHCA 2RRUA 1C7YA 1JB0F 3TWKA 1UFZA 2R4EA 2JA2A 4WURA 2L4FA 3HGIA 2VQEM 4M9XA 2MH8A 1ZAEA 3WHLA 4CISA 2HAKA 4P17A 5EP2A 4JN6A 2XEPA 3H4MA 3EIHA 2CHVA 2KRKA 4FCTA 4CJ6A 3VDPA 4R3DA 4ITQA 1JR3A 2ZM6M 2B3TA 2DAKA 3FTDA 1GKIA 3MHVC 1QQWA 4M9SA 4DUYM 3M6AA 5ITUA 1Z6TA 3BBZA 1TH2A 2EJSA 3DOAA 4LF9M 4Z6YA 2KDLA 4R71A 4CIZA 4WW0A 4B7FA 3VK8A 1VDLA 2KA6B 2YFQA 2VF7A 1DO0A 1GVNA 4DR4M 1YUBA 1AIPC 2QSFX 4DR7M 5DYIA 4LFCM 1N78A 4I4LA 1WHCA 3B7QA 4QHSA 4BB9A 3U6PA 2DXIA 3GO8A 3GLIB 1TDHA 2V6ZM 1Z5AA 3EIEA 3I04M 2OPFA 2BWEA 3LCVB 3LVWA 4DV4M 2H5XA 2W82A 5L8RF 2UU9M 5FSWA 4LJ6A 2ZANA 2APLA 3QAUA 4XBOA 5GKNA 1GJSA 1PGYA 3A46A 2MROB 4GKJM 2XZFA 3KP1E 4NOOB 3HHWA 3M7GA 1SXJB 5FTMA 4B08A 1G41A 3SYLA 1NNJA 2Y20A 2G5GX 4BBAA 4PT5A 1MX0A 2X8AA 4WP2A 1G59A 2Y0TA 4IBCA 2X4AA 4IBBA 1LTMA 3SHGB 1QVRA 1QUSA 4QNMA 1OAIA 2R46A 2VIIA 4JI4M 3K92A 4AI6A 3MMPA 1GO5A 4GHLA 5FTJA 1TH4A 1EFUB 2C96A 4KODA 2BWBA 1FNNA 4DR3M 2R4JA 4L16A 3VDUA 4IBJA 3A45A 1X37A 2V1CA 2CHGA 4GRIA 1F4IA 1IY0A 5IREB 4XK8F 4Y28F 3PNVA 1VDDA 3FRIA 4I8OA 4NXMM 3GLFB 4OVZA 1YE9A 2FFJA 1PJJA 2O5RA 2VDBB 2LVPC 2F5QA 3D8BA 4DR1M 2R18A 1A5TA 2KNZA 5C18A 4NC6A 2LXEA 3SBJA 1SXJA 3U61B 1J09A 1SXJC 1VG5A 1XHBA 2X49A 2C5RA 4NSRA 1FJGM 3E4RA 2WSCF 3HU3A 2YR0A 4AKGA 1R5LA 3THGA 2YQZA 4X65M 3SMPA 3GLFE 1QANA 1OAOC 5DNYA 2UXCM 2QZ4A 5KQ8A 4GITA 4B3TM 4LRTA 3SMSA 3PFIA 5ITTA 3IG8A 4IBFA 2LVAA 3KP0E 4LGMA 3RGPA 1WGNA 2Y0QA 2DAMA 3HZJA 5EXSA 1OFIA 4B3SM 1PRBA 4Z8XA 2R0IA 1WR1B 1T6OA 1N33M 3B9PA 4LJ8A 4DV6M 4FCVA 4X62M 7CATA 2CFOA 4L8RC 4GMQA 5A2QS 2DKLA 2XLJA 4X64M 1OKSA 3FUTA 2F5PA 4JI6M 2JY5A 1IY2A 1QDTA 2CWBA 5EP3A 2OOBA 5KPZA 3AOEA 2LBCA 4DV0M 4NRWA 4JI8M 3J2PB 4KO8A 5IT9S 2KZSA 3B7ZA 2DZLA 2LH0A 3C3DA 3UGJA 2MGWA 2R65A 1GL7A 1QAMA 3FE3A 4UN2B 3C3EA 1CUKA 4NXNM 2DI0A 2P5TA 3K9PA 2M5ZA 4AW4A 2D7HA 4G3OA 5C1BA 4PDIA 1L1TA 4LG2A 1R2ZA 3KS4A 2ZAMA 3U6DA 3SHFA 2EKFA 3GLGA 4OW0A 2CHQA 3J81S 3DFZA 3HX3A 1QYRA 3T15A 2LVNC 2BJVA 4L15A 4AG6A 2KW0A 3AOGA 4LJ5A 3ILKA 3TE6A 2ZAOA 3L26A 3SFZA 1IN6A 4LFBM 1DGBA 4GH9A 3RFWA 3FUVA 1L8QA 3MJ5A 4NSOB 4DBGB 3FTFA 2YNMD 1KSFX 3UMMA 1Z5BA 4B7HA 1XB2B 2LHGA 1T3TA 1Q3CA 2DZOB 5KPRA 1IN4A 1N77A 1NJGA 2XGNA 1PJTA 1IN7A 2KHHA 5H37D 3Q8GA 3UJNA 4HEOA 5JI2E 1IBKM 4KLNA 4L6V6 1DGHB 1K3XA 5FTLA 1ZMWA 4K0KM 3NWLA 5FTKA 4D82A 2EUCA 3L28A 2AHMA 4LZJA 4KHPM 5FLXS 1W5SA 4AG5A 2FE8A 3FUUA 2JY6B 3GLHE 2Q2EB 5EXXA 2Z3XA 4DV7M 2QBYB 3HU1A 4I5SA 4F1IA 3HWSA 2QENA 4DV5M 3R8FA 4LRSA 3SYKA 1Y8GA 4EIWA 2BJWA 4DR6M 3HHYA 1NY6A 2O25A 4I81A 4L78A 4AQYM 4ZPXA 1XC8A 2D7EA 2WSFF 3SAVA 1KFVA 1NO1A 5BR8M 1ZV1A 1OJLA 2C99A 2G8LA 2VF8A 1QAOA 1TDZA 2JZ0A 2R44A 4FVMA 1ZMUA 3FUXA 5EP1A 3K1JA 4GHAA 2RGHA 1VQ1A 3JR5A 4LF4M 3L27A 2UUAM 5JI3E 3KSXA 1E9RA 5EQTA 4PDGA 2K9DA 1XMQM 2I7NA 1JR3D 1NHWC 1MU5A 3FKEA 3KSJA 2EO2A 1XNQM 3TPZA 1OFHA 1LV7A 2QNJA 3U5ZB 1V92A 1G3IA 3W0LB
chains in the Genus database with same CATH topology
3GLIA 3T1YM 4MM3B 4FW9A 5E6JA 1IBLM 1K3WA 3ZC7B 4D80A 1KYIA 2BNKA 2UUBM 4W5WA 5LMNM 1ZQ9A 4IJEA 2QBYA 1UM8A 4FCWA 4LJ4A 1C1KA 1JQJC 1L2BA 4TUWA 2LWXA 1IN8A 3KOZE 3K2LA 3FTCA 5E26A 2HL7A 2XSZA 2XH9A 2DWMA 3GRYA 4S12A 1IXRC 3I51A 1EE8A 3CTWB 3IG5A 1QZMA 1R6BX 2EA0A 3L25A 4M0WA 4LF5M 1Z5CA 3HU2A 5IZ7D 2NQ8C 5ITRA 2E5LM 4YHHM 1NY5A 4MB7A 4LJ9A 4DUZM 3KXEC 2UXDM 2FNAA 3LMMA 2Y21A 4FWGA 4OX9M 3AKZA 4G6ZA 1HNXM 3E9SA 2DZNB 3GQ5A 2F5OA 4QNRA 2R45A 1IQPA 3BOSA 3U5ZA 1J5EM 3AV0A 1E9SA 4DV2M 2ZBKB 4NL4H 2KZUA 5LMUM 2DWZB 3FTEA 4JI1M 5KO3A 3GPYA 3GLFA 3KDSE 5DYGA 1W5TA 1N75A 2QPAA 1E32A 3WHKA 2M60A 4M0DA 4BLCA 4QHTA 2Z4RA 3U61A 3U6QA 1QAQA 3U6OA 5EJCA 5KQDA 3U6SA 4GC5A 1GLNA 2FOIC 2QP9X 2Z4SA 1E94E 3W0FA 4G4QA 1K82A 4RNAA 3SARA 3KS8A 3UZUA 1SXJD 3U6EA 3DZDA 1ORYB 1TH3A 2J7OA 4IBIA 1NNUC 4B3RM 1G4AE 3RE8A 3UK6A 4JI5M 2L09A 1GL6A 5ITXA 1J7KA 2L7HA 3D8LA 1PM5A 1IM2A 2F4VM 1G8PA 3GQ3A 3KOXE 5EXPA 3JAMS 3LQQA 1H6UA 3DA1A 3LQRA 3L29A 3OTOM 4RF1A 3SAWA 5BPVA 2KRUA 4DV1M 2RGOA 1R2YA 4LCBA 3GLHB 1HNZM 5KPTA 2CUZA 2C98A 3J80S 1IBMM 1IXSB 1HR0M 4OU7A 3KW6A 2CEAA 1HNWM 1L1ZA 3ZCBB 2L6OA 4M9ZA 3GPUA 1HQCA 4G4RA 4YY3M 3KVWA 3SAUA 3TWLA 2K47A 4IBKA 4DR2M 3MK6A 4MGZE 4RF0A 4B3MM 1L2CA 3PVSA 5F3WA 1TGUA 3C58A 1PJIA 3GPXA 3HJQA 4D81A 1XWIA 1N34M 3VKHA 4AKIA 2CV1A 4X66M 3LVVA 3HHZA 3VKGA 1Q39A 1S3SA 4AKHA 2XF3A 5FTNA 4MGIE 2A5YB 4CGYB 4IBGA 4LF7M 3SC3A 1XMOM 4JYAM 1DGFA 3I4YA 3GRVA 4OVZB 3U6LA 3VK7A 3R9XB 1HQYE 2C9CA 4LJ7A 3TWMA 3GLHA 3T1HM 1HT2E 4GC9A 2CV0A 1XXHB 4HL4A 2LNHC 1N36M 3TL4X 3J27B 3VLFB 3PNYA 2XFSA 4LY6A 2KXEA 3ZH9B 4A3VB 1DGHA 1KFVA 5EP4A 1WXQA 4FD2A 3SATA 2D7GA 4QOZC 3SASA 3L2AA 1NJFA 5ITYA 3GQ4A 2DWNA 4R7GA 4HLQA 1YSYA 5EXTA 4LF6M 1Z59A 1SXJE 4PD2A 4REZA 2DVWB 3CF0A 1NHGC 4IBEA 4MGYE 1IY1A 4B7GA 3GRUA 4JI7M 8CATA 2I7PA 4G4NA 2R62A 3A98B 2H1RA 1DGGA 3FYDA 4IBDA 4AZFA 3GPPA 4PCZA 3J7AS 2J7NA 2QCUA 4JV5M 2ERCA 3FYCA 3KOWE 1XXHA 3CF2A 3J7BA 3K8ZA 3RGSA 4G4OA 4JXJA 4IJFA 3KOYE 4QOSA 2F5SA 3HHXA 4IIWA 3U60B 3VFDA 3U6CA 1NVMA 4P16A 2KEBA 3HJSA 3FUWA 3QWLA 4MH0E 4FWHA 4LGYA 2DWLA 3GLGB 4LFAM 1I4WA 1L2DA 1XNRM 4LJAA 3GRRA 4DR5M 4JI3M 3Q8XA 2CV2A 3AJIB 2C9OA 3HJ8A 1HT1E 4XGIA 2Z7JA 3GP1A 2UXBM 2HHHM 4JI2M 5ITQA 4JI0M 2UUCM 2OQ4A 5IWAM 3I4VA 3CF6E 3AFHA 4LZZA 4DV3M 4NRVA 2L7IA 4L4UA 2CE7A 4II7A 2VQFM 2HKJA 2XFTA 4MGKE 2F5NA 3AL0C 1N32M 1DO2A 4GIPA 2XSZD 3NBIA 3PXGA 5ITXE 4LF8M 3A42A 1D2NA 1NSFA 3U6MA 3KFUG 3FD9A 4CHTB 3AOEC 4FWDA 1IXZA 3TQSA 4MGHA 3JR4A 2DHRA 3M0EA 3T38A 3HKPA 1R7RA 3U60A 1Q3BA 1I94M 1IN5A 2V1UA 4GKKM 2HCBA 2RKOA 2XZUA 3TWKA 2R4EA 2JA2A 4WURA 3HGIA 2VQEM 4M9XA 1ZAEA 3WHLA 4CISA 5EP2A 4JN6A 2XEPA 3H4MA 3EIHA 2CHVA 2KRKA 4FCTA 3VDPA 4R3DA 4ITQA 1JR3A 2ZM6M 3FTDA 1GKIA 3MHVC 1QQWA 4M9SA 4DUYM 3M6AA 5ITUA 1Z6TA 1TH2A 3DOAA 4LF9M 4Z6YA 4WW0A 4B7FA 3VK8A 2KA6B 2YFQA 1DO0A 1GVNA 4DR4M 1YUBA 4DR7M 5DYIA 4LFCM 1N78A 4I4LA 4QHSA 3U6PA 4BB9A 2DXIA 3GO8A 3GLIB 1TDHA 2V6ZM 1Z5AA 3EIEA 2OPFA 3LVWA 4DV4M 2W82A 2UU9M 5FSWA 4LJ6A 2ZANA 3QAUA 4XBOA 5GKNA 3A46A 4GKJM 2XZFA 3KP1E 4NOOB 3HHWA 3M7GA 1SXJB 5FTMA 4B08A 1G41A 3SYLA 1NNJA 2Y20A 2G5GX 4BBAA 4PT5A 1MX0A 2X8AA 1G59A 2Y0TA 4IBCA 2X4AA 4IBBA 3SHGB 1QVRA 4QNMA 2R46A 2VIIA 4JI4M 3K92A 4AI6A 4GHLA 5FTJA 1TH4A 2C96A 4KODA 1FNNA 4DR3M 2R4JA 4L16A 3VDUA 4IBJA 3A45A 1X37A 2V1CA 2CHGA 4GRIA 1IY0A 5IREB 3PNVA 1VDDA 4NXMM 4I8OA 3GLFB 4OVZA 1YE9A 2FFJA 1PJJA 2O5RA 2F5QA 3D8BA 4DR1M 2R18A 5C18A 2LXEA 3SBJA 1SXJA 3U61B 1J09A 1SXJC 1XHBA 2X49A 2C5RA 4NSRA 1FJGM 3E4RA 3HU3A 2YR0A 4AKGA 3THGA 2YQZA 4X65M 3SMPA 1QANA 2UXCM 5DNYA 2QZ4A 5KQ8A 4GITA 4B3TM 4LRTA 3SMSA 3PFIA 5ITTA 3IG8A 4IBFA 3KP0E 4LGMA 3RGPA 2Y0QA 5EXSA 1OFIA 4B3SM 4Z8XA 1N33M 3B9PA 4LJ8A 4DV6M 4FCVA 4X62M 7CATA 2CFOA 4L8RC 4GMQA 5A2QS 2XLJA 4X64M 3FUTA 2F5PA 1IY2A 5EP3A 5KPZA 3AOEA 4DV0M 4NRWA 4JI8M 3J2PB 4KO8A 5IT9S 2KZSA 2LH0A 3UGJA 2R65A 1GL7A 1QAMA 4NXNM 2P5TA 2M5ZA 4AW4A 2D7HA 5C1BA 4PDIA 1L1TA 4LG2A 1R2ZA 3KS4A 2ZAMA 3U6DA 3SHFA 3GLGA 4OW0A 2CHQA 3J81S 3DFZA 1QYRA 3T15A 2BJVA 4L15A 4AG6A 2KW0A 3AOGA 4LJ5A 3ILKA 3TE6A 2ZAOA 3L26A 3SFZA 1IN6A 4LFBM 1DGBA 4GH9A 3RFWA 3FUVA 1L8QA 3MJ5A 4NSOB 3FTFA 2YNMD 1KSFX 3UMMA 1Z5BA 4B7HA 1T3TA 1Q3CA 2DZOB 5KPRA 1IN4A 1N77A 1NJGA 2XGNA 1IN7A 5H37D 3UJNA 1IBKM 5JI2E 4KLNA 1DGHB 1K3XA 5FTLA 4K0KM 3NWLA 5FTKA 4D82A 2EUCA 3L28A 2AHMA 4LZJA 4KHPM 5FLXS 1W5SA 4AG5A 2FE8A 3FUUA 2Z3XA 2QBYB 2Q2EB 5EXXA 4DV7M 4JI6M 3HU1A 4I5SA 3HWSA 2QENA 4DV5M 3R8FA 4LRSA 3SYKA 4EIWA 4DR6M 2BJWA 3HHYA 1NY6A 4L78A 4I81A 4AQYM 1XC8A 4ZPXA 2D7EA 3SAVA 5BR8M 1OJLA 2C99A 2G8LA 1TDZA 1QAOA 4FVMA 3FUXA 5EP1A 3K1JA 4GHAA 2RGHA 3JR5A 4LF4M 3L27A 2UUAM 5JI3E 3KSXA 1E9RA 5EQTA 4PDGA 1XMQM 2I7NA 1JR3D 1NHWC 1MU5A 3FKEA 3KSJA 2EO2A 1XNQM 3TPZA 1OFHA 1LV7A 3U5ZB 1G3IA 3W0LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K47 A;  3HHZ A;  3HHW A; 
#chains in the Genus database with same CATH topology
 1EIJ A;  3HY5 A;  3GLI A;  3T1Y M;  4MM3 B;  4FW9 A;  2JNH A;  3B7N A;  5E6J A;  1K3W A;  3ZC7 B;  1IBL M;  4D80 A;  1KYI A;  2BNK A;  2UUB M;  4W5W A;  1VEK A;  3K9O A;  5LMN M;  1ZQ9 A;  4IJE A;  2QBY A;  1UM8 A;  1XXH E;  4FCW A;  4LJ4 A;  2LVQ D;  1C1K A;  1JQJ C;  1L2B A;  1PJQ A;  1WJ7 A;  4TUW A;  2LWX A;  1IN8 A;  2JP7 A;  3KOZ E;  3K2L A;  3FTC A;  5E26 A;  1V33 A;  2HL7 A;  2XSZ A;  2XH9 A;  2DWM A;  3GRY A;  1NV9 A;  4S12 A;  1IXR C;  3I51 A;  1EE8 A;  3CTW B;  3IG5 A;  1QZM A;  1R6B X;  2EA0 A;  3L25 A;  4M0W A;  4LF5 M;  1Z5C A;  1OIZ A;  3HU2 A;  5IZ7 D;  1YLA A;  2NQ8 C;  4Q7J A;  5ITR A;  4YHH M;  2E5L M;  1NY5 A;  4MB7 A;  4LJ9 A;  1HJP A;  3FRH A;  4DUZ M;  3KXE C;  2UXD M;  2FNA A;  3LMM A;  2Y21 A;  4FWG A;  3W68 A;  3AKZ A;  4G6Z A;  1HNX M;  3E9S A;  4OX9 M;  2DZN B;  3GQ5 A;  2F5O A;  4QNR A;  2R45 A;  1IQP A;  3BOS A;  3U5Z A;  1J5E M;  3AV0 A;  1E9S A;  3QYB A;  3T6P A;  4DV2 M;  1R4G A;  2ZBK B;  4NL4 H;  2KZU A;  3B89 A;  2DWZ B;  5LMU M;  1TF0 B;  3FTE A;  4JI1 M;  5KO3 A;  1D0L A;  3GPY A;  3GLF A;  3KDS E;  5DYG A;  1W5T A;  1GAB A;  1N75 A;  2QPA A;  1E32 A;  2JWS A;  3NBX X;  2WSE F;  2CRU A;  2DAG A;  3WHK A;  2M60 A;  4M0D A;  4BLC A;  4QHT A;  2Z4R A;  3U61 A;  3U6Q A;  1QAQ A;  3U6O A;  2R6F A;  3B74 A;  5EJC A;  5KQD A;  3U6S A;  4GC5 A;  2DAE A;  3W67 A;  1GLN A;  2FOI C;  2QP9 X;  2Z4S A;  1E94 E;  2J5Y A;  4KT0 F;  3W0F A;  4RNA A;  2Z8Y M;  4G4Q A;  1K82 A;  3SAR A;  3KS8 A;  2JXN A;  3UZU A;  1SXJ D;  2CP8 A;  3U6E A;  1PJS A;  3DZD A;  1ORY B;  1TH3 A;  2OO9 A;  2J7O A;  4IBI A;  1NNU C;  4B3R M;  1G4A E;  2DNA A;  2G3Q A;  3GLG E;  3RE8 A;  3UK6 A;  4JI5 M;  2L09 A;  1GL6 A;  2JUJ A;  1J7K A;  1MN3 A;  2L7H A;  3D8L A;  5ITX A;  1PM5 A;  1IM2 A;  2F4V M;  1G8P A;  3GQ3 A;  3KOX E;  5EXP A;  3JAM S;  3LQQ A;  1H6U A;  1OQY A;  3DA1 A;  3LQR A;  3L29 A;  2KNA A;  3OTO M;  4RF1 A;  3SAW A;  5BPV A;  2KRU A;  4DV1 M;  1JR3 E;  2RGO A;  1R2Y A;  2K6B A;  3GLH B;  4LCB A;  1HNZ M;  5KPT A;  2CUZ A;  2C98 A;  2O01 F;  2WZJ A;  3J80 S;  2FS1 A;  2L2D A;  1IBM M;  2DEN A;  1IXS B;  1HR0 M;  4OU7 A;  3KW6 A;  1Q02 A;  1D0M A;  2CEA A;  1HNW M;  1L1Z A;  3ZCB B;  1DV0 A;  2L6O A;  4M9Z A;  3GPU A;  2GQF A;  1HQC A;  4G4R A;  4YY3 M;  2JY8 A;  1OTR A;  3KVW A;  3SAU A;  4ANR A;  3TWL A;  2K47 A;  4IBK A;  4RKU F;  4DR2 M;  1TR8 A;  3MK6 A;  2QQ8 A;  4MGZ E;  4RF0 A;  1IFY A;  1G71 A;  4B3M M;  1L2C A;  3PVS A;  5F3W A;  1TGU A;  3C58 A;  1PJI A;  3GPX A;  3HJQ A;  4D81 A;  1XWI A;  1N34 M;  1GJT A;  2KNV A;  4AKI A;  3VKH A;  2CV1 A;  4X66 M;  3LVV A;  3HHZ A;  3VKG A;  1Q39 A;  1S3S A;  4AKH A;  2XF3 A;  5FTN A;  4MGI E;  1QDR A;  2A5Y B;  4CGY B;  4IBG A;  4LF7 M;  3SC3 A;  1XMO M;  1NV8 A;  4JYA M;  1DGF A;  3I4Y A;  3GRV A;  4OVZ B;  1TTE A;  3U6L A;  2LTU A;  3IHP A;  1HQY E;  2C9C A;  4LJ7 A;  3TWM A;  3VK7 A;  3R9X B;  3GLH A;  3T1H M;  1HT2 E;  4GC9 A;  2CV0 A;  1XXH B;  2N35 A;  3F92 A;  1ZMV A;  4HL4 A;  2LNH C;  1IXS A;  1N36 M;  2JZ1 A;  3TL4 X;  3ZQJ A;  3J27 B;  3VLF B;  3PNY A;  2XFS A;  4LY6 A;  1WGL A;  2KXE A;  3ZH9 B;  1DGH A;  4A3V B;  3LCU A;  5EP4 A;  1WXQ A;  4FD2 A;  3GLI E;  2DHY A;  3SAT A;  2D7G A;  3CGW A;  4QOZ C;  3SAS A;  3L2A A;  1NJF A;  5ITY A;  2QHO B;  2OOA A;  4GEW A;  3GQ4 A;  2DWN A;  4R7G A;  4HLQ A;  2ZTD A;  1YSY A;  5EXT A;  2MJ5 B;  1QZE A;  4LF6 M;  1Z59 A;  1SXJ E;  4PD2 A;  4REZ A;  2DVW B;  3CF0 A;  1NHG C;  4IBE A;  4MGY E;  1IY1 A;  4B7G A;  3GRU A;  4JI7 M;  8CAT A;  2I7P A;  4G4N A;  2R62 A;  2EKK A;  3A98 B;  2H1R A;  1DGG A;  3FYD A;  1D0K A;  4IBD A;  4AZF A;  4PCZ A;  3GPP A;  3J7A S;  3V76 A;  2J7N A;  2HWJ A;  2QCU A;  1BVS A;  4JV5 M;  2ERC A;  3FYC A;  3KOW E;  2FH0 A;  1XXH A;  3CF2 A;  3IEC A;  3J7B A;  3K8Z A;  2LVO C;  3RGS A;  4G4O A;  4JXJ A;  4IJF A;  3KOY E;  4QOS A;  1QUT A;  2F5S A;  1VEG A;  3HHX A;  4IIW A;  3U60 B;  2JY7 A;  3LW5 F;  3VFD A;  3U6C A;  3E46 A;  1NVM A;  3QYE A;  4P16 A;  2KEB A;  3HJS A;  3FUW A;  1SG9 A;  3QWL A;  4MH0 E;  3E21 A;  4FWH A;  4LGY A;  2DWL A;  3GLG B;  4F2L A;  4LFA M;  1I4W A;  1L2D A;  1XNR M;  4LJA A;  3GRR A;  3H4J A;  4DR5 M;  4JI3 M;  3Q8X A;  2CV2 A;  3AJI B;  2C9O A;  3HJ8 A;  1HT1 E;  4XGI A;  2GNO A;  2Z7J A;  3GP1 A;  2HHH M;  4JI2 M;  5ITQ A;  2UXB M;  4JI0 M;  2UUC M;  2OQ4 A;  5IWA M;  3I4V A;  3CF6 E;  3AFH A;  4LZZ A;  4DV3 M;  4NRV A;  2L4E A;  2L7I A;  1WIV A;  2CE7 A;  4II7 A;  4L4U A;  2VQF M;  2HKJ A;  1P3Q Q;  2MR9 A;  1AUA A;  2XFT A;  2K0B X;  4MGK E;  2F5N A;  1OIP A;  3AL0 C;  1N32 M;  1DO2 A;  3C9P A;  4GIP A;  2XSZ D;  3NBI A;  3PXG A;  1T43 A;  1V34 A;  3BXW A;  5DFL A;  5ITX E;  1MJG M;  3A42 A;  4LF8 M;  1D2N A;  1NSF A;  2DAI A;  3U6M A;  3I01 M;  1VEJ A;  3KFU G;  3FD9 A;  4CHT B;  3AOE C;  4FWD A;  1IXZ A;  3TQS A;  4MGH A;  3JR4 A;  2DHR A;  2ZTC A;  3M0E A;  3T38 A;  3HKP A;  1R7R A;  3U60 A;  1Q3B A;  1I94 M;  1IN5 A;  2V1U A;  4GKK M;  1RU3 A;  2HCB A;  2RKO A;  2XZU A;  2LHC A;  2RRU A;  1C7Y A;  1JB0 F;  3TWK A;  1UFZ A;  2R4E A;  2JA2 A;  4WUR A;  2L4F A;  3HGI A;  2VQE M;  4M9X A;  2MH8 A;  1ZAE A;  3WHL A;  4CIS A;  2HAK A;  4P17 A;  5EP2 A;  4JN6 A;  2XEP A;  3H4M A;  3EIH A;  2CHV A;  2KRK A;  4FCT A;  4CJ6 A;  3VDP A;  4R3D A;  4ITQ A;  1JR3 A;  2ZM6 M;  2B3T A;  2DAK A;  3FTD A;  1GKI A;  3MHV C;  1QQW A;  4M9S A;  4DUY M;  3M6A A;  5ITU A;  1Z6T A;  3BBZ A;  1TH2 A;  2EJS A;  3DOA A;  4LF9 M;  4Z6Y A;  2KDL A;  4R71 A;  4CIZ A;  4WW0 A;  4B7F A;  3VK8 A;  1VDL A;  2KA6 B;  2YFQ A;  2VF7 A;  1DO0 A;  1GVN A;  4DR4 M;  1YUB A;  1AIP C;  2QSF X;  4DR7 M;  5DYI A;  4LFC M;  1N78 A;  4I4L A;  1WHC A;  3B7Q A;  4QHS A;  4BB9 A;  3U6P A;  2DXI A;  3GO8 A;  3GLI B;  1TDH A;  2V6Z M;  1Z5A A;  3EIE A;  3I04 M;  2OPF A;  2BWE A;  3LCV B;  3LVW A;  4DV4 M;  2H5X A;  2W82 A;  5L8R F;  2UU9 M;  5FSW A;  4LJ6 A;  2ZAN A;  2APL A;  3QAU A;  4XBO A;  5GKN A;  1GJS A;  1PGY A;  3A46 A;  2MRO B;  4GKJ M;  2XZF A;  3KP1 E;  4NOO B;  3HHW A;  3M7G A;  1SXJ B;  5FTM A;  4B08 A;  1G41 A;  3SYL A;  1NNJ A;  2Y20 A;  2G5G X;  4BBA A;  4PT5 A;  1MX0 A;  2X8A A;  4WP2 A;  1G59 A;  2Y0T A;  4IBC A;  2X4A A;  4IBB A;  1LTM A;  3SHG B;  1QVR A;  1QUS A;  4QNM A;  1OAI A;  2R46 A;  2VII A;  4JI4 M;  3K92 A;  4AI6 A;  3MMP A;  1GO5 A;  4GHL A;  5FTJ A;  1TH4 A;  1EFU B;  2C96 A;  4KOD A;  2BWB A;  1FNN A;  4DR3 M;  2R4J A;  4L16 A;  3VDU A;  4IBJ A;  3A45 A;  1X37 A;  2V1C A;  2CHG A;  4GRI A;  1F4I A;  1IY0 A;  5IRE B;  4XK8 F;  4Y28 F;  3PNV A;  1VDD A;  3FRI A;  4I8O A;  4NXM M;  3GLF B;  4OVZ A;  1YE9 A;  2FFJ A;  1PJJ A;  2O5R A;  2VDB B;  2LVP C;  2F5Q A;  3D8B A;  4DR1 M;  2R18 A;  1A5T A;  2KNZ A;  5C18 A;  4NC6 A;  2LXE A;  3SBJ A;  1SXJ A;  3U61 B;  1J09 A;  1SXJ C;  1VG5 A;  1XHB A;  2X49 A;  2C5R A;  4NSR A;  1FJG M;  3E4R A;  2WSC F;  3HU3 A;  2YR0 A;  4AKG A;  1R5L A;  3THG A;  2YQZ A;  4X65 M;  3SMP A;  3GLF E;  1QAN A;  1OAO C;  5DNY A;  2UXC M;  2QZ4 A;  5KQ8 A;  4GIT A;  4B3T M;  4LRT A;  3SMS A;  3PFI A;  5ITT A;  3IG8 A;  4IBF A;  2LVA A;  3KP0 E;  4LGM A;  3RGP A;  1WGN A;  2Y0Q A;  2DAM A;  3HZJ A;  5EXS A;  1OFI A;  4B3S M;  1PRB A;  4Z8X A;  2R0I A;  1WR1 B;  1T6O A;  1N33 M;  3B9P A;  4LJ8 A;  4DV6 M;  4FCV A;  4X62 M;  7CAT A;  2CFO A;  4L8R C;  4GMQ A;  5A2Q S;  2DKL A;  2XLJ A;  4X64 M;  1OKS A;  3FUT A;  2F5P A;  4JI6 M;  2JY5 A;  1IY2 A;  1QDT A;  2CWB A;  5EP3 A;  2OOB A;  5KPZ A;  3AOE A;  2LBC A;  4DV0 M;  4NRW A;  4JI8 M;  3J2P B;  4KO8 A;  5IT9 S;  2KZS A;  3B7Z A;  2DZL A;  2LH0 A;  3C3D A;  3UGJ A;  2MGW A;  2R65 A;  1GL7 A;  1QAM A;  3FE3 A;  4UN2 B;  3C3E A;  1CUK A;  4NXN M;  2DI0 A;  2P5T A;  3K9P A;  2M5Z A;  4AW4 A;  2D7H A;  4G3O A;  5C1B A;  4PDI A;  1L1T A;  4LG2 A;  1R2Z A;  3KS4 A;  2ZAM A;  3U6D A;  3SHF A;  2EKF A;  3GLG A;  4OW0 A;  2CHQ A;  3J81 S;  3DFZ A;  3HX3 A;  1QYR A;  3T15 A;  2LVN C;  2BJV A;  4L15 A;  4AG6 A;  2KW0 A;  3AOG A;  4LJ5 A;  3ILK A;  3TE6 A;  2ZAO A;  3L26 A;  3SFZ A;  1IN6 A;  4LFB M;  1DGB A;  4GH9 A;  3RFW A;  3FUV A;  1L8Q A;  3MJ5 A;  4NSO B;  4DBG B;  3FTF A;  2YNM D;  1KSF X;  3UMM A;  1Z5B A;  4B7H A;  1XB2 B;  2LHG A;  1T3T A;  1Q3C A;  2DZO B;  5KPR A;  1IN4 A;  1N77 A;  1NJG A;  2XGN A;  1PJT A;  1IN7 A;  2KHH A;  5H37 D;  3Q8G A;  3UJN A;  4HEO A;  5JI2 E;  1IBK M;  4KLN A;  4L6V 6;  1DGH B;  1K3X A;  5FTL A;  1ZMW A;  4K0K M;  3NWL A;  5FTK A;  4D82 A;  2EUC A;  3L28 A;  2AHM A;  4LZJ A;  4KHP M;  5FLX S;  1W5S A;  4AG5 A;  2FE8 A;  3FUU A;  2JY6 B;  3GLH E;  2Q2E B;  5EXX A;  2Z3X A;  4DV7 M;  2QBY B;  3HU1 A;  4I5S A;  4F1I A;  3HWS A;  2QEN A;  4DV5 M;  3R8F A;  4LRS A;  3SYK A;  1Y8G A;  4EIW A;  2BJW A;  4DR6 M;  3HHY A;  1NY6 A;  2O25 A;  4I81 A;  4L78 A;  4AQY M;  4ZPX A;  1XC8 A;  2D7E A;  2WSF F;  3SAV A;  1KFV A;  1NO1 A;  5BR8 M;  1ZV1 A;  1OJL A;  2C99 A;  2G8L A;  2VF8 A;  1QAO A;  1TDZ A;  2JZ0 A;  2R44 A;  4FVM A;  1ZMU A;  3FUX A;  5EP1 A;  3K1J A;  4GHA A;  2RGH A;  1VQ1 A;  3JR5 A;  4LF4 M;  3L27 A;  2UUA M;  5JI3 E;  3KSX A;  1E9R A;  5EQT A;  4PDG A;  2K9D A;  1XMQ M;  2I7N A;  1JR3 D;  1NHW C;  1MU5 A;  3FKE A;  3KSJ A;  2EO2 A;  1XNQ M;  3TPZ A;  1OFH A;  1LV7 A;  2QNJ A;  3U5Z B;  1V92 A;  1G3I A;  3W0L B; 
#chains in the Genus database with same CATH homology
 3GLI A;  3T1Y M;  4MM3 B;  4FW9 A;  5E6J A;  1IBL M;  1K3W A;  3ZC7 B;  4D80 A;  1KYI A;  2BNK A;  2UUB M;  4W5W A;  5LMN M;  1ZQ9 A;  4IJE A;  2QBY A;  1UM8 A;  4FCW A;  4LJ4 A;  1C1K A;  1JQJ C;  1L2B A;  4TUW A;  2LWX A;  1IN8 A;  3KOZ E;  3K2L A;  3FTC A;  5E26 A;  2HL7 A;  2XSZ A;  2XH9 A;  2DWM A;  3GRY A;  4S12 A;  1IXR C;  3I51 A;  1EE8 A;  3CTW B;  3IG5 A;  1QZM A;  1R6B X;  2EA0 A;  3L25 A;  4M0W A;  4LF5 M;  1Z5C A;  3HU2 A;  5IZ7 D;  2NQ8 C;  5ITR A;  2E5L M;  4YHH M;  1NY5 A;  4MB7 A;  4LJ9 A;  4DUZ M;  3KXE C;  2UXD M;  2FNA A;  3LMM A;  2Y21 A;  4FWG A;  4OX9 M;  3AKZ A;  4G6Z A;  1HNX M;  3E9S A;  2DZN B;  3GQ5 A;  2F5O A;  4QNR A;  2R45 A;  1IQP A;  3BOS A;  3U5Z A;  1J5E M;  3AV0 A;  1E9S A;  4DV2 M;  2ZBK B;  4NL4 H;  2KZU A;  5LMU M;  2DWZ B;  3FTE A;  4JI1 M;  5KO3 A;  3GPY A;  3GLF A;  3KDS E;  5DYG A;  1W5T A;  1N75 A;  2QPA A;  1E32 A;  3WHK A;  2M60 A;  4M0D A;  4BLC A;  4QHT A;  2Z4R A;  3U61 A;  3U6Q A;  1QAQ A;  3U6O A;  5EJC A;  5KQD A;  3U6S A;  4GC5 A;  1GLN A;  2FOI C;  2QP9 X;  2Z4S A;  1E94 E;  3W0F A;  4G4Q A;  1K82 A;  4RNA A;  3SAR A;  3KS8 A;  3UZU A;  1SXJ D;  3U6E A;  3DZD A;  1ORY B;  1TH3 A;  2J7O A;  4IBI A;  1NNU C;  4B3R M;  1G4A E;  3RE8 A;  3UK6 A;  4JI5 M;  2L09 A;  1GL6 A;  5ITX A;  1J7K A;  2L7H A;  3D8L A;  1PM5 A;  1IM2 A;  2F4V M;  1G8P A;  3GQ3 A;  3KOX E;  5EXP A;  3JAM S;  3LQQ A;  1H6U A;  3DA1 A;  3LQR A;  3L29 A;  3OTO M;  4RF1 A;  3SAW A;  5BPV A;  2KRU A;  4DV1 M;  2RGO A;  1R2Y A;  4LCB A;  3GLH B;  1HNZ M;  5KPT A;  2CUZ A;  2C98 A;  3J80 S;  1IBM M;  1IXS B;  1HR0 M;  4OU7 A;  3KW6 A;  2CEA A;  1HNW M;  1L1Z A;  3ZCB B;  2L6O A;  4M9Z A;  3GPU A;  1HQC A;  4G4R A;  4YY3 M;  3KVW A;  3SAU A;  3TWL A;  2K47 A;  4IBK A;  4DR2 M;  3MK6 A;  4MGZ E;  4RF0 A;  4B3M M;  1L2C A;  3PVS A;  5F3W A;  1TGU A;  3C58 A;  1PJI A;  3GPX A;  3HJQ A;  4D81 A;  1XWI A;  1N34 M;  3VKH A;  4AKI A;  2CV1 A;  4X66 M;  3LVV A;  3HHZ A;  3VKG A;  1Q39 A;  1S3S A;  4AKH A;  2XF3 A;  5FTN A;  4MGI E;  2A5Y B;  4CGY B;  4IBG A;  4LF7 M;  3SC3 A;  1XMO M;  4JYA M;  1DGF A;  3I4Y A;  3GRV A;  4OVZ B;  3U6L A;  3VK7 A;  3R9X B;  1HQY E;  2C9C A;  4LJ7 A;  3TWM A;  3GLH A;  3T1H M;  1HT2 E;  4GC9 A;  2CV0 A;  1XXH B;  4HL4 A;  2LNH C;  1N36 M;  3TL4 X;  3J27 B;  3VLF B;  3PNY A;  2XFS A;  4LY6 A;  2KXE A;  3ZH9 B;  4A3V B;  1DGH A;  1KFV A;  5EP4 A;  1WXQ A;  4FD2 A;  3SAT A;  2D7G A;  4QOZ C;  3SAS A;  3L2A A;  1NJF A;  5ITY A;  3GQ4 A;  2DWN A;  4R7G A;  4HLQ A;  1YSY A;  5EXT A;  4LF6 M;  1Z59 A;  1SXJ E;  4PD2 A;  4REZ A;  2DVW B;  3CF0 A;  1NHG C;  4IBE A;  4MGY E;  1IY1 A;  4B7G A;  3GRU A;  4JI7 M;  8CAT A;  2I7P A;  4G4N A;  2R62 A;  3A98 B;  2H1R A;  1DGG A;  3FYD A;  4IBD A;  4AZF A;  3GPP A;  4PCZ A;  3J7A S;  2J7N A;  2QCU A;  4JV5 M;  2ERC A;  3FYC A;  3KOW E;  1XXH A;  3CF2 A;  3J7B A;  3K8Z A;  3RGS A;  4G4O A;  4JXJ A;  4IJF A;  3KOY E;  4QOS A;  2F5S A;  3HHX A;  4IIW A;  3U60 B;  3VFD A;  3U6C A;  1NVM A;  4P16 A;  2KEB A;  3HJS A;  3FUW A;  3QWL A;  4MH0 E;  4FWH A;  4LGY A;  2DWL A;  3GLG B;  4LFA M;  1I4W A;  1L2D A;  1XNR M;  4LJA A;  3GRR A;  4DR5 M;  4JI3 M;  3Q8X A;  2CV2 A;  3AJI B;  2C9O A;  3HJ8 A;  1HT1 E;  4XGI A;  2Z7J A;  3GP1 A;  2UXB M;  2HHH M;  4JI2 M;  5ITQ A;  4JI0 M;  2UUC M;  2OQ4 A;  5IWA M;  3I4V A;  3CF6 E;  3AFH A;  4LZZ A;  4DV3 M;  4NRV A;  2L7I A;  4L4U A;  2CE7 A;  4II7 A;  2VQF M;  2HKJ A;  2XFT A;  4MGK E;  2F5N A;  3AL0 C;  1N32 M;  1DO2 A;  4GIP A;  2XSZ D;  3NBI A;  3PXG A;  5ITX E;  4LF8 M;  3A42 A;  1D2N A;  1NSF A;  3U6M A;  3KFU G;  3FD9 A;  4CHT B;  3AOE C;  4FWD A;  1IXZ A;  3TQS A;  4MGH A;  3JR4 A;  2DHR A;  3M0E A;  3T38 A;  3HKP A;  1R7R A;  3U60 A;  1Q3B A;  1I94 M;  1IN5 A;  2V1U A;  4GKK M;  2HCB A;  2RKO A;  2XZU A;  3TWK A;  2R4E A;  2JA2 A;  4WUR A;  3HGI A;  2VQE M;  4M9X A;  1ZAE A;  3WHL A;  4CIS A;  5EP2 A;  4JN6 A;  2XEP A;  3H4M A;  3EIH A;  2CHV A;  2KRK A;  4FCT A;  3VDP A;  4R3D A;  4ITQ A;  1JR3 A;  2ZM6 M;  3FTD A;  1GKI A;  3MHV C;  1QQW A;  4M9S A;  4DUY M;  3M6A A;  5ITU A;  1Z6T A;  1TH2 A;  3DOA A;  4LF9 M;  4Z6Y A;  4WW0 A;  4B7F A;  3VK8 A;  2KA6 B;  2YFQ A;  1DO0 A;  1GVN A;  4DR4 M;  1YUB A;  4DR7 M;  5DYI A;  4LFC M;  1N78 A;  4I4L A;  4QHS A;  3U6P A;  4BB9 A;  2DXI A;  3GO8 A;  3GLI B;  1TDH A;  2V6Z M;  1Z5A A;  3EIE A;  2OPF A;  3LVW A;  4DV4 M;  2W82 A;  2UU9 M;  5FSW A;  4LJ6 A;  2ZAN A;  3QAU A;  4XBO A;  5GKN A;  3A46 A;  4GKJ M;  2XZF A;  3KP1 E;  4NOO B;  3HHW A;  3M7G A;  1SXJ B;  5FTM A;  4B08 A;  1G41 A;  3SYL A;  1NNJ A;  2Y20 A;  2G5G X;  4BBA A;  4PT5 A;  1MX0 A;  2X8A A;  1G59 A;  2Y0T A;  4IBC A;  2X4A A;  4IBB A;  3SHG B;  1QVR A;  4QNM A;  2R46 A;  2VII A;  4JI4 M;  3K92 A;  4AI6 A;  4GHL A;  5FTJ A;  1TH4 A;  2C96 A;  4KOD A;  1FNN A;  4DR3 M;  2R4J A;  4L16 A;  3VDU A;  4IBJ A;  3A45 A;  1X37 A;  2V1C A;  2CHG A;  4GRI A;  1IY0 A;  5IRE B;  3PNV A;  1VDD A;  4NXM M;  4I8O A;  3GLF B;  4OVZ A;  1YE9 A;  2FFJ A;  1PJJ A;  2O5R A;  2F5Q A;  3D8B A;  4DR1 M;  2R18 A;  5C18 A;  2LXE A;  3SBJ A;  1SXJ A;  3U61 B;  1J09 A;  1SXJ C;  1XHB A;  2X49 A;  2C5R A;  4NSR A;  1FJG M;  3E4R A;  3HU3 A;  2YR0 A;  4AKG A;  3THG A;  2YQZ A;  4X65 M;  3SMP A;  1QAN A;  2UXC M;  5DNY A;  2QZ4 A;  5KQ8 A;  4GIT A;  4B3T M;  4LRT A;  3SMS A;  3PFI A;  5ITT A;  3IG8 A;  4IBF A;  3KP0 E;  4LGM A;  3RGP A;  2Y0Q A;  5EXS A;  1OFI A;  4B3S M;  4Z8X A;  1N33 M;  3B9P A;  4LJ8 A;  4DV6 M;  4FCV A;  4X62 M;  7CAT A;  2CFO A;  4L8R C;  4GMQ A;  5A2Q S;  2XLJ A;  4X64 M;  3FUT A;  2F5P A;  1IY2 A;  5EP3 A;  5KPZ A;  3AOE A;  4DV0 M;  4NRW A;  4JI8 M;  3J2P B;  4KO8 A;  5IT9 S;  2KZS A;  2LH0 A;  3UGJ A;  2R65 A;  1GL7 A;  1QAM A;  4NXN M;  2P5T A;  2M5Z A;  4AW4 A;  2D7H A;  5C1B A;  4PDI A;  1L1T A;  4LG2 A;  1R2Z A;  3KS4 A;  2ZAM A;  3U6D A;  3SHF A;  3GLG A;  4OW0 A;  2CHQ A;  3J81 S;  3DFZ A;  1QYR A;  3T15 A;  2BJV A;  4L15 A;  4AG6 A;  2KW0 A;  3AOG A;  4LJ5 A;  3ILK A;  3TE6 A;  2ZAO A;  3L26 A;  3SFZ A;  1IN6 A;  4LFB M;  1DGB A;  4GH9 A;  3RFW A;  3FUV A;  1L8Q A;  3MJ5 A;  4NSO B;  3FTF A;  2YNM D;  1KSF X;  3UMM A;  1Z5B A;  4B7H A;  1T3T A;  1Q3C A;  2DZO B;  5KPR A;  1IN4 A;  1N77 A;  1NJG A;  2XGN A;  1IN7 A;  5H37 D;  3UJN A;  1IBK M;  5JI2 E;  4KLN A;  1DGH B;  1K3X A;  5FTL A;  4K0K M;  3NWL A;  5FTK A;  4D82 A;  2EUC A;  3L28 A;  2AHM A;  4LZJ A;  4KHP M;  5FLX S;  1W5S A;  4AG5 A;  2FE8 A;  3FUU A;  2Z3X A;  2QBY B;  2Q2E B;  5EXX A;  4DV7 M;  4JI6 M;  3HU1 A;  4I5S A;  3HWS A;  2QEN A;  4DV5 M;  3R8F A;  4LRS A;  3SYK A;  4EIW A;  4DR6 M;  2BJW A;  3HHY A;  1NY6 A;  4L78 A;  4I81 A;  4AQY M;  1XC8 A;  4ZPX A;  2D7E A;  3SAV A;  5BR8 M;  1OJL A;  2C99 A;  2G8L A;  1TDZ A;  1QAO A;  4FVM A;  3FUX A;  5EP1 A;  3K1J A;  4GHA A;  2RGH A;  3JR5 A;  4LF4 M;  3L27 A;  2UUA M;  5JI3 E;  3KSX A;  1E9R A;  5EQT A;  4PDG A;  1XMQ M;  2I7N A;  1JR3 D;  1NHW C;  1MU5 A;  3FKE A;  3KSJ A;  2EO2 A;  1XNQ M;  3TPZ A;  1OFH A;  1LV7 A;  3U5Z B;  1G3I A;  3W0L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...