2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
molecule keywords Capsid assembly protein VP3
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2Z7JA 2R18A
chains in the Genus database with same CATH superfamily
2UVRA 3UK6A 1S77D 1P7DA 5KFAA 2KVSA 5KG3A 7ICQA 3VFDA 4DUYM 4NLBA 5ALZA 3TQ1A 3L29A 4QWDA 2QP9X 3N28A 1GJTA 3OPXA 1YZ6A 2DWZB 4EX7A 3F2BA 3GQCA 2WF5A 4M9HA 1W5SA 4NLGA 4NLNA 4JI2M 2IOFA 4DBGB 4CHTB 4O3RA 3AN1A 5EE3A 2KJ9A 2LHGA 2B21A 5DG7A 4GIBA 3U6DA 2OHFA 4FCWA 3M1YA 1ZV1A 1NK0A 1GO5A 1VDVA 2F77X 2RRDA 3GPUA 1WJ7A 2F5NA 1SXJD 5J0RA 5KT5A 2EZZA 3T5JA 1RXWA 4MHVA 2VA8A 4USAA 4B9UA 7ICJA 1A77A 2KZSA 4RNMA 4YQWA 4P0QB 2DUYA 2ZIUA 3V6KA 1GL6A 5HP4A 4WURA 1L3TA 5EWFA 2EDUA 1IXSB 1X9WA 3UQ0A 2K0BX 3AQFA 1PUZA 3T15A 1NK6A 2ZTEA 5FLXS 1QAOA 3NVZA 1SXJB 1S3SA 2FS1A 3TADC 3HP6A 4FZMA 4DOCA 2BQRA 3MGVA 1SZPA 1U4BA 1J2MA 3KFUG 4G4NA 5ALHA 5J2JA 4I27A 3W68A 3G6VA 5AKIA 4C7ZA 4KMOB 2A19A 4GC5A 1D8YA 3E21A 3LQRA 4YD1A 1GKIA 2AGQA 5FTLA 1DGHA 4KLHA 3QYPA 3AFHA 2OM6A 5KFBA 3TFSA 1NK5A 4HL4A 1Z19A 3A0HU 4AG5A 3B7QA 1F5SA 4GXJA 4M9XA 4KN4A 4QZ9A 4DL5A 1ZQCA 4QWCA 4L15A 5CHGA 1QSYA 2RQ5A 5ALJA 4LJAA 1U9LA 3TACB 2HBMA 1LTMA 3QEAZ 1MA7A 8ICYA 4ZPXA 4QOZC 5J2AA 8ICOA 5B66U 3GRRA 4DUZM 1X9MA 3PNYA 2FMQA 1PZNA 4JB3A 1L3UA 1DGHB 4FWHA 4DR3M 4ECWA 4FO6A 3PY8A 5JUMA 1JMSA 4QOSA 1SIJA 2OOBA 3QUBA 5FTJA 3FKEA 2CV2A 5C5JA 3SAWA 3UM9A 2LBOA 3ZDEA 1QAMA 2QNJA 1QSSA 1FEZA 4RQ8A 3LQQA 4X5VA 1FO4A 4DL3A 2AQ0A 1MN3A 3B74A 1NJGA 3ORYA 4PT5A 2EZYA 3ISBA 3M7DA 1SKSA 1L6NA 1AROP 7ICHA 2QSFX 2E5LM 1TK0A 2L5YA 3ICXA 2A5YB 5ALSA 4YR0A 8ICZA 4BB9A 3H4JA 1ZQIA 1ZQVA 4NRWA 8ICUA 2K47A 2KRUA 1TK5A 1L5UA 3E9SA 3Q8RB 4P0PB 7ICRA 3EIEA 3FTEA 3TFRA 2HMXA 4FZNA 1JXLA 2F1JA 1D9FA 2PFPA 3W0LB 2PFQA 3WK5A 4JK1A 8ICXA 1NKEA 5DFLA 2PMZF 1L7OA 1Z1VA 4O3NA 3U5ZA 3AJIB 3T5LA 3J80S 2HBLA 2FFJA 3T1HM 4UATA 1HQYE 2FJ6A 9ICPA 4LRTA 1K82A 2F5SA 1OW5A 4F72A 2IA6A 3RR8A 1X40A 5KG5A 1EE8A 3F2CA 3UMBA 1PJTA 4YXMA 4RQ6A 2LXEA 8CATA 4QZDA 4KLFA 2UUAM 2YB1A 4C4SA 2HI0A 1GVNA 2HBKA 1SZHA 9ICEA 3KW6A 3T5KA 3QZ8A 2I6XA 3ZH9B 1G8PA 1OIPA 2J5YA 2WF9A 3QU2A 2BCRA 2ZANA 1ZXIA 1A0PA 2QB0A 1SGGA 3U6LA 5AIBA 3AUOA 5K4LA 2J7NA 4Y2RA 2QBYA 4I29A 3H4MA 1R2YA 3FUUA 2XF3A 1QDTA 1EIJA 2P66A 1IXRA 4DL6A 4JI5M 5DGBA 2O01F 1NY6A 3CTWB 5EE1A 2UUBM 2K8BB 5KFWA 1OFHA 1SKRA 3BS5B 2CN1A 3KVWA 3KBBA 4ZH4A 5KFMA 5J0YA 3PX4A 1ZQZA 4OX9M 3CNHA 3D6JA 4IIWA 2XY5A 4NLZA 2G5HB 4J9RA 1RM6C 2BJWA 2BWBA 2KMDA 3C23A 1G4AE 4QWBA 3WK8A 4DL4A 4GH9A 5ITUA 4R66A 1LKYA 2C2RA 1ECWA 1NJXA 7ICIA 3OSPA 5HR7A 8ICHA 2JRZA 3HJQA 4KTQA 3KHHA 1L7NA 2DGZA 1WCLA 1XNRM 4IQUA 3G6YA 2XFSA 1D2NA 2WSEF 4RF0A 5AI9A 3A98B 4EEKA 1EFUB 2K4IA 3FTFA 1I4WA 2Q0ZX 1NV8A 5AM0A 2XLJA 3GV8B 3KSJA 5AK6A 3QUCA 1C20A 1XNSA 2G5GX 4ECUA 5CR0A 1T43A 1KN5A 4FCTA 1J09A 8ICGA 5G5HA 4RF1A 4NSRA 2JH7A 3C58A 1WHCA 2N35A 1X6IA 4C8LA 4QZGA 3M0EA 4LJ7A 3SENA 4Q44A 3RB0A 2KIWA 2H5XA 4EBCA 1UT8A 1IBKM 5EWEA 2KFNA 4QWAA 2WZJA 5ALNA 1UQVA 1OQYA 4JI7M 2DHRA 2XY6A 1QSLA 4DQRA 2R8IA 2RRUA 5L1JA 1L2CA 4P4MA 2A3VA 1JUDA 4RQ5A 1TFRA 3QU5A 3I76A 3N7SC 3I04M 1XSPA 3Q8LA 4DO9A 2YY6A 3BXWA 3K1RB 3ZDCA 5DBBA 2LYBA 1PGYA 2VQFM 4M9GA 8ICCA 5DQHA 4NXNM 5KAIU 1RQNA 2PI4A 5J2DA 3T79A 1VEKA 3M9MB 2DAMA 4K0KM 4CGYB 2X4AA 2KJ8A 2HKJA 5FTMA 2NRWA 3HT3A 1XS9D 4L4UA 4HEOA 2VIXA 2CUZA 1KKXA 5IIIA 4J9OA 3MC1A 9ICOA 4KITB 5KTQA 5EXXA 3VK7A 2UXBM 1S0VA 4M6WA 2Z7JA 3E46A 3ILKA 2V6ZM 4NL4H 4OU7A 3KHGA 4UN2B 3QU7A 4NLCA 4G3IA 2XEPA 1TTEA 1JROA 1MQ2A 2VF8A 1WGLA 1N2XA 3BQ7A 4XRHA 2KHVA 4UB5A 2F2AB 4ED2A 1F4IA 3GPXA 2PKEA 2JY5A 1LV7A 3U5ZB 2BCQA 4YVZA 1SXEA 2F4VM 4IBGA 2KHHA 5KFFA 1ZD2P 4L78A 2CRUA 5CJ7A 1SG9A 2DAKA 5AM5A 4M04A 2G8LA 4BWMA 3J27B 7CATA 3U61B 8ICAA 2A1AA 1R5LA 2YN4A 1HNWM 4R64A 2V4RA 1E94E 1NZPA 4QZBA 2VF7A 1ZQAA 4I2EA 2B0CA 1J97A 3NTUA 3UXPA 3AL0B 4X66M 4J9LA 1T3TA 2PFOA 1F0MA 4PZOA 3RAXA 3A45A 3Q8QB 3SAGA 3HRDD 7ICKA 1IV8A 4DV4M 4B3TM 2KSOB 4UBBA 4MGKE 1DV0A 4RQ4A 2F1HA 4LF9M 1JIHA 3J2PB 3QX7A 4F91B 3GILA 1ZQNA 3MDCA 5GKNA 1TDZA 2Z3XA 2DXIA 3MGIA 3J7AS 1KEJA 4Y2SA 1L2DA 2DFLA 3H40A 2XGPA 4EENA 5FTNA 4OW0A 4F2SA 2R6FA 3V7LA 2HOFA 2YB4A 5J2EA 3D8LA 3V72A 2C9CA 3DEEA 5AI6A 5DNYA 1TH3A 1N36M 4UB4A 3MBYA 1IN4A 2HDOA 3HHZA 1NK4A 4OCZA 8ICQA 1WG8A 4UB1A 4WP2A 3N97B 1NNLA 9ICRA 4DLEA 1VG5A 2XCAA 2KEYA 1RG6A 4ELUA 1K1SA 4AKIA 5KT4A 9ICNA 2B3TA 4DFMA 4YD2A 4QIWC 3HPOA 4I2GA 2GLEA 2M5ZA 2D7EA 3PVXA 4DQSA 5AHXA 4EX6A 3SR6A 4UQGA 1KDHA 3B7NA 4C80A 8ICMA 2WHEA 2KK0A 4G3OA 1N5XA 4IJFA 4Y2UA 4ELVA 4IRCA 3J81j 3JPSA 5IINA 4DS4A 5D46A 2KDLA 3SEIA 2W9CB 4DOBA 3PV8A 5BPVA 4Z6EA 4M9JA 2E8MA 4KLJA 3WKDA 4R7GA 3UMMA 2RDJA 4QHTA 1GO3F 7ICSA 2W8LA 1IY2A 3I01M 5JI2E 4M0AA 1L8LA 2Y1JA 2R8HA 2IHMA 2ZIXA 1B43A 4TUPA 3RFAA 4YFKA 3GRUA 4JXJA 5TZVA 5B5EU 3TWLA 8ICRA 2CE7A 9ICSA 3C3EA 1IN5A 1MJGM 4PDGA 2V1CA 5DB9A 2Y0TA 2GQFA 4I28A 2FPKA 5IIJA 9ICWA 2DL0A 4YP3A 4R71A 4GXKA 4MB7A 5H37D 2ZM6M 2W7PA 5F9LA 3B0XA 1RPLA 4QNLA 2QQ8A 2DZNB 4PCZA 2JUJA 5ALMA 5ALPA 2W9CA 1OAOC 2MR9A 4MFFA 1IY0A 1L7MA 2BCUA 2O25A 2FLLA 2HHUA 1NK9A 1ZQJA 4MM3B 3SBJA 4DSLA 1S9FA 3GLIA 2LMRA 5AI4A 3TANA 2R44A 2RGHA 2LYHA 4O3QA 2QLTA 2DPJA 5KT6A 4P0PA 4B7HA 4UB6U 1ED1A 4I2HA 4JI0M 4NV0A 4B6JA 5ALTA 2KXEA 2XSZA 2YMPA 4QWEA 1E9SA 2CPRA 5KFYA 3PSIA 3MDAA 4DSKA 1ZD3A 3ISDA 4YY3M 3SYZA 4JV0A 2MSNA 5KFIA 4MEYA 3RTVA 5DGAA 1NY5A 4RQ1A 3U60A 4GHLA 3WHKA 2L6OA 1N60A 3DV9A 4R8UA 1Z4NA 3ZD9A 3KS4A 2W3RA 2JP7A 4QHSA 3IDWA 2YTUA 5KFRA 1IN7A 4FS1A 3QWLA 1AUAA 3PW7A 4AYBC 3TWKA 4C8NA 7ICTA 1OXJA 1QLNA 2I7PA 4DSEA 3KFUF 1DGFA 4B3RM 4U7CA 1N48A 2VDBB 2MRLA 2HOQA 9ICXA 4ECTA 2BDUA 3AKZA 1ZYQA 3BQ0A 1MN8A 3E4RA 2ZIVB 5LMNM 3UXNA 1JX4A 2ZAOA 2ZXIA 3LWLA 4DS5A 4BBAA 1ZQQA 3RJHA 3FDSA 1HQCA 4LFBM 4TUQA 3DOAA 1G41A 1BPBA 3U6OA 1U48A 4IRKA 3GLFB 2L4EA 3KP0E 2JY6B 2YMMA 1KL9A 4C0ZA 1QVRA 3LVWA 2LNHC 4O3SA 4BXOA 1TH2A 2M60A 2JEJA 2VJ5A 2JY8A 3SV4A 3SHGB 3BS7A 4ECYA 5DQIA 4GLXA 2E8OA 4B7FA 3PR4A 4UAVA 3JPNA 1C1KA 2WAQF 2WTFA 4RQ0A 3DFZA 3JPOA 1PVRA 2C99A 2KE7A 2OOAA 4KX5A 3Q8MA 3BQTA 4I5SA 4JI4M 1Q3VA 5EP4A 2YMQA 1GJSA 1SXJA 1U47A 5F9NA 4UAZA 2HBJA 3GLHA 4IL6U 4UARA 2DAEA 5KAFU 4AYBF 8ICKA 4LFCM 1JXEA 1K5OA 3SC3A 4AI6A 5J2CA 2Y21A 3MABA 5J2KA 4EEYA 2UVVA 4HYKA 2Y20A 4F5QA 1V34A 5DB8A 3N4MB 3TARA 3HKZC 2VIIA 2XY7A 1TAUA 3TE6A 1VQ1A 4AW4A 1TE2A 4B9LA 4Z6FA 2D3DA 5FSWA 1S10A 2I9GA 2H3IA 2LHTA 1RDFA 3IM1A 3BJYA 4KLQA 3L25A 2G08A 4ED0A 4FE3A 2OWOA 2WF6A 4DEZA 1NSFA 4FW9A 2AHMA 3F92A 5KFGA 1IBLM 3LW5F 5EQTA 1T3NA 2AH5A 1M6YA 3F5AA 2ES6A 4RNAA 2R18A 5F3WA 1L1TA 1PM5A 7ICNA 2W55A 1YT3A 2BZFA 4O5CA 3EYZA 2BPFA 1NJZA 4JI6M 5ITXE 2R4JA 2K9DA 2CRXA 5CWRA 5EXTA 1ZD5A 1IG6A 1O03A 3CGWA 1T3QA 3LK9A 1IXRC 4IBJA 2HHXA 5E79U 4GIPA 3C5FA 2MUTA 5KG0A 2P5TA 4R3DA 4Y28F 4TQRA 3PW4A 4A8EA 1IIPA 3OJUA 4NLKA 1EXNA 3TKAA 3Q8SB 3PMNA 1SL0A 1NI3A 2VA3A 3GQ5A 3PSPA 1VDLA 4XA5A 3PW0A 3W67A 2R62A 3GLGE 2W9BA 2ZIWB 3RB4A 9ICCA 3JPQA 1L1ZA 5DBCA 4GC7A 2ZUBA 1ZQMA 3GLFE 3TAQA 1MX0A 4RQMA 2PMZC 3GLHE 5L1MA 3KZXA 4YR3A 4F4WA 2JH1A 3GQ4A 2HAKA 5DB6A 1Q02A 1XSNA 4QZFA 1A6SA 3QU4A 4DV3M 2W7OA 2KNVA 1DK3A 4RT2A 3KHLA 5IREB 2HVHA 2W43A 3ZI4A 4CF5A 1V85A 5DYGA 4DFKA 5L9XA 4CIZA 2XZUA 4RNOA 2NYVA 3T38A 5JRTA 2KD1A 1ZRNA 5FTKA 2JXNA 5L8RF 1XO1A 4PH5A 5C18A 5ALKA 4PJ0U 4I2CA 3MMPA 8ICVA 3FC4A 3GV5B 1NJFA 2ZJ5A 3H4DA 4QIWF 1NO1A 3WKAA 3WU2U 5ALIA 4BWJA 3RJIA 5E26A 1VLBA 3THVA 4RNNA 2KRKA 1Z5CA 4ED6A 4MF2A 3GZFA 1KFVA 2JR5A 1SXJC 2LYAA 9ICAA 4K4GA 4LZGA 4OD0A 3KP1E 3V7KA 3MJ5A 3WHLA 1RYSA 2C9OA 2K8AA 3B89A 1N77A 1HJPA 1PVQA 1G59A 4ECQA 3B9PA 2KTQA 2W03A 3HWTA 2AXTU 3SATA 1COOA 5ALLA 3SARA 3UMGA 2NRZA 4QZAA 2KN7A 1XSLA 2QARA 2LVOC 4LJ5A 5T14A 1HNXM 2QARB 2W9MA 3NVVA 4DFDA 2HSZA 2OYYA 7ICPA 2MAXA 4C7YA 3C1YA 2OH2A 4M0DA 3GV7B 5AKHA 5J8YC 3PW5A 9ICGA 4GFJA 2HVIA 1X2IA 1Q39A 5KPRA 1QQ6A 1YLAA 5KO3A 1X9SA 1TAMA 2L7HA 3GO8A 2M9NA 9ICTA 3TQSA 4RPZA 4ECZA 1HUZA 5C1BA 1Q3CA 4IBDA 1Z00B 3K75D 5J0SA 1KRPA 1CI4A 4TQSA 2ZJ8A 2EA0A 1ZQYA 1YE9A 3J81S 1L3SA 3F5EA 4HAIA 3RH6A 5DDYA 1JALA 5AI5A 4R63A 3CRXA 5IWAM 3N7RC 5EP1A 5AM1A 4JWMA 2CHQA 4Y2PA 5IIMA 4M47A 3MR5A 2EJSA 3K4GA 1ZQEA 1RU3A 1SL2A 9ICQA 1S5LU 4LJ6A 1HIWA 2CFOA 3AOEA 4S12A 2KA6B 3PO4A 1T6OA 2XIDA 2D8CA 2WSFF 2OCEA 3H8SA 1IXSA 3QNMA 2Q4TA 4I8OA 2ZXHA 1V97A 5IIOA 4O3OA 3HWSA 3RRGA 1N5WA 3SMVA 4KLSA 3PNCA 4LFAM 1IFYA 3SAVA 4DLGA 1ZAEA 1WR1B 2QHOB 2YR0A 3QUQA 4B9MA 4KLOA 2JMGA 7ICEA 2JZ1A 2QZ4A 3GLIB 2R46A 4NOOB 2RDIA 2MJ5B 2MU2A 4C4RA 4O5KA 3M9OB 5L1KA 7ICFA 4DV6M 4WW0A 2ASLA 2Y9UA 4DSIA 1A76A 5KFHA 1DGGA 3CP8A 3B7ZA 1UHUA 2NRTA 5ALUA 1S97A 4FBUA 2D6FC 2JGAA 1E9RA 2UVUA 2K4PA 1H38A 1OIZA 5H2FU 2J6SA 1N34M 1N61A 2B6GA 4B9TA 1T8EA 2F76X 3U6QA 3T1YM 2C2DA 1UA1A 1NKCA 3SQIA 1WXQA 1XB2B 2C22A 4B9VA 7ICVA 1D8LA 1S0OA 1UM8A 1IY1A 1UA0A 1SXJE 2R8KA 3LMMA 2Q2EB 4GKKM 1Q8KA 5JTIA 2IOFK 3AL0C 4O0IA 3AOGA 4KODA 1XMQM 3QZ7A 4L6V6 2XICA 1PJJA 4DQIA 4PHEA 2K4EA 3AOEC 1OUQA 1XNQM 3VC8A 3PX6A 4CCHA 2PI5A 1NJYA 2DQNB 1WUDA 4LJXA 5EE0A 4J03A 2LM4A 3C21A 2AGOA 2NRVA 2EH9A 3SYLA 5ITRA 4EZ6A 5A0LA 3NBXX 2FPLA 3OGUA 2L7IA 3U26A 3K92A 2E3TA 3FYHA 2RGOA 4P16A 4UAYA 4DSJA 1Z5BA 1LVHA 1ZJNA 2EO2A 4DQPA 2HHWA 2F44A 4J9NA 1LV5A 1V92A 2KKPA 5DLFA 2BDPA 2WFAA 2KV2A 5ITYA 2CP8A 2G07A 1KYIA 4PHPA 2LWXA 1AQ6A 4LZDA 4RU9A 2BPGA 1JB0F 4TUSA 3PR5B 5BPCA 4IBCA 2DVWB 5KFQA 2E1EA 4Q8FA 4O9MA 1WWUA 1JR3D 5AK5A 1Q3UA 3Q8KA 5AI0A 3M6AA 2HWJA 2YQEA 3K1JA 4KLEA 3HJSA 5L1IA 2F5PA 2BJVA 3ONNA 4GEWA 4YMOA 5KFDA 5J2IA 5DKWA 4GC6A 4D82A 5AM3A 1KFDA 3NUQA 1XXHA 5AKZA 2MROB 3MR2A 3DDHA 1R7RA 2JEFA 4I81A 5J0WA 1D0MA 5L1LA 4DV0M 1Z1BA 7ICGA 5CEHA 4E0DA 1IN6A 3DZDA 4BUGA 2APLA 1XU4A 2DWQA 3MR3A 9ICIA 1QUTA 1SXDA 4O3PA 4CF4A 4NRVA 1K3WA 3NASA 4XQ8A 5KFPA 5KFKA 2DPIA 1JN3A 4K4HA 1ZQ9A 3R9XB 4RT3A 3IRUA 2BCSA 3KOWE 1J7KA 3TWMA 3QU9A 1PRBA 1UCVA 2L4FA 2LVAA 5EP2A 1SV0A 1NK7A 4LG2A 3NS1A 1HUOA 1HT1E 3HU3A 2C98A 3ZC7B 3GLIE 3IP4B 4G4RA 5KG7A 2H3QA 4MF8A 3RJFA 4PHAA 1PJIA 1QZEA 2C96A 4YMMA 3H8JA 3NBIA 2BPCA 4NXMM 1QQ5A 1YUBA 3O0FA 2QBYB 1KFSA 2LHCA 3IHQB 4F92B 8ICSA 2EAMA 1KSPA 1QZMA 3JPPA 2R65A 1FFUA 5DBAA 4PZNA 1Z5AA 2O5RA 2I5HA 2E8PA 4C8OA 4JYAM 3FD9A 4RQ7A 4IRDA 3KHRA 1TKDA 1VEGA 3HU2A 4CGZA 4I2BA 4Z6DA 5J0XA 3TL4X 3R9KA 5CA7A 5AKEA 3IG5A 2PFNA 3BQ2A 3SYKA 3M6KA 2ZJAA 2R4EA 1UPHA 1K3XA 3F53A 2D7HA 2W54A 2Z4RA 3M6ZA 1I94M 4DR7M 4KX3A 2GH1A 4DCCA 4ICAA 1RXVA 3K9PA 4IC9A 2C28A 2FI1A 4NSOB 4F4KA 3FUTA 1PJQA 2FOIC 1QH9A 3H4BA 1BPDA 3ZDAA 1J5EM 5J2HA 3I28A 4FCVA 1LB2B 4KLGA 2PXIA 4FWDA 3FUXA 4LF4M 2ASDA 2KZUA 3BZCA 2R45A 2BGWA 4LJ8A 3VK8A 2EKFA 4UB3A 5D4BA 1DOQA 1NOMA 4EELA 5KFSA 1IM2A 3IG8A 3C29A 3OHBA 5TISU 1TVAA 1IBMM 5GTIU 5AM2A 4FZLA 4HLQA 2FNAA 1Z3EB 3SMSA 4CDGA 4ECVA 2NO4A 4B3MM 3NRZA 3GU3A 2G09A 1QAQA 3C2LA 3FRIA 1WWVA 1WCNA 5KFLA 2WB1F 2ISPA 2H1RA 3RB3A 1ZQKA 1XXHB 5KFXA 2KEBA 3K1ZA 7ICUA 2DI0A 2DHYA 3WK6A 4B7GA 3U60B 1BPXA 2EAPA 2HL7A 4PGQA 3ZDDA 5ALGA 1G71A 2DBYA 1DXSA 4G4QA 2DWLA 1BPZA 3CF0A 3RR7A 4KLUA 1TF0B 1ZETA 4EIWA 2NV3A 3SFZA 4DQQA 4EYHB 4JN6A 3HHWA 2ZIUB 2ZIVA 3F2DA 2DZOB 3RJGA 3KKAA 1ZQLA 2N1RA 2W82A 1KLNA 2L09A 4J9QA 3TADA 2BKEA 4QZHA 3SAFA 2RHFA 5IILA 4NY8A 1NHGC 1KSFX 1CUKA 2JV3A 2OQ4A 2QKQA 1PJSA 3QXGA 5AKJA 3NVYA 1B22A 1XWIA 4MGIE 3C1ZA 3JR4A 3VKGA 1BNOA 2H3ZA 4BX9C 1ZD4A 5LMUM 4GHAA 2DAGA 1QYRA 4KT0F 3U6MA 5KNIA 4UB8U 1O08A 3WKEA 1NV9A 1N63A 2VANA 3FUWA 3U6CA 2WB1C 4PGXA 1XO0A 5DB7A 3ZQJA 4DF8A 3C5GA 4FVMA 3EIHA 4P0QA 4QNRA 1WYGA 3E58A 5ITTA 1DO2A 1JR3A 4IQWA 1SB3C 1L8QA 5KT2A 3LYSA 3C2MA 5HNKA 1N32M 4F2LA 1ZRMA 4JV2A 1XC9A 3PNVA 4MH0E 1Z4OA 1XHBA 1PVPA 5E6JA 5KFOA 4M0WA 1ZQWA 5BOMA 4Q7JA 4M9SA 5KPTA 3KOZE 4R65A 1KBUA 2BQUA 5AI8A 5KG2A 2EUCA 4DR2M 2KOBA 9ICFA 3ZD8A 1QCKA 5J0OA 4QJFB 1QQWA 1MSWD 4RQ3A 1CEZA 1GABA 5J0UA 5J0PA 4F50A 3CYMA 5KT3A 5ALQA 3HJEA 5DLGA 4B3SM 2H3VA 5G5GA 4I2IA 2KNZA 3FAHA 3EZ5A 1SV0C 5KFZA 3G6XA 2W8KA 1N75A 4L8RC 2HCBA 2CXYA 1L2BA 4KHPM 1NKBA 4LCBA 5EP3A 1TAQA 4F71A 1QUSA 1NJWA 2LH0A 2G3QA 1ZQDA 4JV5M 3IECA 5KPZA 4AQYM 3HU1A 2ISOA 4QNMA 4QZEA 3PFIA 4CRXA 3RFWA 2ASJA 2J6TA 2LVPC 2XGNA 3VCBA 4DOAA 4LF7M 4FWGA 5AK3A 2C5RA 3BZKA 2MUTB 1PK3A 3HKPA 2OO9A 4DFPA 1OAIA 3WKBA 3VDUA 3KZIU 4OJPA 2JEIA 1D0KA 3RGSA 1V38A 1K1QA 4JI1M 2RP5A 2FMSA 1Q3BA 3JAMS 3M8SA 1OTRA 2VQEM 5CRXA 3GIMA 3AV0A 1ZQPA 2IMWP 1MC8A 4Y2JA 4XGIA 2YFQA 4F5RA 1ZMUA 9ICMA 5J2FA 2DKZA 8ICLA 5D49A 1V9PA 3V6JA 2O6KA 3OHAA 1B0XA 4B08A 1JI7A 3AU6A 1B4FA 3ETLA 2BWEA 3T6PA 5ITQA 1UFZA 2G06A 5AKLA 4P2HA 5KG1A 3PZPA 1XC8A 8ICEA 4LF6M 2D7GA 3D2QA 4RQNA 1IQPA 3S6JA 5DG9A 2JZBB 2K8CB 4XK8F 4Z8XA 1G3IA 1X42A 4B9SA 3BQ1A 5KFVA 2LVNC 2XVTA 2HHTA 2UUCM 2YNMD 1MQ3A 2ATLA 5KFEA 2ZAMA 3OTOM 3EUB2 3RRHA 5CB1A 3UGJA 4EBDA 2VJ4A 4BDPA 2E1FA 1ZJMA 1T7PA 3H0LB 2LPEA 3ALRA 3QYBA 3TI0A 3LCVB 5EWGA 2XC9A 4LGMA 3HHYA 2F1IA 5AKYA 2Y9TA 4UB2A 9ICKA 4K4IA 5HHIA 3DA1A 2FLNA 4QW8A 1KFTA 5AK4A 3MHVC 4P17A 2RLTA 1TK8A 4OJ6A 4PL1A 3EWAA 1QANA 4G4OA 2JEGA 2QB0B 2HCFA 8ICJA 3KXEC 2HHSA 2VA2A 3D2NA 4ZOHC 5ALXA 2GNOA 3FE3A 3M7GA 2K4HA 4F1IA 4LVSA 4DR1M 2ZTCA 3KOYE 4F5NA 4IQVA 3L3FX 4JV1A 3HX3A 3GPYA 2QCUA 5HMLA 3GLHB 3HJ8A 3ISCA 4YCXA 2A1JB 4UAWA 1QQ7A 2M0NA 4P4OA 4DV1M 4NWIA 3HY5A 3K9OA 1ZQHA 4GKJM 3AM9A 2P6RA 3GIKA 5AICA 1N62A 3L4PA 5BR8M 3EPGA 3HILA 5ALRA 1RZTA 3C3DA 1HNZM 4ANRA 4O3MA 3I4VA 3E0FA 1NVMA 2GWSA 5KFJA 3QAUA 4J9MA 3D2SA 4F4ZA 5KT7A 2Y1IA 2XI9A 1OJLA 5KL1B 3W0FA 3ED5A 4KN7A 4YG2A 1IM4A 4GC9A 4RPYA 3TAPA 2F8LA 2E5SA 4GITA 1LKYB 3JPRA 4IQTA 2AGPA 1OKSA 1S76D 4OO1J 2C2EA 5HR6A 1T94A 3BDPA 2ERCA 4EZ9A 8ICPA 3SHFA 1HEKA 2Y0QA 4Y2YA 2EZXA 1TDHA 2Y0SC 3T5HA 3RH5A 1KQQA 2FLPA 2EKKA 2ODGA 4MGYE 3TPZA 2ZIWA 3IHPA 4II7A 2NRXA 4UW9A 2Z8YM 3RE8A 1ZQOA 2BQ3A 1HT2E 4AG6A 2UXCM 4ED8A 4DF4A 3HHXA 4QZ8A 4KLTA 2XO7A 5KQDA 3L5KA 5AM4A 7ICLA 1N33M 2KZMA 2UXDM 4IR1A 3WK9A 2LKYA 8ICWA 1DO0A 1SWVA 3EPIA 2CHGA 2KICA 9ICBA 2I1QA 4G6ZA 2DF4B 4KLLA 2AJQA 2HHHM 1JR3E 3FYDA 2ZTDA 1ZQFA 1ZQSA 1X9XA 2UVWA 2P35A 1RYRA 2FPMA 1CRXA 4ED7A 2AQ4A 3N7PD 5J8YA 3RJKA 2K60A 4CISA 3LDAA 1GLNA 2DNAA 1ZQRA 2XZFA 2OEHA 1FNNA 1KTQA 3KKAC 3U6SA 3GDXA 5AKXA 2Y0SF 1TR8A 1WIVA 3CF6E 2XGQA 4M9LA 4RUCA 4ELTA 3H0RB 1URJA 5ALDA 3THGA 3H8WA 4BGDA 4BJQA 4Q45A 4GXIA 4J9SA 3FYCA 4PD2A 1U49A 3L2AA 4LRSA 1HR0M 1DRGA 4CF3A 3PMLA 4ECXA 4C4TA 4RUAA 3ZDBA 4RZRA 1YSYA 3RBEA 2DAIA 1VEJA 4M9NA 1D0LA 3SD7A 5FP0A 5IT9S 1D9DA 5KL8B 5DYIA 1L3VA 3U6EA 2JZBA 4IS7A 1Y88A 2YMLA 5ITXA 3HX0A 7ICMA 4YN4A 2HW3A 1D8BA 4OJOA 4LF8M 4Y2QA 3AMZA 3FTDA 2KW0A 4Z6YA 3T3FA 5J0QA 3R8FA 3KDSE 3K8ZA 2F5QA 2V1UA 1ZQUA 1BPEA 1SV4A 4ACOA 3SI8A 2R0IA 2MH8A 4PPXA 3GLGB 3GRYA 4EBEA 4F3OA 4U6PA 3K2LA 1PK1B 3GLGA 3RJEA 1N78A 5DDMA 1X66A 1AIPC 2JY7A 4F5OA 4ED1A 2KVCA 2HHQA 3EW9A 3OJSA 1VJ5A 3RH4A 1WGNA 4F5PA 3RJJA 2XH9A 2KJ5A 1ZMWA 4NXZA 2JXJA 3IN5A 3VLFB 4TURA 3KD3A 1L7PA 3H7IA 2JA2A 4G9BA 1SKWA 2BCVA 2ZG6A 2DWMA 4JUZA 3UZUA 3BS5A 4UASA 4C8MA 5ALEA 4I2FA 1DGBA 2FDRA 3GIIA 3SAUA 3E2EA 1ZQTA 2J7OA 3JR5A 2YQZA 4NL9C 3NWLA 2HOIA 2W11A 1DGSA 1UT5A 5HMMA 4ITQA 3ETRA 5EXSA 3SMPA 3M8RA 3I4YA 4B9NA 3FM9A 4QZIA 3V6HA 2F3NA 3M9NB 8ICIA 3H8MA 3QE9Y 1Z00A 3L26A 2LTUA 4Y2XA 1BPYA 4YMNA 3PVSA 4KLMA 4ED3A 3UQ2A 4IJEA 2W04A 5HHHA 4C8KA 3PSFA 2ZIXB 4FBTA 8ICNA 2CV1A 9ICLA 4Q43A 2FE9A 3KOXE 2K6BA 4M6WB 5F3XB 3ZCBB 2W9AA 3PO5A 2R8GA 5KQ8A 3C28A 3FUVA 3A46A 4I4LA 5IIKA 4JMUA 2YX8A 2LBCA 3L28A 2X8AA 2JZ0A 4NM2A 5KG6A 4M9ZA 4OJLA 1GL7A 2KHQA 4DL7A 1DK2A 4KLDA 3GQ3A 4PL2A 3RB6A 4MGHA 4X64M 3RBDA 2Z4SA 5CP2A 1R2ZA 4F4XA 8ICFA 2FE8A 1ZQXA 3I51A 2X49A 2GO7A 3AU2A 2DENA 3UXOA 2FH0A 5ALOA 2LVQD 1F44A 3CW2C 4IBFA 4IBBA 3AEVA 2KP7A 4EYIB 4I2DA 5KFUA 1BGXT 4RKUF 5GTHU 3NGDA 3RAQA 2EANA 4LF5M 5JI3E 4F93B 4QW9A 1QDRA 1NK8A 1RQLA 3VKHA 1T4GA 2GOLA 5KG4A 4NL9A 4DR6M 4QZCA 4KMUA 4TUWA 1OFIA 5IZ7D 3J7BA 2OXOA 2JHDA 2K89A 3PW2A 5EJCA 3MR6A 4DWIA 4IBEA 2KNJA 4MFCA 3MFHA 3KTQA 4MFAA 3UMCA 2W9BB 1BNPA 3GFKB 4IR9A 4RPXA 2KZ3A 1H6UA 3UJNA 5AKKA 3A42A 2KNAA 4ECSA 2AU0A 1NZBA 2XFTA 2KG5A 7ICOA 1JQJC 2HHVA 2WAQC 1S0NA 4LJ4A 2KFZA 1VDDA 4DSFA 1R4GA 2WF7A 2E8NA 3KS8A 1RYUA 4XBOA 4YHHM 4FFDA 4NC6A 2NQ8C 2XSZD 1FFVA 4LZJA 2QENA 3GLFA 4UAUA 5AIAA 2OPFA 1E32A 5ALWA 4IBIA 3B0YA 3Q8XA 2G0AA 1TGUA 3GPPA 4X62M 5ALFA 3L27A 3CF2A 5J2GA 1BVSA 5KFCA 3U61A 4US9A 1R6BX 2XCPA 3KSXA 2ZBKB 4DR4M 4AP9A 4JWNA 3HKZF 1PK1A 3MK6A 2JWSA 2MGWA 4AZFA 4Y2TA 3NVWA 5J0TA 2IOHA 3GRVA 4PGYA 1FJGM 2IHNA 1XWLA 3IV6A 1JRPA 2JNHA 3OTQA 4REZA 2QB1A 3SV3A 2CWBA 2H3FA 4J9PA 4CE6A 2P6UA 1S0MA 2F5OA 3JPTA 3H0MB 3V7JA 2KSOA 4PHDA 3QUTA 1Q46A 3FRHA 2ESEA 2FMPA 1NHWC 2J6UA 2I7NA 4IBKA 1TH4A 4CNQA 3Q8PB 4Z6CA 3AQEA 1SL1A 4I2AA 2KZZA 3RGPA 3QEBZ 2DWNA 2CHVA 4M2YA 2IBKA 3I1YA 4OJ5A 4FD2A 4LY6A 4MEXA 9ICUA 3BOSA 4W5WA 3VDPA 2BNKA 1SWWA 2EAOA 1IN8A 1XMOM 1J2NA 5ALYA 4LGYA 1C7YA 4RQ2A 1NNJA 1YZ7A 1ZOLA 1V33A 4OVZB 9ICVA 2DKXA 5ALVA 4I2JA 4Y2VA 1ZQBA 9ICJA 4XUSA 4YR2A 5J2BA 1ZMVA 1NNUC 3Q8GA 4ECRA 4OVZA 1A5TA 1XXHE 4DV2M 2F8KA 4F8RA 3LCUA 1L8OA 1X37A 4F2RA 2CEAA 2A1JA 2BHNA 3C9PA 4BXOB 2V9WA 3V76A 4F4YA 3WK4A 1S8OA 2CV0A 3UPQA 3KOOA 5C0YA 3GP1A 2MA1A 2DKLA 3HW8A 5EXPA 3SASA 2QPAA 4MGZE 1COKA 3U6PA 4NJ8A 1N56A 4DL2A 2NO5A 1ZQ1C 3LWMA 1TV9A 2LM1A 5KFTA 4JI3M 4A3VB 1MU5A 2VKQA 4YXJA 3D8BA 5BOLA 4AKGA 8ICBA 4UBCA 3PXGA 2LI6A 3QYEA 2ZUDA 4DR5M 5JU5A 4L16A 4DV5M 5EOZA 3WK7A 2L2DA 4D81A 2BR0A 1FIQA 5AKGA 8ICTA 3PX0A 1ORYB 3FTCA 4D80A 2R8JA 1P3QQ 2AHOB 4LZZA 5A2QS 3C2KA 4P4PA 1Z59A 4J9KA 1DGJA 1X6JA 2W3SA 2UU9M 4R8UB 1IXZA 3LVVA 1QTMA 4KLIA 2ZUCA 1Y8GA 4JI8M 5DQGA 4CJ6A 2KKVA 4US8A 1KW4A 4DFJA 3MFIA 2EQYA 4BLCA 4WJ3B 1W5TA 4DV7M 2KIVA 4KLNA 3NRWA 3WKCA 2DZLA 1U45A 3PSTA 4AKHA 1ZQGA 4LJ9A 2V4QA 4GMQA 4PDIA 5DG8A 5EE9A 9ICHA 3BBZA 3B9JA 2WSCF 3HGIA 3SAHA 5KFNA 4KO8A 2ALZA 4GRIA 4Q8EA 4X65M 3OSNA 3A0BU 3GIJA 2G5IB 3MGHA 4FS2A 2WF8A 4NM1A 5J29A 2RKOA 3RF9A 3HZJA 1Z6TA 4O5EA 3SZ2A
chains in the Genus database with same CATH topology
2L7IA 3K92A 3D2SA 3UK6A 2RGOA 4P16A 2XI9A 1OJLA 1Z5BA 5KL1B 1P7DA 5BPVA 2EO2A 3W0FA 3VFDA 4DUYM 4R7GA 2KKPA 3UMMA 4NLBA 2KV2A 3L29A 4GC9A 4QHTA 5ITYA 1GO3F 1IY2A 5JI2E 2F8LA 2G07A 1KYIA 2E5SA 2QP9X 4GITA 2LWXA 3OPXA 4OO1J 2ZIXA 2DWZB 5HR6A 3RFAA 1T94A 3GRUA 3F2BA 1W5SA 4JXJA 4IBCA 2ERCA 2DVWB 4JI2M 2E1EA 3SHFA 1HEKA 2Y0QA 3TWLA 1JR3D 1TDHA 2Y0SC 1Q3UA 2CE7A 4MGYE 1IN5A 3M6AA 3TPZA 2ZIWA 4PDGA 3K1JA 2V1CA 2Y0TA 3HJSA 4CHTB 4II7A 4MB7A 2F5PA 2BJVA 5H37D 3RE8A 2ZM6M 2KJ9A 3ONNA 2W7PA 1HT2E 4AG6A 2UXCM 4QNLA 4D82A 2DZNB 3HHXA 4PCZA 3U6DA 3NUQA 1XXHA 1IY0A 4FCWA 1R7RA 5KQDA 4MM3B 4I81A 3SBJA 3GLIA 1N33M 4DV0M 1Z1BA 2UXDM 2RGHA 1IN6A 2LKYA 2F77X 2RRDA 1DO0A 3DZDA 4BUGA 2CHGA 3GPUA 2KICA 2F5NA 1SXJD 4P0PA 4B7HA 1ED1A 4G6ZA 4JI0M 2DF4B 4NRVA 1K3WA 4NV0A 1ZQ9A 2KXEA 3R9XB 2XSZA 1E9SA 2CPRA 3PSIA 2HHHM 3FYDA 2KZSA 3KOWE 1J7KA 4YY3M 3TWMA 4P0QB 2ZIUA 1GL6A 4WURA 5EP2A 1IXSB 1CRXA 4LG2A 3AQFA 3N7PD 1NY5A 1HT1E 3HU3A 2C98A 3T15A 3U60A 4GHLA 3WHKA 3ZC7B 5FLXS 2L6OA 1QAOA 4G4RA 1SXJB 1S3SA 4CISA 1GLNA 2H3QA 4FZMA 3KS4A 1PJIA 3MGVA 2C96A 2XZFA 4QHSA 3KFUG 4G4NA 3NBIA 4NXMM 1FNNA 1IN7A 1YUBA 3O0FA 3QWLA 2QBYB 4KMOB 4AYBC 3TWKA 3U6SA 4GC5A 3LQRA 2Y0SF 2I7PA 3KFUF 3CF6E 1DGFA 1GKIA 3H0RB 1URJA 5FTLA 4B3RM 4U7CA 1DGHA 2MRLA 3AFHA 3THGA 2OM6A 2HOQA 4BJQA 1QZMA 2R65A 2BDUA 3FYCA 1Z5AA 3AKZA 3E4RA 4PD2A 2O5RA 4HL4A 1Z19A 4AG5A 3L2AA 4LRSA 5LMNM 2ZIVB 2ZAOA 1HR0M 4JYAM 3FD9A 4M9XA 4BBAA 2ZXIA 1DRGA 1HQCA 4LFBM 3DOAA 1G41A 1YSYA 3U6OA 3HU2A 3GLFB 4CGZA 3KP0E 4L15A 3TL4X 5IT9S 3IG5A 4LJAA 1QVRA 5KL8B 4C0ZA 2HBMA 3LVWA 3SYKA 3M6KA 5DYIA 2R4EA 2LNHC 1UPHA 3U6EA 1MA7A 1K3XA 4ZPXA 4QOZC 3F53A 1TH2A 2D7HA 2M60A 5ITXA 2VJ5A 3GRRA 3SHGB 4DUZM 3PNYA 1D8BA 2Z4RA 4LF8M 3M6ZA 4OJOA 3FTDA 1I94M 4B7FA 4DR7M 2GH1A 1DGHB 4FWHA 4DR3M 4KX3A 2KW0A 1C1KA 4Z6YA 2WAQF 3R8FA 3KDSE 3K8ZA 2F5QA 2V1UA 4IC9A 4ICAA 4QOSA 3DFZA 4ACOA 4NSOB 1PVRA 3FUTA 2FOIC 2C99A 3GLGB 3GRYA 5FTJA 4KX5A 4U6PA 3FKEA 2CV2A 3K2LA 3GLGA 4I5SA 4JI4M 1N78A 3SAWA 1J5EM 2LBOA 4FCVA 1QAMA 1Q3VA 5EP4A 4FWDA 1SXJA 3FUXA 3LQQA 4LF4M 2KVCA 2HBJA 2KZUA 1NJGA 3GLHA 2R45A 4PT5A 3M7DA 4AYBF 4LJ8A 1L6NA 3VK8A 4LFCM 3SC3A 4AI6A 2E5LM 2Y21A 2XH9A 2A5YB 2KJ5A 3ICXA 1IM2A 2Y20A 3IG8A 3IN5A 3C29A 4BB9A 3VLFB 1IBMM 3HKZC 2VIIA 2JA2A 4NRWA 3TE6A 2K47A 2ZG6A 2DWMA 4FZLA 2KRUA 4AW4A 3UZUA 4HLQA 2FNAA 3E9SA 4P0PB 3EIEA 3FTEA 1DGBA 3SMSA 4CDGA 5FSWA 2H3IA 3SAUA 2HMXA 2LHTA 4FZNA 4B3MM 3GU3A 3W0LB 2G09A 1QAQA 2J7OA 3JR5A 3L25A 2YQZA 2G08A 4FE3A 3NWLA 2WB1F 2H1RA 1NSFA 1XXHB 2PMZF 2HOIA 4FW9A 2AHMA 3U5ZA 2KEBA 3AJIB 3J80S 2FFJA 3T1HM 1IBLM 2HBLA 3K1ZA 1HQYE 5EQTA 4ITQA 4JMUA 4LRTA 1K82A 5EXSA 4RNAA 3SMPA 2R18A 2F5SA 5F3WA 3F5AA 3I4YA 1PM5A 1L1TA 4B7GA 3U60B 1YT3A 2HL7A 3L26A 4JI6M 5ITXE 1EE8A 3F2CA 4G4QA 2DWLA 2R4JA 3CF0A 3PVSA 2CRXA 2LXEA 8CATA 4IJEA 5EXTA 4EIWA 2W04A 2NV3A 3PSFA 2UUAM 2ZIXB 3SFZA 2YB1A 2CV1A 3KOXE 4JN6A 1GVNA 3HHWA 3ZCBB 2ZIUB 2HBKA 1SZHA 2ZIVA 3KW6A 2DZOB 1IXRC 5KQ8A 3C28A 4IBJA 3FUVA 3ZH9B 1G8PA 4GIPA 3A46A 4I4LA 2W82A 2ZANA 2N1RA 2YX8A 2L09A 3L28A 2X8AA 2P5TA 1A0PA 4R3DA 4M9ZA 4OJLA 1GL7A 2KHQA 4A8EA 2RHFA 1IIPA 3SAFA 3U6LA 1NHGC 1KSFX 3GQ3A 2OQ4A 4PL2A 2J7NA 4MGHA 4X64M 2Z4SA 2QBYA 3H4MA 1R2YA 1XWIA 2XF3A 3FUUA 4MGIE 1R2ZA 2FE8A 3I51A 3GQ5A 3JR4A 2X49A 3PSPA 3VKGA 2H3ZA 4BX9C 3IP4B 4JI5M 1NY6A 5LMUM 4GHAA 3CTWB 1F44A 1QYRA 2R62A 2UUBM 2K8BB 1OFHA 4IBFA 3U6MA 2ZIWB 4IBBA 1L1ZA 2CN1A 3KVWA 3FUWA 4OX9M 3U6CA 2WB1C 1MX0A 2PMZC 4IIWA 1XO0A 2G5HB 3KZXA 4FVMA 2JH1A 3GQ4A 3EIHA 5JI3E 4LF5M 4P0QA 2BJWA 4QNRA 1G4AE 1A6SA 5ITTA 4DV3M 2W7OA 1DO2A 1JR3A 3VKHA 2GOLA 5IREB 1L8QA 4GH9A 5ITUA 4DR6M 3LYSA 4TUWA 1ECWA 1OFIA 5IZ7D 3J7BA 1N32M 2OXOA 2JHDA 3HJQA 5HR7A 3PNVA 4MH0E 5DYGA 1XHBA 2K89A 1PVPA 5EJCA 2DGZA 4IBEA 2KNJA 5E6JA 2XZUA 1XNRM 4M0WA 3T38A 2XFSA 4M9SA 5KPTA 3KOZE 2KD1A 1D2NA 5FTKA 4RF0A 1KBUA 3A98B 2K4IA 1H6UA 3UJNA 5C18A 2EUCA 3A42A 4DR2M 1I4WA 3FTFA 1NZBA 2XFTA 2KOBA 2XLJA 3KSJA 4QJFB 1QQWA 1JQJC 2G5GX 1XNSA 2WAQC 1NJFA 4LJ4A 1VDDA 4FCTA 1J09A 3CYMA 4RF1A 3KS8A 4XBOA 4NSRA 2JH7A 4YHHM 4QIWF 3C58A 4B3SM 2NQ8C 2H3VA 5E26A 2XSZD 2KRKA 3M0EA 4LZJA 1Z5CA 4LJ7A 2QENA 3GLFA 3GZFA 1KFVA 2KIWA 1SXJC 2LYAA 1IBKM 2OPFA 1E32A 4JI7M 1N75A 3KP1E 3MJ5A 2DHRA 4IBIA 4L8RC 2HCBA 1TGUA 3Q8XA 3WHLA 4X62M 3GPPA 3L27A 2C9OA 3CF2A 1L2BA 2G0AA 1L2CA 1N77A 4KHPM 2K8AA 2A3VA 4LCBA 5EP3A 1G59A 1PVQA 3B9PA 3U61A 3N7SC 3F2DA 2LH0A 1R6BX 2W03A 4JV5M 3KSXA 2ZBKB 5KPZA 3SATA 4DR4M 3HKZF 4AQYM 3SARA 3MK6A 2LYBA 3HU1A 4QNMA 4LJ5A 3PFIA 4AZFA 2VQFM 3RFWA 1HNXM 5T14A 4NXNM 4CRXA 3GRVA 2OYYA 3T79A 1FJGM 2XGNA 3VCBA 4LF7M 2OH2A 4FWGA 4M0DA 2C5RA 4REZA 3HKPA 4K0KM 4CGYB 2X4AA 2H3FA 2KJ8A 2HKJA 2F5OA 5FTMA 4GFJA 3H0MB 3VDUA 4L4UA 4OJPA 2VIXA 2CUZA 1Q39A 5KPRA 3RGSA 1NHWC 2I7NA 4IBKA 1TH4A 5KO3A 1TAMA 4JI1M 2RP5A 3AQEA 1Q3BA 3JAMS 5EXXA 2L7HA 3GO8A 2VQEM 3RGPA 3VK7A 3TQSA 2UXBM 5CRXA 2DWNA 2CHVA 3AV0A 2Z7JA 3ILKA 4OJ5A 2V6ZM 4NL4H 1Q3CA 5C1BA 4IBDA 4FD2A 4XGIA 4OU7A 4NLCA 2YFQA 4LY6A 3BOSA 2XEPA 2EA0A 1YE9A 4W5WA 3VDPA 3J81S 3F5EA 2BNKA 1IN8A 1XMOM 2KHVA 4LGYA 2F2AB 1NNJA 3CRXA 5IWAM 3N7RC 4B08A 3GPXA 5EP1A 3U5ZB 1LV7A 2CHQA 4OVZB 5ITQA 2F4VM 2G06A 4IBGA 1NNUC 3PZPA 1XC8A 4OVZA 4L78A 4DV2M 4LF6M 4LJ6A 1HIWA 2D7GA 1X37A 3D2QA 2CEAA 2CFOA 1IQPA 2G8LA 2KA6B 3AOEA 4S12A 3J27B 7CATA 3U61B 2K8CB 4Z8XA 1G3IA 1HNWM 2XIDA 1E94E 2CV0A 2XVTA 2Q4TA 2UUCM 2YNMD 5C0YA 4I8OA 3GP1A 2MA1A 2ZXHA 2ZAMA 3HWSA 5EXPA 3OTOM 3AL0B 4X66M 1T3TA 3UGJA 3SASA 2VJ4A 2QPAA 3SMVA 3A45A 4MGZE 2E1FA 3U6PA 3H0LB 3SAGA 3ALRA 4DV4M 4LFAM 4B3TM 4MGKE 3SAVA 1ZAEA 2YR0A 4LF9M 1ZQ1C 3J2PB 2JMGA 4LGMA 5GKNA 3HHYA 1TDZA 4JI3M 4A3VB 1MU5A 2Z3XA 2VKQA 2DXIA 2QZ4A 3J7AS 3D8BA 3GLIB 2R46A 3DA1A 4AKGA 4NOOB 1L2DA 3MHVC 3PXGA 4DR5M 4L16A 5FTNA 4OW0A 4OJ6A 4DV5M 4PL1A 2HOFA 4D81A 4DV6M 3D8LA 4WW0A 2YB4A 2C9CA 3DEEA 1QANA 4G4OA 1ORYB 1DGGA 3FTCA 1TH3A 4D80A 5DNYA 1N36M 4LZZA 5A2QS 3KXEC 3CP8A 3D2NA 1IN4A 2K4HA 3M7GA 3HHZA 1Z59A 4DR1M 2D6FC 2JGAA 2UU9M 1E9RA 1IXZA 3KOYE 3LVVA 1N34M 3L3FX 3GPYA 2QCUA 2KEYA 4JI8M 3GLHB 2F76X 3U6QA 3T1YM 4AKIA 2KKVA 3SQIA 1WXQA 3HJ8A 1UM8A 4QIWC 1IY1A 4BLCA 4WJ3B 1SXJE 1W5TA 2D7EA 2M5ZA 4DV7M 3LMMA 2Q2EB 4KLNA 4GKKM 3NRWA 3AL0C 2M0NA 3PSTA 4DV1M 4NWIA 3AOGA 4KODA 1XMQM 4GKJM 4AKHA 4LJ9A 4GMQA 4PDIA 5BR8M 2XICA 1PJJA 2K4EA 3AOEC 3HGIA 1HNZM 3SAHA 1OUQA 4KO8A 1XNQM 4GRIA 3VC8A 4X65M 2DQNB 1WUDA 4O3MA 2G5IB 3I4VA 3E0FA 2RKOA 4IJFA 1NVMA 3SYLA 5ITRA 3RF9A 1Z6TA 5A0LA 3QAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7J A;  2R18 A; 
#chains in the Genus database with same CATH topology
 2UVR A;  3UK6 A;  1S77 D;  1P7D A;  5KFA A;  2KVS A;  5KG3 A;  7ICQ A;  3VFD A;  4DUY M;  4NLB A;  5ALZ A;  3TQ1 A;  3L29 A;  4QWD A;  2QP9 X;  3N28 A;  1GJT A;  3OPX A;  1YZ6 A;  2DWZ B;  4EX7 A;  3F2B A;  3GQC A;  2WF5 A;  4M9H A;  1W5S A;  4NLG A;  4NLN A;  4JI2 M;  2IOF A;  4DBG B;  4CHT B;  4O3R A;  3AN1 A;  5EE3 A;  2KJ9 A;  2LHG A;  2B21 A;  5DG7 A;  4GIB A;  3U6D A;  2OHF A;  4FCW A;  3M1Y A;  1ZV1 A;  1NK0 A;  1GO5 A;  1VDV A;  2F77 X;  2RRD A;  3GPU A;  1WJ7 A;  2F5N A;  1SXJ D;  5J0R A;  5KT5 A;  2EZZ A;  3T5J A;  1RXW A;  4MHV A;  2VA8 A;  4USA A;  4B9U A;  7ICJ A;  1A77 A;  2KZS A;  4RNM A;  4YQW A;  4P0Q B;  2DUY A;  2ZIU A;  3V6K A;  1GL6 A;  5HP4 A;  4WUR A;  1L3T A;  5EWF A;  2EDU A;  1IXS B;  1X9W A;  3UQ0 A;  2K0B X;  3AQF A;  1PUZ A;  3T15 A;  1NK6 A;  2ZTE A;  5FLX S;  1QAO A;  3NVZ A;  1SXJ B;  1S3S A;  2FS1 A;  3TAD C;  3HP6 A;  4FZM A;  4DOC A;  2BQR A;  3MGV A;  1SZP A;  1U4B A;  1J2M A;  3KFU G;  4G4N A;  5ALH A;  5J2J A;  4I27 A;  3W68 A;  3G6V A;  5AKI A;  4C7Z A;  4KMO B;  2A19 A;  4GC5 A;  1D8Y A;  3E21 A;  3LQR A;  4YD1 A;  1GKI A;  2AGQ A;  5FTL A;  1DGH A;  4KLH A;  3QYP A;  3AFH A;  2OM6 A;  5KFB A;  3TFS A;  1NK5 A;  4HL4 A;  1Z19 A;  3A0H U;  4AG5 A;  3B7Q A;  1F5S A;  4GXJ A;  4M9X A;  4KN4 A;  4QZ9 A;  4DL5 A;  1ZQC A;  4QWC A;  4L15 A;  5CHG A;  1QSY A;  2RQ5 A;  5ALJ A;  4LJA A;  1U9L A;  3TAC B;  2HBM A;  1LTM A;  3QEA Z;  1MA7 A;  8ICY A;  4ZPX A;  4QOZ C;  5J2A A;  8ICO A;  5B66 U;  3GRR A;  4DUZ M;  1X9M A;  3PNY A;  2FMQ A;  1PZN A;  4JB3 A;  1L3U A;  1DGH B;  4FWH A;  4DR3 M;  4ECW A;  4FO6 A;  3PY8 A;  5JUM A;  1JMS A;  4QOS A;  1SIJ A;  2OOB A;  3QUB A;  5FTJ A;  3FKE A;  2CV2 A;  5C5J A;  3SAW A;  3UM9 A;  2LBO A;  3ZDE A;  1QAM A;  2QNJ A;  1QSS A;  1FEZ A;  4RQ8 A;  3LQQ A;  4X5V A;  1FO4 A;  4DL3 A;  2AQ0 A;  1MN3 A;  3B74 A;  1NJG A;  3ORY A;  4PT5 A;  2EZY A;  3ISB A;  3M7D A;  1SKS A;  1L6N A;  1ARO P;  7ICH A;  2QSF X;  2E5L M;  1TK0 A;  2L5Y A;  3ICX A;  2A5Y B;  5ALS A;  4YR0 A;  8ICZ A;  4BB9 A;  3H4J A;  1ZQI A;  1ZQV A;  4NRW A;  8ICU A;  2K47 A;  2KRU A;  1TK5 A;  1L5U A;  3E9S A;  3Q8R B;  4P0P B;  7ICR A;  3EIE A;  3FTE A;  3TFR A;  2HMX A;  4FZN A;  1JXL A;  2F1J A;  1D9F A;  2PFP A;  3W0L B;  2PFQ A;  3WK5 A;  4JK1 A;  8ICX A;  1NKE A;  5DFL A;  2PMZ F;  1L7O A;  1Z1V A;  4O3N A;  3U5Z A;  3AJI B;  3T5L A;  3J80 S;  2HBL A;  2FFJ A;  3T1H M;  4UAT A;  1HQY E;  2FJ6 A;  9ICP A;  4LRT A;  1K82 A;  2F5S A;  1OW5 A;  4F72 A;  2IA6 A;  3RR8 A;  1X40 A;  5KG5 A;  1EE8 A;  3F2C A;  3UMB A;  1PJT A;  4YXM A;  4RQ6 A;  2LXE A;  8CAT A;  4QZD A;  4KLF A;  2UUA M;  2YB1 A;  4C4S A;  2HI0 A;  1GVN A;  2HBK A;  1SZH A;  9ICE A;  3KW6 A;  3T5K A;  3QZ8 A;  2I6X A;  3ZH9 B;  1G8P A;  1OIP A;  2J5Y A;  2WF9 A;  3QU2 A;  2BCR A;  2ZAN A;  1ZXI A;  1A0P A;  2QB0 A;  1SGG A;  3U6L A;  5AIB A;  3AUO A;  5K4L A;  2J7N A;  4Y2R A;  2QBY A;  4I29 A;  3H4M A;  1R2Y A;  3FUU A;  2XF3 A;  1QDT A;  1EIJ A;  2P66 A;  1IXR A;  4DL6 A;  4JI5 M;  5DGB A;  2O01 F;  1NY6 A;  3CTW B;  5EE1 A;  2UUB M;  2K8B B;  5KFW A;  1OFH A;  1SKR A;  3BS5 B;  2CN1 A;  3KVW A;  3KBB A;  4ZH4 A;  5KFM A;  5J0Y A;  3PX4 A;  1ZQZ A;  4OX9 M;  3CNH A;  3D6J A;  4IIW A;  2XY5 A;  4NLZ A;  2G5H B;  4J9R A;  1RM6 C;  2BJW A;  2BWB A;  2KMD A;  3C23 A;  1G4A E;  4QWB A;  3WK8 A;  4DL4 A;  4GH9 A;  5ITU A;  4R66 A;  1LKY A;  2C2R A;  1ECW A;  1NJX A;  7ICI A;  3OSP A;  5HR7 A;  8ICH A;  2JRZ A;  3HJQ A;  4KTQ A;  3KHH A;  1L7N A;  2DGZ A;  1WCL A;  1XNR M;  4IQU A;  3G6Y A;  2XFS A;  1D2N A;  2WSE F;  4RF0 A;  5AI9 A;  3A98 B;  4EEK A;  1EFU B;  2K4I A;  3FTF A;  1I4W A;  2Q0Z X;  1NV8 A;  5AM0 A;  2XLJ A;  3GV8 B;  3KSJ A;  5AK6 A;  3QUC A;  1C20 A;  1XNS A;  2G5G X;  4ECU A;  5CR0 A;  1T43 A;  1KN5 A;  4FCT A;  1J09 A;  8ICG A;  5G5H A;  4RF1 A;  4NSR A;  2JH7 A;  3C58 A;  1WHC A;  2N35 A;  1X6I A;  4C8L A;  4QZG A;  3M0E A;  4LJ7 A;  3SEN A;  4Q44 A;  3RB0 A;  2KIW A;  2H5X A;  4EBC A;  1UT8 A;  1IBK M;  5EWE A;  2KFN A;  4QWA A;  2WZJ A;  5ALN A;  1UQV A;  1OQY A;  4JI7 M;  2DHR A;  2XY6 A;  1QSL A;  4DQR A;  2R8I A;  2RRU A;  5L1J A;  1L2C A;  4P4M A;  2A3V A;  1JUD A;  4RQ5 A;  1TFR A;  3QU5 A;  3I76 A;  3N7S C;  3I04 M;  1XSP A;  3Q8L A;  4DO9 A;  2YY6 A;  3BXW A;  3K1R B;  3ZDC A;  5DBB A;  2LYB A;  1PGY A;  2VQF M;  4M9G A;  8ICC A;  5DQH A;  4NXN M;  5KAI U;  1RQN A;  2PI4 A;  5J2D A;  3T79 A;  1VEK A;  3M9M B;  2DAM A;  4K0K M;  4CGY B;  2X4A A;  2KJ8 A;  2HKJ A;  5FTM A;  2NRW A;  3HT3 A;  1XS9 D;  4L4U A;  4HEO A;  2VIX A;  2CUZ A;  1KKX A;  5III A;  4J9O A;  3MC1 A;  9ICO A;  4KIT B;  5KTQ A;  5EXX A;  3VK7 A;  2UXB M;  1S0V A;  4M6W A;  2Z7J A;  3E46 A;  3ILK A;  2V6Z M;  4NL4 H;  4OU7 A;  3KHG A;  4UN2 B;  3QU7 A;  4NLC A;  4G3I A;  2XEP A;  1TTE A;  1JRO A;  1MQ2 A;  2VF8 A;  1WGL A;  1N2X A;  3BQ7 A;  4XRH A;  2KHV A;  4UB5 A;  2F2A B;  4ED2 A;  1F4I A;  3GPX A;  2PKE A;  2JY5 A;  1LV7 A;  3U5Z B;  2BCQ A;  4YVZ A;  1SXE A;  2F4V M;  4IBG A;  2KHH A;  5KFF A;  1ZD2 P;  4L78 A;  2CRU A;  5CJ7 A;  1SG9 A;  2DAK A;  5AM5 A;  4M04 A;  2G8L A;  4BWM A;  3J27 B;  7CAT A;  3U61 B;  8ICA A;  2A1A A;  1R5L A;  2YN4 A;  1HNW M;  4R64 A;  2V4R A;  1E94 E;  1NZP A;  4QZB A;  2VF7 A;  1ZQA A;  4I2E A;  2B0C A;  1J97 A;  3NTU A;  3UXP A;  3AL0 B;  4X66 M;  4J9L A;  1T3T A;  2PFO A;  1F0M A;  4PZO A;  3RAX A;  3A45 A;  3Q8Q B;  3SAG A;  3HRD D;  7ICK A;  1IV8 A;  4DV4 M;  4B3T M;  2KSO B;  4UBB A;  4MGK E;  1DV0 A;  4RQ4 A;  2F1H A;  4LF9 M;  1JIH A;  3J2P B;  3QX7 A;  4F91 B;  3GIL A;  1ZQN A;  3MDC A;  5GKN A;  1TDZ A;  2Z3X A;  2DXI A;  3MGI A;  3J7A S;  1KEJ A;  4Y2S A;  1L2D A;  2DFL A;  3H40 A;  2XGP A;  4EEN A;  5FTN A;  4OW0 A;  4F2S A;  2R6F A;  3V7L A;  2HOF A;  2YB4 A;  5J2E A;  3D8L A;  3V72 A;  2C9C A;  3DEE A;  5AI6 A;  5DNY A;  1TH3 A;  1N36 M;  4UB4 A;  3MBY A;  1IN4 A;  2HDO A;  3HHZ A;  1NK4 A;  4OCZ A;  8ICQ A;  1WG8 A;  4UB1 A;  4WP2 A;  3N97 B;  1NNL A;  9ICR A;  4DLE A;  1VG5 A;  2XCA A;  2KEY A;  1RG6 A;  4ELU A;  1K1S A;  4AKI A;  5KT4 A;  9ICN A;  2B3T A;  4DFM A;  4YD2 A;  4QIW C;  3HPO A;  4I2G A;  2GLE A;  2M5Z A;  2D7E A;  3PVX A;  4DQS A;  5AHX A;  4EX6 A;  3SR6 A;  4UQG A;  1KDH A;  3B7N A;  4C80 A;  8ICM A;  2WHE A;  2KK0 A;  4G3O A;  1N5X A;  4IJF A;  4Y2U A;  4ELV A;  4IRC A;  3J81 j;  3JPS A;  5IIN A;  4DS4 A;  5D46 A;  2KDL A;  3SEI A;  2W9C B;  4DOB A;  3PV8 A;  5BPV A;  4Z6E A;  4M9J A;  2E8M A;  4KLJ A;  3WKD A;  4R7G A;  3UMM A;  2RDJ A;  4QHT A;  1GO3 F;  7ICS A;  2W8L A;  1IY2 A;  3I01 M;  5JI2 E;  4M0A A;  1L8L A;  2Y1J A;  2R8H A;  2IHM A;  2ZIX A;  1B43 A;  4TUP A;  3RFA A;  4YFK A;  3GRU A;  4JXJ A;  5TZV A;  5B5E U;  3TWL A;  8ICR A;  2CE7 A;  9ICS A;  3C3E A;  1IN5 A;  1MJG M;  4PDG A;  2V1C A;  5DB9 A;  2Y0T A;  2GQF A;  4I28 A;  2FPK A;  5IIJ A;  9ICW A;  2DL0 A;  4YP3 A;  4R71 A;  4GXK A;  4MB7 A;  5H37 D;  2ZM6 M;  2W7P A;  5F9L A;  3B0X A;  1RPL A;  4QNL A;  2QQ8 A;  2DZN B;  4PCZ A;  2JUJ A;  5ALM A;  5ALP A;  2W9C A;  1OAO C;  2MR9 A;  4MFF A;  1IY0 A;  1L7M A;  2BCU A;  2O25 A;  2FLL A;  2HHU A;  1NK9 A;  1ZQJ A;  4MM3 B;  3SBJ A;  4DSL A;  1S9F A;  3GLI A;  2LMR A;  5AI4 A;  3TAN A;  2R44 A;  2RGH A;  2LYH A;  4O3Q A;  2QLT A;  2DPJ A;  5KT6 A;  4P0P A;  4B7H A;  4UB6 U;  1ED1 A;  4I2H A;  4JI0 M;  4NV0 A;  4B6J A;  5ALT A;  2KXE A;  2XSZ A;  2YMP A;  4QWE A;  1E9S A;  2CPR A;  5KFY A;  3PSI A;  3MDA A;  4DSK A;  1ZD3 A;  3ISD A;  4YY3 M;  3SYZ A;  4JV0 A;  2MSN A;  5KFI A;  4MEY A;  3RTV A;  5DGA A;  1NY5 A;  4RQ1 A;  3U60 A;  4GHL A;  3WHK A;  2L6O A;  1N60 A;  3DV9 A;  4R8U A;  1Z4N A;  3ZD9 A;  3KS4 A;  2W3R A;  2JP7 A;  4QHS A;  3IDW A;  2YTU A;  5KFR A;  1IN7 A;  4FS1 A;  3QWL A;  1AUA A;  3PW7 A;  4AYB C;  3TWK A;  4C8N A;  7ICT A;  1OXJ A;  1QLN A;  2I7P A;  4DSE A;  3KFU F;  1DGF A;  4B3R M;  4U7C A;  1N48 A;  2VDB B;  2MRL A;  2HOQ A;  9ICX A;  4ECT A;  2BDU A;  3AKZ A;  1ZYQ A;  3BQ0 A;  1MN8 A;  3E4R A;  2ZIV B;  5LMN M;  3UXN A;  1JX4 A;  2ZAO A;  2ZXI A;  3LWL A;  4DS5 A;  4BBA A;  1ZQQ A;  3RJH A;  3FDS A;  1HQC A;  4LFB M;  4TUQ A;  3DOA A;  1G41 A;  1BPB A;  3U6O A;  1U48 A;  4IRK A;  3GLF B;  2L4E A;  3KP0 E;  2JY6 B;  2YMM A;  1KL9 A;  4C0Z A;  1QVR A;  3LVW A;  2LNH C;  4O3S A;  4BXO A;  1TH2 A;  2M60 A;  2JEJ A;  2VJ5 A;  2JY8 A;  3SV4 A;  3SHG B;  3BS7 A;  4ECY A;  5DQI A;  4GLX A;  2E8O A;  4B7F A;  3PR4 A;  4UAV A;  3JPN A;  1C1K A;  2WAQ F;  2WTF A;  4RQ0 A;  3DFZ A;  3JPO A;  1PVR A;  2C99 A;  2KE7 A;  2OOA A;  4KX5 A;  3Q8M A;  3BQT A;  4I5S A;  4JI4 M;  1Q3V A;  5EP4 A;  2YMQ A;  1GJS A;  1SXJ A;  1U47 A;  5F9N A;  4UAZ A;  2HBJ A;  3GLH A;  4IL6 U;  4UAR A;  2DAE A;  5KAF U;  4AYB F;  8ICK A;  4LFC M;  1JXE A;  1K5O A;  3SC3 A;  4AI6 A;  5J2C A;  2Y21 A;  3MAB A;  5J2K A;  4EEY A;  2UVV A;  4HYK A;  2Y20 A;  4F5Q A;  1V34 A;  5DB8 A;  3N4M B;  3TAR A;  3HKZ C;  2VII A;  2XY7 A;  1TAU A;  3TE6 A;  1VQ1 A;  4AW4 A;  1TE2 A;  4B9L A;  4Z6F A;  2D3D A;  5FSW A;  1S10 A;  2I9G A;  2H3I A;  2LHT A;  1RDF A;  3IM1 A;  3BJY A;  4KLQ A;  3L25 A;  2G08 A;  4ED0 A;  4FE3 A;  2OWO A;  2WF6 A;  4DEZ A;  1NSF A;  4FW9 A;  2AHM A;  3F92 A;  5KFG A;  1IBL M;  3LW5 F;  5EQT A;  1T3N A;  2AH5 A;  1M6Y A;  3F5A A;  2ES6 A;  4RNA A;  2R18 A;  5F3W A;  1L1T A;  1PM5 A;  7ICN A;  2W55 A;  1YT3 A;  2BZF A;  4O5C A;  3EYZ A;  2BPF A;  1NJZ A;  4JI6 M;  5ITX E;  2R4J A;  2K9D A;  2CRX A;  5CWR A;  5EXT A;  1ZD5 A;  1IG6 A;  1O03 A;  3CGW A;  1T3Q A;  3LK9 A;  1IXR C;  4IBJ A;  2HHX A;  5E79 U;  4GIP A;  3C5F A;  2MUT A;  5KG0 A;  2P5T A;  4R3D A;  4Y28 F;  4TQR A;  3PW4 A;  4A8E A;  1IIP A;  3OJU A;  4NLK A;  1EXN A;  3TKA A;  3Q8S B;  3PMN A;  1SL0 A;  1NI3 A;  2VA3 A;  3GQ5 A;  3PSP A;  1VDL A;  4XA5 A;  3PW0 A;  3W67 A;  2R62 A;  3GLG E;  2W9B A;  2ZIW B;  3RB4 A;  9ICC A;  3JPQ A;  1L1Z A;  5DBC A;  4GC7 A;  2ZUB A;  1ZQM A;  3GLF E;  3TAQ A;  1MX0 A;  4RQM A;  2PMZ C;  3GLH E;  5L1M A;  3KZX A;  4YR3 A;  4F4W A;  2JH1 A;  3GQ4 A;  2HAK A;  5DB6 A;  1Q02 A;  1XSN A;  4QZF A;  1A6S A;  3QU4 A;  4DV3 M;  2W7O A;  2KNV A;  1DK3 A;  4RT2 A;  3KHL A;  5IRE B;  2HVH A;  2W43 A;  3ZI4 A;  4CF5 A;  1V85 A;  5DYG A;  4DFK A;  5L9X A;  4CIZ A;  2XZU A;  4RNO A;  2NYV A;  3T38 A;  5JRT A;  2KD1 A;  1ZRN A;  5FTK A;  2JXN A;  5L8R F;  1XO1 A;  4PH5 A;  5C18 A;  5ALK A;  4PJ0 U;  4I2C A;  3MMP A;  8ICV A;  3FC4 A;  3GV5 B;  1NJF A;  2ZJ5 A;  3H4D A;  4QIW F;  1NO1 A;  3WKA A;  3WU2 U;  5ALI A;  4BWJ A;  3RJI A;  5E26 A;  1VLB A;  3THV A;  4RNN A;  2KRK A;  1Z5C A;  4ED6 A;  4MF2 A;  3GZF A;  1KFV A;  2JR5 A;  1SXJ C;  2LYA A;  9ICA A;  4K4G A;  4LZG A;  4OD0 A;  3KP1 E;  3V7K A;  3MJ5 A;  3WHL A;  1RYS A;  2C9O A;  2K8A A;  3B89 A;  1N77 A;  1HJP A;  1PVQ A;  1G59 A;  4ECQ A;  3B9P A;  2KTQ A;  2W03 A;  3HWT A;  2AXT U;  3SAT A;  1COO A;  5ALL A;  3SAR A;  3UMG A;  2NRZ A;  4QZA A;  2KN7 A;  1XSL A;  2QAR A;  2LVO C;  4LJ5 A;  5T14 A;  1HNX M;  2QAR B;  2W9M A;  3NVV A;  4DFD A;  2HSZ A;  2OYY A;  7ICP A;  2MAX A;  4C7Y A;  3C1Y A;  2OH2 A;  4M0D A;  3GV7 B;  5AKH A;  5J8Y C;  3PW5 A;  9ICG A;  4GFJ A;  2HVI A;  1X2I A;  1Q39 A;  5KPR A;  1QQ6 A;  1YLA A;  5KO3 A;  1X9S A;  1TAM A;  2L7H A;  3GO8 A;  2M9N A;  9ICT A;  3TQS A;  4RPZ A;  4ECZ A;  1HUZ A;  5C1B A;  1Q3C A;  4IBD A;  1Z00 B;  3K75 D;  5J0S A;  1KRP A;  1CI4 A;  4TQS A;  2ZJ8 A;  2EA0 A;  1ZQY A;  1YE9 A;  3J81 S;  1L3S A;  3F5E A;  4HAI A;  3RH6 A;  5DDY A;  1JAL A;  5AI5 A;  4R63 A;  3CRX A;  5IWA M;  3N7R C;  5EP1 A;  5AM1 A;  4JWM A;  2CHQ A;  4Y2P A;  5IIM A;  4M47 A;  3MR5 A;  2EJS A;  3K4G A;  1ZQE A;  1RU3 A;  1SL2 A;  9ICQ A;  1S5L U;  4LJ6 A;  1HIW A;  2CFO A;  3AOE A;  4S12 A;  2KA6 B;  3PO4 A;  1T6O A;  2XID A;  2D8C A;  2WSF F;  2OCE A;  3H8S A;  1IXS A;  3QNM A;  2Q4T A;  4I8O A;  2ZXH A;  1V97 A;  5IIO A;  4O3O A;  3HWS A;  3RRG A;  1N5W A;  3SMV A;  4KLS A;  3PNC A;  4LFA M;  1IFY A;  3SAV A;  4DLG A;  1ZAE A;  1WR1 B;  2QHO B;  2YR0 A;  3QUQ A;  4B9M A;  4KLO A;  2JMG A;  7ICE A;  2JZ1 A;  2QZ4 A;  3GLI B;  2R46 A;  4NOO B;  2RDI A;  2MJ5 B;  2MU2 A;  4C4R A;  4O5K A;  3M9O B;  5L1K A;  7ICF A;  4DV6 M;  4WW0 A;  2ASL A;  2Y9U A;  4DSI A;  1A76 A;  5KFH A;  1DGG A;  3CP8 A;  3B7Z A;  1UHU A;  2NRT A;  5ALU A;  1S97 A;  4FBU A;  2D6F C;  2JGA A;  1E9R A;  2UVU A;  2K4P A;  1H38 A;  1OIZ A;  5H2F U;  2J6S A;  1N34 M;  1N61 A;  2B6G A;  4B9T A;  1T8E A;  2F76 X;  3U6Q A;  3T1Y M;  2C2D A;  1UA1 A;  1NKC A;  3SQI A;  1WXQ A;  1XB2 B;  2C22 A;  4B9V A;  7ICV A;  1D8L A;  1S0O A;  1UM8 A;  1IY1 A;  1UA0 A;  1SXJ E;  2R8K A;  3LMM A;  2Q2E B;  4GKK M;  1Q8K A;  5JTI A;  2IOF K;  3AL0 C;  4O0I A;  3AOG A;  4KOD A;  1XMQ M;  3QZ7 A;  4L6V 6;  2XIC A;  1PJJ A;  4DQI A;  4PHE A;  2K4E A;  3AOE C;  1OUQ A;  1XNQ M;  3VC8 A;  3PX6 A;  4CCH A;  2PI5 A;  1NJY A;  2DQN B;  1WUD A;  4LJX A;  5EE0 A;  4J03 A;  2LM4 A;  3C21 A;  2AGO A;  2NRV A;  2EH9 A;  3SYL A;  5ITR A;  4EZ6 A;  5A0L A;  3NBX X;  2FPL A;  3OGU A;  2L7I A;  3U26 A;  3K92 A;  2E3T A;  3FYH A;  2RGO A;  4P16 A;  4UAY A;  4DSJ A;  1Z5B A;  1LVH A;  1ZJN A;  2EO2 A;  4DQP A;  2HHW A;  2F44 A;  4J9N A;  1LV5 A;  1V92 A;  2KKP A;  5DLF A;  2BDP A;  2WFA A;  2KV2 A;  5ITY A;  2CP8 A;  2G07 A;  1KYI A;  4PHP A;  2LWX A;  1AQ6 A;  4LZD A;  4RU9 A;  2BPG A;  1JB0 F;  4TUS A;  3PR5 B;  5BPC A;  4IBC A;  2DVW B;  5KFQ A;  2E1E A;  4Q8F A;  4O9M A;  1WWU A;  1JR3 D;  5AK5 A;  1Q3U A;  3Q8K A;  5AI0 A;  3M6A A;  2HWJ A;  2YQE A;  3K1J A;  4KLE A;  3HJS A;  5L1I A;  2F5P A;  2BJV A;  3ONN A;  4GEW A;  4YMO A;  5KFD A;  5J2I A;  5DKW A;  4GC6 A;  4D82 A;  5AM3 A;  1KFD A;  3NUQ A;  1XXH A;  5AKZ A;  2MRO B;  3MR2 A;  3DDH A;  1R7R A;  2JEF A;  4I81 A;  5J0W A;  1D0M A;  5L1L A;  4DV0 M;  1Z1B A;  7ICG A;  5CEH A;  4E0D A;  1IN6 A;  3DZD A;  4BUG A;  2APL A;  1XU4 A;  2DWQ A;  3MR3 A;  9ICI A;  1QUT A;  1SXD A;  4O3P A;  4CF4 A;  4NRV A;  1K3W A;  3NAS A;  4XQ8 A;  5KFP A;  5KFK A;  2DPI A;  1JN3 A;  4K4H A;  1ZQ9 A;  3R9X B;  4RT3 A;  3IRU A;  2BCS A;  3KOW E;  1J7K A;  3TWM A;  3QU9 A;  1PRB A;  1UCV A;  2L4F A;  2LVA A;  5EP2 A;  1SV0 A;  1NK7 A;  4LG2 A;  3NS1 A;  1HUO A;  1HT1 E;  3HU3 A;  2C98 A;  3ZC7 B;  3GLI E;  3IP4 B;  4G4R A;  5KG7 A;  2H3Q A;  4MF8 A;  3RJF A;  4PHA A;  1PJI A;  1QZE A;  2C96 A;  4YMM A;  3H8J A;  3NBI A;  2BPC A;  4NXM M;  1QQ5 A;  1YUB A;  3O0F A;  2QBY B;  1KFS A;  2LHC A;  3IHQ B;  4F92 B;  8ICS A;  2EAM A;  1KSP A;  1QZM A;  3JPP A;  2R65 A;  1FFU A;  5DBA A;  4PZN A;  1Z5A A;  2O5R A;  2I5H A;  2E8P A;  4C8O A;  4JYA M;  3FD9 A;  4RQ7 A;  4IRD A;  3KHR A;  1TKD A;  1VEG A;  3HU2 A;  4CGZ A;  4I2B A;  4Z6D A;  5J0X A;  3TL4 X;  3R9K A;  5CA7 A;  5AKE A;  3IG5 A;  2PFN A;  3BQ2 A;  3SYK A;  3M6K A;  2ZJA A;  2R4E A;  1UPH A;  1K3X A;  3F53 A;  2D7H A;  2W54 A;  2Z4R A;  3M6Z A;  1I94 M;  4DR7 M;  4KX3 A;  2GH1 A;  4DCC A;  4ICA A;  1RXV A;  3K9P A;  4IC9 A;  2C28 A;  2FI1 A;  4NSO B;  4F4K A;  3FUT A;  1PJQ A;  2FOI C;  1QH9 A;  3H4B A;  1BPD A;  3ZDA A;  1J5E M;  5J2H A;  3I28 A;  4FCV A;  1LB2 B;  4KLG A;  2PXI A;  4FWD A;  3FUX A;  4LF4 M;  2ASD A;  2KZU A;  3BZC A;  2R45 A;  2BGW A;  4LJ8 A;  3VK8 A;  2EKF A;  4UB3 A;  5D4B A;  1DOQ A;  1NOM A;  4EEL A;  5KFS A;  1IM2 A;  3IG8 A;  3C29 A;  3OHB A;  5TIS U;  1TVA A;  1IBM M;  5GTI U;  5AM2 A;  4FZL A;  4HLQ A;  2FNA A;  1Z3E B;  3SMS A;  4CDG A;  4ECV A;  2NO4 A;  4B3M M;  3NRZ A;  3GU3 A;  2G09 A;  1QAQ A;  3C2L A;  3FRI A;  1WWV A;  1WCN A;  5KFL A;  2WB1 F;  2ISP A;  2H1R A;  3RB3 A;  1ZQK A;  1XXH B;  5KFX A;  2KEB A;  3K1Z A;  7ICU A;  2DI0 A;  2DHY A;  3WK6 A;  4B7G A;  3U60 B;  1BPX A;  2EAP A;  2HL7 A;  4PGQ A;  3ZDD A;  5ALG A;  1G71 A;  2DBY A;  1DXS A;  4G4Q A;  2DWL A;  1BPZ A;  3CF0 A;  3RR7 A;  4KLU A;  1TF0 B;  1ZET A;  4EIW A;  2NV3 A;  3SFZ A;  4DQQ A;  4EYH B;  4JN6 A;  3HHW A;  2ZIU B;  2ZIV A;  3F2D A;  2DZO B;  3RJG A;  3KKA A;  1ZQL A;  2N1R A;  2W82 A;  1KLN A;  2L09 A;  4J9Q A;  3TAD A;  2BKE A;  4QZH A;  3SAF A;  2RHF A;  5IIL A;  4NY8 A;  1NHG C;  1KSF X;  1CUK A;  2JV3 A;  2OQ4 A;  2QKQ A;  1PJS A;  3QXG A;  5AKJ A;  3NVY A;  1B22 A;  1XWI A;  4MGI E;  3C1Z A;  3JR4 A;  3VKG A;  1BNO A;  2H3Z A;  4BX9 C;  1ZD4 A;  5LMU M;  4GHA A;  2DAG A;  1QYR A;  4KT0 F;  3U6M A;  5KNI A;  4UB8 U;  1O08 A;  3WKE A;  1NV9 A;  1N63 A;  2VAN A;  3FUW A;  3U6C A;  2WB1 C;  4PGX A;  1XO0 A;  5DB7 A;  3ZQJ A;  4DF8 A;  3C5G A;  4FVM A;  3EIH A;  4P0Q A;  4QNR A;  1WYG A;  3E58 A;  5ITT A;  1DO2 A;  1JR3 A;  4IQW A;  1SB3 C;  1L8Q A;  5KT2 A;  3LYS A;  3C2M A;  5HNK A;  1N32 M;  4F2L A;  1ZRM A;  4JV2 A;  1XC9 A;  3PNV A;  4MH0 E;  1Z4O A;  1XHB A;  1PVP A;  5E6J A;  5KFO A;  4M0W A;  1ZQW A;  5BOM A;  4Q7J A;  4M9S A;  5KPT A;  3KOZ E;  4R65 A;  1KBU A;  2BQU A;  5AI8 A;  5KG2 A;  2EUC A;  4DR2 M;  2KOB A;  9ICF A;  3ZD8 A;  1QCK A;  5J0O A;  4QJF B;  1QQW A;  1MSW D;  4RQ3 A;  1CEZ A;  1GAB A;  5J0U A;  5J0P A;  4F50 A;  3CYM A;  5KT3 A;  5ALQ A;  3HJE A;  5DLG A;  4B3S M;  2H3V A;  5G5G A;  4I2I A;  2KNZ A;  3FAH A;  3EZ5 A;  1SV0 C;  5KFZ A;  3G6X A;  2W8K A;  1N75 A;  4L8R C;  2HCB A;  2CXY A;  1L2B A;  4KHP M;  1NKB A;  4LCB A;  5EP3 A;  1TAQ A;  4F71 A;  1QUS A;  1NJW A;  2LH0 A;  2G3Q A;  1ZQD A;  4JV5 M;  3IEC A;  5KPZ A;  4AQY M;  3HU1 A;  2ISO A;  4QNM A;  4QZE A;  3PFI A;  4CRX A;  3RFW A;  2ASJ A;  2J6T A;  2LVP C;  2XGN A;  3VCB A;  4DOA A;  4LF7 M;  4FWG A;  5AK3 A;  2C5R A;  3BZK A;  2MUT B;  1PK3 A;  3HKP A;  2OO9 A;  4DFP A;  1OAI A;  3WKB A;  3VDU A;  3KZI U;  4OJP A;  2JEI A;  1D0K A;  3RGS A;  1V38 A;  1K1Q A;  4JI1 M;  2RP5 A;  2FMS A;  1Q3B A;  3JAM S;  3M8S A;  1OTR A;  2VQE M;  5CRX A;  3GIM A;  3AV0 A;  1ZQP A;  2IMW P;  1MC8 A;  4Y2J A;  4XGI A;  2YFQ A;  4F5R A;  1ZMU A;  9ICM A;  5J2F A;  2DKZ A;  8ICL A;  5D49 A;  1V9P A;  3V6J A;  2O6K A;  3OHA A;  1B0X A;  4B08 A;  1JI7 A;  3AU6 A;  1B4F A;  3ETL A;  2BWE A;  3T6P A;  5ITQ A;  1UFZ A;  2G06 A;  5AKL A;  4P2H A;  5KG1 A;  3PZP A;  1XC8 A;  8ICE A;  4LF6 M;  2D7G A;  3D2Q A;  4RQN A;  1IQP A;  3S6J A;  5DG9 A;  2JZB B;  2K8C B;  4XK8 F;  4Z8X A;  1G3I A;  1X42 A;  4B9S A;  3BQ1 A;  5KFV A;  2LVN C;  2XVT A;  2HHT A;  2UUC M;  2YNM D;  1MQ3 A;  2ATL A;  5KFE A;  2ZAM A;  3OTO M;  3EUB 2;  3RRH A;  5CB1 A;  3UGJ A;  4EBD A;  2VJ4 A;  4BDP A;  2E1F A;  1ZJM A;  1T7P A;  3H0L B;  2LPE A;  3ALR A;  3QYB A;  3TI0 A;  3LCV B;  5EWG A;  2XC9 A;  4LGM A;  3HHY A;  2F1I A;  5AKY A;  2Y9T A;  4UB2 A;  9ICK A;  4K4I A;  5HHI A;  3DA1 A;  2FLN A;  4QW8 A;  1KFT A;  5AK4 A;  3MHV C;  4P17 A;  2RLT A;  1TK8 A;  4OJ6 A;  4PL1 A;  3EWA A;  1QAN A;  4G4O A;  2JEG A;  2QB0 B;  2HCF A;  8ICJ A;  3KXE C;  2HHS A;  2VA2 A;  3D2N A;  4ZOH C;  5ALX A;  2GNO A;  3FE3 A;  3M7G A;  2K4H A;  4F1I A;  4LVS A;  4DR1 M;  2ZTC A;  3KOY E;  4F5N A;  4IQV A;  3L3F X;  4JV1 A;  3HX3 A;  3GPY A;  2QCU A;  5HML A;  3GLH B;  3HJ8 A;  3ISC A;  4YCX A;  2A1J B;  4UAW A;  1QQ7 A;  2M0N A;  4P4O A;  4DV1 M;  4NWI A;  3HY5 A;  3K9O A;  1ZQH A;  4GKJ M;  3AM9 A;  2P6R A;  3GIK A;  5AIC A;  1N62 A;  3L4P A;  5BR8 M;  3EPG A;  3HIL A;  5ALR A;  1RZT A;  3C3D A;  1HNZ M;  4ANR A;  4O3M A;  3I4V A;  3E0F A;  1NVM A;  2GWS A;  5KFJ A;  3QAU A;  4J9M A;  3D2S A;  4F4Z A;  5KT7 A;  2Y1I A;  2XI9 A;  1OJL A;  5KL1 B;  3W0F A;  3ED5 A;  4KN7 A;  4YG2 A;  1IM4 A;  4GC9 A;  4RPY A;  3TAP A;  2F8L A;  2E5S A;  4GIT A;  1LKY B;  3JPR A;  4IQT A;  2AGP A;  1OKS A;  1S76 D;  4OO1 J;  2C2E A;  5HR6 A;  1T94 A;  3BDP A;  2ERC A;  4EZ9 A;  8ICP A;  3SHF A;  1HEK A;  2Y0Q A;  4Y2Y A;  2EZX A;  1TDH A;  2Y0S C;  3T5H A;  3RH5 A;  1KQQ A;  2FLP A;  2EKK A;  2ODG A;  4MGY E;  3TPZ A;  2ZIW A;  3IHP A;  4II7 A;  2NRX A;  4UW9 A;  2Z8Y M;  3RE8 A;  1ZQO A;  2BQ3 A;  1HT2 E;  4AG6 A;  2UXC M;  4ED8 A;  4DF4 A;  3HHX A;  4QZ8 A;  4KLT A;  2XO7 A;  5KQD A;  3L5K A;  5AM4 A;  7ICL A;  1N33 M;  2KZM A;  2UXD M;  4IR1 A;  3WK9 A;  2LKY A;  8ICW A;  1DO0 A;  1SWV A;  3EPI A;  2CHG A;  2KIC A;  9ICB A;  2I1Q A;  4G6Z A;  2DF4 B;  4KLL A;  2AJQ A;  2HHH M;  1JR3 E;  3FYD A;  2ZTD A;  1ZQF A;  1ZQS A;  1X9X A;  2UVW A;  2P35 A;  1RYR A;  2FPM A;  1CRX A;  4ED7 A;  2AQ4 A;  3N7P D;  5J8Y A;  3RJK A;  2K60 A;  4CIS A;  3LDA A;  1GLN A;  2DNA A;  1ZQR A;  2XZF A;  2OEH A;  1FNN A;  1KTQ A;  3KKA C;  3U6S A;  3GDX A;  5AKX A;  2Y0S F;  1TR8 A;  1WIV A;  3CF6 E;  2XGQ A;  4M9L A;  4RUC A;  4ELT A;  3H0R B;  1URJ A;  5ALD A;  3THG A;  3H8W A;  4BGD A;  4BJQ A;  4Q45 A;  4GXI A;  4J9S A;  3FYC A;  4PD2 A;  1U49 A;  3L2A A;  4LRS A;  1HR0 M;  1DRG A;  4CF3 A;  3PML A;  4ECX A;  4C4T A;  4RUA A;  3ZDB A;  4RZR A;  1YSY A;  3RBE A;  2DAI A;  1VEJ A;  4M9N A;  1D0L A;  3SD7 A;  5FP0 A;  5IT9 S;  1D9D A;  5KL8 B;  5DYI A;  1L3V A;  3U6E A;  2JZB A;  4IS7 A;  1Y88 A;  2YML A;  5ITX A;  3HX0 A;  7ICM A;  4YN4 A;  2HW3 A;  1D8B A;  4OJO A;  4LF8 M;  4Y2Q A;  3AMZ A;  3FTD A;  2KW0 A;  4Z6Y A;  3T3F A;  5J0Q A;  3R8F A;  3KDS E;  3K8Z A;  2F5Q A;  2V1U A;  1ZQU A;  1BPE A;  1SV4 A;  4ACO A;  3SI8 A;  2R0I A;  2MH8 A;  4PPX A;  3GLG B;  3GRY A;  4EBE A;  4F3O A;  4U6P A;  3K2L A;  1PK1 B;  3GLG A;  3RJE A;  1N78 A;  5DDM A;  1X66 A;  1AIP C;  2JY7 A;  4F5O A;  4ED1 A;  2KVC A;  2HHQ A;  3EW9 A;  3OJS A;  1VJ5 A;  3RH4 A;  1WGN A;  4F5P A;  3RJJ A;  2XH9 A;  2KJ5 A;  1ZMW A;  4NXZ A;  2JXJ A;  3IN5 A;  3VLF B;  4TUR A;  3KD3 A;  1L7P A;  3H7I A;  2JA2 A;  4G9B A;  1SKW A;  2BCV A;  2ZG6 A;  2DWM A;  4JUZ A;  3UZU A;  3BS5 A;  4UAS A;  4C8M A;  5ALE A;  4I2F A;  1DGB A;  2FDR A;  3GII A;  3SAU A;  3E2E A;  1ZQT A;  2J7O A;  3JR5 A;  2YQZ A;  4NL9 C;  3NWL A;  2HOI A;  2W11 A;  1DGS A;  1UT5 A;  5HMM A;  4ITQ A;  3ETR A;  5EXS A;  3SMP A;  3M8R A;  3I4Y A;  4B9N A;  3FM9 A;  4QZI A;  3V6H A;  2F3N A;  3M9N B;  8ICI A;  3H8M A;  3QE9 Y;  1Z00 A;  3L26 A;  2LTU A;  4Y2X A;  1BPY A;  4YMN A;  3PVS A;  4KLM A;  4ED3 A;  3UQ2 A;  4IJE A;  2W04 A;  5HHH A;  4C8K A;  3PSF A;  2ZIX B;  4FBT A;  8ICN A;  2CV1 A;  9ICL A;  4Q43 A;  2FE9 A;  3KOX E;  2K6B A;  4M6W B;  5F3X B;  3ZCB B;  2W9A A;  3PO5 A;  2R8G A;  5KQ8 A;  3C28 A;  3FUV A;  3A46 A;  4I4L A;  5IIK A;  4JMU A;  2YX8 A;  2LBC A;  3L28 A;  2X8A A;  2JZ0 A;  4NM2 A;  5KG6 A;  4M9Z A;  4OJL A;  1GL7 A;  2KHQ A;  4DL7 A;  1DK2 A;  4KLD A;  3GQ3 A;  4PL2 A;  3RB6 A;  4MGH A;  4X64 M;  3RBD A;  2Z4S A;  5CP2 A;  1R2Z A;  4F4X A;  8ICF A;  2FE8 A;  1ZQX A;  3I51 A;  2X49 A;  2GO7 A;  3AU2 A;  2DEN A;  3UXO A;  2FH0 A;  5ALO A;  2LVQ D;  1F44 A;  3CW2 C;  4IBF A;  4IBB A;  3AEV A;  2KP7 A;  4EYI B;  4I2D A;  5KFU A;  1BGX T;  4RKU F;  5GTH U;  3NGD A;  3RAQ A;  2EAN A;  4LF5 M;  5JI3 E;  4F93 B;  4QW9 A;  1QDR A;  1NK8 A;  1RQL A;  3VKH A;  1T4G A;  2GOL A;  5KG4 A;  4NL9 A;  4DR6 M;  4QZC A;  4KMU A;  4TUW A;  1OFI A;  5IZ7 D;  3J7B A;  2OXO A;  2JHD A;  2K89 A;  3PW2 A;  5EJC A;  3MR6 A;  4DWI A;  4IBE A;  2KNJ A;  4MFC A;  3MFH A;  3KTQ A;  4MFA A;  3UMC A;  2W9B B;  1BNP A;  3GFK B;  4IR9 A;  4RPX A;  2KZ3 A;  1H6U A;  3UJN A;  5AKK A;  3A42 A;  2KNA A;  4ECS A;  2AU0 A;  1NZB A;  2XFT A;  2KG5 A;  7ICO A;  1JQJ C;  2HHV A;  2WAQ C;  1S0N A;  4LJ4 A;  2KFZ A;  1VDD A;  4DSF A;  1R4G A;  2WF7 A;  2E8N A;  3KS8 A;  1RYU A;  4XBO A;  4YHH M;  4FFD A;  4NC6 A;  2NQ8 C;  2XSZ D;  1FFV A;  4LZJ A;  2QEN A;  3GLF A;  4UAU A;  5AIA A;  2OPF A;  1E32 A;  5ALW A;  4IBI A;  3B0Y A;  3Q8X A;  2G0A A;  1TGU A;  3GPP A;  4X62 M;  5ALF A;  3L27 A;  3CF2 A;  5J2G A;  1BVS A;  5KFC A;  3U61 A;  4US9 A;  1R6B X;  2XCP A;  3KSX A;  2ZBK B;  4DR4 M;  4AP9 A;  4JWN A;  3HKZ F;  1PK1 A;  3MK6 A;  2JWS A;  2MGW A;  4AZF A;  4Y2T A;  3NVW A;  5J0T A;  2IOH A;  3GRV A;  4PGY A;  1FJG M;  2IHN A;  1XWL A;  3IV6 A;  1JRP A;  2JNH A;  3OTQ A;  4REZ A;  2QB1 A;  3SV3 A;  2CWB A;  2H3F A;  4J9P A;  4CE6 A;  2P6U A;  1S0M A;  2F5O A;  3JPT A;  3H0M B;  3V7J A;  2KSO A;  4PHD A;  3QUT A;  1Q46 A;  3FRH A;  2ESE A;  2FMP A;  1NHW C;  2J6U A;  2I7N A;  4IBK A;  1TH4 A;  4CNQ A;  3Q8P B;  4Z6C A;  3AQE A;  1SL1 A;  4I2A A;  2KZZ A;  3RGP A;  3QEB Z;  2DWN A;  2CHV A;  4M2Y A;  2IBK A;  3I1Y A;  4OJ5 A;  4FD2 A;  4LY6 A;  4MEX A;  9ICU A;  3BOS A;  4W5W A;  3VDP A;  2BNK A;  1SWW A;  2EAO A;  1IN8 A;  1XMO M;  1J2N A;  5ALY A;  4LGY A;  1C7Y A;  4RQ2 A;  1NNJ A;  1YZ7 A;  1ZOL A;  1V33 A;  4OVZ B;  9ICV A;  2DKX A;  5ALV A;  4I2J A;  4Y2V A;  1ZQB A;  9ICJ A;  4XUS A;  4YR2 A;  5J2B A;  1ZMV A;  1NNU C;  3Q8G A;  4ECR A;  4OVZ A;  1A5T A;  1XXH E;  4DV2 M;  2F8K A;  4F8R A;  3LCU A;  1L8O A;  1X37 A;  4F2R A;  2CEA A;  2A1J A;  2BHN A;  3C9P A;  4BXO B;  2V9W A;  3V76 A;  4F4Y A;  3WK4 A;  1S8O A;  2CV0 A;  3UPQ A;  3KOO A;  5C0Y A;  3GP1 A;  2MA1 A;  2DKL A;  3HW8 A;  5EXP A;  3SAS A;  2QPA A;  4MGZ E;  1COK A;  3U6P A;  4NJ8 A;  1N56 A;  4DL2 A;  2NO5 A;  1ZQ1 C;  3LWM A;  1TV9 A;  2LM1 A;  5KFT A;  4JI3 M;  4A3V B;  1MU5 A;  2VKQ A;  4YXJ A;  3D8B A;  5BOL A;  4AKG A;  8ICB A;  4UBC A;  3PXG A;  2LI6 A;  3QYE A;  2ZUD A;  4DR5 M;  5JU5 A;  4L16 A;  4DV5 M;  5EOZ A;  3WK7 A;  2L2D A;  4D81 A;  2BR0 A;  1FIQ A;  5AKG A;  8ICT A;  3PX0 A;  1ORY B;  3FTC A;  4D80 A;  2R8J A;  1P3Q Q;  2AHO B;  4LZZ A;  5A2Q S;  3C2K A;  4P4P A;  1Z59 A;  4J9K A;  1DGJ A;  1X6J A;  2W3S A;  2UU9 M;  4R8U B;  1IXZ A;  3LVV A;  1QTM A;  4KLI A;  2ZUC A;  1Y8G A;  4JI8 M;  5DQG A;  4CJ6 A;  2KKV A;  4US8 A;  1KW4 A;  4DFJ A;  3MFI A;  2EQY A;  4BLC A;  4WJ3 B;  1W5T A;  4DV7 M;  2KIV A;  4KLN A;  3NRW A;  3WKC A;  2DZL A;  1U45 A;  3PST A;  4AKH A;  1ZQG A;  4LJ9 A;  2V4Q A;  4GMQ A;  4PDI A;  5DG8 A;  5EE9 A;  9ICH A;  3BBZ A;  3B9J A;  2WSC F;  3HGI A;  3SAH A;  5KFN A;  4KO8 A;  2ALZ A;  4GRI A;  4Q8E A;  4X65 M;  3OSN A;  3A0B U;  3GIJ A;  2G5I B;  3MGH A;  4FS2 A;  2WF8 A;  4NM1 A;  5J29 A;  2RKO A;  3RF9 A;  3HZJ A;  1Z6T A;  4O5E A;  3SZ2 A; 
#chains in the Genus database with same CATH homology
 2L7I A;  3K92 A;  3D2S A;  3UK6 A;  2RGO A;  4P16 A;  2XI9 A;  1OJL A;  1Z5B A;  5KL1 B;  1P7D A;  5BPV A;  2EO2 A;  3W0F A;  3VFD A;  4DUY M;  4R7G A;  2KKP A;  3UMM A;  4NLB A;  2KV2 A;  3L29 A;  4GC9 A;  4QHT A;  5ITY A;  1GO3 F;  1IY2 A;  5JI2 E;  2F8L A;  2G07 A;  1KYI A;  2E5S A;  2QP9 X;  4GIT A;  2LWX A;  3OPX A;  4OO1 J;  2ZIX A;  2DWZ B;  5HR6 A;  3RFA A;  1T94 A;  3GRU A;  3F2B A;  1W5S A;  4JXJ A;  4IBC A;  2ERC A;  2DVW B;  4JI2 M;  2E1E A;  3SHF A;  1HEK A;  2Y0Q A;  3TWL A;  1JR3 D;  1TDH A;  2Y0S C;  1Q3U A;  2CE7 A;  4MGY E;  1IN5 A;  3M6A A;  3TPZ A;  2ZIW A;  4PDG A;  3K1J A;  2V1C A;  2Y0T A;  3HJS A;  4CHT B;  4II7 A;  4MB7 A;  2F5P A;  2BJV A;  5H37 D;  3RE8 A;  2ZM6 M;  2KJ9 A;  3ONN A;  2W7P A;  1HT2 E;  4AG6 A;  2UXC M;  4QNL A;  4D82 A;  2DZN B;  3HHX A;  4PCZ A;  3U6D A;  3NUQ A;  1XXH A;  1IY0 A;  4FCW A;  1R7R A;  5KQD A;  4MM3 B;  4I81 A;  3SBJ A;  3GLI A;  1N33 M;  4DV0 M;  1Z1B A;  2UXD M;  2RGH A;  1IN6 A;  2LKY A;  2F77 X;  2RRD A;  1DO0 A;  3DZD A;  4BUG A;  2CHG A;  3GPU A;  2KIC A;  2F5N A;  1SXJ D;  4P0P A;  4B7H A;  1ED1 A;  4G6Z A;  4JI0 M;  2DF4 B;  4NRV A;  1K3W A;  4NV0 A;  1ZQ9 A;  2KXE A;  3R9X B;  2XSZ A;  1E9S A;  2CPR A;  3PSI A;  2HHH M;  3FYD A;  2KZS A;  3KOW E;  1J7K A;  4YY3 M;  3TWM A;  4P0Q B;  2ZIU A;  1GL6 A;  4WUR A;  5EP2 A;  1IXS B;  1CRX A;  4LG2 A;  3AQF A;  3N7P D;  1NY5 A;  1HT1 E;  3HU3 A;  2C98 A;  3T15 A;  3U60 A;  4GHL A;  3WHK A;  3ZC7 B;  5FLX S;  2L6O A;  1QAO A;  4G4R A;  1SXJ B;  1S3S A;  4CIS A;  1GLN A;  2H3Q A;  4FZM A;  3KS4 A;  1PJI A;  3MGV A;  2C96 A;  2XZF A;  4QHS A;  3KFU G;  4G4N A;  3NBI A;  4NXM M;  1FNN A;  1IN7 A;  1YUB A;  3O0F A;  3QWL A;  2QBY B;  4KMO B;  4AYB C;  3TWK A;  3U6S A;  4GC5 A;  3LQR A;  2Y0S F;  2I7P A;  3KFU F;  3CF6 E;  1DGF A;  1GKI A;  3H0R B;  1URJ A;  5FTL A;  4B3R M;  4U7C A;  1DGH A;  2MRL A;  3AFH A;  3THG A;  2OM6 A;  2HOQ A;  4BJQ A;  1QZM A;  2R65 A;  2BDU A;  3FYC A;  1Z5A A;  3AKZ A;  3E4R A;  4PD2 A;  2O5R A;  4HL4 A;  1Z19 A;  4AG5 A;  3L2A A;  4LRS A;  5LMN M;  2ZIV B;  2ZAO A;  1HR0 M;  4JYA M;  3FD9 A;  4M9X A;  4BBA A;  2ZXI A;  1DRG A;  1HQC A;  4LFB M;  3DOA A;  1G41 A;  1YSY A;  3U6O A;  3HU2 A;  3GLF B;  4CGZ A;  3KP0 E;  4L15 A;  3TL4 X;  5IT9 S;  3IG5 A;  4LJA A;  1QVR A;  5KL8 B;  4C0Z A;  2HBM A;  3LVW A;  3SYK A;  3M6K A;  5DYI A;  2R4E A;  2LNH C;  1UPH A;  3U6E A;  1MA7 A;  1K3X A;  4ZPX A;  4QOZ C;  3F53 A;  1TH2 A;  2D7H A;  2M60 A;  5ITX A;  2VJ5 A;  3GRR A;  3SHG B;  4DUZ M;  3PNY A;  1D8B A;  2Z4R A;  4LF8 M;  3M6Z A;  4OJO A;  3FTD A;  1I94 M;  4B7F A;  4DR7 M;  2GH1 A;  1DGH B;  4FWH A;  4DR3 M;  4KX3 A;  2KW0 A;  1C1K A;  4Z6Y A;  2WAQ F;  3R8F A;  3KDS E;  3K8Z A;  2F5Q A;  2V1U A;  4IC9 A;  4ICA A;  4QOS A;  3DFZ A;  4ACO A;  4NSO B;  1PVR A;  3FUT A;  2FOI C;  2C99 A;  3GLG B;  3GRY A;  5FTJ A;  4KX5 A;  4U6P A;  3FKE A;  2CV2 A;  3K2L A;  3GLG A;  4I5S A;  4JI4 M;  1N78 A;  3SAW A;  1J5E M;  2LBO A;  4FCV A;  1QAM A;  1Q3V A;  5EP4 A;  4FWD A;  1SXJ A;  3FUX A;  3LQQ A;  4LF4 M;  2KVC A;  2HBJ A;  2KZU A;  1NJG A;  3GLH A;  2R45 A;  4PT5 A;  3M7D A;  4AYB F;  4LJ8 A;  1L6N A;  3VK8 A;  4LFC M;  3SC3 A;  4AI6 A;  2E5L M;  2Y21 A;  2XH9 A;  2A5Y B;  2KJ5 A;  3ICX A;  1IM2 A;  2Y20 A;  3IG8 A;  3IN5 A;  3C29 A;  4BB9 A;  3VLF B;  1IBM M;  3HKZ C;  2VII A;  2JA2 A;  4NRW A;  3TE6 A;  2K47 A;  2ZG6 A;  2DWM A;  4FZL A;  2KRU A;  4AW4 A;  3UZU A;  4HLQ A;  2FNA A;  3E9S A;  4P0P B;  3EIE A;  3FTE A;  1DGB A;  3SMS A;  4CDG A;  5FSW A;  2H3I A;  3SAU A;  2HMX A;  2LHT A;  4FZN A;  4B3M M;  3GU3 A;  3W0L B;  2G09 A;  1QAQ A;  2J7O A;  3JR5 A;  3L25 A;  2YQZ A;  2G08 A;  4FE3 A;  3NWL A;  2WB1 F;  2H1R A;  1NSF A;  1XXH B;  2PMZ F;  2HOI A;  4FW9 A;  2AHM A;  3U5Z A;  2KEB A;  3AJI B;  3J80 S;  2FFJ A;  3T1H M;  1IBL M;  2HBL A;  3K1Z A;  1HQY E;  5EQT A;  4ITQ A;  4JMU A;  4LRT A;  1K82 A;  5EXS A;  4RNA A;  3SMP A;  2R18 A;  2F5S A;  5F3W A;  3F5A A;  3I4Y A;  1PM5 A;  1L1T A;  4B7G A;  3U60 B;  1YT3 A;  2HL7 A;  3L26 A;  4JI6 M;  5ITX E;  1EE8 A;  3F2C A;  4G4Q A;  2DWL A;  2R4J A;  3CF0 A;  3PVS A;  2CRX A;  2LXE A;  8CAT A;  4IJE A;  5EXT A;  4EIW A;  2W04 A;  2NV3 A;  3PSF A;  2UUA M;  2ZIX B;  3SFZ A;  2YB1 A;  2CV1 A;  3KOX E;  4JN6 A;  1GVN A;  3HHW A;  3ZCB B;  2ZIU B;  2HBK A;  1SZH A;  2ZIV A;  3KW6 A;  2DZO B;  1IXR C;  5KQ8 A;  3C28 A;  4IBJ A;  3FUV A;  3ZH9 B;  1G8P A;  4GIP A;  3A46 A;  4I4L A;  2W82 A;  2ZAN A;  2N1R A;  2YX8 A;  2L09 A;  3L28 A;  2X8A A;  2P5T A;  1A0P A;  4R3D A;  4M9Z A;  4OJL A;  1GL7 A;  2KHQ A;  4A8E A;  2RHF A;  1IIP A;  3SAF A;  3U6L A;  1NHG C;  1KSF X;  3GQ3 A;  2OQ4 A;  4PL2 A;  2J7N A;  4MGH A;  4X64 M;  2Z4S A;  2QBY A;  3H4M A;  1R2Y A;  1XWI A;  2XF3 A;  3FUU A;  4MGI E;  1R2Z A;  2FE8 A;  3I51 A;  3GQ5 A;  3JR4 A;  2X49 A;  3PSP A;  3VKG A;  2H3Z A;  4BX9 C;  3IP4 B;  4JI5 M;  1NY6 A;  5LMU M;  4GHA A;  3CTW B;  1F44 A;  1QYR A;  2R62 A;  2UUB M;  2K8B B;  1OFH A;  4IBF A;  3U6M A;  2ZIW B;  4IBB A;  1L1Z A;  2CN1 A;  3KVW A;  3FUW A;  4OX9 M;  3U6C A;  2WB1 C;  1MX0 A;  2PMZ C;  4IIW A;  1XO0 A;  2G5H B;  3KZX A;  4FVM A;  2JH1 A;  3GQ4 A;  3EIH A;  5JI3 E;  4LF5 M;  4P0Q A;  2BJW A;  4QNR A;  1G4A E;  1A6S A;  5ITT A;  4DV3 M;  2W7O A;  1DO2 A;  1JR3 A;  3VKH A;  2GOL A;  5IRE B;  1L8Q A;  4GH9 A;  5ITU A;  4DR6 M;  3LYS A;  4TUW A;  1ECW A;  1OFI A;  5IZ7 D;  3J7B A;  1N32 M;  2OXO A;  2JHD A;  3HJQ A;  5HR7 A;  3PNV A;  4MH0 E;  5DYG A;  1XHB A;  2K89 A;  1PVP A;  5EJC A;  2DGZ A;  4IBE A;  2KNJ A;  5E6J A;  2XZU A;  1XNR M;  4M0W A;  3T38 A;  2XFS A;  4M9S A;  5KPT A;  3KOZ E;  2KD1 A;  1D2N A;  5FTK A;  4RF0 A;  1KBU A;  3A98 B;  2K4I A;  1H6U A;  3UJN A;  5C18 A;  2EUC A;  3A42 A;  4DR2 M;  1I4W A;  3FTF A;  1NZB A;  2XFT A;  2KOB A;  2XLJ A;  3KSJ A;  4QJF B;  1QQW A;  1JQJ C;  2G5G X;  1XNS A;  2WAQ C;  1NJF A;  4LJ4 A;  1VDD A;  4FCT A;  1J09 A;  3CYM A;  4RF1 A;  3KS8 A;  4XBO A;  4NSR A;  2JH7 A;  4YHH M;  4QIW F;  3C58 A;  4B3S M;  2NQ8 C;  2H3V A;  5E26 A;  2XSZ D;  2KRK A;  3M0E A;  4LZJ A;  1Z5C A;  4LJ7 A;  2QEN A;  3GLF A;  3GZF A;  1KFV A;  2KIW A;  1SXJ C;  2LYA A;  1IBK M;  2OPF A;  1E32 A;  4JI7 M;  1N75 A;  3KP1 E;  3MJ5 A;  2DHR A;  4IBI A;  4L8R C;  2HCB A;  1TGU A;  3Q8X A;  3WHL A;  4X62 M;  3GPP A;  3L27 A;  2C9O A;  3CF2 A;  1L2B A;  2G0A A;  1L2C A;  1N77 A;  4KHP M;  2K8A A;  2A3V A;  4LCB A;  5EP3 A;  1G59 A;  1PVQ A;  3B9P A;  3U61 A;  3N7S C;  3F2D A;  2LH0 A;  1R6B X;  2W03 A;  4JV5 M;  3KSX A;  2ZBK B;  5KPZ A;  3SAT A;  4DR4 M;  3HKZ F;  4AQY M;  3SAR A;  3MK6 A;  2LYB A;  3HU1 A;  4QNM A;  4LJ5 A;  3PFI A;  4AZF A;  2VQF M;  3RFW A;  1HNX M;  5T14 A;  4NXN M;  4CRX A;  3GRV A;  2OYY A;  3T79 A;  1FJG M;  2XGN A;  3VCB A;  4LF7 M;  2OH2 A;  4FWG A;  4M0D A;  2C5R A;  4REZ A;  3HKP A;  4K0K M;  4CGY B;  2X4A A;  2H3F A;  2KJ8 A;  2HKJ A;  2F5O A;  5FTM A;  4GFJ A;  3H0M B;  3VDU A;  4L4U A;  4OJP A;  2VIX A;  2CUZ A;  1Q39 A;  5KPR A;  3RGS A;  1NHW C;  2I7N A;  4IBK A;  1TH4 A;  5KO3 A;  1TAM A;  4JI1 M;  2RP5 A;  3AQE A;  1Q3B A;  3JAM S;  5EXX A;  2L7H A;  3GO8 A;  2VQE M;  3RGP A;  3VK7 A;  3TQS A;  2UXB M;  5CRX A;  2DWN A;  2CHV A;  3AV0 A;  2Z7J A;  3ILK A;  4OJ5 A;  2V6Z M;  4NL4 H;  1Q3C A;  5C1B A;  4IBD A;  4FD2 A;  4XGI A;  4OU7 A;  4NLC A;  2YFQ A;  4LY6 A;  3BOS A;  2XEP A;  2EA0 A;  1YE9 A;  4W5W A;  3VDP A;  3J81 S;  3F5E A;  2BNK A;  1IN8 A;  1XMO M;  2KHV A;  4LGY A;  2F2A B;  1NNJ A;  3CRX A;  5IWA M;  3N7R C;  4B08 A;  3GPX A;  5EP1 A;  3U5Z B;  1LV7 A;  2CHQ A;  4OVZ B;  5ITQ A;  2F4V M;  2G06 A;  4IBG A;  1NNU C;  3PZP A;  1XC8 A;  4OVZ A;  4L78 A;  4DV2 M;  4LF6 M;  4LJ6 A;  1HIW A;  2D7G A;  1X37 A;  3D2Q A;  2CEA A;  2CFO A;  1IQP A;  2G8L A;  2KA6 B;  3AOE A;  4S12 A;  3J27 B;  7CAT A;  3U61 B;  2K8C B;  4Z8X A;  1G3I A;  1HNW M;  2XID A;  1E94 E;  2CV0 A;  2XVT A;  2Q4T A;  2UUC M;  2YNM D;  5C0Y A;  4I8O A;  3GP1 A;  2MA1 A;  2ZXH A;  2ZAM A;  3HWS A;  5EXP A;  3OTO M;  3AL0 B;  4X66 M;  1T3T A;  3UGJ A;  3SAS A;  2VJ4 A;  2QPA A;  3SMV A;  3A45 A;  4MGZ E;  2E1F A;  3U6P A;  3H0L B;  3SAG A;  3ALR A;  4DV4 M;  4LFA M;  4B3T M;  4MGK E;  3SAV A;  1ZAE A;  2YR0 A;  4LF9 M;  1ZQ1 C;  3J2P B;  2JMG A;  4LGM A;  5GKN A;  3HHY A;  1TDZ A;  4JI3 M;  4A3V B;  1MU5 A;  2Z3X A;  2VKQ A;  2DXI A;  2QZ4 A;  3J7A S;  3D8B A;  3GLI B;  2R46 A;  3DA1 A;  4AKG A;  4NOO B;  1L2D A;  3MHV C;  3PXG A;  4DR5 M;  4L16 A;  5FTN A;  4OW0 A;  4OJ6 A;  4DV5 M;  4PL1 A;  2HOF A;  4D81 A;  4DV6 M;  3D8L A;  4WW0 A;  2YB4 A;  2C9C A;  3DEE A;  1QAN A;  4G4O A;  1ORY B;  1DGG A;  3FTC A;  1TH3 A;  4D80 A;  5DNY A;  1N36 M;  4LZZ A;  5A2Q S;  3KXE C;  3CP8 A;  3D2N A;  1IN4 A;  2K4H A;  3M7G A;  3HHZ A;  1Z59 A;  4DR1 M;  2D6F C;  2JGA A;  2UU9 M;  1E9R A;  1IXZ A;  3KOY E;  3LVV A;  1N34 M;  3L3F X;  3GPY A;  2QCU A;  2KEY A;  4JI8 M;  3GLH B;  2F76 X;  3U6Q A;  3T1Y M;  4AKI A;  2KKV A;  3SQI A;  1WXQ A;  3HJ8 A;  1UM8 A;  4QIW C;  1IY1 A;  4BLC A;  4WJ3 B;  1SXJ E;  1W5T A;  2D7E A;  2M5Z A;  4DV7 M;  3LMM A;  2Q2E B;  4KLN A;  4GKK M;  3NRW A;  3AL0 C;  2M0N A;  3PST A;  4DV1 M;  4NWI A;  3AOG A;  4KOD A;  1XMQ M;  4GKJ M;  4AKH A;  4LJ9 A;  4GMQ A;  4PDI A;  5BR8 M;  2XIC A;  1PJJ A;  2K4E A;  3AOE C;  3HGI A;  1HNZ M;  3SAH A;  1OUQ A;  4KO8 A;  1XNQ M;  4GRI A;  3VC8 A;  4X65 M;  2DQN B;  1WUD A;  4O3M A;  2G5I B;  3I4V A;  3E0F A;  2RKO A;  4IJF A;  1NVM A;  3SYL A;  5ITR A;  3RF9 A;  1Z6T A;  5A0L A;  3QAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...