2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
molecule keywords Capsid assembly protein VP3
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2Z7JA 2R18A
chains in the Genus database with same CATH superfamily
3E46A 8ICBA 4LRSA 2ASDA 4MGHA 2FPMA 2DGZA 2ZTCA 2DVWB 4UB5A 1N5XA 4F72A 2XY5A 1DK2A 2A1JB 2YMMA 3RH6A 3LMMA 3THVA 4QOZC 3PO4A 2R62A 4F4KA 4RNOA 4AKHA 5KFFA 2YFQA 2F5NA 2ZUCA 4NLKA 1SV0C 3QYBA 4CF3A 4P4MA 5J0UA 2C96A 1DGFA 3VK7A 5F3WA 1QQ7A 1L3SA 2KP7A 3C1YA 4PHEA 3Q8QB 2G5IB 1B22A 4ECYA 4QZEA 3VDPA 5J2BA 2QB0A 2K89A 5AK3A 4EBDA 1KN5A 4AG5A 1ZQUA 2BJVA 5FP0A 3WK9A 2VKQA 5KFEA 4IQUA 2UVUA 2W7OA 2LM4A 3KHRA 1B4FA 5KPRA 2JHDA 4NLZA 3AN1A 4DSKA 1WCNA 4PL1A 3UMMA 1DGJA 1SXJD 2JXNA 3AU6A 5AI8A 1IIPA 5EOZA 2DKZA 1ZQDA 3RB6A 5AK4A 3SD7A 2AGOA 4LFCM 3T5HA 4HLQA 3GLFB 1ZETA 3SAUA 1Q39A 1LVHA 2HHUA 4YMNA 1YUBA 3T5KA 5J0WA 2W8KA 4IJFA 5IWAM 4Y2UA 4QOSA 4J9PA 5J2EA 2G5HB 1ZQJA 4DR1M 5AKLA 1TVAA 3PSFA 5CWRA 7ICRA 3HJSA 4BGDA 5KFQA 1DXSA 3BS7A 5JI2E 4QNMA 2HL7A 9ICIA 5KFVA 3IV6A 4PL2A 4DOCA 5EP1A 4KHPM 1ZD5A 1WG8A 1SXEA 3VK8A 3RR7A 1D0KA 1GO3F 2ODGA 2ZIWA 2I6XA 2R65A 2F5SA 5H2FU 1IY0A 2LHCA 3RJEA 1OAIA 2ZG6A 9ICKA 2FI1A 5EXXA 2FMPA 2FPLA 3RH4A 2BWEA 1NNJA 3VKHA 2BGWA 4P17A 4I29A 2DQNB 4KLDA 3AUOA 3V6JA 2WZJA 1S3SA 3T1YM 4EZ9A 4LVSA 3DEEA 4C8LA 4LRTA 1QSSA 3SMPA 3A0BU 5J2HA 3RRGA 5B66U 4IBJA 3F53A 4LZDA 2HWJA 1A0PA 2QPAA 3GLGA 2I5HA 3GRRA 3RGPA 4O3OA 1KW4A 4IR9A 5KFUA 2ZTEA 1F5SA 5DG9A 4C4SA 3B7QA 3W0FA 2BCUA 2KJ5A 5KFJA 4RQ7A 4FWDA 4ECTA 5JTIA 7ICHA 2MRLA 1Q3CA 2PKEA 3ZDBA 8ICUA 1D8YA 1SXJA 2KMDA 2OM6A 3B0YA 5KFBA 1NK5A 3QXGA 1HNZM 3H8MA 3KVWA 2CE7A 4P4OA 5KFNA 2EA0A 3NUQA 3SFZA 5KFMA 5AI0A 2V4RA 1NK9A 2I1QA 2E1FA 4FCVA 4P0QB 4QJFB 1NO1A 3HILA 9ICNA 3ZCBB 7ICPA 3A98B 5ALPA 1V85A 3UGJA 2DXIA 3H4JA 2M0NA 2YB4A 4QZCA 1K1QA 4Z6DA 2B6GA 1L8QA 1PUZA 3AL0C 4F5QA 1R2ZA 3Q8LA 7CATA 1OJLA 2FH0A 4D80A 1PJTA 3OHBA 4DBGB 2LKYA 2LYBA 2HW3A 8ICTA 4AYBC 3F5EA 1SG9A 5C18A 3PX6A 2J6UA 1R7RA 3PFIA 4G6ZA 5IT9S 2ZIVB 2Z4SA 1ZQLA 2JY6B 3SMVA 4IBGA 1OIPA 3K8ZA 4EEYA 4C7YA 4NXNM 4R71A 5HR7A 3ILKA 3M1YA 3W67A 3UMBA 3A0HU 1YLAA 2L4EA 1D9DA 2VQFM 1D2NA 1HQCA 2FS1A 4MGKE 2EZZA 4QHTA 5EWGA 1P7DA 4DL5A 1SWWA 3RJJA 4M9XA 4ED0A 3HU2A 2CHVA 2XF3A 5JI3E 2ZIXB 1G59A 2D6FC 1NJYA 1WWVA 3ETRA 3KD3A 3OGUA 1L3UA 1WIVA 4I2CA 3SYKA 2BQ3A 1DOQA 2UVRA 1RDFA 7ICGA 2L09A 4M9NA 1NSFA 1ZRMA 3ISCA 4KLLA 3KHHA 3LK9A 4UB6U 1RYUA 3GLHA 1JXEA 4F92B 1OFHA 2OCEA 1KLNA 4RUCA 3B0XA 1ZQKA 1PJIA 5AKHA 3U6DA 3T38A 4LF4M 2Y0SC 2R8IA 4RT3A 4OU7A 4DV7M 3B89A 2JNHA 4DSEA 4KLJA 1RZTA 3J7BA 1WGNA 2HKJA 2LVQD 4M6WA 4Z6YA 2EDUA 8ICXA 4Q7JA 4B3RM 5HP4A 3PO5A 2DKLA 1QAQA 1SXJE 2VF8A 1K82A 3Q8PB 4KLTA 3AL0B 1QDTA 1E9RA 2HBJA 4O5CA 1TH2A 4B7FA 5TZVA 2PI5A 2W9BA 3NVYA 1KFSA 4B9LA 1G71A 2HOQA 3V7KA 3U6EA 3V7LA 1VLBA 3ZC7B 2FFJA 4LCBA 1OAOC 1TFRA 4ELVA 3M9OB 2R8JA 3BQ0A 3L4PA 2BCSA 4P0PA 4EBEA 3JPTA 4MB7A 5L1MA 2KA6B 1NY5A 2XCAA 3EW9A 3BQ2A 1QUTA 5AKEA 1KRPA 9ICFA 1TH4A 1D8BA 3GLFA 4F3OA 8ICLA 4AP9A 1VDLA 4E0DA 2EKFA 5T14A 1GO5A 2RP5A 2WAQF 3TADA 4LY6A 4M9GA 9ICVA 2RHFA 1YE9A 4JV1A 4PCZA 2K60A 5EWFA 4R8UA 3SARA 4YY3M 2F77X 3QYPA 4F91B 4PHDA 2G06A 4UAVA 4KLOA 4F5PA 2BHNA 1L5UA 1PRBA 3B9PA 1GL6A 1IXRA 4K4HA 2RLTA 5ALLA 4ITQA 3EUB2 4KLSA 3E21A 3F2CA 1NKEA 4YQWA 4S12A 5IINA 3I51A 4OJ6A 4B9UA 3JPSA 5KO3A 2F4VM 4C7ZA 3PNCA 2F5OA 1NK7A 3LDAA 1TAMA 2CV0A 3N7SC 4RQ4A 4TUSA 1ZQTA 1JR3D 1JIHA 3QEBZ 2OWOA 3SMSA 3LCVB 2IBKA 3EPGA 1X2IA 4Y2SA 2W3SA 2QCUA 4LJ4A 3KHGA 1T8EA 8ICWA 4LF9M 2MH8A 1N33M 4Y2YA 5KT5A 4ED6A 2V1CA 1GKIA 3C2KA 2C2RA 3S6JA 3SV4A 3HKZF 9ICMA 2OO9A 3SV3A 2BPFA 3PY8A 2BCVA 1TV9A 2FLLA 3MBYA 2LYHA 4TUPA 1Q46A 4EYIB 3TFRA 2CXYA 7ICMA 1WHCA 4I2IA 1KQQA 4EBCA 1XHBA 2JZBA 3AJIB 3CTWB 5KT3A 1L3VA 3V72A 2B3TA 2HHWA 2J6SA 3HZJA 1FO4A 2XICA 1ZQZA 5LMUM 4DFKA 2F5PA 4FCTA 5EP3A 8ICNA 4KLFA 2KVSA 9ICSA 5D46A 1XC9A 3BOSA 3WK6A 2QBYA 1ZQRA 2M5ZA 1Z00B 1J2MA 3FRHA 3Q8SB 4YFKA 5DB8A 1ZD3A 4GHAA 9ICAA 1O03A 2DWLA 5KG2A 4LFAM 4F50A 4L8RC 3TAQA 2W54A 1XO0A 2XFTA 2C9OA 1UT5A 2IHNA 2NRWA 3FUXA 1B0XA 2JY5A 1JALA 1MJGM 2ALZA 2K0BX 4A8EA 3KTQA 2UUAM 1QCKA 2F2AB 3PVXA 4M47A 3U60A 2WSFF 3M8RA 4KN4A 4NY8A 2K4HA 2R8KA 3FC4A 4TUQA 1O08A 9ICLA 3TAPA 2EZYA 4KT0F 1AROP 5J0QA 1HUZA 3E0FA 4IBBA 1HQYE 4P4PA 2FLPA 2I9GA 3ZDAA 1L7PA 3U6OA 3MFHA 2PMZC 4RPZA 3AQEA 3K4GA 5EE3A 4AKIA 4Z6FA 4RT2A 1IXZA 2IOFK 1K3XA 3GDXA 1ZQGA 2P6RA 5K4LA 4QZBA 1JX4A 2ZIVA 1B43A 1ZQCA 2BCRA 4QW9A 2HI0A 4PDIA 4FCWA 2LPEA 4D81A 1Z5CA 2E8MA 2HVHA 1KFDA 1ZD2P 1OKSA 5HHIA 2KOBA 3NBIA 4DCCA 1S0OA 2KSOB 4DQQA 2AQ0A 2KZZA 1IV8A 2Y9UA 2VA3A 2DWQA 3TQSA 3OSNA 2NRXA 5DNYA 3TQ1A 4I81A 2EKKA 5KFTA 1ZQQA 3G6XA 3B7ZA 3GLGE 4OCZA 4BLCA 4EIWA 4DSJA 1D0LA 1IXSB 5EWEA 2E3TA 2AH5A 4DSIA 4DL2A 3PXGA 1ZJNA 3HWTA 3GQ4A 2W9CA 2R46A 2LI6A 2DI0A 4JI6M 5FTNA 5KFIA 3H8WA 3WHLA 2BDUA 4OO1J 1N61A 1IM2A 2K4PA 4PDGA 2ERCA 1EE8A 1XO1A 2AGQA 2R8GA 2FMQA 2WF7A 5H37D 3H4BA 3ETLA 1QQ6A 4BWJA 2UVVA 1R6BX 3ZD9A 4DF8A 8ICRA 4KLUA 3GV7B 4GKJM 3U6CA 2EH9A 3RH5A 1XB2B 1KKXA 3KS4A 2OYYA 3PMNA 1N34M 5DQHA 3SC3A 1KTQA 2UUBM 1G3IA 2NO5A 3JPRA 5L1KA 4G4QA 3SYLA 2NQ8C 4DL4A 4M9JA 1A5TA 2CEAA 2KZUA 4M6WB 1Q02A 5AM3A 3DV9A 1RXWA 1BVSA 4RQ2A 4QZAA 3G6YA 7ICSA 4WW0A 3IG8A 3LCUA 1FJGM 4USAA 4J9RA 1X9WA 2N35A 3U6QA 4QWCA 5KG1A 4YXMA 2ZIWB 9ICUA 1JQJC 2KEBA 3RAQA 8ICFA 2BQUA 2LHTA 2HHTA 3NS1A 2LXEA 3HJQA 1AUAA 2KZ3A 3KHLA 4AW4A 1LKYA 1PVPA 3I01M 1L2DA 4CIZA 9ICEA 1MA7A 3AOEA 5ITYA 5D49A 4X5VA 2Y0QA 2KZSA 4WURA 4REZA 1I94M 5DGAA 4O3PA 3KKAC 3WHKA 4I4LA 1COKA 1V92A 1XNSA 4II7A 5KPTA 2KNVA 3TANA 4G9BA 1AQ6A 1RQLA 2RRUA 1SL2A 4GC9A 1R2YA 2XGQA 2HHSA 3KOWE 3C3DA 3KFUF 3J81j 2Y1IA 3EIHA 2XGNA 5L1LA 2X4AA 5CB1A 1ZXIA 5DGBA 3Q8XA 4NOOB 3GO8A 4M9LA 4JXJA 3R9XB 1PGYA 1U49A 3ISDA 2R4JA 2JH1A 4LG2A 9ICRA 2XZUA 3DFZA 5DKWA 2AGPA 1IBMM 2QQ8A 1HEKA 2B21A 2QENA 3T79A 2DNAA 2DF4B 4IIWA 4AZFA 2DZLA 4Y2TA 5KG6A 4JV2A 5KL8B 1L7MA 1OW5A 5DQIA 1SIJA 2ZAMA 2QARA 3JPQA 4DR2M 1PJJA 3BBZA 2NYVA 4GC7A 2HMXA 4MF8A 4HYKA 3EWAA 3MGHA 2QBYB 4G4RA 3DA1A 4GKKM 1W5SA 1L7OA 4YP3A 8ICPA 5ITXA 3EZ5A 5J0YA 4QZGA 5FTLA 4M9SA 3HPOA 3GQ3A 3FKEA 2KN7A 3C9PA 3TL4X 3J80S 3J2PB 4Q8EA 1OFIA 4C8MA 2VA8A 2XIDA 4BWMA 5DFLA 4UARA 3HX0A 4IRDA 3T15A 1IY1A 5KFAA 4UAYA 4Y2PA 3FYHA 1NV8A 3Q8GA 4DS4A 4CGYB 5A2QS 4B6JA 2XSZA 4CNQA 2ZXIA 1JRPA 4QWBA 3UK6A 2HBKA 4F5OA 4B9VA 4FWHA 4K4GA 3GPPA 2KW0A 4OW0A 3W68A 2L5YA 4DWIA 1KYIA 1RQNA 4FS1A 4AI6A 5AM0A 1RU3A 1RYRA 4JUZA 2ZUDA 2JP7A 2ZJ8A 4QZIA 2UXCM 1RM6C 1CRXA 2JY7A 3J81S 1WGLA 2BPCA 3RJGA 3NRZA 2KK0A 3PZPA 3IP4B 4KLHA 1XNRM 1QZEA 3HJ8A 1X37A 1L1ZA 4YXJA 3FYCA 7ICIA 3C3EA 1SB3C 3K2LA 2D7EA 2CWBA 4Z6CA 2XI9A 2HCBA 5ALVA 1XC8A 5CR0A 4XK8F 4YHHM 3OHAA 3PV8A 1ZD4A 2K4EA 4CDGA 4EX7A 5KT4A 4Y28F 4BXOA 4I2JA 2L4FA 4NL9C 2DUYA 4JI0M 4R3DA 1C20A 2I7PA 2DAMA 2KXEA 5KFCA 5BOLA 2ASLA 3GQ5A 1X6IA 2BPGA 2F1JA 2K4IA 2XH9A 2YMQA 2W3RA 1VDDA 3I04M 3NGDA 4R8UB 3O0FA 1SL0A 4M0AA 4RQ3A 3CYMA 1VQ1A 3RB0A 2WB1C 1E9SA 3JAMS 4I8OA 2KV2A 7ICTA 2YQZA 2C2DA 1S0VA 2PXIA 3ZDCA 1FFUA 1RPLA 1BPEA 3AM9A 1T3TA 5IIOA 4KLIA 2K6BA 1QSLA 4DF4A 1QVRA 4DV0M 2YMLA 2H3ZA 5AM2A 1OIZA 2QSFX 4FZMA 5J2AA 4CRXA 4JWMA 3WKBA 1ZQWA 2VJ4A 4ECRA 1ZQBA 5EXSA 2JEJA 4C4TA 4IQWA 1NOMA 2HCFA 4DS5A 9ICBA 4D82A 7ICQA 4DFPA 3A46A 3LVVA 4RQ1A 4NV0A 4G3IA 2WF5A 4GIPA 5ALNA 2G0AA 3GV5B 2OEHA 5EQTA 2R18A 3GU3A 1QDRA 4OD0A 4YD2A 1T3QA 1RXVA 5IILA 1ZV1A 3N4MB 3RJFA 2I7NA 3RRHA 8ICIA 1U48A 4UAZA 2JZ1A 1NY6A 2BKEA 4EELA 4ACOA 2PFQA 2KIWA 4M0WA 1WCLA 4NL9A 2G08A 2W9BB 4MFAA 4ECXA 2ASJA 4UB3A 3H40A 2DAKA 4M9HA 1SXJC 3NVZA 4IL6U 3KSXA 2G07A 3RJKA 2J7NA 1N2XA 4RNMA 4UAWA 2R8HA 2OOAA 4KX5A 2LBOA 4I2AA 4RU9A 1U4BA 1ED1A 4FW9A 5C0YA 3WKCA 2D3DA 4LJ7A 1DO0A 5AIBA 1K1SA 3HW8A 4KTQA 4UB2A 3IHQB 8ICCA 3RFAA 4KLEA 2F44A 1KDHA 3K1RB 4BBAA 4YR0A 5ITQA 4B3TM 2MSNA 2PFOA 4QZDA 1LKYB 2ZJAA 1ZQEA 1XMOM 3UQ0A 2VQEM 3K75D 2DWMA 1DO2A 1L7NA 3PW2A 3DDHA 4IS7A 1QTMA 1G4AE 5DQGA 4I28A 3F5AA 4L16A 3I28A 4Q43A 3K9PA 1NK0A 3AU2A 1MN3A 1XS9D 1OTRA 4QNLA 4QW8A 5CP2A 4J9KA 2HVIA 4BDPA 3RJHA 2KE7A 3M7DA 4DEZA 4QZ9A 1ZQNA 2LHGA 3AFHA 2GWSA 4ELTA 8ICSA 1ZRNA 1PJSA 1S76D 5ALSA 4IRKA 1JUDA 1QZMA 2JY8A 4EEKA 2QARB 2XFSA 4O3RA 1ECWA 4MF2A 1PVQA 4RZRA 4NWIA 2LVPC 3AKZA 1ZQFA 4P2HA 3E58A 4J9LA 5GTIU 3HKPA 2MAXA 3LYSA 4B9SA 2DPJA 3ORYA 5J2FA 2HSZA 5F3XB 2JGAA 3W0LB 5CEHA 4UB8U 3U5ZB 5L1JA 5JU5A 3GIJA 1L2BA 4J9MA 1SGGA 4GH9A 4Q8FA 2NO4A 2J6TA 4JI1M 3FUTA 4Y2QA 1HUOA 4DR6M 3RJIA 5J2CA 4DV1M 4DLGA 2QP9X 3GLIE 4MEYA 3MR3A 1XXHB 3M8SA 4DQPA 7ICFA 9ICJA 1Z5BA 2CHGA 4NXMM 1ZQIA 3Q8RB 3GIKA 3CNHA 1F44A 1NI3A 1Z19A 5CJ7A 5J0XA 4IBKA 5EE1A 3HU1A 4M2YA 5AKJA 1TR8A 2DAEA 4TURA 3E9SA 2NV3A 2H3FA 4JB3A 1G8PA 3UPQA 3RGSA 1L1TA 1NJXA 1VJ5A 4M0DA 1NJFA 3IM1A 2UXDM 4RNAA 5BR8M 4FZLA 9ICWA 5KFLA 8ICHA 3WKAA 2Q4TA 2LVAA 1M6YA 3K92A 3K1JA 2E8PA 3FTDA 3ZDDA 2FPKA 3L26A 5JUMA 4TQRA 2FDRA 1BPZA 5ALJA 1F0MA 3TFSA 1U45A 1S9FA 5IIMA 2UXBM 4NSRA 5J0PA 1E32A 2W8LA 2XY7A 2BWBA 4NJ8A 1FFVA 8ICJA 4C80A 2LTUA 3HGIA 3I4YA 3VLFB 3H4MA 2JRZA 4KLQA 2YR0A 4G3OA 1X40A 3SENA 3H8SA 5KFSA 8CATA 3JPPA 4O3MA 4GC5A 2E8NA 4NL4H 3GPUA 5ALZA 4DOAA 1J09A 2KRKA 2F1IA 1TF0B 2CV1A 3BZKA 2ZUBA 5J2KA 4XGIA 4MFCA 4CCHA 4UATA 2XO7A 4DQIA 2OH2A 2UVWA 2VDBB 3U61B 3TADC 1ZQYA 4UAUA 5L8RF 1Q3VA 2EQYA 1G41A 2BZFA 1GLNA 4DL6A 2BCQA 2A5YB 3JR5A 2DZNB 2E5SA 4MH0E 4KMUA 1QANA 2M60A 3H0LB 4LFBM 1MQ2A 2EAOA 3FUUA 2W9CB 2Q2EB 3SR6A 2XZFA 2H5XA 2C28A 4F71A 5IZ7D 2Y20A 3HX3A 3KP0E 1OXJA 5HMMA 1TAUA 4A3VB 5FTKA 2LVOC 5AI6A 4UB1A 2C5RA 2CV2A 1Z3EB 4UBCA 1X6JA 2MUTA 3QUCA 2K9DA 3LQRA 4B7HA 3M9MB 2V4QA 4DUZM 5DBAA 1R4GA 1GL7A 4CISA 4LGYA 1Z4OA 2B0CA 2W9AA 3HHWA 4GXIA 2CRXA 5KFPA 1IN8A 4AKGA 4Y2XA 2O5RA 2AHMA 1ZQAA 2KD1A 2W03A 2RQ5A 3PW5A 3U5ZA 2HOFA 4MGZE 5FLXS 4CF5A 2KHQA 1D9FA 4Y2VA 4RQ6A 1H38A 3V6HA 4I2GA 2MR9A 5KG0A 4X66M 3U6SA 1S8OA 1RG6A 3KZXA 5AM1A 2Y0TA 1NZBA 4J9SA 1Z1BA 4MM3B 3ZQJA 3SBJA 4O5EA 1PVRA 7ICEA 3TE6A 3CP8A 1SL1A 1H6UA 4R65A 2ISPA 2IHMA 2DHRA 3KOZE 3ZD8A 3SATA 2QB0B 4DSLA 5J2JA 5C1BA 2YB1A 2WHEA 3TACB 1MSWD 2LBCA 4KITB 3N28A 8ICYA 5BPVA 2P6UA 5ALGA 1UM8A 3H7IA 5KFOA 1S97A 4NXZA 2OHFA 1MU5A 1UFZA 3TI0A 1V33A 3RB4A 1J5EM 5ALUA 2W43A 3QNMA 2IMWP 3T5LA 3B74A 1IN7A 1ZQ9A 1V38A 3UMCA 2W7PA 3WKEA 3BQ1A 3QU9A 4OJOA 5AK6A 3KBBA 2ISOA 4JV0A 3EIEA 5DB6A 3QU4A 4NLCA 3BS5B 1OUQA 4GMQA 1Z00A 3T6PA 3FTCA 4X65M 1IFYA 2MROB 2DPIA 2KNZA 2YY6A 1HR0M 3J7AS 4LZJA 4CJ6A 4QZHA 2YNMD 1D0MA 2EZXA 1QYRA 3OJSA 1T7PA 3WU2U 5ALTA 3C23A 2JV3A 4YCXA 1JR3A 2H1RA 2F3NA 2L7IA 4RQ5A 3UZUA 5FTJA 2DWNA 1GABA 2E8OA 2MU2A 3SYZA 5DB9A 3QU7A 4LF5M 5ITRA 2JA2A 3L27A 2LWXA 4RPYA 1I4WA 1K5OA 3UMGA 2ZJ5A 3MR6A 2ZM6M 2A19A 4MFFA 4ED8A 2KVCA 2WAQC 4B7GA 4F1IA 2ZIUB 2BDPA 5GTHU 1ZOLA 4PGQA 2RGOA 4LJ8A 2KDLA 1U47A 2C2EA 4P0PB 2RKOA 3T3FA 3C2LA 1TK8A 2JWSA 5DDMA 3NWLA 3FD9A 3HT3A 4XRHA 2DWZB 4JI2M 1X9SA 5KG3A 4ECQA 2JXJA 1TGUA 5DYIA 5J0TA 1DK3A 9ICOA 1IBKM 1BPBA 1CEZA 4W5WA 4QNRA 2YX8A 2HDOA 4BUGA 2GH1A 4DUYM 4PHAA 3E4RA 4ZOHC 4DL3A 1TH3A 4KLNA 4OX9M 3AEVA 2LH0A 3D8BA 5AKYA 4I2HA 2G09A 2FOIC 1S5LU 4MEXA 3H0RB 4JI3M 5DYGA 3SHGB 2EAMA 1BPXA 3PMLA 5EXTA 4EZ6A 3NBXX 2R45A 2BNKA 1J97A 3CF6E 4RQNA 5D4BA 5FSWA 5ALHA 2WTFA 3V7JA 2R6FA 3HKZC 2ZIUA 8ICQA 3UXNA 9ICXA 4I5SA 4BJQA 3ED5A 5BPCA 4LJ6A 4J03A 2PFPA 1N5WA 5KFKA 5AKGA 3FAHA 4HEOA 2ES6A 1XNQM 1Q3UA 4YR3A 1N60A 4WP2A 4CGZA 2EUCA 3PX0A 2W04A 4DSFA 4Q45A 3HJEA 2AQ4A 3C5FA 3AV0A 3NVWA 1QUSA 1MC8A 2Y1JA 4K0KM 5KQ8A 3I1YA 1DGHB 4PZNA 3RTVA 2JMGA 8ICOA 2FE8A 2FNAA 2PFNA 5KL1B 4HL4A 1MQ3A 1BPDA 2OQ4A 3BQTA 4B08A 3BS5A 5AHXA 3EPIA 2MUTB 3TWLA 3VKGA 1FIQA 1Z4NA 1DGSA 3RFWA 5FTMA 4DR3M 4F4XA 5KFZA 3C58A 2F8LA 5IREB 3KOXE 4ECWA 1ZQMA 1ZJMA 2MGWA 3CW2C 3U6PA 5EE9A 1YSYA 1L2CA 3PW7A 4C8OA 1QH9A 1DRGA 9ICCA 4JI7M 2CP8A 3Q8MA 3QUQA 3UM9A 5KT7A 2C22A 4I2BA 2CFOA 3KZIU 1FEZA 4QWEA 1RYSA 4KMOB 2ZAOA 3BQ7A 3C1ZA 2W9MA 2HBLA 3RB3A 3AOEC 5E79U 2L6OA 4F5NA 3MABA 5AI5A 3KKAA 4LF6M 2R0IA 4GIBA 3ZH9B 1TE2A 1DGBA 4YD1A 5J29A 3SHFA 2V1UA 1KEJA 3NASA 4EENA 4DV2M 5J0OA 4B9NA 1GJTA 1N77A 1C7YA 4RNNA 2K47A 1XSNA 3MC1A 3FE3A 1TTEA 4YMMA 1KFTA 4KN7A 1URJA 4FVMA 5KT6A 1SZPA 1ZQ1C 5KFYA 3LW5F 3MR2A 2EAPA 1IY2A 2WSEF 4B3MM 4IJEA 1V97A 4RQ0A 5L9XA 1NNUC 1SXJB 2D7GA 1PK1B 3KW6A 3HHZA 4YMOA 3GLIB 1JB0F 2CRUA 3QE9Y 3G6VA 3AMZA 2AU0A 3C5GA 2K8CB 2VIIA 1KL9A 1NZPA 2DBYA 2KKPA 5ALQA 3VFDA 3PR4A 2VANA 3QZ7A 3WK8A 5ALIA 5KTQA 3WK5A 9ICTA 2P5TA 4LJAA 5DBCA 3SAHA 5AM4A 4RQ8A 3KXEC 3OSPA 2DAIA 3IECA 2WSCF 1SXDA 2HHHM 4JV5M 2FLNA 3BJYA 2HBMA 1Q8KA 1L6NA 4MGIE 3AOGA 4DV4M 2KJ8A 3GFKB 4QWDA 2APLA 3WK7A 2R44A 3V6KA 4PD2A 3GLHE 2CUZA 5KFRA 4GITA 2M9NA 5AICA 3L25A 3ALRA 3KOYE 1VEKA 1IQPA 4G4OA 2NRZA 3SEIA 5J2GA 4ED1A 5KAIU 3T1HM 3GILA 2IA6A 4EX6A 2RGHA 1XXHE 4JWNA 2KIVA 4RUAA 3GQCA 5IIKA 1ZYQA 3QZ8A 1ZAEA 5ALEA 2KNJA 4PHPA 3K1ZA 1N32M 3TWMA 3AQFA 1KSFX 1L8LA 1UA1A 2RDIA 2FMSA 2C99A 1JI7A 8ICEA 4IBFA 3SAVA 2KTQA 5J2IA 2F5QA 4JK1A 4ECUA 2GLEA 5KFGA 1ZQVA 3VC8A 4F5RA 4I2FA 2KFZA 3KDSE 3QU2A 1JXLA 1VDVA 1HT1E 2E1EA 3WKDA 4DFDA 4YN4A 2C9CA 1L3TA 4J9OA 4DL7A 1IXRC 1N36M 2Y0SF 4RQMA 4FWGA 2QNJA 9ICGA 1WUDA 3GZFA 4DR7M 4L78A 4QWAA 2W55A 3FRIA 5EP2A 2KFNA 2ZBKB 7ICUA 3Q8KA 2WF6A 3QAUA 3M7GA 4OJ5A 2IOFA 4CE6A 2DAGA 2P35A 3N7PD 4PH5A 1X66A 4ECSA 2VA2A 3B9JA 1WXQA 4F4WA 3IG5A 4KLMA 5HNKA 4GRIA 4GC6A 3FM9A 2LYAA 4ECZA 2D7HA 4RF0A 3MJ5A 2VIXA 2J7OA 5L1IA 2DENA 3GLGB 4L6V6 5J8YA 4FS2A 2RRDA 3H8JA 3F92A 4ED2A 2PI4A 3DOAA 1BNPA 1IN4A 3HU3A 2E5LM 3PSIA 3HHXA 4PJ0U 5J2DA 5CHGA 5KPZA 1SWVA 7ICNA 3L3FX 4RPXA 1XU4A 1N63A 1HIWA 3LVWA 2WF8A 4FBTA 2Z3XA 3KFUG 4O5KA 3MDCA 1DV0A 1J2NA 2JUJA 3C21A 1JN3A 2UUCM 1S0MA 4KODA 4MHVA 3HP6A 2CHQA 1ZQSA 4UASA 3UXPA 2XC9A 3RE8A 2KKVA 4O3NA 4K4IA 4IQTA 5J0SA 3M6AA 3M6ZA 3HHYA 4B9MA 4PPXA 3E2EA 3QUTA 1XXHA 3FUVA 3SZ2A 1PZNA 1R5LA 4GXKA 5KG7A 2F76X 3RBDA 7ICKA 2RDJA 4L4UA 2XGPA 1S10A 3EYZA 2R4EA 8ICAA 4LF8M 2ATLA 3GRYA 3RR8A 5DLFA 4NLGA 4JMUA 1IM4A 4LJXA 1Z59A 4F2RA 5G5GA 4DO9A 2L7HA 2QB1A 5KFXA 3BDPA 1YT3A 3GLFE 2K8BB 1NJGA 4YR2A 3OTOM 3WK4A 5KQDA 4C4RA 5BOMA 4IRCA 5AKZA 4F4YA 5ALMA 4BXOB 3PNVA 3OPXA 3QX7A 1QSYA 2W82A 3ICXA 2KICA 3N7RC 1TKDA 1OQYA 3A45A 5ALWA 1HNXM 3JPNA 2XY6A 3BZCA 1F4IA 4UN2B 4DV6M 2EJSA 3N97B 5AI4A 5DBBA 5DG8A 4JI5M 4C8KA 4J9QA 4ECVA 3NRWA 4X62M 5A0LA 2EO2A 4PGXA 1N62A 1T4GA 1T3NA 4O3SA 5AKXA 2HAKA 4DFMA 4PGYA 2G8LA 3SQIA 2VJ5A 1QLNA 4MGYE 1QQ5A 3THGA 2K8AA 3LWMA 3GV8B 2X8AA 1XMQM 2NRVA 1DGGA 3CRXA 3HRDD 1WWUA 4KLGA 2KHHA 3SAWA 1GVNA 2KEYA 3SAFA 4YVZA 1BPYA 4IR1A 5KFDA 3DZDA 5DB7A 3KS8A 4Z6EA 1NK4A 2JZBB 3GLHB 4O0IA 4LJ5A 2J5YA 4US8A 2VF7A 2ZXHA 2LM1A 2EANA 1NK8A 3UXOA 2XEPA 1COOA 2WB1F 1SKWA 1HJPA 3D8LA 4FZNA 3VCBA 4QIWF 1A6SA 1JROA 1QQWA 4QZ8A 2DHYA 2F8KA 4FD2A 4R63A 2KZMA 5B5EU 3M9NB 1SKRA 4LGMA 4LF7M 1QAMA 1YZ7A 3L5KA 1LB2B 2JZ0A 4OJPA 3IDWA 3FTFA 4BB9A 1ZQHA 1XSPA 1X42A 1VG5A 1LV5A 1ORYB 2X49A 3RF9A 2KG5A 1K3WA 4LZGA 1NNLA 3I76A 2JEIA 4I2DA 2WFAA 1NKBA 3PR5B 4DOBA 1PJQA 1TAQA 3PSPA 4FE3A 5C5JA 4XA5A 3R8FA 3MHVC 2WF9A 1MN8A 2KNAA 1JR3E 4DQSA 3PW4A 2LVNC 3TWKA 2AHOB 4JI8M 2Y9TA 1XWLA 4R66A 4DV3M 1SZHA 4Z8XA 5ALKA 5KG4A 5DLGA 4UQGA 2BR0A 1VEJA 2BJWA 1FNNA 1X9MA 2DKXA 4KO8A 1L8OA 1UQVA 5HHHA 1TK5A 3RBEA 3HWSA 4NLBA 1D8LA 2QLTA 5TISU 2O25A 5AKKA 2JH7A 4C0ZA 4L15A 2CN1A 1EFUB 5AIAA 4Y2RA 3MGVA 3LQQA 2PMZF 5IIIA 3V76A 2XSZD 2ZTDA 3U6LA 5EJCA 1UHUA 2JEFA 4NC6A 5KAFU 1MX0A 1T6OA 2JR5A 3D2NA 3LWLA 1P3QQ 4FBUA 2YQEA 3QUBA 2HOIA 3M6KA 1TDHA 2XCPA 1IBLM 2HHQA 3U61A 4IBDA 1ZQOA 4I27A 4R64A 1UCVA 2H3VA 1Z5AA 2OOBA 3NVVA 3TPZA 4F93B 3GRUA 7ICOA 3QYEA 4O9MA 2UU9M 1ZMVA 3QWLA 5ITXE 5ALOA 3GIMA 2HHXA 1A77A 3JR4A 4BX9C 5EXPA 5EP4A 4NM1A 1NV9A 5E26A 5HR6A 4GFJA 3C29A 3UQ2A 3QU5A 3GPYA 2XVTA 4OJLA 3QEAZ 2FJ6A 4YG2A 4R7GA 3J27B 1KSPA 5G5HA 3BXWA 3L28A 4RKUF 3L29A 1X9XA 4TQSA 5AM5A 2JEGA 3UJNA 3GP1A 3GPXA 5EE0A 2ZIXA 2DZOB 3MDAA 3M0EA 4CHTB 3A42A 1A76A 1BNOA 1Z1VA 3ZI4A 2O6KA 1N48A 5AI9A 2G3QA 4NLNA 4AQYM 2FE9A 1IXSA 3FTEA 3PNYA 4PZOA 3D2QA 1VEGA 5KG5A 3F2BA 2P66A 2GO7A 2YN4A 2OPFA 3GIIA 3TKAA 3FDSA 4FFDA 4AYBF 3H4DA 5E6JA 4F4ZA 3T5JA 4NRVA 5JRTA 4B9TA 2O01F 4PT5A 2KSOA 3MK6A 2Z8YM 1BGXT 4XQ8A 5IIJA 4IBCA 3L2AA 2Y21A 4B3SM 4F8RA 2ESEA 2XLJA 5ALRA 4GLXA 2HHVA 4Q44A 2KJ9A 2DFLA 1UPHA 4QHSA 2LMRA 2H3IA 1ZMUA 2V6ZM 3B7NA 1TDZA 1TK0A 4U7CA 8ICKA 2DL0A 1AIPC 3KP1E 1QAOA 2QHOB 4IBIA 4Y2JA 1NVMA 4P0QA 3PX4A 1JMSA 1NJZA 1EIJA 5CRXA 4JYAM 4G4NA 5LMNM 4HAIA 1EXNA 2N1RA 1E94E 2KRUA 3HY5A 2G5GX 1UA0A 2LNHC 4ZH4A 4KX3A 3ISBA 4IC9A 5AK5A 4XUSA 3U60B 5GKNA 4DR5M 3H0MB 1KBUA 2Q0ZX 4DFJA 3MMPA 3VDUA 8ICGA 2Z4RA 1W5TA 3OTQA 4C8NA 2GOLA 1WYGA 1ZQXA 4NSOB 5F9NA 4ZPXA 4XBOA 1CI4A 1SV4A 4GXJA 4US9A 5KFWA 9ICQA 9ICHA 4M04A 4OVZB 4ICAA 1S77D 3KSJA 3PSTA 5KNIA 3GLIA 4UB4A 7ICJA 2MJ5B 1PK1A 1DGHA 2NRTA 1S0NA 1J7KA 4LJ9A 1WR1B 2F1HA 2AJQA 4IQVA 5KFHA 3FYDA 4O3QA 4IBEA 1N75A 1V34A 3MGIA 4RF1A 4DLEA 1HNWM 4JN6A 1N78A 3IHPA 2Z7JA 5ITUA 4X64M 1IN5A 7ICLA 1YZ6A 4ELUA 1C1KA 1NJWA 4NRWA 3FUWA 3TARA 4ED3A 1T94A 1NHWC 5J8YC 4U6PA 1NKCA 7ICVA 8ICMA 1IG6A 3C28A 3CF2A 9ICPA 4CF4A 1XSLA 3NTUA 2L2DA 3ZDEA 4QZFA 2OXOA 5DDYA 4ED7A 2IOHA 2QKQA 3MFIA 4I2EA 8ICZA 4DV5M 2AXTU 3GRVA 3CGWA 3OJUA 2MA1A 4UBBA 3C2MA 1PK3A 1SV0A 5ALFA 5HMLA 1V9PA 1NHGC 1T43A 1ZMWA 2C98A 4WJ3B 4NM2A 4P16A 3R9KA 1N56A 1LV7A 5F9LA 2V9WA 4UW9A 3JPOA 2YTUA 1XWIA 1GJSA 3K9OA 1LTMA 4M9ZA 3U6MA 3PW0A 1UT8A 2KHVA 2GNOA 3CF0A 3PVSA 2CPRA 3D2SA 2W11A 1ZQPA 3SI8A 5J0RA 2ZANA 1IN6A 1SKSA 1U9LA 8ICVA 4F2SA 3IRUA 5CA7A 1CUKA 3RAXA 1Y8GA 2GQFA 1Z6TA 4GHLA 3SASA 4OVZA 1PM5A 1Q3BA 1WJ7A 2D8CA 2BQRA 5ITTA 1Y88A 3KOOA 4ANRA 4DQRA 3I4VA 2A3VA 3ONNA 3MR5A 2QZ4A 5DG7A 4LZZA 3SAGA 4J9NA 5ALYA 5KT2A 4QIWC 3F2DA 1HT2E 1NK6A 4JI4M 5ALXA 4DR4M 2A1JA 4AG6A 4FO6A 2A1AA 5AKIA 3D6JA 3U26A 4EYHB 4F2LA 1KFVA 4TUWA 5ALDA 4GEWA 2H3QA 3IN5A 2YMPA
chains in the Genus database with same CATH topology
2YR0A 4LRSA 4EIWA 4MGHA 3HHYA 4O3MA 2DGZA 8CATA 2DVWB 4GC5A 1IXSB 1XXHA 3FUVA 4NL4H 3GPUA 1J09A 2KRKA 3LMMA 2F76X 3PXGA 2CV1A 4QOZC 4XGIA 4L4UA 2R62A 3GQ4A 2OH2A 2R46A 3U61B 4AKHA 2YFQA 2R4EA 2F5NA 4JI6M 5FTNA 1Q3VA 4LF8M 3WHLA 2BDUA 4OO1J 3GRYA 1IM2A 1G41A 2C96A 1DGFA 3VK7A 5F3WA 1GLNA 4PDGA 4JMUA 2ERCA 2A5YB 3JR5A 1EE8A 1Z59A 2DZNB 2E5SA 4MH0E 2G5IB 2L7HA 1QANA 2M60A 3H0LB 5H37D 4LFBM 3FUUA 1YT3A 3VDPA 2Q2EB 2XZFA 2K89A 2K8BB 1NJGA 4AG5A 3OTOM 5IZ7D 2Y20A 2BJVA 3KP0E 5KQDA 1R6BX 2VKQA 4A3VB 5FTKA 2W7OA 2C5RA 2CV2A 4GKJM 3U6CA 3PNVA 5KPRA 2JHDA 3OPXA 2W82A 3LQRA 4B7HA 3ICXA 2KICA 3N7RC 3KS4A 2OYYA 4PL1A 4DUZM 3UMMA 3A45A 1N34M 3SC3A 1SXJD 1HNXM 2UUBM 1G3IA 1GL7A 4LGYA 4CISA 4G4QA 3SYLA 3HHWA 1IIPA 2CRXA 2NQ8C 1IN8A 4AKGA 2O5RA 2AHMA 3IN5A 4DV6M 2CEAA 4LFCM 2KZUA 4HLQA 3GLFB 3SAUA 2KD1A 2W03A 4JI5M 1Q39A 3U5ZA 3NRWA 2HOFA 4X62M 1YUBA 4MGZE 5A0LA 5FLXS 2EO2A 2KHQA 4WW0A 4IJFA 5IWAM 3IG8A 4QOSA 1FJGM 2G5HB 4BLCA 4X66M 3U6QA 4DR1M 3U6SA 3KZXA 2ZIWB 1NZBA 2Y0TA 1JQJC 3PSFA 1Z1BA 4MM3B 2KEBA 2G8LA 3HJSA 3SBJA 3SQIA 2LHTA 2VJ5A 2LXEA 3HJQA 1PVRA 5JI2E 4MGYE 4QNMA 3TE6A 3THGA 2HL7A 3CP8A 1H6UA 2K8AA 2X8AA 4AW4A 1XMQM 4PL2A 1PVPA 2DHRA 3KOZE 5EP1A 1L2DA 4KHPM 3SATA 1DGGA 3CRXA 1MA7A 3AOEA 5ITYA 3SAWA 1GVNA 3VK8A 1GO3F 2Y0QA 2KZSA 2KEYA 2ZIWA 4WURA 4REZA 5C1BA 1I94M 2YB1A 3DZDA 2R65A 2F5SA 3WHKA 4I4LA 1XNSA 1IY0A 5BPVA 3KS8A 3GLHB 2ZG6A 4LJ5A 1UM8A 4II7A 5EXXA 5KPTA 1MU5A 1NNJA 2ZXHA 3VKHA 2XEPA 2WB1F 2DQNB 4GC9A 1J5EM 1R2YA 1S3SA 3T1YM 3DEEA 3KOWE 1IN7A 1ZQ9A 3D8LA 4LRTA 3SMPA 4FZNA 2W7PA 3KFUF 4OJOA 4IBJA 3EIHA 3VCBA 3F53A 3EIEA 2XGNA 4NLCA 1A0PA 4QIWF 2QPAA 1A6SA 2X4AA 1OUQA 3GLGA 1QQWA 3GRRA 4GMQA 3FTCA 3RGPA 4X65M 4FD2A 3Q8XA 4NOOB 3W0FA 3GO8A 2KJ5A 4LGMA 1HR0M 4JXJA 4LZJA 3J7AS 2YNMD 4LF7M 1QAMA 1QYRA 3R9XB 4FWDA 2R4JA 2JH1A 1JR3A 2H1RA 4LG2A 2L7IA 4OJPA 3UZUA 5FTJA 3FTFA 1Q3CA 2DWNA 4BB9A 2XZUA 2MRLA 3DFZA 1IBMM 4LF5M 5ITRA 1SXJA 1ORYB 2JA2A 2LWXA 2X49A 2QENA 3L27A 1HEKA 2OM6A 3RF9A 1K3WA 3T79A 1I4WA 4IIWA 2DF4B 4AZFA 2ZM6M 1HNZM 3KVWA 2CE7A 2KVCA 2WAQC 4B7GA 5KL8B 2EA0A 2ZIUB 3NUQA 3SFZA 4FE3A 3PSPA 2E1FA 4FCVA 2RGOA 3R8FA 2ZAMA 3MHVC 4LJ8A 4DR2M 4P0QB 1PJJA 4QJFB 2RKOA 4P0PB 2HMXA 3ZCBB 3A98B 3NWLA 3FD9A 3TWKA 4JI8M 3UGJA 4DV3M 2DXIA 2DWZB 4Z8XA 4G4RA 3DA1A 2QBYB 1SZHA 2M0NA 4JI2M 2YB4A 4GKKM 1W5SA 1L8QA 2BJWA 5ITXA 3AL0C 1TGUA 1FNNA 1R2ZA 5DYIA 7CATA 1OJLA 4D80A 5FTLA 1IBKM 4KO8A 4M9SA 3GQ3A 3FKEA 4W5WA 3TL4X 2LKYA 3J80S 2LYBA 4QNRA 2YX8A 4BUGA 2GH1A 4AYBC 3F5EA 3HWSA 3J2PB 3E4RA 4DUYM 1OFIA 5C18A 4NLBA 1R7RA 1TH3A 3PFIA 4G6ZA 4KLNA 2LH0A 3D8BA 4OX9M 5IT9S 2Z4SA 2G09A 2XIDA 2ZIVB 3SMVA 2FOIC 2JH7A 4IBGA 3H0RB 4JI3M 4L15A 3K8ZA 5DYGA 3SHGB 2CN1A 4C0ZA 3T15A 4NXNM 1IY1A 5EXTA 3ILKA 5HR7A 2R45A 3MGVA 2BNKA 3LQQA 2PMZF 3CF6E 2XSZD 2VQFM 5FSWA 4CGYB 3U6LA 5EJCA 1D2NA 1HQCA 5A2QS 4MGKE 1P7DA 2XSZA 4QHTA 2ZXIA 3UK6A 4M9XA 2HBKA 3HKZC 4FWHA 3HU2A 2ZIUA 3GPPA 2KW0A 2CHVA 4I5SA 1MX0A 4OW0A 3D2NA 2XF3A 5JI3E 4BJQA 1KYIA 4LJ6A 2ZIXB 1G59A 2D6FC 4AI6A 1XNQM 2HOIA 3M6KA 2UXCM 1Q3UA 3SYKA 1CRXA 3J81S 1TDHA 1IBLM 4CGZA 3PZPA 3IP4B 2EUCA 3U61A 1XNRM 3HJ8A 1X37A 2L09A 1L1ZA 1NSFA 3FYCA 4IBDA 2W04A 3K2LA 1Z5AA 2H3VA 3TPZA 2D7EA 3AV0A 3GLHA 3GRUA 4K0KM 2UU9M 2XI9A 2HCBA 5KQ8A 1DGHB 1OFHA 1XC8A 3QWLA 5ITXE 2JMGA 4YHHM 2FE8A 2FNAA 5KL1B 4HL4A 2K4EA 3JR4A 2OQ4A 4BX9C 5EXPA 5EP4A 4B08A 4CDGA 5E26A 1PJIA 5HR6A 4GFJA 3C29A 3U6DA 3T38A 4LF4M 2Y0SC 3TWLA 3VKGA 3GPYA 4JI0M 4R3DA 2XVTA 4OU7A 4DV7M 2I7PA 3RFWA 4OJLA 2KXEA 5FTMA 4DR3M 4R7GA 3GQ5A 3C58A 2F8LA 3J7BA 3J27B 2HKJA 3KOXE 5IREB 2K4IA 2XH9A 1VDDA 3L28A 4Z6YA 3U6PA 3O0FA 3L29A 1YSYA 4B3RM 1L2CA 3CYMA 1DRGA 2WB1C 3UJNA 1E9SA 1QAQA 3GP1A 1SXJE 4JI7M 3JAMS 4I8OA 3GPXA 1K82A 2YQZA 2KV2A 2ZIXA 2CFOA 2DZOB 3AL0B 3M0EA 2HBJA 1E9RA 4CHTB 3A42A 1TH2A 4B7FA 4KMOB 2ZAOA 1T3TA 2HBLA 4AQYM 3AOEC 2HOQA 2L6OA 3FTEA 3PNYA 3U6EA 1QVRA 4DV0M 4LF6M 3ZC7B 2H3ZA 3ZH9B 2FFJA 1DGBA 4LCBA 3D2QA 3SHFA 2V1UA 4FZMA 3F2BA 4DV2M 2OPFA 4CRXA 1N77A 2VJ4A 2K47A 4P0PA 5EXSA 4MB7A 2KA6B 1NY5A 4AYBF 5E6JA 4D82A 3A46A 3LVVA 4NRVA 1URJA 4FVMA 4PT5A 4NV0A 1ZQ1C 3MK6A 1TH4A 4GIPA 1D8BA 3GLFA 1IY2A 4B3MM 4IBCA 4IJEA 3L2AA 2G0AA 5T14A 2Y21A 5EQTA 4B3SM 2RP5A 2XLJA 2R18A 2WAQF 3GU3A 1NNUC 1SXJB 4LY6A 2KJ9A 2D7GA 1YE9A 2I7NA 1UPHA 4QHSA 3KW6A 3HHZA 2RHFA 4PCZA 3GLIB 3SARA 2H3IA 2V6ZM 1TDZA 4YY3M 1NY6A 2F77X 4U7CA 3KP1E 2K8CB 1QAOA 2VIIA 4IBIA 2KKPA 4ACOA 1NVMA 3VFDA 4P0QA 2KIWA 4M0WA 3SAFA 2P5TA 4LJAA 2G06A 5CRXA 4JYAM 2G08A 4G4NA 3SAHA 3B9PA 5LMNM 1SXJC 3KXEC 1E94E 2N1RA 2KRUA 2G5GX 3KSXA 1GL6A 2G07A 2LNHC 2J7NA 4KX3A 4ITQA 4IC9A 3F2CA 3U60B 5GKNA 4DR5M 2HHHM 4JV5M 4S12A 3H0MB 2HBMA 1KBUA 3I51A 4OJ6A 4MGIE 3VDUA 1L6NA 5KO3A 2F4VM 2Z4RA 3AOGA 1W5TA 2F5OA 4KX5A 2GOLA 2LBOA 1TAMA 2CV0A 3N7SC 1ED1A 4FW9A 4NSOB 4DV4M 5C0YA 2KJ8A 1JR3D 4ZPXA 4LJ7A 3SMSA 1DO0A 4XBOA 4PD2A 2CUZA 4GITA 2QCUA 4LJ4A 3L25A 3ALRA 3KOYE 3RFAA 4G4OA 1IQPA 4LF9M 1N33M 4OVZB 2V1CA 4ICAA 1GKIA 4BBAA 3KSJA 3PSTA 3T1HM 5ITQA 3HKZF 4B3TM 2RGHA 3GLIA 1DGHA 1XMOM 1J7KA 4LJ9A 2VQEM 1ZAEA 2DWMA 1DO2A 3FYDA 2KNJA 4IBEA 3K1ZA 1N32M 1N75A 1G4AE 4RF1A 1HNWM 3F5AA 4L16A 4JN6A 3TWMA 3AQFA 1N78A 1KSFX 2Z7JA 1XHBA 2C99A 5ITUA 3AJIB 3CTWB 4IBFA 4X64M 3SAVA 4QNLA 1IN5A 2F5QA 3M7DA 1C1KA 3AFHA 3VC8A 4NRWA 3FUWA 3KDSE 2XICA 1HT1E 1QZMA 5LMUM 1NHWC 1T94A 2E1EA 2F5PA 4FCTA 5EP3A 4U6PA 2XFSA 1ECWA 3C28A 3BOSA 2C9CA 1IXRC 1N36M 2Y0SF 3CF2A 4FWGA 2QBYA 1WUDA 1PVQA 2M5ZA 3GZFA 4NWIA 3AKZA 4DR7M 2OXOA 4L78A 4GHAA 5EP2A 3HKPA 2ZBKB 2DWLA 3LYSA 4LFAM 4DV5M 3QAUA 3M7GA 3GRVA 4OJ5A 4L8RC 1XO0A 2JGAA 3W0LB 2MA1A 3N7PD 3U5ZB 2XFTA 1L2BA 1WXQA 2C9OA 4GH9A 3IG5A 4JI1M 3FUXA 1NHGC 3FUTA 2C98A 4WJ3B 4P16A 4DR6M 4A8EA 2UUAM 1LV7A 2F2AB 4DV1M 3U60A 2QP9X 1XXHB 1XWIA 4GRIA 4M9ZA 1Z5BA 3U6MA 2CHGA 2D7HA 4RF0A 2K4HA 2LYAA 3MJ5A 4NXMM 2VIXA 2J7OA 3CF0A 3GLGB 3PVSA 2KHVA 2CPRA 1F44A 3D2SA 1Z19A 2RRDA 4IBKA 3HU1A 2ZANA 3E0FA 4IBBA 1HQYE 1IN6A 3DOAA 3E9SA 1IN4A 2NV3A 3U6OA 2H3FA 1G8PA 3RGSA 2PMZC 1L1TA 3HU3A 2E5LM 3AQEA 3PSIA 3HHXA 4M0DA 4AKIA 1NJFA 1PM5A 1Z6TA 4OVZA 3SASA 4RNAA 4GHLA 1IXZA 1Q3BA 5BR8M 2UXDM 1K3XA 5KPZA 5ITTA 4FZLA 3L3FX 3I4VA 1HIWA 2ZIVA 3LVWA 2Q4TA 3ONNA 2A3VA 3K92A 4PDIA 3K1JA 2Z3XA 3KFUG 4FCWA 2QZ4A 4D81A 3FTDA 1Z5CA 4LZZA 3L26A 3SAGA 2KOBA 3NBIA 2UUCM 4KODA 4QIWC 3F2DA 2CHQA 1HT2E 4JI4M 4DR4M 2UXBM 4AG6A 4NSRA 1E32A 3RE8A 3TQSA 1KFVA 4TUWA 5DNYA 4I81A 2KKVA 2H3QA 3HGIA 3I4YA 3M6AA 3VLFB 3H4MA 3M6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7J A;  2R18 A; 
#chains in the Genus database with same CATH topology
 3E46 A;  8ICB A;  4LRS A;  2ASD A;  4MGH A;  2FPM A;  2DGZ A;  2ZTC A;  2DVW B;  4UB5 A;  1N5X A;  4F72 A;  2XY5 A;  1DK2 A;  2A1J B;  2YMM A;  3RH6 A;  3LMM A;  3THV A;  4QOZ C;  3PO4 A;  2R62 A;  4F4K A;  4RNO A;  4AKH A;  5KFF A;  2YFQ A;  2F5N A;  2ZUC A;  4NLK A;  1SV0 C;  3QYB A;  4CF3 A;  4P4M A;  5J0U A;  2C96 A;  1DGF A;  3VK7 A;  5F3W A;  1QQ7 A;  1L3S A;  2KP7 A;  3C1Y A;  4PHE A;  3Q8Q B;  2G5I B;  1B22 A;  4ECY A;  4QZE A;  3VDP A;  5J2B A;  2QB0 A;  2K89 A;  5AK3 A;  4EBD A;  1KN5 A;  4AG5 A;  1ZQU A;  2BJV A;  5FP0 A;  3WK9 A;  2VKQ A;  5KFE A;  4IQU A;  2UVU A;  2W7O A;  2LM4 A;  3KHR A;  1B4F A;  5KPR A;  2JHD A;  4NLZ A;  3AN1 A;  4DSK A;  1WCN A;  4PL1 A;  3UMM A;  1DGJ A;  1SXJ D;  2JXN A;  3AU6 A;  5AI8 A;  1IIP A;  5EOZ A;  2DKZ A;  1ZQD A;  3RB6 A;  5AK4 A;  3SD7 A;  2AGO A;  4LFC M;  3T5H A;  4HLQ A;  3GLF B;  1ZET A;  3SAU A;  1Q39 A;  1LVH A;  2HHU A;  4YMN A;  1YUB A;  3T5K A;  5J0W A;  2W8K A;  4IJF A;  5IWA M;  4Y2U A;  4QOS A;  4J9P A;  5J2E A;  2G5H B;  1ZQJ A;  4DR1 M;  5AKL A;  1TVA A;  3PSF A;  5CWR A;  7ICR A;  3HJS A;  4BGD A;  5KFQ A;  1DXS A;  3BS7 A;  5JI2 E;  4QNM A;  2HL7 A;  9ICI A;  5KFV A;  3IV6 A;  4PL2 A;  4DOC A;  5EP1 A;  4KHP M;  1ZD5 A;  1WG8 A;  1SXE A;  3VK8 A;  3RR7 A;  1D0K A;  1GO3 F;  2ODG A;  2ZIW A;  2I6X A;  2R65 A;  2F5S A;  5H2F U;  1IY0 A;  2LHC A;  3RJE A;  1OAI A;  2ZG6 A;  9ICK A;  2FI1 A;  5EXX A;  2FMP A;  2FPL A;  3RH4 A;  2BWE A;  1NNJ A;  3VKH A;  2BGW A;  4P17 A;  4I29 A;  2DQN B;  4KLD A;  3AUO A;  3V6J A;  2WZJ A;  1S3S A;  3T1Y M;  4EZ9 A;  4LVS A;  3DEE A;  4C8L A;  4LRT A;  1QSS A;  3SMP A;  3A0B U;  5J2H A;  3RRG A;  5B66 U;  4IBJ A;  3F53 A;  4LZD A;  2HWJ A;  1A0P A;  2QPA A;  3GLG A;  2I5H A;  3GRR A;  3RGP A;  4O3O A;  1KW4 A;  4IR9 A;  5KFU A;  2ZTE A;  1F5S A;  5DG9 A;  4C4S A;  3B7Q A;  3W0F A;  2BCU A;  2KJ5 A;  5KFJ A;  4RQ7 A;  4FWD A;  4ECT A;  5JTI A;  7ICH A;  2MRL A;  1Q3C A;  2PKE A;  3ZDB A;  8ICU A;  1D8Y A;  1SXJ A;  2KMD A;  2OM6 A;  3B0Y A;  5KFB A;  1NK5 A;  3QXG A;  1HNZ M;  3H8M A;  3KVW A;  2CE7 A;  4P4O A;  5KFN A;  2EA0 A;  3NUQ A;  3SFZ A;  5KFM A;  5AI0 A;  2V4R A;  1NK9 A;  2I1Q A;  2E1F A;  4FCV A;  4P0Q B;  4QJF B;  1NO1 A;  3HIL A;  9ICN A;  3ZCB B;  7ICP A;  3A98 B;  5ALP A;  1V85 A;  3UGJ A;  2DXI A;  3H4J A;  2M0N A;  2YB4 A;  4QZC A;  1K1Q A;  4Z6D A;  2B6G A;  1L8Q A;  1PUZ A;  3AL0 C;  4F5Q A;  1R2Z A;  3Q8L A;  7CAT A;  1OJL A;  2FH0 A;  4D80 A;  1PJT A;  3OHB A;  4DBG B;  2LKY A;  2LYB A;  2HW3 A;  8ICT A;  4AYB C;  3F5E A;  1SG9 A;  5C18 A;  3PX6 A;  2J6U A;  1R7R A;  3PFI A;  4G6Z A;  5IT9 S;  2ZIV B;  2Z4S A;  1ZQL A;  2JY6 B;  3SMV A;  4IBG A;  1OIP A;  3K8Z A;  4EEY A;  4C7Y A;  4NXN M;  4R71 A;  5HR7 A;  3ILK A;  3M1Y A;  3W67 A;  3UMB A;  3A0H U;  1YLA A;  2L4E A;  1D9D A;  2VQF M;  1D2N A;  1HQC A;  2FS1 A;  4MGK E;  2EZZ A;  4QHT A;  5EWG A;  1P7D A;  4DL5 A;  1SWW A;  3RJJ A;  4M9X A;  4ED0 A;  3HU2 A;  2CHV A;  2XF3 A;  5JI3 E;  2ZIX B;  1G59 A;  2D6F C;  1NJY A;  1WWV A;  3ETR A;  3KD3 A;  3OGU A;  1L3U A;  1WIV A;  4I2C A;  3SYK A;  2BQ3 A;  1DOQ A;  2UVR A;  1RDF A;  7ICG A;  2L09 A;  4M9N A;  1NSF A;  1ZRM A;  3ISC A;  4KLL A;  3KHH A;  3LK9 A;  4UB6 U;  1RYU A;  3GLH A;  1JXE A;  4F92 B;  1OFH A;  2OCE A;  1KLN A;  4RUC A;  3B0X A;  1ZQK A;  1PJI A;  5AKH A;  3U6D A;  3T38 A;  4LF4 M;  2Y0S C;  2R8I A;  4RT3 A;  4OU7 A;  4DV7 M;  3B89 A;  2JNH A;  4DSE A;  4KLJ A;  1RZT A;  3J7B A;  1WGN A;  2HKJ A;  2LVQ D;  4M6W A;  4Z6Y A;  2EDU A;  8ICX A;  4Q7J A;  4B3R M;  5HP4 A;  3PO5 A;  2DKL A;  1QAQ A;  1SXJ E;  2VF8 A;  1K82 A;  3Q8P B;  4KLT A;  3AL0 B;  1QDT A;  1E9R A;  2HBJ A;  4O5C A;  1TH2 A;  4B7F A;  5TZV A;  2PI5 A;  2W9B A;  3NVY A;  1KFS A;  4B9L A;  1G71 A;  2HOQ A;  3V7K A;  3U6E A;  3V7L A;  1VLB A;  3ZC7 B;  2FFJ A;  4LCB A;  1OAO C;  1TFR A;  4ELV A;  3M9O B;  2R8J A;  3BQ0 A;  3L4P A;  2BCS A;  4P0P A;  4EBE A;  3JPT A;  4MB7 A;  5L1M A;  2KA6 B;  1NY5 A;  2XCA A;  3EW9 A;  3BQ2 A;  1QUT A;  5AKE A;  1KRP A;  9ICF A;  1TH4 A;  1D8B A;  3GLF A;  4F3O A;  8ICL A;  4AP9 A;  1VDL A;  4E0D A;  2EKF A;  5T14 A;  1GO5 A;  2RP5 A;  2WAQ F;  3TAD A;  4LY6 A;  4M9G A;  9ICV A;  2RHF A;  1YE9 A;  4JV1 A;  4PCZ A;  2K60 A;  5EWF A;  4R8U A;  3SAR A;  4YY3 M;  2F77 X;  3QYP A;  4F91 B;  4PHD A;  2G06 A;  4UAV A;  4KLO A;  4F5P A;  2BHN A;  1L5U A;  1PRB A;  3B9P A;  1GL6 A;  1IXR A;  4K4H A;  2RLT A;  5ALL A;  4ITQ A;  3EUB 2;  4KLS A;  3E21 A;  3F2C A;  1NKE A;  4YQW A;  4S12 A;  5IIN A;  3I51 A;  4OJ6 A;  4B9U A;  3JPS A;  5KO3 A;  2F4V M;  4C7Z A;  3PNC A;  2F5O A;  1NK7 A;  3LDA A;  1TAM A;  2CV0 A;  3N7S C;  4RQ4 A;  4TUS A;  1ZQT A;  1JR3 D;  1JIH A;  3QEB Z;  2OWO A;  3SMS A;  3LCV B;  2IBK A;  3EPG A;  1X2I A;  4Y2S A;  2W3S A;  2QCU A;  4LJ4 A;  3KHG A;  1T8E A;  8ICW A;  4LF9 M;  2MH8 A;  1N33 M;  4Y2Y A;  5KT5 A;  4ED6 A;  2V1C A;  1GKI A;  3C2K A;  2C2R A;  3S6J A;  3SV4 A;  3HKZ F;  9ICM A;  2OO9 A;  3SV3 A;  2BPF A;  3PY8 A;  2BCV A;  1TV9 A;  2FLL A;  3MBY A;  2LYH A;  4TUP A;  1Q46 A;  4EYI B;  3TFR A;  2CXY A;  7ICM A;  1WHC A;  4I2I A;  1KQQ A;  4EBC A;  1XHB A;  2JZB A;  3AJI B;  3CTW B;  5KT3 A;  1L3V A;  3V72 A;  2B3T A;  2HHW A;  2J6S A;  3HZJ A;  1FO4 A;  2XIC A;  1ZQZ A;  5LMU M;  4DFK A;  2F5P A;  4FCT A;  5EP3 A;  8ICN A;  4KLF A;  2KVS A;  9ICS A;  5D46 A;  1XC9 A;  3BOS A;  3WK6 A;  2QBY A;  1ZQR A;  2M5Z A;  1Z00 B;  1J2M A;  3FRH A;  3Q8S B;  4YFK A;  5DB8 A;  1ZD3 A;  4GHA A;  9ICA A;  1O03 A;  2DWL A;  5KG2 A;  4LFA M;  4F50 A;  4L8R C;  3TAQ A;  2W54 A;  1XO0 A;  2XFT A;  2C9O A;  1UT5 A;  2IHN A;  2NRW A;  3FUX A;  1B0X A;  2JY5 A;  1JAL A;  1MJG M;  2ALZ A;  2K0B X;  4A8E A;  3KTQ A;  2UUA M;  1QCK A;  2F2A B;  3PVX A;  4M47 A;  3U60 A;  2WSF F;  3M8R A;  4KN4 A;  4NY8 A;  2K4H A;  2R8K A;  3FC4 A;  4TUQ A;  1O08 A;  9ICL A;  3TAP A;  2EZY A;  4KT0 F;  1ARO P;  5J0Q A;  1HUZ A;  3E0F A;  4IBB A;  1HQY E;  4P4P A;  2FLP A;  2I9G A;  3ZDA A;  1L7P A;  3U6O A;  3MFH A;  2PMZ C;  4RPZ A;  3AQE A;  3K4G A;  5EE3 A;  4AKI A;  4Z6F A;  4RT2 A;  1IXZ A;  2IOF K;  1K3X A;  3GDX A;  1ZQG A;  2P6R A;  5K4L A;  4QZB A;  1JX4 A;  2ZIV A;  1B43 A;  1ZQC A;  2BCR A;  4QW9 A;  2HI0 A;  4PDI A;  4FCW A;  2LPE A;  4D81 A;  1Z5C A;  2E8M A;  2HVH A;  1KFD A;  1ZD2 P;  1OKS A;  5HHI A;  2KOB A;  3NBI A;  4DCC A;  1S0O A;  2KSO B;  4DQQ A;  2AQ0 A;  2KZZ A;  1IV8 A;  2Y9U A;  2VA3 A;  2DWQ A;  3TQS A;  3OSN A;  2NRX A;  5DNY A;  3TQ1 A;  4I81 A;  2EKK A;  5KFT A;  1ZQQ A;  3G6X A;  3B7Z A;  3GLG E;  4OCZ A;  4BLC A;  4EIW A;  4DSJ A;  1D0L A;  1IXS B;  5EWE A;  2E3T A;  2AH5 A;  4DSI A;  4DL2 A;  3PXG A;  1ZJN A;  3HWT A;  3GQ4 A;  2W9C A;  2R46 A;  2LI6 A;  2DI0 A;  4JI6 M;  5FTN A;  5KFI A;  3H8W A;  3WHL A;  2BDU A;  4OO1 J;  1N61 A;  1IM2 A;  2K4P A;  4PDG A;  2ERC A;  1EE8 A;  1XO1 A;  2AGQ A;  2R8G A;  2FMQ A;  2WF7 A;  5H37 D;  3H4B A;  3ETL A;  1QQ6 A;  4BWJ A;  2UVV A;  1R6B X;  3ZD9 A;  4DF8 A;  8ICR A;  4KLU A;  3GV7 B;  4GKJ M;  3U6C A;  2EH9 A;  3RH5 A;  1XB2 B;  1KKX A;  3KS4 A;  2OYY A;  3PMN A;  1N34 M;  5DQH A;  3SC3 A;  1KTQ A;  2UUB M;  1G3I A;  2NO5 A;  3JPR A;  5L1K A;  4G4Q A;  3SYL A;  2NQ8 C;  4DL4 A;  4M9J A;  1A5T A;  2CEA A;  2KZU A;  4M6W B;  1Q02 A;  5AM3 A;  3DV9 A;  1RXW A;  1BVS A;  4RQ2 A;  4QZA A;  3G6Y A;  7ICS A;  4WW0 A;  3IG8 A;  3LCU A;  1FJG M;  4USA A;  4J9R A;  1X9W A;  2N35 A;  3U6Q A;  4QWC A;  5KG1 A;  4YXM A;  2ZIW B;  9ICU A;  1JQJ C;  2KEB A;  3RAQ A;  8ICF A;  2BQU A;  2LHT A;  2HHT A;  3NS1 A;  2LXE A;  3HJQ A;  1AUA A;  2KZ3 A;  3KHL A;  4AW4 A;  1LKY A;  1PVP A;  3I01 M;  1L2D A;  4CIZ A;  9ICE A;  1MA7 A;  3AOE A;  5ITY A;  5D49 A;  4X5V A;  2Y0Q A;  2KZS A;  4WUR A;  4REZ A;  1I94 M;  5DGA A;  4O3P A;  3KKA C;  3WHK A;  4I4L A;  1COK A;  1V92 A;  1XNS A;  4II7 A;  5KPT A;  2KNV A;  3TAN A;  4G9B A;  1AQ6 A;  1RQL A;  2RRU A;  1SL2 A;  4GC9 A;  1R2Y A;  2XGQ A;  2HHS A;  3KOW E;  3C3D A;  3KFU F;  3J81 j;  2Y1I A;  3EIH A;  2XGN A;  5L1L A;  2X4A A;  5CB1 A;  1ZXI A;  5DGB A;  3Q8X A;  4NOO B;  3GO8 A;  4M9L A;  4JXJ A;  3R9X B;  1PGY A;  1U49 A;  3ISD A;  2R4J A;  2JH1 A;  4LG2 A;  9ICR A;  2XZU A;  3DFZ A;  5DKW A;  2AGP A;  1IBM M;  2QQ8 A;  1HEK A;  2B21 A;  2QEN A;  3T79 A;  2DNA A;  2DF4 B;  4IIW A;  4AZF A;  2DZL A;  4Y2T A;  5KG6 A;  4JV2 A;  5KL8 B;  1L7M A;  1OW5 A;  5DQI A;  1SIJ A;  2ZAM A;  2QAR A;  3JPQ A;  4DR2 M;  1PJJ A;  3BBZ A;  2NYV A;  4GC7 A;  2HMX A;  4MF8 A;  4HYK A;  3EWA A;  3MGH A;  2QBY B;  4G4R A;  3DA1 A;  4GKK M;  1W5S A;  1L7O A;  4YP3 A;  8ICP A;  5ITX A;  3EZ5 A;  5J0Y A;  4QZG A;  5FTL A;  4M9S A;  3HPO A;  3GQ3 A;  3FKE A;  2KN7 A;  3C9P A;  3TL4 X;  3J80 S;  3J2P B;  4Q8E A;  1OFI A;  4C8M A;  2VA8 A;  2XID A;  4BWM A;  5DFL A;  4UAR A;  3HX0 A;  4IRD A;  3T15 A;  1IY1 A;  5KFA A;  4UAY A;  4Y2P A;  3FYH A;  1NV8 A;  3Q8G A;  4DS4 A;  4CGY B;  5A2Q S;  4B6J A;  2XSZ A;  4CNQ A;  2ZXI A;  1JRP A;  4QWB A;  3UK6 A;  2HBK A;  4F5O A;  4B9V A;  4FWH A;  4K4G A;  3GPP A;  2KW0 A;  4OW0 A;  3W68 A;  2L5Y A;  4DWI A;  1KYI A;  1RQN A;  4FS1 A;  4AI6 A;  5AM0 A;  1RU3 A;  1RYR A;  4JUZ A;  2ZUD A;  2JP7 A;  2ZJ8 A;  4QZI A;  2UXC M;  1RM6 C;  1CRX A;  2JY7 A;  3J81 S;  1WGL A;  2BPC A;  3RJG A;  3NRZ A;  2KK0 A;  3PZP A;  3IP4 B;  4KLH A;  1XNR M;  1QZE A;  3HJ8 A;  1X37 A;  1L1Z A;  4YXJ A;  3FYC A;  7ICI A;  3C3E A;  1SB3 C;  3K2L A;  2D7E A;  2CWB A;  4Z6C A;  2XI9 A;  2HCB A;  5ALV A;  1XC8 A;  5CR0 A;  4XK8 F;  4YHH M;  3OHA A;  3PV8 A;  1ZD4 A;  2K4E A;  4CDG A;  4EX7 A;  5KT4 A;  4Y28 F;  4BXO A;  4I2J A;  2L4F A;  4NL9 C;  2DUY A;  4JI0 M;  4R3D A;  1C20 A;  2I7P A;  2DAM A;  2KXE A;  5KFC A;  5BOL A;  2ASL A;  3GQ5 A;  1X6I A;  2BPG A;  2F1J A;  2K4I A;  2XH9 A;  2YMQ A;  2W3R A;  1VDD A;  3I04 M;  3NGD A;  4R8U B;  3O0F A;  1SL0 A;  4M0A A;  4RQ3 A;  3CYM A;  1VQ1 A;  3RB0 A;  2WB1 C;  1E9S A;  3JAM S;  4I8O A;  2KV2 A;  7ICT A;  2YQZ A;  2C2D A;  1S0V A;  2PXI A;  3ZDC A;  1FFU A;  1RPL A;  1BPE A;  3AM9 A;  1T3T A;  5IIO A;  4KLI A;  2K6B A;  1QSL A;  4DF4 A;  1QVR A;  4DV0 M;  2YML A;  2H3Z A;  5AM2 A;  1OIZ A;  2QSF X;  4FZM A;  5J2A A;  4CRX A;  4JWM A;  3WKB A;  1ZQW A;  2VJ4 A;  4ECR A;  1ZQB A;  5EXS A;  2JEJ A;  4C4T A;  4IQW A;  1NOM A;  2HCF A;  4DS5 A;  9ICB A;  4D82 A;  7ICQ A;  4DFP A;  3A46 A;  3LVV A;  4RQ1 A;  4NV0 A;  4G3I A;  2WF5 A;  4GIP A;  5ALN A;  2G0A A;  3GV5 B;  2OEH A;  5EQT A;  2R18 A;  3GU3 A;  1QDR A;  4OD0 A;  4YD2 A;  1T3Q A;  1RXV A;  5IIL A;  1ZV1 A;  3N4M B;  3RJF A;  2I7N A;  3RRH A;  8ICI A;  1U48 A;  4UAZ A;  2JZ1 A;  1NY6 A;  2BKE A;  4EEL A;  4ACO A;  2PFQ A;  2KIW A;  4M0W A;  1WCL A;  4NL9 A;  2G08 A;  2W9B B;  4MFA A;  4ECX A;  2ASJ A;  4UB3 A;  3H40 A;  2DAK A;  4M9H A;  1SXJ C;  3NVZ A;  4IL6 U;  3KSX A;  2G07 A;  3RJK A;  2J7N A;  1N2X A;  4RNM A;  4UAW A;  2R8H A;  2OOA A;  4KX5 A;  2LBO A;  4I2A A;  4RU9 A;  1U4B A;  1ED1 A;  4FW9 A;  5C0Y A;  3WKC A;  2D3D A;  4LJ7 A;  1DO0 A;  5AIB A;  1K1S A;  3HW8 A;  4KTQ A;  4UB2 A;  3IHQ B;  8ICC A;  3RFA A;  4KLE A;  2F44 A;  1KDH A;  3K1R B;  4BBA A;  4YR0 A;  5ITQ A;  4B3T M;  2MSN A;  2PFO A;  4QZD A;  1LKY B;  2ZJA A;  1ZQE A;  1XMO M;  3UQ0 A;  2VQE M;  3K75 D;  2DWM A;  1DO2 A;  1L7N A;  3PW2 A;  3DDH A;  4IS7 A;  1QTM A;  1G4A E;  5DQG A;  4I28 A;  3F5A A;  4L16 A;  3I28 A;  4Q43 A;  3K9P A;  1NK0 A;  3AU2 A;  1MN3 A;  1XS9 D;  1OTR A;  4QNL A;  4QW8 A;  5CP2 A;  4J9K A;  2HVI A;  4BDP A;  3RJH A;  2KE7 A;  3M7D A;  4DEZ A;  4QZ9 A;  1ZQN A;  2LHG A;  3AFH A;  2GWS A;  4ELT A;  8ICS A;  1ZRN A;  1PJS A;  1S76 D;  5ALS A;  4IRK A;  1JUD A;  1QZM A;  2JY8 A;  4EEK A;  2QAR B;  2XFS A;  4O3R A;  1ECW A;  4MF2 A;  1PVQ A;  4RZR A;  4NWI A;  2LVP C;  3AKZ A;  1ZQF A;  4P2H A;  3E58 A;  4J9L A;  5GTI U;  3HKP A;  2MAX A;  3LYS A;  4B9S A;  2DPJ A;  3ORY A;  5J2F A;  2HSZ A;  5F3X B;  2JGA A;  3W0L B;  5CEH A;  4UB8 U;  3U5Z B;  5L1J A;  5JU5 A;  3GIJ A;  1L2B A;  4J9M A;  1SGG A;  4GH9 A;  4Q8F A;  2NO4 A;  2J6T A;  4JI1 M;  3FUT A;  4Y2Q A;  1HUO A;  4DR6 M;  3RJI A;  5J2C A;  4DV1 M;  4DLG A;  2QP9 X;  3GLI E;  4MEY A;  3MR3 A;  1XXH B;  3M8S A;  4DQP A;  7ICF A;  9ICJ A;  1Z5B A;  2CHG A;  4NXM M;  1ZQI A;  3Q8R B;  3GIK A;  3CNH A;  1F44 A;  1NI3 A;  1Z19 A;  5CJ7 A;  5J0X A;  4IBK A;  5EE1 A;  3HU1 A;  4M2Y A;  5AKJ A;  1TR8 A;  2DAE A;  4TUR A;  3E9S A;  2NV3 A;  2H3F A;  4JB3 A;  1G8P A;  3UPQ A;  3RGS A;  1L1T A;  1NJX A;  1VJ5 A;  4M0D A;  1NJF A;  3IM1 A;  2UXD M;  4RNA A;  5BR8 M;  4FZL A;  9ICW A;  5KFL A;  8ICH A;  3WKA A;  2Q4T A;  2LVA A;  1M6Y A;  3K92 A;  3K1J A;  2E8P A;  3FTD A;  3ZDD A;  2FPK A;  3L26 A;  5JUM A;  4TQR A;  2FDR A;  1BPZ A;  5ALJ A;  1F0M A;  3TFS A;  1U45 A;  1S9F A;  5IIM A;  2UXB M;  4NSR A;  5J0P A;  1E32 A;  2W8L A;  2XY7 A;  2BWB A;  4NJ8 A;  1FFV A;  8ICJ A;  4C80 A;  2LTU A;  3HGI A;  3I4Y A;  3VLF B;  3H4M A;  2JRZ A;  4KLQ A;  2YR0 A;  4G3O A;  1X40 A;  3SEN A;  3H8S A;  5KFS A;  8CAT A;  3JPP A;  4O3M A;  4GC5 A;  2E8N A;  4NL4 H;  3GPU A;  5ALZ A;  4DOA A;  1J09 A;  2KRK A;  2F1I A;  1TF0 B;  2CV1 A;  3BZK A;  2ZUB A;  5J2K A;  4XGI A;  4MFC A;  4CCH A;  4UAT A;  2XO7 A;  4DQI A;  2OH2 A;  2UVW A;  2VDB B;  3U61 B;  3TAD C;  1ZQY A;  4UAU A;  5L8R F;  1Q3V A;  2EQY A;  1G41 A;  2BZF A;  1GLN A;  4DL6 A;  2BCQ A;  2A5Y B;  3JR5 A;  2DZN B;  2E5S A;  4MH0 E;  4KMU A;  1QAN A;  2M60 A;  3H0L B;  4LFB M;  1MQ2 A;  2EAO A;  3FUU A;  2W9C B;  2Q2E B;  3SR6 A;  2XZF A;  2H5X A;  2C28 A;  4F71 A;  5IZ7 D;  2Y20 A;  3HX3 A;  3KP0 E;  1OXJ A;  5HMM A;  1TAU A;  4A3V B;  5FTK A;  2LVO C;  5AI6 A;  4UB1 A;  2C5R A;  2CV2 A;  1Z3E B;  4UBC A;  1X6J A;  2MUT A;  3QUC A;  2K9D A;  3LQR A;  4B7H A;  3M9M B;  2V4Q A;  4DUZ M;  5DBA A;  1R4G A;  1GL7 A;  4CIS A;  4LGY A;  1Z4O A;  2B0C A;  2W9A A;  3HHW A;  4GXI A;  2CRX A;  5KFP A;  1IN8 A;  4AKG A;  4Y2X A;  2O5R A;  2AHM A;  1ZQA A;  2KD1 A;  2W03 A;  2RQ5 A;  3PW5 A;  3U5Z A;  2HOF A;  4MGZ E;  5FLX S;  4CF5 A;  2KHQ A;  1D9F A;  4Y2V A;  4RQ6 A;  1H38 A;  3V6H A;  4I2G A;  2MR9 A;  5KG0 A;  4X66 M;  3U6S A;  1S8O A;  1RG6 A;  3KZX A;  5AM1 A;  2Y0T A;  1NZB A;  4J9S A;  1Z1B A;  4MM3 B;  3ZQJ A;  3SBJ A;  4O5E A;  1PVR A;  7ICE A;  3TE6 A;  3CP8 A;  1SL1 A;  1H6U A;  4R65 A;  2ISP A;  2IHM A;  2DHR A;  3KOZ E;  3ZD8 A;  3SAT A;  2QB0 B;  4DSL A;  5J2J A;  5C1B A;  2YB1 A;  2WHE A;  3TAC B;  1MSW D;  2LBC A;  4KIT B;  3N28 A;  8ICY A;  5BPV A;  2P6U A;  5ALG A;  1UM8 A;  3H7I A;  5KFO A;  1S97 A;  4NXZ A;  2OHF A;  1MU5 A;  1UFZ A;  3TI0 A;  1V33 A;  3RB4 A;  1J5E M;  5ALU A;  2W43 A;  3QNM A;  2IMW P;  3T5L A;  3B74 A;  1IN7 A;  1ZQ9 A;  1V38 A;  3UMC A;  2W7P A;  3WKE A;  3BQ1 A;  3QU9 A;  4OJO A;  5AK6 A;  3KBB A;  2ISO A;  4JV0 A;  3EIE A;  5DB6 A;  3QU4 A;  4NLC A;  3BS5 B;  1OUQ A;  4GMQ A;  1Z00 A;  3T6P A;  3FTC A;  4X65 M;  1IFY A;  2MRO B;  2DPI A;  2KNZ A;  2YY6 A;  1HR0 M;  3J7A S;  4LZJ A;  4CJ6 A;  4QZH A;  2YNM D;  1D0M A;  2EZX A;  1QYR A;  3OJS A;  1T7P A;  3WU2 U;  5ALT A;  3C23 A;  2JV3 A;  4YCX A;  1JR3 A;  2H1R A;  2F3N A;  2L7I A;  4RQ5 A;  3UZU A;  5FTJ A;  2DWN A;  1GAB A;  2E8O A;  2MU2 A;  3SYZ A;  5DB9 A;  3QU7 A;  4LF5 M;  5ITR A;  2JA2 A;  3L27 A;  2LWX A;  4RPY A;  1I4W A;  1K5O A;  3UMG A;  2ZJ5 A;  3MR6 A;  2ZM6 M;  2A19 A;  4MFF A;  4ED8 A;  2KVC A;  2WAQ C;  4B7G A;  4F1I A;  2ZIU B;  2BDP A;  5GTH U;  1ZOL A;  4PGQ A;  2RGO A;  4LJ8 A;  2KDL A;  1U47 A;  2C2E A;  4P0P B;  2RKO A;  3T3F A;  3C2L A;  1TK8 A;  2JWS A;  5DDM A;  3NWL A;  3FD9 A;  3HT3 A;  4XRH A;  2DWZ B;  4JI2 M;  1X9S A;  5KG3 A;  4ECQ A;  2JXJ A;  1TGU A;  5DYI A;  5J0T A;  1DK3 A;  9ICO A;  1IBK M;  1BPB A;  1CEZ A;  4W5W A;  4QNR A;  2YX8 A;  2HDO A;  4BUG A;  2GH1 A;  4DUY M;  4PHA A;  3E4R A;  4ZOH C;  4DL3 A;  1TH3 A;  4KLN A;  4OX9 M;  3AEV A;  2LH0 A;  3D8B A;  5AKY A;  4I2H A;  2G09 A;  2FOI C;  1S5L U;  4MEX A;  3H0R B;  4JI3 M;  5DYG A;  3SHG B;  2EAM A;  1BPX A;  3PML A;  5EXT A;  4EZ6 A;  3NBX X;  2R45 A;  2BNK A;  1J97 A;  3CF6 E;  4RQN A;  5D4B A;  5FSW A;  5ALH A;  2WTF A;  3V7J A;  2R6F A;  3HKZ C;  2ZIU A;  8ICQ A;  3UXN A;  9ICX A;  4I5S A;  4BJQ A;  3ED5 A;  5BPC A;  4LJ6 A;  4J03 A;  2PFP A;  1N5W A;  5KFK A;  5AKG A;  3FAH A;  4HEO A;  2ES6 A;  1XNQ M;  1Q3U A;  4YR3 A;  1N60 A;  4WP2 A;  4CGZ A;  2EUC A;  3PX0 A;  2W04 A;  4DSF A;  4Q45 A;  3HJE A;  2AQ4 A;  3C5F A;  3AV0 A;  3NVW A;  1QUS A;  1MC8 A;  2Y1J A;  4K0K M;  5KQ8 A;  3I1Y A;  1DGH B;  4PZN A;  3RTV A;  2JMG A;  8ICO A;  2FE8 A;  2FNA A;  2PFN A;  5KL1 B;  4HL4 A;  1MQ3 A;  1BPD A;  2OQ4 A;  3BQT A;  4B08 A;  3BS5 A;  5AHX A;  3EPI A;  2MUT B;  3TWL A;  3VKG A;  1FIQ A;  1Z4N A;  1DGS A;  3RFW A;  5FTM A;  4DR3 M;  4F4X A;  5KFZ A;  3C58 A;  2F8L A;  5IRE B;  3KOX E;  4ECW A;  1ZQM A;  1ZJM A;  2MGW A;  3CW2 C;  3U6P A;  5EE9 A;  1YSY A;  1L2C A;  3PW7 A;  4C8O A;  1QH9 A;  1DRG A;  9ICC A;  4JI7 M;  2CP8 A;  3Q8M A;  3QUQ A;  3UM9 A;  5KT7 A;  2C22 A;  4I2B A;  2CFO A;  3KZI U;  1FEZ A;  4QWE A;  1RYS A;  4KMO B;  2ZAO A;  3BQ7 A;  3C1Z A;  2W9M A;  2HBL A;  3RB3 A;  3AOE C;  5E79 U;  2L6O A;  4F5N A;  3MAB A;  5AI5 A;  3KKA A;  4LF6 M;  2R0I A;  4GIB A;  3ZH9 B;  1TE2 A;  1DGB A;  4YD1 A;  5J29 A;  3SHF A;  2V1U A;  1KEJ A;  3NAS A;  4EEN A;  4DV2 M;  5J0O A;  4B9N A;  1GJT A;  1N77 A;  1C7Y A;  4RNN A;  2K47 A;  1XSN A;  3MC1 A;  3FE3 A;  1TTE A;  4YMM A;  1KFT A;  4KN7 A;  1URJ A;  4FVM A;  5KT6 A;  1SZP A;  1ZQ1 C;  5KFY A;  3LW5 F;  3MR2 A;  2EAP A;  1IY2 A;  2WSE F;  4B3M M;  4IJE A;  1V97 A;  4RQ0 A;  5L9X A;  1NNU C;  1SXJ B;  2D7G A;  1PK1 B;  3KW6 A;  3HHZ A;  4YMO A;  3GLI B;  1JB0 F;  2CRU A;  3QE9 Y;  3G6V A;  3AMZ A;  2AU0 A;  3C5G A;  2K8C B;  2VII A;  1KL9 A;  1NZP A;  2DBY A;  2KKP A;  5ALQ A;  3VFD A;  3PR4 A;  2VAN A;  3QZ7 A;  3WK8 A;  5ALI A;  5KTQ A;  3WK5 A;  9ICT A;  2P5T A;  4LJA A;  5DBC A;  3SAH A;  5AM4 A;  4RQ8 A;  3KXE C;  3OSP A;  2DAI A;  3IEC A;  2WSC F;  1SXD A;  2HHH M;  4JV5 M;  2FLN A;  3BJY A;  2HBM A;  1Q8K A;  1L6N A;  4MGI E;  3AOG A;  4DV4 M;  2KJ8 A;  3GFK B;  4QWD A;  2APL A;  3WK7 A;  2R44 A;  3V6K A;  4PD2 A;  3GLH E;  2CUZ A;  5KFR A;  4GIT A;  2M9N A;  5AIC A;  3L25 A;  3ALR A;  3KOY E;  1VEK A;  1IQP A;  4G4O A;  2NRZ A;  3SEI A;  5J2G A;  4ED1 A;  5KAI U;  3T1H M;  3GIL A;  2IA6 A;  4EX6 A;  2RGH A;  1XXH E;  4JWN A;  2KIV A;  4RUA A;  3GQC A;  5IIK A;  1ZYQ A;  3QZ8 A;  1ZAE A;  5ALE A;  2KNJ A;  4PHP A;  3K1Z A;  1N32 M;  3TWM A;  3AQF A;  1KSF X;  1L8L A;  1UA1 A;  2RDI A;  2FMS A;  2C99 A;  1JI7 A;  8ICE A;  4IBF A;  3SAV A;  2KTQ A;  5J2I A;  2F5Q A;  4JK1 A;  4ECU A;  2GLE A;  5KFG A;  1ZQV A;  3VC8 A;  4F5R A;  4I2F A;  2KFZ A;  3KDS E;  3QU2 A;  1JXL A;  1VDV A;  1HT1 E;  2E1E A;  3WKD A;  4DFD A;  4YN4 A;  2C9C A;  1L3T A;  4J9O A;  4DL7 A;  1IXR C;  1N36 M;  2Y0S F;  4RQM A;  4FWG A;  2QNJ A;  9ICG A;  1WUD A;  3GZF A;  4DR7 M;  4L78 A;  4QWA A;  2W55 A;  3FRI A;  5EP2 A;  2KFN A;  2ZBK B;  7ICU A;  3Q8K A;  2WF6 A;  3QAU A;  3M7G A;  4OJ5 A;  2IOF A;  4CE6 A;  2DAG A;  2P35 A;  3N7P D;  4PH5 A;  1X66 A;  4ECS A;  2VA2 A;  3B9J A;  1WXQ A;  4F4W A;  3IG5 A;  4KLM A;  5HNK A;  4GRI A;  4GC6 A;  3FM9 A;  2LYA A;  4ECZ A;  2D7H A;  4RF0 A;  3MJ5 A;  2VIX A;  2J7O A;  5L1I A;  2DEN A;  3GLG B;  4L6V 6;  5J8Y A;  4FS2 A;  2RRD A;  3H8J A;  3F92 A;  4ED2 A;  2PI4 A;  3DOA A;  1BNP A;  1IN4 A;  3HU3 A;  2E5L M;  3PSI A;  3HHX A;  4PJ0 U;  5J2D A;  5CHG A;  5KPZ A;  1SWV A;  7ICN A;  3L3F X;  4RPX A;  1XU4 A;  1N63 A;  1HIW A;  3LVW A;  2WF8 A;  4FBT A;  2Z3X A;  3KFU G;  4O5K A;  3MDC A;  1DV0 A;  1J2N A;  2JUJ A;  3C21 A;  1JN3 A;  2UUC M;  1S0M A;  4KOD A;  4MHV A;  3HP6 A;  2CHQ A;  1ZQS A;  4UAS A;  3UXP A;  2XC9 A;  3RE8 A;  2KKV A;  4O3N A;  4K4I A;  4IQT A;  5J0S A;  3M6A A;  3M6Z A;  3HHY A;  4B9M A;  4PPX A;  3E2E A;  3QUT A;  1XXH A;  3FUV A;  3SZ2 A;  1PZN A;  1R5L A;  4GXK A;  5KG7 A;  2F76 X;  3RBD A;  7ICK A;  2RDJ A;  4L4U A;  2XGP A;  1S10 A;  3EYZ A;  2R4E A;  8ICA A;  4LF8 M;  2ATL A;  3GRY A;  3RR8 A;  5DLF A;  4NLG A;  4JMU A;  1IM4 A;  4LJX A;  1Z59 A;  4F2R A;  5G5G A;  4DO9 A;  2L7H A;  2QB1 A;  5KFX A;  3BDP A;  1YT3 A;  3GLF E;  2K8B B;  1NJG A;  4YR2 A;  3OTO M;  3WK4 A;  5KQD A;  4C4R A;  5BOM A;  4IRC A;  5AKZ A;  4F4Y A;  5ALM A;  4BXO B;  3PNV A;  3OPX A;  3QX7 A;  1QSY A;  2W82 A;  3ICX A;  2KIC A;  3N7R C;  1TKD A;  1OQY A;  3A45 A;  5ALW A;  1HNX M;  3JPN A;  2XY6 A;  3BZC A;  1F4I A;  4UN2 B;  4DV6 M;  2EJS A;  3N97 B;  5AI4 A;  5DBB A;  5DG8 A;  4JI5 M;  4C8K A;  4J9Q A;  4ECV A;  3NRW A;  4X62 M;  5A0L A;  2EO2 A;  4PGX A;  1N62 A;  1T4G A;  1T3N A;  4O3S A;  5AKX A;  2HAK A;  4DFM A;  4PGY A;  2G8L A;  3SQI A;  2VJ5 A;  1QLN A;  4MGY E;  1QQ5 A;  3THG A;  2K8A A;  3LWM A;  3GV8 B;  2X8A A;  1XMQ M;  2NRV A;  1DGG A;  3CRX A;  3HRD D;  1WWU A;  4KLG A;  2KHH A;  3SAW A;  1GVN A;  2KEY A;  3SAF A;  4YVZ A;  1BPY A;  4IR1 A;  5KFD A;  3DZD A;  5DB7 A;  3KS8 A;  4Z6E A;  1NK4 A;  2JZB B;  3GLH B;  4O0I A;  4LJ5 A;  2J5Y A;  4US8 A;  2VF7 A;  2ZXH A;  2LM1 A;  2EAN A;  1NK8 A;  3UXO A;  2XEP A;  1COO A;  2WB1 F;  1SKW A;  1HJP A;  3D8L A;  4FZN A;  3VCB A;  4QIW F;  1A6S A;  1JRO A;  1QQW A;  4QZ8 A;  2DHY A;  2F8K A;  4FD2 A;  4R63 A;  2KZM A;  5B5E U;  3M9N B;  1SKR A;  4LGM A;  4LF7 M;  1QAM A;  1YZ7 A;  3L5K A;  1LB2 B;  2JZ0 A;  4OJP A;  3IDW A;  3FTF A;  4BB9 A;  1ZQH A;  1XSP A;  1X42 A;  1VG5 A;  1LV5 A;  1ORY B;  2X49 A;  3RF9 A;  2KG5 A;  1K3W A;  4LZG A;  1NNL A;  3I76 A;  2JEI A;  4I2D A;  2WFA A;  1NKB A;  3PR5 B;  4DOB A;  1PJQ A;  1TAQ A;  3PSP A;  4FE3 A;  5C5J A;  4XA5 A;  3R8F A;  3MHV C;  2WF9 A;  1MN8 A;  2KNA A;  1JR3 E;  4DQS A;  3PW4 A;  2LVN C;  3TWK A;  2AHO B;  4JI8 M;  2Y9T A;  1XWL A;  4R66 A;  4DV3 M;  1SZH A;  4Z8X A;  5ALK A;  5KG4 A;  5DLG A;  4UQG A;  2BR0 A;  1VEJ A;  2BJW A;  1FNN A;  1X9M A;  2DKX A;  4KO8 A;  1L8O A;  1UQV A;  5HHH A;  1TK5 A;  3RBE A;  3HWS A;  4NLB A;  1D8L A;  2QLT A;  5TIS U;  2O25 A;  5AKK A;  2JH7 A;  4C0Z A;  4L15 A;  2CN1 A;  1EFU B;  5AIA A;  4Y2R A;  3MGV A;  3LQQ A;  2PMZ F;  5III A;  3V76 A;  2XSZ D;  2ZTD A;  3U6L A;  5EJC A;  1UHU A;  2JEF A;  4NC6 A;  5KAF U;  1MX0 A;  1T6O A;  2JR5 A;  3D2N A;  3LWL A;  1P3Q Q;  4FBU A;  2YQE A;  3QUB A;  2HOI A;  3M6K A;  1TDH A;  2XCP A;  1IBL M;  2HHQ A;  3U61 A;  4IBD A;  1ZQO A;  4I27 A;  4R64 A;  1UCV A;  2H3V A;  1Z5A A;  2OOB A;  3NVV A;  3TPZ A;  4F93 B;  3GRU A;  7ICO A;  3QYE A;  4O9M A;  2UU9 M;  1ZMV A;  3QWL A;  5ITX E;  5ALO A;  3GIM A;  2HHX A;  1A77 A;  3JR4 A;  4BX9 C;  5EXP A;  5EP4 A;  4NM1 A;  1NV9 A;  5E26 A;  5HR6 A;  4GFJ A;  3C29 A;  3UQ2 A;  3QU5 A;  3GPY A;  2XVT A;  4OJL A;  3QEA Z;  2FJ6 A;  4YG2 A;  4R7G A;  3J27 B;  1KSP A;  5G5H A;  3BXW A;  3L28 A;  4RKU F;  3L29 A;  1X9X A;  4TQS A;  5AM5 A;  2JEG A;  3UJN A;  3GP1 A;  3GPX A;  5EE0 A;  2ZIX A;  2DZO B;  3MDA A;  3M0E A;  4CHT B;  3A42 A;  1A76 A;  1BNO A;  1Z1V A;  3ZI4 A;  2O6K A;  1N48 A;  5AI9 A;  2G3Q A;  4NLN A;  4AQY M;  2FE9 A;  1IXS A;  3FTE A;  3PNY A;  4PZO A;  3D2Q A;  1VEG A;  5KG5 A;  3F2B A;  2P66 A;  2GO7 A;  2YN4 A;  2OPF A;  3GII A;  3TKA A;  3FDS A;  4FFD A;  4AYB F;  3H4D A;  5E6J A;  4F4Z A;  3T5J A;  4NRV A;  5JRT A;  4B9T A;  2O01 F;  4PT5 A;  2KSO A;  3MK6 A;  2Z8Y M;  1BGX T;  4XQ8 A;  5IIJ A;  4IBC A;  3L2A A;  2Y21 A;  4B3S M;  4F8R A;  2ESE A;  2XLJ A;  5ALR A;  4GLX A;  2HHV A;  4Q44 A;  2KJ9 A;  2DFL A;  1UPH A;  4QHS A;  2LMR A;  2H3I A;  1ZMU A;  2V6Z M;  3B7N A;  1TDZ A;  1TK0 A;  4U7C A;  8ICK A;  2DL0 A;  1AIP C;  3KP1 E;  1QAO A;  2QHO B;  4IBI A;  4Y2J A;  1NVM A;  4P0Q A;  3PX4 A;  1JMS A;  1NJZ A;  1EIJ A;  5CRX A;  4JYA M;  4G4N A;  5LMN M;  4HAI A;  1EXN A;  2N1R A;  1E94 E;  2KRU A;  3HY5 A;  2G5G X;  1UA0 A;  2LNH C;  4ZH4 A;  4KX3 A;  3ISB A;  4IC9 A;  5AK5 A;  4XUS A;  3U60 B;  5GKN A;  4DR5 M;  3H0M B;  1KBU A;  2Q0Z X;  4DFJ A;  3MMP A;  3VDU A;  8ICG A;  2Z4R A;  1W5T A;  3OTQ A;  4C8N A;  2GOL A;  1WYG A;  1ZQX A;  4NSO B;  5F9N A;  4ZPX A;  4XBO A;  1CI4 A;  1SV4 A;  4GXJ A;  4US9 A;  5KFW A;  9ICQ A;  9ICH A;  4M04 A;  4OVZ B;  4ICA A;  1S77 D;  3KSJ A;  3PST A;  5KNI A;  3GLI A;  4UB4 A;  7ICJ A;  2MJ5 B;  1PK1 A;  1DGH A;  2NRT A;  1S0N A;  1J7K A;  4LJ9 A;  1WR1 B;  2F1H A;  2AJQ A;  4IQV A;  5KFH A;  3FYD A;  4O3Q A;  4IBE A;  1N75 A;  1V34 A;  3MGI A;  4RF1 A;  4DLE A;  1HNW M;  4JN6 A;  1N78 A;  3IHP A;  2Z7J A;  5ITU A;  4X64 M;  1IN5 A;  7ICL A;  1YZ6 A;  4ELU A;  1C1K A;  1NJW A;  4NRW A;  3FUW A;  3TAR A;  4ED3 A;  1T94 A;  1NHW C;  5J8Y C;  4U6P A;  1NKC A;  7ICV A;  8ICM A;  1IG6 A;  3C28 A;  3CF2 A;  9ICP A;  4CF4 A;  1XSL A;  3NTU A;  2L2D A;  3ZDE A;  4QZF A;  2OXO A;  5DDY A;  4ED7 A;  2IOH A;  2QKQ A;  3MFI A;  4I2E A;  8ICZ A;  4DV5 M;  2AXT U;  3GRV A;  3CGW A;  3OJU A;  2MA1 A;  4UBB A;  3C2M A;  1PK3 A;  1SV0 A;  5ALF A;  5HML A;  1V9P A;  1NHG C;  1T43 A;  1ZMW A;  2C98 A;  4WJ3 B;  4NM2 A;  4P16 A;  3R9K A;  1N56 A;  1LV7 A;  5F9L A;  2V9W A;  4UW9 A;  3JPO A;  2YTU A;  1XWI A;  1GJS A;  3K9O A;  1LTM A;  4M9Z A;  3U6M A;  3PW0 A;  1UT8 A;  2KHV A;  2GNO A;  3CF0 A;  3PVS A;  2CPR A;  3D2S A;  2W11 A;  1ZQP A;  3SI8 A;  5J0R A;  2ZAN A;  1IN6 A;  1SKS A;  1U9L A;  8ICV A;  4F2S A;  3IRU A;  5CA7 A;  1CUK A;  3RAX A;  1Y8G A;  2GQF A;  1Z6T A;  4GHL A;  3SAS A;  4OVZ A;  1PM5 A;  1Q3B A;  1WJ7 A;  2D8C A;  2BQR A;  5ITT A;  1Y88 A;  3KOO A;  4ANR A;  4DQR A;  3I4V A;  2A3V A;  3ONN A;  3MR5 A;  2QZ4 A;  5DG7 A;  4LZZ A;  3SAG A;  4J9N A;  5ALY A;  5KT2 A;  4QIW C;  3F2D A;  1HT2 E;  1NK6 A;  4JI4 M;  5ALX A;  4DR4 M;  2A1J A;  4AG6 A;  4FO6 A;  2A1A A;  5AKI A;  3D6J A;  3U26 A;  4EYH B;  4F2L A;  1KFV A;  4TUW A;  5ALD A;  4GEW A;  2H3Q A;  3IN5 A;  2YMP A; 
#chains in the Genus database with same CATH homology
 2YR0 A;  4LRS A;  4EIW A;  4MGH A;  3HHY A;  4O3M A;  2DGZ A;  8CAT A;  2DVW B;  4GC5 A;  1IXS B;  1XXH A;  3FUV A;  4NL4 H;  3GPU A;  1J09 A;  2KRK A;  3LMM A;  2F76 X;  3PXG A;  2CV1 A;  4QOZ C;  4XGI A;  4L4U A;  2R62 A;  3GQ4 A;  2OH2 A;  2R46 A;  3U61 B;  4AKH A;  2YFQ A;  2R4E A;  2F5N A;  4JI6 M;  5FTN A;  1Q3V A;  4LF8 M;  3WHL A;  2BDU A;  4OO1 J;  3GRY A;  1IM2 A;  1G41 A;  2C96 A;  1DGF A;  3VK7 A;  5F3W A;  1GLN A;  4PDG A;  4JMU A;  2ERC A;  2A5Y B;  3JR5 A;  1EE8 A;  1Z59 A;  2DZN B;  2E5S A;  4MH0 E;  2G5I B;  2L7H A;  1QAN A;  2M60 A;  3H0L B;  5H37 D;  4LFB M;  3FUU A;  1YT3 A;  3VDP A;  2Q2E B;  2XZF A;  2K89 A;  2K8B B;  1NJG A;  4AG5 A;  3OTO M;  5IZ7 D;  2Y20 A;  2BJV A;  3KP0 E;  5KQD A;  1R6B X;  2VKQ A;  4A3V B;  5FTK A;  2W7O A;  2C5R A;  2CV2 A;  4GKJ M;  3U6C A;  3PNV A;  5KPR A;  2JHD A;  3OPX A;  2W82 A;  3LQR A;  4B7H A;  3ICX A;  2KIC A;  3N7R C;  3KS4 A;  2OYY A;  4PL1 A;  4DUZ M;  3UMM A;  3A45 A;  1N34 M;  3SC3 A;  1SXJ D;  1HNX M;  2UUB M;  1G3I A;  1GL7 A;  4LGY A;  4CIS A;  4G4Q A;  3SYL A;  3HHW A;  1IIP A;  2CRX A;  2NQ8 C;  1IN8 A;  4AKG A;  2O5R A;  2AHM A;  3IN5 A;  4DV6 M;  2CEA A;  4LFC M;  2KZU A;  4HLQ A;  3GLF B;  3SAU A;  2KD1 A;  2W03 A;  4JI5 M;  1Q39 A;  3U5Z A;  3NRW A;  2HOF A;  4X62 M;  1YUB A;  4MGZ E;  5A0L A;  5FLX S;  2EO2 A;  2KHQ A;  4WW0 A;  4IJF A;  5IWA M;  3IG8 A;  4QOS A;  1FJG M;  2G5H B;  4BLC A;  4X66 M;  3U6Q A;  4DR1 M;  3U6S A;  3KZX A;  2ZIW B;  1NZB A;  2Y0T A;  1JQJ C;  3PSF A;  1Z1B A;  4MM3 B;  2KEB A;  2G8L A;  3HJS A;  3SBJ A;  3SQI A;  2LHT A;  2VJ5 A;  2LXE A;  3HJQ A;  1PVR A;  5JI2 E;  4MGY E;  4QNM A;  3TE6 A;  3THG A;  2HL7 A;  3CP8 A;  1H6U A;  2K8A A;  2X8A A;  4AW4 A;  1XMQ M;  4PL2 A;  1PVP A;  2DHR A;  3KOZ E;  5EP1 A;  1L2D A;  4KHP M;  3SAT A;  1DGG A;  3CRX A;  1MA7 A;  3AOE A;  5ITY A;  3SAW A;  1GVN A;  3VK8 A;  1GO3 F;  2Y0Q A;  2KZS A;  2KEY A;  2ZIW A;  4WUR A;  4REZ A;  5C1B A;  1I94 M;  2YB1 A;  3DZD A;  2R65 A;  2F5S A;  3WHK A;  4I4L A;  1XNS A;  1IY0 A;  5BPV A;  3KS8 A;  3GLH B;  2ZG6 A;  4LJ5 A;  1UM8 A;  4II7 A;  5EXX A;  5KPT A;  1MU5 A;  1NNJ A;  2ZXH A;  3VKH A;  2XEP A;  2WB1 F;  2DQN B;  4GC9 A;  1J5E M;  1R2Y A;  1S3S A;  3T1Y M;  3DEE A;  3KOW E;  1IN7 A;  1ZQ9 A;  3D8L A;  4LRT A;  3SMP A;  4FZN A;  2W7P A;  3KFU F;  4OJO A;  4IBJ A;  3EIH A;  3VCB A;  3F53 A;  3EIE A;  2XGN A;  4NLC A;  1A0P A;  4QIW F;  2QPA A;  1A6S A;  2X4A A;  1OUQ A;  3GLG A;  1QQW A;  3GRR A;  4GMQ A;  3FTC A;  3RGP A;  4X65 M;  4FD2 A;  3Q8X A;  4NOO B;  3W0F A;  3GO8 A;  2KJ5 A;  4LGM A;  1HR0 M;  4JXJ A;  4LZJ A;  3J7A S;  2YNM D;  4LF7 M;  1QAM A;  1QYR A;  3R9X B;  4FWD A;  2R4J A;  2JH1 A;  1JR3 A;  2H1R A;  4LG2 A;  2L7I A;  4OJP A;  3UZU A;  5FTJ A;  3FTF A;  1Q3C A;  2DWN A;  4BB9 A;  2XZU A;  2MRL A;  3DFZ A;  1IBM M;  4LF5 M;  5ITR A;  1SXJ A;  1ORY B;  2JA2 A;  2LWX A;  2X49 A;  2QEN A;  3L27 A;  1HEK A;  2OM6 A;  3RF9 A;  1K3W A;  3T79 A;  1I4W A;  4IIW A;  2DF4 B;  4AZF A;  2ZM6 M;  1HNZ M;  3KVW A;  2CE7 A;  2KVC A;  2WAQ C;  4B7G A;  5KL8 B;  2EA0 A;  2ZIU B;  3NUQ A;  3SFZ A;  4FE3 A;  3PSP A;  2E1F A;  4FCV A;  2RGO A;  3R8F A;  2ZAM A;  3MHV C;  4LJ8 A;  4DR2 M;  4P0Q B;  1PJJ A;  4QJF B;  2RKO A;  4P0P B;  2HMX A;  3ZCB B;  3A98 B;  3NWL A;  3FD9 A;  3TWK A;  4JI8 M;  3UGJ A;  4DV3 M;  2DXI A;  2DWZ B;  4Z8X A;  4G4R A;  3DA1 A;  2QBY B;  1SZH A;  2M0N A;  4JI2 M;  2YB4 A;  4GKK M;  1W5S A;  1L8Q A;  2BJW A;  5ITX A;  3AL0 C;  1TGU A;  1FNN A;  1R2Z A;  5DYI A;  7CAT A;  1OJL A;  4D80 A;  5FTL A;  1IBK M;  4KO8 A;  4M9S A;  3GQ3 A;  3FKE A;  4W5W A;  3TL4 X;  2LKY A;  3J80 S;  2LYB A;  4QNR A;  2YX8 A;  4BUG A;  2GH1 A;  4AYB C;  3F5E A;  3HWS A;  3J2P B;  3E4R A;  4DUY M;  1OFI A;  5C18 A;  4NLB A;  1R7R A;  1TH3 A;  3PFI A;  4G6Z A;  4KLN A;  2LH0 A;  3D8B A;  4OX9 M;  5IT9 S;  2Z4S A;  2G09 A;  2XID A;  2ZIV B;  3SMV A;  2FOI C;  2JH7 A;  4IBG A;  3H0R B;  4JI3 M;  4L15 A;  3K8Z A;  5DYG A;  3SHG B;  2CN1 A;  4C0Z A;  3T15 A;  4NXN M;  1IY1 A;  5EXT A;  3ILK A;  5HR7 A;  2R45 A;  3MGV A;  2BNK A;  3LQQ A;  2PMZ F;  3CF6 E;  2XSZ D;  2VQF M;  5FSW A;  4CGY B;  3U6L A;  5EJC A;  1D2N A;  1HQC A;  5A2Q S;  4MGK E;  1P7D A;  2XSZ A;  4QHT A;  2ZXI A;  3UK6 A;  4M9X A;  2HBK A;  3HKZ C;  4FWH A;  3HU2 A;  2ZIU A;  3GPP A;  2KW0 A;  2CHV A;  4I5S A;  1MX0 A;  4OW0 A;  3D2N A;  2XF3 A;  5JI3 E;  4BJQ A;  1KYI A;  4LJ6 A;  2ZIX B;  1G59 A;  2D6F C;  4AI6 A;  1XNQ M;  2HOI A;  3M6K A;  2UXC M;  1Q3U A;  3SYK A;  1CRX A;  3J81 S;  1TDH A;  1IBL M;  4CGZ A;  3PZP A;  3IP4 B;  2EUC A;  3U61 A;  1XNR M;  3HJ8 A;  1X37 A;  2L09 A;  1L1Z A;  1NSF A;  3FYC A;  4IBD A;  2W04 A;  3K2L A;  1Z5A A;  2H3V A;  3TPZ A;  2D7E A;  3AV0 A;  3GLH A;  3GRU A;  4K0K M;  2UU9 M;  2XI9 A;  2HCB A;  5KQ8 A;  1DGH B;  1OFH A;  1XC8 A;  3QWL A;  5ITX E;  2JMG A;  4YHH M;  2FE8 A;  2FNA A;  5KL1 B;  4HL4 A;  2K4E A;  3JR4 A;  2OQ4 A;  4BX9 C;  5EXP A;  5EP4 A;  4B08 A;  4CDG A;  5E26 A;  1PJI A;  5HR6 A;  4GFJ A;  3C29 A;  3U6D A;  3T38 A;  4LF4 M;  2Y0S C;  3TWL A;  3VKG A;  3GPY A;  4JI0 M;  4R3D A;  2XVT A;  4OU7 A;  4DV7 M;  2I7P A;  3RFW A;  4OJL A;  2KXE A;  5FTM A;  4DR3 M;  4R7G A;  3GQ5 A;  3C58 A;  2F8L A;  3J7B A;  3J27 B;  2HKJ A;  3KOX E;  5IRE B;  2K4I A;  2XH9 A;  1VDD A;  3L28 A;  4Z6Y A;  3U6P A;  3O0F A;  3L29 A;  1YSY A;  4B3R M;  1L2C A;  3CYM A;  1DRG A;  2WB1 C;  3UJN A;  1E9S A;  1QAQ A;  3GP1 A;  1SXJ E;  4JI7 M;  3JAM S;  4I8O A;  3GPX A;  1K82 A;  2YQZ A;  2KV2 A;  2ZIX A;  2CFO A;  2DZO B;  3AL0 B;  3M0E A;  2HBJ A;  1E9R A;  4CHT B;  3A42 A;  1TH2 A;  4B7F A;  4KMO B;  2ZAO A;  1T3T A;  2HBL A;  4AQY M;  3AOE C;  2HOQ A;  2L6O A;  3FTE A;  3PNY A;  3U6E A;  1QVR A;  4DV0 M;  4LF6 M;  3ZC7 B;  2H3Z A;  3ZH9 B;  2FFJ A;  1DGB A;  4LCB A;  3D2Q A;  3SHF A;  2V1U A;  4FZM A;  3F2B A;  4DV2 M;  2OPF A;  4CRX A;  1N77 A;  2VJ4 A;  2K47 A;  4P0P A;  5EXS A;  4MB7 A;  2KA6 B;  1NY5 A;  4AYB F;  5E6J A;  4D82 A;  3A46 A;  3LVV A;  4NRV A;  1URJ A;  4FVM A;  4PT5 A;  4NV0 A;  1ZQ1 C;  3MK6 A;  1TH4 A;  4GIP A;  1D8B A;  3GLF A;  1IY2 A;  4B3M M;  4IBC A;  4IJE A;  3L2A A;  2G0A A;  5T14 A;  2Y21 A;  5EQT A;  4B3S M;  2RP5 A;  2XLJ A;  2R18 A;  2WAQ F;  3GU3 A;  1NNU C;  1SXJ B;  4LY6 A;  2KJ9 A;  2D7G A;  1YE9 A;  2I7N A;  1UPH A;  4QHS A;  3KW6 A;  3HHZ A;  2RHF A;  4PCZ A;  3GLI B;  3SAR A;  2H3I A;  2V6Z M;  1TDZ A;  4YY3 M;  1NY6 A;  2F77 X;  4U7C A;  3KP1 E;  2K8C B;  1QAO A;  2VII A;  4IBI A;  2KKP A;  4ACO A;  1NVM A;  3VFD A;  4P0Q A;  2KIW A;  4M0W A;  3SAF A;  2P5T A;  4LJA A;  2G06 A;  5CRX A;  4JYA M;  2G08 A;  4G4N A;  3SAH A;  3B9P A;  5LMN M;  1SXJ C;  3KXE C;  1E94 E;  2N1R A;  2KRU A;  2G5G X;  3KSX A;  1GL6 A;  2G07 A;  2LNH C;  2J7N A;  4KX3 A;  4ITQ A;  4IC9 A;  3F2C A;  3U60 B;  5GKN A;  4DR5 M;  2HHH M;  4JV5 M;  4S12 A;  3H0M B;  2HBM A;  1KBU A;  3I51 A;  4OJ6 A;  4MGI E;  3VDU A;  1L6N A;  5KO3 A;  2F4V M;  2Z4R A;  3AOG A;  1W5T A;  2F5O A;  4KX5 A;  2GOL A;  2LBO A;  1TAM A;  2CV0 A;  3N7S C;  1ED1 A;  4FW9 A;  4NSO B;  4DV4 M;  5C0Y A;  2KJ8 A;  1JR3 D;  4ZPX A;  4LJ7 A;  3SMS A;  1DO0 A;  4XBO A;  4PD2 A;  2CUZ A;  4GIT A;  2QCU A;  4LJ4 A;  3L25 A;  3ALR A;  3KOY E;  3RFA A;  4G4O A;  1IQP A;  4LF9 M;  1N33 M;  4OVZ B;  2V1C A;  4ICA A;  1GKI A;  4BBA A;  3KSJ A;  3PST A;  3T1H M;  5ITQ A;  3HKZ F;  4B3T M;  2RGH A;  3GLI A;  1DGH A;  1XMO M;  1J7K A;  4LJ9 A;  2VQE M;  1ZAE A;  2DWM A;  1DO2 A;  3FYD A;  2KNJ A;  4IBE A;  3K1Z A;  1N32 M;  1N75 A;  1G4A E;  4RF1 A;  1HNW M;  3F5A A;  4L16 A;  4JN6 A;  3TWM A;  3AQF A;  1N78 A;  1KSF X;  2Z7J A;  1XHB A;  2C99 A;  5ITU A;  3AJI B;  3CTW B;  4IBF A;  4X64 M;  3SAV A;  4QNL A;  1IN5 A;  2F5Q A;  3M7D A;  1C1K A;  3AFH A;  3VC8 A;  4NRW A;  3FUW A;  3KDS E;  2XIC A;  1HT1 E;  1QZM A;  5LMU M;  1NHW C;  1T94 A;  2E1E A;  2F5P A;  4FCT A;  5EP3 A;  4U6P A;  2XFS A;  1ECW A;  3C28 A;  3BOS A;  2C9C A;  1IXR C;  1N36 M;  2Y0S F;  3CF2 A;  4FWG A;  2QBY A;  1WUD A;  1PVQ A;  2M5Z A;  3GZF A;  4NWI A;  3AKZ A;  4DR7 M;  2OXO A;  4L78 A;  4GHA A;  5EP2 A;  3HKP A;  2ZBK B;  2DWL A;  3LYS A;  4LFA M;  4DV5 M;  3QAU A;  3M7G A;  3GRV A;  4OJ5 A;  4L8R C;  1XO0 A;  2JGA A;  3W0L B;  2MA1 A;  3N7P D;  3U5Z B;  2XFT A;  1L2B A;  1WXQ A;  2C9O A;  4GH9 A;  3IG5 A;  4JI1 M;  3FUX A;  1NHG C;  3FUT A;  2C98 A;  4WJ3 B;  4P16 A;  4DR6 M;  4A8E A;  2UUA M;  1LV7 A;  2F2A B;  4DV1 M;  3U60 A;  2QP9 X;  1XXH B;  1XWI A;  4GRI A;  4M9Z A;  1Z5B A;  3U6M A;  2CHG A;  2D7H A;  4RF0 A;  2K4H A;  2LYA A;  3MJ5 A;  4NXM M;  2VIX A;  2J7O A;  3CF0 A;  3GLG B;  3PVS A;  2KHV A;  2CPR A;  1F44 A;  3D2S A;  1Z19 A;  2RRD A;  4IBK A;  3HU1 A;  2ZAN A;  3E0F A;  4IBB A;  1HQY E;  1IN6 A;  3DOA A;  3E9S A;  1IN4 A;  2NV3 A;  3U6O A;  2H3F A;  1G8P A;  3RGS A;  2PMZ C;  1L1T A;  3HU3 A;  2E5L M;  3AQE A;  3PSI A;  3HHX A;  4M0D A;  4AKI A;  1NJF A;  1PM5 A;  1Z6T A;  4OVZ A;  3SAS A;  4RNA A;  4GHL A;  1IXZ A;  1Q3B A;  5BR8 M;  2UXD M;  1K3X A;  5KPZ A;  5ITT A;  4FZL A;  3L3F X;  3I4V A;  1HIW A;  2ZIV A;  3LVW A;  2Q4T A;  3ONN A;  2A3V A;  3K92 A;  4PDI A;  3K1J A;  2Z3X A;  3KFU G;  4FCW A;  2QZ4 A;  4D81 A;  3FTD A;  1Z5C A;  4LZZ A;  3L26 A;  3SAG A;  2KOB A;  3NBI A;  2UUC M;  4KOD A;  4QIW C;  3F2D A;  2CHQ A;  1HT2 E;  4JI4 M;  4DR4 M;  2UXB M;  4AG6 A;  4NSR A;  1E32 A;  3RE8 A;  3TQS A;  1KFV A;  4TUW A;  5DNY A;  4I81 A;  2KKV A;  2H3Q A;  3HGI A;  3I4Y A;  3M6A A;  3VLF B;  3H4M A;  3M6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...