2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
molecule keywords Capsid assembly protein VP3
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2R18A 2Z7JA
chains in the Genus database with same CATH superfamily
3TANA 3VKGA 3T15A 1XNSA 9ICCA 2J7NA 1AROP 2QZ4A 4JI2M 2FPMA 1N5XA 4M9XA 1IBLM 2XGNA 1X9SA 1RZTA 2F4VM 3TFSA 5F9LA 2K60A 2B6GA 2LNHC 5ALTA 3GV7B 3HT3A 4MGKE 5BOMA 4X62M 2BCVA 1SG9A 3H8SA 5DB9A 2Z8YM 2V9WA 1COOA 5KFBA 4QZAA 1PJTA 5DBBA 2VF8A 4DFJA 4IQTA 1X66A 3HP6A 2OWOA 1KSPA 1QDTA 2C9CA 4JN6A 2OPFA 3H0MB 4YMNA 8ICVA 3B7ZA 3FUTA 5J0OA 1ZQBA 2XH9A 1ZRMA 4ECWA 3FD9A 1NZPA 4JWMA 1YSYA 2DPIA 5GTHU 1JB0F 1QZEA 1QUSA 2KN7A 2H1RA 2ZUCA 4GHAA 1UT5A 3GRUA 3RH5A 4G4NA 1MC8A 4YQWA 4LVSA 4DL7A 2JH7A 2K4PA 1ZD4A 4DLGA 1DO2A 2KE7A 3FUWA 4RNMA 1SWVA 8ICLA 4IRCA 3R9XB 4RNNA 3U6QA 4DR7M 4YMOA 3GPXA 1ZRNA 3GP1A 3FAHA 3GQ4A 1GL6A 2Y0TA 2R46A 1Z5CA 4YXMA 4FBTA 3AOGA 4O5CA 2KV2A 1SKWA 5HHHA 5KFZA 3QYEA 1RM6C 2OO9A 4HL4A 1DV0A 3UMBA 4Y2TA 2MUTB 5EE1A 4KITB 3SAVA 3BS5A 1NNUC 1MU5A 3B9JA 1L3SA 3HRDD 3H4DA 4ELTA 5KAIU 2ZJAA 1V85A 4NM2A 2DFLA 1IY0A 1WJ7A 2DZNB 2F2AB 5DYGA 5FTKA 4NLNA 2LXEA 7ICTA 3CF2A 3H0RB 2AJQA 4UARA 1D0LA 1DK2A 3BQTA 1HT1E 3J81j 1XO0A 5AKYA 4NM1A 4WJ3B 3BXWA 1RYRA 4PHDA 2EAMA 5CB1A 3S6JA 4EEKA 2EKFA 2CV1A 4LFBM 4DV2M 3NS1A 1L1ZA 4PHAA 1SXJE 2OXOA 5L9XA 3GQ3A 2XIDA 8ICOA 1D0MA 3AL0B 2ALZA 3SYZA 3BQ1A 2N35A 2GO7A 4O3QA 5J2GA 4LJXA 1JI7A 3U26A 4J9QA 4ED6A 1A5TA 1Z19A 1ZQMA 2JZBA 2UUCM 2UVUA 2FI1A 1GABA 2ESEA 3HWTA 4ACOA 2JEGA 2KZUA 4DR2M 1N78A 5T14A 3U60A 3UZUA 9ICNA 1UCVA 5AI6A 4B3MM 5J2FA 3OHBA 2I6XA 4I2AA 4R65A 3GV5B 5AI0A 4G3OA 2EZZA 3V7JA 3E58A 2JEFA 1X2IA 1TH4A 3MR2A 2HWJA 3RB6A 1NHWC 2MRLA 2LBCA 3TI0A 1MA7A 2F8LA 2FMQA 1AIPC 3MGHA 3R9KA 2HHXA 4MGZE 1X6IA 2RQ5A 5AM2A 3LK9A 3N4MB 2AGQA 4MFCA 1RDFA 3KKAA 1JMSA 2RRDA 2JEJA 3KHHA 2ASJA 2Q4TA 4FO6A 2KNVA 5L8RF 1YZ6A 3K92A 3ISCA 4PL2A 4M9GA 1OXJA 1F0MA 3QEAZ 2V1CA 4P17A 3PW0A 5J0YA 2QB0B 1NK7A 3RH6A 2KHHA 4RPZA 5J0PA 1QAMA 5DG7A 4Y2YA 4TUPA 3H4BA 2R8GA 2HOFA 3U6EA 1NKEA 4XRHA 4DWIA 3J27B 4RNOA 2W9MA 3KZIU 5EE0A 4IRKA 2HBLA 1TTEA 4RQ0A 5EXPA 2HCBA 4I27A 8ICTA 5JUMA 2HVHA 1G3IA 4JV2A 4DL4A 1GO3F 1E32A 2ISOA 4Z6CA 2BPCA 1A77A 3QUCA 3J7AS 5ALHA 3AMZA 5J0UA 8ICWA 1CUKA 1OKSA 4OW0A 3OTOM 4ED8A 2HHHM 2K9DA 3U6OA 3L25A 3RJKA 4F4WA 2CRUA 1VDLA 1Z5AA 1PK3A 2JZ1A 1XMQM 4QNLA 3N97B 1NK9A 2D7EA 3BZCA 1XXHB 3EUB2 3GIMA 1ZJMA 3PV8A 1L2DA 3UMCA 2Y9TA 4TURA 3LYSA 5DB7A 4O3PA 2MGWA 4UW9A 5C5JA 4DR6M 9ICKA 3HW8A 3QUTA 4K4HA 2H5XA 3PMNA 4C8KA 5DYIA 3RTVA 1ZMVA 5EP4A 1CRXA 3FM9A 2F3NA 1E94E 3ED5A 4IBFA 5ALWA 1MSWD 2XEPA 2KSOB 3WK5A 4L8RC 1AUAA 4ECZA 1NY6A 4F1IA 4G3IA 3CNHA 4P0QA 1GLNA 1IXZA 2KEYA 2MROB 1NKBA 4ECVA 4HLQA 2FE9A 1IV8A 3L26A 2A1JA 1ZQXA 3GQCA 5J2KA 5CEHA 4I2JA 5CP2A 4M9JA 3RJHA 4R7GA 3C5GA 1TGUA 1I94M 2QLTA 3TWMA 3EIEA 1PK1B 1B0XA 3JR5A 4KODA 2P35A 1O03A 4PD2A 4I2IA 5ALYA 5L1JA 1N62A 5DG8A 4NSOB 2W8LA 3TQSA 1LV5A 3UXNA 2LVQD 2LHGA 2JY7A 3TKAA 3RRHA 2BCRA 4P0QB 4GXKA 4PT5A 3H8WA 1V34A 5IIIA 2XY6A 2JHDA 3MDCA 4F5RA 2ZIUB 1URJA 4IC9A 1NHGC 3U61B 1DOQA 4DF8A 2EO2A 5EE3A 1YZ7A 5C0YA 2I9GA 2KW0A 4IR9A 2HOIA 3KHRA 3RBEA 1Z4NA 4KMUA 3MABA 4F5QA 4DV3M 5KFAA 2FS1A 4CE6A 2FNAA 2Z3XA 4OJ5A 4RT3A 3RJFA 5J2CA 1QYRA 1PVPA 5GKNA 4I2HA 3RF9A 3W68A 1FJGM 4ED1A 4C8NA 3W67A 4M47A 1ZQDA 3QUQA 2ZUBA 4YMMA 4JV5M 2E8OA 2AQ4A 4J9NA 2R45A 3MBYA 1XWIA 3SMPA 2XO7A 4JI8M 3LDAA 5EXSA 5AKZA 2RHFA 2HVIA 1L8OA 4AKHA 2MA1A 2B21A 3WHKA 2W7PA 2KHQA 4US8A 2NYVA 1IY2A 7ICJA 3QU2A 4FVMA 3HX0A 3CP8A 4DLEA 1PUZA 2HSZA 4MGHA 5IWAM 2W9BA 3QWLA 3T38A 4F4XA 3T5LA 2YMMA 4DR5M 2EJSA 2KRKA 3I28A 5AKXA 4QIWF 2P66A 1KYIA 1V92A 1JALA 3WU2U 3HPOA 4Z6EA 2F76X 2JY8A 4LGMA 4KLIA 3KXEC 4XBOA 5CWRA 4OO1J 5CRXA 4PZOA 5EJCA 5J2HA 4F71A 4EELA 2UUBM 3RB4A 2J7OA 1NK5A 3C2MA 4AYBF 5KFIA 3IRUA 4YFKA 4JI7M 4GC9A 4KLMA 2W9BB 3SQIA 4L6V6 4AI6A 5FP0A 1U49A 3LVVA 4DV6M 1ZQJA 2UVVA 3LCVB 3FYCA 2XY5A 2G06A 2E8MA 5DB6A 2EKKA 2GQFA 2KA6B 4TUSA 3HKZF 2KZSA 2CP8A 4I2CA 1HUZA 1IN5A 1IXRA 3DV9A 4CCHA 1BPZA 5AKEA 3PMLA 3BS7A 3IN5A 1N60A 3HU3A 3F53A 5DKWA 2F77X 3B7NA 2YQEA 3VKHA 8ICNA 1IBMM 1A6SA 3SATA 3D8BA 2QQ8A 4LJ9A 4QHTA 4Y28F 3NVWA 8ICHA 2XC9A 4IQVA 5KT6A 4LZJA 1Q3UA 3GDXA 1I4WA 3C9PA 2L5YA 1SV4A 3GFKB 4F4ZA 4F5OA 2PFNA 4RF0A 1QQ6A 2JRZA 4C7ZA 3I4YA 2C5RA 3ONNA 1H38A 4ELVA 4PCZA 4BWJA 3M8SA 4IL6U 1QQ5A 3DOAA 2JUJA 9ICJA 2XZFA 2W3RA 3D2SA 2FLPA 1N2XA 3KS4A 2EDUA 5DB8A 4NRWA 5AI8A 2Y1IA 2NRXA 2C2DA 2M5ZA 3RJEA 1DGHA 2LTUA 1L2CA 4AG5A 3UMGA 4NLZA 3TPZA 1YLAA 3RGSA 3BQ0A 7ICQA 3FTFA 7CATA 1Z3EB 4GIBA 3MHVC 4QNMA 3FUXA 4OD0A 1LV7A 4L78A 2WB1F 4JYAM 4KLGA 4NJ8A 3FRIA 3K4GA 4QOSA 3MR5A 4B6JA 3LQQA 5AKJA 4DV1M 3SMSA 3PW4A 2XFSA 2K4HA 4IBJA 5AKKA 4J9LA 3FDSA 2Y0SC 4DV5M 1Q3VA 4DSIA 1A0PA 7ICVA 5J2IA 2V6ZM 5AKLA 9ICBA 1ZQKA 2KHVA 1N63A 3GLHB 3NVVA 2WSEF 1HIWA 1SV0A 3OSPA 4HEOA 4P0PA 3SHGB 4O3NA 3ZDAA 4UBCA 3H40A 3HU2A 1IM4A 5KFKA 1ZQAA 3M6ZA 1IXSB 1KRPA 4TUWA 4CF3A 1EIJA 4DR3M 4F4KA 2HHSA 1QSLA 1QQWA 2J6UA 5J2DA 4JXJA 5TZVA 5IT9S 3K1RB 1H6UA 3MR3A 2HHQA 1TDHA 3PNYA 1K3WA 1OFHA 4M0DA 1IY1A 3KTQA 3GU3A 3UQ2A 1WCNA 3C3DA 1D2NA 1NK8A 1ZQ1C 2KIVA 5KFFA 2JXJA 5DLFA 3QU5A 2OEHA 4LF6M 1NK6A 1IIPA 8ICCA 1NV9A 4USAA 5AI9A 2DPJA 3KSXA 4R3DA 3M6KA 5J0XA 3M6AA 5E79U 4LJ5A 4NXZA 4CGYB 4YD2A 3GLIB 2DWQA 5DDYA 1NOMA 3FC4A 4ICAA 2Y9UA 3C1YA 3KKAC 3L4PA 3BQ2A 5KFSA 2KRUA 2ZJ5A 1KN5A 2AQ0A 3SAFA 2UXDM 2A5YB 3U6MA 4OJPA 4NL9A 2EQYA 4U6PA 1WGLA 1WHCA 2W82A 4DQPA 2ISPA 1BNOA 2AXTU 4YR3A 5IINA 2MAXA 4B08A 1Z1BA 2YB1A 1XU4A 2QB0A 2MR9A 2H3IA 9ICEA 2IHNA 4M9SA 4OU7A 3KFUF 2HOQA 4UAWA 1S10A 1OTRA 4GXJA 1BPEA 4DUZM 1A76A 1QSYA 4MFAA 1IM2A 1BPYA 2HBKA 3SENA 2DI0A 2LYAA 4KLDA 1JQJC 3SARA 3H8JA 3QNMA 4C8OA 2PMZC 4RT2A 3PX6A 1Y88A 2AGOA 1WGNA 2B3TA 2KD1A 3AFHA 3D6JA 5DGAA 1G8PA 4I81A 4DOBA 3PW5A 1NI3A 1K1QA 1PK1A 3M1YA 8ICMA 4LFCM 4MF2A 2RRUA 1N48A 5L1KA 2XY7A 4WURA 1D8BA 2OYYA 4ECUA 2FE8A 4UB3A 2CHQA 2JH1A 4EENA 7ICNA 5KQDA 1WG8A 2G08A 5FSWA 4I29A 2DAMA 3L27A 3ZH9B 1TF0B 4UB5A 3T79A 4L4UA 3Q8SB 3HKPA 1YUBA 4L16A 5CR0A 4P4MA 7ICMA 5AIBA 2GNOA 1Z6TA 4PDIA 3RR7A 2I1QA 3W0FA 1XWLA 3NUQA 4M6WB 3PNCA 4ITQA 2EH9A 4KLQA 3FKEA 1M6YA 2KKPA 4UAUA 4QWDA 2KSOA 1V38A 1V33A 2IOHA 2G3QA 2K47A 4BB9A 1ZQVA 3NWLA 1P7DA 3GLFB 1WYGA 3UPQA 2YR0A 2WF6A 4B3SM 4GKKM 4B7FA 4DV4M 3NRZA 1OJLA 4UB2A 4DO9A 1QAOA 2Z4SA 9ICHA 2ZIVB 5DGBA 4NXMM 4RPXA 3MJ5A 2BPFA 3RAQA 2BGWA 3M7GA 1J09A 4F92B 2R8HA 4IJEA 2WSFF 3C2LA 3LMMA 1S9FA 2LMRA 3PW7A 2EZYA 2NQ8C 1QUTA 3U6DA 1U45A 2Y0QA 3HHXA 2CFOA 1S0MA 4IIWA 8ICFA 1L2BA 3SR6A 1NK0A 2YFQA 3UK6A 5ALRA 2BNKA 5ALQA 1JXLA 4F3OA 3WHLA 4WW0A 1TAQA 3QUBA 2JMGA 2NRWA 3SEIA 2XGQA 2G5IB 4UB4A 3OTQA 4MF8A 1ZQRA 4KLUA 2IOFK 4DSJA 1WIVA 1ZQQA 1TAMA 5J0QA 3VCBA 4CJ6A 5KT4A 2C96A 2R8IA 4GC7A 1ZXIA 4DEZA 4UAZA 2CEAA 4JK1A 2BKEA 3KOXE 2W7OA 3B89A 4JV0A 3UXPA 5AKIA 5ALPA 1KSFX 4I28A 5ITUA 4TQRA 4KLEA 2ZM6M 1QCKA 3WK6A 1KBUA 4X64M 3JPPA 3SZ2A 1IG6A 3F2CA 1MQ2A 2ZAOA 2FMPA 1XNRM 2R44A 2CHVA 1J2MA 3GQ5A 2E1EA 2UXCM 2ASLA 2HW3A 1KDHA 1DGBA 1ZMWA 5KPZA 1FEZA 5EXTA 2WHEA 5KG3A 3NVYA 1AQ6A 5KNIA 3RJJA 1SXDA 1LKYB 5AHXA 1S0VA 2HHUA 1BPBA 3L2AA 4ZPXA 2KFNA 4GFJA 1L7MA 3SYKA 2LYHA 2H3FA 3J7BA 2D6FC 4PJ0U 2KVCA 2RLTA 4KN4A 5KT3A 4RQ7A 3B74A 5AM0A 2AHMA 2XLJA 3U6LA 4Z6YA 4M9ZA 4NL4H 1JUDA 3GRYA 4OCZA 2D7GA 2FPLA 4R66A 3V6JA 2KG5A 1EE8A 3C3EA 8CATA 1J97A 5IIKA 3TWLA 3DZDA 1D9FA 4BDPA 4J9MA 1UQVA 3WK8A 4M9LA 4WP2A 3PZPA 2BQUA 3QYBA 4YY3M 2AH5A 2VDBB 9ICFA 5AKGA 1XS9D 3AV0A 2MUTA 3EPIA 2JA2A 1VDDA 3THGA 4GRIA 2R4EA 4QNRA 2K89A 5G5GA 4QWAA 3UMMA 4QW8A 3KP1E 4NV0A 1UFZA 2B0CA 1X42A 3MFIA 5DDMA 1T43A 1Z5BA 3AKZA 3H4MA 4DS4A 2BQRA 2JY5A 5DQHA 4FWDA 2NRZA 2VIXA 3KW6A 3WKAA 4J9RA 3KBBA 3RR8A 5KG5A 4B7GA 4Z6FA 1W5SA 2G5GX 4TQSA 1SV0C 8ICJA 7ICHA 3U6CA 3KFUG 1DK3A 1ZAEA 3F2BA 2ATLA 5DLGA 3Q8MA 1N75A 4YXJA 3OHAA 3C58A 4PH5A 3Q8KA 3GLHA 3T1HM 2HMXA 4NLGA 5HR7A 3H4JA 3ZCBB 4D82A 2QKQA 1U9LA 2YQZA 1N34M 1IN4A 4GKJM 1XO1A 4FS2A 4NSRA 2X49A 1FO4A 3O0FA 1Z00B 3MR6A 1OAOC 4DL5A 5FTMA 2H3VA 2EAOA 2ZIXB 4FS1A 3RFAA 2G07A 4KX5A 4M9NA 5KFRA 1GKIA 3SD7A 2OH2A 1X9MA 2JY6B 3JPRA 1E9RA 3E0FA 4AZFA 2QBYA 4QZHA 4QZGA 4UQGA 2WSCF 1OFIA 4B7HA 3SASA 1ZMUA 2YY6A 4CHTB 1RPLA 2RKOA 5KG1A 1ZQUA 3EPGA 1JXEA 4Q45A 1J2NA 1TK5A 5A2QS 1L1TA 1IFYA 1T8EA 2CWBA 4IBGA 3T3FA 3GRVA 8ICRA 1UT8A 1KFSA 5EWGA 3JPQA 3AN1A 4Q8FA 3WK7A 3ZQJA 2VKQA 1ED1A 3GV8B 3TFRA 4LZZA 3AU6A 4LF5M 3SYLA 2QBYB 3UM9A 2XICA 1K5OA 3GLIA 5EP2A 2LVOC 3I76A 2V1UA 2MH8A 2QNJA 3KOOA 3T5JA 4Y2SA 1HJPA 4EYIB 1CI4A 4R8UA 3LWMA 2D7HA 4YG2A 5KFYA 5J8YC 2BHNA 2NRVA 4KLFA 5J2EA 1X40A 1UHUA 4IR1A 1P3QQ 3SMVA 9ICUA 1JN3A 3GZFA 3F92A 4C8MA 4EEYA 2O25A 3K9OA 3FUVA 1RXWA 2HL7A 4UAYA 4P16A 5BOLA 3HJ8A 3V7LA 3I01M 1XNQM 4G4QA 2HBMA 4O5KA 4GITA 3V6KA 4ECXA 1WR1B 5KFOA 2QP9X 2DL0A 2X4AA 3ISBA 3PSPA 2BCSA 2ZBKB 4O3MA 4R63A 1R4GA 1NJFA 1C7YA 4ECQA 2APLA 5IIOA 3H8MA 4B3TM 1PVRA 1ZQTA 2W11A 5KFEA 5E6JA 3PSIA 1SXJD 1R7RA 5EP1A 4CF4A 3ISDA 3GIIA 1OIZA 4FCTA 4LRSA 4F8RA 4I2DA 8ICSA 1ZQ9A 2LKYA 2VA2A 5KFNA 4LF4M 4GIPA 5ALKA 4NLCA 4PHPA 2WFAA 4DS5A 1N56A 1MN3A 4QHSA 2DWNA 4RU9A 2A1JB 3OGUA 2XGPA 1NJYA 4DQSA 3K2LA 3MGIA 2DBYA 4B9TA 4UN2B 2Y20A 3FTCA 2WF5A 3IM1A 4QZBA 1XB2B 1RQLA 5ALNA 4LJ6A 4YVZA 4RKUF 2JV3A 1FFUA 1ZYQA 9ICQA 3AOEC 4FZNA 2W9CB 3K75D 5ITQA 9ICOA 4LJ8A 3D8LA 2CN1A 3SV4A 3LVWA 2VIIA 4LRTA 2Z7JA 3U61A 3MGVA 3A0HU 4LF8M 2ZAMA 3I04M 1KTQA 2VA3A 1NV8A 1CEZA 1Q3CA 4F50A 2KEBA 7ICOA 4A3VB 2HAKA 5KG7A 3G6XA 1U47A 2FOIC 2W43A 4UAVA 3ZDDA 1X9XA 5J0SA 1NJGA 5F3WA 2E8PA 4Y2JA 3E2EA 3ILKA 4J9KA 4QZDA 2G8LA 2JWSA 3A45A 2KVSA 1S0NA 3CTWB 2W04A 5AICA 2P6RA 3FE3A 3WK9A 5KG4A 1UA0A 2ZTDA 7ICFA 2XVTA 3N28A 3M8RA 2AGPA 1MJGM 4IS7A 8ICPA 2DWLA 3I4VA 2E3TA 3HX3A 5L1LA 5DBAA 2WAQC 3EIHA 3PFIA 5HR6A 1TFRA 1ZV1A 2K4EA 9ICGA 1G4AE 2DAEA 1OQYA 4LZGA 1XXHE 2Z4RA 4GMQA 2KKVA 1S0OA 1MQ3A 5J0TA 3ZDEA 3AL0C 3GLFA 4I4LA 1TAUA 4DOCA 4KTQA 2OQ4A 5ALEA 1XC9A 4CDGA 2J6TA 3AM9A 1B22A 1U4BA 3QE9Y 9ICLA 1IN8A 4MH0E 3J2PB 4RQ2A 5J2BA 1IBKM 1X6JA 5GTIU 4BUGA 5D49A 2EZXA 1BGXT 1LKYA 4QZEA 4MFFA 4G4RA 4ED7A 4KHPM 4ED3A 4KLHA 4BJQA 3U6PA 1NJWA 4DQRA 3PO5A 2FLLA 2C99A 1F44A 2RDIA 2IOFA 2G0AA 5AIAA 4CGZA 4DSEA 2HCFA 1OUQA 4DR4M 1S97A 2R4JA 3PX4A 3V72A 3QAUA 1G59A 2LM4A 3HY5A 4ECRA 2KFZA 2BJVA 4XUSA 3HHYA 3SFZA 3CW2C 3SHFA 1SGGA 2HI0A 1J5EM 1HR0M 2ZJ8A 1VDVA 3CF6E 3C23A 1N61A 3JPOA 1LB2B 4QIWC 9ICIA 3UXOA 3HJSA 2ZIWB 3EZ5A 1JIHA 3AQEA 3MFHA 5CHGA 4J9OA 1VLBA 5IIMA 4YHHM 1NZBA 4RQ5A 8ICXA 1QVRA 3N7SC 2ASDA 4R64A 1PVQA 1BPXA 4XA5A 1T6OA 3C28A 1BNPA 3IDWA 2CV0A 5KFPA 2V4RA 5KFGA 1RYUA 5AK6A 5J2JA 3SV3A 2DWZB 4Z6DA 4ELUA 3AOEA 4O0IA 2KZMA 4RF1A 4R71A 4UATA 3HKZC 4B9LA 3PSFA 4U7CA 3KOYE 2Q0ZX 5DFLA 5AM1A 4EZ6A 2KZ3A 1VQ1A 4Y2XA 2LH0A 2ES6A 1LTMA 3C21A 4DCCA 3GRRA 1L7PA 5KFXA 4DOAA 3QU4A 2E5LM 3SI8A 1PJJA 1TV9A 4RQMA 1DGHB 2F1JA 4Q8EA 3RRGA 1Q3BA 1OW5A 5EWFA 5AM4A 2ZTEA 1U48A 1SL1A 2NRTA 4PPXA 2PMZF 1G71A 2CRXA 1VEKA 2CHGA 3HGIA 1NNJA 1TH2A 4KLNA 3K1JA 3SAUA 2HHVA 4Z8XA 5KPTA 3V6HA 1FIQA 4YR0A 1QH9A 3H0LB 1HT2E 2WZJA 2ZXIA 8ICYA 1Z4OA 4O5EA 3ZDCA 3VDUA 2XSZA 4CISA 5KFCA 2KP7A 1J7KA 4RZRA 3K9PA 4IBCA 5F9NA 5AK5A 2GWSA 2YNMD 5AK3A 1NJZA 3HU1A 4DUYM 4ECTA 2KJ5A 2RP5A 1NK4A 3RH4A 3B0YA 5KG0A 1VJ5A 3J80S 4DFKA 4B3RM 2W3SA 4GH9A 5LMUM 4RQ3A 3MDAA 4F91B 4PDGA 1XC8A 3JPSA 1KKXA 1T3QA 4YR2A 4R8UB 4FWHA 2OOAA 3GLFE 1ZQSA 4YP3A 3EW9A 4REZA 1Z00A 4BBAA 3NVZA 4JUZA 4DV0M 2UXBM 1DGFA 2ZIXA 4RQNA 1ZQHA 1L3TA 4ZH4A 3TACB 2W8KA 3OSNA 1ORYB 3IECA 2FJ6A 4OJLA 2RDJA 4DFMA 2BQ3A 4GHLA 3GO8A 1PJIA 2DZLA 1PGYA 3FUUA 8ICQA 1KFDA 1ZD2P 1UM8A 4L15A 2F5OA 4NXNM 3FTEA 4YD1A 4US9A 5ALIA 4RNAA 4QZFA 4Q43A 2H3ZA 4KT0F 3KOWE 4LG2A 2ZXHA 5KL8B 4C80A 4FCWA 3NGDA 4XQ8A 4O9MA 3NRWA 1SXEA 4JI4M 2FDRA 5KFQA 1PJQA 4I5SA 1L3VA 5J2AA 2HKJA 4K0KM 5KFUA 2HHTA 4NWIA 2QARA 4EX7A 1G41A 4Y2RA 5EWEA 1RU3A 7ICSA 5KFJA 5KPRA 3KHLA 1N32M 4X5VA 2IBKA 4F72A 4P4PA 1L7OA 4IQWA 5KT5A 3RJIA 3FYHA 4GC5A 3E21A 5DQGA 1TH3A 2L2DA 1ZQYA 1TK0A 4O3SA 1GL7A 4NRVA 1VG5A 2R65A 4PGQA 3PR4A 3Q8RB 1FNNA 4JMUA 1F5SA 4ZOHC 3G6VA 3W0LB 3K8ZA 2R18A 4QOZC 2CXYA 2O6KA 5EOZA 2BDUA 2FH0A 3K1ZA 2BR0A 3KP0E 7ICIA 7ICPA 3KOZE 2FLNA 2DENA 5KL1B 3BDPA 2FFJA 2PFQA 2W9CA 2KJ8A 3Q8QB 1PRBA 2QSFX 3V7KA 2C9OA 4X66M 2ERCA 4IBIA 5HP4A 2K8AA 1T7PA 4DQQA 3Q8GA 4S12A 5HMMA 3BZKA 3QEBZ 4F2LA 1WWVA 1QSSA 5JU5A 1Z59A 3L5KA 4RQ1A 1KLNA 4LCBA 4D80A 3ZI4A 5AM3A 2XF3A 9ICXA 2DQNB 4KO8A 3UQ0A 5KO3A 3WKCA 2M0NA 4M0AA 5DQIA 3KZXA 4FD2A 5HHIA 3M9MB 5K4LA 3SAWA 4A8EA 2EANA 1SZHA 3RE8A 2JP7A 5EE9A 2I7NA 1N77A 2HDOA 1SXJA 4E0DA 4NOOB 3ORYA 1XSPA 2DKXA 2W55A 3TQ1A 3FTDA 3ZD8A 3I1YA 3IHPA 2F5QA 2KNJA 4BX9C 5C1BA 3QX7A 2XCAA 8ICKA 2OCEA 4XK8F 3EYZA 2BWBA 1DRGA 4F93B 2ZTCA 1NJXA 1VEGA 2LYBA 3JR4A 4FW9A 2H3QA 3U60B 3Q8PB 7ICKA 2KIWA 1MN8A 3JAMS 4C8LA 1R2YA 1ZQFA 4KN7A 2KICA 2PKEA 1C1KA 4JB3A 3T5KA 1F4IA 1ZQWA 3PSTA 3PY8A 2QPAA 3E9SA 4C4SA 5ITYA 3SAHA 5J0WA 2XFTA 2F1IA 4BGDA 3V76A 2KNZA 3TWKA 5CJ7A 2C28A 1X37A 1BPDA 5KAFU 2G09A 1T3NA 2CE7A 2O01F 4AKGA 2ZG6A 4BXOA 1S77D 2BJWA 5JI3E 1VEJA 1SB3C 2UVWA 4PHEA 2V4QA 3AUOA 5AK4A 1TK8A 3GLGA 4DL2A 5KT7A 9ICRA 4X65M 2BDPA 1RXVA 3ZD9A 4AQYM 4OVZA 5ALJA 9ICMA 1D8YA 1L7NA 4C4TA 2YX8A 3B7QA 2WF9A 5DG9A 5ITXE 3GILA 1MX0A 3D2NA 4OX9M 4CNQA 2ZIWA 2E8NA 5AKHA 4F2RA 2C2EA 3M7DA 4FE3A 2QENA 5ALMA 7ICRA 1V97A 1ZQPA 1R2ZA 4LF7M 1QDRA 4W5WA 5TISU 4NC6A 2JR5A 4ED2A 2R8JA 4MEYA 1XSLA 3KSJA 3NBXX 3OPXA 1KQQA 2G5HB 3J81S 3Q8XA 5KG6A 4DF4A 5D46A 2WB1C 4OVZB 4ECSA 3ZC7B 2XI9A 3OJUA 3MC1A 2L09A 3KD3A 3E46A 2L4EA 4BWMA 7ICLA 4LJ7A 3A0BU 1XSNA 2KMDA 5BPVA 4UBBA 2VANA 1PJSA 1ZQOA 4JV1A 2YB4A 4JWNA 5G5HA 4DSFA 1ZQEA 2MSNA 2VJ5A 2F5SA 1N36M 3C29A 1QLNA 1S5LU 4QWBA 4C4RA 3E4RA 3ETRA 3AEVA 4F5NA 2O5RA 3RAXA 5KQ8A 3JPNA 2LVAA 2MJ5B 2LHTA 1GJTA 2EA0A 2W03A 4LZDA 2LHCA 4DFDA 2RGHA 2K4IA 4QWEA 3ICXA 5KFWA 4PGXA 3M0EA 2QCUA 2JNHA 2KDLA 2LM1A 2KXEA 1HNZM 4O3OA 2JGAA 4FBUA 3U6SA 4MB7A 4KLSA 3VLFB 9ICVA 2WTFA 2IMWP 4Y2UA 1SKSA 1TDZA 4JI5M 3CF0A 2I5HA 9ICWA 1GO5A 1T4GA 4AG6A 2LBOA 3T6PA 2Y1JA 2ZANA 3OJSA 3LW5F 5KFDA 5ITTA 3BJYA 2RGOA 3MK6A 3UJNA 2A19A 3IP4B 4AW4A 5EXXA 3GLHE 1ZOLA 4EBDA 2VF7A 5C18A 4DV7M 4QZ9A 8ICZA 3U5ZA 2EUCA 1Z1VA 2F5NA 2I7PA 1FFVA 2OOBA 3TL4X 2DXIA 2GH1A 3D2QA 3M9NB 3CRXA 2K0BX 3GIJA 1WUDA 2ZIUA 1ECWA 3VFDA 4EBCA 5B5EU 4YN4A 5JTIA 1K1SA 4MGIE 2DKLA 4IJFA 5FTLA 2HHWA 4NLKA 4GEWA 4M04A 4FCVA 5CA7A 4XGIA 1UPHA 3F5AA 4PGYA 2DHRA 5IZ7D 1N5WA 2P6UA 4UASA 3LCUA 3PVXA 3PW2A 3ALRA 2WF7A 2C22A 1EFUB 8ICAA 5ALSA 1ZJNA 3PNVA 3GPPA 1L8QA 3DFZA 1SZPA 1NVMA 2LWXA 2E5SA 2CV2A 1GVNA 3DDHA 1TVAA 3G6YA 2VQFM 4RPYA 3AU2A 1SL2A 3KDSE 4EIWA 3GLIE 1NO1A 1K82A 2BCQA 4P2HA 1DGGA 1R6BX 2R8KA 3SC3A 2DVWB 1HEKA 2XCPA 4HAIA 4QWCA 2DUYA 3LWLA 4DL3A 4KLLA 3NASA 2QARB 2M9NA 9ICTA 2JEIA 4KMOB 2W9AA 2CUZA 1WXQA 1D8LA 2YMLA 2Q2EB 3CGWA 1YE9A 2DAKA 2JXNA 2MU2A 2WAQF 3HILA 8ICGA 3IV6A 5IIJA 3WKEA 3BQ7A 2N1RA 2DHYA 1TKDA 4B9VA 3A98B 4CIZA 4G9BA 2J6SA 1IXRC 3A46A 2L4FA 2VA8A 5ALGA 5ALDA 3SAGA 4MGYE 3RBDA 4ED0A 4RUCA 4F5PA 4I2BA 3TADC 2K8BB 3BS5B 3LQRA 4AP9A 1TE2A 4OJOA 2DWMA 5BPCA 3C1ZA 1OIPA 2IHMA 4KLOA 4GLXA 4FZMA 4FFDA 4EX6A 3WK4A 1XHBA 2UU9M 5H37D 5BR8M 3HJQA 1C20A 1HQYE 5B66U 1B4FA 3TAPA 1W5TA 3Q8LA 1KL9A 2YN4A 4DSLA 2ODGA 1S76D 2WF8A 3C2KA 2Y0SF 2DAGA 5J29A 2K6BA 4F4YA 2R62A 3QU7A 4NLBA 1DXSA 3GIKA 3EWAA 4B9UA 5EP3A 2GLEA 4LF9M 1EXNA 5JI2E 4Q44A 3HZJA 3RB3A 2GOLA 2NV3A 3TAQA 4F2SA 3VC8A 3VK8A 1L5UA 2XZUA 3KVWA 2NO5A 4MHVA 4M9HA 3N7PD 2UVRA 3QU9A 3IG8A 2DF4B 4QZIA 2JZBB 1KW4A 4B9NA 1ZQZA 5ALOA 4B9SA 1RYSA 1JX4A 4II7A 3TARA 4MM3B 1HUOA 3GLGE 2KNAA 3QZ8A 1E9SA 4RQ8A 1ZQNA 4D81A 3H7IA 5J8YA 4ECYA 1Q46A 2OHFA 5ITXA 4J03A 3I51A 1ZD5A 2J5YA 3T5HA 4KLTA 5L1IA 4FZLA 5KFLA 4IRDA 1QTMA 9ICSA 3TE6A 2EAPA 3B0XA 5IREB 1V9PA 4UB1A 4TUQA 3WKDA 2FPKA 3GPUA 1O08A 8ICUA 2AHOB 5DNYA 5LMNM 4I2GA 4DSKA 4PZNA 3L3FX 2XSZD 1JRPA 1JR3A 3JPTA 1L3UA 3FRHA 2JZ0A 1N33M 4RQ4A 5KG2A 4C7YA 5DBCA 1SWWA 4AKIA 1NY5A 2LPEA 1DGSA 3R8FA 2F5PA 5A0LA 3PX0A 2DZOB 4GC6A 5IILA 2YMPA 5ALXA 5HMLA 3C5FA 2P5TA 1L8LA 4LY6A 4P0PB 2DGZA 1IXSA 3M9OB 2YTUA 5AI5A 3GLGB 2KTQA 1SXJB 1QZMA 4G6ZA 2L7IA 3CYMA 4EYHB 2PFPA 5F3XB 4EZ9A 4RQ6A 4QJFB 1PM5A 3NTUA 3PO4A 4J9PA 2K8CB 1QANA 1D0KA 4LFAM 4AYBC 3PXGA 3KHGA 2BCUA 4HYKA 4BLCA 1ZQIA 3VK7A 9ICPA 1IQPA 4DL6A 7ICGA 8ICBA 7ICUA 3AQFA 4ANRA 3IHQB 3BBZA 3NBIA 5HNKA 2BPGA 3AJIB 2D3DA 3ETLA 5KFTA 1WCLA 3UGJA 1ZQCA 5KTQA 4K4GA 1XMOM 2DNAA 4P4OA 2IA6A 2NO4A 5ALUA 3MMPA 4IBDA 2LVNC 5E26A 1YT3A 2VQEM 3B9PA 3GPYA 2LVPC 1R5LA 4LGYA 1T94A 3BOSA 1IN7A 4M0WA 2ZUDA 4QW9A 1KFTA 1Y8GA 4LJAA 1QQ7A 4CF5A 2F44A 3THVA 2BWEA 7ICEA 4BXOB 4NY8A 1X9WA 1ZETA 2CPRA 2C2RA 3PVSA 2R6FA 1K3XA 5L1MA 1IN6A 5FTJA 5KT2A 5ITRA 4DQIA 2A3VA 8ICIA 5KFMA 2QB1A 4MEXA 5ALZA 1SL0A 1ZQGA 4J9SA 4C0ZA 5D4BA 1S8OA 1RG6A 4CRXA 1HNXM 3KS8A 4QZCA 4K4IA 1JR3D 2AU0A 4IQUA 3HHZA 3WKBA 5JRTA 2VJ4A 1GJSA 1XXHA 1ZQLA 3PR5B 3T1YM 3VDPA 1ZD3A 4LJ4A 3DEEA 3RGPA 2F1HA 5ALFA 2L6OA 5AI4A 1DGJA 2BZFA 4FWGA 3HJEA 4EBEA 4I2EA 4Y2VA 3N7RC 4YCXA 1TR8A 4NL9C 1HQCA 2FMSA 1Q8KA 2M60A 3TADA 2L7HA 5H2FU 3IG5A 4DBGB 1DO0A 2D8CA 4I2FA 9ICAA 1T3TA 3DA1A 2KK0A 3RJGA 4UB6U 1LVHA 2PXIA 1NSFA 5FTNA 2W54A 4PL1A 1D9DA 4IBBA 1RQNA 5EQTA 4UB8U 1SKRA 1OAIA 2YMQA 1BVSA 2HBJA 5ALVA 3FYDA 1KEJA 1NKCA 2KOBA 4M6WA 1SXJC 3L28A 1WWUA 4O3RA 1S3SA 4DR1M 1UA1A 4JI1M 1SIJA 3ZDBA 1NNLA 4RUAA 3F2DA 1Q02A 4DFPA 1JR3E 2KZZA 3L29A 2PI5A 4Y2PA 2R0IA 4JI0M 2E1FA 3QXGA 8ICEA 2DKZA 3RB0A 3QYPA 1JROA 4M2YA 1QAQA 5ALLA 2DAIA 3HHWA 4OJ6A 4GXIA 2Y21A 2ZIVA 3A42A 1Q39A 4JI3M 3QZ7A 5KFHA 4IBKA 4Q7JA 3SBJA 1HNWM 5KFVA 2PFOA 5J0RA 2C98A 4Y2QA 2F8KA 4JI6M 1KFVA 4KX3A 3RFWA 5FLXS 2LI6A 2KJ9A 5AM5A 2QHOB 3U5ZB 2UUAM 3F5EA 4G4OA 1B43A 2X8AA 4QZ8A 2OM6A 1L6NA 4B9MA 4I8OA 2PI4A 4KLJA 3HWSA 1PZNA 1COKA 2A1AA 4IBEA
chains in the Genus database with same CATH topology
4DV5M 2G5HB 1Q3VA 3J81S 3VKGA 3T15A 1A0PA 3Q8XA 1XNSA 2J7NA 2V6ZM 2QZ4A 3AOEC 4JI2M 4FZNA 2WB1C 4OVZB 2KHVA 4M9XA 3GLHB 3ZC7B 1IBLM 2XI9A 2XGNA 2F4VM 1HIWA 4P0PA 2L09A 3SHGB 5ITQA 2LNHC 3HU2A 4LJ8A 3D8LA 2CN1A 4MGKE 4X62M 1IXSB 3LVWA 3M6ZA 4TUWA 2VIIA 4LJ7A 4LRTA 2Z7JA 4DR3M 3U61A 5BPVA 3MGVA 1QQWA 2YB4A 4LF8M 2ZAMA 4JXJA 2C9CA 2OPFA 1H6UA 4JN6A 2F5SA 5IT9S 1N36M 1TDHA 3PNYA 1Q3CA 2VJ5A 1K3WA 3H0MB 3C29A 2KEBA 1OFHA 3FUTA 4M0DA 3E4RA 4A3VB 2O5RA 2FOIC 2XH9A 1IY1A 5KQ8A 3FD9A 1NJGA 5F3WA 3GU3A 2LHTA 2EA0A 1YSYA 2W03A 3ILKA 2G8LA 1D2NA 3A45A 2RGHA 2K4IA 3ICXA 3CTWB 1ZQ1C 3M0EA 2QCUA 2H1RA 2W04A 2KXEA 1HNZM 2JGAA 3U6SA 4MB7A 4LF6M 3VLFB 4GHAA 3GRUA 4G4NA 1IIPA 2XVTA 2JH7A 3KSXA 4R3DA 1DO2A 3M6KA 3FUWA 2DWLA 1TDZA 3I4VA 3M6AA 4JI5M 3CF0A 4LJ5A 3R9XB 3U6QA 2WAQC 4CGYB 4DR7M 4AG6A 3GPXA 2LBOA 3GP1A 2ZANA 3GLIB 3GQ4A 3EIHA 1GL6A 2Y0TA 2R46A 2RGOA 3PFIA 1Z5CA 3MK6A 3UJNA 5ITTA 3AOGA 3IP4B 4ICAA 2KV2A 4AW4A 5EXXA 2K4EA 1G4AE 2KRUA 3SAFA 5C18A 4DV7M 2UXDM 3U5ZA 2Z4RA 2A5YB 2EUCA 4GMQA 4HL4A 2KKVA 3U6MA 2F5NA 4OJPA 2I7PA 3AL0C 3GLFA 3TL4X 2DXIA 4I4LA 2GH1A 3D2QA 4U6PA 3CRXA 1WUDA 2OQ4A 2W82A 2ZIUA 4CDGA 3SAVA 1NNUC 1MU5A 1ECWA 3VFDA 4B08A 1Z1BA 2YB1A 1IY0A 2DZNB 1IN8A 4MH0E 3J2PB 2F2AB 5DYGA 4MGIE 5FTKA 2H3IA 4IJFA 4M9SA 5FTLA 4OU7A 1IBKM 4BUGA 2LXEA 3KFUF 3CF2A 3H0RB 2HOQA 4FCVA 4G4RA 4XGIA 1UPHA 4DUZM 4KHPM 3F5AA 4BJQA 1IM2A 3U6PA 2DHRA 5IZ7D 2HBKA 2LYAA 1JQJC 2C99A 3SARA 1HT1E 1F44A 1XO0A 3ALRA 2G0AA 4WJ3B 4CGZA 2PMZC 1OUQA 3PNVA 4DR4M 3GPPA 2R4JA 1L8QA 2KD1A 3DFZA 3AFHA 3QAUA 1G59A 1G8PA 1NVMA 2LWXA 4I81A 2CV1A 4LFBM 4DV2M 2BJVA 1L1ZA 2E5SA 4LFCM 2CV2A 1SXJE 3HHYA 3SFZA 2OXOA 3SHFA 1GVNA 3GQ3A 4WURA 2XIDA 1J5EM 1HR0M 1D8BA 3AL0B 2OYYA 3CF6E 2VQFM 2FE8A 2CHQA 2JH1A 3KDSE 4EIWA 1K82A 4QIWC 1Z19A 3HJSA 1DGGA 1R6BX 5KQDA 2UUCM 3SC3A 2ZIWB 2G08A 2DVWB 1HEKA 4ACOA 5FSWA 3AQEA 3L27A 2KZUA 3ZH9B 4DR2M 4YHHM 1N78A 3T79A 4L4UA 1NZBA 1QVRA 3HKPA 3N7SC 3U60A 3UZUA 1YUBA 2CUZA 4L16A 4KMOB 5T14A 1WXQA 1PVQA 4B3MM 1Z6TA 4PDIA 2Q2EB 1YE9A 2WAQF 3C28A 3W0FA 3NUQA 2CV0A 4ITQA 1TH4A 2N1RA 1NHWC 2DWZB 3A98B 3FKEA 2MRLA 1MA7A 2F8LA 2KKPA 3AOEA 1IXRC 4RF1A 3A46A 2K47A 4BB9A 4MGZE 3HKZC 3SAGA 3NWLA 4MGYE 3PSFA 4U7CA 3KOYE 1P7DA 3GLFB 2RRDA 2YR0A 2LH0A 4B3SM 4GKKM 4B7FA 2K8BB 4DV4M 2Q4TA 3LQRA 4OJOA 3GRRA 1OJLA 2DWMA 3K92A 4PL2A 1QAOA 2Z4SA 2ZIVB 2V1CA 4NXMM 4FZMA 2E5LM 3MJ5A 1PJJA 1XHBA 2UU9M 1DGHB 5H37D 5BR8M 1QAMA 3M7GA 3HJQA 1J09A 1HQYE 4IJEA 1Q3BA 2HOFA 3LMMA 3U6EA 1W5TA 3J27B 2NQ8C 2Y0SF 2PMZF 2HBLA 2CRXA 3U6DA 2CHGA 2R62A 3HGIA 2Y0QA 5EXPA 3HHXA 1NNJA 4NLBA 2CFOA 2HCBA 4IIWA 1TH2A 1G3IA 4KLNA 3K1JA 3SAUA 5EP3A 1L2BA 4LF9M 5JI2E 1GO3F 1E32A 2YFQA 4Z8XA 3UK6A 5KPTA 2BNKA 2GOLA 2NV3A 3WHLA 4WW0A 3J7AS 2JMGA 3VC8A 3VK8A 2G5IB 2XZUA 4OW0A 3H0LB 3OTOM 1HT2E 2ZXIA 3KVWA 1TAMA 2HHHM 3VCBA 3U6OA 3L25A 3VDUA 3N7PD 2C96A 2XSZA 3IG8A 4CISA 2DF4B 1Z5AA 1J7KA 1XMQM 4IBCA 2CEAA 2YNMD 3KOXE 3HU1A 4II7A 4DUYM 4QNLA 2W7OA 1KSFX 4MM3B 2D7EA 2KJ5A 1XXHB 2RP5A 5ITUA 1L2DA 3LYSA 2ZM6M 1KBUA 1E9SA 4DR6M 4X64M 4D81A 3F2CA 3J80S 2ZAOA 1XNRM 4B3RM 5DYIA 2CHVA 3GQ5A 5EP4A 2E1EA 5ITXA 4GH9A 2UXCM 3I51A 1CRXA 1E94E 1DGBA 5LMUM 5KPZA 4IBFA 5EXTA 4PDGA 1XC8A 4FZLA 2XEPA 3TE6A 4L8RC 5IREB 1NY6A 4FWHA 4P0QA 3L2AA 4ZPXA 1GLNA 5HR6A 4REZA 1IXZA 2KEYA 3GPUA 4GFJA 3SYKA 2H3FA 3J7BA 5DNYA 2D6FC 4HLQA 4BBAA 5LMNM 3L26A 3L3FX 4DV0M 2UXBM 1DGFA 2XSZD 2KVCA 2ZIXA 2AHMA 1JR3A 2XLJA 4R7GA 3U6LA 1TGUA 4Z6YA 1N33M 1I94M 1ORYB 4M9ZA 4OJLA 4NL4H 3TWMA 3EIEA 4GHLA 3GRYA 3JR5A 4KODA 2D7GA 4PD2A 3GO8A 1PJIA 1EE8A 8CATA 3FUUA 1NY5A 4AKIA 4NSOB 3R8FA 2F5PA 3TWLA 3DZDA 1UM8A 4L15A 5A0LA 2F5OA 4NXNM 3FTEA 3TQSA 4RNAA 2DZOB 2H3ZA 3KOWE 4LG2A 2ZXHA 5KL8B 3PZPA 4FCWA 2P5TA 4P0QB 4YY3M 3NRWA 4LY6A 4P0PB 4JI4M 4PT5A 4I5SA 3AV0A 2JHDA 2HKJA 2ZIUB 2DGZA 2JA2A 1URJA 4K0KM 4IC9A 1NHGC 1VDDA 3THGA 4NWIA 3U61B 3GLGB 1SXJB 1QZMA 1G41A 2EO2A 4GRIA 4G6ZA 2L7IA 3CYMA 5C0YA 2R4EA 4QNRA 5KPRA 2KW0A 2K89A 1N32M 3UMMA 1PM5A 3KP1E 4QJFB 2HOIA 4NV0A 2K8CB 1QANA 4LFAM 4AYBC 3PXGA 4DV3M 4BLCA 3VK7A 4GC5A 2FNAA 2Z3XA 4OJ5A 1IQPA 1TH3A 1Z5BA 3AKZA 3H4MA 3AQFA 4FWDA 1GL7A 3KW6A 4NRVA 2R65A 2VIXA 1QYRA 4B7GA 1W5SA 1PVPA 3NBIA 5GKNA 2G5GX 3RF9A 3AJIB 1FNNA 1FJGM 3U6CA 3KFUG 4JMUA 1ZAEA 3F2BA 3W0LB 3K8ZA 2R18A 3UGJA 1N75A 4QOZC 4JV5M 1XMOM 2BDUA 3K1ZA 3KP0E 3KOZE 3C58A 2R45A 4IBDA 5KL1B 1YT3A 5E26A 1XWIA 2FFJA 3GLHA 3T1HM 2VQEM 3B9PA 3SMPA 3GPYA 2HMXA 2KJ8A 5HR7A 3ZCBB 4D82A 2YQZA 1N34M 1IN4A 4LGYA 4JI8M 4GKJM 5EXSA 1T94A 4NSRA 2C9OA 2X49A 2ERCA 4IBIA 3BOSA 4X66M 2RHFA 3O0FA 1IN7A 5FTMA 4M0WA 2H3VA 2K8AA 4AKHA 2MA1A 4LJAA 2ZIXB 4S12A 3WHKA 3RFAA 2W7PA 2KHQA 2G07A 4KX5A 1GKIA 2OH2A 1IY2A 2CPRA 1Z59A 1E9RA 3PVSA 3E0FA 4AZFA 4FVMA 1K3XA 2QBYA 3CP8A 4LCBA 4D80A 1IN6A 4MGHA 5FTJA 2XF3A 5IWAM 1OFIA 3QWLA 4B7HA 3SASA 5ITRA 2DQNB 4KO8A 3T38A 4CHTB 5KO3A 2RKOA 2A3VA 4DR5M 2M0NA 2KRKA 3KZXA 4QIWF 4FD2A 1KYIA 4C0ZA 5A2QS 1L1TA 3SAWA 4A8EA 4CRXA 4IBGA 1SZHA 1HNXM 2F76X 3KS8A 3RE8A 3GRVA 4LGMA 3KXEC 4XBOA 1JR3D 4OO1J 3HHZA 5CRXA 2I7NA 1N77A 1SXJA 2VJ4A 1XXHA 5EJCA 4NOOB 3T1YM 3VDPA 3DEEA 4LJ4A 3RGPA 3FTDA 2UUBM 2J7OA 2VKQA 2L6OA 1ED1A 4AYBF 4LZZA 4LF5M 3SYLA 2QBYB 2XICA 4FWGA 5EP2A 3GLIA 4GC9A 2F5QA 4JI7M 3SQIA 2V1UA 4AI6A 2KNJA 3LVVA 3N7RC 4BX9C 5C1BA 4DV6M 1HQCA 3FYCA 2G06A 2M60A 2L7HA 2KA6B 3HKZF 2D7HA 3IG5A 1DO0A 2KZSA 1T3TA 3DA1A 1IN5A 3SMVA 1NSFA 5FTNA 3GZFA 1DRGA 4PL1A 4IBBA 2LYBA 3JR4A 4FW9A 5EQTA 3IN5A 2H3QA 3U60B 3FUVA 3HU3A 2HBJA 2KIWA 3F53A 3FYDA 2F77X 2HL7A 3JAMS 4P16A 1R2YA 3VKHA 1A6SA 1IBMM 3SATA 3HJ8A 3D8BA 2KICA 2KOBA 4LJ9A 1C1KA 4QHTA 1XNQM 4G4QA 2HBMA 3PSTA 1SXJC 4GITA 2QPAA 3L28A 3E9SA 2QP9X 2X4AA 3PSPA 1S3SA 4DR1M 2ZBKB 5ITYA 1Q3UA 4LZJA 3SAHA 4O3MA 2XFTA 4JI1M 1NJFA 3F2DA 1I4WA 3L29A 3TWKA 1X37A 4RF0A 4B3TM 1PVRA 2G09A 4JI0M 2CE7A 3I4YA 2C5RA 4AKGA 2E1FA 2ZG6A 3ONNA 4PCZA 2BJWA 5JI3E 3DOAA 1QAQA 5E6JA 2XZFA 3PSIA 1SXJD 1R7RA 5EP1A 3D2SA 3GLGA 3KS4A 3HHWA 4OJ6A 2Y21A 4NRWA 4X65M 2ZIVA 3A42A 1Q39A 4JI3M 4FCTA 4LRSA 2M5ZA 4AQYM 4IBKA 3SBJA 1HNWM 4OVZA 2C98A 1DGHA 2YX8A 1ZQ9A 1L2CA 4AG5A 4JI6M 2LKYA 5ITXE 4LF4M 1MX0A 4GIPA 3TPZA 1KFVA 4NLCA 3D2NA 3RGSA 4OX9M 2ZIWA 4KX3A 3RFWA 5FLXS 4QHSA 2DWNA 7CATA 3FTFA 3M7DA 3MHVC 2KJ9A 4FE3A 4QNMA 2QENA 3K2LA 3FUXA 3U5ZB 2UUAM 3F5EA 4G4OA 1LV7A 4L78A 2WB1F 4JYAM 1R2ZA 4LF7M 2Y20A 2X8AA 3FTCA 4QOSA 4W5WA 2OM6A 3LQQA 1L6NA 4I8OA 3SMSA 4DV1M 2XFSA 2K4HA 4IBJA 4LJ6A 3HWSA 3KSJA 3OPXA 4IBEA 2Y0SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R18 A;  2Z7J A; 
#chains in the Genus database with same CATH topology
 3TAN A;  3VKG A;  3T15 A;  1XNS A;  9ICC A;  2J7N A;  1ARO P;  2QZ4 A;  4JI2 M;  2FPM A;  1N5X A;  4M9X A;  1IBL M;  2XGN A;  1X9S A;  1RZT A;  2F4V M;  3TFS A;  5F9L A;  2K60 A;  2B6G A;  2LNH C;  5ALT A;  3GV7 B;  3HT3 A;  4MGK E;  5BOM A;  4X62 M;  2BCV A;  1SG9 A;  3H8S A;  5DB9 A;  2Z8Y M;  2V9W A;  1COO A;  5KFB A;  4QZA A;  1PJT A;  5DBB A;  2VF8 A;  4DFJ A;  4IQT A;  1X66 A;  3HP6 A;  2OWO A;  1KSP A;  1QDT A;  2C9C A;  4JN6 A;  2OPF A;  3H0M B;  4YMN A;  8ICV A;  3B7Z A;  3FUT A;  5J0O A;  1ZQB A;  2XH9 A;  1ZRM A;  4ECW A;  3FD9 A;  1NZP A;  4JWM A;  1YSY A;  2DPI A;  5GTH U;  1JB0 F;  1QZE A;  1QUS A;  2KN7 A;  2H1R A;  2ZUC A;  4GHA A;  1UT5 A;  3GRU A;  3RH5 A;  4G4N A;  1MC8 A;  4YQW A;  4LVS A;  4DL7 A;  2JH7 A;  2K4P A;  1ZD4 A;  4DLG A;  1DO2 A;  2KE7 A;  3FUW A;  4RNM A;  1SWV A;  8ICL A;  4IRC A;  3R9X B;  4RNN A;  3U6Q A;  4DR7 M;  4YMO A;  3GPX A;  1ZRN A;  3GP1 A;  3FAH A;  3GQ4 A;  1GL6 A;  2Y0T A;  2R46 A;  1Z5C A;  4YXM A;  4FBT A;  3AOG A;  4O5C A;  2KV2 A;  1SKW A;  5HHH A;  5KFZ A;  3QYE A;  1RM6 C;  2OO9 A;  4HL4 A;  1DV0 A;  3UMB A;  4Y2T A;  2MUT B;  5EE1 A;  4KIT B;  3SAV A;  3BS5 A;  1NNU C;  1MU5 A;  3B9J A;  1L3S A;  3HRD D;  3H4D A;  4ELT A;  5KAI U;  2ZJA A;  1V85 A;  4NM2 A;  2DFL A;  1IY0 A;  1WJ7 A;  2DZN B;  2F2A B;  5DYG A;  5FTK A;  4NLN A;  2LXE A;  7ICT A;  3CF2 A;  3H0R B;  2AJQ A;  4UAR A;  1D0L A;  1DK2 A;  3BQT A;  1HT1 E;  3J81 j;  1XO0 A;  5AKY A;  4NM1 A;  4WJ3 B;  3BXW A;  1RYR A;  4PHD A;  2EAM A;  5CB1 A;  3S6J A;  4EEK A;  2EKF A;  2CV1 A;  4LFB M;  4DV2 M;  3NS1 A;  1L1Z A;  4PHA A;  1SXJ E;  2OXO A;  5L9X A;  3GQ3 A;  2XID A;  8ICO A;  1D0M A;  3AL0 B;  2ALZ A;  3SYZ A;  3BQ1 A;  2N35 A;  2GO7 A;  4O3Q A;  5J2G A;  4LJX A;  1JI7 A;  3U26 A;  4J9Q A;  4ED6 A;  1A5T A;  1Z19 A;  1ZQM A;  2JZB A;  2UUC M;  2UVU A;  2FI1 A;  1GAB A;  2ESE A;  3HWT A;  4ACO A;  2JEG A;  2KZU A;  4DR2 M;  1N78 A;  5T14 A;  3U60 A;  3UZU A;  9ICN A;  1UCV A;  5AI6 A;  4B3M M;  5J2F A;  3OHB A;  2I6X A;  4I2A A;  4R65 A;  3GV5 B;  5AI0 A;  4G3O A;  2EZZ A;  3V7J A;  3E58 A;  2JEF A;  1X2I A;  1TH4 A;  3MR2 A;  2HWJ A;  3RB6 A;  1NHW C;  2MRL A;  2LBC A;  3TI0 A;  1MA7 A;  2F8L A;  2FMQ A;  1AIP C;  3MGH A;  3R9K A;  2HHX A;  4MGZ E;  1X6I A;  2RQ5 A;  5AM2 A;  3LK9 A;  3N4M B;  2AGQ A;  4MFC A;  1RDF A;  3KKA A;  1JMS A;  2RRD A;  2JEJ A;  3KHH A;  2ASJ A;  2Q4T A;  4FO6 A;  2KNV A;  5L8R F;  1YZ6 A;  3K92 A;  3ISC A;  4PL2 A;  4M9G A;  1OXJ A;  1F0M A;  3QEA Z;  2V1C A;  4P17 A;  3PW0 A;  5J0Y A;  2QB0 B;  1NK7 A;  3RH6 A;  2KHH A;  4RPZ A;  5J0P A;  1QAM A;  5DG7 A;  4Y2Y A;  4TUP A;  3H4B A;  2R8G A;  2HOF A;  3U6E A;  1NKE A;  4XRH A;  4DWI A;  3J27 B;  4RNO A;  2W9M A;  3KZI U;  5EE0 A;  4IRK A;  2HBL A;  1TTE A;  4RQ0 A;  5EXP A;  2HCB A;  4I27 A;  8ICT A;  5JUM A;  2HVH A;  1G3I A;  4JV2 A;  4DL4 A;  1GO3 F;  1E32 A;  2ISO A;  4Z6C A;  2BPC A;  1A77 A;  3QUC A;  3J7A S;  5ALH A;  3AMZ A;  5J0U A;  8ICW A;  1CUK A;  1OKS A;  4OW0 A;  3OTO M;  4ED8 A;  2HHH M;  2K9D A;  3U6O A;  3L25 A;  3RJK A;  4F4W A;  2CRU A;  1VDL A;  1Z5A A;  1PK3 A;  2JZ1 A;  1XMQ M;  4QNL A;  3N97 B;  1NK9 A;  2D7E A;  3BZC A;  1XXH B;  3EUB 2;  3GIM A;  1ZJM A;  3PV8 A;  1L2D A;  3UMC A;  2Y9T A;  4TUR A;  3LYS A;  5DB7 A;  4O3P A;  2MGW A;  4UW9 A;  5C5J A;  4DR6 M;  9ICK A;  3HW8 A;  3QUT A;  4K4H A;  2H5X A;  3PMN A;  4C8K A;  5DYI A;  3RTV A;  1ZMV A;  5EP4 A;  1CRX A;  3FM9 A;  2F3N A;  1E94 E;  3ED5 A;  4IBF A;  5ALW A;  1MSW D;  2XEP A;  2KSO B;  3WK5 A;  4L8R C;  1AUA A;  4ECZ A;  1NY6 A;  4F1I A;  4G3I A;  3CNH A;  4P0Q A;  1GLN A;  1IXZ A;  2KEY A;  2MRO B;  1NKB A;  4ECV A;  4HLQ A;  2FE9 A;  1IV8 A;  3L26 A;  2A1J A;  1ZQX A;  3GQC A;  5J2K A;  5CEH A;  4I2J A;  5CP2 A;  4M9J A;  3RJH A;  4R7G A;  3C5G A;  1TGU A;  1I94 M;  2QLT A;  3TWM A;  3EIE A;  1PK1 B;  1B0X A;  3JR5 A;  4KOD A;  2P35 A;  1O03 A;  4PD2 A;  4I2I A;  5ALY A;  5L1J A;  1N62 A;  5DG8 A;  4NSO B;  2W8L A;  3TQS A;  1LV5 A;  3UXN A;  2LVQ D;  2LHG A;  2JY7 A;  3TKA A;  3RRH A;  2BCR A;  4P0Q B;  4GXK A;  4PT5 A;  3H8W A;  1V34 A;  5III A;  2XY6 A;  2JHD A;  3MDC A;  4F5R A;  2ZIU B;  1URJ A;  4IC9 A;  1NHG C;  3U61 B;  1DOQ A;  4DF8 A;  2EO2 A;  5EE3 A;  1YZ7 A;  5C0Y A;  2I9G A;  2KW0 A;  4IR9 A;  2HOI A;  3KHR A;  3RBE A;  1Z4N A;  4KMU A;  3MAB A;  4F5Q A;  4DV3 M;  5KFA A;  2FS1 A;  4CE6 A;  2FNA A;  2Z3X A;  4OJ5 A;  4RT3 A;  3RJF A;  5J2C A;  1QYR A;  1PVP A;  5GKN A;  4I2H A;  3RF9 A;  3W68 A;  1FJG M;  4ED1 A;  4C8N A;  3W67 A;  4M47 A;  1ZQD A;  3QUQ A;  2ZUB A;  4YMM A;  4JV5 M;  2E8O A;  2AQ4 A;  4J9N A;  2R45 A;  3MBY A;  1XWI A;  3SMP A;  2XO7 A;  4JI8 M;  3LDA A;  5EXS A;  5AKZ A;  2RHF A;  2HVI A;  1L8O A;  4AKH A;  2MA1 A;  2B21 A;  3WHK A;  2W7P A;  2KHQ A;  4US8 A;  2NYV A;  1IY2 A;  7ICJ A;  3QU2 A;  4FVM A;  3HX0 A;  3CP8 A;  4DLE A;  1PUZ A;  2HSZ A;  4MGH A;  5IWA M;  2W9B A;  3QWL A;  3T38 A;  4F4X A;  3T5L A;  2YMM A;  4DR5 M;  2EJS A;  2KRK A;  3I28 A;  5AKX A;  4QIW F;  2P66 A;  1KYI A;  1V92 A;  1JAL A;  3WU2 U;  3HPO A;  4Z6E A;  2F76 X;  2JY8 A;  4LGM A;  4KLI A;  3KXE C;  4XBO A;  5CWR A;  4OO1 J;  5CRX A;  4PZO A;  5EJC A;  5J2H A;  4F71 A;  4EEL A;  2UUB M;  3RB4 A;  2J7O A;  1NK5 A;  3C2M A;  4AYB F;  5KFI A;  3IRU A;  4YFK A;  4JI7 M;  4GC9 A;  4KLM A;  2W9B B;  3SQI A;  4L6V 6;  4AI6 A;  5FP0 A;  1U49 A;  3LVV A;  4DV6 M;  1ZQJ A;  2UVV A;  3LCV B;  3FYC A;  2XY5 A;  2G06 A;  2E8M A;  5DB6 A;  2EKK A;  2GQF A;  2KA6 B;  4TUS A;  3HKZ F;  2KZS A;  2CP8 A;  4I2C A;  1HUZ A;  1IN5 A;  1IXR A;  3DV9 A;  4CCH A;  1BPZ A;  5AKE A;  3PML A;  3BS7 A;  3IN5 A;  1N60 A;  3HU3 A;  3F53 A;  5DKW A;  2F77 X;  3B7N A;  2YQE A;  3VKH A;  8ICN A;  1IBM M;  1A6S A;  3SAT A;  3D8B A;  2QQ8 A;  4LJ9 A;  4QHT A;  4Y28 F;  3NVW A;  8ICH A;  2XC9 A;  4IQV A;  5KT6 A;  4LZJ A;  1Q3U A;  3GDX A;  1I4W A;  3C9P A;  2L5Y A;  1SV4 A;  3GFK B;  4F4Z A;  4F5O A;  2PFN A;  4RF0 A;  1QQ6 A;  2JRZ A;  4C7Z A;  3I4Y A;  2C5R A;  3ONN A;  1H38 A;  4ELV A;  4PCZ A;  4BWJ A;  3M8S A;  4IL6 U;  1QQ5 A;  3DOA A;  2JUJ A;  9ICJ A;  2XZF A;  2W3R A;  3D2S A;  2FLP A;  1N2X A;  3KS4 A;  2EDU A;  5DB8 A;  4NRW A;  5AI8 A;  2Y1I A;  2NRX A;  2C2D A;  2M5Z A;  3RJE A;  1DGH A;  2LTU A;  1L2C A;  4AG5 A;  3UMG A;  4NLZ A;  3TPZ A;  1YLA A;  3RGS A;  3BQ0 A;  7ICQ A;  3FTF A;  7CAT A;  1Z3E B;  4GIB A;  3MHV C;  4QNM A;  3FUX A;  4OD0 A;  1LV7 A;  4L78 A;  2WB1 F;  4JYA M;  4KLG A;  4NJ8 A;  3FRI A;  3K4G A;  4QOS A;  3MR5 A;  4B6J A;  3LQQ A;  5AKJ A;  4DV1 M;  3SMS A;  3PW4 A;  2XFS A;  2K4H A;  4IBJ A;  5AKK A;  4J9L A;  3FDS A;  2Y0S C;  4DV5 M;  1Q3V A;  4DSI A;  1A0P A;  7ICV A;  5J2I A;  2V6Z M;  5AKL A;  9ICB A;  1ZQK A;  2KHV A;  1N63 A;  3GLH B;  3NVV A;  2WSE F;  1HIW A;  1SV0 A;  3OSP A;  4HEO A;  4P0P A;  3SHG B;  4O3N A;  3ZDA A;  4UBC A;  3H40 A;  3HU2 A;  1IM4 A;  5KFK A;  1ZQA A;  3M6Z A;  1IXS B;  1KRP A;  4TUW A;  4CF3 A;  1EIJ A;  4DR3 M;  4F4K A;  2HHS A;  1QSL A;  1QQW A;  2J6U A;  5J2D A;  4JXJ A;  5TZV A;  5IT9 S;  3K1R B;  1H6U A;  3MR3 A;  2HHQ A;  1TDH A;  3PNY A;  1K3W A;  1OFH A;  4M0D A;  1IY1 A;  3KTQ A;  3GU3 A;  3UQ2 A;  1WCN A;  3C3D A;  1D2N A;  1NK8 A;  1ZQ1 C;  2KIV A;  5KFF A;  2JXJ A;  5DLF A;  3QU5 A;  2OEH A;  4LF6 M;  1NK6 A;  1IIP A;  8ICC A;  1NV9 A;  4USA A;  5AI9 A;  2DPJ A;  3KSX A;  4R3D A;  3M6K A;  5J0X A;  3M6A A;  5E79 U;  4LJ5 A;  4NXZ A;  4CGY B;  4YD2 A;  3GLI B;  2DWQ A;  5DDY A;  1NOM A;  3FC4 A;  4ICA A;  2Y9U A;  3C1Y A;  3KKA C;  3L4P A;  3BQ2 A;  5KFS A;  2KRU A;  2ZJ5 A;  1KN5 A;  2AQ0 A;  3SAF A;  2UXD M;  2A5Y B;  3U6M A;  4OJP A;  4NL9 A;  2EQY A;  4U6P A;  1WGL A;  1WHC A;  2W82 A;  4DQP A;  2ISP A;  1BNO A;  2AXT U;  4YR3 A;  5IIN A;  2MAX A;  4B08 A;  1Z1B A;  2YB1 A;  1XU4 A;  2QB0 A;  2MR9 A;  2H3I A;  9ICE A;  2IHN A;  4M9S A;  4OU7 A;  3KFU F;  2HOQ A;  4UAW A;  1S10 A;  1OTR A;  4GXJ A;  1BPE A;  4DUZ M;  1A76 A;  1QSY A;  4MFA A;  1IM2 A;  1BPY A;  2HBK A;  3SEN A;  2DI0 A;  2LYA A;  4KLD A;  1JQJ C;  3SAR A;  3H8J A;  3QNM A;  4C8O A;  2PMZ C;  4RT2 A;  3PX6 A;  1Y88 A;  2AGO A;  1WGN A;  2B3T A;  2KD1 A;  3AFH A;  3D6J A;  5DGA A;  1G8P A;  4I81 A;  4DOB A;  3PW5 A;  1NI3 A;  1K1Q A;  1PK1 A;  3M1Y A;  8ICM A;  4LFC M;  4MF2 A;  2RRU A;  1N48 A;  5L1K A;  2XY7 A;  4WUR A;  1D8B A;  2OYY A;  4ECU A;  2FE8 A;  4UB3 A;  2CHQ A;  2JH1 A;  4EEN A;  7ICN A;  5KQD A;  1WG8 A;  2G08 A;  5FSW A;  4I29 A;  2DAM A;  3L27 A;  3ZH9 B;  1TF0 B;  4UB5 A;  3T79 A;  4L4U A;  3Q8S B;  3HKP A;  1YUB A;  4L16 A;  5CR0 A;  4P4M A;  7ICM A;  5AIB A;  2GNO A;  1Z6T A;  4PDI A;  3RR7 A;  2I1Q A;  3W0F A;  1XWL A;  3NUQ A;  4M6W B;  3PNC A;  4ITQ A;  2EH9 A;  4KLQ A;  3FKE A;  1M6Y A;  2KKP A;  4UAU A;  4QWD A;  2KSO A;  1V38 A;  1V33 A;  2IOH A;  2G3Q A;  2K47 A;  4BB9 A;  1ZQV A;  3NWL A;  1P7D A;  3GLF B;  1WYG A;  3UPQ A;  2YR0 A;  2WF6 A;  4B3S M;  4GKK M;  4B7F A;  4DV4 M;  3NRZ A;  1OJL A;  4UB2 A;  4DO9 A;  1QAO A;  2Z4S A;  9ICH A;  2ZIV B;  5DGB A;  4NXM M;  4RPX A;  3MJ5 A;  2BPF A;  3RAQ A;  2BGW A;  3M7G A;  1J09 A;  4F92 B;  2R8H A;  4IJE A;  2WSF F;  3C2L A;  3LMM A;  1S9F A;  2LMR A;  3PW7 A;  2EZY A;  2NQ8 C;  1QUT A;  3U6D A;  1U45 A;  2Y0Q A;  3HHX A;  2CFO A;  1S0M A;  4IIW A;  8ICF A;  1L2B A;  3SR6 A;  1NK0 A;  2YFQ A;  3UK6 A;  5ALR A;  2BNK A;  5ALQ A;  1JXL A;  4F3O A;  3WHL A;  4WW0 A;  1TAQ A;  3QUB A;  2JMG A;  2NRW A;  3SEI A;  2XGQ A;  2G5I B;  4UB4 A;  3OTQ A;  4MF8 A;  1ZQR A;  4KLU A;  2IOF K;  4DSJ A;  1WIV A;  1ZQQ A;  1TAM A;  5J0Q A;  3VCB A;  4CJ6 A;  5KT4 A;  2C96 A;  2R8I A;  4GC7 A;  1ZXI A;  4DEZ A;  4UAZ A;  2CEA A;  4JK1 A;  2BKE A;  3KOX E;  2W7O A;  3B89 A;  4JV0 A;  3UXP A;  5AKI A;  5ALP A;  1KSF X;  4I28 A;  5ITU A;  4TQR A;  4KLE A;  2ZM6 M;  1QCK A;  3WK6 A;  1KBU A;  4X64 M;  3JPP A;  3SZ2 A;  1IG6 A;  3F2C A;  1MQ2 A;  2ZAO A;  2FMP A;  1XNR M;  2R44 A;  2CHV A;  1J2M A;  3GQ5 A;  2E1E A;  2UXC M;  2ASL A;  2HW3 A;  1KDH A;  1DGB A;  1ZMW A;  5KPZ A;  1FEZ A;  5EXT A;  2WHE A;  5KG3 A;  3NVY A;  1AQ6 A;  5KNI A;  3RJJ A;  1SXD A;  1LKY B;  5AHX A;  1S0V A;  2HHU A;  1BPB A;  3L2A A;  4ZPX A;  2KFN A;  4GFJ A;  1L7M A;  3SYK A;  2LYH A;  2H3F A;  3J7B A;  2D6F C;  4PJ0 U;  2KVC A;  2RLT A;  4KN4 A;  5KT3 A;  4RQ7 A;  3B74 A;  5AM0 A;  2AHM A;  2XLJ A;  3U6L A;  4Z6Y A;  4M9Z A;  4NL4 H;  1JUD A;  3GRY A;  4OCZ A;  2D7G A;  2FPL A;  4R66 A;  3V6J A;  2KG5 A;  1EE8 A;  3C3E A;  8CAT A;  1J97 A;  5IIK A;  3TWL A;  3DZD A;  1D9F A;  4BDP A;  4J9M A;  1UQV A;  3WK8 A;  4M9L A;  4WP2 A;  3PZP A;  2BQU A;  3QYB A;  4YY3 M;  2AH5 A;  2VDB B;  9ICF A;  5AKG A;  1XS9 D;  3AV0 A;  2MUT A;  3EPI A;  2JA2 A;  1VDD A;  3THG A;  4GRI A;  2R4E A;  4QNR A;  2K89 A;  5G5G A;  4QWA A;  3UMM A;  4QW8 A;  3KP1 E;  4NV0 A;  1UFZ A;  2B0C A;  1X42 A;  3MFI A;  5DDM A;  1T43 A;  1Z5B A;  3AKZ A;  3H4M A;  4DS4 A;  2BQR A;  2JY5 A;  5DQH A;  4FWD A;  2NRZ A;  2VIX A;  3KW6 A;  3WKA A;  4J9R A;  3KBB A;  3RR8 A;  5KG5 A;  4B7G A;  4Z6F A;  1W5S A;  2G5G X;  4TQS A;  1SV0 C;  8ICJ A;  7ICH A;  3U6C A;  3KFU G;  1DK3 A;  1ZAE A;  3F2B A;  2ATL A;  5DLG A;  3Q8M A;  1N75 A;  4YXJ A;  3OHA A;  3C58 A;  4PH5 A;  3Q8K A;  3GLH A;  3T1H M;  2HMX A;  4NLG A;  5HR7 A;  3H4J A;  3ZCB B;  4D82 A;  2QKQ A;  1U9L A;  2YQZ A;  1N34 M;  1IN4 A;  4GKJ M;  1XO1 A;  4FS2 A;  4NSR A;  2X49 A;  1FO4 A;  3O0F A;  1Z00 B;  3MR6 A;  1OAO C;  4DL5 A;  5FTM A;  2H3V A;  2EAO A;  2ZIX B;  4FS1 A;  3RFA A;  2G07 A;  4KX5 A;  4M9N A;  5KFR A;  1GKI A;  3SD7 A;  2OH2 A;  1X9M A;  2JY6 B;  3JPR A;  1E9R A;  3E0F A;  4AZF A;  2QBY A;  4QZH A;  4QZG A;  4UQG A;  2WSC F;  1OFI A;  4B7H A;  3SAS A;  1ZMU A;  2YY6 A;  4CHT B;  1RPL A;  2RKO A;  5KG1 A;  1ZQU A;  3EPG A;  1JXE A;  4Q45 A;  1J2N A;  1TK5 A;  5A2Q S;  1L1T A;  1IFY A;  1T8E A;  2CWB A;  4IBG A;  3T3F A;  3GRV A;  8ICR A;  1UT8 A;  1KFS A;  5EWG A;  3JPQ A;  3AN1 A;  4Q8F A;  3WK7 A;  3ZQJ A;  2VKQ A;  1ED1 A;  3GV8 B;  3TFR A;  4LZZ A;  3AU6 A;  4LF5 M;  3SYL A;  2QBY B;  3UM9 A;  2XIC A;  1K5O A;  3GLI A;  5EP2 A;  2LVO C;  3I76 A;  2V1U A;  2MH8 A;  2QNJ A;  3KOO A;  3T5J A;  4Y2S A;  1HJP A;  4EYI B;  1CI4 A;  4R8U A;  3LWM A;  2D7H A;  4YG2 A;  5KFY A;  5J8Y C;  2BHN A;  2NRV A;  4KLF A;  5J2E A;  1X40 A;  1UHU A;  4IR1 A;  1P3Q Q;  3SMV A;  9ICU A;  1JN3 A;  3GZF A;  3F92 A;  4C8M A;  4EEY A;  2O25 A;  3K9O A;  3FUV A;  1RXW A;  2HL7 A;  4UAY A;  4P16 A;  5BOL A;  3HJ8 A;  3V7L A;  3I01 M;  1XNQ M;  4G4Q A;  2HBM A;  4O5K A;  4GIT A;  3V6K A;  4ECX A;  1WR1 B;  5KFO A;  2QP9 X;  2DL0 A;  2X4A A;  3ISB A;  3PSP A;  2BCS A;  2ZBK B;  4O3M A;  4R63 A;  1R4G A;  1NJF A;  1C7Y A;  4ECQ A;  2APL A;  5IIO A;  3H8M A;  4B3T M;  1PVR A;  1ZQT A;  2W11 A;  5KFE A;  5E6J A;  3PSI A;  1SXJ D;  1R7R A;  5EP1 A;  4CF4 A;  3ISD A;  3GII A;  1OIZ A;  4FCT A;  4LRS A;  4F8R A;  4I2D A;  8ICS A;  1ZQ9 A;  2LKY A;  2VA2 A;  5KFN A;  4LF4 M;  4GIP A;  5ALK A;  4NLC A;  4PHP A;  2WFA A;  4DS5 A;  1N56 A;  1MN3 A;  4QHS A;  2DWN A;  4RU9 A;  2A1J B;  3OGU A;  2XGP A;  1NJY A;  4DQS A;  3K2L A;  3MGI A;  2DBY A;  4B9T A;  4UN2 B;  2Y20 A;  3FTC A;  2WF5 A;  3IM1 A;  4QZB A;  1XB2 B;  1RQL A;  5ALN A;  4LJ6 A;  4YVZ A;  4RKU F;  2JV3 A;  1FFU A;  1ZYQ A;  9ICQ A;  3AOE C;  4FZN A;  2W9C B;  3K75 D;  5ITQ A;  9ICO A;  4LJ8 A;  3D8L A;  2CN1 A;  3SV4 A;  3LVW A;  2VII A;  4LRT A;  2Z7J A;  3U61 A;  3MGV A;  3A0H U;  4LF8 M;  2ZAM A;  3I04 M;  1KTQ A;  2VA3 A;  1NV8 A;  1CEZ A;  1Q3C A;  4F50 A;  2KEB A;  7ICO A;  4A3V B;  2HAK A;  5KG7 A;  3G6X A;  1U47 A;  2FOI C;  2W43 A;  4UAV A;  3ZDD A;  1X9X A;  5J0S A;  1NJG A;  5F3W A;  2E8P A;  4Y2J A;  3E2E A;  3ILK A;  4J9K A;  4QZD A;  2G8L A;  2JWS A;  3A45 A;  2KVS A;  1S0N A;  3CTW B;  2W04 A;  5AIC A;  2P6R A;  3FE3 A;  3WK9 A;  5KG4 A;  1UA0 A;  2ZTD A;  7ICF A;  2XVT A;  3N28 A;  3M8R A;  2AGP A;  1MJG M;  4IS7 A;  8ICP A;  2DWL A;  3I4V A;  2E3T A;  3HX3 A;  5L1L A;  5DBA A;  2WAQ C;  3EIH A;  3PFI A;  5HR6 A;  1TFR A;  1ZV1 A;  2K4E A;  9ICG A;  1G4A E;  2DAE A;  1OQY A;  4LZG A;  1XXH E;  2Z4R A;  4GMQ A;  2KKV A;  1S0O A;  1MQ3 A;  5J0T A;  3ZDE A;  3AL0 C;  3GLF A;  4I4L A;  1TAU A;  4DOC A;  4KTQ A;  2OQ4 A;  5ALE A;  1XC9 A;  4CDG A;  2J6T A;  3AM9 A;  1B22 A;  1U4B A;  3QE9 Y;  9ICL A;  1IN8 A;  4MH0 E;  3J2P B;  4RQ2 A;  5J2B A;  1IBK M;  1X6J A;  5GTI U;  4BUG A;  5D49 A;  2EZX A;  1BGX T;  1LKY A;  4QZE A;  4MFF A;  4G4R A;  4ED7 A;  4KHP M;  4ED3 A;  4KLH A;  4BJQ A;  3U6P A;  1NJW A;  4DQR A;  3PO5 A;  2FLL A;  2C99 A;  1F44 A;  2RDI A;  2IOF A;  2G0A A;  5AIA A;  4CGZ A;  4DSE A;  2HCF A;  1OUQ A;  4DR4 M;  1S97 A;  2R4J A;  3PX4 A;  3V72 A;  3QAU A;  1G59 A;  2LM4 A;  3HY5 A;  4ECR A;  2KFZ A;  2BJV A;  4XUS A;  3HHY A;  3SFZ A;  3CW2 C;  3SHF A;  1SGG A;  2HI0 A;  1J5E M;  1HR0 M;  2ZJ8 A;  1VDV A;  3CF6 E;  3C23 A;  1N61 A;  3JPO A;  1LB2 B;  4QIW C;  9ICI A;  3UXO A;  3HJS A;  2ZIW B;  3EZ5 A;  1JIH A;  3AQE A;  3MFH A;  5CHG A;  4J9O A;  1VLB A;  5IIM A;  4YHH M;  1NZB A;  4RQ5 A;  8ICX A;  1QVR A;  3N7S C;  2ASD A;  4R64 A;  1PVQ A;  1BPX A;  4XA5 A;  1T6O A;  3C28 A;  1BNP A;  3IDW A;  2CV0 A;  5KFP A;  2V4R A;  5KFG A;  1RYU A;  5AK6 A;  5J2J A;  3SV3 A;  2DWZ B;  4Z6D A;  4ELU A;  3AOE A;  4O0I A;  2KZM A;  4RF1 A;  4R71 A;  4UAT A;  3HKZ C;  4B9L A;  3PSF A;  4U7C A;  3KOY E;  2Q0Z X;  5DFL A;  5AM1 A;  4EZ6 A;  2KZ3 A;  1VQ1 A;  4Y2X A;  2LH0 A;  2ES6 A;  1LTM A;  3C21 A;  4DCC A;  3GRR A;  1L7P A;  5KFX A;  4DOA A;  3QU4 A;  2E5L M;  3SI8 A;  1PJJ A;  1TV9 A;  4RQM A;  1DGH B;  2F1J A;  4Q8E A;  3RRG A;  1Q3B A;  1OW5 A;  5EWF A;  5AM4 A;  2ZTE A;  1U48 A;  1SL1 A;  2NRT A;  4PPX A;  2PMZ F;  1G71 A;  2CRX A;  1VEK A;  2CHG A;  3HGI A;  1NNJ A;  1TH2 A;  4KLN A;  3K1J A;  3SAU A;  2HHV A;  4Z8X A;  5KPT A;  3V6H A;  1FIQ A;  4YR0 A;  1QH9 A;  3H0L B;  1HT2 E;  2WZJ A;  2ZXI A;  8ICY A;  1Z4O A;  4O5E A;  3ZDC A;  3VDU A;  2XSZ A;  4CIS A;  5KFC A;  2KP7 A;  1J7K A;  4RZR A;  3K9P A;  4IBC A;  5F9N A;  5AK5 A;  2GWS A;  2YNM D;  5AK3 A;  1NJZ A;  3HU1 A;  4DUY M;  4ECT A;  2KJ5 A;  2RP5 A;  1NK4 A;  3RH4 A;  3B0Y A;  5KG0 A;  1VJ5 A;  3J80 S;  4DFK A;  4B3R M;  2W3S A;  4GH9 A;  5LMU M;  4RQ3 A;  3MDA A;  4F91 B;  4PDG A;  1XC8 A;  3JPS A;  1KKX A;  1T3Q A;  4YR2 A;  4R8U B;  4FWH A;  2OOA A;  3GLF E;  1ZQS A;  4YP3 A;  3EW9 A;  4REZ A;  1Z00 A;  4BBA A;  3NVZ A;  4JUZ A;  4DV0 M;  2UXB M;  1DGF A;  2ZIX A;  4RQN A;  1ZQH A;  1L3T A;  4ZH4 A;  3TAC B;  2W8K A;  3OSN A;  1ORY B;  3IEC A;  2FJ6 A;  4OJL A;  2RDJ A;  4DFM A;  2BQ3 A;  4GHL A;  3GO8 A;  1PJI A;  2DZL A;  1PGY A;  3FUU A;  8ICQ A;  1KFD A;  1ZD2 P;  1UM8 A;  4L15 A;  2F5O A;  4NXN M;  3FTE A;  4YD1 A;  4US9 A;  5ALI A;  4RNA A;  4QZF A;  4Q43 A;  2H3Z A;  4KT0 F;  3KOW E;  4LG2 A;  2ZXH A;  5KL8 B;  4C80 A;  4FCW A;  3NGD A;  4XQ8 A;  4O9M A;  3NRW A;  1SXE A;  4JI4 M;  2FDR A;  5KFQ A;  1PJQ A;  4I5S A;  1L3V A;  5J2A A;  2HKJ A;  4K0K M;  5KFU A;  2HHT A;  4NWI A;  2QAR A;  4EX7 A;  1G41 A;  4Y2R A;  5EWE A;  1RU3 A;  7ICS A;  5KFJ A;  5KPR A;  3KHL A;  1N32 M;  4X5V A;  2IBK A;  4F72 A;  4P4P A;  1L7O A;  4IQW A;  5KT5 A;  3RJI A;  3FYH A;  4GC5 A;  3E21 A;  5DQG A;  1TH3 A;  2L2D A;  1ZQY A;  1TK0 A;  4O3S A;  1GL7 A;  4NRV A;  1VG5 A;  2R65 A;  4PGQ A;  3PR4 A;  3Q8R B;  1FNN A;  4JMU A;  1F5S A;  4ZOH C;  3G6V A;  3W0L B;  3K8Z A;  2R18 A;  4QOZ C;  2CXY A;  2O6K A;  5EOZ A;  2BDU A;  2FH0 A;  3K1Z A;  2BR0 A;  3KP0 E;  7ICI A;  7ICP A;  3KOZ E;  2FLN A;  2DEN A;  5KL1 B;  3BDP A;  2FFJ A;  2PFQ A;  2W9C A;  2KJ8 A;  3Q8Q B;  1PRB A;  2QSF X;  3V7K A;  2C9O A;  4X66 M;  2ERC A;  4IBI A;  5HP4 A;  2K8A A;  1T7P A;  4DQQ A;  3Q8G A;  4S12 A;  5HMM A;  3BZK A;  3QEB Z;  4F2L A;  1WWV A;  1QSS A;  5JU5 A;  1Z59 A;  3L5K A;  4RQ1 A;  1KLN A;  4LCB A;  4D80 A;  3ZI4 A;  5AM3 A;  2XF3 A;  9ICX A;  2DQN B;  4KO8 A;  3UQ0 A;  5KO3 A;  3WKC A;  2M0N A;  4M0A A;  5DQI A;  3KZX A;  4FD2 A;  5HHI A;  3M9M B;  5K4L A;  3SAW A;  4A8E A;  2EAN A;  1SZH A;  3RE8 A;  2JP7 A;  5EE9 A;  2I7N A;  1N77 A;  2HDO A;  1SXJ A;  4E0D A;  4NOO B;  3ORY A;  1XSP A;  2DKX A;  2W55 A;  3TQ1 A;  3FTD A;  3ZD8 A;  3I1Y A;  3IHP A;  2F5Q A;  2KNJ A;  4BX9 C;  5C1B A;  3QX7 A;  2XCA A;  8ICK A;  2OCE A;  4XK8 F;  3EYZ A;  2BWB A;  1DRG A;  4F93 B;  2ZTC A;  1NJX A;  1VEG A;  2LYB A;  3JR4 A;  4FW9 A;  2H3Q A;  3U60 B;  3Q8P B;  7ICK A;  2KIW A;  1MN8 A;  3JAM S;  4C8L A;  1R2Y A;  1ZQF A;  4KN7 A;  2KIC A;  2PKE A;  1C1K A;  4JB3 A;  3T5K A;  1F4I A;  1ZQW A;  3PST A;  3PY8 A;  2QPA A;  3E9S A;  4C4S A;  5ITY A;  3SAH A;  5J0W A;  2XFT A;  2F1I A;  4BGD A;  3V76 A;  2KNZ A;  3TWK A;  5CJ7 A;  2C28 A;  1X37 A;  1BPD A;  5KAF U;  2G09 A;  1T3N A;  2CE7 A;  2O01 F;  4AKG A;  2ZG6 A;  4BXO A;  1S77 D;  2BJW A;  5JI3 E;  1VEJ A;  1SB3 C;  2UVW A;  4PHE A;  2V4Q A;  3AUO A;  5AK4 A;  1TK8 A;  3GLG A;  4DL2 A;  5KT7 A;  9ICR A;  4X65 M;  2BDP A;  1RXV A;  3ZD9 A;  4AQY M;  4OVZ A;  5ALJ A;  9ICM A;  1D8Y A;  1L7N A;  4C4T A;  2YX8 A;  3B7Q A;  2WF9 A;  5DG9 A;  5ITX E;  3GIL A;  1MX0 A;  3D2N A;  4OX9 M;  4CNQ A;  2ZIW A;  2E8N A;  5AKH A;  4F2R A;  2C2E A;  3M7D A;  4FE3 A;  2QEN A;  5ALM A;  7ICR A;  1V97 A;  1ZQP A;  1R2Z A;  4LF7 M;  1QDR A;  4W5W A;  5TIS U;  4NC6 A;  2JR5 A;  4ED2 A;  2R8J A;  4MEY A;  1XSL A;  3KSJ A;  3NBX X;  3OPX A;  1KQQ A;  2G5H B;  3J81 S;  3Q8X A;  5KG6 A;  4DF4 A;  5D46 A;  2WB1 C;  4OVZ B;  4ECS A;  3ZC7 B;  2XI9 A;  3OJU A;  3MC1 A;  2L09 A;  3KD3 A;  3E46 A;  2L4E A;  4BWM A;  7ICL A;  4LJ7 A;  3A0B U;  1XSN A;  2KMD A;  5BPV A;  4UBB A;  2VAN A;  1PJS A;  1ZQO A;  4JV1 A;  2YB4 A;  4JWN A;  5G5H A;  4DSF A;  1ZQE A;  2MSN A;  2VJ5 A;  2F5S A;  1N36 M;  3C29 A;  1QLN A;  1S5L U;  4QWB A;  4C4R A;  3E4R A;  3ETR A;  3AEV A;  4F5N A;  2O5R A;  3RAX A;  5KQ8 A;  3JPN A;  2LVA A;  2MJ5 B;  2LHT A;  1GJT A;  2EA0 A;  2W03 A;  4LZD A;  2LHC A;  4DFD A;  2RGH A;  2K4I A;  4QWE A;  3ICX A;  5KFW A;  4PGX A;  3M0E A;  2QCU A;  2JNH A;  2KDL A;  2LM1 A;  2KXE A;  1HNZ M;  4O3O A;  2JGA A;  4FBU A;  3U6S A;  4MB7 A;  4KLS A;  3VLF B;  9ICV A;  2WTF A;  2IMW P;  4Y2U A;  1SKS A;  1TDZ A;  4JI5 M;  3CF0 A;  2I5H A;  9ICW A;  1GO5 A;  1T4G A;  4AG6 A;  2LBO A;  3T6P A;  2Y1J A;  2ZAN A;  3OJS A;  3LW5 F;  5KFD A;  5ITT A;  3BJY A;  2RGO A;  3MK6 A;  3UJN A;  2A19 A;  3IP4 B;  4AW4 A;  5EXX A;  3GLH E;  1ZOL A;  4EBD A;  2VF7 A;  5C18 A;  4DV7 M;  4QZ9 A;  8ICZ A;  3U5Z A;  2EUC A;  1Z1V A;  2F5N A;  2I7P A;  1FFV A;  2OOB A;  3TL4 X;  2DXI A;  2GH1 A;  3D2Q A;  3M9N B;  3CRX A;  2K0B X;  3GIJ A;  1WUD A;  2ZIU A;  1ECW A;  3VFD A;  4EBC A;  5B5E U;  4YN4 A;  5JTI A;  1K1S A;  4MGI E;  2DKL A;  4IJF A;  5FTL A;  2HHW A;  4NLK A;  4GEW A;  4M04 A;  4FCV A;  5CA7 A;  4XGI A;  1UPH A;  3F5A A;  4PGY A;  2DHR A;  5IZ7 D;  1N5W A;  2P6U A;  4UAS A;  3LCU A;  3PVX A;  3PW2 A;  3ALR A;  2WF7 A;  2C22 A;  1EFU B;  8ICA A;  5ALS A;  1ZJN A;  3PNV A;  3GPP A;  1L8Q A;  3DFZ A;  1SZP A;  1NVM A;  2LWX A;  2E5S A;  2CV2 A;  1GVN A;  3DDH A;  1TVA A;  3G6Y A;  2VQF M;  4RPY A;  3AU2 A;  1SL2 A;  3KDS E;  4EIW A;  3GLI E;  1NO1 A;  1K82 A;  2BCQ A;  4P2H A;  1DGG A;  1R6B X;  2R8K A;  3SC3 A;  2DVW B;  1HEK A;  2XCP A;  4HAI A;  4QWC A;  2DUY A;  3LWL A;  4DL3 A;  4KLL A;  3NAS A;  2QAR B;  2M9N A;  9ICT A;  2JEI A;  4KMO B;  2W9A A;  2CUZ A;  1WXQ A;  1D8L A;  2YML A;  2Q2E B;  3CGW A;  1YE9 A;  2DAK A;  2JXN A;  2MU2 A;  2WAQ F;  3HIL A;  8ICG A;  3IV6 A;  5IIJ A;  3WKE A;  3BQ7 A;  2N1R A;  2DHY A;  1TKD A;  4B9V A;  3A98 B;  4CIZ A;  4G9B A;  2J6S A;  1IXR C;  3A46 A;  2L4F A;  2VA8 A;  5ALG A;  5ALD A;  3SAG A;  4MGY E;  3RBD A;  4ED0 A;  4RUC A;  4F5P A;  4I2B A;  3TAD C;  2K8B B;  3BS5 B;  3LQR A;  4AP9 A;  1TE2 A;  4OJO A;  2DWM A;  5BPC A;  3C1Z A;  1OIP A;  2IHM A;  4KLO A;  4GLX A;  4FZM A;  4FFD A;  4EX6 A;  3WK4 A;  1XHB A;  2UU9 M;  5H37 D;  5BR8 M;  3HJQ A;  1C20 A;  1HQY E;  5B66 U;  1B4F A;  3TAP A;  1W5T A;  3Q8L A;  1KL9 A;  2YN4 A;  4DSL A;  2ODG A;  1S76 D;  2WF8 A;  3C2K A;  2Y0S F;  2DAG A;  5J29 A;  2K6B A;  4F4Y A;  2R62 A;  3QU7 A;  4NLB A;  1DXS A;  3GIK A;  3EWA A;  4B9U A;  5EP3 A;  2GLE A;  4LF9 M;  1EXN A;  5JI2 E;  4Q44 A;  3HZJ A;  3RB3 A;  2GOL A;  2NV3 A;  3TAQ A;  4F2S A;  3VC8 A;  3VK8 A;  1L5U A;  2XZU A;  3KVW A;  2NO5 A;  4MHV A;  4M9H A;  3N7P D;  2UVR A;  3QU9 A;  3IG8 A;  2DF4 B;  4QZI A;  2JZB B;  1KW4 A;  4B9N A;  1ZQZ A;  5ALO A;  4B9S A;  1RYS A;  1JX4 A;  4II7 A;  3TAR A;  4MM3 B;  1HUO A;  3GLG E;  2KNA A;  3QZ8 A;  1E9S A;  4RQ8 A;  1ZQN A;  4D81 A;  3H7I A;  5J8Y A;  4ECY A;  1Q46 A;  2OHF A;  5ITX A;  4J03 A;  3I51 A;  1ZD5 A;  2J5Y A;  3T5H A;  4KLT A;  5L1I A;  4FZL A;  5KFL A;  4IRD A;  1QTM A;  9ICS A;  3TE6 A;  2EAP A;  3B0X A;  5IRE B;  1V9P A;  4UB1 A;  4TUQ A;  3WKD A;  2FPK A;  3GPU A;  1O08 A;  8ICU A;  2AHO B;  5DNY A;  5LMN M;  4I2G A;  4DSK A;  4PZN A;  3L3F X;  2XSZ D;  1JRP A;  1JR3 A;  3JPT A;  1L3U A;  3FRH A;  2JZ0 A;  1N33 M;  4RQ4 A;  5KG2 A;  4C7Y A;  5DBC A;  1SWW A;  4AKI A;  1NY5 A;  2LPE A;  1DGS A;  3R8F A;  2F5P A;  5A0L A;  3PX0 A;  2DZO B;  4GC6 A;  5IIL A;  2YMP A;  5ALX A;  5HML A;  3C5F A;  2P5T A;  1L8L A;  4LY6 A;  4P0P B;  2DGZ A;  1IXS A;  3M9O B;  2YTU A;  5AI5 A;  3GLG B;  2KTQ A;  1SXJ B;  1QZM A;  4G6Z A;  2L7I A;  3CYM A;  4EYH B;  2PFP A;  5F3X B;  4EZ9 A;  4RQ6 A;  4QJF B;  1PM5 A;  3NTU A;  3PO4 A;  4J9P A;  2K8C B;  1QAN A;  1D0K A;  4LFA M;  4AYB C;  3PXG A;  3KHG A;  2BCU A;  4HYK A;  4BLC A;  1ZQI A;  3VK7 A;  9ICP A;  1IQP A;  4DL6 A;  7ICG A;  8ICB A;  7ICU A;  3AQF A;  4ANR A;  3IHQ B;  3BBZ A;  3NBI A;  5HNK A;  2BPG A;  3AJI B;  2D3D A;  3ETL A;  5KFT A;  1WCL A;  3UGJ A;  1ZQC A;  5KTQ A;  4K4G A;  1XMO M;  2DNA A;  4P4O A;  2IA6 A;  2NO4 A;  5ALU A;  3MMP A;  4IBD A;  2LVN C;  5E26 A;  1YT3 A;  2VQE M;  3B9P A;  3GPY A;  2LVP C;  1R5L A;  4LGY A;  1T94 A;  3BOS A;  1IN7 A;  4M0W A;  2ZUD A;  4QW9 A;  1KFT A;  1Y8G A;  4LJA A;  1QQ7 A;  4CF5 A;  2F44 A;  3THV A;  2BWE A;  7ICE A;  4BXO B;  4NY8 A;  1X9W A;  1ZET A;  2CPR A;  2C2R A;  3PVS A;  2R6F A;  1K3X A;  5L1M A;  1IN6 A;  5FTJ A;  5KT2 A;  5ITR A;  4DQI A;  2A3V A;  8ICI A;  5KFM A;  2QB1 A;  4MEX A;  5ALZ A;  1SL0 A;  1ZQG A;  4J9S A;  4C0Z A;  5D4B A;  1S8O A;  1RG6 A;  4CRX A;  1HNX M;  3KS8 A;  4QZC A;  4K4I A;  1JR3 D;  2AU0 A;  4IQU A;  3HHZ A;  3WKB A;  5JRT A;  2VJ4 A;  1GJS A;  1XXH A;  1ZQL A;  3PR5 B;  3T1Y M;  3VDP A;  1ZD3 A;  4LJ4 A;  3DEE A;  3RGP A;  2F1H A;  5ALF A;  2L6O A;  5AI4 A;  1DGJ A;  2BZF A;  4FWG A;  3HJE A;  4EBE A;  4I2E A;  4Y2V A;  3N7R C;  4YCX A;  1TR8 A;  4NL9 C;  1HQC A;  2FMS A;  1Q8K A;  2M60 A;  3TAD A;  2L7H A;  5H2F U;  3IG5 A;  4DBG B;  1DO0 A;  2D8C A;  4I2F A;  9ICA A;  1T3T A;  3DA1 A;  2KK0 A;  3RJG A;  4UB6 U;  1LVH A;  2PXI A;  1NSF A;  5FTN A;  2W54 A;  4PL1 A;  1D9D A;  4IBB A;  1RQN A;  5EQT A;  4UB8 U;  1SKR A;  1OAI A;  2YMQ A;  1BVS A;  2HBJ A;  5ALV A;  3FYD A;  1KEJ A;  1NKC A;  2KOB A;  4M6W A;  1SXJ C;  3L28 A;  1WWU A;  4O3R A;  1S3S A;  4DR1 M;  1UA1 A;  4JI1 M;  1SIJ A;  3ZDB A;  1NNL A;  4RUA A;  3F2D A;  1Q02 A;  4DFP A;  1JR3 E;  2KZZ A;  3L29 A;  2PI5 A;  4Y2P A;  2R0I A;  4JI0 M;  2E1F A;  3QXG A;  8ICE A;  2DKZ A;  3RB0 A;  3QYP A;  1JRO A;  4M2Y A;  1QAQ A;  5ALL A;  2DAI A;  3HHW A;  4OJ6 A;  4GXI A;  2Y21 A;  2ZIV A;  3A42 A;  1Q39 A;  4JI3 M;  3QZ7 A;  5KFH A;  4IBK A;  4Q7J A;  3SBJ A;  1HNW M;  5KFV A;  2PFO A;  5J0R A;  2C98 A;  4Y2Q A;  2F8K A;  4JI6 M;  1KFV A;  4KX3 A;  3RFW A;  5FLX S;  2LI6 A;  2KJ9 A;  5AM5 A;  2QHO B;  3U5Z B;  2UUA M;  3F5E A;  4G4O A;  1B43 A;  2X8A A;  4QZ8 A;  2OM6 A;  1L6N A;  4B9M A;  4I8O A;  2PI4 A;  4KLJ A;  3HWS A;  1PZN A;  1COK A;  2A1A A;  4IBE A; 
#chains in the Genus database with same CATH homology
 4DV5 M;  2G5H B;  1Q3V A;  3J81 S;  3VKG A;  3T15 A;  1A0P A;  3Q8X A;  1XNS A;  2J7N A;  2V6Z M;  2QZ4 A;  3AOE C;  4JI2 M;  4FZN A;  2WB1 C;  4OVZ B;  2KHV A;  4M9X A;  3GLH B;  3ZC7 B;  1IBL M;  2XI9 A;  2XGN A;  2F4V M;  1HIW A;  4P0P A;  2L09 A;  3SHG B;  5ITQ A;  2LNH C;  3HU2 A;  4LJ8 A;  3D8L A;  2CN1 A;  4MGK E;  4X62 M;  1IXS B;  3LVW A;  3M6Z A;  4TUW A;  2VII A;  4LJ7 A;  4LRT A;  2Z7J A;  4DR3 M;  3U61 A;  5BPV A;  3MGV A;  1QQW A;  2YB4 A;  4LF8 M;  2ZAM A;  4JXJ A;  2C9C A;  2OPF A;  1H6U A;  4JN6 A;  2F5S A;  5IT9 S;  1N36 M;  1TDH A;  3PNY A;  1Q3C A;  2VJ5 A;  1K3W A;  3H0M B;  3C29 A;  2KEB A;  1OFH A;  3FUT A;  4M0D A;  3E4R A;  4A3V B;  2O5R A;  2FOI C;  2XH9 A;  1IY1 A;  5KQ8 A;  3FD9 A;  1NJG A;  5F3W A;  3GU3 A;  2LHT A;  2EA0 A;  1YSY A;  2W03 A;  3ILK A;  2G8L A;  1D2N A;  3A45 A;  2RGH A;  2K4I A;  3ICX A;  3CTW B;  1ZQ1 C;  3M0E A;  2QCU A;  2H1R A;  2W04 A;  2KXE A;  1HNZ M;  2JGA A;  3U6S A;  4MB7 A;  4LF6 M;  3VLF B;  4GHA A;  3GRU A;  4G4N A;  1IIP A;  2XVT A;  2JH7 A;  3KSX A;  4R3D A;  1DO2 A;  3M6K A;  3FUW A;  2DWL A;  1TDZ A;  3I4V A;  3M6A A;  4JI5 M;  3CF0 A;  4LJ5 A;  3R9X B;  3U6Q A;  2WAQ C;  4CGY B;  4DR7 M;  4AG6 A;  3GPX A;  2LBO A;  3GP1 A;  2ZAN A;  3GLI B;  3GQ4 A;  3EIH A;  1GL6 A;  2Y0T A;  2R46 A;  2RGO A;  3PFI A;  1Z5C A;  3MK6 A;  3UJN A;  5ITT A;  3AOG A;  3IP4 B;  4ICA A;  2KV2 A;  4AW4 A;  5EXX A;  2K4E A;  1G4A E;  2KRU A;  3SAF A;  5C18 A;  4DV7 M;  2UXD M;  3U5Z A;  2Z4R A;  2A5Y B;  2EUC A;  4GMQ A;  4HL4 A;  2KKV A;  3U6M A;  2F5N A;  4OJP A;  2I7P A;  3AL0 C;  3GLF A;  3TL4 X;  2DXI A;  4I4L A;  2GH1 A;  3D2Q A;  4U6P A;  3CRX A;  1WUD A;  2OQ4 A;  2W82 A;  2ZIU A;  4CDG A;  3SAV A;  1NNU C;  1MU5 A;  1ECW A;  3VFD A;  4B08 A;  1Z1B A;  2YB1 A;  1IY0 A;  2DZN B;  1IN8 A;  4MH0 E;  3J2P B;  2F2A B;  5DYG A;  4MGI E;  5FTK A;  2H3I A;  4IJF A;  4M9S A;  5FTL A;  4OU7 A;  1IBK M;  4BUG A;  2LXE A;  3KFU F;  3CF2 A;  3H0R B;  2HOQ A;  4FCV A;  4G4R A;  4XGI A;  1UPH A;  4DUZ M;  4KHP M;  3F5A A;  4BJQ A;  1IM2 A;  3U6P A;  2DHR A;  5IZ7 D;  2HBK A;  2LYA A;  1JQJ C;  2C99 A;  3SAR A;  1HT1 E;  1F44 A;  1XO0 A;  3ALR A;  2G0A A;  4WJ3 B;  4CGZ A;  2PMZ C;  1OUQ A;  3PNV A;  4DR4 M;  3GPP A;  2R4J A;  1L8Q A;  2KD1 A;  3DFZ A;  3AFH A;  3QAU A;  1G59 A;  1G8P A;  1NVM A;  2LWX A;  4I81 A;  2CV1 A;  4LFB M;  4DV2 M;  2BJV A;  1L1Z A;  2E5S A;  4LFC M;  2CV2 A;  1SXJ E;  3HHY A;  3SFZ A;  2OXO A;  3SHF A;  1GVN A;  3GQ3 A;  4WUR A;  2XID A;  1J5E M;  1HR0 M;  1D8B A;  3AL0 B;  2OYY A;  3CF6 E;  2VQF M;  2FE8 A;  2CHQ A;  2JH1 A;  3KDS E;  4EIW A;  1K82 A;  4QIW C;  1Z19 A;  3HJS A;  1DGG A;  1R6B X;  5KQD A;  2UUC M;  3SC3 A;  2ZIW B;  2G08 A;  2DVW B;  1HEK A;  4ACO A;  5FSW A;  3AQE A;  3L27 A;  2KZU A;  3ZH9 B;  4DR2 M;  4YHH M;  1N78 A;  3T79 A;  4L4U A;  1NZB A;  1QVR A;  3HKP A;  3N7S C;  3U60 A;  3UZU A;  1YUB A;  2CUZ A;  4L16 A;  4KMO B;  5T14 A;  1WXQ A;  1PVQ A;  4B3M M;  1Z6T A;  4PDI A;  2Q2E B;  1YE9 A;  2WAQ F;  3C28 A;  3W0F A;  3NUQ A;  2CV0 A;  4ITQ A;  1TH4 A;  2N1R A;  1NHW C;  2DWZ B;  3A98 B;  3FKE A;  2MRL A;  1MA7 A;  2F8L A;  2KKP A;  3AOE A;  1IXR C;  4RF1 A;  3A46 A;  2K47 A;  4BB9 A;  4MGZ E;  3HKZ C;  3SAG A;  3NWL A;  4MGY E;  3PSF A;  4U7C A;  3KOY E;  1P7D A;  3GLF B;  2RRD A;  2YR0 A;  2LH0 A;  4B3S M;  4GKK M;  4B7F A;  2K8B B;  4DV4 M;  2Q4T A;  3LQR A;  4OJO A;  3GRR A;  1OJL A;  2DWM A;  3K92 A;  4PL2 A;  1QAO A;  2Z4S A;  2ZIV B;  2V1C A;  4NXM M;  4FZM A;  2E5L M;  3MJ5 A;  1PJJ A;  1XHB A;  2UU9 M;  1DGH B;  5H37 D;  5BR8 M;  1QAM A;  3M7G A;  3HJQ A;  1J09 A;  1HQY E;  4IJE A;  1Q3B A;  2HOF A;  3LMM A;  3U6E A;  1W5T A;  3J27 B;  2NQ8 C;  2Y0S F;  2PMZ F;  2HBL A;  2CRX A;  3U6D A;  2CHG A;  2R62 A;  3HGI A;  2Y0Q A;  5EXP A;  3HHX A;  1NNJ A;  4NLB A;  2CFO A;  2HCB A;  4IIW A;  1TH2 A;  1G3I A;  4KLN A;  3K1J A;  3SAU A;  5EP3 A;  1L2B A;  4LF9 M;  5JI2 E;  1GO3 F;  1E32 A;  2YFQ A;  4Z8X A;  3UK6 A;  5KPT A;  2BNK A;  2GOL A;  2NV3 A;  3WHL A;  4WW0 A;  3J7A S;  2JMG A;  3VC8 A;  3VK8 A;  2G5I B;  2XZU A;  4OW0 A;  3H0L B;  3OTO M;  1HT2 E;  2ZXI A;  3KVW A;  1TAM A;  2HHH M;  3VCB A;  3U6O A;  3L25 A;  3VDU A;  3N7P D;  2C96 A;  2XSZ A;  3IG8 A;  4CIS A;  2DF4 B;  1Z5A A;  1J7K A;  1XMQ M;  4IBC A;  2CEA A;  2YNM D;  3KOX E;  3HU1 A;  4II7 A;  4DUY M;  4QNL A;  2W7O A;  1KSF X;  4MM3 B;  2D7E A;  2KJ5 A;  1XXH B;  2RP5 A;  5ITU A;  1L2D A;  3LYS A;  2ZM6 M;  1KBU A;  1E9S A;  4DR6 M;  4X64 M;  4D81 A;  3F2C A;  3J80 S;  2ZAO A;  1XNR M;  4B3R M;  5DYI A;  2CHV A;  3GQ5 A;  5EP4 A;  2E1E A;  5ITX A;  4GH9 A;  2UXC M;  3I51 A;  1CRX A;  1E94 E;  1DGB A;  5LMU M;  5KPZ A;  4IBF A;  5EXT A;  4PDG A;  1XC8 A;  4FZL A;  2XEP A;  3TE6 A;  4L8R C;  5IRE B;  1NY6 A;  4FWH A;  4P0Q A;  3L2A A;  4ZPX A;  1GLN A;  5HR6 A;  4REZ A;  1IXZ A;  2KEY A;  3GPU A;  4GFJ A;  3SYK A;  2H3F A;  3J7B A;  5DNY A;  2D6F C;  4HLQ A;  4BBA A;  5LMN M;  3L26 A;  3L3F X;  4DV0 M;  2UXB M;  1DGF A;  2XSZ D;  2KVC A;  2ZIX A;  2AHM A;  1JR3 A;  2XLJ A;  4R7G A;  3U6L A;  1TGU A;  4Z6Y A;  1N33 M;  1I94 M;  1ORY B;  4M9Z A;  4OJL A;  4NL4 H;  3TWM A;  3EIE A;  4GHL A;  3GRY A;  3JR5 A;  4KOD A;  2D7G A;  4PD2 A;  3GO8 A;  1PJI A;  1EE8 A;  8CAT A;  3FUU A;  1NY5 A;  4AKI A;  4NSO B;  3R8F A;  2F5P A;  3TWL A;  3DZD A;  1UM8 A;  4L15 A;  5A0L A;  2F5O A;  4NXN M;  3FTE A;  3TQS A;  4RNA A;  2DZO B;  2H3Z A;  3KOW E;  4LG2 A;  2ZXH A;  5KL8 B;  3PZP A;  4FCW A;  2P5T A;  4P0Q B;  4YY3 M;  3NRW A;  4LY6 A;  4P0P B;  4JI4 M;  4PT5 A;  4I5S A;  3AV0 A;  2JHD A;  2HKJ A;  2ZIU B;  2DGZ A;  2JA2 A;  1URJ A;  4K0K M;  4IC9 A;  1NHG C;  1VDD A;  3THG A;  4NWI A;  3U61 B;  3GLG B;  1SXJ B;  1QZM A;  1G41 A;  2EO2 A;  4GRI A;  4G6Z A;  2L7I A;  3CYM A;  5C0Y A;  2R4E A;  4QNR A;  5KPR A;  2KW0 A;  2K89 A;  1N32 M;  3UMM A;  1PM5 A;  3KP1 E;  4QJF B;  2HOI A;  4NV0 A;  2K8C B;  1QAN A;  4LFA M;  4AYB C;  3PXG A;  4DV3 M;  4BLC A;  3VK7 A;  4GC5 A;  2FNA A;  2Z3X A;  4OJ5 A;  1IQP A;  1TH3 A;  1Z5B A;  3AKZ A;  3H4M A;  3AQF A;  4FWD A;  1GL7 A;  3KW6 A;  4NRV A;  2R65 A;  2VIX A;  1QYR A;  4B7G A;  1W5S A;  1PVP A;  3NBI A;  5GKN A;  2G5G X;  3RF9 A;  3AJI B;  1FNN A;  1FJG M;  3U6C A;  3KFU G;  4JMU A;  1ZAE A;  3F2B A;  3W0L B;  3K8Z A;  2R18 A;  3UGJ A;  1N75 A;  4QOZ C;  4JV5 M;  1XMO M;  2BDU A;  3K1Z A;  3KP0 E;  3KOZ E;  3C58 A;  2R45 A;  4IBD A;  5KL1 B;  1YT3 A;  5E26 A;  1XWI A;  2FFJ A;  3GLH A;  3T1H M;  2VQE M;  3B9P A;  3SMP A;  3GPY A;  2HMX A;  2KJ8 A;  5HR7 A;  3ZCB B;  4D82 A;  2YQZ A;  1N34 M;  1IN4 A;  4LGY A;  4JI8 M;  4GKJ M;  5EXS A;  1T94 A;  4NSR A;  2C9O A;  2X49 A;  2ERC A;  4IBI A;  3BOS A;  4X66 M;  2RHF A;  3O0F A;  1IN7 A;  5FTM A;  4M0W A;  2H3V A;  2K8A A;  4AKH A;  2MA1 A;  4LJA A;  2ZIX B;  4S12 A;  3WHK A;  3RFA A;  2W7P A;  2KHQ A;  2G07 A;  4KX5 A;  1GKI A;  2OH2 A;  1IY2 A;  2CPR A;  1Z59 A;  1E9R A;  3PVS A;  3E0F A;  4AZF A;  4FVM A;  1K3X A;  2QBY A;  3CP8 A;  4LCB A;  4D80 A;  1IN6 A;  4MGH A;  5FTJ A;  2XF3 A;  5IWA M;  1OFI A;  3QWL A;  4B7H A;  3SAS A;  5ITR A;  2DQN B;  4KO8 A;  3T38 A;  4CHT B;  5KO3 A;  2RKO A;  2A3V A;  4DR5 M;  2M0N A;  2KRK A;  3KZX A;  4QIW F;  4FD2 A;  1KYI A;  4C0Z A;  5A2Q S;  1L1T A;  3SAW A;  4A8E A;  4CRX A;  4IBG A;  1SZH A;  1HNX M;  2F76 X;  3KS8 A;  3RE8 A;  3GRV A;  4LGM A;  3KXE C;  4XBO A;  1JR3 D;  4OO1 J;  3HHZ A;  5CRX A;  2I7N A;  1N77 A;  1SXJ A;  2VJ4 A;  1XXH A;  5EJC A;  4NOO B;  3T1Y M;  3VDP A;  3DEE A;  4LJ4 A;  3RGP A;  3FTD A;  2UUB M;  2J7O A;  2VKQ A;  2L6O A;  1ED1 A;  4AYB F;  4LZZ A;  4LF5 M;  3SYL A;  2QBY B;  2XIC A;  4FWG A;  5EP2 A;  3GLI A;  4GC9 A;  2F5Q A;  4JI7 M;  3SQI A;  2V1U A;  4AI6 A;  2KNJ A;  3LVV A;  3N7R C;  4BX9 C;  5C1B A;  4DV6 M;  1HQC A;  3FYC A;  2G06 A;  2M60 A;  2L7H A;  2KA6 B;  3HKZ F;  2D7H A;  3IG5 A;  1DO0 A;  2KZS A;  1T3T A;  3DA1 A;  1IN5 A;  3SMV A;  1NSF A;  5FTN A;  3GZF A;  1DRG A;  4PL1 A;  4IBB A;  2LYB A;  3JR4 A;  4FW9 A;  5EQT A;  3IN5 A;  2H3Q A;  3U60 B;  3FUV A;  3HU3 A;  2HBJ A;  2KIW A;  3F53 A;  3FYD A;  2F77 X;  2HL7 A;  3JAM S;  4P16 A;  1R2Y A;  3VKH A;  1A6S A;  1IBM M;  3SAT A;  3HJ8 A;  3D8B A;  2KIC A;  2KOB A;  4LJ9 A;  1C1K A;  4QHT A;  1XNQ M;  4G4Q A;  2HBM A;  3PST A;  1SXJ C;  4GIT A;  2QPA A;  3L28 A;  3E9S A;  2QP9 X;  2X4A A;  3PSP A;  1S3S A;  4DR1 M;  2ZBK B;  5ITY A;  1Q3U A;  4LZJ A;  3SAH A;  4O3M A;  2XFT A;  4JI1 M;  1NJF A;  3F2D A;  1I4W A;  3L29 A;  3TWK A;  1X37 A;  4RF0 A;  4B3T M;  1PVR A;  2G09 A;  4JI0 M;  2CE7 A;  3I4Y A;  2C5R A;  4AKG A;  2E1F A;  2ZG6 A;  3ONN A;  4PCZ A;  2BJW A;  5JI3 E;  3DOA A;  1QAQ A;  5E6J A;  2XZF A;  3PSI A;  1SXJ D;  1R7R A;  5EP1 A;  3D2S A;  3GLG A;  3KS4 A;  3HHW A;  4OJ6 A;  2Y21 A;  4NRW A;  4X65 M;  2ZIV A;  3A42 A;  1Q39 A;  4JI3 M;  4FCT A;  4LRS A;  2M5Z A;  4AQY M;  4IBK A;  3SBJ A;  1HNW M;  4OVZ A;  2C98 A;  1DGH A;  2YX8 A;  1ZQ9 A;  1L2C A;  4AG5 A;  4JI6 M;  2LKY A;  5ITX E;  4LF4 M;  1MX0 A;  4GIP A;  3TPZ A;  1KFV A;  4NLC A;  3D2N A;  3RGS A;  4OX9 M;  2ZIW A;  4KX3 A;  3RFW A;  5FLX S;  4QHS A;  2DWN A;  7CAT A;  3FTF A;  3M7D A;  3MHV C;  2KJ9 A;  4FE3 A;  4QNM A;  2QEN A;  3K2L A;  3FUX A;  3U5Z B;  2UUA M;  3F5E A;  4G4O A;  1LV7 A;  4L78 A;  2WB1 F;  4JYA M;  1R2Z A;  4LF7 M;  2Y20 A;  2X8A A;  3FTC A;  4QOS A;  4W5W A;  2OM6 A;  3LQQ A;  1L6N A;  4I8O A;  3SMS A;  4DV1 M;  2XFS A;  2K4H A;  4IBJ A;  4LJ6 A;  3HWS A;  3KSJ A;  3OPX A;  4IBE A;  2Y0S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...