2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
b'TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2R18A 2Z7JA
chains in the Genus database with same CATH superfamily
2ZUBA 1V33A 2KKVA 1XXHA 5DBBA 3BQ7A 4M9LA 3BXWA 4DSJA 2FPLA 5EE0A 4QZFA 1N5XA 2BJVA 1D0LA 1K82A 3AM9A 3UQ0A 4P4OA 4ED7A 3M7DA 1T7PA 4NV0A 2KIWA 3MFIA 2C2DA 2R65A 1QUSA 1RYUA 3D2NA 1KSPA 4CIZA 8ICTA 4LCBA 4Q45A 1ZD4A 4P4MA 5A2QS 1WCLA 5KFLA 5KFDA 4ED8A 3TWMA 3K1ZA 1OAIA 3RF9A 2MH8A 1URJA 4GH9A 2F4VM 1UHUA 3PSFA 2NYVA 3GP1A 5FTJA 1WWVA 4B9MA 1XNRM 1IN7A 2CXYA 2VA8A 5KL8B 5J2CA 3I04M 3HHXA 4OJPA 1ZAEA 2BCUA 4F4YA 3CF2A 1U45A 3HKZC 4AYBC 1PJJA 4PJ0U 5KFFA 1ZETA 4Q43A 2K9DA 1J5EM 4G3IA 4C7ZA 5KG5A 2R62A 1XS9D 3V76A 8ICVA 3M8RA 5KG3A 5AK4A 5J2JA 4CJ6A 2VIIA 3FTCA 3Q8XA 4QIWC 4BXOB 4PH5A 2Q4TA 3EW9A 5KFTA 3SFZA 1WIVA 3U60B 4ECUA 4QWCA 3BQTA 5AM3A 1SXJA 5ALZA 4DL7A 1KYIA 2EZXA 3C2MA 4L6V6 5FTMA 4O3NA 4RUCA 3RJIA 4WURA 3GILA 4G4NA 1WWUA 1SXJE 3TACB 2HOQA 1XB2B 2FI1A 3HWTA 4KLIA 1SG9A 4YQWA 2RKOA 3OJSA 3I4VA 5ALRA 5D49A 3MGHA 1DGBA 2BJWA 2JNHA 2AGQA 4C4RA 2HVIA 1QQ6A 1B4FA 2NRWA 4O9MA 2F1HA 3SMVA 2H3VA 2KNVA 1CEZA 3F5EA 4FO6A 2JA2A 4A3VB 4DFJA 5J0YA 1BPBA 4NXNM 2RDIA 1Q8KA 3RJFA 2FLNA 7ICKA 5A0LA 4K0KM 2JEGA 2R4JA 4EYHB 2XC9A 5IIKA 5KFSA 3IRUA 3QUQA 1T94A 4MF2A 3Q8PB 4FS2A 1OFHA 4YMNA 1ORYB 4NLGA 4LJ6A 4LJ8A 4JWNA 2QLTA 5ALYA 5L1LA 3HU2A 4R63A 2DPIA 4KLNA 5IILA 2Y0SC 8ICCA 4PDGA 4QW8A 1DGHB 2ZBKB 3J7AS 2AH5A 4OW0A 2PI4A 1OTRA 9ICXA 2PFPA 4X65M 3JR5A 2W55A 4Z6DA 4DL6A 2JWSA 2KHQA 3HRDD 4NL9C 2CHVA 2V1UA 4R7GA 2QNJA 3KS8A 1NJZA 4HAIA 1XSLA 2CHQA 1JQJC 2OXOA 2ZIWB 3OSNA 1SGGA 1K3WA 4FFDA 1K3XA 2VANA 1YUBA 3TE6A 1QQ5A 4FVMA 2C99A 4F93B 4AKHA 1X9XA 1V92A 3K8ZA 2GLEA 4NM2A 5B5EU 4DWIA 3RE8A 5ALDA 3QZ8A 1T4GA 3GLHB 4X62M 1ZMUA 4B9SA 1AQ6A 4ELVA 4NLCA 1HT1E 2I7PA 4DSIA 2LVQD 2F5NA 4IRDA 3H8JA 4B3RM 2L7IA 2VIXA 2BQ3A 8ICPA 4HYKA 3E21A 5FTKA 3B9JA 5AKLA 4PGYA 2XY7A 9ICSA 3UXNA 2L2DA 4DR2M 1Z1VA 1MA7A 1S9FA 2MR9A 3TAPA 2KIVA 4XGIA 4OU7A 3NVYA 5ALJA 3RJEA 4BDPA 3I1YA 2FLLA 4ED0A 3KXEC 2PI5A 2G3QA 4IRCA 2FMQA 4IL6U 2MROB 7ICRA 3N7RC 2WF8A 1PGYA 4NXMM 1L7NA 4PHAA 2HOIA 3K9PA 1R2ZA 1WUDA 3U60A 3NUQA 2JEJA 4KLJA 8ICRA 5AM0A 4QZDA 5CWRA 2G5GX 3HT3A 1MQ2A 4MH0E 1W5TA 4L16A 2HHQA 8ICYA 3IECA 4P16A 2R8JA 2HW3A 2ZJAA 3QYEA 2RGOA 3K2LA 2HBMA 1C1KA 1ZD5A 4NSOB 1NNJA 1S10A 1IBMM 1S5LU 2JZBB 4RNMA 4DQPA 4I2BA 1JRPA 3G6XA 3SHGB 1TK0A 1N32M 3LYSA 2F77X 1SWVA 2K8AA 4MF8A 2WTFA 1R6BX 4O5KA 2ZUDA 1HJPA 3C1YA 5F3WA 4Q8EA 3SYLA 2E8NA 3EIHA 2DHRA 1V34A 4BBAA 4LF9M 2IOHA 3PW4A 1Q02A 2K4PA 4P0PB 3GLGB 4IBIA 3GRYA 3M6KA 3FRIA 9ICOA 3SI8A 2Z3XA 4OD0A 2XH9A 1QSYA 1NK4A 1JXLA 3HP6A 2WFAA 2BPCA 4EZ9A 1RDFA 2PMZF 2CP8A 1KLNA 4DL4A 2Q0ZX 5ALEA 4QZCA 1DGHA 4NLBA 3CF6E 3J7BA 1K1QA 2ODGA 4CF4A 3U26A 4F71A 3L5KA 2W8KA 1F44A 4QHTA 2DFLA 4Q7JA 1TV9A 3IG5A 2K4EA 4QZAA 4HEOA 3L26A 4FZLA 2JP7A 4RQ7A 2VA3A 3ZDAA 2IOFK 2Q2EB 2YY6A 3V7LA 1ZRMA 2DAMA 2ZIWA 4LRSA 2IMWP 3HHZA 1NI3A 3FD9A 4IBCA 5AM2A 2V9WA 2QPAA 5KFIA 3MDCA 3SATA 2AU0A 3AKZA 5KT3A 4J9SA 3U5ZB 4NM1A 4LJ9A 2KJ8A 5J0XA 4TUSA 3K92A 3GLHA 2QBYA 4JI6M 2BR0A 3C2LA 2W9AA 2JXJA 4M47A 5EWFA 1IN4A 9ICTA 1OIZA 2G07A 1ZQLA 3GLHE 1BPDA 4MFAA 2ZIUA 4RQ8A 3V72A 1ZMVA 3OJUA 2DKLA 4FW9A 2PFQA 2YX8A 3M7GA 1PRBA 2W7OA 4NLZA 4LFAM 3SC3A 3WHLA 2KZUA 1IBKM 2G5HB 4GXKA 4RPXA 2XY5A 3FM9A 3F53A 4EIWA 4F1IA 2AXTU 4J03A 3U6OA 1CI4A 1ZQMA 2WB1F 1PVQA 3UMGA 2A1AA 5ITXE 3DDHA 1V38A 1WGLA 1HNWM 4RQNA 2BCVA 4AI6A 5EQTA 2W43A 4KX3A 2LHCA 3JR4A 2HWJA 4GKKM 2ASLA 1DO0A 2LNHC 1SZPA 4UB5A 1VEGA 3HILA 3ZI4A 2LXEA 2I9GA 2V6ZM 2HDOA 1NJXA 2V4RA 4ANRA 4MFCA 1TH3A 1GVNA 2ZAMA 3L3FX 1NZBA 3N4MB 4B3MM 4G3OA 4MM3B 3V6HA 3SR6A 3H40A 3E0FA 1ZJMA 3H4MA 3JPSA 2FE9A 4TUWA 3KZIU 4DOBA 4QOSA 2G09A 4M9JA 3KS4A 3RB0A 5KFUA 3EPGA 4UBBA 1VDLA 1XNQM 4ECVA 4PZNA 4KLDA 4KMOB 2KW0A 3EWAA 5KFQA 2JZBA 2N1RA 1PJSA 3PSTA 5ITYA 5H37D 2YQEA 3N7PD 2RGHA 3VDUA 2NO4A 5GTHU 2HHWA 4LGMA 1PJQA 3Q8QB 1VLBA 2PKEA 3GPPA 3MR3A 4FCVA 5KT7A 3QXGA 1AIPC 4ECSA 3M1YA 2QSFX 1N77A 3L25A 4NL9A 1X40A 2C28A 2FH0A 1VJ5A 4P0PA 5DYGA 1SXJC 3PXGA 4B7HA 1MN3A 1P3QQ 1I94M 3MBYA 4U7CA 2XI9A 3ORYA 4R3DA 5G5HA 2K4HA 2RRDA 1OFIA 2W3RA 1JROA 2XY6A 4D80A 5AKZA 3GLGE 5KT2A 4M0WA 1GJSA 3TAQA 1G8PA 2L4EA 3GLFA 4F4XA 4I27A 1GKIA 4OVZB 5DGAA 3M9MB 4YMOA 2EKKA 1ZJNA 3T5HA 4EZ6A 2J6SA 2C5RA 1XMQM 1SB3C 2JRZA 5BOLA 3FUVA 4NLKA 1U47A 3B9PA 2FJ6A 4ICAA 3UMCA 3MR5A 3SV3A 2OM6A 1KKXA 4YXJA 1N56A 3SAUA 4YCXA 4RPZA 3ZDDA 4GIPA 2YMPA 3IG8A 1SIJA 5EXXA 4DS4A 2J6UA 3WKAA 2YQZA 3U5ZA 3AU6A 1RQLA 3M9OB 3Q8KA 2C9CA 3BZCA 2JZ1A 2R45A 3H0MB 2P5TA 3IM1A 4YD1A 3CTWB 3GU3A 4BUGA 3V7KA 4FWGA 2X8AA 5HHIA 3LCUA 2BPFA 5ALQA 1WJ7A 4LJXA 3ZQJA 5J0UA 3VKHA 3RH6A 4XQ8A 5FSWA 2ZM6M 1SKRA 2MUTB 3TADC 4DFMA 3ZH9B 3RJGA 3I01M 2YB1A 3ED5A 4QWDA 3W0FA 5KFMA 2RRUA 3H0RB 3BZKA 1HT2E 1ZQWA 5AKYA 1OJLA 1QZMA 5ALGA 3PVXA 5HR6A 2DUYA 4EBCA 1L7PA 1N2XA 3UGJA 4YR3A 4CNQA 2ZG6A 1X6IA 5CB1A 3QUTA 3QX7A 4OJ6A 4I2FA 1MSWD 5E26A 5ITTA 3EYZA 3FKEA 1WXQA 1HEKA 8ICGA 2Y0TA 4OJ5A 5DG9A 3ZDBA 8ICZA 1GJTA 3T5LA 1RU3A 3RRGA 3GV8B 2BWEA 4LFBM 1ZRNA 4DF4A 2LVAA 2ZIVB 3GLIA 1BPZA 3QAUA 5KFZA 1QQWA 5EXPA 3NASA 9ICPA 3U6LA 8CATA 1JN3A 1NK8A 4BB9A 2F8KA 9ICWA 4UAUA 3IHPA 2WF9A 3QE9Y 4KLLA 2AQ0A 4LJ4A 4RZRA 3PW7A 3HX0A 2DPJA 4YXMA 2H5XA 2E8MA 2EAPA 1N62A 1S0VA 1X9WA 2ASDA 2CRXA 3OTQA 5KFCA 1JR3E 4I2AA 2UXCM 1ECWA 3RRHA 1HUZA 5KFRA 4IJEA 4EYIB 1NK6A 2UVUA 4DR1M 2B3TA 2LPEA 2WAQC 1U48A 5C0YA 3HU3A 2LVOC 4JI8M 1Z00B 1QAQA 4PD2A 1ZQVA 3K75D 5KT5A 5DYIA 3IDWA 2DL0A 1Z5CA 2DWMA 2M9NA 3FC4A 4EELA 2HHHM 5FTLA 2IOFA 2DZNB 4OO1J 2W03A 2UXBM 3QU7A 3O0FA 4OJLA 4BWMA 8ICFA 5CJ7A 2WF6A 1JI7A 4LZDA 4IBJA 4B08A 4DQQA 5DB8A 3TWKA 1ZQAA 1KFTA 4DQRA 3LWMA 5KFVA 5KNIA 1L7MA 3T79A 5BPCA 3KKAC 3Q8RB 4OVZA 2KOBA 3MR6A 1XWIA 3FYDA 3H4BA 2ZJ8A 1BVSA 2Y21A 2GOLA 1ZQPA 4JV2A 1YT3A 1ZQYA 2MSNA 4C8OA 2VQEM 3UMMA 2YN4A 5KL1B 4REZA 3PR5B 2C22A 3EPIA 2KXEA 3GPUA 3HJEA 3SAGA 1E94E 2HBLA 2KZ3A 3FTEA 3JPOA 3C28A 1DXSA 2O01F 1UQVA 1ZQGA 2EZZA 4TQSA 3GQ4A 4UB3A 5J0PA 2MAXA 4Z6YA 5KG6A 1IY1A 2DHYA 3TANA 2BGWA 4G4QA 5KG7A 1SXJD 2L7HA 2YMQA 4Q8FA 2OHFA 4UB6U 2HHTA 3NRZA 1S3SA 5FTNA 2KVCA 2GQFA 4EBEA 4PT5A 2BQRA 1YE9A 2KSOB 1K1SA 3RB4A 2VJ5A 3DV9A 4D82A 3D8LA 8ICLA 2XLJA 2EH9A 2OCEA 2QARB 2LTUA 2NRXA 1QDRA 3N28A 4YR2A 1KQQA 1DK3A 1ZQZA 3TWLA 3LDAA 1ZD3A 3C5GA 5L1KA 3HPOA 5BOMA 8ICQA 2XGPA 4IQTA 4DR3M 5J0QA 1E32A 4IBFA 2QB1A 4F2RA 4JWMA 1L6NA 9ICVA 3V6JA 4ECRA 4Y2VA 5AKHA 5DB7A 3H0LB 1KFSA 3KOXE 4D81A 4J9KA 1D2NA 1F5SA 4IBGA 2G5IB 3FYHA 4I28A 9ICIA 1L1TA 4DR6M 4Y2TA 4R66A 3JPTA 5KFWA 2ZIVA 4JV1A 1QH9A 3HY5A 9ICGA 3PO5A 3SZ2A 1RXWA 2J6TA 4NLNA 1DGJA 5J2DA 4JI3M 3KHRA 3G6VA 4M0AA 3SASA 4UN2B 2W8LA 4C7YA 5J2HA 5L1JA 3TQ1A 5ALPA 1G4AE 2LH0A 2K47A 4LF5M 1RM6C 3KFUF 4NXZA 5DKWA 3ZCBB 4XUSA 3M0EA 5J2IA 4Y2SA 4CCHA 3U6PA 3F2CA 1TDHA 4RNAA 3HU1A 5KQ8A 3TL4X 1S8OA 2LHGA 1NV9A 2KJ5A 1OUQA 4P17A 2KFNA 3C1ZA 2CV2A 2B0CA 5AM4A 3UXOA 2KA6B 5DG8A 4KLSA 4QW9A 8ICOA 2J7NA 1Z00A 3WK7A 5CA7A 1OIPA 4GMQA 5AM1A 2W9BA 4Y28F 2CHGA 5AKXA 4DFDA 2CPRA 1NK7A 1U9LA 1ZQBA 1N33M 4F72A 1D8BA 5JRTA 5DGBA 4UQGA 4DO9A 1TH4A 4L15A 3GPXA 2UU9M 2R44A 1Z3EB 2ZTCA 9ICMA 4AQYM 5J2EA 3MMPA 1CRXA 2KD1A 1NVMA 5AKGA 2ZUCA 1QVRA 2L09A 1F4IA 1KDHA 3VK7A 4P0QB 2A1JA 3HGIA 4DV2M 2UVVA 2XCAA 2GWSA 4RQ2A 4QZ8A 3FYCA 3PVSA 2EO2A 2YMMA 2RHFA 1EE8A 1F0MA 2JUJA 3U6DA 2UXDM 2ZIXB 3TADA 1PVPA 4KLOA 3S6JA 2LM4A 8ICJA 3FUUA 2CV1A 5EE9A 2D3DA 1PZNA 1VEKA 1X9SA 4O3OA 5IWAM 1QYRA 1IXSB 2JEIA 5J2FA 3ILKA 5G5GA 5HMMA 1LVHA 2C96A 5ITUA 3C3DA 2O6KA 1NKBA 4M9XA 2J5YA 2KNZA 3R8FA 3ALRA 3KFUG 4ED2A 3KHLA 5DQHA 1COKA 4QWBA 4I2DA 4TURA 3Q8GA 1A6SA 3M9NB 2HI0A 2KSOA 5AI5A 4ECYA 3CGWA 3JAMS 3PV8A 2Z4RA 4B9UA 1TK8A 2LHTA 4F4ZA 2QARA 4LJAA 2N35A 5ALIA 2EZYA 3K4GA 2RDJA 4MFFA 3FUWA 1K5OA 2LYBA 5ALKA 5KT6A 1RPLA 5DDYA 4F2SA 2KFZA 2DQNB 4RF0A 3C58A 2KICA 1X9MA 3LVVA 2FLPA 1FEZA 4I5SA 5EE3A 2NRVA 4O3MA 3L29A 4UB2A 2AGOA 3PX0A 1SL1A 1X2IA 2JR5A 2VF7A 5JI2E 4F5NA 5KFNA 3GPYA 4BXOA 5B66U 2HBKA 4LGYA 7ICGA 3AL0C 2HBJA 1Z5AA 4MB7A 8ICKA 3MJ5A 2WSFF 1A76A 3WKCA 4TUQA 3DA1A 3GQ3A 3LMMA 2G8LA 3GIMA 4PZOA 3KZXA 2LWXA 5DLGA 3PMLA 4Z6FA 2CRUA 1YSYA 3KKAA 3FAHA 2QKQA 2HOFA 2XICA 3RBEA 3C2KA 2HHXA 3NWLA 4I29A 4MGYE 2C2RA 1PK1B 2HHUA 1S77D 3WKBA 2X49A 3ISBA 4RKUF 1DGFA 3ETLA 8ICSA 2R8HA 3HKZF 4AYBF 4EENA 7ICTA 5ALWA 1L3SA 3L27A 2QCUA 1ZQUA 3EIEA 4DL3A 4LZZA 1Y88A 4M9NA 2KN7A 1V9PA 4LF7M 2YR0A 4DR5M 5KFPA 4QZHA 2E5SA 2Y0QA 2E1EA 4KLHA 4AKGA 4K4GA 3OHAA 1V85A 4QIWF 5IIIA 5JU5A 1UT5A 4QNMA 9ICJA 1Z6TA 1TAQA 4P0QA 4RQ3A 4U6PA 1U49A 3W68A 1LV7A 5AKJA 2EA0A 2W3SA 3OTOM 1QQ7A 4TUPA 4DFKA 4UB1A 4F2LA 3GQCA 2AGPA 1Z1BA 1TH2A 8ICIA 4I2HA 2EDUA 3OHBA 5D46A 3A98B 4JI0M 3UZUA 4LZGA 4CE6A 2KZSA 1NV8A 4I4LA 4JI4M 4BX9C 4GC6A 1GL6A 1WGNA 2XF3A 1X6JA 4PL2A 1IXSA 3OPXA 1NY5A 1OW5A 2XO7A 1QSLA 7ICNA 2DAKA 2PFNA 3RB3A 2Z7JA 2D7EA 5DQIA 1TR8A 5EP2A 1IFYA 4F5RA 4I2IA 2KE7A 2KJ9A 3AOEC 1MN8A 2W7PA 2EJSA 3SMPA 4MGKE 3GDXA 1A5TA 3GQ5A 1SWWA 3H8SA 1NZPA 4CF3A 1RYSA 5ALUA 3SEIA 4LJ7A 2XSZD 3B7QA 1ZQFA 1QTMA 5IZ7D 4K4IA 2EUCA 4QZIA 2R4EA 1ZQHA 2F76X 4QZGA 3LVWA 2EAMA 4Y2QA 2XFSA 1RG6A 5F9NA 3OGUA 2LVPC 2Y9UA 1IV8A 4GC5A 2UUAM 1YZ6A 3BS7A 3BQ1A 8ICEA 3T38A 1C20A 5KFEA 4X64M 3W67A 8ICNA 4R71A 3UJNA 3GRRA 3AL0B 4G6ZA 5ITXA 2Y0SF 1HNXM 4OCZA 2FOIC 5AI4A 2W11A 4ECQA 3Q8SB 3B7NA 4IR1A 4KN7A 1NJGA 5EP1A 4PGQA 5AKIA 3PO4A 4I2EA 3PY8A 2EAOA 4ELUA 4J9MA 2L4FA 2XFTA 1N5WA 2WF7A 4LY6A 3U6CA 2ATLA 4IRKA 1GO3F 7ICPA 2DZLA 4IS7A 1OXJA 4DV1M 2W54A 3K1RB 4NJ8A 2R0IA 4J9NA 1A0PA 1N75A 3VDPA 1T3TA 3E9SA 1VQ1A 5C18A 3IP4B 3QNMA 5AKKA 5GTIU 3HHWA 4Y2XA 3HX3A 1NK9A 4AG6A 5KFOA 4QOZC 3PNYA 1Z4OA 2XSZA 1KN5A 4Y2JA 3NS1A 1RYRA 5H2FU 3N97B 1XSPA 3FTFA 4UAZA 3FDSA 2JGAA 4DQSA 1E9SA 8ICMA 1HQYE 1SXDA 5KPRA 3A45A 2K0BX 1D8LA 1BGXT 3SQIA 3GO8A 3KTQA 2DAEA 4PHDA 4M6WB 2FE8A 1IXZA 4KLMA 4IBKA 4M04A 5J0TA 2K6BA 3GZFA 1Q3CA 4G4OA 4JXJA 2F1IA 4KX5A 1ED1A 5TZVA 2DZOB 1Q46A 1BPYA 5EXSA 1QANA 3KVWA 9ICLA 3GLGA 1D0MA 3M8SA 2OOBA 1YZ7A 3U6QA 2UUBM 3U6SA 5IREB 2UVRA 3HJQA 2VJ4A 3B7ZA 3KOOA 4QJFB 4C8LA 2DVWB 2IBKA 3FTDA 3F5AA 5AI0A 5AHXA 4DSKA 2WSCF 2BCRA 4GRIA 3V7JA 3H8MA 2W82A 4LG2A 4CGZA 5BR8M 1WYGA 3BS5B 3U61B 3TFRA 4IC9A 9ICRA 4X66M 1SL0A 1L8QA 5ALHA 2WHEA 5DB6A 1MU5A 1PJTA 2QP9X 1GABA 5AIBA 7ICQA 5HP4A 1ZXIA 3CNHA 4L78A 5J0OA 3I51A 2LM1A 1ZQNA 3MHVC 3KW6A 3SAFA 2BKEA 1NKCA 3RJJA 3QU2A 1U4BA 2IA6A 2K89A 2RLTA 4JN6A 3PSPA 5DFLA 4CISA 1GO5A 4O3RA 5KT4A 4KLFA 1BNPA 3AU2A 5CRXA 4I2JA 3LWLA 3V6KA 8ICUA 1IN5A 3T15A 1XO0A 3GRUA 2DI0A 2CUZA 1ZQDA 7ICJA 2DKXA 1DGSA 1QSSA 2HMXA 1ZQOA 5ITRA 4G9BA 4M9ZA 1EIJA 1BPEA 3H7IA 2WSEF 1N34M 5AM5A 4QNLA 1OKSA 5JUMA 5HNKA 2F5QA 4CF5A 1HUOA 4C4SA 4FZNA 4BLCA 3IV6A 4DV5M 3D2QA 3K9OA 1CUKA 2OPFA 3IHQB 2F44A 1H38A 5IINA 3Q8LA 1XNSA 1N63A 3TFSA 4GLXA 2KVSA 3CP8A 3R9XB 3RBDA 2QB0B 1X66A 2HSZA 5ALMA 2KNAA 5DDMA 4JI7M 2JY5A 2QHOB 4RT2A 2NO5A 2APLA 3HKPA 8ICHA 7ICHA 4I2GA 4FE3A 3VCBA 1WG8A 4NRVA 3W0LB 2ZXHA 4ZPXA 2KKPA 4QWAA 3H8WA 2A19A 1IN8A 4C4TA 1JR3A 4ELTA 4RT3A 1IQPA 4AW4A 1ZQRA 1L8OA 3FUTA 5L1IA 4F8RA 1DK2A 1ZMWA 5E6JA 1I4WA 4ECTA 2ZANA 3PW0A 9ICAA 1A77A 4KHPM 3AJIB 3GV5B 4IBDA 2NQ8C 4Z6EA 1R7RA 2QZ4A 9ICEA 4LZJA 2JMGA 4M6WA 2A3VA 1UCVA 3T3FA 1DOQA 2V4QA 3HJ8A 3C29A 2R8GA 2UVWA 5KTQA 2ERCA 1L3TA 4II7A 2E8PA 1LKYB 3E46A 4YP3A 2OH2A 4DFPA 1NHGC 4WP2A 2H1RA 4B3SM 3QYBA 5LMNM 1KSFX 2DXIA 2B21A 3R9KA 1Q3VA 3NBIA 5EP4A 4RPYA 4NY8A 2NRZA 3MR2A 4GFJA 5IIMA 2K4IA 4USAA 7ICEA 4Z6CA 4UATA 3AOEA 1IXRC 4RF1A 1XMOM 4JMUA 1N48A 4GXIA 2CN1A 5ALSA 1KW4A 4M0DA 1L1ZA 5T14A 4F5OA 5AI9A 2LYHA 2AJQA 4LF4M 2HAKA 3DEEA 4JK1A 3MABA 2E1FA 4GIBA 2H3FA 5JI3E 3BJYA 2KMDA 2M5ZA 1EFUB 1KEJA 1E9RA 4DR7M 4F5QA 4AKIA 4GC7A 1LTMA 1XHBA 2XCPA 2D6FC 4Y2YA 4YN4A 3NVZA 2F5PA 4ZH4A 4DF8A 5ALFA 1KRPA 2YMLA 3PNVA 1L8LA 5J0WA 3F2DA 1G3IA 4S12A 2ZXIA 3QWLA 3PX4A 1D8YA 5DQGA 5DLFA 5AIAA 2YTUA 2MUTA 1Z5BA 4FWDA 4MGHA 2P35A 3D6JA 5J2GA 2ZTDA 2P6UA 3VK8A 1HQCA 4AZFA 2E5LM 1Q39A 1HIWA 4CRXA 2ESEA 1JB0F 5EE1A 3PNCA 2DNAA 2YFQA 1S0MA 2XVTA 5KG1A 4PPXA 3L2AA 5IT9S 1UPHA 3QZ7A 1XXHE 2BZFA 1ZQQA 2JXNA 2OQ4A 5ALTA 3WU2U 3PZPA 1ZD2P 1RZTA 1JX4A 3B0XA 3NBXX 2M0NA 2Z4SA 2QB0A 2MJ5B 1FFUA 2CV0A 1M6YA 3F92A 1IIPA 4C0ZA 4QNRA 3A46A 4IQUA 4F4KA 2KZZA 4J9RA 3GRVA 4GHLA 1GL7A 3SARA 8ICAA 9ICNA 1JUDA 1UFZA 3LQQA 4OX9M 2YB4A 3I76A 4DBGB 4X5VA 4F91B 2R6FA 4RNNA 4RQ5A 3IN5A 3THVA 1B0XA 1HR0M 1IBLM 1NO1A 3WK8A 2DF4B 1NNUC 1G71A 2HCBA 8ICWA 3J2PB 3T5JA 4KLGA 4CDGA 2K60A 4WW0A 4YY3M 3ONNA 9ICQA 3A0HU 2HCFA 2JY7A 4PHPA 2CWBA 2P6RA 2GO7A 4KN4A 4PHEA 2DWZB 2F3NA 2H3QA 2PMZC 7ICFA 3I4YA 4OJOA 1NOMA 4RQ0A 1LKYA 3PX6A 4XRHA 4Z8XA 4YVZA 2I1QA 2EQYA 4RU9A 9ICBA 5AK3A 3U6EA 1ZQ9A 5EXTA 4MHVA 4LJ5A 3AMZA 4ED6A 5F9LA 3ZD9A 4B9VA 4IJFA 4GKJM 1VDVA 2W04A 4B6JA 5CR0A 4PGXA 1QLNA 3SYKA 4DSFA 4XBOA 5KFBA 3SHFA 5DNYA 3RTVA 1UM8A 5C1BA 1L7OA 4I81A 4DL5A 2JY6B 1NJYA 1SV4A 5KQDA 9ICCA 4IR9A 3D8BA 4JV5M 1ZQJA 3SV4A 4LRTA 3UM9A 2XGNA 4GEWA 4NOOB 4UAWA 2V1CA 3NTUA 4B9LA 4LVSA 1FNNA 2K8CB 5DG7A 1G59A 3FRHA 2XGQA 1TVAA 2ZAOA 4FWHA 2KDLA 7ICMA 4P4PA 7ICUA 1MJGM 4YD2A 5AICA 1WR1B 3DZDA 4F4WA 1QCKA 3JPNA 4FBTA 2KHHA 1L2DA 1ZQTA 2FDRA 5L1MA 4UAYA 2JEFA 1D0KA 4ITQA 3VFDA 5KFJA 4ECXA 2WAQF 2UUCM 2F1JA 1Z59A 4IBEA 1H6UA 4F3OA 2R8KA 2DBYA 1R4GA 2PFOA 4MGIE 2KTQA 1TAUA 4DL2A 5ITQA 2KHVA 2KP7A 4RUAA 1YLAA 2YNMD 2WB1C 1S97A 1TGUA 4KLUA 4JUZA 4UB4A 1LV5A 2JH7A 4NSRA 4UW9A 2AHMA 3KHHA 4DV0M 1ZV1A 2F5SA 1P7DA 2ZTEA 4AP9A 4JI5M 1J09A 1X37A 2M60A 4JI1M 3AN1A 1MC8A 4P2HA 2NV3A 2BDUA 3J27B 3DOAA 5J8YC 4EEYA 4J9PA 4Y2UA 4UASA 2QBYB 3B89A 4EBDA 1NK0A 3RAQA 2DWQA 3QEAZ 1L3VA 3KSJA 4B7GA 4FBUA 4ACOA 1L5UA 4ED3A 4AG5A 3SYZA 1ZQIA 2ZIUB 3C23A 2AHOB 1L2CA 2BQUA 3RAXA 8ICXA 2BDPA 1BPXA 4YFKA 1ZQCA 1W5SA 4KLEA 2KK0A 5F3XB 5FP0A 3RR7A 1XC9A 5EWGA 4RQ1A 1QAMA 3KDSE 2DENA 1DGGA 4B7FA 1N78A 3KOZE 3M6ZA 3AOGA 1MX0A 4PCZA 5L9XA 1AUAA 4FS1A 3B74A 4FD2A 1N60A 4LFCM 1QAOA 4YG2A 4UARA 4DOAA 1QZEA 4US9A 2JH1A 3HJSA 2JHDA 3MGVA 2E8OA 3HW8A 3GIKA 4PDIA 4GXJA 3SAHA 5KFAA 1IXRA 2RP5A 3L4PA 3PMNA 2DGZA 1O03A 3PSIA 5TISU 3LK9A 5KFKA 4EEKA 2F2AB 4QWEA 3J81S 7ICSA 1TDZA 5EP3A 4O5EA 5J0SA 2HL7A 5ALNA 1KL9A 4DSEA 2LI6A 4IQVA 4QHSA 4ECZA 3AEVA 4M9GA 5EWEA 5ALLA 3ZD8A 3WKEA 4DCCA 4LF6M 3D2SA 4QZBA 4FCWA 3UPQA 7ICOA 4W5WA 4I2CA 3M6AA 5CP2A 2KZMA 4JV0A 5CHGA 5C5JA 3HHYA 5KO3A 3ETRA 1B43A 4KT0F 3RJHA 3BOSA 3E4RA 3NVVA 2P66A 2C9OA 4E0DA 5BPVA 1HNZM 2ZIXA 4L8RC 4UBCA 4NC6A 1PJIA 3WKDA 2VDBB 1JXEA 1ZQEA 1AROP 3RH4A 8ICBA 2FPMA 3GLFB 1PM5A 2BCQA 4BWJA 2OYYA 2Y9TA 4DEZA 4IQWA 3DFZA 5L8RF 5KFYA 1QUTA 2CEAA 3WK5A 1TTEA 2XIDA 2FNAA 1J7KA 2G06A 1S0OA 4KITB 2G08A 3RR8A 3J80S 4EX6A 2XEPA 1SV0C 5KFHA 4A8EA 2L6OA 3KOYE 3K1JA 2GH1A 4R8UB 3C5FA 3JPPA 2LBCA 2J7OA 3MDAA 4O3QA 3A42A 3TKAA 2O5RA 2VQFM 4O5CA 2JY8A 2LKYA 4DUZM 1ZQXA 2KEYA 4TQRA 4J9LA 1J2NA 1FFVA 3HZJA 2KEBA 2JZ0A 2LVNC 4RNOA 4K4HA 2ZJ5A 4EX7A 1XU4A 1UA0A 3ICXA 3H4JA 4KLQA 2D7GA 4RQMA 1N61A 3BQ2A 4IIWA 5E79U 1NNLA 9ICFA 7ICLA 2FMPA 5DBCA 1R2YA 1TF0B 2PXIA 1NKEA 2H3ZA 2JV3A 3N7SC 2VF8A 3UQ2A 4PL1A 2Y1IA 4US8A 3ZDCA 4M9SA 2D7HA 2ES6A 3BDPA 3H4DA 1IY2A 3ISCA 3CRXA 3NGDA 4J9QA 2OEHA 3BBZA 2A5YB 1DRGA 2MGWA 3Q8MA 4GHAA 3AUOA 3WK9A 4YMMA 3VC8A 4NL4H 5HMLA 1WCNA 2DWLA 2F5OA 2MU2A 4KMUA 4NWIA 3ZDEA 2KG5A 2XZFA 4O0IA 1IM2A 3GLIB 1Z4NA 4F92B 5HR7A 3C21A 2DWNA 2D8CA 1PK1A 2OO9A 4I8OA 1Q3BA 3RFAA 2KNJA 5KAIU 1KTQA 3GFKB 4DV7M 2EKFA 3A0BU 4ED1A 4G4RA 4DLEA 2W9CB 2LBOA 4YR0A 2G0AA 3MGIA 3QUCA 4R65A 5AK5A 1TK5A 5CEHA 3NVWA 5KFXA 1Y8GA 2MRLA 5LMUM 4JYAM 3LCVB 4Y2RA 2BHNA 1SL2A 1C7YA 1PVRA 2L5YA 3WHKA 1DO2A 2KRUA 4L4UA 1ZYQA 9ICUA 4IBBA 2QENA 5KPTA 2FS1A 3C9PA 2I6XA 3GV7B 1QDTA 1FO4A 1IG6A 4UAVA 4DV3M 2DKZA 2W9MA 4FCTA 2I5HA 3T1YM 3TI0A 1EXNA 1SKSA 2NRTA 2MA1A 1IY0A 5AI6A 4O3PA 1FIQA 1NY6A 4LF8M 5IIJA 2CE7A 3GIJA 3UXPA 1IM4A 1XWLA 3AV0A 2F8LA 3HWSA 3MC1A 4UB8U 1L3UA 2BNKA 5AI8A 2O25A 5KPZA 1JIHA 3E2EA 2Y20A 2WF5A 1ZQSA 2I7NA 3PW2A 7CATA 1RXVA 4XA5A 4DS5A 2R18A 1ZQKA 5J8YA 2R46A 1WHCA 1BNOA 1X42A 2LMRA 3RFWA 5ALOA 5J0RA 5ALXA 3THGA 3GLFE 4O3SA 5KG4A 4F5PA 4DOCA 2R8IA 2LYAA 5ALVA 4DLGA 1JR3D 3KOWE 3JPRA 4HLQA 3RJKA 1T3QA 1N36M 4R8UA 1XSNA 2DAGA 3ISDA 3SMSA 4MGZE 2HHVA 3WK6A 2WZJA 1T6OA 5J2KA 3KSXA 3F2BA 1R5LA 1GLNA 1XXHB 3I28A 3L28A 4GITA 1NK5A 1L2BA 2RQ5A 2OWOA 3PW5A 4B9NA 4DUYM 2BWBA 1NJFA 5EJCA 2ISOA 4Q44A 4RQ6A 3SAVA 1OQYA 1NHWC 2OOAA 3T6PA 1COOA 1PUZA 2Z8YM 3PR4A 3FUXA 4QZ9A 1VDDA 1KFDA 1G41A 1S76D 4KO8A 2CFOA 3G6YA 4JI2M 9ICKA 3RGPA 5J2AA 5FLXS 3KP0E 3KBBA 3PFIA 2H3IA 5AKEA 2GNOA 3QU4A 3CF0A 7ICVA 4C8NA 1UA1A 4C8KA 4DSLA 2ISPA 3VKGA 3GIIA 4RQ4A 1V97A 2C2EA 4MEXA 1DV0A 3SBJA 4BJQA 2B6GA 3RGSA 1ZQ1C 2XZUA 1J2MA 3RB6A 3QU9A 1OAOC 1PK3A 5DBAA 4DQIA 1XO1A 3QEBZ 2BCSA 4DV6M 3SENA 2E3TA 1TE2A 2ALZA 3KP1E 1T3NA 1IN6A 4B3TM 3UK6A 2Y1JA 3GLIE 1VG5A 3QYPA 2W9CA 4KODA 4XK8F 3LW5F 3WK4A 2KRKA 9ICHA 2AQ4A 3FE3A 4BGDA 4M9HA 1S0NA 4M2YA 3TQSA 1SXJB 4GC9A 3LQRA 4ZOHC 2FMSA 3U6MA 5AK6A 3C3EA 1O08A 1MQ3A 5KG0A 1KFVA 3OSPA 2IHMA 1TFRA 3CW2C 4CGYB 1ZOLA 1TAMA 1UT8A 2K8BB 4ECWA 1VEJA 3QUBA 4DR4M 3TARA 1Q3UA 5DB9A 3KHGA 1RQNA 4F50A 3NRWA 3BQ0A 2DAIA 3ZC7B 5KAFU 4KTQA 4HL4A 2IHNA 1B22A 2W9BB 1T8EA 2VKQA 1JALA 1Z19A 2C98A 1D9FA 3CYMA 3MK6A 1SV0A 3AQEA 3TPZA 2VA2A 5J29A 2QQ8A 4QZEA 4CHTB 4DV4M 3BS5A 1LB2B 4YHHM 3U61A 4B9TA 1KBUA 1SXEA 3T5KA 5KFGA 5GKNA 2KV2A 3AQFA 2X4AA 4MEYA 3MFHA 1SKWA 4FZMA 4C80A 4KLTA 1NJWA 4JB3A 3T1HM 3SAWA 7ICIA 1TKDA 2HVHA 3B0YA 3UMBA 2A1JB 2HKJA 2FFJA 1J97A 5J2BA 1XC8A 4R64A 3JPQA 1JMSA 2BPGA 2FPKA 3AFHA 5HHHA 3VLFB 3E58A 4NRWA 1T43A 1D9DA 5JTIA 3KD3A 3SD7A 2HHSA 5IIOA 3EZ5A 4C8MA 5K4LA 3J81j 5D4BA 3EUB2 5KG2A 5EOZA 1FJGM 4J9OA 3RH5A 3QU5A 2ASJA 4WJ3B 2EANA 4Y2PA 1NSFA 1SZHA
chains in the Genus database with same CATH topology
4FWGA 2JH7A 2F76X 2X8AA 2KKVA 4NSRA 1XXHA 3LVWA 2AHMA 2XFSA 4DV0M 2F5SA 2BJVA 1K82A 1P7DA 4JI5M 4GC5A 2UUAM 1J09A 3M7DA 4NV0A 1X37A 3T38A 3VKHA 2KIWA 2M60A 4JI1M 2R65A 4X64M 5FSWA 2ZM6M 2NV3A 3D2NA 2BDUA 3J27B 3DOAA 3UJNA 4LCBA 3ZH9B 3GRRA 3AL0B 2QBYB 4G6ZA 2YB1A 5ITXA 2Y0SF 1HNXM 2FOIC 5A2QS 3W0FA 3TWMA 3K1ZA 3H0RB 1NJGA 5EP1A 1HT2E 3RF9A 1OJLA 1QZMA 3KSJA 4B7GA 5HR6A 1URJA 4GH9A 4ACOA 2F4VM 3UGJA 3PSFA 4AG5A 3GP1A 2ZG6A 2ZIUB 2XFTA 1L2CA 5FTJA 1XNRM 1IN7A 4LY6A 3U6CA 4OJ6A 5KL8B 5E26A 5ITTA 3HHXA 4OJPA 1ZAEA 1WXQA 3FKEA 1GO3F 2Y0TA 1W5SA 1HEKA 4OJ5A 3CF2A 3HKZC 4AYBC 4DV1M 1QAMA 1PJJA 4LFBM 3KDSE 1DGGA 4B7FA 1N78A 3KOZE 3M6ZA 3AOGA 1MX0A 4PCZA 1J5EM 1N75A 3VDPA 1A0PA 1T3TA 3E9SA 5C18A 2R62A 2ZIVB 4FD2A 3GLIA 4LFCM 3IP4B 1QAOA 3QAUA 3HHWA 3HJSA 2JH1A 1QQWA 2JHDA 5EXPA 4AG6A 3MGVA 4QOZC 3PNYA 2VIIA 3FTCA 3U6LA 4PDIA 2XSZA 3Q8XA 8CATA 3SAHA 4QIWC 2RP5A 4BB9A 2Q4TA 3SFZA 2DGZA 3FTFA 3PSIA 3U60B 4LJ4A 2F2AB 3J81S 1SXJA 2JGAA 1E9SA 1KYIA 1TDZA 2CRXA 5EP3A 5FTMA 1HQYE 2HL7A 5KPRA 3A45A 4WURA 2UXCM 1ECWA 4G4NA 3SQIA 4IJEA 3GO8A 4DR1M 1SXJE 4QHSA 2WAQC 2FE8A 2HOQA 1IXZA 5C0YA 3HU3A 4IBKA 3GZFA 1Q3CA 4G4OA 2RKOA 4JXJA 4JI8M 4KX5A 1QAQA 4PD2A 3I4VA 4LF6M 3D2SA 1DGBA 2BJWA 5DYIA 1ED1A 2DZOB 4FCWA 5EXSA 1QANA 1Z5CA 3KVWA 3GLGA 2DWMA 2HHHM 5FTLA 2DZNB 4W5WA 3SMVA 4OO1J 2W03A 2UXBM 3M6AA 2H3VA 3F5EA 3O0FA 2JA2A 4OJLA 3U6QA 2UUBM 4A3VB 3U6SA 5IREB 3HHYA 4IBJA 4NXNM 4B08A 5KO3A 3HJQA 2VJ4A 3TWKA 5A0LA 3BOSA 3E4RA 4K0KM 2R4JA 4QJFB 2DVWB 3T79A 2C9OA 3FTDA 3F5AA 4OVZA 5BPVA 1HNZM 1T94A 2KOBA 2ZIXA 4GRIA 1OFHA 1ORYB 1XWIA 2W82A 3FYDA 4LJ6A 5BR8M 4L8RC 4LG2A 4CGZA 2Y21A 3H0MB 4LJ8A 1PJIA 2GOLA 1YT3A 3U61B 4IC9A 2VQEM 4X66M 1L8QA 3HU2A 3UMMA 4KLNA 2Y0SC 5KL1B 4PDGA 3GLFB 1MU5A 1DGHB 2QP9X 2ZBKB 4REZA 1PM5A 3J7AS 4OW0A 2OYYA 2KXEA 4L78A 3I51A 3DFZA 3MHVC 2CEAA 3KW6A 4X65M 3GPUA 3JR5A 2XIDA 3SAFA 2FNAA 2KHQA 1J7KA 2G06A 3SAGA 1E94E 2CHVA 2HBLA 2G08A 3J80S 3FTEA 4JN6A 2V1UA 2K89A 4R7GA 3PSPA 3KS8A 3C28A 2XEPA 4CISA 2CHQA 4A8EA 1JQJC 2OXOA 2L6OA 2ZIWB 3KOYE 3GQ4A 3K1JA 2GH1A 4Z6YA 1K3WA 1IY1A 1K3XA 4G4QA 1YUBA 2J7OA 3TE6A 4FVMA 2C99A 5CRXA 1SXJD 2L7HA 4AKHA 3A42A 3K8ZA 1IN5A 2O5RA 3RE8A 3T15A 2VQFM 1XO0A 3GRUA 1S3SA 5FTNA 2KVCA 2CUZA 2LKYA 4DUZM 2KEYA 4PT5A 2HMXA 5ITRA 1YE9A 4M9ZA 1N34M 3GLHB 4X62M 2KEBA 2VJ5A 4QNLA 4D82A 3D8LA 4NLCA 1HT1E 2F5QA 2XLJA 2I7PA 3ICXA 2F5NA 2D7GA 4B3RM 2L7IA 4IIWA 2VIXA 4FZNA 4BLCA 5FTKA 3TWLA 4DV5M 3D2QA 2OPFA 1R2YA 4DR3M 1E32A 4IBFA 2H3ZA 4DR2M 3N7SC 1L6NA 4PL1A 1MA7A 1XNSA 4M9SA 2D7HA 3H0LB 3KOXE 4D81A 4XGIA 3CP8A 4OU7A 3R9XB 1D2NA 1IY2A 4IBGA 2G5IB 3CRXA 1L1TA 4DR6M 2ZIVA 4JI7M 2A5YB 1DRGA 3KXEC 4GHAA 3HKPA 4FE3A 3VC8A 3VCBA 4NL4H 4NRVA 3W0LB 2ZXHA 4ZPXA 4JI3M 2KKPA 3N7RC 2DWLA 2F5OA 3SASA 4NWIA 1IN8A 1JR3A 1G4AE 2LH0A 2K47A 4NXMM 1IQPA 4LF5M 2HOIA 1R2ZA 1WUDA 3U60A 2XZFA 3NUQA 1IM2A 4AW4A 3GLIB 3KFUF 5HR7A 3ZCBB 3FUTA 3M0EA 2DWNA 1NSFA 3U6PA 5E6JA 1I4WA 2G5GX 2ZANA 1Q3BA 4I8OA 2KNJA 3RFAA 1TDHA 4MH0E 4KHPM 4RNAA 3F2CA 1W5TA 4L16A 3HU1A 3AJIB 4DV7M 5KQ8A 3TL4X 2KJ5A 4G4RA 4IBDA 1OUQA 2CV2A 2NQ8C 4P16A 1R7RA 2KA6B 2LBOA 2G0AA 2QZ4A 4LZJA 2JMGA 2A3VA 2RGOA 3C29A 3HJ8A 3K2LA 2HBMA 1C1KA 4NSOB 1NNJA 2ERCA 2MRLA 5LMUM 2J7NA 1IBMM 4II7A 4JYAM 4GMQA 2OH2A 2CHGA 1NHGC 1PVRA 2H1RA 4B3SM 5LMNM 1KSFX 2DXIA 3SHGB 2CPRA 3WHKA 1DO2A 2KRUA 4L4UA 1N32M 3NBIA 4IBBA 2QENA 2F77X 2K8AA 5EP4A 3LYSA 1R6BX 1N33M 5KPTA 1D8BA 1TH4A 4L15A 3GPXA 2UU9M 4GFJA 4DV3M 2K4IA 4FCTA 5F3WA 3T1YM 3SYLA 3AOEA 1IXRC 3EIHA 4RF1A 1XMOM 4JMUA 4AQYM 2MA1A 2DHRA 4BBAA 4LF9M 1CRXA 1IY0A 2CN1A 2KD1A 4P0PB 3GLGB 4IBIA 1NVMA 1NY6A 3GRYA 4M0DA 1L1ZA 4LF8M 3M6KA 5T14A 1QVRA 2CE7A 2L09A 2Z3XA 2XH9A 3VK7A 4LF4M 4P0QB 3DEEA 3AV0A 3HGIA 2E1FA 2F8LA 3HWSA 2H3FA 4DV2M 5JI3E 2BNKA 2M5ZA 2PMZF 5KPZA 2Y20A 3FYCA 3PVSA 2EO2A 1DGHA 2I7NA 2RHFA 3CF6E 1E9RA 3J7BA 7CATA 4DR7M 1EE8A 4AKIA 1SZHA 3U6DA 2UXDM 2ZIXB 1PVPA 2R18A 1F44A 2R46A 1XHBA 4QHTA 2D6FC 3FUUA 3IG5A 2CV1A 2K4EA 2F5PA 3RFWA 3L26A 4FZLA 5IWAM 3THGA 1QYRA 1IXSB 3PNVA 2Q2EB 3ILKA 2LYAA 3F2DA 1G3IA 1JR3D 3KOWE 2C96A 5ITUA 4HLQA 4S12A 2ZIWA 4LRSA 2ZXIA 3HHZA 1N36M 3FD9A 4IBCA 4M9XA 3QWLA 2QPAA 3R8FA 3SATA 3ALRA 3KFUG 3AKZA 3U5ZB 3SMSA 4MGZE 4LJ9A 2KJ8A 1A6SA 1Z5BA 4FWDA 3K92A 4MGHA 3GLHA 3KSXA 2QBYA 4JI6M 3F2BA 1GLNA 1XXHB 3JAMS 3VK8A 3L28A 4GITA 1HQCA 2Z4RA 1L2BA 4NLBA 4AZFA 2E5LM 2LHTA 1Q39A 1HIWA 4CRXA 4DUYM 1IN4A 4LJAA 1NJFA 5EJCA 2YFQA 2G07A 3SAVA 2XVTA 3FUWA 1NHWC 3L2AA 5IT9S 1UPHA 2ZIUA 2LYBA 3FUXA 1VDDA 1G41A 4FW9A 4RF0A 3C58A 4KO8A 2DQNB 2CFOA 2YX8A 3M7GA 2W7OA 4JI2M 4LFAM 3SC3A 3WHLA 2KZUA 3RGPA 2OQ4A 1IBKM 2G5HB 2KICA 3LVVA 5FLXS 3F53A 3PZPA 4EIWA 3KP0E 3PFIA 4I5SA 3U6OA 2H3IA 2WB1F 1PVQA 3CF0A 2M0NA 2Z4SA 4O3MA 3L29A 2CV0A 5ITXE 1HNWM 3VKGA 4AI6A 1Q3VA 5EQTA 4KX3A 1IIPA 5JI2E 4C0ZA 3JR4A 3GPYA 4GKKM 1DO0A 2LNHC 4QNRA 3A46A 2LXEA 3SBJA 4BJQA 2HBKA 4LGYA 2V6ZM 3AL0C 2HBJA 3GRVA 4GHLA 1Z5AA 4MB7A 3RGSA 2XZUA 1GL7A 3SARA 1ZQ1C 1TH3A 4OX9M 3LQQA 3MJ5A 2YB4A 1GVNA 2ZAMA 3L3FX 1NZBA 4DV6M 4B3MM 3DA1A 3IN5A 1HR0M 1IBLM 4MM3B 3LMMA 3GQ3A 2DF4B 1NNUC 3E0FA 2HCBA 3KP1E 3H4MA 1IN6A 4B3TM 2G8LA 3J2PB 4TUWA 3UK6A 3KZXA 4CDGA 2LWXA 4WW0A 4QOSA 4YY3M 3ONNA 2G09A 4KODA 1YSYA 3KS4A 2KRKA 2DWZB 2HOFA 1XNQM 2XICA 3TQSA 1SXJB 4GC9A 2H3QA 3NWLA 2PMZC 4MGYE 3I4YA 4OJOA 4KMOB 4Z8XA 2KW0A 3LQRA 3U6MA 2X49A 1KFVA 1DGFA 2N1RA 3PSTA 5ITYA 1ZQ9A 5EXTA 5H37D 3U6EA 4CGYB 3N7PD 4LJ5A 2RGHA 3VDUA 1TAMA 3HKZF 4AYBF 2K8BB 1Q3UA 4DR4M 4LGMA 3L27A 4IJFA 4GKJM 2W04A 2QCUA 3SYKA 3EIEA 4XBOA 4LZZA 3SHFA 3NRWA 3ZC7B 5DNYA 3GPPA 4FCVA 1UM8A 5C1BA 4LF7M 2YR0A 4DR5M 4HL4A 1N77A 4I81A 2Y0QA 3L25A 2E1EA 2E5SA 4AKGA 2VKQA 1Z19A 4P0PA 5DYGA 1SXJC 2C98A 3PXGA 4B7HA 5KQDA 4QIWF 1I94M 3CYMA 3MK6A 4U7CA 3AQEA 3D8BA 3TPZA 4QNMA 4JV5M 4R3DA 2XI9A 4BUGA 1Z6TA 4LRTA 4CHTB 4DV4M 2XGNA 2K4HA 2RRDA 4P0QA 4YHHM 1OFIA 3U61A 1LV7A 4U6PA 4NOOB 2V1CA 1FNNA 2K8CB 4D80A 2EA0A 1G59A 5GKNA 1KBUA 2KV2A 4M0WA 3AQFA 3OTOM 1G8PA 3GLFA 2ZAOA 4FWHA 1Z1BA 1GKIA 2X4AA 4OVZB 1TH2A 4FZMA 3A98B 3DZDA 4JI0M 3UZUA 3SAWA 3T1HM 2KZSA 1L2DA 4I4LA 4JI4M 4BX9C 2C5RA 1XMQM 2HKJA 1GL6A 2FFJA 4ITQA 1XC8A 3VFDA 2XF3A 3FUVA 2WAQF 3B9PA 3AFHA 2UUCM 4ICAA 1Z59A 3VLFB 4NRWA 2OM6A 4IBEA 1H6UA 3OPXA 1NY5A 4PL2A 3SAUA 4MGIE 2Z7JA 2D7EA 4GIPA 5ITQA 3IG8A 5EP2A 2KHVA 2YNMD 2WB1C 2KJ9A 3AOEC 1TGUA 1FJGM 2W7PA 3SMPA 4MGKE 5EXXA 3GQ5A 2YQZA 3U5ZA 4LJ7A 2XSZD 2C9CA 4WJ3B 5IZ7D 2EUCA 2R45A 2P5TA 3CTWB 3GU3A 2R4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R18 A;  2Z7J A; 
#chains in the Genus database with same CATH topology
 2ZUB A;  1V33 A;  2KKV A;  1XXH A;  5DBB A;  3BQ7 A;  4M9L A;  3BXW A;  4DSJ A;  2FPL A;  5EE0 A;  4QZF A;  1N5X A;  2BJV A;  1D0L A;  1K82 A;  3AM9 A;  3UQ0 A;  4P4O A;  4ED7 A;  3M7D A;  1T7P A;  4NV0 A;  2KIW A;  3MFI A;  2C2D A;  2R65 A;  1QUS A;  1RYU A;  3D2N A;  1KSP A;  4CIZ A;  8ICT A;  4LCB A;  4Q45 A;  1ZD4 A;  4P4M A;  5A2Q S;  1WCL A;  5KFL A;  5KFD A;  4ED8 A;  3TWM A;  3K1Z A;  1OAI A;  3RF9 A;  2MH8 A;  1URJ A;  4GH9 A;  2F4V M;  1UHU A;  3PSF A;  2NYV A;  3GP1 A;  5FTJ A;  1WWV A;  4B9M A;  1XNR M;  1IN7 A;  2CXY A;  2VA8 A;  5KL8 B;  5J2C A;  3I04 M;  3HHX A;  4OJP A;  1ZAE A;  2BCU A;  4F4Y A;  3CF2 A;  1U45 A;  3HKZ C;  4AYB C;  1PJJ A;  4PJ0 U;  5KFF A;  1ZET A;  4Q43 A;  2K9D A;  1J5E M;  4G3I A;  4C7Z A;  5KG5 A;  2R62 A;  1XS9 D;  3V76 A;  8ICV A;  3M8R A;  5KG3 A;  5AK4 A;  5J2J A;  4CJ6 A;  2VII A;  3FTC A;  3Q8X A;  4QIW C;  4BXO B;  4PH5 A;  2Q4T A;  3EW9 A;  5KFT A;  3SFZ A;  1WIV A;  3U60 B;  4ECU A;  4QWC A;  3BQT A;  5AM3 A;  1SXJ A;  5ALZ A;  4DL7 A;  1KYI A;  2EZX A;  3C2M A;  4L6V 6;  5FTM A;  4O3N A;  4RUC A;  3RJI A;  4WUR A;  3GIL A;  4G4N A;  1WWU A;  1SXJ E;  3TAC B;  2HOQ A;  1XB2 B;  2FI1 A;  3HWT A;  4KLI A;  1SG9 A;  4YQW A;  2RKO A;  3OJS A;  3I4V A;  5ALR A;  5D49 A;  3MGH A;  1DGB A;  2BJW A;  2JNH A;  2AGQ A;  4C4R A;  2HVI A;  1QQ6 A;  1B4F A;  2NRW A;  4O9M A;  2F1H A;  3SMV A;  2H3V A;  2KNV A;  1CEZ A;  3F5E A;  4FO6 A;  2JA2 A;  4A3V B;  4DFJ A;  5J0Y A;  1BPB A;  4NXN M;  2RDI A;  1Q8K A;  3RJF A;  2FLN A;  7ICK A;  5A0L A;  4K0K M;  2JEG A;  2R4J A;  4EYH B;  2XC9 A;  5IIK A;  5KFS A;  3IRU A;  3QUQ A;  1T94 A;  4MF2 A;  3Q8P B;  4FS2 A;  1OFH A;  4YMN A;  1ORY B;  4NLG A;  4LJ6 A;  4LJ8 A;  4JWN A;  2QLT A;  5ALY A;  5L1L A;  3HU2 A;  4R63 A;  2DPI A;  4KLN A;  5IIL A;  2Y0S C;  8ICC A;  4PDG A;  4QW8 A;  1DGH B;  2ZBK B;  3J7A S;  2AH5 A;  4OW0 A;  2PI4 A;  1OTR A;  9ICX A;  2PFP A;  4X65 M;  3JR5 A;  2W55 A;  4Z6D A;  4DL6 A;  2JWS A;  2KHQ A;  3HRD D;  4NL9 C;  2CHV A;  2V1U A;  4R7G A;  2QNJ A;  3KS8 A;  1NJZ A;  4HAI A;  1XSL A;  2CHQ A;  1JQJ C;  2OXO A;  2ZIW B;  3OSN A;  1SGG A;  1K3W A;  4FFD A;  1K3X A;  2VAN A;  1YUB A;  3TE6 A;  1QQ5 A;  4FVM A;  2C99 A;  4F93 B;  4AKH A;  1X9X A;  1V92 A;  3K8Z A;  2GLE A;  4NM2 A;  5B5E U;  4DWI A;  3RE8 A;  5ALD A;  3QZ8 A;  1T4G A;  3GLH B;  4X62 M;  1ZMU A;  4B9S A;  1AQ6 A;  4ELV A;  4NLC A;  1HT1 E;  2I7P A;  4DSI A;  2LVQ D;  2F5N A;  4IRD A;  3H8J A;  4B3R M;  2L7I A;  2VIX A;  2BQ3 A;  8ICP A;  4HYK A;  3E21 A;  5FTK A;  3B9J A;  5AKL A;  4PGY A;  2XY7 A;  9ICS A;  3UXN A;  2L2D A;  4DR2 M;  1Z1V A;  1MA7 A;  1S9F A;  2MR9 A;  3TAP A;  2KIV A;  4XGI A;  4OU7 A;  3NVY A;  5ALJ A;  3RJE A;  4BDP A;  3I1Y A;  2FLL A;  4ED0 A;  3KXE C;  2PI5 A;  2G3Q A;  4IRC A;  2FMQ A;  4IL6 U;  2MRO B;  7ICR A;  3N7R C;  2WF8 A;  1PGY A;  4NXM M;  1L7N A;  4PHA A;  2HOI A;  3K9P A;  1R2Z A;  1WUD A;  3U60 A;  3NUQ A;  2JEJ A;  4KLJ A;  8ICR A;  5AM0 A;  4QZD A;  5CWR A;  2G5G X;  3HT3 A;  1MQ2 A;  4MH0 E;  1W5T A;  4L16 A;  2HHQ A;  8ICY A;  3IEC A;  4P16 A;  2R8J A;  2HW3 A;  2ZJA A;  3QYE A;  2RGO A;  3K2L A;  2HBM A;  1C1K A;  1ZD5 A;  4NSO B;  1NNJ A;  1S10 A;  1IBM M;  1S5L U;  2JZB B;  4RNM A;  4DQP A;  4I2B A;  1JRP A;  3G6X A;  3SHG B;  1TK0 A;  1N32 M;  3LYS A;  2F77 X;  1SWV A;  2K8A A;  4MF8 A;  2WTF A;  1R6B X;  4O5K A;  2ZUD A;  1HJP A;  3C1Y A;  5F3W A;  4Q8E A;  3SYL A;  2E8N A;  3EIH A;  2DHR A;  1V34 A;  4BBA A;  4LF9 M;  2IOH A;  3PW4 A;  1Q02 A;  2K4P A;  4P0P B;  3GLG B;  4IBI A;  3GRY A;  3M6K A;  3FRI A;  9ICO A;  3SI8 A;  2Z3X A;  4OD0 A;  2XH9 A;  1QSY A;  1NK4 A;  1JXL A;  3HP6 A;  2WFA A;  2BPC A;  4EZ9 A;  1RDF A;  2PMZ F;  2CP8 A;  1KLN A;  4DL4 A;  2Q0Z X;  5ALE A;  4QZC A;  1DGH A;  4NLB A;  3CF6 E;  3J7B A;  1K1Q A;  2ODG A;  4CF4 A;  3U26 A;  4F71 A;  3L5K A;  2W8K A;  1F44 A;  4QHT A;  2DFL A;  4Q7J A;  1TV9 A;  3IG5 A;  2K4E A;  4QZA A;  4HEO A;  3L26 A;  4FZL A;  2JP7 A;  4RQ7 A;  2VA3 A;  3ZDA A;  2IOF K;  2Q2E B;  2YY6 A;  3V7L A;  1ZRM A;  2DAM A;  2ZIW A;  4LRS A;  2IMW P;  3HHZ A;  1NI3 A;  3FD9 A;  4IBC A;  5AM2 A;  2V9W A;  2QPA A;  5KFI A;  3MDC A;  3SAT A;  2AU0 A;  3AKZ A;  5KT3 A;  4J9S A;  3U5Z B;  4NM1 A;  4LJ9 A;  2KJ8 A;  5J0X A;  4TUS A;  3K92 A;  3GLH A;  2QBY A;  4JI6 M;  2BR0 A;  3C2L A;  2W9A A;  2JXJ A;  4M47 A;  5EWF A;  1IN4 A;  9ICT A;  1OIZ A;  2G07 A;  1ZQL A;  3GLH E;  1BPD A;  4MFA A;  2ZIU A;  4RQ8 A;  3V72 A;  1ZMV A;  3OJU A;  2DKL A;  4FW9 A;  2PFQ A;  2YX8 A;  3M7G A;  1PRB A;  2W7O A;  4NLZ A;  4LFA M;  3SC3 A;  3WHL A;  2KZU A;  1IBK M;  2G5H B;  4GXK A;  4RPX A;  2XY5 A;  3FM9 A;  3F53 A;  4EIW A;  4F1I A;  2AXT U;  4J03 A;  3U6O A;  1CI4 A;  1ZQM A;  2WB1 F;  1PVQ A;  3UMG A;  2A1A A;  5ITX E;  3DDH A;  1V38 A;  1WGL A;  1HNW M;  4RQN A;  2BCV A;  4AI6 A;  5EQT A;  2W43 A;  4KX3 A;  2LHC A;  3JR4 A;  2HWJ A;  4GKK M;  2ASL A;  1DO0 A;  2LNH C;  1SZP A;  4UB5 A;  1VEG A;  3HIL A;  3ZI4 A;  2LXE A;  2I9G A;  2V6Z M;  2HDO A;  1NJX A;  2V4R A;  4ANR A;  4MFC A;  1TH3 A;  1GVN A;  2ZAM A;  3L3F X;  1NZB A;  3N4M B;  4B3M M;  4G3O A;  4MM3 B;  3V6H A;  3SR6 A;  3H40 A;  3E0F A;  1ZJM A;  3H4M A;  3JPS A;  2FE9 A;  4TUW A;  3KZI U;  4DOB A;  4QOS A;  2G09 A;  4M9J A;  3KS4 A;  3RB0 A;  5KFU A;  3EPG A;  4UBB A;  1VDL A;  1XNQ M;  4ECV A;  4PZN A;  4KLD A;  4KMO B;  2KW0 A;  3EWA A;  5KFQ A;  2JZB A;  2N1R A;  1PJS A;  3PST A;  5ITY A;  5H37 D;  2YQE A;  3N7P D;  2RGH A;  3VDU A;  2NO4 A;  5GTH U;  2HHW A;  4LGM A;  1PJQ A;  3Q8Q B;  1VLB A;  2PKE A;  3GPP A;  3MR3 A;  4FCV A;  5KT7 A;  3QXG A;  1AIP C;  4ECS A;  3M1Y A;  2QSF X;  1N77 A;  3L25 A;  4NL9 A;  1X40 A;  2C28 A;  2FH0 A;  1VJ5 A;  4P0P A;  5DYG A;  1SXJ C;  3PXG A;  4B7H A;  1MN3 A;  1P3Q Q;  1I94 M;  3MBY A;  4U7C A;  2XI9 A;  3ORY A;  4R3D A;  5G5H A;  2K4H A;  2RRD A;  1OFI A;  2W3R A;  1JRO A;  2XY6 A;  4D80 A;  5AKZ A;  3GLG E;  5KT2 A;  4M0W A;  1GJS A;  3TAQ A;  1G8P A;  2L4E A;  3GLF A;  4F4X A;  4I27 A;  1GKI A;  4OVZ B;  5DGA A;  3M9M B;  4YMO A;  2EKK A;  1ZJN A;  3T5H A;  4EZ6 A;  2J6S A;  2C5R A;  1XMQ M;  1SB3 C;  2JRZ A;  5BOL A;  3FUV A;  4NLK A;  1U47 A;  3B9P A;  2FJ6 A;  4ICA A;  3UMC A;  3MR5 A;  3SV3 A;  2OM6 A;  1KKX A;  4YXJ A;  1N56 A;  3SAU A;  4YCX A;  4RPZ A;  3ZDD A;  4GIP A;  2YMP A;  3IG8 A;  1SIJ A;  5EXX A;  4DS4 A;  2J6U A;  3WKA A;  2YQZ A;  3U5Z A;  3AU6 A;  1RQL A;  3M9O B;  3Q8K A;  2C9C A;  3BZC A;  2JZ1 A;  2R45 A;  3H0M B;  2P5T A;  3IM1 A;  4YD1 A;  3CTW B;  3GU3 A;  4BUG A;  3V7K A;  4FWG A;  2X8A A;  5HHI A;  3LCU A;  2BPF A;  5ALQ A;  1WJ7 A;  4LJX A;  3ZQJ A;  5J0U A;  3VKH A;  3RH6 A;  4XQ8 A;  5FSW A;  2ZM6 M;  1SKR A;  2MUT B;  3TAD C;  4DFM A;  3ZH9 B;  3RJG A;  3I01 M;  2YB1 A;  3ED5 A;  4QWD A;  3W0F A;  5KFM A;  2RRU A;  3H0R B;  3BZK A;  1HT2 E;  1ZQW A;  5AKY A;  1OJL A;  1QZM A;  5ALG A;  3PVX A;  5HR6 A;  2DUY A;  4EBC A;  1L7P A;  1N2X A;  3UGJ A;  4YR3 A;  4CNQ A;  2ZG6 A;  1X6I A;  5CB1 A;  3QUT A;  3QX7 A;  4OJ6 A;  4I2F A;  1MSW D;  5E26 A;  5ITT A;  3EYZ A;  3FKE A;  1WXQ A;  1HEK A;  8ICG A;  2Y0T A;  4OJ5 A;  5DG9 A;  3ZDB A;  8ICZ A;  1GJT A;  3T5L A;  1RU3 A;  3RRG A;  3GV8 B;  2BWE A;  4LFB M;  1ZRN A;  4DF4 A;  2LVA A;  2ZIV B;  3GLI A;  1BPZ A;  3QAU A;  5KFZ A;  1QQW A;  5EXP A;  3NAS A;  9ICP A;  3U6L A;  8CAT A;  1JN3 A;  1NK8 A;  4BB9 A;  2F8K A;  9ICW A;  4UAU A;  3IHP A;  2WF9 A;  3QE9 Y;  4KLL A;  2AQ0 A;  4LJ4 A;  4RZR A;  3PW7 A;  3HX0 A;  2DPJ A;  4YXM A;  2H5X A;  2E8M A;  2EAP A;  1N62 A;  1S0V A;  1X9W A;  2ASD A;  2CRX A;  3OTQ A;  5KFC A;  1JR3 E;  4I2A A;  2UXC M;  1ECW A;  3RRH A;  1HUZ A;  5KFR A;  4IJE A;  4EYI B;  1NK6 A;  2UVU A;  4DR1 M;  2B3T A;  2LPE A;  2WAQ C;  1U48 A;  5C0Y A;  3HU3 A;  2LVO C;  4JI8 M;  1Z00 B;  1QAQ A;  4PD2 A;  1ZQV A;  3K75 D;  5KT5 A;  5DYI A;  3IDW A;  2DL0 A;  1Z5C A;  2DWM A;  2M9N A;  3FC4 A;  4EEL A;  2HHH M;  5FTL A;  2IOF A;  2DZN B;  4OO1 J;  2W03 A;  2UXB M;  3QU7 A;  3O0F A;  4OJL A;  4BWM A;  8ICF A;  5CJ7 A;  2WF6 A;  1JI7 A;  4LZD A;  4IBJ A;  4B08 A;  4DQQ A;  5DB8 A;  3TWK A;  1ZQA A;  1KFT A;  4DQR A;  3LWM A;  5KFV A;  5KNI A;  1L7M A;  3T79 A;  5BPC A;  3KKA C;  3Q8R B;  4OVZ A;  2KOB A;  3MR6 A;  1XWI A;  3FYD A;  3H4B A;  2ZJ8 A;  1BVS A;  2Y21 A;  2GOL A;  1ZQP A;  4JV2 A;  1YT3 A;  1ZQY A;  2MSN A;  4C8O A;  2VQE M;  3UMM A;  2YN4 A;  5KL1 B;  4REZ A;  3PR5 B;  2C22 A;  3EPI A;  2KXE A;  3GPU A;  3HJE A;  3SAG A;  1E94 E;  2HBL A;  2KZ3 A;  3FTE A;  3JPO A;  3C28 A;  1DXS A;  2O01 F;  1UQV A;  1ZQG A;  2EZZ A;  4TQS A;  3GQ4 A;  4UB3 A;  5J0P A;  2MAX A;  4Z6Y A;  5KG6 A;  1IY1 A;  2DHY A;  3TAN A;  2BGW A;  4G4Q A;  5KG7 A;  1SXJ D;  2L7H A;  2YMQ A;  4Q8F A;  2OHF A;  4UB6 U;  2HHT A;  3NRZ A;  1S3S A;  5FTN A;  2KVC A;  2GQF A;  4EBE A;  4PT5 A;  2BQR A;  1YE9 A;  2KSO B;  1K1S A;  3RB4 A;  2VJ5 A;  3DV9 A;  4D82 A;  3D8L A;  8ICL A;  2XLJ A;  2EH9 A;  2OCE A;  2QAR B;  2LTU A;  2NRX A;  1QDR A;  3N28 A;  4YR2 A;  1KQQ A;  1DK3 A;  1ZQZ A;  3TWL A;  3LDA A;  1ZD3 A;  3C5G A;  5L1K A;  3HPO A;  5BOM A;  8ICQ A;  2XGP A;  4IQT A;  4DR3 M;  5J0Q A;  1E32 A;  4IBF A;  2QB1 A;  4F2R A;  4JWM A;  1L6N A;  9ICV A;  3V6J A;  4ECR A;  4Y2V A;  5AKH A;  5DB7 A;  3H0L B;  1KFS A;  3KOX E;  4D81 A;  4J9K A;  1D2N A;  1F5S A;  4IBG A;  2G5I B;  3FYH A;  4I28 A;  9ICI A;  1L1T A;  4DR6 M;  4Y2T A;  4R66 A;  3JPT A;  5KFW A;  2ZIV A;  4JV1 A;  1QH9 A;  3HY5 A;  9ICG A;  3PO5 A;  3SZ2 A;  1RXW A;  2J6T A;  4NLN A;  1DGJ A;  5J2D A;  4JI3 M;  3KHR A;  3G6V A;  4M0A A;  3SAS A;  4UN2 B;  2W8L A;  4C7Y A;  5J2H A;  5L1J A;  3TQ1 A;  5ALP A;  1G4A E;  2LH0 A;  2K47 A;  4LF5 M;  1RM6 C;  3KFU F;  4NXZ A;  5DKW A;  3ZCB B;  4XUS A;  3M0E A;  5J2I A;  4Y2S A;  4CCH A;  3U6P A;  3F2C A;  1TDH A;  4RNA A;  3HU1 A;  5KQ8 A;  3TL4 X;  1S8O A;  2LHG A;  1NV9 A;  2KJ5 A;  1OUQ A;  4P17 A;  2KFN A;  3C1Z A;  2CV2 A;  2B0C A;  5AM4 A;  3UXO A;  2KA6 B;  5DG8 A;  4KLS A;  4QW9 A;  8ICO A;  2J7N A;  1Z00 A;  3WK7 A;  5CA7 A;  1OIP A;  4GMQ A;  5AM1 A;  2W9B A;  4Y28 F;  2CHG A;  5AKX A;  4DFD A;  2CPR A;  1NK7 A;  1U9L A;  1ZQB A;  1N33 M;  4F72 A;  1D8B A;  5JRT A;  5DGB A;  4UQG A;  4DO9 A;  1TH4 A;  4L15 A;  3GPX A;  2UU9 M;  2R44 A;  1Z3E B;  2ZTC A;  9ICM A;  4AQY M;  5J2E A;  3MMP A;  1CRX A;  2KD1 A;  1NVM A;  5AKG A;  2ZUC A;  1QVR A;  2L09 A;  1F4I A;  1KDH A;  3VK7 A;  4P0Q B;  2A1J A;  3HGI A;  4DV2 M;  2UVV A;  2XCA A;  2GWS A;  4RQ2 A;  4QZ8 A;  3FYC A;  3PVS A;  2EO2 A;  2YMM A;  2RHF A;  1EE8 A;  1F0M A;  2JUJ A;  3U6D A;  2UXD M;  2ZIX B;  3TAD A;  1PVP A;  4KLO A;  3S6J A;  2LM4 A;  8ICJ A;  3FUU A;  2CV1 A;  5EE9 A;  2D3D A;  1PZN A;  1VEK A;  1X9S A;  4O3O A;  5IWA M;  1QYR A;  1IXS B;  2JEI A;  5J2F A;  3ILK A;  5G5G A;  5HMM A;  1LVH A;  2C96 A;  5ITU A;  3C3D A;  2O6K A;  1NKB A;  4M9X A;  2J5Y A;  2KNZ A;  3R8F A;  3ALR A;  3KFU G;  4ED2 A;  3KHL A;  5DQH A;  1COK A;  4QWB A;  4I2D A;  4TUR A;  3Q8G A;  1A6S A;  3M9N B;  2HI0 A;  2KSO A;  5AI5 A;  4ECY A;  3CGW A;  3JAM S;  3PV8 A;  2Z4R A;  4B9U A;  1TK8 A;  2LHT A;  4F4Z A;  2QAR A;  4LJA A;  2N35 A;  5ALI A;  2EZY A;  3K4G A;  2RDJ A;  4MFF A;  3FUW A;  1K5O A;  2LYB A;  5ALK A;  5KT6 A;  1RPL A;  5DDY A;  4F2S A;  2KFZ A;  2DQN B;  4RF0 A;  3C58 A;  2KIC A;  1X9M A;  3LVV A;  2FLP A;  1FEZ A;  4I5S A;  5EE3 A;  2NRV A;  4O3M A;  3L29 A;  4UB2 A;  2AGO A;  3PX0 A;  1SL1 A;  1X2I A;  2JR5 A;  2VF7 A;  5JI2 E;  4F5N A;  5KFN A;  3GPY A;  4BXO A;  5B66 U;  2HBK A;  4LGY A;  7ICG A;  3AL0 C;  2HBJ A;  1Z5A A;  4MB7 A;  8ICK A;  3MJ5 A;  2WSF F;  1A76 A;  3WKC A;  4TUQ A;  3DA1 A;  3GQ3 A;  3LMM A;  2G8L A;  3GIM A;  4PZO A;  3KZX A;  2LWX A;  5DLG A;  3PML A;  4Z6F A;  2CRU A;  1YSY A;  3KKA A;  3FAH A;  2QKQ A;  2HOF A;  2XIC A;  3RBE A;  3C2K A;  2HHX A;  3NWL A;  4I29 A;  4MGY E;  2C2R A;  1PK1 B;  2HHU A;  1S77 D;  3WKB A;  2X49 A;  3ISB A;  4RKU F;  1DGF A;  3ETL A;  8ICS A;  2R8H A;  3HKZ F;  4AYB F;  4EEN A;  7ICT A;  5ALW A;  1L3S A;  3L27 A;  2QCU A;  1ZQU A;  3EIE A;  4DL3 A;  4LZZ A;  1Y88 A;  4M9N A;  2KN7 A;  1V9P A;  4LF7 M;  2YR0 A;  4DR5 M;  5KFP A;  4QZH A;  2E5S A;  2Y0Q A;  2E1E A;  4KLH A;  4AKG A;  4K4G A;  3OHA A;  1V85 A;  4QIW F;  5III A;  5JU5 A;  1UT5 A;  4QNM A;  9ICJ A;  1Z6T A;  1TAQ A;  4P0Q A;  4RQ3 A;  4U6P A;  1U49 A;  3W68 A;  1LV7 A;  5AKJ A;  2EA0 A;  2W3S A;  3OTO M;  1QQ7 A;  4TUP A;  4DFK A;  4UB1 A;  4F2L A;  3GQC A;  2AGP A;  1Z1B A;  1TH2 A;  8ICI A;  4I2H A;  2EDU A;  3OHB A;  5D46 A;  3A98 B;  4JI0 M;  3UZU A;  4LZG A;  4CE6 A;  2KZS A;  1NV8 A;  4I4L A;  4JI4 M;  4BX9 C;  4GC6 A;  1GL6 A;  1WGN A;  2XF3 A;  1X6J A;  4PL2 A;  1IXS A;  3OPX A;  1NY5 A;  1OW5 A;  2XO7 A;  1QSL A;  7ICN A;  2DAK A;  2PFN A;  3RB3 A;  2Z7J A;  2D7E A;  5DQI A;  1TR8 A;  5EP2 A;  1IFY A;  4F5R A;  4I2I A;  2KE7 A;  2KJ9 A;  3AOE C;  1MN8 A;  2W7P A;  2EJS A;  3SMP A;  4MGK E;  3GDX A;  1A5T A;  3GQ5 A;  1SWW A;  3H8S A;  1NZP A;  4CF3 A;  1RYS A;  5ALU A;  3SEI A;  4LJ7 A;  2XSZ D;  3B7Q A;  1ZQF A;  1QTM A;  5IZ7 D;  4K4I A;  2EUC A;  4QZI A;  2R4E A;  1ZQH A;  2F76 X;  4QZG A;  3LVW A;  2EAM A;  4Y2Q A;  2XFS A;  1RG6 A;  5F9N A;  3OGU A;  2LVP C;  2Y9U A;  1IV8 A;  4GC5 A;  2UUA M;  1YZ6 A;  3BS7 A;  3BQ1 A;  8ICE A;  3T38 A;  1C20 A;  5KFE A;  4X64 M;  3W67 A;  8ICN A;  4R71 A;  3UJN A;  3GRR A;  3AL0 B;  4G6Z A;  5ITX A;  2Y0S F;  1HNX M;  4OCZ A;  2FOI C;  5AI4 A;  2W11 A;  4ECQ A;  3Q8S B;  3B7N A;  4IR1 A;  4KN7 A;  1NJG A;  5EP1 A;  4PGQ A;  5AKI A;  3PO4 A;  4I2E A;  3PY8 A;  2EAO A;  4ELU A;  4J9M A;  2L4F A;  2XFT A;  1N5W A;  2WF7 A;  4LY6 A;  3U6C A;  2ATL A;  4IRK A;  1GO3 F;  7ICP A;  2DZL A;  4IS7 A;  1OXJ A;  4DV1 M;  2W54 A;  3K1R B;  4NJ8 A;  2R0I A;  4J9N A;  1A0P A;  1N75 A;  3VDP A;  1T3T A;  3E9S A;  1VQ1 A;  5C18 A;  3IP4 B;  3QNM A;  5AKK A;  5GTI U;  3HHW A;  4Y2X A;  3HX3 A;  1NK9 A;  4AG6 A;  5KFO A;  4QOZ C;  3PNY A;  1Z4O A;  2XSZ A;  1KN5 A;  4Y2J A;  3NS1 A;  1RYR A;  5H2F U;  3N97 B;  1XSP A;  3FTF A;  4UAZ A;  3FDS A;  2JGA A;  4DQS A;  1E9S A;  8ICM A;  1HQY E;  1SXD A;  5KPR A;  3A45 A;  2K0B X;  1D8L A;  1BGX T;  3SQI A;  3GO8 A;  3KTQ A;  2DAE A;  4PHD A;  4M6W B;  2FE8 A;  1IXZ A;  4KLM A;  4IBK A;  4M04 A;  5J0T A;  2K6B A;  3GZF A;  1Q3C A;  4G4O A;  4JXJ A;  2F1I A;  4KX5 A;  1ED1 A;  5TZV A;  2DZO B;  1Q46 A;  1BPY A;  5EXS A;  1QAN A;  3KVW A;  9ICL A;  3GLG A;  1D0M A;  3M8S A;  2OOB A;  1YZ7 A;  3U6Q A;  2UUB M;  3U6S A;  5IRE B;  2UVR A;  3HJQ A;  2VJ4 A;  3B7Z A;  3KOO A;  4QJF B;  4C8L A;  2DVW B;  2IBK A;  3FTD A;  3F5A A;  5AI0 A;  5AHX A;  4DSK A;  2WSC F;  2BCR A;  4GRI A;  3V7J A;  3H8M A;  2W82 A;  4LG2 A;  4CGZ A;  5BR8 M;  1WYG A;  3BS5 B;  3U61 B;  3TFR A;  4IC9 A;  9ICR A;  4X66 M;  1SL0 A;  1L8Q A;  5ALH A;  2WHE A;  5DB6 A;  1MU5 A;  1PJT A;  2QP9 X;  1GAB A;  5AIB A;  7ICQ A;  5HP4 A;  1ZXI A;  3CNH A;  4L78 A;  5J0O A;  3I51 A;  2LM1 A;  1ZQN A;  3MHV C;  3KW6 A;  3SAF A;  2BKE A;  1NKC A;  3RJJ A;  3QU2 A;  1U4B A;  2IA6 A;  2K89 A;  2RLT A;  4JN6 A;  3PSP A;  5DFL A;  4CIS A;  1GO5 A;  4O3R A;  5KT4 A;  4KLF A;  1BNP A;  3AU2 A;  5CRX A;  4I2J A;  3LWL A;  3V6K A;  8ICU A;  1IN5 A;  3T15 A;  1XO0 A;  3GRU A;  2DI0 A;  2CUZ A;  1ZQD A;  7ICJ A;  2DKX A;  1DGS A;  1QSS A;  2HMX A;  1ZQO A;  5ITR A;  4G9B A;  4M9Z A;  1EIJ A;  1BPE A;  3H7I A;  2WSE F;  1N34 M;  5AM5 A;  4QNL A;  1OKS A;  5JUM A;  5HNK A;  2F5Q A;  4CF5 A;  1HUO A;  4C4S A;  4FZN A;  4BLC A;  3IV6 A;  4DV5 M;  3D2Q A;  3K9O A;  1CUK A;  2OPF A;  3IHQ B;  2F44 A;  1H38 A;  5IIN A;  3Q8L A;  1XNS A;  1N63 A;  3TFS A;  4GLX A;  2KVS A;  3CP8 A;  3R9X B;  3RBD A;  2QB0 B;  1X66 A;  2HSZ A;  5ALM A;  2KNA A;  5DDM A;  4JI7 M;  2JY5 A;  2QHO B;  4RT2 A;  2NO5 A;  2APL A;  3HKP A;  8ICH A;  7ICH A;  4I2G A;  4FE3 A;  3VCB A;  1WG8 A;  4NRV A;  3W0L B;  2ZXH A;  4ZPX A;  2KKP A;  4QWA A;  3H8W A;  2A19 A;  1IN8 A;  4C4T A;  1JR3 A;  4ELT A;  4RT3 A;  1IQP A;  4AW4 A;  1ZQR A;  1L8O A;  3FUT A;  5L1I A;  4F8R A;  1DK2 A;  1ZMW A;  5E6J A;  1I4W A;  4ECT A;  2ZAN A;  3PW0 A;  9ICA A;  1A77 A;  4KHP M;  3AJI B;  3GV5 B;  4IBD A;  2NQ8 C;  4Z6E A;  1R7R A;  2QZ4 A;  9ICE A;  4LZJ A;  2JMG A;  4M6W A;  2A3V A;  1UCV A;  3T3F A;  1DOQ A;  2V4Q A;  3HJ8 A;  3C29 A;  2R8G A;  2UVW A;  5KTQ A;  2ERC A;  1L3T A;  4II7 A;  2E8P A;  1LKY B;  3E46 A;  4YP3 A;  2OH2 A;  4DFP A;  1NHG C;  4WP2 A;  2H1R A;  4B3S M;  3QYB A;  5LMN M;  1KSF X;  2DXI A;  2B21 A;  3R9K A;  1Q3V A;  3NBI A;  5EP4 A;  4RPY A;  4NY8 A;  2NRZ A;  3MR2 A;  4GFJ A;  5IIM A;  2K4I A;  4USA A;  7ICE A;  4Z6C A;  4UAT A;  3AOE A;  1IXR C;  4RF1 A;  1XMO M;  4JMU A;  1N48 A;  4GXI A;  2CN1 A;  5ALS A;  1KW4 A;  4M0D A;  1L1Z A;  5T14 A;  4F5O A;  5AI9 A;  2LYH A;  2AJQ A;  4LF4 M;  2HAK A;  3DEE A;  4JK1 A;  3MAB A;  2E1F A;  4GIB A;  2H3F A;  5JI3 E;  3BJY A;  2KMD A;  2M5Z A;  1EFU B;  1KEJ A;  1E9R A;  4DR7 M;  4F5Q A;  4AKI A;  4GC7 A;  1LTM A;  1XHB A;  2XCP A;  2D6F C;  4Y2Y A;  4YN4 A;  3NVZ A;  2F5P A;  4ZH4 A;  4DF8 A;  5ALF A;  1KRP A;  2YML A;  3PNV A;  1L8L A;  5J0W A;  3F2D A;  1G3I A;  4S12 A;  2ZXI A;  3QWL A;  3PX4 A;  1D8Y A;  5DQG A;  5DLF A;  5AIA A;  2YTU A;  2MUT A;  1Z5B A;  4FWD A;  4MGH A;  2P35 A;  3D6J A;  5J2G A;  2ZTD A;  2P6U A;  3VK8 A;  1HQC A;  4AZF A;  2E5L M;  1Q39 A;  1HIW A;  4CRX A;  2ESE A;  1JB0 F;  5EE1 A;  3PNC A;  2DNA A;  2YFQ A;  1S0M A;  2XVT A;  5KG1 A;  4PPX A;  3L2A A;  5IT9 S;  1UPH A;  3QZ7 A;  1XXH E;  2BZF A;  1ZQQ A;  2JXN A;  2OQ4 A;  5ALT A;  3WU2 U;  3PZP A;  1ZD2 P;  1RZT A;  1JX4 A;  3B0X A;  3NBX X;  2M0N A;  2Z4S A;  2QB0 A;  2MJ5 B;  1FFU A;  2CV0 A;  1M6Y A;  3F92 A;  1IIP A;  4C0Z A;  4QNR A;  3A46 A;  4IQU A;  4F4K A;  2KZZ A;  4J9R A;  3GRV A;  4GHL A;  1GL7 A;  3SAR A;  8ICA A;  9ICN A;  1JUD A;  1UFZ A;  3LQQ A;  4OX9 M;  2YB4 A;  3I76 A;  4DBG B;  4X5V A;  4F91 B;  2R6F A;  4RNN A;  4RQ5 A;  3IN5 A;  3THV A;  1B0X A;  1HR0 M;  1IBL M;  1NO1 A;  3WK8 A;  2DF4 B;  1NNU C;  1G71 A;  2HCB A;  8ICW A;  3J2P B;  3T5J A;  4KLG A;  4CDG A;  2K60 A;  4WW0 A;  4YY3 M;  3ONN A;  9ICQ A;  3A0H U;  2HCF A;  2JY7 A;  4PHP A;  2CWB A;  2P6R A;  2GO7 A;  4KN4 A;  4PHE A;  2DWZ B;  2F3N A;  2H3Q A;  2PMZ C;  7ICF A;  3I4Y A;  4OJO A;  1NOM A;  4RQ0 A;  1LKY A;  3PX6 A;  4XRH A;  4Z8X A;  4YVZ A;  2I1Q A;  2EQY A;  4RU9 A;  9ICB A;  5AK3 A;  3U6E A;  1ZQ9 A;  5EXT A;  4MHV A;  4LJ5 A;  3AMZ A;  4ED6 A;  5F9L A;  3ZD9 A;  4B9V A;  4IJF A;  4GKJ M;  1VDV A;  2W04 A;  4B6J A;  5CR0 A;  4PGX A;  1QLN A;  3SYK A;  4DSF A;  4XBO A;  5KFB A;  3SHF A;  5DNY A;  3RTV A;  1UM8 A;  5C1B A;  1L7O A;  4I81 A;  4DL5 A;  2JY6 B;  1NJY A;  1SV4 A;  5KQD A;  9ICC A;  4IR9 A;  3D8B A;  4JV5 M;  1ZQJ A;  3SV4 A;  4LRT A;  3UM9 A;  2XGN A;  4GEW A;  4NOO B;  4UAW A;  2V1C A;  3NTU A;  4B9L A;  4LVS A;  1FNN A;  2K8C B;  5DG7 A;  1G59 A;  3FRH A;  2XGQ A;  1TVA A;  2ZAO A;  4FWH A;  2KDL A;  7ICM A;  4P4P A;  7ICU A;  1MJG M;  4YD2 A;  5AIC A;  1WR1 B;  3DZD A;  4F4W A;  1QCK A;  3JPN A;  4FBT A;  2KHH A;  1L2D A;  1ZQT A;  2FDR A;  5L1M A;  4UAY A;  2JEF A;  1D0K A;  4ITQ A;  3VFD A;  5KFJ A;  4ECX A;  2WAQ F;  2UUC M;  2F1J A;  1Z59 A;  4IBE A;  1H6U A;  4F3O A;  2R8K A;  2DBY A;  1R4G A;  2PFO A;  4MGI E;  2KTQ A;  1TAU A;  4DL2 A;  5ITQ A;  2KHV A;  2KP7 A;  4RUA A;  1YLA A;  2YNM D;  2WB1 C;  1S97 A;  1TGU A;  4KLU A;  4JUZ A;  4UB4 A;  1LV5 A;  2JH7 A;  4NSR A;  4UW9 A;  2AHM A;  3KHH A;  4DV0 M;  1ZV1 A;  2F5S A;  1P7D A;  2ZTE A;  4AP9 A;  4JI5 M;  1J09 A;  1X37 A;  2M60 A;  4JI1 M;  3AN1 A;  1MC8 A;  4P2H A;  2NV3 A;  2BDU A;  3J27 B;  3DOA A;  5J8Y C;  4EEY A;  4J9P A;  4Y2U A;  4UAS A;  2QBY B;  3B89 A;  4EBD A;  1NK0 A;  3RAQ A;  2DWQ A;  3QEA Z;  1L3V A;  3KSJ A;  4B7G A;  4FBU A;  4ACO A;  1L5U A;  4ED3 A;  4AG5 A;  3SYZ A;  1ZQI A;  2ZIU B;  3C23 A;  2AHO B;  1L2C A;  2BQU A;  3RAX A;  8ICX A;  2BDP A;  1BPX A;  4YFK A;  1ZQC A;  1W5S A;  4KLE A;  2KK0 A;  5F3X B;  5FP0 A;  3RR7 A;  1XC9 A;  5EWG A;  4RQ1 A;  1QAM A;  3KDS E;  2DEN A;  1DGG A;  4B7F A;  1N78 A;  3KOZ E;  3M6Z A;  3AOG A;  1MX0 A;  4PCZ A;  5L9X A;  1AUA A;  4FS1 A;  3B74 A;  4FD2 A;  1N60 A;  4LFC M;  1QAO A;  4YG2 A;  4UAR A;  4DOA A;  1QZE A;  4US9 A;  2JH1 A;  3HJS A;  2JHD A;  3MGV A;  2E8O A;  3HW8 A;  3GIK A;  4PDI A;  4GXJ A;  3SAH A;  5KFA A;  1IXR A;  2RP5 A;  3L4P A;  3PMN A;  2DGZ A;  1O03 A;  3PSI A;  5TIS U;  3LK9 A;  5KFK A;  4EEK A;  2F2A B;  4QWE A;  3J81 S;  7ICS A;  1TDZ A;  5EP3 A;  4O5E A;  5J0S A;  2HL7 A;  5ALN A;  1KL9 A;  4DSE A;  2LI6 A;  4IQV A;  4QHS A;  4ECZ A;  3AEV A;  4M9G A;  5EWE A;  5ALL A;  3ZD8 A;  3WKE A;  4DCC A;  4LF6 M;  3D2S A;  4QZB A;  4FCW A;  3UPQ A;  7ICO A;  4W5W A;  4I2C A;  3M6A A;  5CP2 A;  2KZM A;  4JV0 A;  5CHG A;  5C5J A;  3HHY A;  5KO3 A;  3ETR A;  1B43 A;  4KT0 F;  3RJH A;  3BOS A;  3E4R A;  3NVV A;  2P66 A;  2C9O A;  4E0D A;  5BPV A;  1HNZ M;  2ZIX A;  4L8R C;  4UBC A;  4NC6 A;  1PJI A;  3WKD A;  2VDB B;  1JXE A;  1ZQE A;  1ARO P;  3RH4 A;  8ICB A;  2FPM A;  3GLF B;  1PM5 A;  2BCQ A;  4BWJ A;  2OYY A;  2Y9T A;  4DEZ A;  4IQW A;  3DFZ A;  5L8R F;  5KFY A;  1QUT A;  2CEA A;  3WK5 A;  1TTE A;  2XID A;  2FNA A;  1J7K A;  2G06 A;  1S0O A;  4KIT B;  2G08 A;  3RR8 A;  3J80 S;  4EX6 A;  2XEP A;  1SV0 C;  5KFH A;  4A8E A;  2L6O A;  3KOY E;  3K1J A;  2GH1 A;  4R8U B;  3C5F A;  3JPP A;  2LBC A;  2J7O A;  3MDA A;  4O3Q A;  3A42 A;  3TKA A;  2O5R A;  2VQF M;  4O5C A;  2JY8 A;  2LKY A;  4DUZ M;  1ZQX A;  2KEY A;  4TQR A;  4J9L A;  1J2N A;  1FFV A;  3HZJ A;  2KEB A;  2JZ0 A;  2LVN C;  4RNO A;  4K4H A;  2ZJ5 A;  4EX7 A;  1XU4 A;  1UA0 A;  3ICX A;  3H4J A;  4KLQ A;  2D7G A;  4RQM A;  1N61 A;  3BQ2 A;  4IIW A;  5E79 U;  1NNL A;  9ICF A;  7ICL A;  2FMP A;  5DBC A;  1R2Y A;  1TF0 B;  2PXI A;  1NKE A;  2H3Z A;  2JV3 A;  3N7S C;  2VF8 A;  3UQ2 A;  4PL1 A;  2Y1I A;  4US8 A;  3ZDC A;  4M9S A;  2D7H A;  2ES6 A;  3BDP A;  3H4D A;  1IY2 A;  3ISC A;  3CRX A;  3NGD A;  4J9Q A;  2OEH A;  3BBZ A;  2A5Y B;  1DRG A;  2MGW A;  3Q8M A;  4GHA A;  3AUO A;  3WK9 A;  4YMM A;  3VC8 A;  4NL4 H;  5HML A;  1WCN A;  2DWL A;  2F5O A;  2MU2 A;  4KMU A;  4NWI A;  3ZDE A;  2KG5 A;  2XZF A;  4O0I A;  1IM2 A;  3GLI B;  1Z4N A;  4F92 B;  5HR7 A;  3C21 A;  2DWN A;  2D8C A;  1PK1 A;  2OO9 A;  4I8O A;  1Q3B A;  3RFA A;  2KNJ A;  5KAI U;  1KTQ A;  3GFK B;  4DV7 M;  2EKF A;  3A0B U;  4ED1 A;  4G4R A;  4DLE A;  2W9C B;  2LBO A;  4YR0 A;  2G0A A;  3MGI A;  3QUC A;  4R65 A;  5AK5 A;  1TK5 A;  5CEH A;  3NVW A;  5KFX A;  1Y8G A;  2MRL A;  5LMU M;  4JYA M;  3LCV B;  4Y2R A;  2BHN A;  1SL2 A;  1C7Y A;  1PVR A;  2L5Y A;  3WHK A;  1DO2 A;  2KRU A;  4L4U A;  1ZYQ A;  9ICU A;  4IBB A;  2QEN A;  5KPT A;  2FS1 A;  3C9P A;  2I6X A;  3GV7 B;  1QDT A;  1FO4 A;  1IG6 A;  4UAV A;  4DV3 M;  2DKZ A;  2W9M A;  4FCT A;  2I5H A;  3T1Y M;  3TI0 A;  1EXN A;  1SKS A;  2NRT A;  2MA1 A;  1IY0 A;  5AI6 A;  4O3P A;  1FIQ A;  1NY6 A;  4LF8 M;  5IIJ A;  2CE7 A;  3GIJ A;  3UXP A;  1IM4 A;  1XWL A;  3AV0 A;  2F8L A;  3HWS A;  3MC1 A;  4UB8 U;  1L3U A;  2BNK A;  5AI8 A;  2O25 A;  5KPZ A;  1JIH A;  3E2E A;  2Y20 A;  2WF5 A;  1ZQS A;  2I7N A;  3PW2 A;  7CAT A;  1RXV A;  4XA5 A;  4DS5 A;  2R18 A;  1ZQK A;  5J8Y A;  2R46 A;  1WHC A;  1BNO A;  1X42 A;  2LMR A;  3RFW A;  5ALO A;  5J0R A;  5ALX A;  3THG A;  3GLF E;  4O3S A;  5KG4 A;  4F5P A;  4DOC A;  2R8I A;  2LYA A;  5ALV A;  4DLG A;  1JR3 D;  3KOW E;  3JPR A;  4HLQ A;  3RJK A;  1T3Q A;  1N36 M;  4R8U A;  1XSN A;  2DAG A;  3ISD A;  3SMS A;  4MGZ E;  2HHV A;  3WK6 A;  2WZJ A;  1T6O A;  5J2K A;  3KSX A;  3F2B A;  1R5L A;  1GLN A;  1XXH B;  3I28 A;  3L28 A;  4GIT A;  1NK5 A;  1L2B A;  2RQ5 A;  2OWO A;  3PW5 A;  4B9N A;  4DUY M;  2BWB A;  1NJF A;  5EJC A;  2ISO A;  4Q44 A;  4RQ6 A;  3SAV A;  1OQY A;  1NHW C;  2OOA A;  3T6P A;  1COO A;  1PUZ A;  2Z8Y M;  3PR4 A;  3FUX A;  4QZ9 A;  1VDD A;  1KFD A;  1G41 A;  1S76 D;  4KO8 A;  2CFO A;  3G6Y A;  4JI2 M;  9ICK A;  3RGP A;  5J2A A;  5FLX S;  3KP0 E;  3KBB A;  3PFI A;  2H3I A;  5AKE A;  2GNO A;  3QU4 A;  3CF0 A;  7ICV A;  4C8N A;  1UA1 A;  4C8K A;  4DSL A;  2ISP A;  3VKG A;  3GII A;  4RQ4 A;  1V97 A;  2C2E A;  4MEX A;  1DV0 A;  3SBJ A;  4BJQ A;  2B6G A;  3RGS A;  1ZQ1 C;  2XZU A;  1J2M A;  3RB6 A;  3QU9 A;  1OAO C;  1PK3 A;  5DBA A;  4DQI A;  1XO1 A;  3QEB Z;  2BCS A;  4DV6 M;  3SEN A;  2E3T A;  1TE2 A;  2ALZ A;  3KP1 E;  1T3N A;  1IN6 A;  4B3T M;  3UK6 A;  2Y1J A;  3GLI E;  1VG5 A;  3QYP A;  2W9C A;  4KOD A;  4XK8 F;  3LW5 F;  3WK4 A;  2KRK A;  9ICH A;  2AQ4 A;  3FE3 A;  4BGD A;  4M9H A;  1S0N A;  4M2Y A;  3TQS A;  1SXJ B;  4GC9 A;  3LQR A;  4ZOH C;  2FMS A;  3U6M A;  5AK6 A;  3C3E A;  1O08 A;  1MQ3 A;  5KG0 A;  1KFV A;  3OSP A;  2IHM A;  1TFR A;  3CW2 C;  4CGY B;  1ZOL A;  1TAM A;  1UT8 A;  2K8B B;  4ECW A;  1VEJ A;  3QUB A;  4DR4 M;  3TAR A;  1Q3U A;  5DB9 A;  3KHG A;  1RQN A;  4F50 A;  3NRW A;  3BQ0 A;  2DAI A;  3ZC7 B;  5KAF U;  4KTQ A;  4HL4 A;  2IHN A;  1B22 A;  2W9B B;  1T8E A;  2VKQ A;  1JAL A;  1Z19 A;  2C98 A;  1D9F A;  3CYM A;  3MK6 A;  1SV0 A;  3AQE A;  3TPZ A;  2VA2 A;  5J29 A;  2QQ8 A;  4QZE A;  4CHT B;  4DV4 M;  3BS5 A;  1LB2 B;  4YHH M;  3U61 A;  4B9T A;  1KBU A;  1SXE A;  3T5K A;  5KFG A;  5GKN A;  2KV2 A;  3AQF A;  2X4A A;  4MEY A;  3MFH A;  1SKW A;  4FZM A;  4C80 A;  4KLT A;  1NJW A;  4JB3 A;  3T1H M;  3SAW A;  7ICI A;  1TKD A;  2HVH A;  3B0Y A;  3UMB A;  2A1J B;  2HKJ A;  2FFJ A;  1J97 A;  5J2B A;  1XC8 A;  4R64 A;  3JPQ A;  1JMS A;  2BPG A;  2FPK A;  3AFH A;  5HHH A;  3VLF B;  3E58 A;  4NRW A;  1T43 A;  1D9D A;  5JTI A;  3KD3 A;  3SD7 A;  2HHS A;  5IIO A;  3EZ5 A;  4C8M A;  5K4L A;  3J81 j;  5D4B A;  3EUB 2;  5KG2 A;  5EOZ A;  1FJG M;  4J9O A;  3RH5 A;  3QU5 A;  2ASJ A;  4WJ3 B;  2EAN A;  4Y2P A;  1NSF A;  1SZH A; 
#chains in the Genus database with same CATH homology
 4FWG A;  2JH7 A;  2F76 X;  2X8A A;  2KKV A;  4NSR A;  1XXH A;  3LVW A;  2AHM A;  2XFS A;  4DV0 M;  2F5S A;  2BJV A;  1K82 A;  1P7D A;  4JI5 M;  4GC5 A;  2UUA M;  1J09 A;  3M7D A;  4NV0 A;  1X37 A;  3T38 A;  3VKH A;  2KIW A;  2M60 A;  4JI1 M;  2R65 A;  4X64 M;  5FSW A;  2ZM6 M;  2NV3 A;  3D2N A;  2BDU A;  3J27 B;  3DOA A;  3UJN A;  4LCB A;  3ZH9 B;  3GRR A;  3AL0 B;  2QBY B;  4G6Z A;  2YB1 A;  5ITX A;  2Y0S F;  1HNX M;  2FOI C;  5A2Q S;  3W0F A;  3TWM A;  3K1Z A;  3H0R B;  1NJG A;  5EP1 A;  1HT2 E;  3RF9 A;  1OJL A;  1QZM A;  3KSJ A;  4B7G A;  5HR6 A;  1URJ A;  4GH9 A;  4ACO A;  2F4V M;  3UGJ A;  3PSF A;  4AG5 A;  3GP1 A;  2ZG6 A;  2ZIU B;  2XFT A;  1L2C A;  5FTJ A;  1XNR M;  1IN7 A;  4LY6 A;  3U6C A;  4OJ6 A;  5KL8 B;  5E26 A;  5ITT A;  3HHX A;  4OJP A;  1ZAE A;  1WXQ A;  3FKE A;  1GO3 F;  2Y0T A;  1W5S A;  1HEK A;  4OJ5 A;  3CF2 A;  3HKZ C;  4AYB C;  4DV1 M;  1QAM A;  1PJJ A;  4LFB M;  3KDS E;  1DGG A;  4B7F A;  1N78 A;  3KOZ E;  3M6Z A;  3AOG A;  1MX0 A;  4PCZ A;  1J5E M;  1N75 A;  3VDP A;  1A0P A;  1T3T A;  3E9S A;  5C18 A;  2R62 A;  2ZIV B;  4FD2 A;  3GLI A;  4LFC M;  3IP4 B;  1QAO A;  3QAU A;  3HHW A;  3HJS A;  2JH1 A;  1QQW A;  2JHD A;  5EXP A;  4AG6 A;  3MGV A;  4QOZ C;  3PNY A;  2VII A;  3FTC A;  3U6L A;  4PDI A;  2XSZ A;  3Q8X A;  8CAT A;  3SAH A;  4QIW C;  2RP5 A;  4BB9 A;  2Q4T A;  3SFZ A;  2DGZ A;  3FTF A;  3PSI A;  3U60 B;  4LJ4 A;  2F2A B;  3J81 S;  1SXJ A;  2JGA A;  1E9S A;  1KYI A;  1TDZ A;  2CRX A;  5EP3 A;  5FTM A;  1HQY E;  2HL7 A;  5KPR A;  3A45 A;  4WUR A;  2UXC M;  1ECW A;  4G4N A;  3SQI A;  4IJE A;  3GO8 A;  4DR1 M;  1SXJ E;  4QHS A;  2WAQ C;  2FE8 A;  2HOQ A;  1IXZ A;  5C0Y A;  3HU3 A;  4IBK A;  3GZF A;  1Q3C A;  4G4O A;  2RKO A;  4JXJ A;  4JI8 M;  4KX5 A;  1QAQ A;  4PD2 A;  3I4V A;  4LF6 M;  3D2S A;  1DGB A;  2BJW A;  5DYI A;  1ED1 A;  2DZO B;  4FCW A;  5EXS A;  1QAN A;  1Z5C A;  3KVW A;  3GLG A;  2DWM A;  2HHH M;  5FTL A;  2DZN B;  4W5W A;  3SMV A;  4OO1 J;  2W03 A;  2UXB M;  3M6A A;  2H3V A;  3F5E A;  3O0F A;  2JA2 A;  4OJL A;  3U6Q A;  2UUB M;  4A3V B;  3U6S A;  5IRE B;  3HHY A;  4IBJ A;  4NXN M;  4B08 A;  5KO3 A;  3HJQ A;  2VJ4 A;  3TWK A;  5A0L A;  3BOS A;  3E4R A;  4K0K M;  2R4J A;  4QJF B;  2DVW B;  3T79 A;  2C9O A;  3FTD A;  3F5A A;  4OVZ A;  5BPV A;  1HNZ M;  1T94 A;  2KOB A;  2ZIX A;  4GRI A;  1OFH A;  1ORY B;  1XWI A;  2W82 A;  3FYD A;  4LJ6 A;  5BR8 M;  4L8R C;  4LG2 A;  4CGZ A;  2Y21 A;  3H0M B;  4LJ8 A;  1PJI A;  2GOL A;  1YT3 A;  3U61 B;  4IC9 A;  2VQE M;  4X66 M;  1L8Q A;  3HU2 A;  3UMM A;  4KLN A;  2Y0S C;  5KL1 B;  4PDG A;  3GLF B;  1MU5 A;  1DGH B;  2QP9 X;  2ZBK B;  4REZ A;  1PM5 A;  3J7A S;  4OW0 A;  2OYY A;  2KXE A;  4L78 A;  3I51 A;  3DFZ A;  3MHV C;  2CEA A;  3KW6 A;  4X65 M;  3GPU A;  3JR5 A;  2XID A;  3SAF A;  2FNA A;  2KHQ A;  1J7K A;  2G06 A;  3SAG A;  1E94 E;  2CHV A;  2HBL A;  2G08 A;  3J80 S;  3FTE A;  4JN6 A;  2V1U A;  2K89 A;  4R7G A;  3PSP A;  3KS8 A;  3C28 A;  2XEP A;  4CIS A;  2CHQ A;  4A8E A;  1JQJ C;  2OXO A;  2L6O A;  2ZIW B;  3KOY E;  3GQ4 A;  3K1J A;  2GH1 A;  4Z6Y A;  1K3W A;  1IY1 A;  1K3X A;  4G4Q A;  1YUB A;  2J7O A;  3TE6 A;  4FVM A;  2C99 A;  5CRX A;  1SXJ D;  2L7H A;  4AKH A;  3A42 A;  3K8Z A;  1IN5 A;  2O5R A;  3RE8 A;  3T15 A;  2VQF M;  1XO0 A;  3GRU A;  1S3S A;  5FTN A;  2KVC A;  2CUZ A;  2LKY A;  4DUZ M;  2KEY A;  4PT5 A;  2HMX A;  5ITR A;  1YE9 A;  4M9Z A;  1N34 M;  3GLH B;  4X62 M;  2KEB A;  2VJ5 A;  4QNL A;  4D82 A;  3D8L A;  4NLC A;  1HT1 E;  2F5Q A;  2XLJ A;  2I7P A;  3ICX A;  2F5N A;  2D7G A;  4B3R M;  2L7I A;  4IIW A;  2VIX A;  4FZN A;  4BLC A;  5FTK A;  3TWL A;  4DV5 M;  3D2Q A;  2OPF A;  1R2Y A;  4DR3 M;  1E32 A;  4IBF A;  2H3Z A;  4DR2 M;  3N7S C;  1L6N A;  4PL1 A;  1MA7 A;  1XNS A;  4M9S A;  2D7H A;  3H0L B;  3KOX E;  4D81 A;  4XGI A;  3CP8 A;  4OU7 A;  3R9X B;  1D2N A;  1IY2 A;  4IBG A;  2G5I B;  3CRX A;  1L1T A;  4DR6 M;  2ZIV A;  4JI7 M;  2A5Y B;  1DRG A;  3KXE C;  4GHA A;  3HKP A;  4FE3 A;  3VC8 A;  3VCB A;  4NL4 H;  4NRV A;  3W0L B;  2ZXH A;  4ZPX A;  4JI3 M;  2KKP A;  3N7R C;  2DWL A;  2F5O A;  3SAS A;  4NWI A;  1IN8 A;  1JR3 A;  1G4A E;  2LH0 A;  2K47 A;  4NXM M;  1IQP A;  4LF5 M;  2HOI A;  1R2Z A;  1WUD A;  3U60 A;  2XZF A;  3NUQ A;  1IM2 A;  4AW4 A;  3GLI B;  3KFU F;  5HR7 A;  3ZCB B;  3FUT A;  3M0E A;  2DWN A;  1NSF A;  3U6P A;  5E6J A;  1I4W A;  2G5G X;  2ZAN A;  1Q3B A;  4I8O A;  2KNJ A;  3RFA A;  1TDH A;  4MH0 E;  4KHP M;  4RNA A;  3F2C A;  1W5T A;  4L16 A;  3HU1 A;  3AJI B;  4DV7 M;  5KQ8 A;  3TL4 X;  2KJ5 A;  4G4R A;  4IBD A;  1OUQ A;  2CV2 A;  2NQ8 C;  4P16 A;  1R7R A;  2KA6 B;  2LBO A;  2G0A A;  2QZ4 A;  4LZJ A;  2JMG A;  2A3V A;  2RGO A;  3C29 A;  3HJ8 A;  3K2L A;  2HBM A;  1C1K A;  4NSO B;  1NNJ A;  2ERC A;  2MRL A;  5LMU M;  2J7N A;  1IBM M;  4II7 A;  4JYA M;  4GMQ A;  2OH2 A;  2CHG A;  1NHG C;  1PVR A;  2H1R A;  4B3S M;  5LMN M;  1KSF X;  2DXI A;  3SHG B;  2CPR A;  3WHK A;  1DO2 A;  2KRU A;  4L4U A;  1N32 M;  3NBI A;  4IBB A;  2QEN A;  2F77 X;  2K8A A;  5EP4 A;  3LYS A;  1R6B X;  1N33 M;  5KPT A;  1D8B A;  1TH4 A;  4L15 A;  3GPX A;  2UU9 M;  4GFJ A;  4DV3 M;  2K4I A;  4FCT A;  5F3W A;  3T1Y M;  3SYL A;  3AOE A;  1IXR C;  3EIH A;  4RF1 A;  1XMO M;  4JMU A;  4AQY M;  2MA1 A;  2DHR A;  4BBA A;  4LF9 M;  1CRX A;  1IY0 A;  2CN1 A;  2KD1 A;  4P0P B;  3GLG B;  4IBI A;  1NVM A;  1NY6 A;  3GRY A;  4M0D A;  1L1Z A;  4LF8 M;  3M6K A;  5T14 A;  1QVR A;  2CE7 A;  2L09 A;  2Z3X A;  2XH9 A;  3VK7 A;  4LF4 M;  4P0Q B;  3DEE A;  3AV0 A;  3HGI A;  2E1F A;  2F8L A;  3HWS A;  2H3F A;  4DV2 M;  5JI3 E;  2BNK A;  2M5Z A;  2PMZ F;  5KPZ A;  2Y20 A;  3FYC A;  3PVS A;  2EO2 A;  1DGH A;  2I7N A;  2RHF A;  3CF6 E;  1E9R A;  3J7B A;  7CAT A;  4DR7 M;  1EE8 A;  4AKI A;  1SZH A;  3U6D A;  2UXD M;  2ZIX B;  1PVP A;  2R18 A;  1F44 A;  2R46 A;  1XHB A;  4QHT A;  2D6F C;  3FUU A;  3IG5 A;  2CV1 A;  2K4E A;  2F5P A;  3RFW A;  3L26 A;  4FZL A;  5IWA M;  3THG A;  1QYR A;  1IXS B;  3PNV A;  2Q2E B;  3ILK A;  2LYA A;  3F2D A;  1G3I A;  1JR3 D;  3KOW E;  2C96 A;  5ITU A;  4HLQ A;  4S12 A;  2ZIW A;  4LRS A;  2ZXI A;  3HHZ A;  1N36 M;  3FD9 A;  4IBC A;  4M9X A;  3QWL A;  2QPA A;  3R8F A;  3SAT A;  3ALR A;  3KFU G;  3AKZ A;  3U5Z B;  3SMS A;  4MGZ E;  4LJ9 A;  2KJ8 A;  1A6S A;  1Z5B A;  4FWD A;  3K92 A;  4MGH A;  3GLH A;  3KSX A;  2QBY A;  4JI6 M;  3F2B A;  1GLN A;  1XXH B;  3JAM S;  3VK8 A;  3L28 A;  4GIT A;  1HQC A;  2Z4R A;  1L2B A;  4NLB A;  4AZF A;  2E5L M;  2LHT A;  1Q39 A;  1HIW A;  4CRX A;  4DUY M;  1IN4 A;  4LJA A;  1NJF A;  5EJC A;  2YFQ A;  2G07 A;  3SAV A;  2XVT A;  3FUW A;  1NHW C;  3L2A A;  5IT9 S;  1UPH A;  2ZIU A;  2LYB A;  3FUX A;  1VDD A;  1G41 A;  4FW9 A;  4RF0 A;  3C58 A;  4KO8 A;  2DQN B;  2CFO A;  2YX8 A;  3M7G A;  2W7O A;  4JI2 M;  4LFA M;  3SC3 A;  3WHL A;  2KZU A;  3RGP A;  2OQ4 A;  1IBK M;  2G5H B;  2KIC A;  3LVV A;  5FLX S;  3F53 A;  3PZP A;  4EIW A;  3KP0 E;  3PFI A;  4I5S A;  3U6O A;  2H3I A;  2WB1 F;  1PVQ A;  3CF0 A;  2M0N A;  2Z4S A;  4O3M A;  3L29 A;  2CV0 A;  5ITX E;  1HNW M;  3VKG A;  4AI6 A;  1Q3V A;  5EQT A;  4KX3 A;  1IIP A;  5JI2 E;  4C0Z A;  3JR4 A;  3GPY A;  4GKK M;  1DO0 A;  2LNH C;  4QNR A;  3A46 A;  2LXE A;  3SBJ A;  4BJQ A;  2HBK A;  4LGY A;  2V6Z M;  3AL0 C;  2HBJ A;  3GRV A;  4GHL A;  1Z5A A;  4MB7 A;  3RGS A;  2XZU A;  1GL7 A;  3SAR A;  1ZQ1 C;  1TH3 A;  4OX9 M;  3LQQ A;  3MJ5 A;  2YB4 A;  1GVN A;  2ZAM A;  3L3F X;  1NZB A;  4DV6 M;  4B3M M;  3DA1 A;  3IN5 A;  1HR0 M;  1IBL M;  4MM3 B;  3LMM A;  3GQ3 A;  2DF4 B;  1NNU C;  3E0F A;  2HCB A;  3KP1 E;  3H4M A;  1IN6 A;  4B3T M;  2G8L A;  3J2P B;  4TUW A;  3UK6 A;  3KZX A;  4CDG A;  2LWX A;  4WW0 A;  4QOS A;  4YY3 M;  3ONN A;  2G09 A;  4KOD A;  1YSY A;  3KS4 A;  2KRK A;  2DWZ B;  2HOF A;  1XNQ M;  2XIC A;  3TQS A;  1SXJ B;  4GC9 A;  2H3Q A;  3NWL A;  2PMZ C;  4MGY E;  3I4Y A;  4OJO A;  4KMO B;  4Z8X A;  2KW0 A;  3LQR A;  3U6M A;  2X49 A;  1KFV A;  1DGF A;  2N1R A;  3PST A;  5ITY A;  1ZQ9 A;  5EXT A;  5H37 D;  3U6E A;  4CGY B;  3N7P D;  4LJ5 A;  2RGH A;  3VDU A;  1TAM A;  3HKZ F;  4AYB F;  2K8B B;  1Q3U A;  4DR4 M;  4LGM A;  3L27 A;  4IJF A;  4GKJ M;  2W04 A;  2QCU A;  3SYK A;  3EIE A;  4XBO A;  4LZZ A;  3SHF A;  3NRW A;  3ZC7 B;  5DNY A;  3GPP A;  4FCV A;  1UM8 A;  5C1B A;  4LF7 M;  2YR0 A;  4DR5 M;  4HL4 A;  1N77 A;  4I81 A;  2Y0Q A;  3L25 A;  2E1E A;  2E5S A;  4AKG A;  2VKQ A;  1Z19 A;  4P0P A;  5DYG A;  1SXJ C;  2C98 A;  3PXG A;  4B7H A;  5KQD A;  4QIW F;  1I94 M;  3CYM A;  3MK6 A;  4U7C A;  3AQE A;  3D8B A;  3TPZ A;  4QNM A;  4JV5 M;  4R3D A;  2XI9 A;  4BUG A;  1Z6T A;  4LRT A;  4CHT B;  4DV4 M;  2XGN A;  2K4H A;  2RRD A;  4P0Q A;  4YHH M;  1OFI A;  3U61 A;  1LV7 A;  4U6P A;  4NOO B;  2V1C A;  1FNN A;  2K8C B;  4D80 A;  2EA0 A;  1G59 A;  5GKN A;  1KBU A;  2KV2 A;  4M0W A;  3AQF A;  3OTO M;  1G8P A;  3GLF A;  2ZAO A;  4FWH A;  1Z1B A;  1GKI A;  2X4A A;  4OVZ B;  1TH2 A;  4FZM A;  3A98 B;  3DZD A;  4JI0 M;  3UZU A;  3SAW A;  3T1H M;  2KZS A;  1L2D A;  4I4L A;  4JI4 M;  4BX9 C;  2C5R A;  1XMQ M;  2HKJ A;  1GL6 A;  2FFJ A;  4ITQ A;  1XC8 A;  3VFD A;  2XF3 A;  3FUV A;  2WAQ F;  3B9P A;  3AFH A;  2UUC M;  4ICA A;  1Z59 A;  3VLF B;  4NRW A;  2OM6 A;  4IBE A;  1H6U A;  3OPX A;  1NY5 A;  4PL2 A;  3SAU A;  4MGI E;  2Z7J A;  2D7E A;  4GIP A;  5ITQ A;  3IG8 A;  5EP2 A;  2KHV A;  2YNM D;  2WB1 C;  2KJ9 A;  3AOE C;  1TGU A;  1FJG M;  2W7P A;  3SMP A;  4MGK E;  5EXX A;  3GQ5 A;  2YQZ A;  3U5Z A;  4LJ7 A;  2XSZ D;  2C9C A;  4WJ3 B;  5IZ7 D;  2EUC A;  2R45 A;  2P5T A;  3CTW B;  3GU3 A;  2R4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...