2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2Z7JA 2R18A
chains in the Genus database with same CATH superfamily
2YMLA 1D8BA 3DOAA 4OU7A 3T6PA 3C2KA 2YB1A 2XGNA 1WYGA 1SG9A 1DGHA 3LW5F 2VDBB 3HHZA 3G6YA 4GC7A 3GLFA 2DPIA 7ICOA 2A5YB 4IR1A 2JP7A 4UN2B 5AI6A 4MEXA 3ZCBB 3WKAA 3UM9A 2L4EA 2EZYA 5AI0A 3ZD9A 3M8RA 3TKAA 3M9NB 4DUYM 1L2DA 4WW0A 2EUCA 5KPZA 2C2EA 4G3IA 2Q0ZX 3RB4A 1T3TA 3U6QA 3L25A 1NKCA 1ZMVA 5J2DA 1T6OA 5IINA 2AGPA 3FTFA 2KRUA 1NZPA 3AOGA 2MRLA 5KNIA 4DQIA 1PJIA 1WXQA 2JNHA 2QPAA 4JI0M 3CF0A 1S76D 4IJEA 2EKFA 4X65M 2O5RA 2H3FA 4DR2M 7ICLA 3NVZA 2ZIXB 5EE1A 2ZTEA 4KLLA 1VLBA 3RJGA 2ZG6A 4DV1M 2K4IA 4PZOA 3LWMA 1N33M 3EIEA 3PNYA 1ZYQA 2BZFA 4UAYA 5KAIU 5KFXA 1QSSA 4EZ9A 4JK1A 3K9PA 1RYSA 3QUCA 5J2AA 4NLBA 5AM4A 1NK5A 1XSNA 1TVAA 5J0TA 4RZRA 4DQSA 1SXEA 5AIAA 5CB1A 5L1KA 3BQTA 3SMSA 2PMZF 5KFIA 4GIBA 1KKXA 1D0MA 2FPLA 4DV4M 2JRZA 3NVVA 5J2KA 2WAQF 3C29A 2PKEA 1WGLA 3LQQA 4QOSA 1XU4A 3RB3A 4IBGA 3RTVA 5HNKA 2GWSA 1WJ7A 3KHLA 2DXIA 3H0RB 3RJHA 2QB1A 3TARA 5C1BA 4KT0F 3GV8B 2KHVA 4O5CA 4RQ7A 3KFUF 2BCSA 3ZDAA 4C0ZA 1L7PA 4F4KA 2OM6A 4L6V6 1UQVA 1D9FA 1NK4A 4DV6M 3U61B 4LFCM 4UB2A 1KFTA 3C58A 4REZA 4ACOA 2JZBA 3C23A 1IXRC 4KMOB 5DYIA 4ECWA 3ZD8A 4Q44A 2R0IA 2V1UA 4LJ6A 3R9KA 3BXWA 4OO1J 3TANA 1PK1A 1WWUA 2AQ0A 2L6OA 3OPXA 1L2CA 5DG9A 4ELVA 1KFVA 4PHDA 1NHWC 1S8OA 4B9MA 2KV2A 1S10A 9ICUA 3FUTA 2Q2EB 3JR4A 3FTEA 4I27A 4OVZB 4ECVA 7ICUA 2QSFX 4NLNA 3CGWA 2KOBA 4J9QA 4NLCA 4M47A 1N2XA 1FEZA 3TFRA 1OUQA 3I01M 2C28A 2LVOC 3K8ZA 3GLIB 2NRZA 2H3ZA 1CEZA 2F76X 2O6KA 3NWLA 3M8SA 2KRKA 1UHUA 2H5XA 4AYBF 3D8LA 3I04M 1NK0A 4ICAA 2E5SA 4EYIB 4RF1A 4NSRA 3CTWB 9ICIA 2KZ3A 5IILA 1BPEA 3FUWA 5C18A 5KG7A 3MFHA 3KOOA 1MX0A 4JMUA 4YQWA 2VA8A 4I2IA 2YX8A 3GLGA 1SXJD 1Q3BA 2PFOA 2XICA 2WF9A 1NV8A 4P0PB 3R8FA 1DO0A 3T38A 3M6ZA 3E4RA 2HBLA 4NLGA 5AI4A 3QWLA 4KODA 2JZ1A 5FLXS 3BQ2A 4UQGA 4R63A 1XC8A 1G59A 4PGQA 3BDPA 1QAMA 3F53A 3KSJA 3PV8A 2IA6A 3PVSA 2N35A 2FS1A 1TF0B 2ZUDA 1S0VA 4MB7A 1MQ2A 3THGA 1NOMA 4MGYE 4WURA 3U6CA 3VCBA 3IHPA 2CUZA 2WSEF 3Q8SB 2DHYA 1N56A 1IG6A 4BXOB 2EKKA 1ZQLA 2FPMA 2UVWA 5ITTA 4DR3M 2G5GX 4QZIA 5C5JA 3C28A 2KNVA 2WF8A 4JN6A 5CEHA 3SBJA 1NNJA 2ALZA 2K60A 3C3DA 4PT5A 2WB1C 2GLEA 1BPZA 5ALDA 3IN5A 1V34A 4F71A 2KEBA 2MUTA 1LKYA 4PHAA 1IM2A 2UXCM 1IV8A 2AXTU 1NZBA 1Q3VA 4B9UA 2OCEA 3A0BU 2D7EA 3GQ5A 1L2BA 1BPBA 4YVZA 1X2IA 2HHSA 1IY0A 1EIJA 2BDUA 3NVYA 3E46A 4KLQA 2BJWA 4AG5A 3MGHA 2KVSA 4CF5A 1IY2A 3GDXA 2HHQA 1M6YA 3EWAA 1DGSA 3W67A 1ZQYA 4CJ6A 1ED1A 2E8MA 1FNNA 4G4QA 3NRWA 3FUUA 2L7IA 5KFZA 3RJIA 1BPDA 5ALVA 1ZQHA 4Z6DA 1GABA 4FO6A 1K3WA 5DB6A 5IREB 3PMLA 7ICKA 2HBKA 2W9CB 3LK9A 2XZUA 5EJCA 4LVSA 1X9SA 3NRZA 3SASA 1NI3A 1Z1VA 4UATA 1QDRA 2KHQA 2APLA 4GLXA 3THVA 4DL6A 4PL1A 2HOFA 4E0DA 3LVWA 4ED0A 3PO4A 1MA7A 2JMGA 3QU7A 5ITXE 2J6UA 2CV2A 5FTJA 2ZXIA 4Z6FA 3TWKA 2JHDA 8ICNA 2KW0A 2H3IA 9ICGA 4C8OA 1S97A 2PFQA 1NKEA 3O0FA 1SV4A 2Y1IA 4I2GA 1UT8A 2Y0SC 3KVWA 2AJQA 4UBBA 4IBDA 1UFZA 7ICFA 4NM1A 3FC4A 3BQ0A 1X42A 2DGZA 5AKZA 3QZ7A 4UAWA 8ICOA 3ZDDA 2HCFA 4QW9A 1U47A 3TFSA 1KYIA 2ZANA 4JI7M 4QWBA 5KTQA 1L1TA 2ZIUA 1N48A 1E32A 1WCLA 2DF4B 3AU6A 2OQ4A 1WUDA 1DGBA 2OO9A 3SARA 3HKZF 2XY6A 1R2YA 2CHQA 3BJYA 3WK8A 2FFJA 4AKIA 1YZ6A 4OJPA 3UMGA 2F8KA 4I2DA 3ICXA 4FE3A 5AM2A 1HQYE 4F72A 5AI9A 2FPKA 1JXEA 2ZJAA 4O9MA 2WSCF 4OD0A 5JU5A 4YN4A 1L3VA 1K82A 4DR4M 3VC8A 5AI8A 3D8BA 4RT2A 4P4MA 7CATA 5DNYA 1JR3D 1Z00B 2JUJA 4RQ6A 3RRHA 1SKSA 8ICBA 1S0MA 5DGBA 1FFVA 2WF6A 4B9NA 2QB0A 1XC9A 1N32M 4R66A 5AKLA 3QYEA 1SB3C 3V7LA 2L2DA 2L7HA 3AJIB 2WFAA 1AIPC 4DQQA 4S12A 5ALIA 4JXJA 2JWSA 3K4GA 2E8OA 1TK0A 4EEYA 4F2SA 3V6HA 3GRUA 2XY7A 4YY3M 1RM6C 2KICA 2FNAA 3OGUA 2W8LA 4KLIA 4ECRA 3KW6A 5KFHA 3MR5A 2D7GA 4WJ3B 4ECSA 4X64M 2LVNC 5EE3A 3CF6E 4EX7A 1N34M 3OSNA 1OQYA 4JI8M 5KG5A 3HW8A 5DBBA 1AROP 2OWOA 4FCVA 4R3DA 2G09A 4BJQA 8ICFA 5IT9S 4Z6EA 4IBCA 3ORYA 5KG6A 2JEGA 4USAA 1X6IA 4DFDA 5J2GA 5J0SA 7ICQA 3C2MA 3V76A 3T5JA 2VIIA 1N62A 1QAQA 5EXTA 1ZD4A 1L7MA 2BCVA 4MF8A 2WF7A 4IC9A 3CF2A 3T1YM 1ZQNA 4JV5M 4KLNA 2C5RA 5DFLA 2K4EA 1T3NA 3KP0E 4UB8U 3K92A 2W03A 4M9JA 2KHHA 3SYZA 1O08A 1Z5CA 1L6NA 4ZPXA 2O25A 3GV5B 4M04A 4LF7M 1DK3A 2RHFA 2L5YA 3F92A 5KFKA 2R65A 4DSEA 7ICEA 3FUVA 4IBIA 2LVQD 3VK8A 3WKBA 2A1JB 4YFKA 2KNAA 5ALSA 5EP2A 2KIWA 3ZC7B 5KFWA 5J2EA 5JI3E 8ICWA 5HP4A 2VA2A 2W7OA 4JI1M 3NGDA 2RKOA 3MHVC 2P6RA 3J27B 2YQEA 1XXHA 1UPHA 1TKDA 2QBYB 2LTUA 1DV0A 1RQNA 4QNRA 4DSLA 5L8RF 4GXJA 4ECTA 4BWJA 4CGZA 4ECZA 4PZNA 3T79A 7ICNA 4DL3A 3B9JA 3M1YA 5IZ7D 4YXJA 4XK8F 4K4HA 2ERCA 1ZQAA 4L4UA 3ED5A 2EH9A 3V7KA 2ASJA 4KMUA 2RGOA 4QZFA 2G8LA 3E58A 4P0QA 1IXZA 4F5RA 5J0XA 3FTCA 4RQ4A 3L3FX 4DCCA 4KLEA 5J0YA 4O3RA 1RDFA 5KAFU 4QWAA 4GC9A 2UUBM 3ISCA 3Q8PB 5KFFA 2JZ0A 2HAKA 2G0AA 4KITB 3JPQA 4IR9A 3ZDCA 4FS1A 3T5HA 2I6XA 2XCPA 2YMQA 2R4EA 1QZMA 5KFPA 1HT2E 2XH9A 1R4GA 3L2AA 3QYPA 8ICAA 4O3OA 4DOCA 2K6BA 1KEJA 2W9MA 3PSTA 4RUCA 3T1HM 1ZQKA 2JA2A 4KLSA 3L5KA 3KOWE 1AQ6A 3AOEC 3J81j 3B7QA 3PXGA 1JX4A 5DBAA 5AM5A 4FS2A 2KJ9A 2VJ5A 2DWZB 4AZFA 2JR5A 1DGFA 2DHRA 4CE6A 1U48A 2KSOB 4J9MA 4IBEA 1FIQA 2C9CA 2KZSA 5JI2E 2UXBM 2JZBB 4MFAA 1ZMUA 3HJQA 1IQPA 3EPGA 1RXWA 1SXJA 1NO1A 2KNZA 1HJPA 1UA1A 5J2BA 1S3SA 1Q46A 4P16A 1PK1B 5TZVA 5ALZA 1C1KA 2VKQA 4I81A 1F4IA 2QARA 4QZ9A 2K4HA 2KFNA 4RQ1A 4EBEA 4M9XA 1JALA 1FFUA 2ZTCA 4KLHA 4R64A 1LTMA 4BX9C 5KT5A 4RNOA 8ICKA 1KW4A 2FMQA 7ICIA 4F5PA 2XF3A 4R65A 4NLZA 2NYVA 3U6MA 4DR5M 4KX3A 1ZQRA 3BS5A 2JY7A 2F1HA 4IBFA 2FDRA 4A3VB 4O3MA 2IOFK 2AHMA 3H4BA 1X37A 1XHBA 4FBUA 4LZGA 2O01F 5CR0A 5CRXA 2JXJA 1LB2B 1HNZM 1X9MA 5ALNA 3LQRA 5EWGA 2KJ8A 1LV7A 2MAXA 4MFCA 1N60A 1JRPA 1DO2A 3FYDA 2DL0A 2F1IA 4F8RA 1MQ3A 4DO9A 4IIWA 2W3SA 4RUAA 3T15A 9ICSA 2W9BA 4NC6A 1TAUA 2RRDA 4TQSA 5EP1A 3TWMA 1FO4A 2WF5A 3PSPA 3H40A 5AKJA 5J0OA 1NJGA 4QZGA 3HWSA 2B0CA 2KZZA 4CCHA 3OTQA 2ZUCA 1QYRA 4FVMA 4LF6M 2YNMD 2EQYA 1KBUA 5AKEA 2RDIA 3VLFB 3VKHA 4RNMA 3TAQA 1XNSA 4QZHA 1SZPA 1N63A 4I8OA 1MN3A 1RYUA 1JUDA 1WHCA 2NRTA 3OSPA 3E2EA 3HT3A 2K89A 2OOAA 1N36M 2FLPA 3BQ7A 3N7RC 1TV9A 3GIIA 4C8MA 1KTQA 1B4FA 2LI6A 1U45A 2CRUA 2DAIA 5EQTA 2BDPA 2KXEA 2HBMA 2L09A 4RF0A 3GQ3A 2IHNA 1G3IA 1S0OA 1QCKA 2GNOA 4QIWC 3NBXX 3F5EA 4MM3B 1JMSA 1ZQDA 4BUGA 4P17A 1YZ7A 3N28A 1TH2A 4C8KA 4B08A 3GLHA 3B0XA 7ICTA 4RQ3A 4LJ7A 1Z4NA 3JR5A 1OW5A 3T3FA 1Z6TA 1A76A 2XGQA 3D6JA 2X4AA 4M0WA 3PW5A 5BPCA 3PSIA 2KZUA 4B6JA 1R6BX 2P35A 3Q8LA 4I29A 2V1CA 3PO5A 4LJ4A 3H4MA 1VEGA 5DBCA 2HHHM 4HAIA 3CRXA 1PGYA 4C8LA 1NVMA 5ALLA 3UXPA 4OCZA 4M6WA 1OJLA 4KLGA 5K4LA 5KFEA 5A2QS 2CHGA 2UXDM 1Q02A 3LMMA 3AQEA 3MGVA 2BHNA 2ZXHA 9ICNA 1NK8A 4IRCA 1QQWA 2G3QA 2GO7A 2F5SA 2ZIVB 3DZDA 2QCUA 3GU3A 3K75D 2IMWP 4C80A 3DV9A 2J5YA 3JPTA 2R18A 3A98B 1GJTA 1J7KA 1YE9A 2DWLA 4DOBA 5DKWA 2EZXA 4QNLA 1AUAA 2OYYA 9ICEA 3OJSA 1QH9A 2Y9TA 1ZQUA 2FLLA 5KL1B 4MHVA 1YUBA 1JR3A 2R62A 5CWRA 3AUOA 4RNAA 2ASDA 5J2HA 1RU3A 5J2CA 3HY5A 4UASA 5KFOA 4J9OA 3RJJA 1ZQ1C 1W5SA 5J0PA 3NASA 2W43A 1HNXM 3QU2A 1JXLA 3G6XA 4RNNA 2ZIUB 1U49A 1TTEA 1TE2A 4M2YA 4L16A 5J2JA 2RDJA 3BQ1A 2IBKA 3FTDA 3LVVA 3LCUA 8ICQA 3U60A 2Z8YM 2HHUA 3H8SA 4RQMA 1ZD3A 4DSFA 1L5UA 4DL7A 5GKNA 2ISPA 2W11A 3RBEA 4MEYA 3QYBA 2F44A 3JPPA 4D81A 2W54A 2WZJA 3AEVA 3QUTA 4JI6M 4LF9M 1NJYA 5H37D 3SHGB 3SFZA 2LMRA 4KLOA 2C99A 2W04A 5BR8M 4LZDA 5DQIA 3SV4A 3SYLA 5KT4A 2AQ4A 3AN1A 2OPFA 1XSPA 4DL5A 3KD3A 1D2NA 2QB0B 1WCNA 4CRXA 2HKJA 2W82A 1SKRA 5J2IA 1IY1A 2EANA 1QANA 4PHEA 4AQYM 3RGPA 3U5ZA 4J9KA 4DR7M 3SMPA 2WB1F 5DB7A 2ODGA 7ICPA 5F3XB 4DFKA 3IECA 3N4MB 8ICEA 4DSKA 3GLIE 2XGPA 2CXYA 1J5EM 4UW9A 4DS4A 5FP0A 1COKA 3NS1A 5JUMA 3L28A 4L15A 3MBYA 2XLJA 1B0XA 3M7GA 3L4PA 2HL7A 3GP1A 1KDHA 1ZOLA 5DGAA 2VJ4A 3VDUA 2FE8A 2C22A 2OEHA 1P3QQ 9ICJA 3F2DA 2UUAM 5KPRA 3MJ5A 4NRVA 4F5QA 2HHTA 4CIZA 1TK8A 2HVHA 4O0IA 2IOHA 4JV0A 2X49A 1J2MA 1GO5A 8ICRA 5AHXA 4YHHM 1Q8KA 1VG5A 5HHHA 2W8KA 2XCAA 2LWXA 4U7CA 4IBJA 3WKEA 3QXGA 4Y2PA 1G4AE 3L29A 3CP8A 3RBDA 2C96A 4TUQA 3SHFA 4HL4A 4ED8A 3JAMS 4R8UA 5FTNA 4LGMA 2IHMA 5KFYA 2F5NA 4M9SA 2BQRA 4UAUA 4LJ9A 5BOLA 5AIBA 4FZNA 5J0RA 3ETRA 4LFAM 9ICXA 1N77A 2KIVA 3HU1A 1MC8A 1Y8GA 3ISDA 4Z6YA 4DWIA 2P66A 3K1JA 1WWVA 4F93B 4G4OA 1SWVA 5J0WA 2QQ8A 1V38A 1TGUA 1QDTA 1TH4A 1HUOA 2LYHA 2NRWA 2Y0SF 5KFMA 1MJGM 1IN4A 1QQ5A 1N5XA 1BVSA 3SAHA 4Z6CA 2B6GA 4RQ0A 5H2FU 1NK7A 4K4GA 2G07A 1WGNA 2ZBKB 5DLGA 1XXHB 4YCXA 3BBZA 3AU2A 2LVPC 3CYMA 2FLNA 3TQSA 9ICLA 5EWEA 1T7PA 4X66M 3RH5A 4RQ8A 3AFHA 4JV1A 2EAOA 1IN7A 3QEBZ 3RR8A 1ZQGA 5ALUA 2ZIXA 4LJ8A 2QLTA 9ICWA 1PJTA 5AK5A 4F4YA 5ALXA 1OAIA 4L8RC 4MGIE 3A42A 4NXZA 1CI4A 8ICGA 4RKUF 2HI0A 4DOAA 2A1AA 3PW7A 3LDAA 1IFYA 1QAOA 4ZOHC 5T14A 2FMSA 4MFFA 5JRTA 4XA5A 3J7AS 2E3TA 3RRGA 2XVTA 4BGDA 9ICRA 1OAOC 9ICTA 4MH0E 5FSWA 1T3QA 4P4OA 5GTHU 4OJ5A 4D82A 3RB6A 2BR0A 3KXEC 3ZDEA 2LXEA 3HU3A 4F2LA 4JV2A 2DUYA 2UVRA 3KZXA 2KK0A 3FM9A 5B5EU 2HMXA 4II7A 1IN8A 2H1RA 1NHGC 4DF8A 5KG4A 3PSFA 4I4LA 4UARA 1N75A 3M9OB 4EEKA 4F50A 1B22A 5KG1A 2JXNA 3D2SA 5DB8A 1Q3UA 5J8YA 1X66A 4NM2A 2LM1A 4NL9A 2MR9A 5KT7A 4QZDA 1A0PA 3KHHA 3ZQJA 4EBDA 2KE7A 1SXJB 1Z5BA 4M0DA 1K1QA 3UXNA 1NNUC 2DAMA 3EPIA 3HJSA 1OFHA 2CEAA 2F4VM 2Q4TA 4PGXA 2GQFA 2W55A 1OKSA 5A0LA 3I4YA 3TADA 1H38A 1MN8A 2DQNB 2Z3XA 1QSLA 3D2NA 2QARB 1ZQXA 1L3SA 3SC3A 1E94E 1VQ1A 2Y20A 4M9LA 3LWLA 3GRRA 3SI8A 4J9RA 1QLNA 2YMMA 2KJ5A 1XNRM 3HX3A 3RFAA 5L1IA 2LHTA 4F1IA 5CP2A 4ED3A 3JPNA 1GKIA 3BS5B 2UUCM 2QP9X 1SV0A 2K47A 3PNVA 4FWDA 1ZQSA 3AKZA 2HVIA 4XBOA 2OXOA 1DRGA 9ICPA 4FFDA 1TH3A 3KZIU 3PW0A 9ICBA 1TR8A 3WKCA 1YSYA 3C5FA 4NXMM 4I28A 3GFKB 3QU4A 2E5LM 4Y2JA 1ZQEA 2B3TA 5KO3A 5DDMA 2KVCA 2F3NA 3HZJA 1QTMA 5AKIA 3JPRA 2YN4A 3C21A 2W9BB 4G4RA 4Q43A 2JV3A 7ICSA 3U6OA 3PX0A 1VEJA 4ED2A 2DVWB 4PH5A 9ICCA 3ZDBA 3IRUA 2E8PA 3H0LB 1XMOM 5ALOA 3GPXA 1SWWA 4LZZA 3WKDA 4NL4H 1IIPA 1ZQWA 3KHRA 1QUSA 4TUSA 1WG8A 2JY8A 3HJ8A 1JROA 2JH1A 4DL4A 5DG7A 4K4IA 1Z4OA 3FYCA 5IIKA 5F9NA 1IBLM 1NJFA 2BPFA 1LV5A 4TURA 2KN7A 4LFBM 1ZD5A 1DGHB 5KFJA 4F3OA 2D6FC 3KOZE 5EP4A 3GLFB 1RQLA 1XWIA 3UQ2A 2KNJA 2LYBA 1T8EA 2P5TA 4LZJA 4ELTA 2J6SA 1NSFA 2BNKA 1UM8A 1IM4A 1MU5A 8ICSA 3RAQA 3HRDD 4ECYA 5ITUA 8ICJA 5KQDA 5KT3A 3GPPA 2R45A 3KP1E 1SXDA 5D46A 4GC5A 3OTOM 2ZAOA 4GXKA 4I2CA 3MMPA 1C7YA 4X5VA 3KTQA 3ALRA 3EW9A 1ZXIA 1A5TA 5AKXA 3PY8A 2KTQA 5KFBA 5J2FA 5ITXA 4DV7M 2PI4A 1CRXA 3PNCA 1X6JA 2W9CA 4B3MM 5ITYA 5ALPA 4QHTA 3DA1A 2HWJA 3K9OA 4YG2A 1H6UA 4RPYA 4BBAA 1PJQA 4GH9A 3MK6A 1K1SA 2BWEA 1I94M 1DXSA 5KT6A 2LBCA 2W7PA 4O3SA 2CV0A 3KKAA 2FJ6A 1TDZA 4DLEA 4F4XA 4HLQA 4PD2A 4CF4A 5AKKA 2MJ5B 2CPRA 3FE3A 4F2RA 3M6KA 3V7JA 2DKZA 2Y9UA 4I2EA 2BQUA 1R7RA 5AK6A 1XSLA 3FAHA 3QE9Y 1HQCA 2E1FA 4O5EA 1V97A 4IQTA 4US8A 3GPYA 5EE0A 8ICMA 1ECWA 2VF8A 5KG2A 2BWBA 1TAQA 4LJAA 2PI5A 5ALTA 4XGIA 3GPUA 2YFQA 2IOFA 4CF3A 8ICCA 2KZMA 8ICXA 1PK3A 4B3SM 1E9RA 3RH4A 2C98A 2XI9A 4UB5A 2X8AA 1W5TA 2CV1A 2NRXA 3PX6A 3WHLA 5KFRA 2DKLA 5KFCA 4ITQA 1OIZA 4IQVA 4OX9M 1ZQVA 3RJKA 3SYKA 1XO1A 4DV5M 3L27A 3ONNA 5BPVA 5D4BA 5LMNM 2KG5A 1V9PA 2I9GA 5EXSA 3HX0A 4KN7A 2XY5A 2XO7A 3C2LA 1VDVA 2Y21A 4PL2A 1NJXA 1XB2B 4FW9A 4MGKE 2ES6A 3WHKA 2BPCA 4LF8M 3PVXA 9ICKA 4NRWA 2JEIA 4UAZA 2KKVA 2F1JA 2CRXA 3RGSA 3HU2A 1X40A 3D2QA 4U6PA 4RQ5A 5DLFA 4YR3A 2NRVA 4UB1A 4QNMA 4L78A 2EJSA 2WHEA 4EELA 4HEOA 3SENA 1Z1BA 1GJSA 1F5SA 3FD9A 2DWMA 2KKPA 3HP6A 1HNWM 3PW4A 3GLGB 3V72A 3WK7A 1ZJNA 4AG6A 4B7GA 3U5ZB 3MR6A 4QIWF 4NWIA 7ICRA 2A19A 4NY8A 1IBMM 5ALQA 8ICHA 2M9NA 2ZIWA 4US9A 4EYHB 3HJEA 1SXJC 3K2LA 2EDUA 2FOIC 1UA0A 3RJEA 1IXSA 2M60A 5KG3A 4NLKA 4Y28F 4QZ8A 4I2HA 1ZQBA 5FTKA 4Y2UA 2G5HB 2K8AA 4Y2YA 3GQCA 4PPXA 1N5WA 1IN6A 3TE6A 4YP3A 2QZ4A 3B9PA 3QUQA 3JPOA 3GIJA 4TUPA 1R5LA 3H4DA 3EYZA 5L1JA 1SIJA 4ECQA 1UT5A 4ED7A 2V6ZM 4B7HA 4O3NA 4YXMA 1Y88A 4RPXA 2XSZD 3U6LA 4XRHA 2EZZA 3AV0A 2BCUA 3IG5A 3KOXE 2NQ8C 3OHAA 2HOQA 1TDHA 4XUSA 4K0KM 3UGJA 3C9PA 9ICAA 8ICZA 3SAUA 3KDSE 2MUTB 2EAMA 3T5KA 4I5SA 1LKYB 3J80S 3VK7A 2V4RA 3W68A 3Q8XA 1ZQIA 1V92A 4Q8EA 3DEEA 3TPZA 3GQ4A 4QJFB 3W0FA 4R71A 2F5QA 1L8LA 1SL2A 2JY5A 4GHAA 4EBCA 5B66U 2A1JA 1X9WA 1ZQQA 4F4WA 1F44A 5L9XA 4W5WA 2JH7A 2Y0QA 4DV0M 1K3XA 2C2DA 2GH1A 4ECUA 1ZMWA 3NUQA 1ZJMA 3J7BA 2N1RA 1OIPA 1UCVA 3MDAA 5DQHA 2MSNA 2NV3A 4DR1M 2VA3A 4Q7JA 5KFNA 1ZRMA 2UU9M 2QBYA 2R44A 1JIHA 2DZOB 1PVRA 1BNPA 1TFRA 1S5LU 3UK6A 5ALHA 1IXRA 4IBBA 4DV2M 1XS9D 3M0EA 3V6KA 4I2BA 4QWDA 3M6AA 3R9XB 4GHLA 1KFSA 1G8PA 3SEIA 8ICVA 3AL0B 2BJVA 4LY6A 1QSYA 3ILKA 3B7NA 2QKQA 3AM9A 2HW3A 1L8OA 4GIPA 3VDPA 1VJ5A 4FWGA 3TQ1A 2K9DA 9ICVA 3IM1A 2Y0TA 5IIJA 2V9WA 4WP2A 3H8MA 2AGQA 4B9SA 3PFIA 5BOMA 4O5KA 4LGYA 1RYRA 5KG0A 3IDWA 4UAVA 1DGGA 3H4JA 4GXIA 5G5GA 5AK4A 4Q45A 5DYGA 2DAEA 2LHCA 4I2JA 1ZV1A 3UZUA 1DOQA 5ALFA 4FBTA 4Q8FA 1VDLA 5LMUM 1ZQCA 1J09A 1G71A 4JI3M 1GVNA 4PJ0U 3VKGA 2EO2A 3GV7B 1SL0A 3EIHA 4GKKM 4FCTA 4QZBA 4ECXA 4Y2TA 4IRKA 1R2ZA 2KSOA 4O3QA 5J29A 1BNOA 4BDPA 2RLTA 3FRHA 5ALMA 5ITRA 1XO0A 4CDGA 2LH0A 1RG6A 1SL1A 5EP3A 3EZ5A 4EENA 2FMPA 1ZAEA 5J0QA 3H7IA 3WU2U 7ICMA 3MR2A 1YLAA 8ICYA 4J9NA 3E9SA 1JB0F 3PZPA 1XWLA 1E9SA 4QWEA 2DWQA 1ZETA 2K4PA 8ICLA 4NOOB 5KFSA 3MC1A 2PMZC 1HIWA 2V4QA 3KOYE 3KFUG 4M0AA 2WAQC 3RE8A 7ICJA 5AM0A 3KBBA 4FD2A 3I76A 1NJWA 2R8KA 3KSXA 4NJ8A 2LM4A 3Q8KA 1WR1B 4QW8A 7ICHA 3I4VA 2L4FA 3UXOA 4DL2A 1NK9A 1COOA 4LCBA 4J03A 5KFAA 4QWCA 4IQWA 3NTUA 2VQEM 1JQJC 4J9LA 2DPJA 4KLDA 4YMMA 2C2RA 2MROB 3RJFA 1LVHA 1QQ6A 3SAFA 2D3DA 1D9DA 4C4RA 5KPTA 5L1LA 3FYHA 2DENA 2I1QA 1Z5AA 3UMMA 5EE9A 1JN3A 4F4ZA 3HHWA 1HEKA 3Q8RB 4Z8XA 3UPQA 1EFUB 4KTQA 3H0MB 4JI5M 3E21A 4P4PA 1GLNA 2FH0A 4PDGA 5CA7A 2PFNA 1OXJA 2C9OA 2RQ5A 2EAPA 3GILA 3SQIA 3J81S 1L3UA 1GL6A 4Y2RA 4KLMA 2LKYA 4JI4M 3BS7A 5AKGA 1RZTA 4EIWA 1C20A 4QZCA 3HHXA 3H8JA 3A46A 3E0FA 4AYBC 2DAKA 1HR0M 3UQ0A 2W3RA 3MR3A 1NK6A 3WK6A 2KD1A 1TK5A 3EUB2 4B9LA 2HOIA 1BPXA 1RXVA 5FTMA 1N78A 4UBCA 3KS4A 5KL8B 3I51A 7ICVA 3TAPA 1NY5A 2I7NA 3U6EA 4GMQA 1F0MA 4DEZA 4NV0A 2LPEA 2VANA 1DGJA 3CNHA 2MU2A 4NXNM 1NV9A 4DUZM 1J2NA 3HKPA 4MGHA 5HMLA 2UVUA 1X9XA 3KS8A 5ALEA 2BCQA 4GITA 2R4JA 1D8LA 5KT2A 5EXPA 1GL7A 3U6DA 4OJLA 2VQFM 2OHFA 4LF4M 1NJZA 4B9VA 2LNHC 5AKYA 4TUWA 1NKBA 2KP7A 1OTRA 2VIXA 4YMNA 4P0QB 3C3EA 4A8EA 2HBJA 5ALWA 1GO3F 2E1EA 1DK2A 1KRPA 4EZ6A 1XXHE 3AMZA 2F5PA 2DZLA 2NO4A 3SMVA 3WK9A 3B74A 8ICIA 3UJNA 5DQGA 2K0BX 2J7NA 3H8WA 1KLNA 2DNAA 2ZIVA 3B0YA 2I5HA 2PFPA 2QENA 4B7FA 5C0YA 4DR6M 2ZJ5A 8ICUA 3F5AA 5EOZA 3Q8MA 4O3PA 1KN5A 2FE9A 3HILA 3OHBA 4YD2A 2YMPA 4R7GA 3J2PB 4FZMA 4YMOA 1N61A 5L1MA 1RPLA 4DS5A 2LBOA 3Q8GA 4ANRA 2AHOB 3N97B 1HUZA 2OH2A 4IRDA 4CHTB 3DDHA 4AW4A 4M9HA 1BGXT 3LCVB 3U61A 2YY6A 2EA0A 2XEPA 4LRTA 1B43A 4UB6U 1T43A 5EWFA 5ALGA 3AQFA 1KL9A 2XFTA 5ITQA 1CUKA 3HHYA 3RF9A 1S77D 4IS7A 2Y1JA 5KFQA 3PR5B 4GRIA 3AL0C 4KLFA 4B9TA 3C1YA 4F5NA 3GO8A 4CISA 2KFZA 2ATLA 2JY6B 3SATA 2P6UA 3PR4A 1Z59A 1A6SA 3M9MB 4JWMA 4LG2A 3QZ8A 2YR0A 4DFJA 4RPZA 4OVZA 3F2CA 1IN5A 2G08A 4PHPA 4LJ5A 3NBIA 1SZHA 1MSWD 3HPOA 4DFMA 3QU5A 3CW2C 5DB9A 2WTFA 3SV3A 1ZQTA 2K8CB 1Z3EB 4KO8A 4RU9A 3GLIA 1IBKM 5DDYA 1ZQJA 2DKXA 3BZCA 1SXJE 4M9GA 3RR7A 1I4WA 4RT3A 2AH5A 4PCZA 4B3RM 3B89A 2D7HA 4GFJA 1TAMA 3TL4X 1Q3CA 9ICMA 4DSJA 4IBKA 3TWLA 3QU9A 2DI0A 2XSZA 4C7YA 1NNLA 4CNQA 4Y2QA 1EXNA 2QHOB 4P0PA 4QOZC 2W9AA 2BCRA 3HWTA 4JYAM 3QAUA 5KFUA 1SGGA 4PDIA 3HKZC 4OJ6A 5AICA 9ICQA 3IV6A 4DLGA 3V6JA 2JEJA 5J8YC 1G41A 2DWNA 4G9BA 2PXIA 4YD1A 1QZEA 1PZNA 4QZAA 4NL9C 3KHGA 2BGWA 2CN1A 3K1ZA 4UB3A 5ALRA 2MGWA 2ZIWB 3K1RB 2R46A 2E8NA 3QNMA 1PUZA 1HT1E 3W0LB 4BWMA 5JTIA 5J0UA 3SAGA 4G6ZA 1PM5A 1IXSB 1L1ZA 2CFOA 3ISBA 1ZQFA 1OFIA 2G06A 2QNJA 1V85A 3I28A 4C4TA 3SZ2A 1SKWA 4B3TM 4KN4A 9ICFA 1URJA 3TI0A 3TADC 4DQRA 4YR0A 4AKHA 3MGIA 3GIMA 4HYKA 1KSFX 3TACB 4BXOA 4JI2M 2H3QA 3IP4B 3SR6A 1KSPA 4DSIA 1ZQMA 4M9NA 2F8LA 2R8HA 4OW0A 1QUTA 2H3VA 2HSZA 1FJGM 3SAWA 9ICOA 3ZI4A 3WK4A 4FWHA 2R8GA 1YT3A 4LRSA 5KFVA 2XIDA 3IHQB 4IQUA 5KQ8A 1PJJA 5AK3A 3WK5A 2UVVA 2BQ3A 4CGYB 1ZQOA 1SV0C 3FKEA 3RH6A 2RGHA 2RRUA 2ZJ8A 2F77X 3G6VA 5IIOA 1D8YA 3GLHB 3PMNA 1P7DA 2ESEA 3NVWA 2CWBA 2YTUA 5F3WA 3C5GA 2M0NA 3MDCA 2F5OA 3HGIA 4QZEA 3MFIA 3AOEA 3PX4A 3ZH9B 1KQQA 5IIMA 5IWAM 1A77A 1ZRNA 3A0HU 4DQPA 3GLFE 2RP5A 5HHIA 4I2AA 2HHVA 2R8JA 4IL6U 2HHXA 2CE7A 2LYAA 4YR2A 3GLHE 2ZM6M 3F2BA 4M6WB 5TISU 2G5IB 3VFDA 4GC6A 2ASLA 1JI7A 3GRYA 2DAGA 3RFWA 4Y2VA 4F92B 1S9FA 5FTLA 4M9ZA 2XZFA 4JWNA 4G3OA 3T5LA 4RQ2A 1D0KA 4BLCA 1XMQM 1K5OA 2DFLA 4P2HA 8CATA 3RB0A 4LF5M 5KFGA 4RQNA 1ZQPA 8ICPA 2KMDA 2KA6B 2ZUBA 2ZAMA 5AM1A 7ICGA 4KX5A 4JUZA 1S0NA 5KFDA 5HMMA 2YQZA 3FUXA 5HR7A 1ZQZA 5ALJA 3Q8QB 4AI6A 1WIVA 5F9LA 4C4SA 2A3VA 1L7OA 2YB4A 9ICHA 1L8QA 1L7NA 4OJOA 1O03A 5KFTA 5E6JA 4X62M 3QX7A 2J6TA 2Z4RA 2Z4SA 3N7PD 3L26A 4I2FA 5AM3A 1T94A 2JEFA 1BPYA 3GZFA 2WSFF 1JR3E 4F5OA 3U60B 1ORYB 3QEAZ 4ELUA 5E79U 2OOBA 4NSOB 5ALKA 1ZQ9A 2HDOA 3MABA 1PVPA 5ALYA 4Y2XA 1PJSA 4GKJM 4C8NA 4IJFA 2F2AB 4DV3M 3KKAC 1J97A 2BPGA 2J7OA 1U9LA 1Z00A 4KLJA 2K8BB 5HR6A 5GTIU 1L3TA 3FDSA 2DZNB 1ZD2P 3GIKA 4J9SA 4DFPA 2VF7A 4UB4A 2XC9A 5EXXA 1XNQM 3IG8A 4AKGA 2M5ZA 2HCBA 5KFLA 2KDLA 2CP8A 2MA1A 1Q39A 1QQ7A 5IIIA 4AP9A 3U26A 4J9PA 3JPSA 4C7ZA 4ED6A 2B21A 3SD7A 3UMCA 1VDDA 4PGYA 2D8CA 2R8IA 4DBGB 4FZLA 4KLUA 4GEWA 5AI5A 4ZH4A 4F91B 3C1ZA 1U4BA 4KHPM 2KEYA 3M7DA 3DFZA 2AU0A 5G5HA 3RAXA 4JB3A 2R6FA 4EX6A 1VEKA 3N7SC 2MH8A 5DG8A 3U6PA 2Z7JA 3A45A 2GOLA 5CHGA 4MF2A 4D80A 2BKEA 4Y2SA 3S6JA 4TQRA 1PVQA 4FCWA 2ZTDA 4QHSA 4ED1A 3B7ZA 4G4NA 5D49A 3GLGE 3U6SA 2XFSA 3ETLA 4KLTA 2LHGA 2HHWA 3SAVA 4XQ8A 2DBYA 1Z19A 4MGZE 3LYSA 2I7PA 1NY6A 1V33A 1T4GA 1KFDA 8ICTA 1QVRA 4LJXA 3UMBA 3PW2A 4DF4A 4BB9A 3BOSA 2CHVA 4R8UB 1PRBA 2JGAA 2NO5A 1D0LA 5CJ7A 3OJUA 5AKHA 2FI1A 2AGOA 2LVAA 1EE8A 3BZKA 2ISOA 3QUBA 5E26A 3FRIA 3GRVA 3I1YA
chains in the Genus database with same CATH topology
1Q3UA 1D8BA 3DOAA 3FTCA 4OU7A 3L3FX 2YB1A 2XGNA 1A0PA 4GC9A 1DGHA 3SAFA 2UUBM 3HHZA 1SXJB 1Z5BA 4M0DA 2G0AA 5KPTA 3GLFA 2A5YB 1NNUC 3HJSA 1OFHA 2R4EA 2CEAA 2F4VM 2Q4TA 3ZCBB 1QZMA 1Z5AA 3UMMA 1HT2E 2XH9A 3L2AA 3HHWA 1HEKA 3I4YA 5A0LA 3PSTA 4Z8XA 4DUYM 1L2DA 4WW0A 3T1HM 2Z3XA 2DQNB 2EUCA 5KPZA 3D2NA 3H0MB 4JI5M 2JA2A 1T3TA 3SC3A 1GLNA 1E94E 3KOWE 3U6QA 3AOEC 4PDGA 3L25A 2Y20A 3PXGA 2C9OA 3FTFA 2KRUA 3AOGA 2MRLA 3SQIA 3J81S 2VQEM 1GL6A 2KJ9A 2VJ5A 1PJIA 2DWZB 1WXQA 2LKYA 3GRRA 2QPAA 4AZFA 4JI4M 4JI0M 4EIWA 3HHXA 3CF0A 1XNRM 4IJEA 1DGFA 2DHRA 4X65M 3A46A 2O5RA 1HR0M 4DR2M 2H3FA 4IBEA 2LHTA 3E0FA 2ZIXB 1GKIA 2C9CA 2UUCM 2QP9X 4DV1M 2ZG6A 2K47A 2KZSA 3PNVA 4FWDA 3AKZA 5JI2E 2UXBM 2K4IA 2KD1A 1N33M 3EIEA 4XBOA 2OXOA 1DRGA 3HJQA 3PNYA 2HOIA 1IQPA 5FTMA 1N78A 1SXJA 3KS4A 1TH3A 3I51A 5KL8B 1NY5A 2I7NA 4NLBA 3U6EA 1S3SA 1YSYA 4GMQA 4P16A 4NXMM 4NV0A 2E5LM 5KO3A 1C1KA 3SMSA 2PMZF 2KVCA 2VKQA 4NXNM 4I81A 4DUZM 3HKPA 4MGHA 4DV4M 4G4RA 2K4HA 2WAQF 3C29A 4M9XA 3KS8A 3LQQA 4QOSA 3U6OA 4GITA 4IBGA 2R4JA 2DVWB 3RFAA 2DXIA 3H0RB 4BX9C 5EXPA 1GL7A 3U6DA 3H0LB 4OJLA 1XMOM 5C1BA 3GPXA 2VQFM 4LZZA 4LF4M 2KHVA 2LNHC 3KFUF 4NL4H 2XF3A 4C0ZA 4TUWA 3U6MA 2OM6A 1IIPA 4DR5M 4KX3A 4DV6M 3U61B 4LFCM 4IBFA 2VIXA 4A3VB 4O3MA 4P0QB 4A8EA 2AHMA 4REZA 3C58A 2HBJA 1GO3F 3HJ8A 2E1EA 4ACOA 1IXRC 1X37A 1XHBA 2JH1A 4KMOB 5DYIA 3FYCA 2F5PA 5CRXA 2V1UA 3SMVA 1IBLM 1NJFA 1HNZM 4LJ6A 3UJNA 4LFBM 3LQRA 1DGHB 4OO1J 2KJ8A 2D6FC 1LV7A 2L6OA 2J7NA 1L2CA 3KOZE 5EP4A 3OPXA 1KFVA 1DO2A 3GLFB 3FYDA 1NHWC 2ZIVA 1XWIA 2KV2A 2KNJA 2LYBA 2QENA 2P5TA 4LZJA 4IIWA 3FUTA 3T15A 4B7FA 5C0YA 4DR6M 1NSFA 2BNKA 2Q2EB 3JR4A 1UM8A 3FTEA 4OVZB 3F5AA 2RRDA 1MU5A 5EP1A 5ITUA 5KQDA 2KOBA 3GPPA 3TWMA 4NLCA 2R45A 4R7GA 3KP1E 3J2PB 3PSPA 4FZMA 1OUQA 1NJGA 4GC5A 3HWSA 3OTOM 3K8ZA 2ZAOA 2LBOA 3GLIB 2OH2A 1QYRA 4CHTB 4FVMA 2H3ZA 4LF6M 2YNMD 4AW4A 2F76X 3ALRA 1KBUA 3NWLA 2KRKA 5ITXA 3U61A 4AYBF 3VLFB 3VKHA 3D8LA 2EA0A 1XNSA 2XEPA 4LRTA 4I8OA 4DV7M 4ICAA 2E5SA 4RF1A 4NSRA 3CTWB 1CRXA 2K89A 1N36M 3AQFA 3N7RC 2XFTA 5ITQA 3FUWA 5ITYA 5C18A 4B3MM 4QHTA 3HHYA 1MX0A 3DA1A 3RF9A 4JMUA 2YX8A 1H6UA 3GLGA 4BBAA 5EQTA 1SXJD 4GRIA 2KXEA 4GH9A 1Q3BA 3MK6A 2L09A 2HBMA 2XICA 1I94M 4P0PB 3R8FA 4RF0A 1DO0A 3GQ3A 3AL0C 1G3IA 3T38A 3M6ZA 2CV0A 2W7PA 3E4RA 3GO8A 1TDZA 4CISA 2HBLA 3SATA 4MM3B 3F5EA 4QIWC 1Z59A 1A6SA 4BUGA 3QWLA 4HLQA 4PD2A 4KODA 4LG2A 2YR0A 1TH2A 5FLXS 4OVZA 3GLHA 4B08A 2CPRA 1XC8A 1G59A 4LJ7A 3F2CA 1IN5A 3M6KA 3JR5A 2G08A 1QAMA 4LJ5A 3NBIA 3F53A 3KSJA 1SZHA 3PVSA 1R7RA 1Z6TA 2X4AA 4M0WA 2K8CB 4MB7A 1HQCA 4KO8A 2E1FA 3GLIA 1IBKM 2KZUA 3THGA 1R6BX 3PSIA 2V1CA 4LJ4A 3H4MA 4MGYE 1SXJE 4WURA 3GPYA 3U6CA 2HHHM 1I4WA 2CUZA 1ECWA 3VCBA 3CRXA 4PCZA 4B3RM 4LJAA 2D7HA 1NVMA 4XGIA 5ITTA 4DR3M 3TL4X 1Q3CA 1TAMA 4GFJA 2G5GX 4IBKA 3TWLA 2YFQA 3GPUA 3C28A 1OJLA 4JN6A 5A2QS 2CHGA 2XSZA 3SBJA 1NNJA 2UXDM 4B3SM 1E9RA 3LMMA 3AQEA 4P0PA 2C98A 4PT5A 4QOZC 2WB1C 2XI9A 3MGVA 2X8AA 1W5TA 2CV1A 3QAUA 4JYAM 2ZXHA 3IN5A 3WHLA 4PDIA 4ITQA 3HKZC 4OJ6A 2KEBA 1QQWA 1IM2A 4OX9M 2F5SA 2UXCM 2ZIVB 3DZDA 1G41A 3SYKA 4DV5M 3L27A 2DWNA 5BPVA 2QCUA 5LMNM 3ONNA 4AYBC 1NZBA 1Q3VA 3GU3A 2D7EA 2R18A 5EXSA 3GQ5A 1L2BA 2CN1A 3K1ZA 3A98B 1IY0A 1J7KA 1YE9A 2DWLA 2ZIWB 2R46A 2BDUA 1HT1E 4QNLA 3W0LB 2OYYA 3SAGA 4G6ZA 1PM5A 2Y21A 2BJWA 4PL2A 4AG5A 1IXSB 1L1ZA 2CFOA 4FW9A 4MGKE 3WHKA 4LF8M 1OFIA 5KL1B 1IY2A 4NRWA 2G06A 1YUBA 1JR3A 2R62A 2KKVA 2CRXA 4B3TM 3RGSA 4RNAA 1URJA 3HU2A 4AKHA 3D2QA 1KSFX 4U6PA 1ED1A 4JI2M 2H3QA 3IP4B 1FNNA 4G4QA 1ZQ1C 4QNMA 3NRWA 1W5SA 2F8LA 3FUUA 4OW0A 2H3VA 2L7IA 4L78A 1FJGM 3SAWA 1HNXM 1K3WA 1Z1BA 5IREB 2HBKA 3FD9A 2DWMA 2KKPA 2XZUA 2KJ5A 2ZIUB 5EJCA 4FWHA 1HNWM 3GLGB 1YT3A 4AG6A 4L16A 4B7GA 3U5ZB 3SASA 4LRSA 3FTDA 2XIDA 4QIWF 2KHQA 5KQ8A 1PJJA 4NWIA 3LVVA 4CGYB 2HOFA 4PL1A 3U60A 3LVWA 1IBMM 3FKEA 2RGHA 1MA7A 2F77X 2JMGA 5ITXE 3GLHB 1P7DA 2ZIWA 5GKNA 2CV2A 5FTJA 1SXJC 3K2LA 2ZXIA 3TWKA 2JHDA 2FOIC 2KW0A 2H3IA 4D81A 5F3WA 4JI6M 2M60A 4LF9M 2M0NA 2F5OA 5H37D 3HGIA 3SHGB 3SFZA 2C99A 3AOEA 5FTKA 3ZH9B 5BR8M 2G5HB 2K8AA 2W04A 3O0FA 3SYLA 2Y0SC 3KVWA 5IWAM 4IBDA 2OPFA 1IN6A 3TE6A 2RP5A 2DGZA 1D2NA 2QZ4A 3B9PA 4CRXA 2HKJA 2W82A 2CE7A 2LYAA 2ZM6M 3F2BA 2V6ZM 4B7HA 1KYIA 2ZANA 4JI7M 1IY1A 2XSZD 1L1TA 3U6LA 2ZIUA 1E32A 1QANA 2G5IB 4AQYM 3VFDA 3RGPA 3U5ZA 2DF4B 4DR7M 3SMPA 2WB1F 3AV0A 2OQ4A 3GRYA 3IG5A 3KOXE 2NQ8C 3RFWA 1WUDA 1DGBA 3SARA 5FTLA 2HOQA 3HKZF 1TDHA 1R2YA 3UGJA 4K0KM 2CHQA 4M9ZA 3SAUA 2XZFA 2FFJA 3KDSE 4AKIA 4OJPA 1J5EM 4I5SA 4BLCA 3ICXA 4FE3A 1XMQM 3L28A 4L15A 3J80S 3VK7A 1HQYE 2XLJA 3D2SA 3M7GA 3Q8XA 2HL7A 3GP1A 3DEEA 3TPZA 3GQ4A 4QJFB 8CATA 3W0FA 4LF5M 3VDUA 2FE8A 2VJ4A 2F5QA 3F2DA 2UUAM 5KPRA 1K82A 4DR4M 4GHAA 3MJ5A 3VC8A 4NRVA 2KA6B 3D8BA 1F44A 4W5WA 7CATA 1JR3D 5DNYA 2X49A 2ZAMA 2JH7A 2Y0QA 4DV0M 4KX5A 1K3XA 2GH1A 4YHHM 2YQZA 3NUQA 3FUXA 3J7BA 2N1RA 5HR7A 4AI6A 1N32M 2LWXA 4DR1M 2NV3A 4U7CA 2UU9M 4IBJA 2QBYA 2A3VA 2DZOB 2YB4A 1PVRA 1G4AE 1L8QA 2L7HA 3AJIB 3L29A 3CP8A 2C96A 3UK6A 3SHFA 4OJOA 4HL4A 3JAMS 4S12A 4JXJA 5FTNA 4IBBA 4LGMA 5E6JA 4X62M 4DV2M 3M0EA 2Z4RA 2Z4SA 3N7PD 3L26A 2F5NA 4M9SA 1T94A 3M6AA 3R9XB 4GHLA 3GZFA 4LJ9A 1G8PA 3GRUA 3U60B 1ORYB 3AL0B 2BJVA 4LY6A 4YY3M 2FNAA 3ILKA 2KICA 4FZNA 4NSOB 1ZQ9A 4LFAM 3KW6A 1PVPA 1N77A 4GIPA 3VDPA 2D7GA 3HU1A 4FWGA 4WJ3B 4X64M 4GKJM 2Y0TA 4Z6YA 3CF6E 3K1JA 4IJFA 1N34M 2F2AB 4G4OA 4DV3M 4JI8M 2J7OA 3PFIA 2K8BB 1TGUA 4FCVA 1TH4A 5HR6A 4R3DA 2G09A 4BJQA 2Y0SF 4LGYA 1IN4A 5IT9S 2DZNB 1DGGA 4IBCA 3SAHA 5EXXA 1XNQM 3IG8A 4AKGA 2M5ZA 2HCBA 5DYGA 2VIIA 3UZUA 2G07A 2ZBKB 1QAQA 1XXHB 2MA1A 1Q39A 5EXTA 5LMUM 3CYMA 4IC9A 3TQSA 1J09A 4JI3M 3CF2A 1GVNA 3T1YM 3VKGA 2EO2A 4X66M 4JV5M 3EIHA 4GKKM 4FCTA 1VDDA 3AFHA 4KLNA 2C5RA 2K4EA 1IN7A 3KP0E 3K92A 4FZLA 1R2ZA 2W03A 2ZIXA 4LJ8A 4KHPM 1Z5CA 5ITRA 2KEYA 1L6NA 3M7DA 1XO0A 3DFZA 4CDGA 4ZPXA 2LH0A 3N7SC 3U6PA 5EP3A 2Z7JA 3A45A 4MGIE 3A42A 4L8RC 4LF7M 2GOLA 4D80A 2RHFA 1ZAEA 2R65A 3FUVA 1PVQA 4IBIA 4FCWA 3VK8A 4QHSA 1QAOA 5T14A 3E9SA 3PZPA 4G4NA 3U6SA 1E9SA 2XFSA 3J7AS 5EP2A 2KIWA 3ZC7B 2XVTA 5JI3E 4NOOB 3SAVA 2W7OA 1Z19A 4JI1M 2PMZC 4MGZE 4MH0E 1HIWA 3LYSA 2RKOA 2I7PA 3MHVC 1NY6A 3J27B 5FSWA 1XXHA 1UPHA 4OJ5A 4D82A 3KOYE 3KFUG 1QVRA 2QBYB 2WAQC 3KXEC 3RE8A 2LXEA 4QNRA 3HU3A 4CGZA 3T79A 3KZXA 4FD2A 4BB9A 5IZ7D 3BOSA 2CHVA 2ERCA 2HMXA 2JGAA 3KSXA 1IN8A 4II7A 2H1RA 1NHGC 4L4UA 3PSFA 4I4LA 2RGOA 3I4VA 1N75A 2G8LA 4LCBA 1EE8A 5E26A 1JQJC 4P0QA 1IXZA 3GRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7J A;  2R18 A; 
#chains in the Genus database with same CATH topology
 2YML A;  1D8B A;  3DOA A;  4OU7 A;  3T6P A;  3C2K A;  2YB1 A;  2XGN A;  1WYG A;  1SG9 A;  1DGH A;  3LW5 F;  2VDB B;  3HHZ A;  3G6Y A;  4GC7 A;  3GLF A;  2DPI A;  7ICO A;  2A5Y B;  4IR1 A;  2JP7 A;  4UN2 B;  5AI6 A;  4MEX A;  3ZCB B;  3WKA A;  3UM9 A;  2L4E A;  2EZY A;  5AI0 A;  3ZD9 A;  3M8R A;  3TKA A;  3M9N B;  4DUY M;  1L2D A;  4WW0 A;  2EUC A;  5KPZ A;  2C2E A;  4G3I A;  2Q0Z X;  3RB4 A;  1T3T A;  3U6Q A;  3L25 A;  1NKC A;  1ZMV A;  5J2D A;  1T6O A;  5IIN A;  2AGP A;  3FTF A;  2KRU A;  1NZP A;  3AOG A;  2MRL A;  5KNI A;  4DQI A;  1PJI A;  1WXQ A;  2JNH A;  2QPA A;  4JI0 M;  3CF0 A;  1S76 D;  4IJE A;  2EKF A;  4X65 M;  2O5R A;  2H3F A;  4DR2 M;  7ICL A;  3NVZ A;  2ZIX B;  5EE1 A;  2ZTE A;  4KLL A;  1VLB A;  3RJG A;  2ZG6 A;  4DV1 M;  2K4I A;  4PZO A;  3LWM A;  1N33 M;  3EIE A;  3PNY A;  1ZYQ A;  2BZF A;  4UAY A;  5KAI U;  5KFX A;  1QSS A;  4EZ9 A;  4JK1 A;  3K9P A;  1RYS A;  3QUC A;  5J2A A;  4NLB A;  5AM4 A;  1NK5 A;  1XSN A;  1TVA A;  5J0T A;  4RZR A;  4DQS A;  1SXE A;  5AIA A;  5CB1 A;  5L1K A;  3BQT A;  3SMS A;  2PMZ F;  5KFI A;  4GIB A;  1KKX A;  1D0M A;  2FPL A;  4DV4 M;  2JRZ A;  3NVV A;  5J2K A;  2WAQ F;  3C29 A;  2PKE A;  1WGL A;  3LQQ A;  4QOS A;  1XU4 A;  3RB3 A;  4IBG A;  3RTV A;  5HNK A;  2GWS A;  1WJ7 A;  3KHL A;  2DXI A;  3H0R B;  3RJH A;  2QB1 A;  3TAR A;  5C1B A;  4KT0 F;  3GV8 B;  2KHV A;  4O5C A;  4RQ7 A;  3KFU F;  2BCS A;  3ZDA A;  4C0Z A;  1L7P A;  4F4K A;  2OM6 A;  4L6V 6;  1UQV A;  1D9F A;  1NK4 A;  4DV6 M;  3U61 B;  4LFC M;  4UB2 A;  1KFT A;  3C58 A;  4REZ A;  4ACO A;  2JZB A;  3C23 A;  1IXR C;  4KMO B;  5DYI A;  4ECW A;  3ZD8 A;  4Q44 A;  2R0I A;  2V1U A;  4LJ6 A;  3R9K A;  3BXW A;  4OO1 J;  3TAN A;  1PK1 A;  1WWU A;  2AQ0 A;  2L6O A;  3OPX A;  1L2C A;  5DG9 A;  4ELV A;  1KFV A;  4PHD A;  1NHW C;  1S8O A;  4B9M A;  2KV2 A;  1S10 A;  9ICU A;  3FUT A;  2Q2E B;  3JR4 A;  3FTE A;  4I27 A;  4OVZ B;  4ECV A;  7ICU A;  2QSF X;  4NLN A;  3CGW A;  2KOB A;  4J9Q A;  4NLC A;  4M47 A;  1N2X A;  1FEZ A;  3TFR A;  1OUQ A;  3I01 M;  2C28 A;  2LVO C;  3K8Z A;  3GLI B;  2NRZ A;  2H3Z A;  1CEZ A;  2F76 X;  2O6K A;  3NWL A;  3M8S A;  2KRK A;  1UHU A;  2H5X A;  4AYB F;  3D8L A;  3I04 M;  1NK0 A;  4ICA A;  2E5S A;  4EYI B;  4RF1 A;  4NSR A;  3CTW B;  9ICI A;  2KZ3 A;  5IIL A;  1BPE A;  3FUW A;  5C18 A;  5KG7 A;  3MFH A;  3KOO A;  1MX0 A;  4JMU A;  4YQW A;  2VA8 A;  4I2I A;  2YX8 A;  3GLG A;  1SXJ D;  1Q3B A;  2PFO A;  2XIC A;  2WF9 A;  1NV8 A;  4P0P B;  3R8F A;  1DO0 A;  3T38 A;  3M6Z A;  3E4R A;  2HBL A;  4NLG A;  5AI4 A;  3QWL A;  4KOD A;  2JZ1 A;  5FLX S;  3BQ2 A;  4UQG A;  4R63 A;  1XC8 A;  1G59 A;  4PGQ A;  3BDP A;  1QAM A;  3F53 A;  3KSJ A;  3PV8 A;  2IA6 A;  3PVS A;  2N35 A;  2FS1 A;  1TF0 B;  2ZUD A;  1S0V A;  4MB7 A;  1MQ2 A;  3THG A;  1NOM A;  4MGY E;  4WUR A;  3U6C A;  3VCB A;  3IHP A;  2CUZ A;  2WSE F;  3Q8S B;  2DHY A;  1N56 A;  1IG6 A;  4BXO B;  2EKK A;  1ZQL A;  2FPM A;  2UVW A;  5ITT A;  4DR3 M;  2G5G X;  4QZI A;  5C5J A;  3C28 A;  2KNV A;  2WF8 A;  4JN6 A;  5CEH A;  3SBJ A;  1NNJ A;  2ALZ A;  2K60 A;  3C3D A;  4PT5 A;  2WB1 C;  2GLE A;  1BPZ A;  5ALD A;  3IN5 A;  1V34 A;  4F71 A;  2KEB A;  2MUT A;  1LKY A;  4PHA A;  1IM2 A;  2UXC M;  1IV8 A;  2AXT U;  1NZB A;  1Q3V A;  4B9U A;  2OCE A;  3A0B U;  2D7E A;  3GQ5 A;  1L2B A;  1BPB A;  4YVZ A;  1X2I A;  2HHS A;  1IY0 A;  1EIJ A;  2BDU A;  3NVY A;  3E46 A;  4KLQ A;  2BJW A;  4AG5 A;  3MGH A;  2KVS A;  4CF5 A;  1IY2 A;  3GDX A;  2HHQ A;  1M6Y A;  3EWA A;  1DGS A;  3W67 A;  1ZQY A;  4CJ6 A;  1ED1 A;  2E8M A;  1FNN A;  4G4Q A;  3NRW A;  3FUU A;  2L7I A;  5KFZ A;  3RJI A;  1BPD A;  5ALV A;  1ZQH A;  4Z6D A;  1GAB A;  4FO6 A;  1K3W A;  5DB6 A;  5IRE B;  3PML A;  7ICK A;  2HBK A;  2W9C B;  3LK9 A;  2XZU A;  5EJC A;  4LVS A;  1X9S A;  3NRZ A;  3SAS A;  1NI3 A;  1Z1V A;  4UAT A;  1QDR A;  2KHQ A;  2APL A;  4GLX A;  3THV A;  4DL6 A;  4PL1 A;  2HOF A;  4E0D A;  3LVW A;  4ED0 A;  3PO4 A;  1MA7 A;  2JMG A;  3QU7 A;  5ITX E;  2J6U A;  2CV2 A;  5FTJ A;  2ZXI A;  4Z6F A;  3TWK A;  2JHD A;  8ICN A;  2KW0 A;  2H3I A;  9ICG A;  4C8O A;  1S97 A;  2PFQ A;  1NKE A;  3O0F A;  1SV4 A;  2Y1I A;  4I2G A;  1UT8 A;  2Y0S C;  3KVW A;  2AJQ A;  4UBB A;  4IBD A;  1UFZ A;  7ICF A;  4NM1 A;  3FC4 A;  3BQ0 A;  1X42 A;  2DGZ A;  5AKZ A;  3QZ7 A;  4UAW A;  8ICO A;  3ZDD A;  2HCF A;  4QW9 A;  1U47 A;  3TFS A;  1KYI A;  2ZAN A;  4JI7 M;  4QWB A;  5KTQ A;  1L1T A;  2ZIU A;  1N48 A;  1E32 A;  1WCL A;  2DF4 B;  3AU6 A;  2OQ4 A;  1WUD A;  1DGB A;  2OO9 A;  3SAR A;  3HKZ F;  2XY6 A;  1R2Y A;  2CHQ A;  3BJY A;  3WK8 A;  2FFJ A;  4AKI A;  1YZ6 A;  4OJP A;  3UMG A;  2F8K A;  4I2D A;  3ICX A;  4FE3 A;  5AM2 A;  1HQY E;  4F72 A;  5AI9 A;  2FPK A;  1JXE A;  2ZJA A;  4O9M A;  2WSC F;  4OD0 A;  5JU5 A;  4YN4 A;  1L3V A;  1K82 A;  4DR4 M;  3VC8 A;  5AI8 A;  3D8B A;  4RT2 A;  4P4M A;  7CAT A;  5DNY A;  1JR3 D;  1Z00 B;  2JUJ A;  4RQ6 A;  3RRH A;  1SKS A;  8ICB A;  1S0M A;  5DGB A;  1FFV A;  2WF6 A;  4B9N A;  2QB0 A;  1XC9 A;  1N32 M;  4R66 A;  5AKL A;  3QYE A;  1SB3 C;  3V7L A;  2L2D A;  2L7H A;  3AJI B;  2WFA A;  1AIP C;  4DQQ A;  4S12 A;  5ALI A;  4JXJ A;  2JWS A;  3K4G A;  2E8O A;  1TK0 A;  4EEY A;  4F2S A;  3V6H A;  3GRU A;  2XY7 A;  4YY3 M;  1RM6 C;  2KIC A;  2FNA A;  3OGU A;  2W8L A;  4KLI A;  4ECR A;  3KW6 A;  5KFH A;  3MR5 A;  2D7G A;  4WJ3 B;  4ECS A;  4X64 M;  2LVN C;  5EE3 A;  3CF6 E;  4EX7 A;  1N34 M;  3OSN A;  1OQY A;  4JI8 M;  5KG5 A;  3HW8 A;  5DBB A;  1ARO P;  2OWO A;  4FCV A;  4R3D A;  2G09 A;  4BJQ A;  8ICF A;  5IT9 S;  4Z6E A;  4IBC A;  3ORY A;  5KG6 A;  2JEG A;  4USA A;  1X6I A;  4DFD A;  5J2G A;  5J0S A;  7ICQ A;  3C2M A;  3V76 A;  3T5J A;  2VII A;  1N62 A;  1QAQ A;  5EXT A;  1ZD4 A;  1L7M A;  2BCV A;  4MF8 A;  2WF7 A;  4IC9 A;  3CF2 A;  3T1Y M;  1ZQN A;  4JV5 M;  4KLN A;  2C5R A;  5DFL A;  2K4E A;  1T3N A;  3KP0 E;  4UB8 U;  3K92 A;  2W03 A;  4M9J A;  2KHH A;  3SYZ A;  1O08 A;  1Z5C A;  1L6N A;  4ZPX A;  2O25 A;  3GV5 B;  4M04 A;  4LF7 M;  1DK3 A;  2RHF A;  2L5Y A;  3F92 A;  5KFK A;  2R65 A;  4DSE A;  7ICE A;  3FUV A;  4IBI A;  2LVQ D;  3VK8 A;  3WKB A;  2A1J B;  4YFK A;  2KNA A;  5ALS A;  5EP2 A;  2KIW A;  3ZC7 B;  5KFW A;  5J2E A;  5JI3 E;  8ICW A;  5HP4 A;  2VA2 A;  2W7O A;  4JI1 M;  3NGD A;  2RKO A;  3MHV C;  2P6R A;  3J27 B;  2YQE A;  1XXH A;  1UPH A;  1TKD A;  2QBY B;  2LTU A;  1DV0 A;  1RQN A;  4QNR A;  4DSL A;  5L8R F;  4GXJ A;  4ECT A;  4BWJ A;  4CGZ A;  4ECZ A;  4PZN A;  3T79 A;  7ICN A;  4DL3 A;  3B9J A;  3M1Y A;  5IZ7 D;  4YXJ A;  4XK8 F;  4K4H A;  2ERC A;  1ZQA A;  4L4U A;  3ED5 A;  2EH9 A;  3V7K A;  2ASJ A;  4KMU A;  2RGO A;  4QZF A;  2G8L A;  3E58 A;  4P0Q A;  1IXZ A;  4F5R A;  5J0X A;  3FTC A;  4RQ4 A;  3L3F X;  4DCC A;  4KLE A;  5J0Y A;  4O3R A;  1RDF A;  5KAF U;  4QWA A;  4GC9 A;  2UUB M;  3ISC A;  3Q8P B;  5KFF A;  2JZ0 A;  2HAK A;  2G0A A;  4KIT B;  3JPQ A;  4IR9 A;  3ZDC A;  4FS1 A;  3T5H A;  2I6X A;  2XCP A;  2YMQ A;  2R4E A;  1QZM A;  5KFP A;  1HT2 E;  2XH9 A;  1R4G A;  3L2A A;  3QYP A;  8ICA A;  4O3O A;  4DOC A;  2K6B A;  1KEJ A;  2W9M A;  3PST A;  4RUC A;  3T1H M;  1ZQK A;  2JA2 A;  4KLS A;  3L5K A;  3KOW E;  1AQ6 A;  3AOE C;  3J81 j;  3B7Q A;  3PXG A;  1JX4 A;  5DBA A;  5AM5 A;  4FS2 A;  2KJ9 A;  2VJ5 A;  2DWZ B;  4AZF A;  2JR5 A;  1DGF A;  2DHR A;  4CE6 A;  1U48 A;  2KSO B;  4J9M A;  4IBE A;  1FIQ A;  2C9C A;  2KZS A;  5JI2 E;  2UXB M;  2JZB B;  4MFA A;  1ZMU A;  3HJQ A;  1IQP A;  3EPG A;  1RXW A;  1SXJ A;  1NO1 A;  2KNZ A;  1HJP A;  1UA1 A;  5J2B A;  1S3S A;  1Q46 A;  4P16 A;  1PK1 B;  5TZV A;  5ALZ A;  1C1K A;  2VKQ A;  4I81 A;  1F4I A;  2QAR A;  4QZ9 A;  2K4H A;  2KFN A;  4RQ1 A;  4EBE A;  4M9X A;  1JAL A;  1FFU A;  2ZTC A;  4KLH A;  4R64 A;  1LTM A;  4BX9 C;  5KT5 A;  4RNO A;  8ICK A;  1KW4 A;  2FMQ A;  7ICI A;  4F5P A;  2XF3 A;  4R65 A;  4NLZ A;  2NYV A;  3U6M A;  4DR5 M;  4KX3 A;  1ZQR A;  3BS5 A;  2JY7 A;  2F1H A;  4IBF A;  2FDR A;  4A3V B;  4O3M A;  2IOF K;  2AHM A;  3H4B A;  1X37 A;  1XHB A;  4FBU A;  4LZG A;  2O01 F;  5CR0 A;  5CRX A;  2JXJ A;  1LB2 B;  1HNZ M;  1X9M A;  5ALN A;  3LQR A;  5EWG A;  2KJ8 A;  1LV7 A;  2MAX A;  4MFC A;  1N60 A;  1JRP A;  1DO2 A;  3FYD A;  2DL0 A;  2F1I A;  4F8R A;  1MQ3 A;  4DO9 A;  4IIW A;  2W3S A;  4RUA A;  3T15 A;  9ICS A;  2W9B A;  4NC6 A;  1TAU A;  2RRD A;  4TQS A;  5EP1 A;  3TWM A;  1FO4 A;  2WF5 A;  3PSP A;  3H40 A;  5AKJ A;  5J0O A;  1NJG A;  4QZG A;  3HWS A;  2B0C A;  2KZZ A;  4CCH A;  3OTQ A;  2ZUC A;  1QYR A;  4FVM A;  4LF6 M;  2YNM D;  2EQY A;  1KBU A;  5AKE A;  2RDI A;  3VLF B;  3VKH A;  4RNM A;  3TAQ A;  1XNS A;  4QZH A;  1SZP A;  1N63 A;  4I8O A;  1MN3 A;  1RYU A;  1JUD A;  1WHC A;  2NRT A;  3OSP A;  3E2E A;  3HT3 A;  2K89 A;  2OOA A;  1N36 M;  2FLP A;  3BQ7 A;  3N7R C;  1TV9 A;  3GII A;  4C8M A;  1KTQ A;  1B4F A;  2LI6 A;  1U45 A;  2CRU A;  2DAI A;  5EQT A;  2BDP A;  2KXE A;  2HBM A;  2L09 A;  4RF0 A;  3GQ3 A;  2IHN A;  1G3I A;  1S0O A;  1QCK A;  2GNO A;  4QIW C;  3NBX X;  3F5E A;  4MM3 B;  1JMS A;  1ZQD A;  4BUG A;  4P17 A;  1YZ7 A;  3N28 A;  1TH2 A;  4C8K A;  4B08 A;  3GLH A;  3B0X A;  7ICT A;  4RQ3 A;  4LJ7 A;  1Z4N A;  3JR5 A;  1OW5 A;  3T3F A;  1Z6T A;  1A76 A;  2XGQ A;  3D6J A;  2X4A A;  4M0W A;  3PW5 A;  5BPC A;  3PSI A;  2KZU A;  4B6J A;  1R6B X;  2P35 A;  3Q8L A;  4I29 A;  2V1C A;  3PO5 A;  4LJ4 A;  3H4M A;  1VEG A;  5DBC A;  2HHH M;  4HAI A;  3CRX A;  1PGY A;  4C8L A;  1NVM A;  5ALL A;  3UXP A;  4OCZ A;  4M6W A;  1OJL A;  4KLG A;  5K4L A;  5KFE A;  5A2Q S;  2CHG A;  2UXD M;  1Q02 A;  3LMM A;  3AQE A;  3MGV A;  2BHN A;  2ZXH A;  9ICN A;  1NK8 A;  4IRC A;  1QQW A;  2G3Q A;  2GO7 A;  2F5S A;  2ZIV B;  3DZD A;  2QCU A;  3GU3 A;  3K75 D;  2IMW P;  4C80 A;  3DV9 A;  2J5Y A;  3JPT A;  2R18 A;  3A98 B;  1GJT A;  1J7K A;  1YE9 A;  2DWL A;  4DOB A;  5DKW A;  2EZX A;  4QNL A;  1AUA A;  2OYY A;  9ICE A;  3OJS A;  1QH9 A;  2Y9T A;  1ZQU A;  2FLL A;  5KL1 B;  4MHV A;  1YUB A;  1JR3 A;  2R62 A;  5CWR A;  3AUO A;  4RNA A;  2ASD A;  5J2H A;  1RU3 A;  5J2C A;  3HY5 A;  4UAS A;  5KFO A;  4J9O A;  3RJJ A;  1ZQ1 C;  1W5S A;  5J0P A;  3NAS A;  2W43 A;  1HNX M;  3QU2 A;  1JXL A;  3G6X A;  4RNN A;  2ZIU B;  1U49 A;  1TTE A;  1TE2 A;  4M2Y A;  4L16 A;  5J2J A;  2RDJ A;  3BQ1 A;  2IBK A;  3FTD A;  3LVV A;  3LCU A;  8ICQ A;  3U60 A;  2Z8Y M;  2HHU A;  3H8S A;  4RQM A;  1ZD3 A;  4DSF A;  1L5U A;  4DL7 A;  5GKN A;  2ISP A;  2W11 A;  3RBE A;  4MEY A;  3QYB A;  2F44 A;  3JPP A;  4D81 A;  2W54 A;  2WZJ A;  3AEV A;  3QUT A;  4JI6 M;  4LF9 M;  1NJY A;  5H37 D;  3SHG B;  3SFZ A;  2LMR A;  4KLO A;  2C99 A;  2W04 A;  5BR8 M;  4LZD A;  5DQI A;  3SV4 A;  3SYL A;  5KT4 A;  2AQ4 A;  3AN1 A;  2OPF A;  1XSP A;  4DL5 A;  3KD3 A;  1D2N A;  2QB0 B;  1WCN A;  4CRX A;  2HKJ A;  2W82 A;  1SKR A;  5J2I A;  1IY1 A;  2EAN A;  1QAN A;  4PHE A;  4AQY M;  3RGP A;  3U5Z A;  4J9K A;  4DR7 M;  3SMP A;  2WB1 F;  5DB7 A;  2ODG A;  7ICP A;  5F3X B;  4DFK A;  3IEC A;  3N4M B;  8ICE A;  4DSK A;  3GLI E;  2XGP A;  2CXY A;  1J5E M;  4UW9 A;  4DS4 A;  5FP0 A;  1COK A;  3NS1 A;  5JUM A;  3L28 A;  4L15 A;  3MBY A;  2XLJ A;  1B0X A;  3M7G A;  3L4P A;  2HL7 A;  3GP1 A;  1KDH A;  1ZOL A;  5DGA A;  2VJ4 A;  3VDU A;  2FE8 A;  2C22 A;  2OEH A;  1P3Q Q;  9ICJ A;  3F2D A;  2UUA M;  5KPR A;  3MJ5 A;  4NRV A;  4F5Q A;  2HHT A;  4CIZ A;  1TK8 A;  2HVH A;  4O0I A;  2IOH A;  4JV0 A;  2X49 A;  1J2M A;  1GO5 A;  8ICR A;  5AHX A;  4YHH M;  1Q8K A;  1VG5 A;  5HHH A;  2W8K A;  2XCA A;  2LWX A;  4U7C A;  4IBJ A;  3WKE A;  3QXG A;  4Y2P A;  1G4A E;  3L29 A;  3CP8 A;  3RBD A;  2C96 A;  4TUQ A;  3SHF A;  4HL4 A;  4ED8 A;  3JAM S;  4R8U A;  5FTN A;  4LGM A;  2IHM A;  5KFY A;  2F5N A;  4M9S A;  2BQR A;  4UAU A;  4LJ9 A;  5BOL A;  5AIB A;  4FZN A;  5J0R A;  3ETR A;  4LFA M;  9ICX A;  1N77 A;  2KIV A;  3HU1 A;  1MC8 A;  1Y8G A;  3ISD A;  4Z6Y A;  4DWI A;  2P66 A;  3K1J A;  1WWV A;  4F93 B;  4G4O A;  1SWV A;  5J0W A;  2QQ8 A;  1V38 A;  1TGU A;  1QDT A;  1TH4 A;  1HUO A;  2LYH A;  2NRW A;  2Y0S F;  5KFM A;  1MJG M;  1IN4 A;  1QQ5 A;  1N5X A;  1BVS A;  3SAH A;  4Z6C A;  2B6G A;  4RQ0 A;  5H2F U;  1NK7 A;  4K4G A;  2G07 A;  1WGN A;  2ZBK B;  5DLG A;  1XXH B;  4YCX A;  3BBZ A;  3AU2 A;  2LVP C;  3CYM A;  2FLN A;  3TQS A;  9ICL A;  5EWE A;  1T7P A;  4X66 M;  3RH5 A;  4RQ8 A;  3AFH A;  4JV1 A;  2EAO A;  1IN7 A;  3QEB Z;  3RR8 A;  1ZQG A;  5ALU A;  2ZIX A;  4LJ8 A;  2QLT A;  9ICW A;  1PJT A;  5AK5 A;  4F4Y A;  5ALX A;  1OAI A;  4L8R C;  4MGI E;  3A42 A;  4NXZ A;  1CI4 A;  8ICG A;  4RKU F;  2HI0 A;  4DOA A;  2A1A A;  3PW7 A;  3LDA A;  1IFY A;  1QAO A;  4ZOH C;  5T14 A;  2FMS A;  4MFF A;  5JRT A;  4XA5 A;  3J7A S;  2E3T A;  3RRG A;  2XVT A;  4BGD A;  9ICR A;  1OAO C;  9ICT A;  4MH0 E;  5FSW A;  1T3Q A;  4P4O A;  5GTH U;  4OJ5 A;  4D82 A;  3RB6 A;  2BR0 A;  3KXE C;  3ZDE A;  2LXE A;  3HU3 A;  4F2L A;  4JV2 A;  2DUY A;  2UVR A;  3KZX A;  2KK0 A;  3FM9 A;  5B5E U;  2HMX A;  4II7 A;  1IN8 A;  2H1R A;  1NHG C;  4DF8 A;  5KG4 A;  3PSF A;  4I4L A;  4UAR A;  1N75 A;  3M9O B;  4EEK A;  4F50 A;  1B22 A;  5KG1 A;  2JXN A;  3D2S A;  5DB8 A;  1Q3U A;  5J8Y A;  1X66 A;  4NM2 A;  2LM1 A;  4NL9 A;  2MR9 A;  5KT7 A;  4QZD A;  1A0P A;  3KHH A;  3ZQJ A;  4EBD A;  2KE7 A;  1SXJ B;  1Z5B A;  4M0D A;  1K1Q A;  3UXN A;  1NNU C;  2DAM A;  3EPI A;  3HJS A;  1OFH A;  2CEA A;  2F4V M;  2Q4T A;  4PGX A;  2GQF A;  2W55 A;  1OKS A;  5A0L A;  3I4Y A;  3TAD A;  1H38 A;  1MN8 A;  2DQN B;  2Z3X A;  1QSL A;  3D2N A;  2QAR B;  1ZQX A;  1L3S A;  3SC3 A;  1E94 E;  1VQ1 A;  2Y20 A;  4M9L A;  3LWL A;  3GRR A;  3SI8 A;  4J9R A;  1QLN A;  2YMM A;  2KJ5 A;  1XNR M;  3HX3 A;  3RFA A;  5L1I A;  2LHT A;  4F1I A;  5CP2 A;  4ED3 A;  3JPN A;  1GKI A;  3BS5 B;  2UUC M;  2QP9 X;  1SV0 A;  2K47 A;  3PNV A;  4FWD A;  1ZQS A;  3AKZ A;  2HVI A;  4XBO A;  2OXO A;  1DRG A;  9ICP A;  4FFD A;  1TH3 A;  3KZI U;  3PW0 A;  9ICB A;  1TR8 A;  3WKC A;  1YSY A;  3C5F A;  4NXM M;  4I28 A;  3GFK B;  3QU4 A;  2E5L M;  4Y2J A;  1ZQE A;  2B3T A;  5KO3 A;  5DDM A;  2KVC A;  2F3N A;  3HZJ A;  1QTM A;  5AKI A;  3JPR A;  2YN4 A;  3C21 A;  2W9B B;  4G4R A;  4Q43 A;  2JV3 A;  7ICS A;  3U6O A;  3PX0 A;  1VEJ A;  4ED2 A;  2DVW B;  4PH5 A;  9ICC A;  3ZDB A;  3IRU A;  2E8P A;  3H0L B;  1XMO M;  5ALO A;  3GPX A;  1SWW A;  4LZZ A;  3WKD A;  4NL4 H;  1IIP A;  1ZQW A;  3KHR A;  1QUS A;  4TUS A;  1WG8 A;  2JY8 A;  3HJ8 A;  1JRO A;  2JH1 A;  4DL4 A;  5DG7 A;  4K4I A;  1Z4O A;  3FYC A;  5IIK A;  5F9N A;  1IBL M;  1NJF A;  2BPF A;  1LV5 A;  4TUR A;  2KN7 A;  4LFB M;  1ZD5 A;  1DGH B;  5KFJ A;  4F3O A;  2D6F C;  3KOZ E;  5EP4 A;  3GLF B;  1RQL A;  1XWI A;  3UQ2 A;  2KNJ A;  2LYB A;  1T8E A;  2P5T A;  4LZJ A;  4ELT A;  2J6S A;  1NSF A;  2BNK A;  1UM8 A;  1IM4 A;  1MU5 A;  8ICS A;  3RAQ A;  3HRD D;  4ECY A;  5ITU A;  8ICJ A;  5KQD A;  5KT3 A;  3GPP A;  2R45 A;  3KP1 E;  1SXD A;  5D46 A;  4GC5 A;  3OTO M;  2ZAO A;  4GXK A;  4I2C A;  3MMP A;  1C7Y A;  4X5V A;  3KTQ A;  3ALR A;  3EW9 A;  1ZXI A;  1A5T A;  5AKX A;  3PY8 A;  2KTQ A;  5KFB A;  5J2F A;  5ITX A;  4DV7 M;  2PI4 A;  1CRX A;  3PNC A;  1X6J A;  2W9C A;  4B3M M;  5ITY A;  5ALP A;  4QHT A;  3DA1 A;  2HWJ A;  3K9O A;  4YG2 A;  1H6U A;  4RPY A;  4BBA A;  1PJQ A;  4GH9 A;  3MK6 A;  1K1S A;  2BWE A;  1I94 M;  1DXS A;  5KT6 A;  2LBC A;  2W7P A;  4O3S A;  2CV0 A;  3KKA A;  2FJ6 A;  1TDZ A;  4DLE A;  4F4X A;  4HLQ A;  4PD2 A;  4CF4 A;  5AKK A;  2MJ5 B;  2CPR A;  3FE3 A;  4F2R A;  3M6K A;  3V7J A;  2DKZ A;  2Y9U A;  4I2E A;  2BQU A;  1R7R A;  5AK6 A;  1XSL A;  3FAH A;  3QE9 Y;  1HQC A;  2E1F A;  4O5E A;  1V97 A;  4IQT A;  4US8 A;  3GPY A;  5EE0 A;  8ICM A;  1ECW A;  2VF8 A;  5KG2 A;  2BWB A;  1TAQ A;  4LJA A;  2PI5 A;  5ALT A;  4XGI A;  3GPU A;  2YFQ A;  2IOF A;  4CF3 A;  8ICC A;  2KZM A;  8ICX A;  1PK3 A;  4B3S M;  1E9R A;  3RH4 A;  2C98 A;  2XI9 A;  4UB5 A;  2X8A A;  1W5T A;  2CV1 A;  2NRX A;  3PX6 A;  3WHL A;  5KFR A;  2DKL A;  5KFC A;  4ITQ A;  1OIZ A;  4IQV A;  4OX9 M;  1ZQV A;  3RJK A;  3SYK A;  1XO1 A;  4DV5 M;  3L27 A;  3ONN A;  5BPV A;  5D4B A;  5LMN M;  2KG5 A;  1V9P A;  2I9G A;  5EXS A;  3HX0 A;  4KN7 A;  2XY5 A;  2XO7 A;  3C2L A;  1VDV A;  2Y21 A;  4PL2 A;  1NJX A;  1XB2 B;  4FW9 A;  4MGK E;  2ES6 A;  3WHK A;  2BPC A;  4LF8 M;  3PVX A;  9ICK A;  4NRW A;  2JEI A;  4UAZ A;  2KKV A;  2F1J A;  2CRX A;  3RGS A;  3HU2 A;  1X40 A;  3D2Q A;  4U6P A;  4RQ5 A;  5DLF A;  4YR3 A;  2NRV A;  4UB1 A;  4QNM A;  4L78 A;  2EJS A;  2WHE A;  4EEL A;  4HEO A;  3SEN A;  1Z1B A;  1GJS A;  1F5S A;  3FD9 A;  2DWM A;  2KKP A;  3HP6 A;  1HNW M;  3PW4 A;  3GLG B;  3V72 A;  3WK7 A;  1ZJN A;  4AG6 A;  4B7G A;  3U5Z B;  3MR6 A;  4QIW F;  4NWI A;  7ICR A;  2A19 A;  4NY8 A;  1IBM M;  5ALQ A;  8ICH A;  2M9N A;  2ZIW A;  4US9 A;  4EYH B;  3HJE A;  1SXJ C;  3K2L A;  2EDU A;  2FOI C;  1UA0 A;  3RJE A;  1IXS A;  2M60 A;  5KG3 A;  4NLK A;  4Y28 F;  4QZ8 A;  4I2H A;  1ZQB A;  5FTK A;  4Y2U A;  2G5H B;  2K8A A;  4Y2Y A;  3GQC A;  4PPX A;  1N5W A;  1IN6 A;  3TE6 A;  4YP3 A;  2QZ4 A;  3B9P A;  3QUQ A;  3JPO A;  3GIJ A;  4TUP A;  1R5L A;  3H4D A;  3EYZ A;  5L1J A;  1SIJ A;  4ECQ A;  1UT5 A;  4ED7 A;  2V6Z M;  4B7H A;  4O3N A;  4YXM A;  1Y88 A;  4RPX A;  2XSZ D;  3U6L A;  4XRH A;  2EZZ A;  3AV0 A;  2BCU A;  3IG5 A;  3KOX E;  2NQ8 C;  3OHA A;  2HOQ A;  1TDH A;  4XUS A;  4K0K M;  3UGJ A;  3C9P A;  9ICA A;  8ICZ A;  3SAU A;  3KDS E;  2MUT B;  2EAM A;  3T5K A;  4I5S A;  1LKY B;  3J80 S;  3VK7 A;  2V4R A;  3W68 A;  3Q8X A;  1ZQI A;  1V92 A;  4Q8E A;  3DEE A;  3TPZ A;  3GQ4 A;  4QJF B;  3W0F A;  4R71 A;  2F5Q A;  1L8L A;  1SL2 A;  2JY5 A;  4GHA A;  4EBC A;  5B66 U;  2A1J A;  1X9W A;  1ZQQ A;  4F4W A;  1F44 A;  5L9X A;  4W5W A;  2JH7 A;  2Y0Q A;  4DV0 M;  1K3X A;  2C2D A;  2GH1 A;  4ECU A;  1ZMW A;  3NUQ A;  1ZJM A;  3J7B A;  2N1R A;  1OIP A;  1UCV A;  3MDA A;  5DQH A;  2MSN A;  2NV3 A;  4DR1 M;  2VA3 A;  4Q7J A;  5KFN A;  1ZRM A;  2UU9 M;  2QBY A;  2R44 A;  1JIH A;  2DZO B;  1PVR A;  1BNP A;  1TFR A;  1S5L U;  3UK6 A;  5ALH A;  1IXR A;  4IBB A;  4DV2 M;  1XS9 D;  3M0E A;  3V6K A;  4I2B A;  4QWD A;  3M6A A;  3R9X B;  4GHL A;  1KFS A;  1G8P A;  3SEI A;  8ICV A;  3AL0 B;  2BJV A;  4LY6 A;  1QSY A;  3ILK A;  3B7N A;  2QKQ A;  3AM9 A;  2HW3 A;  1L8O A;  4GIP A;  3VDP A;  1VJ5 A;  4FWG A;  3TQ1 A;  2K9D A;  9ICV A;  3IM1 A;  2Y0T A;  5IIJ A;  2V9W A;  4WP2 A;  3H8M A;  2AGQ A;  4B9S A;  3PFI A;  5BOM A;  4O5K A;  4LGY A;  1RYR A;  5KG0 A;  3IDW A;  4UAV A;  1DGG A;  3H4J A;  4GXI A;  5G5G A;  5AK4 A;  4Q45 A;  5DYG A;  2DAE A;  2LHC A;  4I2J A;  1ZV1 A;  3UZU A;  1DOQ A;  5ALF A;  4FBT A;  4Q8F A;  1VDL A;  5LMU M;  1ZQC A;  1J09 A;  1G71 A;  4JI3 M;  1GVN A;  4PJ0 U;  3VKG A;  2EO2 A;  3GV7 B;  1SL0 A;  3EIH A;  4GKK M;  4FCT A;  4QZB A;  4ECX A;  4Y2T A;  4IRK A;  1R2Z A;  2KSO A;  4O3Q A;  5J29 A;  1BNO A;  4BDP A;  2RLT A;  3FRH A;  5ALM A;  5ITR A;  1XO0 A;  4CDG A;  2LH0 A;  1RG6 A;  1SL1 A;  5EP3 A;  3EZ5 A;  4EEN A;  2FMP A;  1ZAE A;  5J0Q A;  3H7I A;  3WU2 U;  7ICM A;  3MR2 A;  1YLA A;  8ICY A;  4J9N A;  3E9S A;  1JB0 F;  3PZP A;  1XWL A;  1E9S A;  4QWE A;  2DWQ A;  1ZET A;  2K4P A;  8ICL A;  4NOO B;  5KFS A;  3MC1 A;  2PMZ C;  1HIW A;  2V4Q A;  3KOY E;  3KFU G;  4M0A A;  2WAQ C;  3RE8 A;  7ICJ A;  5AM0 A;  3KBB A;  4FD2 A;  3I76 A;  1NJW A;  2R8K A;  3KSX A;  4NJ8 A;  2LM4 A;  3Q8K A;  1WR1 B;  4QW8 A;  7ICH A;  3I4V A;  2L4F A;  3UXO A;  4DL2 A;  1NK9 A;  1COO A;  4LCB A;  4J03 A;  5KFA A;  4QWC A;  4IQW A;  3NTU A;  2VQE M;  1JQJ C;  4J9L A;  2DPJ A;  4KLD A;  4YMM A;  2C2R A;  2MRO B;  3RJF A;  1LVH A;  1QQ6 A;  3SAF A;  2D3D A;  1D9D A;  4C4R A;  5KPT A;  5L1L A;  3FYH A;  2DEN A;  2I1Q A;  1Z5A A;  3UMM A;  5EE9 A;  1JN3 A;  4F4Z A;  3HHW A;  1HEK A;  3Q8R B;  4Z8X A;  3UPQ A;  1EFU B;  4KTQ A;  3H0M B;  4JI5 M;  3E21 A;  4P4P A;  1GLN A;  2FH0 A;  4PDG A;  5CA7 A;  2PFN A;  1OXJ A;  2C9O A;  2RQ5 A;  2EAP A;  3GIL A;  3SQI A;  3J81 S;  1L3U A;  1GL6 A;  4Y2R A;  4KLM A;  2LKY A;  4JI4 M;  3BS7 A;  5AKG A;  1RZT A;  4EIW A;  1C20 A;  4QZC A;  3HHX A;  3H8J A;  3A46 A;  3E0F A;  4AYB C;  2DAK A;  1HR0 M;  3UQ0 A;  2W3R A;  3MR3 A;  1NK6 A;  3WK6 A;  2KD1 A;  1TK5 A;  3EUB 2;  4B9L A;  2HOI A;  1BPX A;  1RXV A;  5FTM A;  1N78 A;  4UBC A;  3KS4 A;  5KL8 B;  3I51 A;  7ICV A;  3TAP A;  1NY5 A;  2I7N A;  3U6E A;  4GMQ A;  1F0M A;  4DEZ A;  4NV0 A;  2LPE A;  2VAN A;  1DGJ A;  3CNH A;  2MU2 A;  4NXN M;  1NV9 A;  4DUZ M;  1J2N A;  3HKP A;  4MGH A;  5HML A;  2UVU A;  1X9X A;  3KS8 A;  5ALE A;  2BCQ A;  4GIT A;  2R4J A;  1D8L A;  5KT2 A;  5EXP A;  1GL7 A;  3U6D A;  4OJL A;  2VQF M;  2OHF A;  4LF4 M;  1NJZ A;  4B9V A;  2LNH C;  5AKY A;  4TUW A;  1NKB A;  2KP7 A;  1OTR A;  2VIX A;  4YMN A;  4P0Q B;  3C3E A;  4A8E A;  2HBJ A;  5ALW A;  1GO3 F;  2E1E A;  1DK2 A;  1KRP A;  4EZ6 A;  1XXH E;  3AMZ A;  2F5P A;  2DZL A;  2NO4 A;  3SMV A;  3WK9 A;  3B74 A;  8ICI A;  3UJN A;  5DQG A;  2K0B X;  2J7N A;  3H8W A;  1KLN A;  2DNA A;  2ZIV A;  3B0Y A;  2I5H A;  2PFP A;  2QEN A;  4B7F A;  5C0Y A;  4DR6 M;  2ZJ5 A;  8ICU A;  3F5A A;  5EOZ A;  3Q8M A;  4O3P A;  1KN5 A;  2FE9 A;  3HIL A;  3OHB A;  4YD2 A;  2YMP A;  4R7G A;  3J2P B;  4FZM A;  4YMO A;  1N61 A;  5L1M A;  1RPL A;  4DS5 A;  2LBO A;  3Q8G A;  4ANR A;  2AHO B;  3N97 B;  1HUZ A;  2OH2 A;  4IRD A;  4CHT B;  3DDH A;  4AW4 A;  4M9H A;  1BGX T;  3LCV B;  3U61 A;  2YY6 A;  2EA0 A;  2XEP A;  4LRT A;  1B43 A;  4UB6 U;  1T43 A;  5EWF A;  5ALG A;  3AQF A;  1KL9 A;  2XFT A;  5ITQ A;  1CUK A;  3HHY A;  3RF9 A;  1S77 D;  4IS7 A;  2Y1J A;  5KFQ A;  3PR5 B;  4GRI A;  3AL0 C;  4KLF A;  4B9T A;  3C1Y A;  4F5N A;  3GO8 A;  4CIS A;  2KFZ A;  2ATL A;  2JY6 B;  3SAT A;  2P6U A;  3PR4 A;  1Z59 A;  1A6S A;  3M9M B;  4JWM A;  4LG2 A;  3QZ8 A;  2YR0 A;  4DFJ A;  4RPZ A;  4OVZ A;  3F2C A;  1IN5 A;  2G08 A;  4PHP A;  4LJ5 A;  3NBI A;  1SZH A;  1MSW D;  3HPO A;  4DFM A;  3QU5 A;  3CW2 C;  5DB9 A;  2WTF A;  3SV3 A;  1ZQT A;  2K8C B;  1Z3E B;  4KO8 A;  4RU9 A;  3GLI A;  1IBK M;  5DDY A;  1ZQJ A;  2DKX A;  3BZC A;  1SXJ E;  4M9G A;  3RR7 A;  1I4W A;  4RT3 A;  2AH5 A;  4PCZ A;  4B3R M;  3B89 A;  2D7H A;  4GFJ A;  1TAM A;  3TL4 X;  1Q3C A;  9ICM A;  4DSJ A;  4IBK A;  3TWL A;  3QU9 A;  2DI0 A;  2XSZ A;  4C7Y A;  1NNL A;  4CNQ A;  4Y2Q A;  1EXN A;  2QHO B;  4P0P A;  4QOZ C;  2W9A A;  2BCR A;  3HWT A;  4JYA M;  3QAU A;  5KFU A;  1SGG A;  4PDI A;  3HKZ C;  4OJ6 A;  5AIC A;  9ICQ A;  3IV6 A;  4DLG A;  3V6J A;  2JEJ A;  5J8Y C;  1G41 A;  2DWN A;  4G9B A;  2PXI A;  4YD1 A;  1QZE A;  1PZN A;  4QZA A;  4NL9 C;  3KHG A;  2BGW A;  2CN1 A;  3K1Z A;  4UB3 A;  5ALR A;  2MGW A;  2ZIW B;  3K1R B;  2R46 A;  2E8N A;  3QNM A;  1PUZ A;  1HT1 E;  3W0L B;  4BWM A;  5JTI A;  5J0U A;  3SAG A;  4G6Z A;  1PM5 A;  1IXS B;  1L1Z A;  2CFO A;  3ISB A;  1ZQF A;  1OFI A;  2G06 A;  2QNJ A;  1V85 A;  3I28 A;  4C4T A;  3SZ2 A;  1SKW A;  4B3T M;  4KN4 A;  9ICF A;  1URJ A;  3TI0 A;  3TAD C;  4DQR A;  4YR0 A;  4AKH A;  3MGI A;  3GIM A;  4HYK A;  1KSF X;  3TAC B;  4BXO A;  4JI2 M;  2H3Q A;  3IP4 B;  3SR6 A;  1KSP A;  4DSI A;  1ZQM A;  4M9N A;  2F8L A;  2R8H A;  4OW0 A;  1QUT A;  2H3V A;  2HSZ A;  1FJG M;  3SAW A;  9ICO A;  3ZI4 A;  3WK4 A;  4FWH A;  2R8G A;  1YT3 A;  4LRS A;  5KFV A;  2XID A;  3IHQ B;  4IQU A;  5KQ8 A;  1PJJ A;  5AK3 A;  3WK5 A;  2UVV A;  2BQ3 A;  4CGY B;  1ZQO A;  1SV0 C;  3FKE A;  3RH6 A;  2RGH A;  2RRU A;  2ZJ8 A;  2F77 X;  3G6V A;  5IIO A;  1D8Y A;  3GLH B;  3PMN A;  1P7D A;  2ESE A;  3NVW A;  2CWB A;  2YTU A;  5F3W A;  3C5G A;  2M0N A;  3MDC A;  2F5O A;  3HGI A;  4QZE A;  3MFI A;  3AOE A;  3PX4 A;  3ZH9 B;  1KQQ A;  5IIM A;  5IWA M;  1A77 A;  1ZRN A;  3A0H U;  4DQP A;  3GLF E;  2RP5 A;  5HHI A;  4I2A A;  2HHV A;  2R8J A;  4IL6 U;  2HHX A;  2CE7 A;  2LYA A;  4YR2 A;  3GLH E;  2ZM6 M;  3F2B A;  4M6W B;  5TIS U;  2G5I B;  3VFD A;  4GC6 A;  2ASL A;  1JI7 A;  3GRY A;  2DAG A;  3RFW A;  4Y2V A;  4F92 B;  1S9F A;  5FTL A;  4M9Z A;  2XZF A;  4JWN A;  4G3O A;  3T5L A;  4RQ2 A;  1D0K A;  4BLC A;  1XMQ M;  1K5O A;  2DFL A;  4P2H A;  8CAT A;  3RB0 A;  4LF5 M;  5KFG A;  4RQN A;  1ZQP A;  8ICP A;  2KMD A;  2KA6 B;  2ZUB A;  2ZAM A;  5AM1 A;  7ICG A;  4KX5 A;  4JUZ A;  1S0N A;  5KFD A;  5HMM A;  2YQZ A;  3FUX A;  5HR7 A;  1ZQZ A;  5ALJ A;  3Q8Q B;  4AI6 A;  1WIV A;  5F9L A;  4C4S A;  2A3V A;  1L7O A;  2YB4 A;  9ICH A;  1L8Q A;  1L7N A;  4OJO A;  1O03 A;  5KFT A;  5E6J A;  4X62 M;  3QX7 A;  2J6T A;  2Z4R A;  2Z4S A;  3N7P D;  3L26 A;  4I2F A;  5AM3 A;  1T94 A;  2JEF A;  1BPY A;  3GZF A;  2WSF F;  1JR3 E;  4F5O A;  3U60 B;  1ORY B;  3QEA Z;  4ELU A;  5E79 U;  2OOB A;  4NSO B;  5ALK A;  1ZQ9 A;  2HDO A;  3MAB A;  1PVP A;  5ALY A;  4Y2X A;  1PJS A;  4GKJ M;  4C8N A;  4IJF A;  2F2A B;  4DV3 M;  3KKA C;  1J97 A;  2BPG A;  2J7O A;  1U9L A;  1Z00 A;  4KLJ A;  2K8B B;  5HR6 A;  5GTI U;  1L3T A;  3FDS A;  2DZN B;  1ZD2 P;  3GIK A;  4J9S A;  4DFP A;  2VF7 A;  4UB4 A;  2XC9 A;  5EXX A;  1XNQ M;  3IG8 A;  4AKG A;  2M5Z A;  2HCB A;  5KFL A;  2KDL A;  2CP8 A;  2MA1 A;  1Q39 A;  1QQ7 A;  5III A;  4AP9 A;  3U26 A;  4J9P A;  3JPS A;  4C7Z A;  4ED6 A;  2B21 A;  3SD7 A;  3UMC A;  1VDD A;  4PGY A;  2D8C A;  2R8I A;  4DBG B;  4FZL A;  4KLU A;  4GEW A;  5AI5 A;  4ZH4 A;  4F91 B;  3C1Z A;  1U4B A;  4KHP M;  2KEY A;  3M7D A;  3DFZ A;  2AU0 A;  5G5H A;  3RAX A;  4JB3 A;  2R6F A;  4EX6 A;  1VEK A;  3N7S C;  2MH8 A;  5DG8 A;  3U6P A;  2Z7J A;  3A45 A;  2GOL A;  5CHG A;  4MF2 A;  4D80 A;  2BKE A;  4Y2S A;  3S6J A;  4TQR A;  1PVQ A;  4FCW A;  2ZTD A;  4QHS A;  4ED1 A;  3B7Z A;  4G4N A;  5D49 A;  3GLG E;  3U6S A;  2XFS A;  3ETL A;  4KLT A;  2LHG A;  2HHW A;  3SAV A;  4XQ8 A;  2DBY A;  1Z19 A;  4MGZ E;  3LYS A;  2I7P A;  1NY6 A;  1V33 A;  1T4G A;  1KFD A;  8ICT A;  1QVR A;  4LJX A;  3UMB A;  3PW2 A;  4DF4 A;  4BB9 A;  3BOS A;  2CHV A;  4R8U B;  1PRB A;  2JGA A;  2NO5 A;  1D0L A;  5CJ7 A;  3OJU A;  5AKH A;  2FI1 A;  2AGO A;  2LVA A;  1EE8 A;  3BZK A;  2ISO A;  3QUB A;  5E26 A;  3FRI A;  3GRV A;  3I1Y A; 
#chains in the Genus database with same CATH homology
 1Q3U A;  1D8B A;  3DOA A;  3FTC A;  4OU7 A;  3L3F X;  2YB1 A;  2XGN A;  1A0P A;  4GC9 A;  1DGH A;  3SAF A;  2UUB M;  3HHZ A;  1SXJ B;  1Z5B A;  4M0D A;  2G0A A;  5KPT A;  3GLF A;  2A5Y B;  1NNU C;  3HJS A;  1OFH A;  2R4E A;  2CEA A;  2F4V M;  2Q4T A;  3ZCB B;  1QZM A;  1Z5A A;  3UMM A;  1HT2 E;  2XH9 A;  3L2A A;  3HHW A;  1HEK A;  3I4Y A;  5A0L A;  3PST A;  4Z8X A;  4DUY M;  1L2D A;  4WW0 A;  3T1H M;  2Z3X A;  2DQN B;  2EUC A;  5KPZ A;  3D2N A;  3H0M B;  4JI5 M;  2JA2 A;  1T3T A;  3SC3 A;  1GLN A;  1E94 E;  3KOW E;  3U6Q A;  3AOE C;  4PDG A;  3L25 A;  2Y20 A;  3PXG A;  2C9O A;  3FTF A;  2KRU A;  3AOG A;  2MRL A;  3SQI A;  3J81 S;  2VQE M;  1GL6 A;  2KJ9 A;  2VJ5 A;  1PJI A;  2DWZ B;  1WXQ A;  2LKY A;  3GRR A;  2QPA A;  4AZF A;  4JI4 M;  4JI0 M;  4EIW A;  3HHX A;  3CF0 A;  1XNR M;  4IJE A;  1DGF A;  2DHR A;  4X65 M;  3A46 A;  2O5R A;  1HR0 M;  4DR2 M;  2H3F A;  4IBE A;  2LHT A;  3E0F A;  2ZIX B;  1GKI A;  2C9C A;  2UUC M;  2QP9 X;  4DV1 M;  2ZG6 A;  2K47 A;  2KZS A;  3PNV A;  4FWD A;  3AKZ A;  5JI2 E;  2UXB M;  2K4I A;  2KD1 A;  1N33 M;  3EIE A;  4XBO A;  2OXO A;  1DRG A;  3HJQ A;  3PNY A;  2HOI A;  1IQP A;  5FTM A;  1N78 A;  1SXJ A;  3KS4 A;  1TH3 A;  3I51 A;  5KL8 B;  1NY5 A;  2I7N A;  4NLB A;  3U6E A;  1S3S A;  1YSY A;  4GMQ A;  4P16 A;  4NXM M;  4NV0 A;  2E5L M;  5KO3 A;  1C1K A;  3SMS A;  2PMZ F;  2KVC A;  2VKQ A;  4NXN M;  4I81 A;  4DUZ M;  3HKP A;  4MGH A;  4DV4 M;  4G4R A;  2K4H A;  2WAQ F;  3C29 A;  4M9X A;  3KS8 A;  3LQQ A;  4QOS A;  3U6O A;  4GIT A;  4IBG A;  2R4J A;  2DVW B;  3RFA A;  2DXI A;  3H0R B;  4BX9 C;  5EXP A;  1GL7 A;  3U6D A;  3H0L B;  4OJL A;  1XMO M;  5C1B A;  3GPX A;  2VQF M;  4LZZ A;  4LF4 M;  2KHV A;  2LNH C;  3KFU F;  4NL4 H;  2XF3 A;  4C0Z A;  4TUW A;  3U6M A;  2OM6 A;  1IIP A;  4DR5 M;  4KX3 A;  4DV6 M;  3U61 B;  4LFC M;  4IBF A;  2VIX A;  4A3V B;  4O3M A;  4P0Q B;  4A8E A;  2AHM A;  4REZ A;  3C58 A;  2HBJ A;  1GO3 F;  3HJ8 A;  2E1E A;  4ACO A;  1IXR C;  1X37 A;  1XHB A;  2JH1 A;  4KMO B;  5DYI A;  3FYC A;  2F5P A;  5CRX A;  2V1U A;  3SMV A;  1IBL M;  1NJF A;  1HNZ M;  4LJ6 A;  3UJN A;  4LFB M;  3LQR A;  1DGH B;  4OO1 J;  2KJ8 A;  2D6F C;  1LV7 A;  2L6O A;  2J7N A;  1L2C A;  3KOZ E;  5EP4 A;  3OPX A;  1KFV A;  1DO2 A;  3GLF B;  3FYD A;  1NHW C;  2ZIV A;  1XWI A;  2KV2 A;  2KNJ A;  2LYB A;  2QEN A;  2P5T A;  4LZJ A;  4IIW A;  3FUT A;  3T15 A;  4B7F A;  5C0Y A;  4DR6 M;  1NSF A;  2BNK A;  2Q2E B;  3JR4 A;  1UM8 A;  3FTE A;  4OVZ B;  3F5A A;  2RRD A;  1MU5 A;  5EP1 A;  5ITU A;  5KQD A;  2KOB A;  3GPP A;  3TWM A;  4NLC A;  2R45 A;  4R7G A;  3KP1 E;  3J2P B;  3PSP A;  4FZM A;  1OUQ A;  1NJG A;  4GC5 A;  3HWS A;  3OTO M;  3K8Z A;  2ZAO A;  2LBO A;  3GLI B;  2OH2 A;  1QYR A;  4CHT B;  4FVM A;  2H3Z A;  4LF6 M;  2YNM D;  4AW4 A;  2F76 X;  3ALR A;  1KBU A;  3NWL A;  2KRK A;  5ITX A;  3U61 A;  4AYB F;  3VLF B;  3VKH A;  3D8L A;  2EA0 A;  1XNS A;  2XEP A;  4LRT A;  4I8O A;  4DV7 M;  4ICA A;  2E5S A;  4RF1 A;  4NSR A;  3CTW B;  1CRX A;  2K89 A;  1N36 M;  3AQF A;  3N7R C;  2XFT A;  5ITQ A;  3FUW A;  5ITY A;  5C18 A;  4B3M M;  4QHT A;  3HHY A;  1MX0 A;  3DA1 A;  3RF9 A;  4JMU A;  2YX8 A;  1H6U A;  3GLG A;  4BBA A;  5EQT A;  1SXJ D;  4GRI A;  2KXE A;  4GH9 A;  1Q3B A;  3MK6 A;  2L09 A;  2HBM A;  2XIC A;  1I94 M;  4P0P B;  3R8F A;  4RF0 A;  1DO0 A;  3GQ3 A;  3AL0 C;  1G3I A;  3T38 A;  3M6Z A;  2CV0 A;  2W7P A;  3E4R A;  3GO8 A;  1TDZ A;  4CIS A;  2HBL A;  3SAT A;  4MM3 B;  3F5E A;  4QIW C;  1Z59 A;  1A6S A;  4BUG A;  3QWL A;  4HLQ A;  4PD2 A;  4KOD A;  4LG2 A;  2YR0 A;  1TH2 A;  5FLX S;  4OVZ A;  3GLH A;  4B08 A;  2CPR A;  1XC8 A;  1G59 A;  4LJ7 A;  3F2C A;  1IN5 A;  3M6K A;  3JR5 A;  2G08 A;  1QAM A;  4LJ5 A;  3NBI A;  3F53 A;  3KSJ A;  1SZH A;  3PVS A;  1R7R A;  1Z6T A;  2X4A A;  4M0W A;  2K8C B;  4MB7 A;  1HQC A;  4KO8 A;  2E1F A;  3GLI A;  1IBK M;  2KZU A;  3THG A;  1R6B X;  3PSI A;  2V1C A;  4LJ4 A;  3H4M A;  4MGY E;  1SXJ E;  4WUR A;  3GPY A;  3U6C A;  2HHH M;  1I4W A;  2CUZ A;  1ECW A;  3VCB A;  3CRX A;  4PCZ A;  4B3R M;  4LJA A;  2D7H A;  1NVM A;  4XGI A;  5ITT A;  4DR3 M;  3TL4 X;  1Q3C A;  1TAM A;  4GFJ A;  2G5G X;  4IBK A;  3TWL A;  2YFQ A;  3GPU A;  3C28 A;  1OJL A;  4JN6 A;  5A2Q S;  2CHG A;  2XSZ A;  3SBJ A;  1NNJ A;  2UXD M;  4B3S M;  1E9R A;  3LMM A;  3AQE A;  4P0P A;  2C98 A;  4PT5 A;  4QOZ C;  2WB1 C;  2XI9 A;  3MGV A;  2X8A A;  1W5T A;  2CV1 A;  3QAU A;  4JYA M;  2ZXH A;  3IN5 A;  3WHL A;  4PDI A;  4ITQ A;  3HKZ C;  4OJ6 A;  2KEB A;  1QQW A;  1IM2 A;  4OX9 M;  2F5S A;  2UXC M;  2ZIV B;  3DZD A;  1G41 A;  3SYK A;  4DV5 M;  3L27 A;  2DWN A;  5BPV A;  2QCU A;  5LMN M;  3ONN A;  4AYB C;  1NZB A;  1Q3V A;  3GU3 A;  2D7E A;  2R18 A;  5EXS A;  3GQ5 A;  1L2B A;  2CN1 A;  3K1Z A;  3A98 B;  1IY0 A;  1J7K A;  1YE9 A;  2DWL A;  2ZIW B;  2R46 A;  2BDU A;  1HT1 E;  4QNL A;  3W0L B;  2OYY A;  3SAG A;  4G6Z A;  1PM5 A;  2Y21 A;  2BJW A;  4PL2 A;  4AG5 A;  1IXS B;  1L1Z A;  2CFO A;  4FW9 A;  4MGK E;  3WHK A;  4LF8 M;  1OFI A;  5KL1 B;  1IY2 A;  4NRW A;  2G06 A;  1YUB A;  1JR3 A;  2R62 A;  2KKV A;  2CRX A;  4B3T M;  3RGS A;  4RNA A;  1URJ A;  3HU2 A;  4AKH A;  3D2Q A;  1KSF X;  4U6P A;  1ED1 A;  4JI2 M;  2H3Q A;  3IP4 B;  1FNN A;  4G4Q A;  1ZQ1 C;  4QNM A;  3NRW A;  1W5S A;  2F8L A;  3FUU A;  4OW0 A;  2H3V A;  2L7I A;  4L78 A;  1FJG M;  3SAW A;  1HNX M;  1K3W A;  1Z1B A;  5IRE B;  2HBK A;  3FD9 A;  2DWM A;  2KKP A;  2XZU A;  2KJ5 A;  2ZIU B;  5EJC A;  4FWH A;  1HNW M;  3GLG B;  1YT3 A;  4AG6 A;  4L16 A;  4B7G A;  3U5Z B;  3SAS A;  4LRS A;  3FTD A;  2XID A;  4QIW F;  2KHQ A;  5KQ8 A;  1PJJ A;  4NWI A;  3LVV A;  4CGY B;  2HOF A;  4PL1 A;  3U60 A;  3LVW A;  1IBM M;  3FKE A;  2RGH A;  1MA7 A;  2F77 X;  2JMG A;  5ITX E;  3GLH B;  1P7D A;  2ZIW A;  5GKN A;  2CV2 A;  5FTJ A;  1SXJ C;  3K2L A;  2ZXI A;  3TWK A;  2JHD A;  2FOI C;  2KW0 A;  2H3I A;  4D81 A;  5F3W A;  4JI6 M;  2M60 A;  4LF9 M;  2M0N A;  2F5O A;  5H37 D;  3HGI A;  3SHG B;  3SFZ A;  2C99 A;  3AOE A;  5FTK A;  3ZH9 B;  5BR8 M;  2G5H B;  2K8A A;  2W04 A;  3O0F A;  3SYL A;  2Y0S C;  3KVW A;  5IWA M;  4IBD A;  2OPF A;  1IN6 A;  3TE6 A;  2RP5 A;  2DGZ A;  1D2N A;  2QZ4 A;  3B9P A;  4CRX A;  2HKJ A;  2W82 A;  2CE7 A;  2LYA A;  2ZM6 M;  3F2B A;  2V6Z M;  4B7H A;  1KYI A;  2ZAN A;  4JI7 M;  1IY1 A;  2XSZ D;  1L1T A;  3U6L A;  2ZIU A;  1E32 A;  1QAN A;  2G5I B;  4AQY M;  3VFD A;  3RGP A;  3U5Z A;  2DF4 B;  4DR7 M;  3SMP A;  2WB1 F;  3AV0 A;  2OQ4 A;  3GRY A;  3IG5 A;  3KOX E;  2NQ8 C;  3RFW A;  1WUD A;  1DGB A;  3SAR A;  5FTL A;  2HOQ A;  3HKZ F;  1TDH A;  1R2Y A;  3UGJ A;  4K0K M;  2CHQ A;  4M9Z A;  3SAU A;  2XZF A;  2FFJ A;  3KDS E;  4AKI A;  4OJP A;  1J5E M;  4I5S A;  4BLC A;  3ICX A;  4FE3 A;  1XMQ M;  3L28 A;  4L15 A;  3J80 S;  3VK7 A;  1HQY E;  2XLJ A;  3D2S A;  3M7G A;  3Q8X A;  2HL7 A;  3GP1 A;  3DEE A;  3TPZ A;  3GQ4 A;  4QJF B;  8CAT A;  3W0F A;  4LF5 M;  3VDU A;  2FE8 A;  2VJ4 A;  2F5Q A;  3F2D A;  2UUA M;  5KPR A;  1K82 A;  4DR4 M;  4GHA A;  3MJ5 A;  3VC8 A;  4NRV A;  2KA6 B;  3D8B A;  1F44 A;  4W5W A;  7CAT A;  1JR3 D;  5DNY A;  2X49 A;  2ZAM A;  2JH7 A;  2Y0Q A;  4DV0 M;  4KX5 A;  1K3X A;  2GH1 A;  4YHH M;  2YQZ A;  3NUQ A;  3FUX A;  3J7B A;  2N1R A;  5HR7 A;  4AI6 A;  1N32 M;  2LWX A;  4DR1 M;  2NV3 A;  4U7C A;  2UU9 M;  4IBJ A;  2QBY A;  2A3V A;  2DZO B;  2YB4 A;  1PVR A;  1G4A E;  1L8Q A;  2L7H A;  3AJI B;  3L29 A;  3CP8 A;  2C96 A;  3UK6 A;  3SHF A;  4OJO A;  4HL4 A;  3JAM S;  4S12 A;  4JXJ A;  5FTN A;  4IBB A;  4LGM A;  5E6J A;  4X62 M;  4DV2 M;  3M0E A;  2Z4R A;  2Z4S A;  3N7P D;  3L26 A;  2F5N A;  4M9S A;  1T94 A;  3M6A A;  3R9X B;  4GHL A;  3GZF A;  4LJ9 A;  1G8P A;  3GRU A;  3U60 B;  1ORY B;  3AL0 B;  2BJV A;  4LY6 A;  4YY3 M;  2FNA A;  3ILK A;  2KIC A;  4FZN A;  4NSO B;  1ZQ9 A;  4LFA M;  3KW6 A;  1PVP A;  1N77 A;  4GIP A;  3VDP A;  2D7G A;  3HU1 A;  4FWG A;  4WJ3 B;  4X64 M;  4GKJ M;  2Y0T A;  4Z6Y A;  3CF6 E;  3K1J A;  4IJF A;  1N34 M;  2F2A B;  4G4O A;  4DV3 M;  4JI8 M;  2J7O A;  3PFI A;  2K8B B;  1TGU A;  4FCV A;  1TH4 A;  5HR6 A;  4R3D A;  2G09 A;  4BJQ A;  2Y0S F;  4LGY A;  1IN4 A;  5IT9 S;  2DZN B;  1DGG A;  4IBC A;  3SAH A;  5EXX A;  1XNQ M;  3IG8 A;  4AKG A;  2M5Z A;  2HCB A;  5DYG A;  2VII A;  3UZU A;  2G07 A;  2ZBK B;  1QAQ A;  1XXH B;  2MA1 A;  1Q39 A;  5EXT A;  5LMU M;  3CYM A;  4IC9 A;  3TQS A;  1J09 A;  4JI3 M;  3CF2 A;  1GVN A;  3T1Y M;  3VKG A;  2EO2 A;  4X66 M;  4JV5 M;  3EIH A;  4GKK M;  4FCT A;  1VDD A;  3AFH A;  4KLN A;  2C5R A;  2K4E A;  1IN7 A;  3KP0 E;  3K92 A;  4FZL A;  1R2Z A;  2W03 A;  2ZIX A;  4LJ8 A;  4KHP M;  1Z5C A;  5ITR A;  2KEY A;  1L6N A;  3M7D A;  1XO0 A;  3DFZ A;  4CDG A;  4ZPX A;  2LH0 A;  3N7S C;  3U6P A;  5EP3 A;  2Z7J A;  3A45 A;  4MGI E;  3A42 A;  4L8R C;  4LF7 M;  2GOL A;  4D80 A;  2RHF A;  1ZAE A;  2R65 A;  3FUV A;  1PVQ A;  4IBI A;  4FCW A;  3VK8 A;  4QHS A;  1QAO A;  5T14 A;  3E9S A;  3PZP A;  4G4N A;  3U6S A;  1E9S A;  2XFS A;  3J7A S;  5EP2 A;  2KIW A;  3ZC7 B;  2XVT A;  5JI3 E;  4NOO B;  3SAV A;  2W7O A;  1Z19 A;  4JI1 M;  2PMZ C;  4MGZ E;  4MH0 E;  1HIW A;  3LYS A;  2RKO A;  2I7P A;  3MHV C;  1NY6 A;  3J27 B;  5FSW A;  1XXH A;  1UPH A;  4OJ5 A;  4D82 A;  3KOY E;  3KFU G;  1QVR A;  2QBY B;  2WAQ C;  3KXE C;  3RE8 A;  2LXE A;  4QNR A;  3HU3 A;  4CGZ A;  3T79 A;  3KZX A;  4FD2 A;  4BB9 A;  5IZ7 D;  3BOS A;  2CHV A;  2ERC A;  2HMX A;  2JGA A;  3KSX A;  1IN8 A;  4II7 A;  2H1R A;  1NHG C;  4L4U A;  3PSF A;  4I4L A;  2RGO A;  3I4V A;  1N75 A;  2G8L A;  4LCB A;  1EE8 A;  5E26 A;  1JQJ C;  4P0Q A;  1IXZ A;  3GRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...