2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2Z7JA 2R18A
chains in the Genus database with same CATH superfamily
2MA1A 1HQCA 2YR0A 3GZFA 3H7IA 2R8GA 4DSIA 4M9NA 1RYRA 4U7CA 1Z5AA 2H3ZA 3RB3A 3M9OB 2O5RA 3T79A 2RGOA 2XGPA 1LKYB 3VLFB 4F93B 4DV6M 3KTQA 3GV8B 3M7DA 1ZRMA 4DBGB 2ZIWB 2XEPA 4NM1A 4AP9A 1ZD5A 2JH7A 2R62A 3GLFB 1D0LA 4XQ8A 2LKYA 2R18A 9ICQA 2H1RA 2KOBA 3DZDA 9ICRA 1XB2B 3QUCA 4G3OA 4NSOB 1JALA 1IBKM 7ICHA 2EQYA 3U61B 1NJWA 3GRVA 4I28A 4HL4A 2ASLA 3GPXA 1K5OA 1Q8KA 3D2NA 4DV0M 2RKOA 5ITRA 1Z5BA 1HNWM 3M1YA 4DUZM 1NV8A 5KFLA 3GLGB 1MC8A 1RU3A 4CISA 3HKZF 2C9OA 1HNZM 3H4DA 2OOAA 7ICKA 2EH9A 3WKCA 4GXIA 2OH2A 2KDLA 4Y2TA 3PO4A 4RU9A 2LH0A 5EXSA 3JPRA 2FLPA 5AKIA 3KZIU 4JWMA 4UAZA 3KP0E 2LBCA 2W3RA 5HMLA 1Q46A 5EP1A 4M04A 4RUCA 4CRXA 4M9GA 3U60B 4MFFA 2QZ4A 3PX6A 2KZUA 1S0MA 3ZH9B 3JR4A 4ECSA 4GKJM 1ZQZA 5AI9A 2J6TA 9ICWA 3E2EA 4KLUA 2XLJA 4RNAA 3SFZA 4F5RA 3MJ5A 3SAUA 3SMSA 4JI1M 2D7HA 2HCFA 3IHQB 1N34M 4GIPA 3EYZA 1SKSA 5DNYA 5K4LA 4BWMA 1S0OA 1XSNA 4BWJA 1B43A 4FBUA 4I2DA 2HOIA 4AG6A 3SBJA 4WURA 4RQ0A 2UXBM 3PMLA 1SXJE 2K8AA 4P0PB 2KNJA 2HHHM 3HU2A 3K1ZA 1ZD4A 3UXOA 2JH1A 1ZQCA 3AQFA 5ALTA 1Y88A 2C2DA 3RJGA 1HUZA 1L1TA 2Z7JA 4XA5A 2XF3A 8ICWA 2N35A 2EAPA 2ZIXA 2XY5A 4BDPA 2Y9TA 3GLIB 5DYGA 1TAUA 2G5IB 1R7RA 1G3IA 3M0EA 2UUBM 2FMQA 3ZDDA 1UT8A 4JWNA 3NVZA 2NRVA 7ICTA 4I2BA 4J9MA 4JI5M 4FCVA 2MJ5B 2JUJA 5KFDA 1DXSA 2W8KA 1QQWA 2H3QA 2V1CA 4C8MA 4DEZA 3OSNA 2ZIUB 2WF9A 4DV5M 3LVVA 2PI4A 1GO5A 3DA1A 4B6JA 2I9GA 4C8NA 1KDHA 4HAIA 3EW9A 1Z59A 2ZANA 5ITTA 4NJ8A 2JA2A 2ZTCA 3RJFA 1X9WA 2R4EA 1WWUA 4DQPA 2VIIA 3FTDA 3MR2A 3RRGA 4LZGA 1ED1A 4DQSA 2VDBB 4M9LA 4YP3A 1PGYA 5KFUA 1JR3A 1WUDA 4UBCA 4QOSA 1PJTA 3TFSA 2JY7A 5J0WA 5EE1A 4KMUA 3EZ5A 3F2CA 3HWSA 1J2NA 5KG0A 2QB0B 3E0FA 1Q3UA 4JXJA 1SZPA 1HEKA 3Q8KA 1J7KA 2FE9A 1IN7A 2WFAA 2KSOA 2CEAA 4Q8FA 1WIVA 2F1IA 4US9A 1QZEA 1SL0A 4AG5A 1DK3A 4IBIA 2H3FA 2EKKA 5DG7A 4KODA 1TVAA 4ECQA 2BGWA 2V1UA 5AI6A 1U47A 1IXSB 1J2MA 1K1QA 5IIKA 3N97B 4DSKA 1P7DA 1YZ7A 4B3SM 3J7AS 2VQEM 5ALUA 5KFPA 3JPNA 4NY8A 7ICPA 1CI4A 4KLIA 4R71A 1BGXT 2QBYB 3JPOA 4KHPM 4UB2A 1ZQMA 1RXWA 5ALZA 4F72A 2KVCA 5KG2A 4RUAA 4ELUA 5AKLA 2E8PA 3WK4A 4IBDA 1N61A 2DWMA 4Z6EA 2CV1A 3B89A 4M47A 2DI0A 4UN2B 1OJLA 4MFCA 2K4HA 1VEJA 1XXHE 4I2HA 4KLLA 3UK6A 2CUZA 5EE0A 3TADC 2KE7A 4RQ3A 4NRVA 1K3XA 3T38A 1K3WA 2EAOA 5AK3A 1N77A 2H3VA 5KFOA 3KKAC 5C5JA 1L3SA 1ZQPA 5EXPA 4REZA 1KW4A 4F2LA 2CE7A 1ZQEA 7ICGA 2BQUA 4IR1A 1KLNA 4M6WB 4UB4A 3R9XB 2WAQC 1L3TA 4GFJA 3MBYA 5D4BA 2A3VA 3MMPA 4O5CA 2M5ZA 4R64A 1XC8A 1BPBA 1D9FA 4ECRA 1IM4A 3MC1A 4IJFA 4Q7JA 4KX3A 4B9TA 4IJEA 1XU4A 3ALRA 2FLNA 3SD7A 4CDGA 1IXRC 4ECWA 3TANA 5L8RF 3RH4A 1BPEA 2UUCM 3I4VA 2Y1IA 1A5TA 1SV0A 1JR3D 3AEVA 2XSZD 5L1JA 4DS5A 3K8ZA 1SB3C 5KFTA 7ICUA 3GV5B 4QWEA 1HJPA 4RT2A 4EELA 4KO8A 4F4KA 1HIWA 3I28A 1PZNA 1QLNA 3GIMA 3HPOA 2JHDA 1NJGA 2EANA 1GL6A 4YG2A 4IRKA 1ZJNA 7ICQA 5DQHA 9ICIA 3N7RC 2HHUA 1AIPC 5IZ7D 4DQQA 9ICEA 4I4LA 1LKYA 3SV4A 2V6ZM 1VDLA 2LVOC 3CF0A 2ZIWA 3U6OA 2A1AA 4RQ2A 5C0YA 4DOCA 3GLFA 1N32M 4IS7A 3HW8A 4L4UA 3LVWA 5C1BA 2KEYA 3L3FX 3PR4A 4LRSA 2HBLA 1ZQDA 4M0DA 2AJQA 2RDIA 4B7FA 4TUWA 5IIIA 1S5LU 1CRXA 3J81j 3SYLA 3TL4X 4LJ7A 5E26A 1R6BX 4I2EA 4ACOA 4QZCA 4DL5A 3U61A 3L26A 4RQ6A 1G4AE 3C28A 1NK4A 1DO2A 3C58A 4DS4A 1OUQA 3N28A 2XGQA 3PNVA 1L8QA 5KNIA 5FP0A 2F2AB 4MB7A 1QQ5A 2DWLA 3GLGA 3TPZA 4I2GA 2F8LA 5L1IA 7ICMA 1SWWA 3TI0A 2EJSA 3U6LA 5DQGA 4DFPA 4YVZA 5DBAA 2ZAOA 3KSJA 4EEKA 4U6PA 1ZQBA 3SR6A 4RQNA 3QE9Y 4NLGA 3F2BA 3MGHA 4PH5A 2W43A 2C96A 3I76A 4A3VB 2QNJA 3H4BA 4C4SA 4LF7M 2OPFA 2A5YB 5KG3A 2DPJA 1FJGM 1Y8GA 4DSEA 2LHCA 2CXYA 5HP4A 2CHVA 4LJ6A 3U60A 1IV8A 8ICXA 2KRUA 8ICBA 3BQ1A 4B7GA 4IQUA 1SXEA 3NVWA 4KX5A 4O0IA 2GO7A 2L09A 1QDRA 5KFKA 5KG1A 4HYKA 4FZMA 3UMMA 3UM9A 1FFVA 1JUDA 1ZQHA 1JROA 4RKUF 4NLZA 3KOWE 5ALFA 1G41A 7ICEA 1JB0F 4R65A 4RNMA 3NRWA 3HP6A 5F9NA 2BPFA 2LNHC 4DSLA 2DBYA 2F44A 3L25A 3AOEC 2LM4A 1Z4NA 7ICRA 1X40A 4LGYA 4YCXA 3ZI4A 3EIHA 2QLTA 3QUBA 3MGIA 5AM2A 1IQPA 4LF4M 1QH9A 2RHFA 2HOFA 3TE6A 4UW9A 5EP3A 4L15A 1OQYA 3UGJA 2MUTB 5ALWA 1W5TA 2AGOA 4UB1A 3H0MB 3U6QA 2ZIVB 3TAPA 4I2CA 1YT3A 2KEBA 3F2DA 2BQ3A 3PW7A 4IQVA 4KLMA 4GITA 3OGUA 4J9PA 2K6BA 3GLIA 3OJUA 4F3OA 3NS1A 3GLHB 5BPCA 1PVPA 4I2IA 2ZXIA 3ZCBB 1K1SA 2L4EA 2XFTA 2XO7A 3V7JA 4YHHM 2ZIUA 3PSPA 3SC3A 4ED3A 2R6FA 1NK9A 1N48A 1L2BA 1J5EM 3M7GA 2DZOB 2RDJA 3V7KA 2DAMA 2QKQA 1T3TA 1ZQXA 4GIBA 4PHEA 1QSLA 4J9OA 4G3IA 2VKQA 4ICAA 1KRPA 2ZJAA 2KNAA 3B74A 1FEZA 4FCTA 5KTQA 3QEAZ 3G6YA 1SWVA 3B9JA 2K0BX 4C8KA 2LXEA 1S76D 2QENA 1G8PA 5J8YA 4Y2JA 2QB0A 5KT4A 1ZRNA 1OKSA 3UZUA 4S12A 4EBDA 2X4AA 3PSTA 4MHVA 3IV6A 3ZDEA 2UVWA 5F3WA 1VLBA 2ERCA 1DGFA 2IA6A 2DHRA 5DLGA 2HKJA 4KLSA 3H4JA 9ICHA 5J2KA 3NBIA 2IMWP 2PFOA 3ZDAA 1XSPA 1DOQA 3IRUA 2EO2A 5IREB 4Z8XA 1SL1A 5KT3A 2E8MA 4PL2A 2FPKA 1IXSA 1IN6A 5AI4A 3MR5A 2B0CA 1L3VA 1QUSA 2KHHA 3I04M 2HBKA 2KNZA 2P5TA 2K4EA 2E8NA 1Q3VA 4LY6A 3OTOM 7ICNA 5ALSA 4L8RC 2QBYA 3ONNA 3SAVA 2F4VM 5CR0A 2FH0A 1T3NA 4NV0A 1UA0A 3WK8A 4ELVA 4FCWA 4BJQA 4J9NA 2KNVA 2EKFA 3LCUA 3UMGA 4PD2A 1A76A 2LHGA 1NV9A 4YD2A 2XC9A 4Y28F 4DL6A 1UM8A 2XI9A 1T94A 1DGHB 1QQ6A 1WJ7A 1NY6A 5KFEA 3DFZA 4O3RA 1RZTA 2JMGA 3KOOA 3Q8GA 1XO1A 1D9DA 5FTLA 5EP4A 2QB1A 4IRCA 4IRDA 1QCKA 4KN7A 4O3PA 4NM2A 2R45A 4F4XA 2QHOB 1ZD2P 1XMOM 1B22A 1UFZA 4RQMA 2BHNA 3EIEA 1KL9A 3MDCA 3T5LA 5DB6A 1X6IA 3M8RA 1PM5A 1QANA 3HJQA 2WSEF 5HR6A 4J9KA 2F5PA 5J2EA 5ITUA 1NHWC 1XS9D 3PX0A 4KLOA 2ZBKB 7ICLA 2P6UA 3L28A 2LVQD 3F92A 4IBBA 2Y0SF 2QARB 9ICJA 3C9PA 2W9BB 3O0FA 1SXDA 4M6WA 4IBKA 1ZAEA 2MSNA 2C9CA 2FNAA 2KIVA 2L2DA 2WF8A 3R8FA 4QZGA 4JV1A 3GQ5A 1E9SA 2WAQF 5J2CA 1NVMA 2X49A 1SV0C 3ISCA 1KSPA 1L8OA 2BDUA 8ICHA 1GLNA 2WTFA 5KFVA 2KTQA 1ZV1A 2F5SA 4RF0A 3PSFA 3M8SA 3RH6A 5ALOA 2Z8YM 3RTVA 1D8YA 3QU9A 1IXRA 4TQSA 1VG5A 4EYHB 3RB0A 3D8LA 1VJ5A 1NJZA 3MGVA 3FDSA 3PVXA 5JTIA 2PFPA 4KLEA 5ALRA 2KD1A 3C1YA 3WHLA 2VA2A 9ICSA 2KV2A 4FWHA 2M0NA 4B3TM 2BKEA 5JU5A 4C8OA 8ICJA 3JPQA 9ICUA 4GH9A 3KZXA 3CRXA 3BXWA 2YY6A 2W82A 2IHNA 1RPLA 4HEOA 5DYIA 3GQ4A 4YXJA 2MR9A 2Q0ZX 2QSFX 3H8MA 4R3DA 4OU7A 1N5WA 5KO3A 4PT5A 3U5ZB 3QYBA 3J27B 4IL6U 1F5SA 1NK6A 5ALGA 2BCSA 8ICFA 2Y21A 3KXEC 2LVAA 3EUB2 5DDYA 4JV2A 1V9PA 4US8A 8ICMA 4DR6M 4UB8U 5KFCA 2R0IA 1NNUC 3KOZE 4Z6YA 4MGYE 2P35A 3GU3A 1L7PA 4ELTA 1X37A 1NI3A 1CUKA 3LMMA 3LYSA 1S10A 2HWJA 5A0LA 3DOAA 2DWNA 4M9XA 2W7PA 1O03A 4K4IA 1N78A 5KFMA 2JY5A 4BXOB 4TUQA 5KFXA 3RR7A 4LCBA 1SV4A 4TUSA 3TQ1A 1WXQA 3K9OA 2B3TA 2F76X 5CHGA 1VDDA 1QAQA 2GH1A 2W03A 5F9LA 5H37D 5GTHU 3A45A 4F71A 1L3UA 4UB6U 4I29A 5AM3A 1V97A 4DQIA 4NLKA 1D8LA 3TACB 2EA0A 1IN4A 5J2FA 1SZHA 9ICGA 4JN6A 3RJJA 2KZSA 3VKHA 5KT7A 4OCZA 1JRPA 2OM6A 5J2HA 3NVVA 2XCPA 9ICCA 3FTEA 3GPYA 1UA1A 3B0YA 3M9MB 3CP8A 2OO9A 1MX0A 1DO0A 3QNMA 2JEGA 1ZQWA 2G5GX 2K9DA 3I51A 2GWSA 1S77D 1QVRA 2KICA 1QYRA 4CF5A 2K60A 4MFAA 4YR3A 2CRXA 3CGWA 4RF1A 1L2DA 2DPIA 4KT0F 2G0AA 3UQ0A 1Z1VA 4F5OA 5GKNA 4DQRA 1Z19A 2BQRA 2EAMA 1QZMA 4IBGA 2DGZA 4FZNA 4YR2A 3GO8A 4YMNA 3C23A 2LBOA 1RM6C 3C1ZA 5DDMA 1BNPA 9ICAA 5FSWA 3AOEA 3WKAA 3PMNA 2ZG6A 5FTNA 4LZZA 3T3FA 3NBXX 2CP8A 2JZ1A 2MUTA 3LK9A 3GIJA 1TKDA 1PJJA 5EWEA 4IIWA 4FVMA 2HMXA 1NOMA 3PO5A 1ZMUA 2ZIVA 3QYEA 2DKXA 4B9NA 1VEKA 3TWMA 4X62M 1XNRM 2VF8A 5AM5A 3S6JA 3TARA 4M2YA 4JI3M 2PXIA 2R8HA 3QX7A 5DG8A 3L27A 3UXNA 3N7PD 3JPTA 3GLHA 5IILA 1Q39A 3MDAA 1HNXM 9ICNA 3HU1A 5DKWA 1JX4A 4RQ1A 2KN7A 2XZFA 5FTMA 1L7MA 1KFSA 2DAEA 4LGMA 1N5XA 3JPPA 1RQNA 4ED0A 4M0WA 4QNMA 3OHAA 4J9QA 3UXPA 1XWIA 3VK8A 4JYAM 5KAFU 1BPZA 4ECXA 4JB3A 3HJ8A 4LF6M 4IBEA 3LW5F 1TR8A 2MRLA 4CF4A 2W04A 2BCVA 8ICPA 2Q2EB 2ESEA 3KBBA 4RPXA 2DUYA 4IBCA 1N75A 1OFHA 3KHRA 2XSZA 4JI0M 4YFKA 3SI8A 4KLJA 2ZTEA 5J8YC 4YQWA 5J29A 5KG4A 4WJ3B 4MH0E 1NJYA 3BQ7A 1TV9A 2G5HB 1IBMM 3SEIA 1HT2E 2F5QA 1DRGA 2NYVA 4DSJA 2D6FC 3PFIA 4KLNA 3T1HM 1DGSA 2LVNC 3ZDCA 2E1FA 3HJSA 3WU2U 2JY6B 2J7NA 4MF2A 4MEYA 4R7GA 4QZFA 1OTRA 3GFKB 4EZ6A 2FPMA 2DKZA 1TK5A 2J6UA 3TKAA 2B21A 4BUGA 5DQIA 3QZ7A 3UQ2A 4P0QA 5A2QS 5L1KA 2HSZA 4OJLA 5L9XA 4MGIE 4QZHA 2HVIA 2IOFK 5IIJA 4EX6A 1ZQRA 1A77A 3CW2C 5ALDA 2LHTA 2E1EA 4QIWC 3M9NB 4G4QA 1ZQGA 3TQSA 8ICSA 3AJIB 4NSRA 5AI0A 3T5HA 1WCNA 3HRDD 4FFDA 1WCLA 4NWIA 2XY6A 4F4ZA 1BVSA 3HY5A 2AGPA 4F4WA 2ZM6M 1KBUA 3OHBA 3N4MB 5EJCA 2R8KA 3WK6A 3LWMA 5KFRA 4LZJA 1KTQA 1PRBA 5J0YA 1L5UA 1SG9A 2YQZA 1SL2A 4M9SA 3UMCA 5JUMA 4UAYA 3H40A 1TFRA 1EE8A 1TAMA 2YB1A 1DGHA 1ZQLA 2WF6A 5AIBA 5DG9A 3BQ0A 2DF4B 5KL8B 4DL4A 1N33M 3MHVC 3HZJA 2LI6A 3DV9A 4G4RA 5ALHA 4FS1A 2DAIA 3KHLA 3CF2A 1XC9A 2GOLA 3ETLA 2HDOA 2Y0SC 1WWVA 5J2DA 3ILKA 2BPGA 4D81A 3BS5B 5KFIA 2I6XA 2ZAMA 3SHGB 1U4BA 3PX4A 4BX9C 8ICCA 3BZCA 3LCVB 3KOYE 2FFJA 2QARA 1OAIA 2W9BA 1IN5A 4P4MA 2Y20A 2RRDA 2YTUA 3KHGA 3ZD8A 1ZJMA 5EWGA 7ICFA 4G9BA 2XZUA 2E8OA 4UQGA 3E21A 3CYMA 5J0OA 9ICXA 1TDHA 2W11A 2L7HA 3IM1A 4C80A 2N1RA 4R8UB 5EOZA 3OJSA 3BJYA 2PFQA 2E5LM 1M6YA 5KG6A 2XCAA 2FMPA 4B9VA 2CHGA 2WF5A 2XFSA 1S3SA 2O25A 2CRUA 3RGSA 3FAHA 2VIXA 3FM9A 3FC4A 3C3EA 3H8SA 3NWLA 2FJ6A 4KLDA 4BLCA 1ZQUA 3QU2A 3U26A 5EE3A 3B9PA 4ECYA 2YMMA 7CATA 3RJHA 4GMQA 1A0PA 1U9LA 1N2XA 4LFCM 4K0KM 4QWDA 3RJIA 3W0LB 3U5ZA 2XICA 4YN4A 3NTUA 4M9ZA 4LJ8A 2AH5A 5ALYA 5G5GA 4KLGA 2KZZA 8ICOA 3BS7A 4QZBA 2M9NA 3B0XA 4AI6A 1ZMVA 4J9SA 4GC9A 4QJFB 4DFKA 3M6AA 4GHLA 1GJSA 5BOMA 1NK5A 3MFHA 5DB7A 5GTIU 1NKCA 4BXOA 3LQQA 4B9LA 4AKHA 2QP9X 1X66A 4P4OA 4DOAA 1JR3E 5CWRA 5CJ7A 1UT5A 5AKEA 3A42A 4LF9M 5HNKA 2I1QA 1ZYQA 2KP7A 4FZLA 2LPEA 2JNHA 2AU0A 2HHQA 3KP1E 4RNNA 2LTUA 4YMMA 1PJSA 1QAOA 3ICXA 2K4IA 3PNCA 2ISPA 2X8AA 3JR5A 3Q8XA 5KQ8A 2HOQA 4BBAA 1F44A 3HX3A 4ITQA 1TK8A 8ICKA 3RRHA 5ALEA 4Y2XA 1XXHB 4FWDA 4LJ4A 4J03A 3I4YA 3HWTA 5CEHA 5ALNA 3RAXA 8ICGA 2XIDA 1KSFX 1XNQM 3PZPA 4F2SA 2RGHA 3M6KA 4LJ5A 2OOBA 2JR5A 5AI8A 4QZ8A 4Q43A 3AFHA 3GRYA 5J2AA 4ECTA 2HVHA 5KG7A 1PK1B 1MN8A 3W68A 3HHXA 3FRHA 5TZVA 1U45A 1T43A 4I8OA 2OQ4A 4R66A 4PGYA 2IHMA 3HHZA 3TWLA 3NVYA 3AU6A 2R46A 1MSWD 2IOHA 3H0RB 3SAHA 1ZQOA 3NUQA 2M60A 1MN3A 5FTJA 1JQJC 2ZJ5A 3LDAA 1BPYA 4O3MA 3GRRA 2W54A 1K82A 3TFRA 1QTMA 4P0PA 7ICVA 2DXIA 2PKEA 2DFLA 4CNQA 1TDZA 1R2ZA 4DV2M 2K8BB 4B3MM 1E9RA 1T4GA 1PK3A 4XGIA 3F5EA 2UVRA 3QU5A 3D2SA 2AXTU 3QXGA 1L7NA 3A98B 4PJ0U 2UVUA 1TK0A 1ZQVA 2KFNA 5AKKA 2YN4A 2UVVA 5DFLA 3SENA 1N56A 2OHFA 1S0NA 3HJEA 2KA6B 2DQNB 4UAUA 4EEYA 5JI2E 4RT3A 3L2AA 3IN5A 3PW0A 1BNOA 5KT2A 9ICTA 4CE6A 4LFAM 3IECA 1SGGA 5ITYA 2YX8A 2ZUDA 2AGQA 1B0XA 5CP2A 3D2QA 2HBMA 1KYIA 9ICKA 2JWSA 3NGDA 3KW6A 4QHSA 3BZKA 4P16A 1E32A 1MU5A 1MJGM 2OWOA 1HT1E 4I2JA 3QYPA 4KMOB 1C20A 3GPUA 2K4PA 5T14A 5ALKA 3SAFA 2HHWA 3T5KA 1H38A 2V9WA 4RQ7A 1ZXIA 4RQ4A 2IOFA 5EXXA 4GKKM 2FDRA 4JUZA 4C7ZA 1WGNA 4EX7A 4J9RA 5KT5A 3RJKA 4FW9A 1NK7A 4KTQA 1IN8A 4K4HA 2HAKA 2L4FA 3C29A 2KKPA 2C98A 4MF8A 4DWIA 2WHEA 2OCEA 3SATA 4DLEA 5ALQA 2RQ5A 1Z3EB 5D49A 2BJWA 5ALPA 4QZ9A 1SIJA 4LJXA 4W5WA 1L2CA 4ECUA 2EUCA 3IHPA 3GLFE 4RQ8A 3NRZA 4X64M 1F4IA 2G08A 4C4RA 3G6XA 7ICOA 1DV0A 3C5GA 4CGYB 4JK1A 2YQEA 2JZ0A 2LYHA 2RLTA 2MU2A 2XVTA 8ICZA 1OIZA 3FUXA 1ZQSA 2JY8A 4QIWF 3BDPA 1JIHA 2CWBA 1L1ZA 1ZETA 4BB9A 4B3RM 2BZFA 5H2FU 1E94E 4RNOA 1LV7A 3BOSA 1X6JA 5J0RA 2BDPA 3J2PB 3JPSA 1NK8A 3QAUA 2DAGA 3GLGE 1DGJA 2HHVA 2JZBB 1P3QQ 2F77X 4ED6A 1QSYA 4ZPXA 4CCHA 4I27A 4NLBA 1KN5A 3GIIA 4Y2RA 4CIZA 4DO9A 5J2JA 2J5YA 3VDUA 4XUSA 5ITXA 3QZ8A 4O5EA 2W9MA 3B7NA 4QWBA 1D0KA 2KKVA 3BS5A 2EZXA 1IY2A 3GP1A 4GEWA 4DR3M 3RE8A 2ALZA 4F5PA 3Q8LA 2DL0A 3TAQA 3RB6A 4MGZE 1I4WA 2BWEA 2ZUBA 1QSSA 3KDSE 4QWCA 8ICUA 4YY3M 1T3QA 2W3SA 7ICIA 5KFYA 4QZIA 2XH9A 4UBBA 1GABA 2R44A 3KOXE 1IXZA 4LJAA 1LB2B 5B66U 3KSXA 3J80S 4Z6FA 3K1RB 4OJ6A 4R8UA 4B08A 2FE8A 9ICLA 1C1KA 3SZ2A 3RH5A 3L29A 5E79U 5J0QA 3Q8MA 2QPAA 3C2MA 3QWLA 4LRTA 3EWAA 2ZXHA 3HKPA 5EE9A 8ICRA 2LWXA 3B7ZA 2PI5A 5KQDA 1DK2A 3OTQA 3JAMS 3PW5A 3V6JA 4DV3M 1NK0A 2RRUA 3PW2A 1KFTA 5J0UA 5IT9S 1QDTA 5FLXS 4FS2A 3WHKA 2LYBA 3VFDA 2HI0A 4UAWA 2C2EA 2K47A 4CF3A 5DGAA 3RFWA 4YXMA 4F2RA 2VJ4A 4WP2A 4NXNM 1JXLA 4MM3B 2VANA 3HGIA 4GLXA 3D8BA 2F8KA 8ICIA 5CB1A 3GLIE 4AYBC 2CV0A 1ZQ9A 4CJ6A 2Z4SA 9ICVA 4F5NA 2L7IA 4KLFA 2E5SA 2UXDM 2BPCA 2BNKA 1ORYB 1FIQA 4O9MA 5DLFA 4F8RA 1QAMA 4KLHA 3K2LA 4CGZA 4NLCA 1RXVA 4RQ5A 3DEEA 3D6JA 7ICJA 3FD9A 4AZFA 1KEJA 2ODGA 4AQYM 2FS1A 3SQIA 3IDWA 4AW4A 4KITB 1ECWA 3PXGA 3T15A 2OXOA 3HU3A 4NL9A 4PL1A 3RGPA 1VEGA 5EXTA 4EZ9A 1NZPA 4NOOB 2JEJA 4I5SA 4YD1A 2BCQA 4JI8M 5DBBA 2UXCM 8ICTA 5KL1B 1Z00B 3OSPA 3K4GA 2Z4RA 1VQ1A 3BBZA 2C5RA 2WB1C 4QZEA 3PR5B 8ICLA 8ICQA 1DGBA 1X9XA 3R9KA 3KFUG 3CNHA 3BQ2A 2XGNA 1OIPA 5ALVA 2JEFA 4QNRA 3H0LB 2A1JB 2VQFM 1XMQM 3VDPA 1NNLA 4A8EA 3ISDA 1XXHA 9ICFA 5EQTA 5KT6A 2O6KA 2ISOA 1SXJD 3QUQA 1UQVA 2I7NA 3HHYA 1ZQAA 5E6JA 5AKGA 5CA7A 2D8CA 4FO6A 3WKDA 3B7QA 2KVSA 3PSIA 3V6HA 1MQ2A 3V6KA 4L16A 2Y0TA 4JV0A 1PK1A 3SAWA 5ALMA 1GJTA 4I2FA 3FE3A 3ISBA 2CV2A 5KFJA 3SMPA 2DVWB 2NRZA 1R4GA 1TTEA 2AHMA 1KFDA 4PDIA 2D7GA 3ZD9A 1WR1B 4K4GA 2DKLA 1O08A 4O3OA 2NRTA 5EWFA 5J0TA 5JI3E 3VC8A 4UB5A 2QCUA 3U6EA 1HR0M 9ICBA 4DV1M 1PUZA 3FRIA 3W0FA 3FYCA 3SASA 4DOBA 4EBCA 4ED1A 4FD2A 1XSLA 1LVHA 2JRZA 3WKBA 3THGA 5KPRA 3FTFA 5BOLA 4EYIB 1VDVA 3GILA 1RDFA 1TAQA 5BPVA 2ZUCA 4B9SA 1ZQKA 5CRXA 5KFAA 1MQ3A 1NO1A 8ICAA 1WG8A 3T6PA 1ZQYA 3L5KA 4GHAA 5J2GA 5IINA 2FOIC 5ITXE 1JI7A 2I5HA 2W55A 5AKYA 8ICNA 2MROB 2JXNA 1PVRA 1TH4A 1ZQIA 2F5NA 2R8JA 1YSYA 3GQCA 4JI4M 3RF9A 3AUOA 3I01M 4XBOA 2CFOA 2PFNA 5KFFA 2YNMD 2DWQA 5G5HA 1N36M 1JMSA 2GLEA 3QUTA 5L1MA 4UATA 3HILA 3H8JA 1NHGC 4MGKE 1W5SA 2HHTA 1HQYE 3SAGA 2G09A 1V33A 1FFUA 3Q8PB 4NLNA 5LMUM 3V72A 5IIOA 4F91B 2YB4A 1MA7A 1WYGA 1OFIA 4OW0A 3UPQA 3VCBA 4M9HA 2F1HA 2W9AA 3EPIA 1NY5A 3ZQJA 3RB4A 3K1JA 1R5LA 4QNLA 4IQWA 2V4RA 4R63A 4DV7M 2JEIA 2G07A 2A19A 3GPPA 5AM4A 1UPHA 1OAOC 3A0BU 4OVZB 2HHXA 5HHIA 4DLGA 3SMVA 1BPDA 1C7YA 4DL3A 3GQ3A 3IP4B 4QZDA 1ZOLA 4FE3A 3F53A 3AV0A 1T8EA 3MK6A 2ZTDA 1GL7A 3RBDA 1S0VA 3THVA 5AHXA 2AHOB 3RFAA 4G4NA 1OXJA 4LF5M 1V38A 4LJ9A 2QQ8A 2HBJA 3KHHA 4F4YA 2NRXA 9ICOA 4USAA 4F5QA 3T5JA 1IY1A 1RQLA 4DCCA 2D7EA 1NZBA 4Y2YA 4GXKA 4YR0A 2KZ3A 2DZLA 2LMRA 3OPXA 2W9CB 3UJNA 4ECVA 1BPXA 3MFIA 4ED2A 1AQ6A 1COOA 2C99A 2JP7A 1Q3BA 4CHTB 2RP5A 4D80A 5ALIA 2KK0A 4Q45A 1NKEA 3LWLA 4Y2VA 4B9MA 2NV3A 4OJPA 5KFGA 2PMZC 3A0HU 5KFSA 5J2BA 4GC6A 3AKZA 4XK8F 3ZC7B 1NNJA 4ZOHC 2CPRA 2Y1JA 3AQEA 5TISU 3IG8A 2H3IA 2R65A 2JZBA 2F3NA 1X42A 4LF8M 1SXJC 1V34A 4X65M 2VA8A 2MGWA 2FMSA 4EBEA 5LMNM 5KPTA 1ZQFA 3FTCA 1NJFA 1SXJB 1EFUB 2R4JA 3AOGA 1H6UA 3KFUF 1FNNA 1U48A 1RG6A 1JN3A 2O01F 1F0MA 2DZNB 4JI2M 3GV7B 4GC7A 2YMQA 4Y2PA 3WK9A 3PW4A 4D82A 2BCUA 4C7YA 8ICVA 4IC9A 4MGHA 4QOZC 2NO5A 4NL4H 2HL7A 2NRWA 4DV4M 2I7PA 3Q8QB 3PV8A 4QHTA 4IR9A 1YLAA 2GQFA 2Y0QA 2KZMA 4P4PA 1T7PA 4F92B 3U6DA 1YZ6A 5AI5A 2KIWA 4AKIA 3SYZA 1GKIA 5KFQA 1HUOA 3SARA 3HHWA 4WW0A 4UB3A 3G6VA 2EZYA 3E58A 4Z6CA 3M6ZA 3LQRA 5DB9A 5AIAA 4LZDA 5DB8A 2WSFF 4ECZA 2VA3A 4Y2SA 1RYUA 1EIJA 1UHUA 4JMUA 1YUBA 3WK5A 5AK4A 3SHFA 4ED8A 2G3QA 4IBFA 2FLLA 5F3XB 3CTWB 3UMBA 4Q8EA 2HW3A 4ZH4A 2H5XA 4UASA 2ATLA 3GLHE 4ANRA 2J7OA 2XY7A 4DSFA 3GIKA 4MEXA 1GVNA 4AYBF 2ASDA 1L6NA 2K89A 4JI7M 3KVWA 1IFYA 3VK7A 3AM9A 1KKXA 2R8IA 5AKXA 3MR3A 4O3QA 2DNAA 1TE2A 1TH3A 4DFDA 4NL9C 4DL2A 4G6ZA 2EDUA 1I94M 1ZQ1C 2JV3A 5ALLA 2UUAM 2C28A 2BR0A 3SV3A 3E46A 2KW0A 3V76A 3GDXA 4KN4A 4C8LA 2YFQA 1URJA 3E9SA 1SKWA 1L8LA 3RJEA 1N60A 4PPXA 4LG2A 4JV5M 3F5AA 3QU7A 1Z00A 2P66A 3HKZC 2KXEA 1IBLM 3FUVA 1WGLA 2KMDA 4F1IA 3HT3A 3W67A 3ZDBA 4Q44A 1COKA 1XNSA 2B6GA 5D46A 5ITQA 4RPZA 1D2NA 1KFVA 2MH8A 4B7HA 2D3DA 4PGQA 2NQ8C 2LVPC 2A1JA 2WB1F 3MR6A 5AM1A 3C5FA 1RYSA 4OO1J 3FUWA 5HR7A 4LFBM 4OX9M 2L5YA 4C4TA 1ZQNA 1XWLA 5AM0A 1KQQA 2KJ5A 4B9UA 5DGBA 4QW9A 1X9SA 4DR1M 5KFWA 2DHYA 3HX0A 4GRIA 1OW5A 3T1YM 2AQ0A 1NJXA 2DAKA 2C2RA 1N62A 2JGAA 3U6MA 1ZD3A 1N63A 1IY0A 4J9LA 3WKEA 4TQRA 3FUUA 2EZZA 4NRWA 3U6CA 5BR8M 4DFJA 1A6SA 2BJVA 2MAXA 3KD3A 4OJ5A 5KFBA 4F50A 2KFZA 5EP2A 1U49A 3J7BA 1NKBA 3EPGA 3Q8RB 4NC6A 5KG5A 4E0DA 4NXMM 4DR7M 3C21A 3FKEA 4PZNA 9ICPA 2OYYA 4P2HA 3K9PA 4DUYM 4OD0A 3A46A 4M9JA 4DR4M 1LTMA 3U6SA 2CN1A 4IQTA 3K75D 2LM1A 4OJOA 2NO4A 5KFZA 5AICA 5C18A 1ZQTA 1S97A 3FYHA 5JRTA 1IG6A 1JXEA 2J6SA 2ZIXB 4O3SA 5AK5A 8ICEA 1TH2A 4L6V6 2YMLA 3U6PA 4Y2QA 3C2LA 2Y9UA 3MABA 2C22A 1X2IA 5AKJA 3Q8SB 2KHQA 4X5VA 5ALJA 4QW8A 1IIPA 5KFNA 1NSFA 2KRKA 3DDHA 3VKGA 1AROP 2DENA 5J0SA 2OEHA 1Z4OA 2WF7A 5KPZA 3FYDA 2KHVA 2BCRA 4UAVA 1V92A 5FTKA 3GRUA 2E3TA 2AQ4A 1EXNA 2CHQA 3PNYA 4QWAA 2GNOA 4PHPA 4DFMA 3TWKA 4PGXA 3QEBZ 2ZJ8A 4OVZA 4DR5M 3PY8A 2ASJA 3E4RA 2ES6A 5B5EU 2IBKA 1YE9A 2KJ8A 3KS8A 4UARA 1SKRA 2V4QA 4X66M 2Q4TA 4DF8A 3SYKA 3FUTA 3ED5A 3C3DA 1J97A 2APLA 4PCZA 4GXJA 5J0XA 2KSOB 1Q02A 3H4MA 4Z6DA 1PJIA 2FPLA 4M0AA 2FI1A 3N7SC 1T6OA 2UU9M 1J09A 4P0QB 5J0PA 5AKZA 1Z6TA 4EIWA 1IM2A 2W9CA 1LV5A 1WHCA 2F5OA 4PHAA 5ALXA 5KFHA 4GC5A 3KS4A 2Z3XA 1ZQQA 1L7OA 1R2YA 1B4FA 5AK6A 3H8WA 1V85A 1G71A 1Q3CA 3C2KA 4IBJA 3QU4A 2PMZF 2G06A 4FBTA 3AN1A 9ICMA 4ED7A 3IG5A 3RAQA 4XRHA 4LVSA 3V7LA 4TUPA 1X9MA 4O5KA 1S9FA 1SXJA 4NXZA 5L1LA 1ZQJA 5HHHA 3WK7A 3ETRA 8ICYA 1TGUA 4HLQA 1D0MA 3CF6E 4DR2M 1G59A 2KG5A 1XO0A 2DWZB 2HHSA 4I2AA 2VJ5A 3ORYA 1ZMWA 2BWBA 4BGDA 7ICSA 1UCVA 1QQ7A 4PDGA 5AKHA 4AKGA 3PVSA 1QUTA 4JI6M 4PZOA 3TADA 3J81S 5IWAM 5HMMA 5DBCA 2L6OA 1Z5CA 2WSCF 3AU2A 1D8BA 8CATA 2WZJA 2YMPA 4EENA 4RPYA 5J2IA 3KKAA 3K92A 4DL7A 4C0ZA 1AUAA 1XHBA 4L78A 2W8LA 4TURA 3I1YA 3AL0C 4P17A 2P6RA 4FWGA 4PHDA 1FO4A 1CEZA 4Y2UA 4QZAA 2JXJA 1Z1BA 3AL0B 3L4PA 4G4OA 4II7A 2KJ9A 4DF4A 3BQTA 3AMZA 1DGGA 3RR8A 1S8OA 1PVQA 1PJQA 4O3NA 1GO3F 5KAIU 4KLQA 5IIMA 2LYAA 3RBEA 2F1JA 2K8CB 4KLTA 4YMOA 2VF7A 2HCBA 4I81A 3NASA 2W7OA 2G8LA 1TF0B 4RZRA
chains in the Genus database with same CATH topology
1J5EM 1HQCA 2YR0A 2DZOB 3M7GA 7CATA 2MA1A 3GZFA 4GMQA 1A0PA 4LFCM 1T3TA 4K0KM 2YB4A 1MA7A 4U7CA 1OFIA 4OW0A 2VKQA 4ICAA 3VCBA 1Z5AA 2H3ZA 1NY5A 3W0LB 3K1JA 4QNLA 3U5ZA 2XICA 2O5RA 4FCTA 4DV7M 2RGOA 3T79A 4M9ZA 4LJ8A 3VLFB 2G07A 4DV6M 3GPPA 3M7DA 2ZIWB 1UPHA 5C0YA 2XEPA 4OVZB 2LXEA 2JH7A 2QENA 2R62A 3GLFB 1G8PA 3SMVA 2LKYA 4AI6A 2R18A 2H1RA 4GC9A 3GQ3A 2KOBA 3DZDA 3UZUA 3IP4B 4QJFB 4FE3A 3M6AA 4S12A 3AV0A 3F53A 4GHLA 3MK6A 2X4AA 3PSTA 1GL7A 4NSOB 3RFAA 4G4NA 3LQQA 1IBKM 4LF5M 3U61B 5F3WA 2ERCA 1DGFA 2QP9X 3GRVA 4HL4A 2DHRA 4AKHA 3GPXA 4LJ9A 2HKJA 3D2NA 4DV0M 2RKOA 3NBIA 5ITRA 2HBJA 2EO2A 3A42A 5IREB 4LF9M 1Z5BA 4Z8XA 4FZLA 1IY1A 1HNWM 2D7EA 1NZBA 4DUZM 4PL2A 3GLGB 1IN6A 4CISA 3KP1E 3HKZF 2C9OA 1HNZM 3ICXA 1QAOA 3OPXA 2K4IA 2HBKA 2P5TA 2X8AA 3UJNA 3JR5A 2K4EA 3Q8XA 5KQ8A 2HOQA 2C99A 4BBAA 1Q3VA 4LY6A 4ITQA 1F44A 3OTOM 1Q3BA 2OH2A 4CHTB 2RP5A 4D80A 2LH0A 4L8RC 5EXSA 2QBYA 1XXHB 4FWDA 4LJ4A 3ONNA 3I4YA 2NV3A 4OJPA 3SAVA 2F4VM 2PMZC 2XIDA 3AKZA 1KSFX 3ZC7B 1NNJA 1XNQM 2CPRA 4NV0A 3PZPA 3AQEA 3IG8A 2H3IA 3KP0E 2R65A 2RGHA 3M6KA 4FCWA 4LF8M 4LJ5A 5EP1A 4BJQA 4PD2A 1SXJC 4X65M 3AFHA 3GRYA 4CRXA 1UM8A 3U60B 2QZ4A 2XI9A 5LMNM 5KPTA 1T94A 3FTCA 1DGHB 3HHXA 1NJFA 1NY6A 1SXJB 3DFZA 2KZUA 2R4JA 4I8OA 3AOGA 2OQ4A 2JMGA 1H6UA 3KFUF 3HHZA 5FTLA 5EP4A 3TWLA 3ZH9B 3JR4A 4GKJM 1FNNA 2R46A 2R45A 2XLJA 4RNAA 3SFZA 3H0RB 2DZNB 3MJ5A 4JI2M 3SAUA 3SMSA 1XMOM 4JI1M 3SAHA 2D7HA 3EIEA 3NUQA 1N34M 2M60A 5FTJA 1PM5A 1QANA 3HJQA 4GIPA 1JQJC 5HR6A 5DNYA 4D82A 2F5PA 4O3MA 3GRRA 1K82A 5ITUA 1NHWC 4IC9A 2ZBKB 2HOIA 4MGHA 4QOZC 4P0PA 3L28A 2HL7A 4NL4H 4AG6A 4WURA 3SBJA 2DXIA 4IBBA 2Y0SF 2UXBM 3O0FA 4DV4M 2I7PA 4IBKA 1ZAEA 1TDZA 2C9CA 4QHTA 2FNAA 1SXJE 4DV2M 1R2ZA 4B3MM 1E9RA 2K8AA 2K8BB 2HHHM 2KNJA 3HU2A 4XGIA 3F5EA 3K1ZA 4P0PB 3R8FA 3D2SA 2Y0QA 2JH1A 3AQFA 3U6DA 3A98B 3GQ5A 2KIWA 1E9SA 2WAQF 4AKIA 1NVMA 2X49A 1L1TA 1GKIA 2Z7JA 2XF3A 2BDUA 2ZIXA 1GLNA 3SARA 3HHWA 5DYGA 4WW0A 3GLIB 1R7RA 2G5IB 1G3IA 2KA6B 3M0EA 4RF0A 2F5SA 5JI2E 2UUBM 2DQNB 3PSFA 3L2AA 3IN5A 3M6ZA 3LQRA 4LFAM 4JI5M 5ITYA 4FCVA 3D8LA 2YX8A 3MGVA 1QQWA 2H3QA 4JMUA 2V1CA 1YUBA 2ZIUB 2KD1A 3WHLA 4DV5M 3LVVA 3SHFA 2KV2A 3D2QA 3DA1A 4FWHA 4IBFA 2HBMA 2M0NA 1KYIA 4B3TM 3CTWB 1Z59A 2ZANA 5ITTA 2JA2A 3KW6A 4QHSA 2R4EA 4P16A 1E32A 1MU5A 4GH9A 2VIIA 3FTDA 3KZXA 1HT1E 3CRXA 2J7OA 2W82A 1ED1A 4KMOB 5DYIA 3GPUA 3GQ4A 1GVNA 4AYBF 5T14A 1L6NA 1JR3A 4R3DA 4OU7A 4JI7M 5KO3A 3KVWA 1WUDA 2K89A 3SAFA 4PT5A 4QOSA 3U5ZB 3VK7A 3J27B 1TH3A 5EXXA 2Y21A 3KXEC 4GKKM 3F2CA 4G6ZA 3HWSA 1I94M 4DR6M 1ZQ1C 2UUAM 1NNUC 3KOZE 2KW0A 4FW9A 4Z6YA 4MGYE 3E0FA 1IN8A 3GU3A 1X37A 3C29A 2YFQA 2KKPA 3LMMA 1Q3UA 3LYSA 4JXJA 1URJA 2C98A 3DOAA 3E9SA 1HEKA 5A0LA 1J7KA 2DWNA 1IN7A 4M9XA 3SATA 2W7PA 2CEAA 1N78A 4LG2A 4LCBA 4AG5A 4JV5M 3F5AA 4IBIA 2BJWA 2H3FA 3HKZC 2KXEA 1WXQA 3FUVA 4KODA 4W5WA 1L2CA 1IBLM 1VDDA 2F76X 2EUCA 1QAQA 1XNSA 2GH1A 2V1UA 2W03A 5ITQA 4X64M 1D2NA 1KFVA 2G08A 4B7HA 1IXSB 2NQ8C 4CGYB 5H37D 3A45A 2XVTA 2WB1F 1P7DA 4B3SM 3FUXA 4OO1J 3J7AS 4QIWF 3FUWA 2VQEM 5HR7A 4LFBM 4OX9M 1L1ZA 2EA0A 1IN4A 4BB9A 4B3RM 1SZHA 4JN6A 2KJ5A 2QBYB 1E94E 2KZSA 4KHPM 1LV7A 3VKHA 3BOSA 4DR1M 3J2PB 4GRIA 2OM6A 3T1YM 2KVCA 3FTEA 3GPYA 3QAUA 3CP8A 2F77X 4IBDA 1MX0A 1DO0A 4ZPXA 3U6MA 2DWMA 2JGAA 4NLBA 2CV1A 2G5GX 1IY0A 3I51A 1QVRA 1OJLA 3FUUA 2K4HA 3VDUA 2KICA 1QYRA 4NRWA 3UK6A 3U6CA 2CUZA 5ITXA 2CRXA 5BR8M 4RF1A 1A6SA 1L2DA 2BJVA 2G0AA 5GKNA 4NRVA 2KKVA 1K3XA 4OJ5A 1Z19A 3T38A 5EP2A 1K3WA 1IY2A 1QZMA 4IBGA 3GP1A 1N77A 2H3VA 4DR3M 3J7BA 2DGZA 4FZNA 3RE8A 3GO8A 5EXPA 4NXMM 4MGZE 4DR7M 1I4WA 4REZA 3FKEA 2LBOA 2CE7A 3KDSE 2OYYA 5FSWA 3AOEA 4YY3M 2ZG6A 5FTNA 4DUYM 3A46A 2XH9A 4LZZA 3KOXE 1IXZA 4LJAA 3R9XB 2WAQC 1PJJA 3KSXA 4IIWA 4FVMA 3J80S 3U6SA 4DR4M 2CN1A 2HMXA 4GFJA 4OJOA 4OJ6A 2ZIVA 2A3VA 4B08A 2FE8A 5C18A 1XNRM 3TWMA 2M5ZA 4X62M 1C1KA 4JI3M 3L29A 1XC8A 2QPAA 4IJFA 3L27A 4KX3A 4IJEA 3QWLA 3GLHA 4LRTA 3ALRA 1Q39A 2ZIXB 3N7PD 1HNXM 3HU1A 4CDGA 1IXRC 2ZXHA 3HKPA 1TH2A 2LWXA 2XZFA 5KQDA 3U6PA 3I4VA 2UUCM 5FTMA 4LGMA 3JAMS 1JR3D 2XSZD 3K8ZA 4M0WA 4QNMA 2KHQA 4DV3M 1XWIA 3VK8A 1IIPA 4JYAM 1NSFA 5IT9S 5FLXS 2KRKA 3WHKA 3VFDA 2LYBA 2K47A 3VKGA 3HJ8A 4KO8A 4IBEA 3RFWA 4LF6M 1HIWA 2MRLA 2VJ4A 4NXNM 2W04A 4MM3B 3HGIA 2Q2EB 3D8BA 2JHDA 1NJGA 1GL6A 4IBCA 5KPZA 4AYBC 1N75A 1OFHA 2CV0A 3FYDA 1ZQ9A 2XSZA 4JI0M 2Z4SA 2KHVA 3N7RC 5FTKA 3GRUA 2L7IA 2E5SA 5IZ7D 4WJ3B 4MH0E 2BNKA 2UXDM 1ORYB 2CHQA 4I4LA 3PNYA 2V6ZM 2G5HB 1IBMM 3TWKA 3CF0A 2ZIWA 1HT2E 1QAMA 4OVZA 4DR5M 3U6OA 3K2LA 2F5QA 1DRGA 2D6FC 3PFIA 4KLNA 3T1HM 3GLFA 3E4RA 1N32M 4CGZA 4NLCA 2E1FA 1YE9A 2KJ8A 3DEEA 3HJSA 4L4UA 3KS8A 3LVWA 5C1BA 2KEYA 3L3FX 4LRSA 2HBLA 2J7NA 3FD9A 4M0DA 4AZFA 4B7FA 4TUWA 1CRXA 4AQYM 3SYLA 3SQIA 4X66M 3TL4X 4LJ7A 2Q4TA 4R7GA 5E26A 1R6BX 4AW4A 4ACOA 3SYKA 3FUTA 1ECWA 3PXGA 3U61A 3T15A 3L26A 1G4AE 3HU3A 2OXOA 4PL1A 3C28A 3RGPA 5EXTA 4BUGA 1DO2A 4P0QA 3C58A 5A2QS 4PCZA 4NOOB 1OUQA 4I5SA 3H4MA 3PNVA 4JI8M 2UXCM 4OJLA 1L8QA 4MGIE 1PJIA 2F2AB 4MB7A 5KL1B 2DWLA 3GLGA 3TPZA 2Z4RA 3N7SC 2UU9M 2C5RA 1J09A 2WB1C 2F8LA 4P0QB 1Z6TA 2LHTA 1DGBA 2E1EA 4EIWA 3KFUG 1IM2A 4QIWC 3U6LA 2XGNA 4G4QA 3TQSA 4QNRA 3H0LB 3AJIB 2ZAOA 3KSJA 4U6PA 4NSRA 2F5OA 2VQFM 1XMQM 4NWIA 3VDPA 4GC5A 3KS4A 4A8EA 1XXHA 5EQTA 3F2BA 2ZM6M 1KBUA 2Z3XA 2C96A 1SXJD 5EJCA 4A3VB 2I7NA 3HHYA 5E6JA 1R2YA 4LF7M 4LZJA 2OPFA 1Q3CA 2A5YB 4IBJA 2YQZA 1FJGM 3PSIA 4M9SA 2PMZF 2G06A 4L16A 2CHVA 2Y0TA 3IG5A 1EE8A 4LJ6A 3U60A 3SAWA 1TAMA 2KRUA 2YB1A 1DGHA 2CV2A 3SMPA 2DVWB 1SXJA 4B7GA 2DF4B 5KL8B 2AHMA 4KX5A 4PDIA 1N33M 2D7GA 2L09A 3MHVC 1TGUA 4G4RA 4HLQA 4FZMA 3CF6E 4DR2M 1G59A 3UMMA 1XO0A 2DWZB 3CF2A 2GOLA 2VJ5A 2Y0SC 5JI3E 3VC8A 3KOWE 3ILKA 1G41A 4D81A 4PDGA 2QCUA 4AKGA 3PVSA 3U6EA 1HR0M 3NRWA 2ZAMA 3SHGB 4DV1M 4JI6M 2LNHC 3L25A 3W0FA 3AOEC 3FYCA 3SASA 4BX9C 3J81S 5IWAM 3KOYE 2L6OA 1Z5CA 2FFJA 4FD2A 4LGYA 1D8BA 3EIHA 1IN5A 8CATA 3THGA 5KPRA 1IQPA 2Y20A 4LF4M 3FTFA 2RHFA 2RRDA 2HOFA 3K92A 3TE6A 5BPVA 4C0ZA 5EP3A 4L15A 1XHBA 3UGJA 5CRXA 4L78A 2XZUA 3CYMA 3AL0C 4GHAA 4FWGA 1W5TA 3H0MB 3U6QA 1TDHA 2ZIVB 2FOIC 2L7HA 5ITXE 2N1RA 1YT3A 2KEBA 3F2DA 2E5LM 1PVRA 1Z1BA 4GITA 3AL0B 3GLIA 4G4OA 4II7A 2KJ9A 1TH4A 2F5NA 1DGGA 1YSYA 2CHGA 4JI4M 3GLHB 3RF9A 2XFSA 1PVQA 4XBOA 1PVPA 2CFOA 1S3SA 2YNMD 1GO3F 2ZXIA 3ZCBB 1N36M 3RGSA 2K8CB 2LYAA 2XFTA 2VIXA 4YHHM 1NHGC 4MGKE 1W5SA 2ZIUA 1HQYE 2HCBA 3NWLA 4I81A 3SC3A 4BLCA 3PSPA 3SAGA 2W7OA 2G09A 2G8LA 3B9PA 1L2BA 5LMUM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7J A;  2R18 A; 
#chains in the Genus database with same CATH topology
 2MA1 A;  1HQC A;  2YR0 A;  3GZF A;  3H7I A;  2R8G A;  4DSI A;  4M9N A;  1RYR A;  4U7C A;  1Z5A A;  2H3Z A;  3RB3 A;  3M9O B;  2O5R A;  3T79 A;  2RGO A;  2XGP A;  1LKY B;  3VLF B;  4F93 B;  4DV6 M;  3KTQ A;  3GV8 B;  3M7D A;  1ZRM A;  4DBG B;  2ZIW B;  2XEP A;  4NM1 A;  4AP9 A;  1ZD5 A;  2JH7 A;  2R62 A;  3GLF B;  1D0L A;  4XQ8 A;  2LKY A;  2R18 A;  9ICQ A;  2H1R A;  2KOB A;  3DZD A;  9ICR A;  1XB2 B;  3QUC A;  4G3O A;  4NSO B;  1JAL A;  1IBK M;  7ICH A;  2EQY A;  3U61 B;  1NJW A;  3GRV A;  4I28 A;  4HL4 A;  2ASL A;  3GPX A;  1K5O A;  1Q8K A;  3D2N A;  4DV0 M;  2RKO A;  5ITR A;  1Z5B A;  1HNW M;  3M1Y A;  4DUZ M;  1NV8 A;  5KFL A;  3GLG B;  1MC8 A;  1RU3 A;  4CIS A;  3HKZ F;  2C9O A;  1HNZ M;  3H4D A;  2OOA A;  7ICK A;  2EH9 A;  3WKC A;  4GXI A;  2OH2 A;  2KDL A;  4Y2T A;  3PO4 A;  4RU9 A;  2LH0 A;  5EXS A;  3JPR A;  2FLP A;  5AKI A;  3KZI U;  4JWM A;  4UAZ A;  3KP0 E;  2LBC A;  2W3R A;  5HML A;  1Q46 A;  5EP1 A;  4M04 A;  4RUC A;  4CRX A;  4M9G A;  3U60 B;  4MFF A;  2QZ4 A;  3PX6 A;  2KZU A;  1S0M A;  3ZH9 B;  3JR4 A;  4ECS A;  4GKJ M;  1ZQZ A;  5AI9 A;  2J6T A;  9ICW A;  3E2E A;  4KLU A;  2XLJ A;  4RNA A;  3SFZ A;  4F5R A;  3MJ5 A;  3SAU A;  3SMS A;  4JI1 M;  2D7H A;  2HCF A;  3IHQ B;  1N34 M;  4GIP A;  3EYZ A;  1SKS A;  5DNY A;  5K4L A;  4BWM A;  1S0O A;  1XSN A;  4BWJ A;  1B43 A;  4FBU A;  4I2D A;  2HOI A;  4AG6 A;  3SBJ A;  4WUR A;  4RQ0 A;  2UXB M;  3PML A;  1SXJ E;  2K8A A;  4P0P B;  2KNJ A;  2HHH M;  3HU2 A;  3K1Z A;  1ZD4 A;  3UXO A;  2JH1 A;  1ZQC A;  3AQF A;  5ALT A;  1Y88 A;  2C2D A;  3RJG A;  1HUZ A;  1L1T A;  2Z7J A;  4XA5 A;  2XF3 A;  8ICW A;  2N35 A;  2EAP A;  2ZIX A;  2XY5 A;  4BDP A;  2Y9T A;  3GLI B;  5DYG A;  1TAU A;  2G5I B;  1R7R A;  1G3I A;  3M0E A;  2UUB M;  2FMQ A;  3ZDD A;  1UT8 A;  4JWN A;  3NVZ A;  2NRV A;  7ICT A;  4I2B A;  4J9M A;  4JI5 M;  4FCV A;  2MJ5 B;  2JUJ A;  5KFD A;  1DXS A;  2W8K A;  1QQW A;  2H3Q A;  2V1C A;  4C8M A;  4DEZ A;  3OSN A;  2ZIU B;  2WF9 A;  4DV5 M;  3LVV A;  2PI4 A;  1GO5 A;  3DA1 A;  4B6J A;  2I9G A;  4C8N A;  1KDH A;  4HAI A;  3EW9 A;  1Z59 A;  2ZAN A;  5ITT A;  4NJ8 A;  2JA2 A;  2ZTC A;  3RJF A;  1X9W A;  2R4E A;  1WWU A;  4DQP A;  2VII A;  3FTD A;  3MR2 A;  3RRG A;  4LZG A;  1ED1 A;  4DQS A;  2VDB B;  4M9L A;  4YP3 A;  1PGY A;  5KFU A;  1JR3 A;  1WUD A;  4UBC A;  4QOS A;  1PJT A;  3TFS A;  2JY7 A;  5J0W A;  5EE1 A;  4KMU A;  3EZ5 A;  3F2C A;  3HWS A;  1J2N A;  5KG0 A;  2QB0 B;  3E0F A;  1Q3U A;  4JXJ A;  1SZP A;  1HEK A;  3Q8K A;  1J7K A;  2FE9 A;  1IN7 A;  2WFA A;  2KSO A;  2CEA A;  4Q8F A;  1WIV A;  2F1I A;  4US9 A;  1QZE A;  1SL0 A;  4AG5 A;  1DK3 A;  4IBI A;  2H3F A;  2EKK A;  5DG7 A;  4KOD A;  1TVA A;  4ECQ A;  2BGW A;  2V1U A;  5AI6 A;  1U47 A;  1IXS B;  1J2M A;  1K1Q A;  5IIK A;  3N97 B;  4DSK A;  1P7D A;  1YZ7 A;  4B3S M;  3J7A S;  2VQE M;  5ALU A;  5KFP A;  3JPN A;  4NY8 A;  7ICP A;  1CI4 A;  4KLI A;  4R71 A;  1BGX T;  2QBY B;  3JPO A;  4KHP M;  4UB2 A;  1ZQM A;  1RXW A;  5ALZ A;  4F72 A;  2KVC A;  5KG2 A;  4RUA A;  4ELU A;  5AKL A;  2E8P A;  3WK4 A;  4IBD A;  1N61 A;  2DWM A;  4Z6E A;  2CV1 A;  3B89 A;  4M47 A;  2DI0 A;  4UN2 B;  1OJL A;  4MFC A;  2K4H A;  1VEJ A;  1XXH E;  4I2H A;  4KLL A;  3UK6 A;  2CUZ A;  5EE0 A;  3TAD C;  2KE7 A;  4RQ3 A;  4NRV A;  1K3X A;  3T38 A;  1K3W A;  2EAO A;  5AK3 A;  1N77 A;  2H3V A;  5KFO A;  3KKA C;  5C5J A;  1L3S A;  1ZQP A;  5EXP A;  4REZ A;  1KW4 A;  4F2L A;  2CE7 A;  1ZQE A;  7ICG A;  2BQU A;  4IR1 A;  1KLN A;  4M6W B;  4UB4 A;  3R9X B;  2WAQ C;  1L3T A;  4GFJ A;  3MBY A;  5D4B A;  2A3V A;  3MMP A;  4O5C A;  2M5Z A;  4R64 A;  1XC8 A;  1BPB A;  1D9F A;  4ECR A;  1IM4 A;  3MC1 A;  4IJF A;  4Q7J A;  4KX3 A;  4B9T A;  4IJE A;  1XU4 A;  3ALR A;  2FLN A;  3SD7 A;  4CDG A;  1IXR C;  4ECW A;  3TAN A;  5L8R F;  3RH4 A;  1BPE A;  2UUC M;  3I4V A;  2Y1I A;  1A5T A;  1SV0 A;  1JR3 D;  3AEV A;  2XSZ D;  5L1J A;  4DS5 A;  3K8Z A;  1SB3 C;  5KFT A;  7ICU A;  3GV5 B;  4QWE A;  1HJP A;  4RT2 A;  4EEL A;  4KO8 A;  4F4K A;  1HIW A;  3I28 A;  1PZN A;  1QLN A;  3GIM A;  3HPO A;  2JHD A;  1NJG A;  2EAN A;  1GL6 A;  4YG2 A;  4IRK A;  1ZJN A;  7ICQ A;  5DQH A;  9ICI A;  3N7R C;  2HHU A;  1AIP C;  5IZ7 D;  4DQQ A;  9ICE A;  4I4L A;  1LKY A;  3SV4 A;  2V6Z M;  1VDL A;  2LVO C;  3CF0 A;  2ZIW A;  3U6O A;  2A1A A;  4RQ2 A;  5C0Y A;  4DOC A;  3GLF A;  1N32 M;  4IS7 A;  3HW8 A;  4L4U A;  3LVW A;  5C1B A;  2KEY A;  3L3F X;  3PR4 A;  4LRS A;  2HBL A;  1ZQD A;  4M0D A;  2AJQ A;  2RDI A;  4B7F A;  4TUW A;  5III A;  1S5L U;  1CRX A;  3J81 j;  3SYL A;  3TL4 X;  4LJ7 A;  5E26 A;  1R6B X;  4I2E A;  4ACO A;  4QZC A;  4DL5 A;  3U61 A;  3L26 A;  4RQ6 A;  1G4A E;  3C28 A;  1NK4 A;  1DO2 A;  3C58 A;  4DS4 A;  1OUQ A;  3N28 A;  2XGQ A;  3PNV A;  1L8Q A;  5KNI A;  5FP0 A;  2F2A B;  4MB7 A;  1QQ5 A;  2DWL A;  3GLG A;  3TPZ A;  4I2G A;  2F8L A;  5L1I A;  7ICM A;  1SWW A;  3TI0 A;  2EJS A;  3U6L A;  5DQG A;  4DFP A;  4YVZ A;  5DBA A;  2ZAO A;  3KSJ A;  4EEK A;  4U6P A;  1ZQB A;  3SR6 A;  4RQN A;  3QE9 Y;  4NLG A;  3F2B A;  3MGH A;  4PH5 A;  2W43 A;  2C96 A;  3I76 A;  4A3V B;  2QNJ A;  3H4B A;  4C4S A;  4LF7 M;  2OPF A;  2A5Y B;  5KG3 A;  2DPJ A;  1FJG M;  1Y8G A;  4DSE A;  2LHC A;  2CXY A;  5HP4 A;  2CHV A;  4LJ6 A;  3U60 A;  1IV8 A;  8ICX A;  2KRU A;  8ICB A;  3BQ1 A;  4B7G A;  4IQU A;  1SXE A;  3NVW A;  4KX5 A;  4O0I A;  2GO7 A;  2L09 A;  1QDR A;  5KFK A;  5KG1 A;  4HYK A;  4FZM A;  3UMM A;  3UM9 A;  1FFV A;  1JUD A;  1ZQH A;  1JRO A;  4RKU F;  4NLZ A;  3KOW E;  5ALF A;  1G41 A;  7ICE A;  1JB0 F;  4R65 A;  4RNM A;  3NRW A;  3HP6 A;  5F9N A;  2BPF A;  2LNH C;  4DSL A;  2DBY A;  2F44 A;  3L25 A;  3AOE C;  2LM4 A;  1Z4N A;  7ICR A;  1X40 A;  4LGY A;  4YCX A;  3ZI4 A;  3EIH A;  2QLT A;  3QUB A;  3MGI A;  5AM2 A;  1IQP A;  4LF4 M;  1QH9 A;  2RHF A;  2HOF A;  3TE6 A;  4UW9 A;  5EP3 A;  4L15 A;  1OQY A;  3UGJ A;  2MUT B;  5ALW A;  1W5T A;  2AGO A;  4UB1 A;  3H0M B;  3U6Q A;  2ZIV B;  3TAP A;  4I2C A;  1YT3 A;  2KEB A;  3F2D A;  2BQ3 A;  3PW7 A;  4IQV A;  4KLM A;  4GIT A;  3OGU A;  4J9P A;  2K6B A;  3GLI A;  3OJU A;  4F3O A;  3NS1 A;  3GLH B;  5BPC A;  1PVP A;  4I2I A;  2ZXI A;  3ZCB B;  1K1S A;  2L4E A;  2XFT A;  2XO7 A;  3V7J A;  4YHH M;  2ZIU A;  3PSP A;  3SC3 A;  4ED3 A;  2R6F A;  1NK9 A;  1N48 A;  1L2B A;  1J5E M;  3M7G A;  2DZO B;  2RDJ A;  3V7K A;  2DAM A;  2QKQ A;  1T3T A;  1ZQX A;  4GIB A;  4PHE A;  1QSL A;  4J9O A;  4G3I A;  2VKQ A;  4ICA A;  1KRP A;  2ZJA A;  2KNA A;  3B74 A;  1FEZ A;  4FCT A;  5KTQ A;  3QEA Z;  3G6Y A;  1SWV A;  3B9J A;  2K0B X;  4C8K A;  2LXE A;  1S76 D;  2QEN A;  1G8P A;  5J8Y A;  4Y2J A;  2QB0 A;  5KT4 A;  1ZRN A;  1OKS A;  3UZU A;  4S12 A;  4EBD A;  2X4A A;  3PST A;  4MHV A;  3IV6 A;  3ZDE A;  2UVW A;  5F3W A;  1VLB A;  2ERC A;  1DGF A;  2IA6 A;  2DHR A;  5DLG A;  2HKJ A;  4KLS A;  3H4J A;  9ICH A;  5J2K A;  3NBI A;  2IMW P;  2PFO A;  3ZDA A;  1XSP A;  1DOQ A;  3IRU A;  2EO2 A;  5IRE B;  4Z8X A;  1SL1 A;  5KT3 A;  2E8M A;  4PL2 A;  2FPK A;  1IXS A;  1IN6 A;  5AI4 A;  3MR5 A;  2B0C A;  1L3V A;  1QUS A;  2KHH A;  3I04 M;  2HBK A;  2KNZ A;  2P5T A;  2K4E A;  2E8N A;  1Q3V A;  4LY6 A;  3OTO M;  7ICN A;  5ALS A;  4L8R C;  2QBY A;  3ONN A;  3SAV A;  2F4V M;  5CR0 A;  2FH0 A;  1T3N A;  4NV0 A;  1UA0 A;  3WK8 A;  4ELV A;  4FCW A;  4BJQ A;  4J9N A;  2KNV A;  2EKF A;  3LCU A;  3UMG A;  4PD2 A;  1A76 A;  2LHG A;  1NV9 A;  4YD2 A;  2XC9 A;  4Y28 F;  4DL6 A;  1UM8 A;  2XI9 A;  1T94 A;  1DGH B;  1QQ6 A;  1WJ7 A;  1NY6 A;  5KFE A;  3DFZ A;  4O3R A;  1RZT A;  2JMG A;  3KOO A;  3Q8G A;  1XO1 A;  1D9D A;  5FTL A;  5EP4 A;  2QB1 A;  4IRC A;  4IRD A;  1QCK A;  4KN7 A;  4O3P A;  4NM2 A;  2R45 A;  4F4X A;  2QHO B;  1ZD2 P;  1XMO M;  1B22 A;  1UFZ A;  4RQM A;  2BHN A;  3EIE A;  1KL9 A;  3MDC A;  3T5L A;  5DB6 A;  1X6I A;  3M8R A;  1PM5 A;  1QAN A;  3HJQ A;  2WSE F;  5HR6 A;  4J9K A;  2F5P A;  5J2E A;  5ITU A;  1NHW C;  1XS9 D;  3PX0 A;  4KLO A;  2ZBK B;  7ICL A;  2P6U A;  3L28 A;  2LVQ D;  3F92 A;  4IBB A;  2Y0S F;  2QAR B;  9ICJ A;  3C9P A;  2W9B B;  3O0F A;  1SXD A;  4M6W A;  4IBK A;  1ZAE A;  2MSN A;  2C9C A;  2FNA A;  2KIV A;  2L2D A;  2WF8 A;  3R8F A;  4QZG A;  4JV1 A;  3GQ5 A;  1E9S A;  2WAQ F;  5J2C A;  1NVM A;  2X49 A;  1SV0 C;  3ISC A;  1KSP A;  1L8O A;  2BDU A;  8ICH A;  1GLN A;  2WTF A;  5KFV A;  2KTQ A;  1ZV1 A;  2F5S A;  4RF0 A;  3PSF A;  3M8S A;  3RH6 A;  5ALO A;  2Z8Y M;  3RTV A;  1D8Y A;  3QU9 A;  1IXR A;  4TQS A;  1VG5 A;  4EYH B;  3RB0 A;  3D8L A;  1VJ5 A;  1NJZ A;  3MGV A;  3FDS A;  3PVX A;  5JTI A;  2PFP A;  4KLE A;  5ALR A;  2KD1 A;  3C1Y A;  3WHL A;  2VA2 A;  9ICS A;  2KV2 A;  4FWH A;  2M0N A;  4B3T M;  2BKE A;  5JU5 A;  4C8O A;  8ICJ A;  3JPQ A;  9ICU A;  4GH9 A;  3KZX A;  3CRX A;  3BXW A;  2YY6 A;  2W82 A;  2IHN A;  1RPL A;  4HEO A;  5DYI A;  3GQ4 A;  4YXJ A;  2MR9 A;  2Q0Z X;  2QSF X;  3H8M A;  4R3D A;  4OU7 A;  1N5W A;  5KO3 A;  4PT5 A;  3U5Z B;  3QYB A;  3J27 B;  4IL6 U;  1F5S A;  1NK6 A;  5ALG A;  2BCS A;  8ICF A;  2Y21 A;  3KXE C;  2LVA A;  3EUB 2;  5DDY A;  4JV2 A;  1V9P A;  4US8 A;  8ICM A;  4DR6 M;  4UB8 U;  5KFC A;  2R0I A;  1NNU C;  3KOZ E;  4Z6Y A;  4MGY E;  2P35 A;  3GU3 A;  1L7P A;  4ELT A;  1X37 A;  1NI3 A;  1CUK A;  3LMM A;  3LYS A;  1S10 A;  2HWJ A;  5A0L A;  3DOA A;  2DWN A;  4M9X A;  2W7P A;  1O03 A;  4K4I A;  1N78 A;  5KFM A;  2JY5 A;  4BXO B;  4TUQ A;  5KFX A;  3RR7 A;  4LCB A;  1SV4 A;  4TUS A;  3TQ1 A;  1WXQ A;  3K9O A;  2B3T A;  2F76 X;  5CHG A;  1VDD A;  1QAQ A;  2GH1 A;  2W03 A;  5F9L A;  5H37 D;  5GTH U;  3A45 A;  4F71 A;  1L3U A;  4UB6 U;  4I29 A;  5AM3 A;  1V97 A;  4DQI A;  4NLK A;  1D8L A;  3TAC B;  2EA0 A;  1IN4 A;  5J2F A;  1SZH A;  9ICG A;  4JN6 A;  3RJJ A;  2KZS A;  3VKH A;  5KT7 A;  4OCZ A;  1JRP A;  2OM6 A;  5J2H A;  3NVV A;  2XCP A;  9ICC A;  3FTE A;  3GPY A;  1UA1 A;  3B0Y A;  3M9M B;  3CP8 A;  2OO9 A;  1MX0 A;  1DO0 A;  3QNM A;  2JEG A;  1ZQW A;  2G5G X;  2K9D A;  3I51 A;  2GWS A;  1S77 D;  1QVR A;  2KIC A;  1QYR A;  4CF5 A;  2K60 A;  4MFA A;  4YR3 A;  2CRX A;  3CGW A;  4RF1 A;  1L2D A;  2DPI A;  4KT0 F;  2G0A A;  3UQ0 A;  1Z1V A;  4F5O A;  5GKN A;  4DQR A;  1Z19 A;  2BQR A;  2EAM A;  1QZM A;  4IBG A;  2DGZ A;  4FZN A;  4YR2 A;  3GO8 A;  4YMN A;  3C23 A;  2LBO A;  1RM6 C;  3C1Z A;  5DDM A;  1BNP A;  9ICA A;  5FSW A;  3AOE A;  3WKA A;  3PMN A;  2ZG6 A;  5FTN A;  4LZZ A;  3T3F A;  3NBX X;  2CP8 A;  2JZ1 A;  2MUT A;  3LK9 A;  3GIJ A;  1TKD A;  1PJJ A;  5EWE A;  4IIW A;  4FVM A;  2HMX A;  1NOM A;  3PO5 A;  1ZMU A;  2ZIV A;  3QYE A;  2DKX A;  4B9N A;  1VEK A;  3TWM A;  4X62 M;  1XNR M;  2VF8 A;  5AM5 A;  3S6J A;  3TAR A;  4M2Y A;  4JI3 M;  2PXI A;  2R8H A;  3QX7 A;  5DG8 A;  3L27 A;  3UXN A;  3N7P D;  3JPT A;  3GLH A;  5IIL A;  1Q39 A;  3MDA A;  1HNX M;  9ICN A;  3HU1 A;  5DKW A;  1JX4 A;  4RQ1 A;  2KN7 A;  2XZF A;  5FTM A;  1L7M A;  1KFS A;  2DAE A;  4LGM A;  1N5X A;  3JPP A;  1RQN A;  4ED0 A;  4M0W A;  4QNM A;  3OHA A;  4J9Q A;  3UXP A;  1XWI A;  3VK8 A;  4JYA M;  5KAF U;  1BPZ A;  4ECX A;  4JB3 A;  3HJ8 A;  4LF6 M;  4IBE A;  3LW5 F;  1TR8 A;  2MRL A;  4CF4 A;  2W04 A;  2BCV A;  8ICP A;  2Q2E B;  2ESE A;  3KBB A;  4RPX A;  2DUY A;  4IBC A;  1N75 A;  1OFH A;  3KHR A;  2XSZ A;  4JI0 M;  4YFK A;  3SI8 A;  4KLJ A;  2ZTE A;  5J8Y C;  4YQW A;  5J29 A;  5KG4 A;  4WJ3 B;  4MH0 E;  1NJY A;  3BQ7 A;  1TV9 A;  2G5H B;  1IBM M;  3SEI A;  1HT2 E;  2F5Q A;  1DRG A;  2NYV A;  4DSJ A;  2D6F C;  3PFI A;  4KLN A;  3T1H M;  1DGS A;  2LVN C;  3ZDC A;  2E1F A;  3HJS A;  3WU2 U;  2JY6 B;  2J7N A;  4MF2 A;  4MEY A;  4R7G A;  4QZF A;  1OTR A;  3GFK B;  4EZ6 A;  2FPM A;  2DKZ A;  1TK5 A;  2J6U A;  3TKA A;  2B21 A;  4BUG A;  5DQI A;  3QZ7 A;  3UQ2 A;  4P0Q A;  5A2Q S;  5L1K A;  2HSZ A;  4OJL A;  5L9X A;  4MGI E;  4QZH A;  2HVI A;  2IOF K;  5IIJ A;  4EX6 A;  1ZQR A;  1A77 A;  3CW2 C;  5ALD A;  2LHT A;  2E1E A;  4QIW C;  3M9N B;  4G4Q A;  1ZQG A;  3TQS A;  8ICS A;  3AJI B;  4NSR A;  5AI0 A;  3T5H A;  1WCN A;  3HRD D;  4FFD A;  1WCL A;  4NWI A;  2XY6 A;  4F4Z A;  1BVS A;  3HY5 A;  2AGP A;  4F4W A;  2ZM6 M;  1KBU A;  3OHB A;  3N4M B;  5EJC A;  2R8K A;  3WK6 A;  3LWM A;  5KFR A;  4LZJ A;  1KTQ A;  1PRB A;  5J0Y A;  1L5U A;  1SG9 A;  2YQZ A;  1SL2 A;  4M9S A;  3UMC A;  5JUM A;  4UAY A;  3H40 A;  1TFR A;  1EE8 A;  1TAM A;  2YB1 A;  1DGH A;  1ZQL A;  2WF6 A;  5AIB A;  5DG9 A;  3BQ0 A;  2DF4 B;  5KL8 B;  4DL4 A;  1N33 M;  3MHV C;  3HZJ A;  2LI6 A;  3DV9 A;  4G4R A;  5ALH A;  4FS1 A;  2DAI A;  3KHL A;  3CF2 A;  1XC9 A;  2GOL A;  3ETL A;  2HDO A;  2Y0S C;  1WWV A;  5J2D A;  3ILK A;  2BPG A;  4D81 A;  3BS5 B;  5KFI A;  2I6X A;  2ZAM A;  3SHG B;  1U4B A;  3PX4 A;  4BX9 C;  8ICC A;  3BZC A;  3LCV B;  3KOY E;  2FFJ A;  2QAR A;  1OAI A;  2W9B A;  1IN5 A;  4P4M A;  2Y20 A;  2RRD A;  2YTU A;  3KHG A;  3ZD8 A;  1ZJM A;  5EWG A;  7ICF A;  4G9B A;  2XZU A;  2E8O A;  4UQG A;  3E21 A;  3CYM A;  5J0O A;  9ICX A;  1TDH A;  2W11 A;  2L7H A;  3IM1 A;  4C80 A;  2N1R A;  4R8U B;  5EOZ A;  3OJS A;  3BJY A;  2PFQ A;  2E5L M;  1M6Y A;  5KG6 A;  2XCA A;  2FMP A;  4B9V A;  2CHG A;  2WF5 A;  2XFS A;  1S3S A;  2O25 A;  2CRU A;  3RGS A;  3FAH A;  2VIX A;  3FM9 A;  3FC4 A;  3C3E A;  3H8S A;  3NWL A;  2FJ6 A;  4KLD A;  4BLC A;  1ZQU A;  3QU2 A;  3U26 A;  5EE3 A;  3B9P A;  4ECY A;  2YMM A;  7CAT A;  3RJH A;  4GMQ A;  1A0P A;  1U9L A;  1N2X A;  4LFC M;  4K0K M;  4QWD A;  3RJI A;  3W0L B;  3U5Z A;  2XIC A;  4YN4 A;  3NTU A;  4M9Z A;  4LJ8 A;  2AH5 A;  5ALY A;  5G5G A;  4KLG A;  2KZZ A;  8ICO A;  3BS7 A;  4QZB A;  2M9N A;  3B0X A;  4AI6 A;  1ZMV A;  4J9S A;  4GC9 A;  4QJF B;  4DFK A;  3M6A A;  4GHL A;  1GJS A;  5BOM A;  1NK5 A;  3MFH A;  5DB7 A;  5GTI U;  1NKC A;  4BXO A;  3LQQ A;  4B9L A;  4AKH A;  2QP9 X;  1X66 A;  4P4O A;  4DOA A;  1JR3 E;  5CWR A;  5CJ7 A;  1UT5 A;  5AKE A;  3A42 A;  4LF9 M;  5HNK A;  2I1Q A;  1ZYQ A;  2KP7 A;  4FZL A;  2LPE A;  2JNH A;  2AU0 A;  2HHQ A;  3KP1 E;  4RNN A;  2LTU A;  4YMM A;  1PJS A;  1QAO A;  3ICX A;  2K4I A;  3PNC A;  2ISP A;  2X8A A;  3JR5 A;  3Q8X A;  5KQ8 A;  2HOQ A;  4BBA A;  1F44 A;  3HX3 A;  4ITQ A;  1TK8 A;  8ICK A;  3RRH A;  5ALE A;  4Y2X A;  1XXH B;  4FWD A;  4LJ4 A;  4J03 A;  3I4Y A;  3HWT A;  5CEH A;  5ALN A;  3RAX A;  8ICG A;  2XID A;  1KSF X;  1XNQ M;  3PZP A;  4F2S A;  2RGH A;  3M6K A;  4LJ5 A;  2OOB A;  2JR5 A;  5AI8 A;  4QZ8 A;  4Q43 A;  3AFH A;  3GRY A;  5J2A A;  4ECT A;  2HVH A;  5KG7 A;  1PK1 B;  1MN8 A;  3W68 A;  3HHX A;  3FRH A;  5TZV A;  1U45 A;  1T43 A;  4I8O A;  2OQ4 A;  4R66 A;  4PGY A;  2IHM A;  3HHZ A;  3TWL A;  3NVY A;  3AU6 A;  2R46 A;  1MSW D;  2IOH A;  3H0R B;  3SAH A;  1ZQO A;  3NUQ A;  2M60 A;  1MN3 A;  5FTJ A;  1JQJ C;  2ZJ5 A;  3LDA A;  1BPY A;  4O3M A;  3GRR A;  2W54 A;  1K82 A;  3TFR A;  1QTM A;  4P0P A;  7ICV A;  2DXI A;  2PKE A;  2DFL A;  4CNQ A;  1TDZ A;  1R2Z A;  4DV2 M;  2K8B B;  4B3M M;  1E9R A;  1T4G A;  1PK3 A;  4XGI A;  3F5E A;  2UVR A;  3QU5 A;  3D2S A;  2AXT U;  3QXG A;  1L7N A;  3A98 B;  4PJ0 U;  2UVU A;  1TK0 A;  1ZQV A;  2KFN A;  5AKK A;  2YN4 A;  2UVV A;  5DFL A;  3SEN A;  1N56 A;  2OHF A;  1S0N A;  3HJE A;  2KA6 B;  2DQN B;  4UAU A;  4EEY A;  5JI2 E;  4RT3 A;  3L2A A;  3IN5 A;  3PW0 A;  1BNO A;  5KT2 A;  9ICT A;  4CE6 A;  4LFA M;  3IEC A;  1SGG A;  5ITY A;  2YX8 A;  2ZUD A;  2AGQ A;  1B0X A;  5CP2 A;  3D2Q A;  2HBM A;  1KYI A;  9ICK A;  2JWS A;  3NGD A;  3KW6 A;  4QHS A;  3BZK A;  4P16 A;  1E32 A;  1MU5 A;  1MJG M;  2OWO A;  1HT1 E;  4I2J A;  3QYP A;  4KMO B;  1C20 A;  3GPU A;  2K4P A;  5T14 A;  5ALK A;  3SAF A;  2HHW A;  3T5K A;  1H38 A;  2V9W A;  4RQ7 A;  1ZXI A;  4RQ4 A;  2IOF A;  5EXX A;  4GKK M;  2FDR A;  4JUZ A;  4C7Z A;  1WGN A;  4EX7 A;  4J9R A;  5KT5 A;  3RJK A;  4FW9 A;  1NK7 A;  4KTQ A;  1IN8 A;  4K4H A;  2HAK A;  2L4F A;  3C29 A;  2KKP A;  2C98 A;  4MF8 A;  4DWI A;  2WHE A;  2OCE A;  3SAT A;  4DLE A;  5ALQ A;  2RQ5 A;  1Z3E B;  5D49 A;  2BJW A;  5ALP A;  4QZ9 A;  1SIJ A;  4LJX A;  4W5W A;  1L2C A;  4ECU A;  2EUC A;  3IHP A;  3GLF E;  4RQ8 A;  3NRZ A;  4X64 M;  1F4I A;  2G08 A;  4C4R A;  3G6X A;  7ICO A;  1DV0 A;  3C5G A;  4CGY B;  4JK1 A;  2YQE A;  2JZ0 A;  2LYH A;  2RLT A;  2MU2 A;  2XVT A;  8ICZ A;  1OIZ A;  3FUX A;  1ZQS A;  2JY8 A;  4QIW F;  3BDP A;  1JIH A;  2CWB A;  1L1Z A;  1ZET A;  4BB9 A;  4B3R M;  2BZF A;  5H2F U;  1E94 E;  4RNO A;  1LV7 A;  3BOS A;  1X6J A;  5J0R A;  2BDP A;  3J2P B;  3JPS A;  1NK8 A;  3QAU A;  2DAG A;  3GLG E;  1DGJ A;  2HHV A;  2JZB B;  1P3Q Q;  2F77 X;  4ED6 A;  1QSY A;  4ZPX A;  4CCH A;  4I27 A;  4NLB A;  1KN5 A;  3GII A;  4Y2R A;  4CIZ A;  4DO9 A;  5J2J A;  2J5Y A;  3VDU A;  4XUS A;  5ITX A;  3QZ8 A;  4O5E A;  2W9M A;  3B7N A;  4QWB A;  1D0K A;  2KKV A;  3BS5 A;  2EZX A;  1IY2 A;  3GP1 A;  4GEW A;  4DR3 M;  3RE8 A;  2ALZ A;  4F5P A;  3Q8L A;  2DL0 A;  3TAQ A;  3RB6 A;  4MGZ E;  1I4W A;  2BWE A;  2ZUB A;  1QSS A;  3KDS E;  4QWC A;  8ICU A;  4YY3 M;  1T3Q A;  2W3S A;  7ICI A;  5KFY A;  4QZI A;  2XH9 A;  4UBB A;  1GAB A;  2R44 A;  3KOX E;  1IXZ A;  4LJA A;  1LB2 B;  5B66 U;  3KSX A;  3J80 S;  4Z6F A;  3K1R B;  4OJ6 A;  4R8U A;  4B08 A;  2FE8 A;  9ICL A;  1C1K A;  3SZ2 A;  3RH5 A;  3L29 A;  5E79 U;  5J0Q A;  3Q8M A;  2QPA A;  3C2M A;  3QWL A;  4LRT A;  3EWA A;  2ZXH A;  3HKP A;  5EE9 A;  8ICR A;  2LWX A;  3B7Z A;  2PI5 A;  5KQD A;  1DK2 A;  3OTQ A;  3JAM S;  3PW5 A;  3V6J A;  4DV3 M;  1NK0 A;  2RRU A;  3PW2 A;  1KFT A;  5J0U A;  5IT9 S;  1QDT A;  5FLX S;  4FS2 A;  3WHK A;  2LYB A;  3VFD A;  2HI0 A;  4UAW A;  2C2E A;  2K47 A;  4CF3 A;  5DGA A;  3RFW A;  4YXM A;  4F2R A;  2VJ4 A;  4WP2 A;  4NXN M;  1JXL A;  4MM3 B;  2VAN A;  3HGI A;  4GLX A;  3D8B A;  2F8K A;  8ICI A;  5CB1 A;  3GLI E;  4AYB C;  2CV0 A;  1ZQ9 A;  4CJ6 A;  2Z4S A;  9ICV A;  4F5N A;  2L7I A;  4KLF A;  2E5S A;  2UXD M;  2BPC A;  2BNK A;  1ORY B;  1FIQ A;  4O9M A;  5DLF A;  4F8R A;  1QAM A;  4KLH A;  3K2L A;  4CGZ A;  4NLC A;  1RXV A;  4RQ5 A;  3DEE A;  3D6J A;  7ICJ A;  3FD9 A;  4AZF A;  1KEJ A;  2ODG A;  4AQY M;  2FS1 A;  3SQI A;  3IDW A;  4AW4 A;  4KIT B;  1ECW A;  3PXG A;  3T15 A;  2OXO A;  3HU3 A;  4NL9 A;  4PL1 A;  3RGP A;  1VEG A;  5EXT A;  4EZ9 A;  1NZP A;  4NOO B;  2JEJ A;  4I5S A;  4YD1 A;  2BCQ A;  4JI8 M;  5DBB A;  2UXC M;  8ICT A;  5KL1 B;  1Z00 B;  3OSP A;  3K4G A;  2Z4R A;  1VQ1 A;  3BBZ A;  2C5R A;  2WB1 C;  4QZE A;  3PR5 B;  8ICL A;  8ICQ A;  1DGB A;  1X9X A;  3R9K A;  3KFU G;  3CNH A;  3BQ2 A;  2XGN A;  1OIP A;  5ALV A;  2JEF A;  4QNR A;  3H0L B;  2A1J B;  2VQF M;  1XMQ M;  3VDP A;  1NNL A;  4A8E A;  3ISD A;  1XXH A;  9ICF A;  5EQT A;  5KT6 A;  2O6K A;  2ISO A;  1SXJ D;  3QUQ A;  1UQV A;  2I7N A;  3HHY A;  1ZQA A;  5E6J A;  5AKG A;  5CA7 A;  2D8C A;  4FO6 A;  3WKD A;  3B7Q A;  2KVS A;  3PSI A;  3V6H A;  1MQ2 A;  3V6K A;  4L16 A;  2Y0T A;  4JV0 A;  1PK1 A;  3SAW A;  5ALM A;  1GJT A;  4I2F A;  3FE3 A;  3ISB A;  2CV2 A;  5KFJ A;  3SMP A;  2DVW B;  2NRZ A;  1R4G A;  1TTE A;  2AHM A;  1KFD A;  4PDI A;  2D7G A;  3ZD9 A;  1WR1 B;  4K4G A;  2DKL A;  1O08 A;  4O3O A;  2NRT A;  5EWF A;  5J0T A;  5JI3 E;  3VC8 A;  4UB5 A;  2QCU A;  3U6E A;  1HR0 M;  9ICB A;  4DV1 M;  1PUZ A;  3FRI A;  3W0F A;  3FYC A;  3SAS A;  4DOB A;  4EBC A;  4ED1 A;  4FD2 A;  1XSL A;  1LVH A;  2JRZ A;  3WKB A;  3THG A;  5KPR A;  3FTF A;  5BOL A;  4EYI B;  1VDV A;  3GIL A;  1RDF A;  1TAQ A;  5BPV A;  2ZUC A;  4B9S A;  1ZQK A;  5CRX A;  5KFA A;  1MQ3 A;  1NO1 A;  8ICA A;  1WG8 A;  3T6P A;  1ZQY A;  3L5K A;  4GHA A;  5J2G A;  5IIN A;  2FOI C;  5ITX E;  1JI7 A;  2I5H A;  2W55 A;  5AKY A;  8ICN A;  2MRO B;  2JXN A;  1PVR A;  1TH4 A;  1ZQI A;  2F5N A;  2R8J A;  1YSY A;  3GQC A;  4JI4 M;  3RF9 A;  3AUO A;  3I01 M;  4XBO A;  2CFO A;  2PFN A;  5KFF A;  2YNM D;  2DWQ A;  5G5H A;  1N36 M;  1JMS A;  2GLE A;  3QUT A;  5L1M A;  4UAT A;  3HIL A;  3H8J A;  1NHG C;  4MGK E;  1W5S A;  2HHT A;  1HQY E;  3SAG A;  2G09 A;  1V33 A;  1FFU A;  3Q8P B;  4NLN A;  5LMU M;  3V72 A;  5IIO A;  4F91 B;  2YB4 A;  1MA7 A;  1WYG A;  1OFI A;  4OW0 A;  3UPQ A;  3VCB A;  4M9H A;  2F1H A;  2W9A A;  3EPI A;  1NY5 A;  3ZQJ A;  3RB4 A;  3K1J A;  1R5L A;  4QNL A;  4IQW A;  2V4R A;  4R63 A;  4DV7 M;  2JEI A;  2G07 A;  2A19 A;  3GPP A;  5AM4 A;  1UPH A;  1OAO C;  3A0B U;  4OVZ B;  2HHX A;  5HHI A;  4DLG A;  3SMV A;  1BPD A;  1C7Y A;  4DL3 A;  3GQ3 A;  3IP4 B;  4QZD A;  1ZOL A;  4FE3 A;  3F53 A;  3AV0 A;  1T8E A;  3MK6 A;  2ZTD A;  1GL7 A;  3RBD A;  1S0V A;  3THV A;  5AHX A;  2AHO B;  3RFA A;  4G4N A;  1OXJ A;  4LF5 M;  1V38 A;  4LJ9 A;  2QQ8 A;  2HBJ A;  3KHH A;  4F4Y A;  2NRX A;  9ICO A;  4USA A;  4F5Q A;  3T5J A;  1IY1 A;  1RQL A;  4DCC A;  2D7E A;  1NZB A;  4Y2Y A;  4GXK A;  4YR0 A;  2KZ3 A;  2DZL A;  2LMR A;  3OPX A;  2W9C B;  3UJN A;  4ECV A;  1BPX A;  3MFI A;  4ED2 A;  1AQ6 A;  1COO A;  2C99 A;  2JP7 A;  1Q3B A;  4CHT B;  2RP5 A;  4D80 A;  5ALI A;  2KK0 A;  4Q45 A;  1NKE A;  3LWL A;  4Y2V A;  4B9M A;  2NV3 A;  4OJP A;  5KFG A;  2PMZ C;  3A0H U;  5KFS A;  5J2B A;  4GC6 A;  3AKZ A;  4XK8 F;  3ZC7 B;  1NNJ A;  4ZOH C;  2CPR A;  2Y1J A;  3AQE A;  5TIS U;  3IG8 A;  2H3I A;  2R65 A;  2JZB A;  2F3N A;  1X42 A;  4LF8 M;  1SXJ C;  1V34 A;  4X65 M;  2VA8 A;  2MGW A;  2FMS A;  4EBE A;  5LMN M;  5KPT A;  1ZQF A;  3FTC A;  1NJF A;  1SXJ B;  1EFU B;  2R4J A;  3AOG A;  1H6U A;  3KFU F;  1FNN A;  1U48 A;  1RG6 A;  1JN3 A;  2O01 F;  1F0M A;  2DZN B;  4JI2 M;  3GV7 B;  4GC7 A;  2YMQ A;  4Y2P A;  3WK9 A;  3PW4 A;  4D82 A;  2BCU A;  4C7Y A;  8ICV A;  4IC9 A;  4MGH A;  4QOZ C;  2NO5 A;  4NL4 H;  2HL7 A;  2NRW A;  4DV4 M;  2I7P A;  3Q8Q B;  3PV8 A;  4QHT A;  4IR9 A;  1YLA A;  2GQF A;  2Y0Q A;  2KZM A;  4P4P A;  1T7P A;  4F92 B;  3U6D A;  1YZ6 A;  5AI5 A;  2KIW A;  4AKI A;  3SYZ A;  1GKI A;  5KFQ A;  1HUO A;  3SAR A;  3HHW A;  4WW0 A;  4UB3 A;  3G6V A;  2EZY A;  3E58 A;  4Z6C A;  3M6Z A;  3LQR A;  5DB9 A;  5AIA A;  4LZD A;  5DB8 A;  2WSF F;  4ECZ A;  2VA3 A;  4Y2S A;  1RYU A;  1EIJ A;  1UHU A;  4JMU A;  1YUB A;  3WK5 A;  5AK4 A;  3SHF A;  4ED8 A;  2G3Q A;  4IBF A;  2FLL A;  5F3X B;  3CTW B;  3UMB A;  4Q8E A;  2HW3 A;  4ZH4 A;  2H5X A;  4UAS A;  2ATL A;  3GLH E;  4ANR A;  2J7O A;  2XY7 A;  4DSF A;  3GIK A;  4MEX A;  1GVN A;  4AYB F;  2ASD A;  1L6N A;  2K89 A;  4JI7 M;  3KVW A;  1IFY A;  3VK7 A;  3AM9 A;  1KKX A;  2R8I A;  5AKX A;  3MR3 A;  4O3Q A;  2DNA A;  1TE2 A;  1TH3 A;  4DFD A;  4NL9 C;  4DL2 A;  4G6Z A;  2EDU A;  1I94 M;  1ZQ1 C;  2JV3 A;  5ALL A;  2UUA M;  2C28 A;  2BR0 A;  3SV3 A;  3E46 A;  2KW0 A;  3V76 A;  3GDX A;  4KN4 A;  4C8L A;  2YFQ A;  1URJ A;  3E9S A;  1SKW A;  1L8L A;  3RJE A;  1N60 A;  4PPX A;  4LG2 A;  4JV5 M;  3F5A A;  3QU7 A;  1Z00 A;  2P66 A;  3HKZ C;  2KXE A;  1IBL M;  3FUV A;  1WGL A;  2KMD A;  4F1I A;  3HT3 A;  3W67 A;  3ZDB A;  4Q44 A;  1COK A;  1XNS A;  2B6G A;  5D46 A;  5ITQ A;  4RPZ A;  1D2N A;  1KFV A;  2MH8 A;  4B7H A;  2D3D A;  4PGQ A;  2NQ8 C;  2LVP C;  2A1J A;  2WB1 F;  3MR6 A;  5AM1 A;  3C5F A;  1RYS A;  4OO1 J;  3FUW A;  5HR7 A;  4LFB M;  4OX9 M;  2L5Y A;  4C4T A;  1ZQN A;  1XWL A;  5AM0 A;  1KQQ A;  2KJ5 A;  4B9U A;  5DGB A;  4QW9 A;  1X9S A;  4DR1 M;  5KFW A;  2DHY A;  3HX0 A;  4GRI A;  1OW5 A;  3T1Y M;  2AQ0 A;  1NJX A;  2DAK A;  2C2R A;  1N62 A;  2JGA A;  3U6M A;  1ZD3 A;  1N63 A;  1IY0 A;  4J9L A;  3WKE A;  4TQR A;  3FUU A;  2EZZ A;  4NRW A;  3U6C A;  5BR8 M;  4DFJ A;  1A6S A;  2BJV A;  2MAX A;  3KD3 A;  4OJ5 A;  5KFB A;  4F50 A;  2KFZ A;  5EP2 A;  1U49 A;  3J7B A;  1NKB A;  3EPG A;  3Q8R B;  4NC6 A;  5KG5 A;  4E0D A;  4NXM M;  4DR7 M;  3C21 A;  3FKE A;  4PZN A;  9ICP A;  2OYY A;  4P2H A;  3K9P A;  4DUY M;  4OD0 A;  3A46 A;  4M9J A;  4DR4 M;  1LTM A;  3U6S A;  2CN1 A;  4IQT A;  3K75 D;  2LM1 A;  4OJO A;  2NO4 A;  5KFZ A;  5AIC A;  5C18 A;  1ZQT A;  1S97 A;  3FYH A;  5JRT A;  1IG6 A;  1JXE A;  2J6S A;  2ZIX B;  4O3S A;  5AK5 A;  8ICE A;  1TH2 A;  4L6V 6;  2YML A;  3U6P A;  4Y2Q A;  3C2L A;  2Y9U A;  3MAB A;  2C22 A;  1X2I A;  5AKJ A;  3Q8S B;  2KHQ A;  4X5V A;  5ALJ A;  4QW8 A;  1IIP A;  5KFN A;  1NSF A;  2KRK A;  3DDH A;  3VKG A;  1ARO P;  2DEN A;  5J0S A;  2OEH A;  1Z4O A;  2WF7 A;  5KPZ A;  3FYD A;  2KHV A;  2BCR A;  4UAV A;  1V92 A;  5FTK A;  3GRU A;  2E3T A;  2AQ4 A;  1EXN A;  2CHQ A;  3PNY A;  4QWA A;  2GNO A;  4PHP A;  4DFM A;  3TWK A;  4PGX A;  3QEB Z;  2ZJ8 A;  4OVZ A;  4DR5 M;  3PY8 A;  2ASJ A;  3E4R A;  2ES6 A;  5B5E U;  2IBK A;  1YE9 A;  2KJ8 A;  3KS8 A;  4UAR A;  1SKR A;  2V4Q A;  4X66 M;  2Q4T A;  4DF8 A;  3SYK A;  3FUT A;  3ED5 A;  3C3D A;  1J97 A;  2APL A;  4PCZ A;  4GXJ A;  5J0X A;  2KSO B;  1Q02 A;  3H4M A;  4Z6D A;  1PJI A;  2FPL A;  4M0A A;  2FI1 A;  3N7S C;  1T6O A;  2UU9 M;  1J09 A;  4P0Q B;  5J0P A;  5AKZ A;  1Z6T A;  4EIW A;  1IM2 A;  2W9C A;  1LV5 A;  1WHC A;  2F5O A;  4PHA A;  5ALX A;  5KFH A;  4GC5 A;  3KS4 A;  2Z3X A;  1ZQQ A;  1L7O A;  1R2Y A;  1B4F A;  5AK6 A;  3H8W A;  1V85 A;  1G71 A;  1Q3C A;  3C2K A;  4IBJ A;  3QU4 A;  2PMZ F;  2G06 A;  4FBT A;  3AN1 A;  9ICM A;  4ED7 A;  3IG5 A;  3RAQ A;  4XRH A;  4LVS A;  3V7L A;  4TUP A;  1X9M A;  4O5K A;  1S9F A;  1SXJ A;  4NXZ A;  5L1L A;  1ZQJ A;  5HHH A;  3WK7 A;  3ETR A;  8ICY A;  1TGU A;  4HLQ A;  1D0M A;  3CF6 E;  4DR2 M;  1G59 A;  2KG5 A;  1XO0 A;  2DWZ B;  2HHS A;  4I2A A;  2VJ5 A;  3ORY A;  1ZMW A;  2BWB A;  4BGD A;  7ICS A;  1UCV A;  1QQ7 A;  4PDG A;  5AKH A;  4AKG A;  3PVS A;  1QUT A;  4JI6 M;  4PZO A;  3TAD A;  3J81 S;  5IWA M;  5HMM A;  5DBC A;  2L6O A;  1Z5C A;  2WSC F;  3AU2 A;  1D8B A;  8CAT A;  2WZJ A;  2YMP A;  4EEN A;  4RPY A;  5J2I A;  3KKA A;  3K92 A;  4DL7 A;  4C0Z A;  1AUA A;  1XHB A;  4L78 A;  2W8L A;  4TUR A;  3I1Y A;  3AL0 C;  4P17 A;  2P6R A;  4FWG A;  4PHD A;  1FO4 A;  1CEZ A;  4Y2U A;  4QZA A;  2JXJ A;  1Z1B A;  3AL0 B;  3L4P A;  4G4O A;  4II7 A;  2KJ9 A;  4DF4 A;  3BQT A;  3AMZ A;  1DGG A;  3RR8 A;  1S8O A;  1PVQ A;  1PJQ A;  4O3N A;  1GO3 F;  5KAI U;  4KLQ A;  5IIM A;  2LYA A;  3RBE A;  2F1J A;  2K8C B;  4KLT A;  4YMO A;  2VF7 A;  2HCB A;  4I81 A;  3NAS A;  2W7O A;  2G8L A;  1TF0 B;  4RZR A; 
#chains in the Genus database with same CATH homology
 1J5E M;  1HQC A;  2YR0 A;  2DZO B;  3M7G A;  7CAT A;  2MA1 A;  3GZF A;  4GMQ A;  1A0P A;  4LFC M;  1T3T A;  4K0K M;  2YB4 A;  1MA7 A;  4U7C A;  1OFI A;  4OW0 A;  2VKQ A;  4ICA A;  3VCB A;  1Z5A A;  2H3Z A;  1NY5 A;  3W0L B;  3K1J A;  4QNL A;  3U5Z A;  2XIC A;  2O5R A;  4FCT A;  4DV7 M;  2RGO A;  3T79 A;  4M9Z A;  4LJ8 A;  3VLF B;  2G07 A;  4DV6 M;  3GPP A;  3M7D A;  2ZIW B;  1UPH A;  5C0Y A;  2XEP A;  4OVZ B;  2LXE A;  2JH7 A;  2QEN A;  2R62 A;  3GLF B;  1G8P A;  3SMV A;  2LKY A;  4AI6 A;  2R18 A;  2H1R A;  4GC9 A;  3GQ3 A;  2KOB A;  3DZD A;  3UZU A;  3IP4 B;  4QJF B;  4FE3 A;  3M6A A;  4S12 A;  3AV0 A;  3F53 A;  4GHL A;  3MK6 A;  2X4A A;  3PST A;  1GL7 A;  4NSO B;  3RFA A;  4G4N A;  3LQQ A;  1IBK M;  4LF5 M;  3U61 B;  5F3W A;  2ERC A;  1DGF A;  2QP9 X;  3GRV A;  4HL4 A;  2DHR A;  4AKH A;  3GPX A;  4LJ9 A;  2HKJ A;  3D2N A;  4DV0 M;  2RKO A;  3NBI A;  5ITR A;  2HBJ A;  2EO2 A;  3A42 A;  5IRE B;  4LF9 M;  1Z5B A;  4Z8X A;  4FZL A;  1IY1 A;  1HNW M;  2D7E A;  1NZB A;  4DUZ M;  4PL2 A;  3GLG B;  1IN6 A;  4CIS A;  3KP1 E;  3HKZ F;  2C9O A;  1HNZ M;  3ICX A;  1QAO A;  3OPX A;  2K4I A;  2HBK A;  2P5T A;  2X8A A;  3UJN A;  3JR5 A;  2K4E A;  3Q8X A;  5KQ8 A;  2HOQ A;  2C99 A;  4BBA A;  1Q3V A;  4LY6 A;  4ITQ A;  1F44 A;  3OTO M;  1Q3B A;  2OH2 A;  4CHT B;  2RP5 A;  4D80 A;  2LH0 A;  4L8R C;  5EXS A;  2QBY A;  1XXH B;  4FWD A;  4LJ4 A;  3ONN A;  3I4Y A;  2NV3 A;  4OJP A;  3SAV A;  2F4V M;  2PMZ C;  2XID A;  3AKZ A;  1KSF X;  3ZC7 B;  1NNJ A;  1XNQ M;  2CPR A;  4NV0 A;  3PZP A;  3AQE A;  3IG8 A;  2H3I A;  3KP0 E;  2R65 A;  2RGH A;  3M6K A;  4FCW A;  4LF8 M;  4LJ5 A;  5EP1 A;  4BJQ A;  4PD2 A;  1SXJ C;  4X65 M;  3AFH A;  3GRY A;  4CRX A;  1UM8 A;  3U60 B;  2QZ4 A;  2XI9 A;  5LMN M;  5KPT A;  1T94 A;  3FTC A;  1DGH B;  3HHX A;  1NJF A;  1NY6 A;  1SXJ B;  3DFZ A;  2KZU A;  2R4J A;  4I8O A;  3AOG A;  2OQ4 A;  2JMG A;  1H6U A;  3KFU F;  3HHZ A;  5FTL A;  5EP4 A;  3TWL A;  3ZH9 B;  3JR4 A;  4GKJ M;  1FNN A;  2R46 A;  2R45 A;  2XLJ A;  4RNA A;  3SFZ A;  3H0R B;  2DZN B;  3MJ5 A;  4JI2 M;  3SAU A;  3SMS A;  1XMO M;  4JI1 M;  3SAH A;  2D7H A;  3EIE A;  3NUQ A;  1N34 M;  2M60 A;  5FTJ A;  1PM5 A;  1QAN A;  3HJQ A;  4GIP A;  1JQJ C;  5HR6 A;  5DNY A;  4D82 A;  2F5P A;  4O3M A;  3GRR A;  1K82 A;  5ITU A;  1NHW C;  4IC9 A;  2ZBK B;  2HOI A;  4MGH A;  4QOZ C;  4P0P A;  3L28 A;  2HL7 A;  4NL4 H;  4AG6 A;  4WUR A;  3SBJ A;  2DXI A;  4IBB A;  2Y0S F;  2UXB M;  3O0F A;  4DV4 M;  2I7P A;  4IBK A;  1ZAE A;  1TDZ A;  2C9C A;  4QHT A;  2FNA A;  1SXJ E;  4DV2 M;  1R2Z A;  4B3M M;  1E9R A;  2K8A A;  2K8B B;  2HHH M;  2KNJ A;  3HU2 A;  4XGI A;  3F5E A;  3K1Z A;  4P0P B;  3R8F A;  3D2S A;  2Y0Q A;  2JH1 A;  3AQF A;  3U6D A;  3A98 B;  3GQ5 A;  2KIW A;  1E9S A;  2WAQ F;  4AKI A;  1NVM A;  2X49 A;  1L1T A;  1GKI A;  2Z7J A;  2XF3 A;  2BDU A;  2ZIX A;  1GLN A;  3SAR A;  3HHW A;  5DYG A;  4WW0 A;  3GLI B;  1R7R A;  2G5I B;  1G3I A;  2KA6 B;  3M0E A;  4RF0 A;  2F5S A;  5JI2 E;  2UUB M;  2DQN B;  3PSF A;  3L2A A;  3IN5 A;  3M6Z A;  3LQR A;  4LFA M;  4JI5 M;  5ITY A;  4FCV A;  3D8L A;  2YX8 A;  3MGV A;  1QQW A;  2H3Q A;  4JMU A;  2V1C A;  1YUB A;  2ZIU B;  2KD1 A;  3WHL A;  4DV5 M;  3LVV A;  3SHF A;  2KV2 A;  3D2Q A;  3DA1 A;  4FWH A;  4IBF A;  2HBM A;  2M0N A;  1KYI A;  4B3T M;  3CTW B;  1Z59 A;  2ZAN A;  5ITT A;  2JA2 A;  3KW6 A;  4QHS A;  2R4E A;  4P16 A;  1E32 A;  1MU5 A;  4GH9 A;  2VII A;  3FTD A;  3KZX A;  1HT1 E;  3CRX A;  2J7O A;  2W82 A;  1ED1 A;  4KMO B;  5DYI A;  3GPU A;  3GQ4 A;  1GVN A;  4AYB F;  5T14 A;  1L6N A;  1JR3 A;  4R3D A;  4OU7 A;  4JI7 M;  5KO3 A;  3KVW A;  1WUD A;  2K89 A;  3SAF A;  4PT5 A;  4QOS A;  3U5Z B;  3VK7 A;  3J27 B;  1TH3 A;  5EXX A;  2Y21 A;  3KXE C;  4GKK M;  3F2C A;  4G6Z A;  3HWS A;  1I94 M;  4DR6 M;  1ZQ1 C;  2UUA M;  1NNU C;  3KOZ E;  2KW0 A;  4FW9 A;  4Z6Y A;  4MGY E;  3E0F A;  1IN8 A;  3GU3 A;  1X37 A;  3C29 A;  2YFQ A;  2KKP A;  3LMM A;  1Q3U A;  3LYS A;  4JXJ A;  1URJ A;  2C98 A;  3DOA A;  3E9S A;  1HEK A;  5A0L A;  1J7K A;  2DWN A;  1IN7 A;  4M9X A;  3SAT A;  2W7P A;  2CEA A;  1N78 A;  4LG2 A;  4LCB A;  4AG5 A;  4JV5 M;  3F5A A;  4IBI A;  2BJW A;  2H3F A;  3HKZ C;  2KXE A;  1WXQ A;  3FUV A;  4KOD A;  4W5W A;  1L2C A;  1IBL M;  1VDD A;  2F76 X;  2EUC A;  1QAQ A;  1XNS A;  2GH1 A;  2V1U A;  2W03 A;  5ITQ A;  4X64 M;  1D2N A;  1KFV A;  2G08 A;  4B7H A;  1IXS B;  2NQ8 C;  4CGY B;  5H37 D;  3A45 A;  2XVT A;  2WB1 F;  1P7D A;  4B3S M;  3FUX A;  4OO1 J;  3J7A S;  4QIW F;  3FUW A;  2VQE M;  5HR7 A;  4LFB M;  4OX9 M;  1L1Z A;  2EA0 A;  1IN4 A;  4BB9 A;  4B3R M;  1SZH A;  4JN6 A;  2KJ5 A;  2QBY B;  1E94 E;  2KZS A;  4KHP M;  1LV7 A;  3VKH A;  3BOS A;  4DR1 M;  3J2P B;  4GRI A;  2OM6 A;  3T1Y M;  2KVC A;  3FTE A;  3GPY A;  3QAU A;  3CP8 A;  2F77 X;  4IBD A;  1MX0 A;  1DO0 A;  4ZPX A;  3U6M A;  2DWM A;  2JGA A;  4NLB A;  2CV1 A;  2G5G X;  1IY0 A;  3I51 A;  1QVR A;  1OJL A;  3FUU A;  2K4H A;  3VDU A;  2KIC A;  1QYR A;  4NRW A;  3UK6 A;  3U6C A;  2CUZ A;  5ITX A;  2CRX A;  5BR8 M;  4RF1 A;  1A6S A;  1L2D A;  2BJV A;  2G0A A;  5GKN A;  4NRV A;  2KKV A;  1K3X A;  4OJ5 A;  1Z19 A;  3T38 A;  5EP2 A;  1K3W A;  1IY2 A;  1QZM A;  4IBG A;  3GP1 A;  1N77 A;  2H3V A;  4DR3 M;  3J7B A;  2DGZ A;  4FZN A;  3RE8 A;  3GO8 A;  5EXP A;  4NXM M;  4MGZ E;  4DR7 M;  1I4W A;  4REZ A;  3FKE A;  2LBO A;  2CE7 A;  3KDS E;  2OYY A;  5FSW A;  3AOE A;  4YY3 M;  2ZG6 A;  5FTN A;  4DUY M;  3A46 A;  2XH9 A;  4LZZ A;  3KOX E;  1IXZ A;  4LJA A;  3R9X B;  2WAQ C;  1PJJ A;  3KSX A;  4IIW A;  4FVM A;  3J80 S;  3U6S A;  4DR4 M;  2CN1 A;  2HMX A;  4GFJ A;  4OJO A;  4OJ6 A;  2ZIV A;  2A3V A;  4B08 A;  2FE8 A;  5C18 A;  1XNR M;  3TWM A;  2M5Z A;  4X62 M;  1C1K A;  4JI3 M;  3L29 A;  1XC8 A;  2QPA A;  4IJF A;  3L27 A;  4KX3 A;  4IJE A;  3QWL A;  3GLH A;  4LRT A;  3ALR A;  1Q39 A;  2ZIX B;  3N7P D;  1HNX M;  3HU1 A;  4CDG A;  1IXR C;  2ZXH A;  3HKP A;  1TH2 A;  2LWX A;  2XZF A;  5KQD A;  3U6P A;  3I4V A;  2UUC M;  5FTM A;  4LGM A;  3JAM S;  1JR3 D;  2XSZ D;  3K8Z A;  4M0W A;  4QNM A;  2KHQ A;  4DV3 M;  1XWI A;  3VK8 A;  1IIP A;  4JYA M;  1NSF A;  5IT9 S;  5FLX S;  2KRK A;  3WHK A;  3VFD A;  2LYB A;  2K47 A;  3VKG A;  3HJ8 A;  4KO8 A;  4IBE A;  3RFW A;  4LF6 M;  1HIW A;  2MRL A;  2VJ4 A;  4NXN M;  2W04 A;  4MM3 B;  3HGI A;  2Q2E B;  3D8B A;  2JHD A;  1NJG A;  1GL6 A;  4IBC A;  5KPZ A;  4AYB C;  1N75 A;  1OFH A;  2CV0 A;  3FYD A;  1ZQ9 A;  2XSZ A;  4JI0 M;  2Z4S A;  2KHV A;  3N7R C;  5FTK A;  3GRU A;  2L7I A;  2E5S A;  5IZ7 D;  4WJ3 B;  4MH0 E;  2BNK A;  2UXD M;  1ORY B;  2CHQ A;  4I4L A;  3PNY A;  2V6Z M;  2G5H B;  1IBM M;  3TWK A;  3CF0 A;  2ZIW A;  1HT2 E;  1QAM A;  4OVZ A;  4DR5 M;  3U6O A;  3K2L A;  2F5Q A;  1DRG A;  2D6F C;  3PFI A;  4KLN A;  3T1H M;  3GLF A;  3E4R A;  1N32 M;  4CGZ A;  4NLC A;  2E1F A;  1YE9 A;  2KJ8 A;  3DEE A;  3HJS A;  4L4U A;  3KS8 A;  3LVW A;  5C1B A;  2KEY A;  3L3F X;  4LRS A;  2HBL A;  2J7N A;  3FD9 A;  4M0D A;  4AZF A;  4B7F A;  4TUW A;  1CRX A;  4AQY M;  3SYL A;  3SQI A;  4X66 M;  3TL4 X;  4LJ7 A;  2Q4T A;  4R7G A;  5E26 A;  1R6B X;  4AW4 A;  4ACO A;  3SYK A;  3FUT A;  1ECW A;  3PXG A;  3U61 A;  3T15 A;  3L26 A;  1G4A E;  3HU3 A;  2OXO A;  4PL1 A;  3C28 A;  3RGP A;  5EXT A;  4BUG A;  1DO2 A;  4P0Q A;  3C58 A;  5A2Q S;  4PCZ A;  4NOO B;  1OUQ A;  4I5S A;  3H4M A;  3PNV A;  4JI8 M;  2UXC M;  4OJL A;  1L8Q A;  4MGI E;  1PJI A;  2F2A B;  4MB7 A;  5KL1 B;  2DWL A;  3GLG A;  3TPZ A;  2Z4R A;  3N7S C;  2UU9 M;  2C5R A;  1J09 A;  2WB1 C;  2F8L A;  4P0Q B;  1Z6T A;  2LHT A;  1DGB A;  2E1E A;  4EIW A;  3KFU G;  1IM2 A;  4QIW C;  3U6L A;  2XGN A;  4G4Q A;  3TQS A;  4QNR A;  3H0L B;  3AJI B;  2ZAO A;  3KSJ A;  4U6P A;  4NSR A;  2F5O A;  2VQF M;  1XMQ M;  4NWI A;  3VDP A;  4GC5 A;  3KS4 A;  4A8E A;  1XXH A;  5EQT A;  3F2B A;  2ZM6 M;  1KBU A;  2Z3X A;  2C96 A;  1SXJ D;  5EJC A;  4A3V B;  2I7N A;  3HHY A;  5E6J A;  1R2Y A;  4LF7 M;  4LZJ A;  2OPF A;  1Q3C A;  2A5Y B;  4IBJ A;  2YQZ A;  1FJG M;  3PSI A;  4M9S A;  2PMZ F;  2G06 A;  4L16 A;  2CHV A;  2Y0T A;  3IG5 A;  1EE8 A;  4LJ6 A;  3U60 A;  3SAW A;  1TAM A;  2KRU A;  2YB1 A;  1DGH A;  2CV2 A;  3SMP A;  2DVW B;  1SXJ A;  4B7G A;  2DF4 B;  5KL8 B;  2AHM A;  4KX5 A;  4PDI A;  1N33 M;  2D7G A;  2L09 A;  3MHV C;  1TGU A;  4G4R A;  4HLQ A;  4FZM A;  3CF6 E;  4DR2 M;  1G59 A;  3UMM A;  1XO0 A;  2DWZ B;  3CF2 A;  2GOL A;  2VJ5 A;  2Y0S C;  5JI3 E;  3VC8 A;  3KOW E;  3ILK A;  1G41 A;  4D81 A;  4PDG A;  2QCU A;  4AKG A;  3PVS A;  3U6E A;  1HR0 M;  3NRW A;  2ZAM A;  3SHG B;  4DV1 M;  4JI6 M;  2LNH C;  3L25 A;  3W0F A;  3AOE C;  3FYC A;  3SAS A;  4BX9 C;  3J81 S;  5IWA M;  3KOY E;  2L6O A;  1Z5C A;  2FFJ A;  4FD2 A;  4LGY A;  1D8B A;  3EIH A;  1IN5 A;  8CAT A;  3THG A;  5KPR A;  1IQP A;  2Y20 A;  4LF4 M;  3FTF A;  2RHF A;  2RRD A;  2HOF A;  3K92 A;  3TE6 A;  5BPV A;  4C0Z A;  5EP3 A;  4L15 A;  1XHB A;  3UGJ A;  5CRX A;  4L78 A;  2XZU A;  3CYM A;  3AL0 C;  4GHA A;  4FWG A;  1W5T A;  3H0M B;  3U6Q A;  1TDH A;  2ZIV B;  2FOI C;  2L7H A;  5ITX E;  2N1R A;  1YT3 A;  2KEB A;  3F2D A;  2E5L M;  1PVR A;  1Z1B A;  4GIT A;  3AL0 B;  3GLI A;  4G4O A;  4II7 A;  2KJ9 A;  1TH4 A;  2F5N A;  1DGG A;  1YSY A;  2CHG A;  4JI4 M;  3GLH B;  3RF9 A;  2XFS A;  1PVQ A;  4XBO A;  1PVP A;  2CFO A;  1S3S A;  2YNM D;  1GO3 F;  2ZXI A;  3ZCB B;  1N36 M;  3RGS A;  2K8C B;  2LYA A;  2XFT A;  2VIX A;  4YHH M;  1NHG C;  4MGK E;  1W5S A;  2ZIU A;  1HQY E;  2HCB A;  3NWL A;  4I81 A;  3SC3 A;  4BLC A;  3PSP A;  3SAG A;  2W7O A;  2G09 A;  2G8L A;  3B9P A;  1L2B A;  5LMU M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...