2R18A

Structural insights into the multifunctional protein vp3 of birnaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
TPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
total genus 46
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2r18A02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2r18A01
2Z7JA 2R18A
chains in the Genus database with same CATH superfamily
2Q0ZX 9ICOA 3VKGA 7ICIA 1N60A 2BWEA 4BUGA 9ICAA 4L78A 3FTEA 2D8CA 4I4LA 5CEHA 2G8LA 3M1YA 1VDLA 3PVXA 5ITXA 3KKAA 2X4AA 1OUQA 4UB8U 4AKIA 2HBJA 3UQ0A 3Q8XA 3PSFA 3C2MA 2D7HA 2HBLA 5ALLA 1YSYA 3SHGB 1Z5AA 3KFUG 3NGDA 2ZIUA 4I2EA 3W67A 3AFHA 3GLGB 4RQ0A 3CGWA 2HVIA 2DWQA 3TARA 4RZRA 4BXOA 8ICAA 4M0DA 4DSEA 4DFPA 8ICSA 5EP3A 3J7AS 1X42A 4IBFA 1NJZA 3VDUA 3H4JA 3K1JA 1TF0B 5AKLA 3QX7A 1N78A 3RJHA 4IRCA 3J80S 2QB0A 4QIWF 3ISCA 2R8HA 1S0OA 2ZUBA 4PDIA 3RR8A 4EIWA 2HL7A 2ZUDA 4KLMA 1FJGM 2LPEA 2UVWA 1T43A 4IR9A 3MHVC 4QZ9A 1Z1VA 4BDPA 3SATA 2EZYA 5EWFA 3IG8A 1L2DA 4EENA 1QUSA 1KBUA 5AI6A 3HX0A 2QZ4A 2X8AA 9ICHA 4PH5A 4K4GA 3THVA 4EEYA 4JK1A 4LFAM 2Y0QA 3M9MB 4GC7A 3SR6A 4FZMA 4LVSA 5HMLA 2MR9A 2F5SA 5KFAA 4KLSA 1PJSA 5FTKA 3QUBA 5KG1A 1NK4A 3SHFA 1IXRA 2A5YB 2DKXA 2UUAM 1TR8A 4M6WB 4AKHA 4ED2A 4KTQA 2XZUA 2XFTA 3UMCA 1E32A 4US9A 2ZXHA 2JY7A 4K4HA 3Q8MA 3KZXA 2BKEA 1WGNA 4OJLA 3MDCA 4CJ6A 4LCBA 1HUZA 2RRUA 3ZDAA 1NOMA 3WK6A 4XRHA 2YQZA 4P4OA 5KFNA 4A8EA 2GH1A 4I2DA 1WUDA 3U6EA 3AKZA 4Y2SA 1V33A 3RFAA 3BZKA 1V97A 4ECQA 4DR1M 2WAQC 3UQ2A 3PW7A 2RRDA 1XSLA 4P2HA 5IIKA 3AU6A 2IBKA 4Q45A 4QZDA 4L16A 2ERCA 3KTQA 4C8MA 2LXEA 5AI5A 1Z00A 3PO5A 4B9NA 3SAUA 3B7QA 4LF5M 1ZQWA 4QNRA 3PW4A 4MGKE 2KZZA 3NRWA 1C7YA 4GMQA 2LMRA 4R7GA 4LFBM 2FPMA 4DSKA 4YMOA 3UM9A 4TUQA 2XEPA 2LYHA 3L5KA 1DV0A 3HPOA 2ZJ8A 2Z8YM 1JR3E 5J0SA 1Z59A 3JPTA 2MA1A 7ICSA 1KFSA 3SV4A 2NRVA 4NM1A 4LF9M 5KFOA 2YMMA 2HHSA 2WF8A 4BBAA 4F50A 9ICSA 4GHAA 2K8AA 2VA8A 5J0UA 3B0XA 1SXEA 2CE7A 3FYDA 4P4MA 5KQDA 2HHWA 1ZQNA 1QSSA 1V92A 3IHPA 1XC8A 3MR6A 3FTFA 3SAWA 4QZHA 4DS4A 1V9PA 4JYAM 9ICCA 1IQPA 1QZEA 1TGUA 3LVVA 3CP8A 5BOMA 2CEAA 2LTUA 1KW4A 1OTRA 5J0WA 3F53A 4JI6M 2AHMA 2WSEF 1HQYE 2DAEA 5ALQA 3LK9A 4I29A 1XNSA 3JPQA 2OQ4A 2AHOB 1ZQXA 2R65A 4R8UA 1N32M 1L3TA 1ZRMA 5FTJA 2IOFA 4M9ZA 4DFMA 3BZCA 4EYIB 1JI7A 1TAUA 2DXIA 4FBTA 1P7DA 2IA6A 3JR5A 4C0ZA 5KO3A 5ITUA 5EXSA 4DWIA 1WR1B 2C98A 3H0LB 2FMSA 3GQ4A 4O5CA 4AKGA 4USAA 2R44A 1IM2A 2OOBA 2KK0A 5AI0A 5AM3A 5FTLA 3EYZA 2HDOA 4NRVA 2K89A 5KFUA 4DFKA 4PGQA 4P17A 5KFDA 1NNUC 1IN5A 5DLGA 3FUTA 1KSPA 2Z3XA 3PSIA 3NUQA 1NJWA 4GKKM 1TK8A 1GJTA 3A98B 2MH8A 2DWMA 1PK1B 3DA1A 1JMSA 2O25A 3AEVA 4J9MA 4ED7A 1XWLA 5DBAA 2EA0A 3GQ3A 4FWHA 1K5OA 1TTEA 1Q3UA 3RH5A 3EZ5A 2K8CB 3LQQA 5IINA 1ZQOA 2W9CA 4DQSA 2WTFA 2KIVA 3QU9A 4MEXA 4DFDA 2ZBKB 5IREB 4NL9A 1UFZA 2IMWP 3WK4A 1ZAEA 4HAIA 3TADA 4RQ4A 2HHHM 1IN4A 3AQEA 4G4OA 1T4GA 1ZQUA 3QU2A 4XQ8A 3MBYA 3HX3A 2D7GA 2OHFA 3H8JA 2J5YA 2IOHA 4IQVA 3PR4A 5B5EU 3B7NA 4R66A 1OIPA 2EJSA 4DOCA 1TDHA 3E21A 3RFWA 7ICKA 4ITQA 1TH3A 2NO4A 4NM2A 4GIPA 4OJ6A 5ALUA 3IG5A 1KDHA 3GIJA 5DQGA 2FLNA 1A0PA 4G6ZA 1GO3F 7ICUA 4NSOB 5EE3A 1X40A 4LRTA 4Y2PA 1D9FA 4C8KA 5CB1A 1PVPA 5J2CA 8ICHA 1NJXA 2XLJA 3EIEA 3EIHA 4LJ9A 5DBBA 1S3SA 1RPLA 3TFSA 3JPNA 1VJ5A 3KOOA 1U45A 2CP8A 1L7PA 4FE3A 4F5QA 1L3UA 1H6UA 5C5JA 4I2IA 3B74A 1DGBA 5ITQA 3GQCA 9ICTA 2CV0A 1JUDA 4C8NA 1CEZA 2KN7A 1NI3A 5J2EA 2FNAA 2K60A 4YR2A 9ICKA 3ZQJA 4KLTA 2W82A 2F5OA 2PMZC 4Y2RA 4FFDA 1Q46A 1TFRA 3T15A 1TK5A 1C1KA 5ALZA 2L4EA 3HWTA 3V7KA 3GLHE 1X37A 4LZJA 2XIDA 2C28A 4P16A 3SV3A 1ZD5A 4Y2TA 4DL7A 1HNWM 5ALPA 5FSWA 2LKYA 4EBCA 4LJ6A 4LJ8A 4ED6A 3U60B 4IBGA 4LF8M 5D49A 4OU7A 4PZOA 3SYKA 4MFAA 3GLFB 1PK3A 4FBUA 5DQIA 3N7SC 3RGSA 2W7OA 1IM4A 4FS2A 4PT5A 3DFZA 4I2JA 2W04A 5DB7A 1FFVA 5A0LA 2DZNB 3AOEA 1VDVA 1IG6A 1ZQRA 2V1CA 3HRDD 3SI8A 2EDUA 2HHXA 1ZMVA 2C5RA 2Y9TA 5KG7A 4B9VA 1L1TA 2XGPA 1R4GA 3W0FA 4QZBA 1PUZA 1IY0A 5DYGA 1L6NA 3ZD8A 3D2SA 5EWGA 4DQIA 4GIBA 2QCUA 4ECWA 3K9OA 1J2NA 4KLLA 3WHKA 3H4BA 2QLTA 4JWNA 3W68A 2NO5A 1TAMA 3K1ZA 5AKJA 5L9XA 2ASJA 2HOIA 3LW5F 4JXJA 2FMQA 1RM6C 1VQ1A 3H8WA 8ICMA 1RU3A 3BS5A 2BPFA 2KHVA 2CV2A 4B6JA 4NY8A 2P5TA 2LHGA 5KFWA 4UN2B 1R7RA 1CI4A 3NVZA 4MM3B 3HKZC 3RB4A 4ELUA 1WYGA 3GZFA 3JPPA 3GV5B 3T5KA 4NLKA 1I4WA 1ZQCA 1BPDA 3B89A 1S5LU 3UMBA 3ISDA 4UBBA 2UXBM 5KFQA 3T5LA 2EAPA 5KFCA 4I81A 1N75A 4ECRA 2VA2A 3OSPA 2ZIVA 1XXHB 3Q8RB 5DLFA 3UMGA 1KYIA 2OWOA 3GRRA 4GFJA 3ZC7B 3NVYA 2FE8A 2K4PA 5EP4A 2JXNA 1Y8GA 3N7RC 2QSFX 5KFKA 4DQPA 1ZQ1C 3NBXX 2UU9M 2DNAA 2H3VA 2YN4A 4G9BA 1UPHA 1TVAA 2CHGA 2DPJA 1HNXM 4RQ6A 9ICBA 2ZTDA 2NYVA 3AJIB 2ZJAA 4CGYB 4QZGA 1N33M 1X6JA 1PVRA 5DDYA 3PMLA 2XZFA 2L6OA 1XB2B 1ZXIA 1WIVA 1K3XA 3D2QA 2O5RA 4Y2UA 4ZH4A 2JY5A 1AROP 2D7EA 5JUMA 3IDWA 1SXJB 4B3SM 4UASA 4B9UA 1NSFA 5HHHA 1X9SA 1PRBA 1IV8A 4IQTA 3RRGA 4ECYA 3GPPA 4GH9A 3Q8KA 4B7HA 4Z6EA 4TUPA 3ZDBA 2W03A 4X65M 2H3QA 3EW9A 1COOA 1GL7A 1TK0A 2ZIXA 4LF6M 3FTDA 1NKBA 1RXVA 2GQFA 5KT7A 1BVSA 1HT1E 1OQYA 3CW2C 4Z6FA 3FM9A 3IN5A 5H37D 3ZI4A 3F5AA 4FS1A 3C5FA 3LYSA 3TAPA 1GL6A 1JRPA 4DS5A 4OX9M 3TWMA 1AIPC 4P0QB 3CYMA 3KVWA 1ZQZA 4RF1A 1U47A 5EOZA 3QU5A 1SKWA 4R71A 4JB3A 7ICMA 2XY6A 2HMXA 2ESEA 1NZBA 4M0AA 3D8LA 1SKSA 2QB1A 1DRGA 4FVMA 2XO7A 4S12A 2AGOA 2H1RA 2Z7JA 1UCVA 4Y2YA 2R4JA 2HOQA 2L7HA 4LY6A 2ZIWA 2KSOA 4O3RA 3HHZA 2KW0A 4AZFA 2XY5A 1AUAA 5GTIU 3TI0A 4NXZA 1K3WA 1ED1A 4GRIA 3LMMA 4IS7A 2BCVA 5LMNM 2CN1A 1J2MA 2XI9A 2HW3A 1S76D 1S8OA 2HOFA 3FUWA 5DGBA 2F77X 1SZHA 4YCXA 1NK6A 1S9FA 4F5OA 4C4SA 2FH0A 1HT2E 1WGLA 2Q2EB 2E8MA 4YR3A 3F2BA 3KHHA 3KD3A 5T14A 1M6YA 5ALYA 2PKEA 3KHRA 1L8QA 5KG4A 4ECTA 2BCUA 2R18A 2H5XA 1VDDA 2L7IA 3HP6A 3HILA 3KFUF 3KOXE 2F1HA 2KVSA 9ICPA 5J8YC 4KLOA 3C58A 3AM9A 1JB0F 5AM1A 3I1YA 3QAUA 5KFFA 3TWKA 4MB7A 1ZQAA 1IXZA 4UQGA 4J9QA 2R4EA 4P4PA 1RYRA 3WK8A 3CF0A 1YT3A 2H3ZA 4CDGA 9ICNA 1SXJD 2AH5A 2HHVA 2DFLA 9ICFA 2FE9A 4AG5A 4LZZA 4XK8F 2W3SA 3V7JA 2A1JA 1SXJC 4CF5A 4G4QA 1B22A 1X66A 4QIWC 2HHUA 3TWLA 2K47A 2XCPA 3UJNA 2W3RA 2W9BB 3HHXA 4PPXA 5D46A 2QNJA 3G6YA 1KLNA 5IIOA 3QEBZ 3IHQB 4NLCA 3WK5A 4YQWA 1Z5BA 2CPRA 4RQMA 3NWLA 1NJFA 3HHYA 2DGZA 2UVUA 4YG2A 5J0PA 4B7GA 4DUZM 5AK6A 2KNZA 9ICWA 2DAGA 5EP2A 5EE0A 3KZIU 5IIIA 4MFCA 2BDUA 1Q3BA 2W9AA 3OJUA 2Y0TA 5AKGA 3BXWA 5KAFU 3QZ7A 3U6CA 3KS4A 4UB5A 2LYBA 3TQSA 5L1JA 1WWVA 5CP2A 4LRSA 2KNVA 4QWEA 1EIJA 1D8LA 4UAUA 3FUVA 5KG0A 7ICRA 4Q8FA 1J5EM 4HYKA 3SEIA 2BDPA 1OXJA 4YY3M 4TUSA 4PGXA 5ITTA 2H3FA 3RH6A 4IRDA 5KFXA 1ZJNA 2LM4A 2BGWA 3VFDA 5IIMA 3DZDA 3Q8QB 2FLPA 1SL0A 2ZTEA 3H8SA 4PHAA 3H0RB 1XMOM 3N97B 2K6BA 4F2RA 1TH2A 2WF6A 9ICJA 3GP1A 5ALGA 1T8EA 3FYHA 2RGHA 2K4EA 4M9JA 2NRXA 2R8JA 2BQUA 1QQWA 2YX8A 1IFYA 1KTQA 2ZIUB 2KHHA 2HBKA 3TL4X 4I8OA 5DG7A 4KO8A 1ECWA 4BXOB 2B3TA 4I2HA 3C29A 4GITA 2G5HB 2LM1A 1OFIA 3K1RB 1NV8A 2MJ5B 4DR2M 4IBJA 1ZQLA 2QQ8A 4AYBC 4ED8A 1T7PA 4J9OA 4DSFA 2QB0B 3B9JA 2FOIC 2F44A 4Q8EA 5DBCA 1RYSA 2APLA 3GLFE 2AGPA 2JZ1A 3UXNA 1ZMUA 4IJEA 5KG6A 2LVAA 2W54A 1U4BA 4KT0F 2BNKA 2HCBA 1ZD4A 5AM4A 2CRUA 4C4TA 3HKPA 2DZOB 4JI8M 5J2DA 5CR0A 3MK6A 1IY2A 2VF8A 3SAHA 4TQRA 4Z8XA 3V76A 4O3NA 1MQ3A 1ZQ9A 2WSCF 4KODA 4Y2JA 3GDXA 4G4RA 4GC5A 1QSYA 3KS8A 4DV3M 4D81A 3HZJA 1TE2A 2KJ8A 5CJ7A 4MFFA 3E0FA 1X6IA 5AHXA 4UB1A 4X5VA 3KDSE 3SASA 3AV0A 3QU7A 1T94A 3PX6A 1T3QA 1K82A 4KX5A 4AI6A 3HGIA 1DO0A 9ICRA 2XH9A 3GILA 3R8FA 1FIQA 1R2YA 4ACOA 4AG6A 3QE9Y 1JIHA 1HUOA 4NRWA 3U5ZA 3GLIA 2Y21A 3K92A 3AN1A 1S77D 4R3DA 2XF3A 2BCRA 4O0IA 1XC9A 3U61A 4RT3A 5F3XB 3MABA 1E9RA 2PFQA 1TV9A 4DL5A 5FTMA 5KQ8A 3A42A 4QNLA 1IBKM 3U6LA 3MFIA 4UAYA 3EPIA 2C99A 3OHBA 3RBEA 4NXNM 2NRTA 1DGHA 4RF0A 1Z00B 3UMMA 1XXHE 3J81j 5ALEA 4LJAA 4OD0A 3RJFA 4GKJM 3C9PA 5ALOA 3PFIA 4G4NA 3L28A 3UK6A 3MMPA 5G5GA 1S0VA 2BR0A 2KNAA 1PGYA 2G5IB 2JR5A 2OYYA 5KT5A 4B9SA 2UVVA 8ICCA 4CF4A 4RQ1A 4LFCM 2YY6A 3ONNA 1N2XA 3QUCA 1XU4A 5JU5A 1LTMA 2C9OA 5KTQA 2DVWB 4EYHB 2XCAA 3HU1A 2VJ4A 3KKAC 2NV3A 8ICPA 2BPGA 3C3EA 1NK8A 2HKJA 3H40A 4FZLA 3HWSA 2CV1A 5KFRA 3U6MA 3J81S 3MGVA 2HHTA 3FTCA 1SXJE 2QARA 3KSJA 1O08A 8ICGA 1VG5A 3SZ2A 1WXQA 1Z6TA 2LVNC 5F9LA 5KFMA 3UPQA 4DO9A 3V6KA 5IILA 1OJLA 2KICA 5G5HA 4ELTA 3L4PA 4QZEA 3B9PA 5DB6A 1NY5A 3WKCA 4BGDA 1URJA 2FLLA 3MDAA 3HJSA 3PNVA 1MN3A 4JI5M 5KFTA 4CNQA 4JI1M 2MRLA 4XUSA 1NKEA 1ZD3A 5F3WA 2C96A 4MGIE 3BOSA 1HEKA 1B4FA 2KNJA 2NRWA 3BQ7A 3ALRA 4KN4A 4F4XA 1N63A 8ICBA 4BWJA 4OW0A 4I2FA 2KHQA 4UW9A 2BZFA 2KVCA 2B0CA 2Y1JA 4DOAA 5HR6A 2R45A 2HHQA 2ZAOA 7ICVA 4IQWA 1LKYA 3H4DA 5EXXA 1IXRC 1IY1A 1V85A 4ECZA 5AIAA 2JZBB 2ATLA 5JI3E 2L4FA 5AKXA 5F9NA 5KG5A 2ASDA 1X9WA 3M6KA 3SD7A 2RLTA 4FWGA 3A46A 3U6PA 2GO7A 2HI0A 2WF9A 5ALNA 7ICFA 3TE6A 3HJ8A 4YXJA 2DAMA 3L2AA 2D3DA 2RDIA 4C7YA 1PJJA 5J2FA 3M6AA 5KFEA 8ICEA 5JTIA 2W9CB 4CHTB 4KLIA 4CRXA 2XGNA 2FPKA 4HL4A 2C22A 5KFIA 1NO1A 2DAIA 4WP2A 1YZ7A 4F71A 4E0DA 4F3OA 3GU3A 4Z6DA 3LCVB 3SFZA 2EUCA 4ICAA 4L15A 7CATA 1SV0A 2ISPA 1G8PA 2LH0A 1ZQMA 3WK9A 8ICOA 2PFPA 2N1RA 4PHDA 5KFBA 4CGZA 4G3IA 1OAOC 4LZGA 2ZANA 3RJKA 4QZAA 1FEZA 4PZNA 4X64M 3NS1A 1N77A 2F3NA 8ICZA 2ZUCA 2EKKA 4RNNA 3C28A 1XNRM 4RPYA 5AKKA 2YNMD 2BJWA 2G09A 1JALA 1RG6A 3ZDCA 2KG5A 2VQFM 3R9KA 1S97A 4BLCA 3GPUA 4F2LA 4FD2A 3THGA 4PDGA 2B6GA 4NOOB 1SKRA 1ZJMA 1CRXA 2K8BB 1Z5CA 1WCNA 5E26A 4DV6M 2OXOA 1L3SA 1T3TA 3QNMA 3GIIA 3WK7A 9ICQA 3KP0E 4DFJA 2V9WA 2L5YA 3GFKB 5TISU 4AP9A 2ASLA 3HHWA 1D8BA 2YFQA 9ICXA 1QANA 4DR7M 3D6JA 3E2EA 1XHBA 4K0KM 4D80A 3IM1A 4EEKA 5AKHA 5GTHU 1N62A 4U6PA 3KOYE 4LF4M 2KXEA 3HT3A 1ZQSA 3E46A 1JROA 4OVZA 1Z3EB 3T79A 1Z4OA 3FUXA 2I1QA 3NVWA 4DQQA 4C8OA 3SC3A 1B43A 1L5UA 2VA3A 3FYCA 2LWXA 3GRUA 1IBMM 5AI4A 3TKAA 3BBZA 5J0YA 1UQVA 1X9MA 4O5EA 3VK7A 2N35A 5L1LA 4GHLA 2AU0A 2DHRA 3L3FX 3I51A 4PCZA 1XNQM 2JMGA 2LHTA 2C2RA 4MGHA 1HIWA 3FRIA 1JR3A 2JA2A 3Q8GA 3RB3A 2R8GA 3ZDDA 7ICHA 3PZPA 2WHEA 1QDRA 5J2IA 2JEIA 2XFSA 1NV9A 1LV7A 4YMMA 1QCKA 3WKBA 5K4LA 4XGIA 1JN3A 4UB4A 2J6UA 4DR6M 4B7FA 4IQUA 1V34A 3SMPA 2F8KA 2LNHC 2VIIA 3T5HA 4EZ6A 4EX7A 2XSZA 5AIBA 1L8OA 4C4RA 4RU9A 3UZUA 5ITXE 4NXMM 2KZ3A 4B3MM 1SL2A 8ICFA 3BDPA 4DLGA 3KBBA 3C3DA 4IBKA 2E5SA 5HNKA 3L29A 3I4YA 4NL9C 4UARA 4J9LA 3KOWE 3IP4B 4B3TM 4R64A 4REZA 4M04A 4ELVA 1D2NA 1KEJA 5FLXS 2KEYA 5AKZA 4RQ7A 2QKQA 4M9GA 3PVSA 2BQ3A 4GEWA 5AK5A 3TADC 1R2ZA 4F8RA 2R0IA 2WB1F 2X49A 4TUWA 3FD9A 3V6HA 4J9RA 2E8NA 1NNJA 1QAMA 2HAKA 2KKVA 5C1BA 3BS5B 3AOGA 4RKUF 3V7LA 2CHQA 2G06A 3C2KA 4OCZA 2CHVA 2CXYA 4O5KA 8ICUA 4YR0A 5KFVA 1XSNA 2FPLA 3SYLA 5IZ7D 3DEEA 1F4IA 5BR8M 1L7OA 4LZDA 1Y88A 3BQ1A 4RNOA 3PV8A 1NY6A 4KLHA 1NK9A 2M9NA 3FRHA 2FS1A 2ZIVB 3KOZE 2VJ5A 3K75D 3WKDA 5AK3A 1QSLA 2KZSA 1F5SA 2JH7A 1JXLA 4P0PA 4LF7M 5E79U 3RB6A 2DPIA 1ORYB 1YLAA 7ICQA 4QNMA 4FO6A 5AM2A 5J0TA 1ZETA 2Z4SA 3L25A 3ETRA 1ZQHA 2CWBA 8ICTA 3T5JA 3FAHA 2D6FC 1SWVA 2JH1A 1OKSA 4YVZA 3LWLA 4ED3A 3GO8A 1P3QQ 1NJYA 2Y20A 1DGGA 5HP4A 2JP7A 4KMUA 2RHFA 2QBYA 5J2AA 4M9SA 3VC8A 4Z6CA 3TACB 9ICGA 4DBGB 2AXTU 4LJ4A 2J7OA 3F92A 4DL6A 5TZVA 4JI0M 4BJQA 1ZQTA 4IR1A 4NLGA 1GJSA 1ZQGA 3A45A 2LVQD 4ECXA 4Z6YA 2DWLA 1ZQBA 2UUBM 3QU4A 3RR7A 3J27B 4OO1J 4O3QA 1IXSB 5J2KA 4U7CA 3VDPA 2AQ4A 1IN7A 4DV0M 7ICEA 4QHTA 2WF7A 1VEGA 5KFLA 4KLNA 4ZPXA 5EQTA 2XICA 2MU2A 2W11A 2ZIXB 2HWJA 4OJPA 4UATA 4F92B 4LJ7A 2WFAA 2BCSA 1DGFA 3AOEC 4JUZA 1S0MA 3UGJA 1QZMA 1D0KA 2MUTA 2VDBB 3D8BA 2YQEA 3OGUA 2G5GX 2J6SA 3HW8A 1CUKA 2YMLA 2GLEA 1DXSA 3M9NB 3RH4A 4RUCA 4K4IA 5J2JA 3ETLA 2UXCM 3GIKA 2B21A 4X62M 4CIZA 4G3OA 4RQ2A 4EBEA 2Y0SF 2KJ9A 3ZD9A 2H3IA 4F4YA 3C21A 3HJQA 2EAOA 2CUZA 1RXWA 1G59A 1UA0A 3T3FA 2HVHA 1KL9A 5DGAA 1G3IA 3FC4A 3QWLA 3SMSA 3WHLA 1L1ZA 4NLNA 5KPTA 3GLHA 1NZPA 5ALRA 1A76A 3RAXA 4DF8A 2VIXA 2J7NA 2XSZD 5J29A 2VANA 2ZIWB 2KSOB 1KKXA 3E4RA 5DQHA 2O6KA 3E9SA 4QZ8A 5ALKA 3LVWA 4KITB 4MGZE 1BNOA 2EAMA 1KFTA 1KFDA 3IV6A 3QUTA 3KXEC 4Y2XA 3KP1E 2E5LM 1H38A 4O3OA 1BPYA 4IBDA 2F5NA 4FCWA 5ALSA 2C2DA 4I2BA 4RNMA 2A3VA 4YP3A 4DV4M 5A2QS 3RF9A 4C80A 2JUJA 4Q7JA 4DR3M 5DB9A 3L27A 1DK3A 3C23A 3WU2U 1RZTA 1SIJA 4KX3A 4GC6A 5DDMA 3J2PB 5CA7A 1BPZA 4NV0A 3QYEA 1L3VA 3JR4A 3B0YA 2K4IA 2CFOA 3JAMS 5KG2A 1W5TA 1ZQQA 3KW6A 3SENA 2PXIA 1UT5A 1J09A 1TDZA 2AJQA 1S10A 2I7PA 5AKEA 1KRPA 3GLGA 3LDAA 1IBLM 5KFGA 4KLDA 2DKLA 1RQNA 4KN7A 2XGQA 1NK5A 2AQ0A 1F44A 1ZQDA 3SAFA 4GXJA 2OPFA 2DWNA 4LJ5A 5J0XA 3SYZA 4KLGA 3ED5A 3N4MB 3M6ZA 3BQ0A 3GRYA 2F5QA 3TAQA 2A1JB 3SMVA 5C18A 3ORYA 5DG8A 5IIJA 1QUTA 2HBMA 3PX0A 1NK0A 1N5WA 4IBIA 5C0YA 5J0OA 3C1YA 1FNNA 4YHHM 1J7KA 3I01M 1MX0A 3CNHA 3L26A 3M7DA 3E58A 4ECVA 3RJEA 2P6RA 3AU2A 4KLQA 1Z19A 4F2SA 8ICLA 4QZFA 5DKWA 2W55A 3PSTA 2I5HA 4ZOHC 4M6WA 4J9SA 2V1UA 1DK2A 3K9PA 2FI1A 3T38A 3K8ZA 1PJQA 3ISBA 2JV3A 5EWEA 2FDRA 5J0QA 1Z1BA 5IT9S 3GPXA 4DSIA 3JPRA 3U6DA 4AYBF 3PO4A 3VCBA 1N61A 3MR2A 3J7BA 1NHGC 5KFJA 4Q44A 4HEOA 8ICNA 4RT2A 2UXDM 4RQ3A 4QW9A 1NVMA 4NLBA 2EO2A 1UM8A 1QVRA 9ICVA 5HHIA 4IBBA 4FCTA 2JEFA 4YN4A 1L7MA 5KG3A 4Y28F 4UAVA 1BNPA 3CTWB 4KLUA 2XVTA 1NHWC 4FW9A 3U6OA 2JZ0A 4C7ZA 5ITRA 3M8SA 5L1KA 4J9KA 2LI6A 2C2EA 4PL2A 4IBCA 4BB9A 1X2IA 4X66M 4JI2M 2JXJA 4GLXA 1MU5A 4RPXA 3MGIA 2DENA 5AM5A 2LYAA 3FDSA 3OPXA 1EE8A 3RTVA 2DZLA 2JY6B 3RE8A 2M60A 3AQFA 2RP5A 4EZ9A 3SAGA 2RQ5A 2O01F 1SWWA 4WURA 1NNLA 3IRUA 1OIZA 2PFNA 4F5PA 5KPRA 1SZPA 4OJ5A 2XC9A 3GV8B 4O9MA 4JV1A 4B9TA 4IIWA 5CWRA 3I04M 3WKEA 4MF2A 3QYPA 3HY5A 1UT8A 1QLNA 3BQTA 4F72A 2G3QA 2ZAMA 1TAQA 3K4GA 5EE9A 5AICA 2IOFK 3M8RA 4DCCA 1PM5A 4XA5A 4JV2A 7ICJA 1GVNA 2DUYA 3OTOM 3IECA 5FTNA 1Q02A 4LG2A 2HSZA 5JRTA 1C20A 5DG9A 1DO2A 2UUCM 2LVOC 9ICLA 2CRXA 3B7ZA 3RBDA 2W8KA 2V4QA 2MGWA 7ICLA 2YMQA 2R8KA 3UXPA 2C9CA 2P66A 3H0MB 3N28A 1T3NA 2RGOA 4FWDA 2PI5A 5D4BA 2ZJ5A 1N48A 2E1EA 1XWIA 2EZZA 1E9SA 4DR4M 1W5SA 2A19A 4CCHA 5H2FU 2JHDA 4EELA 3RRHA 4UB6U 3C5GA 1XO0A 3O0FA 4B9LA 3GRVA 3U5ZB 3GLIB 1Z4NA 4J9PA 1QDTA 2WAQF 1WCLA 4YXMA 2DBYA 3F5EA 1B0XA 1FFUA 4LJXA 2ZTCA 2R8IA 2DI0A 1ZYQA 3AL0B 2LBCA 1R6BX 3U61B 5L8RF 2LBOA 2V6ZM 1MQ2A 3PW0A 2K0BX 1G4AE 2YB1A 3Q8LA 1GO5A 2BJVA 4DV7M 1SXDA 2R62A 5J2HA 1PK1A 1ZMWA 3PXGA 4UB2A 1AQ6A 1DGHB 3ICXA 1PJIA 2QPAA 3OJSA 3U6QA 1A77A 2G08A 4WJ3B 1NJGA 1UHUA 4QJFB 4PGYA 2RDJA 3BQ2A 1BPEA 3PNYA 1ZQVA 3HJEA 4TQSA 3BS7A 3W0LB 8ICQA 1N36M 5B66U 4R8UB 5ALIA 1LV5A 1SB3C 2F1IA 4PL1A 4UBCA 3C2LA 1GABA 5FP0A 5ALMA 1WWUA 1G41A 1IN6A 1ZQPA 2W8LA 3AMZA 3OTQA 4YD1A 2KDLA 4D82A 1JX4A 4MEYA 5DB8A 4US8A 1MC8A 4Y2VA 4I2AA 3MGHA 3CRXA 2F1JA 3C1ZA 2JZBA 3PR5B 4PJ0U 5BOLA 3I4VA 1EFUB 2KRKA 3EUB2 3OHAA 1J97A 2A1AA 3NRZA 4F93B 4NLZA 2QARB 3ILKA 4O3PA 4DSLA 4QWBA 1QYRA 5ALJA 3VLFB 3KHGA 3G6XA 2KD1A 3N7PD 3H7IA 4GC9A 5E6JA 1OAIA 3V72A 3MFHA 3FE3A 4NWIA 4DOBA 3RAQA 2YB4A 2M5ZA 4NSRA 5AKIA 2DF4B 5BPVA 1MN8A 2VKQA 5ALXA 4PHEA 1YZ6A 4M9LA 1U48A 2WZJA 4F4WA 3PY8A 2KZUA 1XO1A 4DF4A 3PMNA 2FJ6A 3F2CA 1K1QA 3R9XB 5CHGA 3QYBA 4DL4A 4TURA 3LQRA 5KPZA 4RNAA 2GNOA 8ICYA 1LKYB 3GV7B 5JI2E 4NL4H 2M0NA 3EPGA 3JPOA 1N56A 3CF6E 3M9OB 5ALVA 1N5XA 8ICXA 4IJFA 3K2LA 4UAWA 1NK7A 2IHNA 4AW4A 4L4UA 1I94M 9ICEA 2YMPA 2BHNA 3AUOA 3G6VA 4EBDA 4L6V6 4UAZA 3FUUA 1BGXT 4DEZA 3LWMA 1YUBA 3QXGA 4A3VB 2E8PA 5EE1A 4ED1A 2ES6A 3QEAZ 1TKDA 1V38A 8ICKA 4II7A 1G71A 2ZXIA 3U60A 3ZH9B 2RKOA 1SL1A 4DV1M 3AL0C 1WHCA 4DV2M 2DKZA 1DGSA 4M47A 2G07A 2K4HA 3UXOA 3GLFA 2J6TA 4NC6A 8ICJA 3KHLA 1A6SA 4B9MA 4IL6U 2OOAA 2ALZA 2KV2A 4FCVA 4QW8A 1ZQJA 2W43A 5HMMA 2I9GA 2DWZB 4KLEA 1QH9A 9ICIA 4F91B 3T6PA 2GWSA 2NRZA 1YE9A 3DV9A 2P35A 3T1YM 4I28A 1PVQA 1LVHA 4IRKA 5KAIU 4IC9A 5J2BA 1HR0M 1TH4A 1ZRNA 1GKIA 4M9XA 1WJ7A 4QZIA 5GKNA 1HJPA 4MF8A 2KFZA 2OO9A 3NTUA 3V6JA 4DV5M 4IBEA 2WB1C 1Q3VA 2W9MA 3PSPA 3A0HU 4RPZA 4KLJA 3RB0A 2KRUA 2E8OA 4I27A 3HU2A 5DYIA 4J9NA 3RJGA 4QOSA 1Q8KA 4ANRA 3U26A 1S0NA 1XS9D 1RDFA 4F5NA 5EP1A 4DL2A 2EZXA 1OFHA 4CISA 1KN5A 2KEBA 1QTMA 2PMZF 2JEJA 4WW0A 5ALTA 2LHCA 1QQ7A 4OVZB 2KE7A 3PX4A 2F2AB 3EWAA 2JY8A 3M0EA 2NQ8C 4O3MA 2KA6B 5AI8A 2UVRA 1XXHA 5IWAM 3SARA 4YD2A 4MHVA 1Q39A 3GLGE 3SQIA 2BCQA 3SAVA 2F8LA 5AI9A 1VLBA 4DSJA 1L2CA 4I5SA 1ZD2P 2MAXA 3U6SA 2KZMA 1SV4A 1L8LA 3DDHA 5AM0A 2G0AA 3QZ8A 5LMUM 2VF7A 3SBJA 4F1IA 3RJIA 2WSFF 3MJ5A 4NJ8A 5J8YA 4DUYM 3MR5A 1UA1A 4FZNA 4C8LA 1RQLA 5J0RA 2OEHA 1OW5A 1RYUA 2JGAA 4OJOA 3TANA 4B08A 4W5WA 5ALFA 4GXIA 2OH2A 3MC1A 1HNZM 2ZM6M 2KP7A 4JV0A 5ALHA 1WG8A 1GLNA 8CATA 1SXJA 2E1FA 5KFPA 2MROB 3VKHA 4CE6A 1D0MA 2FFJA 3Q8SB 3NBIA 1MA7A 3I28A 5KL8B 3QUQA 2GOLA 5ITYA 1O03A 2F5PA 1BPBA 5ALDA 2E3TA 1D0LA 1QAOA 1SV0C 2P6UA 9ICUA 7ICNA 2V4RA 3ZDEA 2OM6A 3H8MA 3LCUA 3FKEA 4BX9C 1MSWD 5EJCA 4F4KA 2JNHA 1ZQIA 4M9NA 4ECUA 4PD2A 4KMOB 4Y2QA 1COKA 1QQ5A 3DOAA 2F76X 3HKZF 3MR3A 3BJYA 1D8YA 5KT2A 4YMNA 1SG9A 2KKPA 4O3SA 5KT6A 2KIWA 4QWDA 7ICOA 2OCEA 3PW5A 2K9DA 4B3RM 3TQ1A 1QQ6A 5ALWA 5KFYA 3JPSA 3Q8PB 4I2CA 2QHOB 5AKYA 2R46A 1Q3CA 3GPYA 4ECSA 3RJJA 2QENA 2L09A 1IXSA 2DQNB 4P0QA 5KFZA 2Y0SC 1KFVA 1ZV1A 5KFSA 1QAQA 4JV5M 1X9XA 4P0PB 4HLQA 2JWSA 4YFKA 4R63A 3TPZA 2R6FA 3H4MA 4EX6A 3I76A 3F2DA 4F4ZA 2F4VM 1A5TA 2KTQA 4UB3A 4RUAA 1KQQA 1ZQEA 3OSNA 8ICIA 1EXNA 3TFRA 2Z4RA 4DQRA 1T6OA 2QP9X 4PHPA 1F0MA 4GXKA 2FMPA 2ISOA 4CF3A 5CRXA 3HU3A 1NKCA 1DGJA 2Y9UA 5DNYA 4F5RA 4I2GA 3GLIE 4JI4M 3T1HM 2QBYB 4JWMA 4ED0A 2PI4A 2I7NA 3NVVA 3RGPA 2WF5A 4LGMA 2ZG6A 2XY7A 1FO4A 1U9LA 2Y1IA 7ICGA 4RQ8A 1L7NA 4DL3A 1JR3D 3NASA 5KT3A 1VEKA 2DL0A 2MSNA 3PNCA 2YR0A 2KJ5A 5L1IA 4M9HA 1ZOLA 2Q4TA 5HR7A 2KOBA 1ZQKA 3VK8A 1E94E 3D2NA 1LB2B 4L8RC 7ICTA 5KT4A 5EXTA 2BWBA 1VEJA 1K1SA 5AK4A 4AQYM 2IHMA 2MUTB 1IIPA 4MGYE 4DR5M 4KLFA 4QWCA 1XSPA 4QOZC 5BPCA 2W7PA 1BPXA 9ICMA 1JQJC 1D9DA 1R5LA 1L2BA 3GIMA 3ZCBB 1PZNA 1JXEA 2JEGA 4R65A 4BWMA 2L2DA 2W9BA 1N34M 2EANA 7ICPA 5KFHA 1XMQM 3CF2A 2JRZA 2EKFA 1PJTA 2BQRA 4M2YA 2I6XA 2DHYA 2KFNA 4QHSA 2KMDA 2LVPC 3GQ5A 1SGGA 3KSXA 2DAKA 8ICWA 4QWAA 4J03A 3GLHB 4JI3M 2PFOA 4M0WA 2AGQA 2ODGA 4Q43A 1IN8A 3WKAA 5KL1B 2YTUA 1U49A 4KHPM 4QZCA 4RQ5A 2EH9A 5KNIA 2VQEM 1ZQYA 8ICVA 5EXPA 1HQCA 4JMUA 5J2GA 4JN6A 3PW2A 3A0BU 1DOQA 2BPCA 5DFLA 5L1MA 1MJGM 4XBOA 3M7GA 2HCFA 4MH0E 1KSFX 4JI7M 8ICRA 4DLEA 2EQYA 1ZQFA 3S6JA 4RQNA 4LGYA
chains in the Genus database with same CATH topology
1NSFA 4FD2A 3THGA 4PDGA 4NOOB 1CRXA 3VKGA 2K8BB 1Z5CA 4BUGA 1XO0A 5E26A 4DV6M 4L78A 2OXOA 3FTEA 3O0FA 1T3TA 3GRVA 4I4LA 3GPPA 4GH9A 3GLIB 3U5ZB 3KP0E 2G8LA 2WAQF 4B7HA 3F5EA 3AL0B 5ITXA 2X4AA 1R6BX 2W03A 4X65M 1OUQA 2H3QA 4AKIA 3U61B 3HHWA 2LBOA 2HBJA 2V6ZM 2YFQA 3Q8XA 1D8BA 1QANA 1GL7A 1G4AE 4DR7M 2D7HA 2HBLA 2BJVA 2YB1A 3PSFA 1XHBA 4DV7M 4D80A 1YSYA 2R62A 4LF6M 4K0KM 2ZIXA 3SHGB 1Z5AA 3FTDA 3KFUG 3KOYE 4LF4M 4U6PA 2ZIUA 3PXGA 3AFHA 3GLGB 2KXEA 1DGHB 1HT1E 4M0DA 3ICXA 3IN5A 1PJIA 5H37D 2QPAA 5EP3A 3J7AS 4IBFA 4OVZA 3VDUA 3F5AA 3T79A 3U6QA 3K1JA 2G08A 3LYSA 3FUXA 4WJ3B 1NJGA 3SC3A 1N78A 4QJFB 3J80S 4QIWF 1GL6A 3FYCA 2LWXA 3GRUA 3PNYA 1IBMM 4PDIA 4EIWA 2HL7A 1FJGM 3W0LB 4OX9M 3VK7A 3TWMA 1N36M 4P0QB 3CYMA 3KVWA 3MHVC 4RF1A 4PL1A 4GHLA 3SATA 2DHRA 3IG8A 1L2DA 3L3FX 1G41A 1IN6A 3I51A 1KBUA 4PCZA 1XNQM 2JMGA 2LHTA 2QZ4A 2X8AA 4MGHA 1HIWA 4D82A 2HMXA 1NZBA 3D8LA 1JR3A 2JA2A 2Y0QA 4LFAM 3CRXA 1DRGA 4FZMA 4FVMA 4S12A 3I4VA 2H1RA 2Z7JA 2F5SA 3PZPA 2KRKA 2R4JA 5FTKA 2HOQA 2L7HA 4LY6A 2ZIWA 3SHFA 2A5YB 3HHZA 2KW0A 4AZFA 2XFSA 2UUAM 1LV7A 3ILKA 1K3WA 1ED1A 4GRIA 4AKHA 3LMMA 4XGIA 2XZUA 4DR6M 2XFTA 4B7FA 5LMNM 1QYRA 1E32A 2CN1A 2XI9A 2ZXHA 3SMPA 2HOFA 3FUWA 2LNHC 2VIIA 3VLFB 3KZXA 4OJLA 2KD1A 2F77X 1SZHA 3N7PD 2XSZA 4LCBA 4GC9A 5E6JA 4NWIA 3UZUA 2YB4A 2M5ZA 4NSRA 5ITXE 4NXMM 4B3MM 2DF4B 1HT2E 2YQZA 5BPVA 2VKQA 2Q2EB 4IBKA 2E5SA 3F2BA 3L29A 3I4YA 4A8EA 5T14A 2GH1A 1WUDA 3U6EA 3AKZA 3KOWE 3IP4B 4B3TM 2KZUA 1L8QA 4REZA 3RFAA 1D2NA 5FLXS 2R18A 2KEYA 1VDDA 3PVSA 2L7IA 4DR1M 2WAQC 3KOXE 3KFUF 1R2ZA 3F2CA 2WB1F 2X49A 4TUWA 3R9XB 2RRDA 3FD9A 3LQRA 5KPZA 4RNAA 1NNJA 1QAMA 3C58A 2KKVA 4L16A 3QAUA 2ERCA 5C1BA 3TWKA 4MB7A 2LXEA 1IXZA 3AOGA 4NL4H 5JI2E 2M0NA 2R4EA 3CF6E 2CHQA 2G06A 3CF0A 2CHVA 1YT3A 3SAUA 4IJFA 3K2LA 4LF5M 2H3ZA 4QNRA 4MGKE 4CDGA 4AW4A 4L4UA 1SXJD 1I94M 3NRWA 4GMQA 3SYLA 5IZ7D 3DEEA 4R7GA 5BR8M 4AG5A 4LFBM 4LZZA 3FUUA 2XEPA 1NY6A 1SXJC 4G4QA 1YUBA 4QIWC 4A3VB 3TWLA 1Z59A 2MA1A 2K47A 2ZIVB 3UJNA 4LF9M 3HHXA 3KOZE 2VJ5A 4P0PA 2KZSA 2JH7A 4II7A 4NLCA 4LF7M 2ZXIA 1Z5BA 3U60A 3ZH9B 2CPRA 2RKOA 4BBAA 1ORYB 4GHAA 3NWLA 1NJFA 4QNMA 4DV1M 3HHYA 4DV2M 3AL0C 2DGZA 2K8AA 4B7GA 4DUZM 2CE7A 2Z4SA 3L25A 2G07A 3FYDA 3GLFA 5KQDA 2K4HA 1XC8A 5EP2A 1A6SA 2D6FC 3FTFA 3SAWA 2JH1A 2BDUA 4JYAM 2KV2A 4FCVA 1Q3BA 1IQPA 3GO8A 1TGUA 3LVVA 3CP8A 2Y0TA 2CEAA 2DWZB 2Y20A 1DGGA 3F53A 3PSIA 3U6CA 2AHMA 3KS4A 1HQYE 4JI6M 2QBYA 2LYBA 2RHFA 1XNSA 3TQSA 1YE9A 2OQ4A 4M9SA 3VC8A 3T1YM 4LRSA 1PVQA 2R65A 1N32M 4LJ4A 2J7OA 5FTJA 3FUVA 4JI0M 1J5EM 4IC9A 4M9ZA 4BJQA 2DXIA 4YY3M 1HR0M 1P7DA 1TH4A 3JR5A 1GKIA 4M9XA 3A45A 5ITTA 2H3FA 5KO3A 5ITUA 5EXSA 4Z6YA 2DWLA 2C98A 4C0ZA 3H0LB 3VFDA 2UUBM 5GKNA 3GQ4A 3J27B 3DZDA 4AKGA 4OO1J 1IM2A 1IXSB 4U7CA 5FTLA 3VDPA 1IN7A 3H0RB 4DV0M 1XMOM 4NRVA 4DV5M 2K89A 4QHTA 1TH2A 4IBEA 3GP1A 1NNUC 2RGHA 1IN5A 2K4EA 2WB1C 3FUTA 1Q3VA 3PSPA 4KLNA 4ZPXA 1QQWA 2KRUA 2Z3XA 4GKKM 3NUQA 5EQTA 2XICA 3A98B 2YX8A 2ZIXB 4OJPA 4LJ7A 2DWMA 3HU2A 1DGFA 3DA1A 5DYIA 3AOEC 4QOSA 2ZIUB 2HBKA 3TL4X 1QZMA 3UGJA 4I8OA 3D8BA 4KO8A 5EP1A 1ECWA 1OFHA 2G5GX 4CISA 3C29A 4GITA 2G5HB 2EA0A 2KEBA 3GQ3A 2PMZF 4WW0A 4FWHA 1OFIA 4OVZB 1Q3UA 2UXCM 4DR2M 4IBJA 2F2AB 4X62M 2K8CB 3LQQA 4AYBC 3M0EA 2NQ8C 4O3MA 2KA6B 2FOIC 2Y0SF 2KJ9A 1XXHA 5IWAM 3SARA 2H3IA 3HJQA 1Q39A 2CUZA 2ZBKB 5IREB 3SQIA 4IJEA 3SAVA 1G59A 2F8LA 1L2CA 4I5SA 2BNKA 3U6SA 2HCBA 1ZAEA 3HKPA 1G3IA 2DZOB 4JI8M 3MK6A 1IY2A 2G0AA 5LMUM 2HHHM 1IN4A 3AQEA 3QWLA 3SMSA 3WHLA 1L1ZA 3SAHA 3SBJA 5KPTA 4G4OA 3GLHA 3MJ5A 4Z8XA 4DUYM 1ZQ9A 2D7GA 4FZNA 4KODA 2VIXA 4G4RA 2J7NA 2XSZD 4GC5A 2ZIWB 3KS8A 3E4RA 2JGAA 3E9SA 4DV3M 4D81A 4OJOA 4B08A 3LVWA 1TDHA 4MGZE 4W5WA 2KJ8A 2OH2A 3RFWA 3E0FA 4ITQA 1TH3A 1HNZM 2ZM6M 4GIPA 4OJ6A 3KXEC 3IG5A 3KDSE 3SASA 3AV0A 3KP1E 2E5LM 4IBDA 1T94A 2F5NA 1GLNA 8CATA 1SXJA 4FCWA 1A0PA 2E1FA 4G6ZA 1K82A 3VKHA 1GO3F 4KX5A 4AI6A 3HGIA 1DO0A 2A3VA 4DV4M 5A2QS 4NSOB 3RF9A 2FFJA 2XH9A 3NBIA 3R8FA 1R2YA 1MA7A 4LRTA 5KL8B 4ACOA 4AG6A 2GOLA 4DR3M 5ITYA 3L27A 3GLIA 3U5ZA 2Y21A 4NRWA 1PVPA 2F5PA 3K92A 2XLJA 4KX3A 3EIEA 3EIHA 4LJ9A 4R3DA 1QAOA 2XF3A 3J2PB 1S3SA 4NV0A 3JR4A 2OM6A 3U61A 3FKEA 2CFOA 3JAMS 2K4IA 4BX9C 5EJCA 1W5TA 1E9RA 3KW6A 5FTMA 5KQ8A 4FE3A 1J09A 3A42A 1TDZA 1IBKM 3U6LA 1H6UA 4QNLA 4PD2A 4KMOB 2I7PA 1DGBA 5ITQA 3DOAA 3GLGA 2F76X 3HKZF 2C99A 1IBLM 4NXNM 1DGHA 4RF0A 2CV0A 3UMMA 4LJAA 2KKPA 4GKJM 2KIWA 3PFIA 2FNAA 4G4NA 3SAFA 1F44A 3L28A 3UK6A 2OPFA 2DWNA 2W82A 4LJ5A 2F5OA 4B3RM 2PMZC 2G5IB 2OYYA 3M6ZA 3T15A 3GRYA 2F5QA 2R46A 1Q3CA 3GPYA 3SMVA 1C1KA 5C18A 4LFCM 2HBMA 2QENA 2L09A 2DQNB 3ONNA 4P0QA 1X37A 2Y0SC 1KFVA 4LZJA 2XIDA 1QAQA 4P16A 4JV5M 4P0PB 2C9OA 1HNWM 4HLQA 4IBIA 5FSWA 2DVWB 3TPZA 4LJ6A 4LJ8A 2LKYA 5C0YA 3H4MA 3U60B 4IBGA 4LF8M 1FNNA 4OU7A 3F2DA 3HU1A 4YHHM 2VJ4A 2F4VM 1J7KA 3SYKA 1MX0A 2NV3A 3L26A 2HKJA 3M7DA 3GLFB 4FZLA 3HWSA 2CV1A 1Z19A 2W7OA 3N7SC 3RGSA 2Z4RA 4PT5A 3DFZA 3U6MA 2QP9X 3J81S 2W04A 3MGVA 3PSTA 5A0LA 2DZNB 3AOEA 3FTCA 1SXJE 3KSJA 2V1CA 2V1UA 1WXQA 1Z6TA 5CRXA 3HU3A 2C5RA 5DNYA 3T38A 3K8ZA 1L1TA 1OJLA 2KICA 3W0FA 1Z1BA 1IY0A 4JI4M 3T1HM 2QBYB 3GPXA 5IT9S 5DYGA 2I7NA 3U6DA 4AYBF 3B9PA 3VCBA 1NY5A 3RGPA 4LGMA 1L6NA 1URJA 3J7BA 1NHGC 2ZG6A 3D2SA 3HJSA 3PNVA 2UXDM 1NVMA 4JI5M 2EO2A 2QCUA 1UM8A 1QVRA 4JI1M 2MRLA 4NLBA 4IBBA 4FCTA 5F3WA 2C96A 4MGIE 1JR3D 3BOSA 3WHKA 1HEKA 2KNJA 3CTWB 2YR0A 3ALRA 1TAMA 2KJ5A 2XVTA 3K1ZA 1NHWC 4FW9A 3U6OA 4OW0A 5ITRA 2KHQA 2Q4TA 2HOIA 2KVCA 5HR7A 2KOBA 4JXJA 4PL2A 3VK8A 5HR6A 4IBCA 1E94E 2R45A 3D2NA 4BB9A 2ZAOA 4L8RC 4X66M 4JI2M 1MU5A 5EXTA 2KHVA 5EXXA 2CV2A 2LYAA 1IXRC 2P5TA 3OPXA 1EE8A 4AQYM 1IY1A 1R7RA 3RE8A 5JI3E 4MM3B 3HKZC 2M60A 1IIPA 3AQFA 2RP5A 3GZFA 3M6KA 3SAGA 4FWGA 3A46A 3U6PA 1I4WA 4MGYE 4DR5M 4WURA 3TE6A 3HJ8A 4QOZC 3L2AA 2W7PA 5KPRA 2UXBM 1PJJA 1JQJC 4OJ5A 1L2BA 3ZCBB 4I81A 1N75A 3M6AA 4IIWA 4CHTB 2ZIVA 1XXHB 4CRXA 2XGNA 1N34M 4HL4A 1KYIA 3GRRA 1XMQM 3CF2A 3GU3A 3SFZA 2ZAMA 4GFJA 2EUCA 3GPUA 4L15A 3ZC7B 7CATA 2FE8A 4ICAA 4QHSA 5EP4A 1G8PA 2LH0A 3GQ5A 1PM5A 3KSXA 3N7RC 2N1RA 1GVNA 1ZQ1C 3OTOM 3GLHB 4JI3M 2UU9M 4M0WA 2H3VA 4CGZA 1IN8A 2ZANA 2CHGA 5FTNA 1HNXM 4LG2A 1UPHA 5KL1B 1DO2A 3AJIB 4KHPM 4X64M 2UUCM 4CGYB 1N77A 2VQEM 1N33M 5EXPA 1HQCA 2CRXA 1PVRA 4JMUA 4JN6A 3C28A 1XNRM 2XZFA 2L6OA 1K3XA 2YNMD 2BJWA 3D2QA 2O5RA 2G09A 2C9CA 3H0MB 4XBOA 3M7GA 2RGOA 1KSFX 4FWDA 4MH0E 2VQFM 4JI7M 4BLCA 2E1EA 1XWIA 2D7EA 1E9SA 4DR4M 1W5SA 1SXJB 4B3SM 4LGYA 2JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7J A;  2R18 A; 
#chains in the Genus database with same CATH topology
 2Q0Z X;  9ICO A;  3VKG A;  7ICI A;  1N60 A;  2BWE A;  4BUG A;  9ICA A;  4L78 A;  3FTE A;  2D8C A;  4I4L A;  5CEH A;  2G8L A;  3M1Y A;  1VDL A;  3PVX A;  5ITX A;  3KKA A;  2X4A A;  1OUQ A;  4UB8 U;  4AKI A;  2HBJ A;  3UQ0 A;  3Q8X A;  3PSF A;  3C2M A;  2D7H A;  2HBL A;  5ALL A;  1YSY A;  3SHG B;  1Z5A A;  3KFU G;  3NGD A;  2ZIU A;  4I2E A;  3W67 A;  3AFH A;  3GLG B;  4RQ0 A;  3CGW A;  2HVI A;  2DWQ A;  3TAR A;  4RZR A;  4BXO A;  8ICA A;  4M0D A;  4DSE A;  4DFP A;  8ICS A;  5EP3 A;  3J7A S;  1X42 A;  4IBF A;  1NJZ A;  3VDU A;  3H4J A;  3K1J A;  1TF0 B;  5AKL A;  3QX7 A;  1N78 A;  3RJH A;  4IRC A;  3J80 S;  2QB0 A;  4QIW F;  3ISC A;  2R8H A;  1S0O A;  2ZUB A;  4PDI A;  3RR8 A;  4EIW A;  2HL7 A;  2ZUD A;  4KLM A;  1FJG M;  2LPE A;  2UVW A;  1T43 A;  4IR9 A;  3MHV C;  4QZ9 A;  1Z1V A;  4BDP A;  3SAT A;  2EZY A;  5EWF A;  3IG8 A;  1L2D A;  4EEN A;  1QUS A;  1KBU A;  5AI6 A;  3HX0 A;  2QZ4 A;  2X8A A;  9ICH A;  4PH5 A;  4K4G A;  3THV A;  4EEY A;  4JK1 A;  4LFA M;  2Y0Q A;  3M9M B;  4GC7 A;  3SR6 A;  4FZM A;  4LVS A;  5HML A;  2MR9 A;  2F5S A;  5KFA A;  4KLS A;  1PJS A;  5FTK A;  3QUB A;  5KG1 A;  1NK4 A;  3SHF A;  1IXR A;  2A5Y B;  2DKX A;  2UUA M;  1TR8 A;  4M6W B;  4AKH A;  4ED2 A;  4KTQ A;  2XZU A;  2XFT A;  3UMC A;  1E32 A;  4US9 A;  2ZXH A;  2JY7 A;  4K4H A;  3Q8M A;  3KZX A;  2BKE A;  1WGN A;  4OJL A;  3MDC A;  4CJ6 A;  4LCB A;  1HUZ A;  2RRU A;  3ZDA A;  1NOM A;  3WK6 A;  4XRH A;  2YQZ A;  4P4O A;  5KFN A;  4A8E A;  2GH1 A;  4I2D A;  1WUD A;  3U6E A;  3AKZ A;  4Y2S A;  1V33 A;  3RFA A;  3BZK A;  1V97 A;  4ECQ A;  4DR1 M;  2WAQ C;  3UQ2 A;  3PW7 A;  2RRD A;  1XSL A;  4P2H A;  5IIK A;  3AU6 A;  2IBK A;  4Q45 A;  4QZD A;  4L16 A;  2ERC A;  3KTQ A;  4C8M A;  2LXE A;  5AI5 A;  1Z00 A;  3PO5 A;  4B9N A;  3SAU A;  3B7Q A;  4LF5 M;  1ZQW A;  4QNR A;  3PW4 A;  4MGK E;  2KZZ A;  3NRW A;  1C7Y A;  4GMQ A;  2LMR A;  4R7G A;  4LFB M;  2FPM A;  4DSK A;  4YMO A;  3UM9 A;  4TUQ A;  2XEP A;  2LYH A;  3L5K A;  1DV0 A;  3HPO A;  2ZJ8 A;  2Z8Y M;  1JR3 E;  5J0S A;  1Z59 A;  3JPT A;  2MA1 A;  7ICS A;  1KFS A;  3SV4 A;  2NRV A;  4NM1 A;  4LF9 M;  5KFO A;  2YMM A;  2HHS A;  2WF8 A;  4BBA A;  4F50 A;  9ICS A;  4GHA A;  2K8A A;  2VA8 A;  5J0U A;  3B0X A;  1SXE A;  2CE7 A;  3FYD A;  4P4M A;  5KQD A;  2HHW A;  1ZQN A;  1QSS A;  1V92 A;  3IHP A;  1XC8 A;  3MR6 A;  3FTF A;  3SAW A;  4QZH A;  4DS4 A;  1V9P A;  4JYA M;  9ICC A;  1IQP A;  1QZE A;  1TGU A;  3LVV A;  3CP8 A;  5BOM A;  2CEA A;  2LTU A;  1KW4 A;  1OTR A;  5J0W A;  3F53 A;  4JI6 M;  2AHM A;  2WSE F;  1HQY E;  2DAE A;  5ALQ A;  3LK9 A;  4I29 A;  1XNS A;  3JPQ A;  2OQ4 A;  2AHO B;  1ZQX A;  2R65 A;  4R8U A;  1N32 M;  1L3T A;  1ZRM A;  5FTJ A;  2IOF A;  4M9Z A;  4DFM A;  3BZC A;  4EYI B;  1JI7 A;  1TAU A;  2DXI A;  4FBT A;  1P7D A;  2IA6 A;  3JR5 A;  4C0Z A;  5KO3 A;  5ITU A;  5EXS A;  4DWI A;  1WR1 B;  2C98 A;  3H0L B;  2FMS A;  3GQ4 A;  4O5C A;  4AKG A;  4USA A;  2R44 A;  1IM2 A;  2OOB A;  2KK0 A;  5AI0 A;  5AM3 A;  5FTL A;  3EYZ A;  2HDO A;  4NRV A;  2K89 A;  5KFU A;  4DFK A;  4PGQ A;  4P17 A;  5KFD A;  1NNU C;  1IN5 A;  5DLG A;  3FUT A;  1KSP A;  2Z3X A;  3PSI A;  3NUQ A;  1NJW A;  4GKK M;  1TK8 A;  1GJT A;  3A98 B;  2MH8 A;  2DWM A;  1PK1 B;  3DA1 A;  1JMS A;  2O25 A;  3AEV A;  4J9M A;  4ED7 A;  1XWL A;  5DBA A;  2EA0 A;  3GQ3 A;  4FWH A;  1K5O A;  1TTE A;  1Q3U A;  3RH5 A;  3EZ5 A;  2K8C B;  3LQQ A;  5IIN A;  1ZQO A;  2W9C A;  4DQS A;  2WTF A;  2KIV A;  3QU9 A;  4MEX A;  4DFD A;  2ZBK B;  5IRE B;  4NL9 A;  1UFZ A;  2IMW P;  3WK4 A;  1ZAE A;  4HAI A;  3TAD A;  4RQ4 A;  2HHH M;  1IN4 A;  3AQE A;  4G4O A;  1T4G A;  1ZQU A;  3QU2 A;  4XQ8 A;  3MBY A;  3HX3 A;  2D7G A;  2OHF A;  3H8J A;  2J5Y A;  2IOH A;  4IQV A;  3PR4 A;  5B5E U;  3B7N A;  4R66 A;  1OIP A;  2EJS A;  4DOC A;  1TDH A;  3E21 A;  3RFW A;  7ICK A;  4ITQ A;  1TH3 A;  2NO4 A;  4NM2 A;  4GIP A;  4OJ6 A;  5ALU A;  3IG5 A;  1KDH A;  3GIJ A;  5DQG A;  2FLN A;  1A0P A;  4G6Z A;  1GO3 F;  7ICU A;  4NSO B;  5EE3 A;  1X40 A;  4LRT A;  4Y2P A;  1D9F A;  4C8K A;  5CB1 A;  1PVP A;  5J2C A;  8ICH A;  1NJX A;  2XLJ A;  3EIE A;  3EIH A;  4LJ9 A;  5DBB A;  1S3S A;  1RPL A;  3TFS A;  3JPN A;  1VJ5 A;  3KOO A;  1U45 A;  2CP8 A;  1L7P A;  4FE3 A;  4F5Q A;  1L3U A;  1H6U A;  5C5J A;  4I2I A;  3B74 A;  1DGB A;  5ITQ A;  3GQC A;  9ICT A;  2CV0 A;  1JUD A;  4C8N A;  1CEZ A;  2KN7 A;  1NI3 A;  5J2E A;  2FNA A;  2K60 A;  4YR2 A;  9ICK A;  3ZQJ A;  4KLT A;  2W82 A;  2F5O A;  2PMZ C;  4Y2R A;  4FFD A;  1Q46 A;  1TFR A;  3T15 A;  1TK5 A;  1C1K A;  5ALZ A;  2L4E A;  3HWT A;  3V7K A;  3GLH E;  1X37 A;  4LZJ A;  2XID A;  2C28 A;  4P16 A;  3SV3 A;  1ZD5 A;  4Y2T A;  4DL7 A;  1HNW M;  5ALP A;  5FSW A;  2LKY A;  4EBC A;  4LJ6 A;  4LJ8 A;  4ED6 A;  3U60 B;  4IBG A;  4LF8 M;  5D49 A;  4OU7 A;  4PZO A;  3SYK A;  4MFA A;  3GLF B;  1PK3 A;  4FBU A;  5DQI A;  3N7S C;  3RGS A;  2W7O A;  1IM4 A;  4FS2 A;  4PT5 A;  3DFZ A;  4I2J A;  2W04 A;  5DB7 A;  1FFV A;  5A0L A;  2DZN B;  3AOE A;  1VDV A;  1IG6 A;  1ZQR A;  2V1C A;  3HRD D;  3SI8 A;  2EDU A;  2HHX A;  1ZMV A;  2C5R A;  2Y9T A;  5KG7 A;  4B9V A;  1L1T A;  2XGP A;  1R4G A;  3W0F A;  4QZB A;  1PUZ A;  1IY0 A;  5DYG A;  1L6N A;  3ZD8 A;  3D2S A;  5EWG A;  4DQI A;  4GIB A;  2QCU A;  4ECW A;  3K9O A;  1J2N A;  4KLL A;  3WHK A;  3H4B A;  2QLT A;  4JWN A;  3W68 A;  2NO5 A;  1TAM A;  3K1Z A;  5AKJ A;  5L9X A;  2ASJ A;  2HOI A;  3LW5 F;  4JXJ A;  2FMQ A;  1RM6 C;  1VQ1 A;  3H8W A;  8ICM A;  1RU3 A;  3BS5 A;  2BPF A;  2KHV A;  2CV2 A;  4B6J A;  4NY8 A;  2P5T A;  2LHG A;  5KFW A;  4UN2 B;  1R7R A;  1CI4 A;  3NVZ A;  4MM3 B;  3HKZ C;  3RB4 A;  4ELU A;  1WYG A;  3GZF A;  3JPP A;  3GV5 B;  3T5K A;  4NLK A;  1I4W A;  1ZQC A;  1BPD A;  3B89 A;  1S5L U;  3UMB A;  3ISD A;  4UBB A;  2UXB M;  5KFQ A;  3T5L A;  2EAP A;  5KFC A;  4I81 A;  1N75 A;  4ECR A;  2VA2 A;  3OSP A;  2ZIV A;  1XXH B;  3Q8R B;  5DLF A;  3UMG A;  1KYI A;  2OWO A;  3GRR A;  4GFJ A;  3ZC7 B;  3NVY A;  2FE8 A;  2K4P A;  5EP4 A;  2JXN A;  1Y8G A;  3N7R C;  2QSF X;  5KFK A;  4DQP A;  1ZQ1 C;  3NBX X;  2UU9 M;  2DNA A;  2H3V A;  2YN4 A;  4G9B A;  1UPH A;  1TVA A;  2CHG A;  2DPJ A;  1HNX M;  4RQ6 A;  9ICB A;  2ZTD A;  2NYV A;  3AJI B;  2ZJA A;  4CGY B;  4QZG A;  1N33 M;  1X6J A;  1PVR A;  5DDY A;  3PML A;  2XZF A;  2L6O A;  1XB2 B;  1ZXI A;  1WIV A;  1K3X A;  3D2Q A;  2O5R A;  4Y2U A;  4ZH4 A;  2JY5 A;  1ARO P;  2D7E A;  5JUM A;  3IDW A;  1SXJ B;  4B3S M;  4UAS A;  4B9U A;  1NSF A;  5HHH A;  1X9S A;  1PRB A;  1IV8 A;  4IQT A;  3RRG A;  4ECY A;  3GPP A;  4GH9 A;  3Q8K A;  4B7H A;  4Z6E A;  4TUP A;  3ZDB A;  2W03 A;  4X65 M;  2H3Q A;  3EW9 A;  1COO A;  1GL7 A;  1TK0 A;  2ZIX A;  4LF6 M;  3FTD A;  1NKB A;  1RXV A;  2GQF A;  5KT7 A;  1BVS A;  1HT1 E;  1OQY A;  3CW2 C;  4Z6F A;  3FM9 A;  3IN5 A;  5H37 D;  3ZI4 A;  3F5A A;  4FS1 A;  3C5F A;  3LYS A;  3TAP A;  1GL6 A;  1JRP A;  4DS5 A;  4OX9 M;  3TWM A;  1AIP C;  4P0Q B;  3CYM A;  3KVW A;  1ZQZ A;  4RF1 A;  1U47 A;  5EOZ A;  3QU5 A;  1SKW A;  4R71 A;  4JB3 A;  7ICM A;  2XY6 A;  2HMX A;  2ESE A;  1NZB A;  4M0A A;  3D8L A;  1SKS A;  2QB1 A;  1DRG A;  4FVM A;  2XO7 A;  4S12 A;  2AGO A;  2H1R A;  2Z7J A;  1UCV A;  4Y2Y A;  2R4J A;  2HOQ A;  2L7H A;  4LY6 A;  2ZIW A;  2KSO A;  4O3R A;  3HHZ A;  2KW0 A;  4AZF A;  2XY5 A;  1AUA A;  5GTI U;  3TI0 A;  4NXZ A;  1K3W A;  1ED1 A;  4GRI A;  3LMM A;  4IS7 A;  2BCV A;  5LMN M;  2CN1 A;  1J2M A;  2XI9 A;  2HW3 A;  1S76 D;  1S8O A;  2HOF A;  3FUW A;  5DGB A;  2F77 X;  1SZH A;  4YCX A;  1NK6 A;  1S9F A;  4F5O A;  4C4S A;  2FH0 A;  1HT2 E;  1WGL A;  2Q2E B;  2E8M A;  4YR3 A;  3F2B A;  3KHH A;  3KD3 A;  5T14 A;  1M6Y A;  5ALY A;  2PKE A;  3KHR A;  1L8Q A;  5KG4 A;  4ECT A;  2BCU A;  2R18 A;  2H5X A;  1VDD A;  2L7I A;  3HP6 A;  3HIL A;  3KFU F;  3KOX E;  2F1H A;  2KVS A;  9ICP A;  5J8Y C;  4KLO A;  3C58 A;  3AM9 A;  1JB0 F;  5AM1 A;  3I1Y A;  3QAU A;  5KFF A;  3TWK A;  4MB7 A;  1ZQA A;  1IXZ A;  4UQG A;  4J9Q A;  2R4E A;  4P4P A;  1RYR A;  3WK8 A;  3CF0 A;  1YT3 A;  2H3Z A;  4CDG A;  9ICN A;  1SXJ D;  2AH5 A;  2HHV A;  2DFL A;  9ICF A;  2FE9 A;  4AG5 A;  4LZZ A;  4XK8 F;  2W3S A;  3V7J A;  2A1J A;  1SXJ C;  4CF5 A;  4G4Q A;  1B22 A;  1X66 A;  4QIW C;  2HHU A;  3TWL A;  2K47 A;  2XCP A;  3UJN A;  2W3R A;  2W9B B;  3HHX A;  4PPX A;  5D46 A;  2QNJ A;  3G6Y A;  1KLN A;  5IIO A;  3QEB Z;  3IHQ B;  4NLC A;  3WK5 A;  4YQW A;  1Z5B A;  2CPR A;  4RQM A;  3NWL A;  1NJF A;  3HHY A;  2DGZ A;  2UVU A;  4YG2 A;  5J0P A;  4B7G A;  4DUZ M;  5AK6 A;  2KNZ A;  9ICW A;  2DAG A;  5EP2 A;  5EE0 A;  3KZI U;  5III A;  4MFC A;  2BDU A;  1Q3B A;  2W9A A;  3OJU A;  2Y0T A;  5AKG A;  3BXW A;  5KAF U;  3QZ7 A;  3U6C A;  3KS4 A;  4UB5 A;  2LYB A;  3TQS A;  5L1J A;  1WWV A;  5CP2 A;  4LRS A;  2KNV A;  4QWE A;  1EIJ A;  1D8L A;  4UAU A;  3FUV A;  5KG0 A;  7ICR A;  4Q8F A;  1J5E M;  4HYK A;  3SEI A;  2BDP A;  1OXJ A;  4YY3 M;  4TUS A;  4PGX A;  5ITT A;  2H3F A;  3RH6 A;  4IRD A;  5KFX A;  1ZJN A;  2LM4 A;  2BGW A;  3VFD A;  5IIM A;  3DZD A;  3Q8Q B;  2FLP A;  1SL0 A;  2ZTE A;  3H8S A;  4PHA A;  3H0R B;  1XMO M;  3N97 B;  2K6B A;  4F2R A;  1TH2 A;  2WF6 A;  9ICJ A;  3GP1 A;  5ALG A;  1T8E A;  3FYH A;  2RGH A;  2K4E A;  4M9J A;  2NRX A;  2R8J A;  2BQU A;  1QQW A;  2YX8 A;  1IFY A;  1KTQ A;  2ZIU B;  2KHH A;  2HBK A;  3TL4 X;  4I8O A;  5DG7 A;  4KO8 A;  1ECW A;  4BXO B;  2B3T A;  4I2H A;  3C29 A;  4GIT A;  2G5H B;  2LM1 A;  1OFI A;  3K1R B;  1NV8 A;  2MJ5 B;  4DR2 M;  4IBJ A;  1ZQL A;  2QQ8 A;  4AYB C;  4ED8 A;  1T7P A;  4J9O A;  4DSF A;  2QB0 B;  3B9J A;  2FOI C;  2F44 A;  4Q8E A;  5DBC A;  1RYS A;  2APL A;  3GLF E;  2AGP A;  2JZ1 A;  3UXN A;  1ZMU A;  4IJE A;  5KG6 A;  2LVA A;  2W54 A;  1U4B A;  4KT0 F;  2BNK A;  2HCB A;  1ZD4 A;  5AM4 A;  2CRU A;  4C4T A;  3HKP A;  2DZO B;  4JI8 M;  5J2D A;  5CR0 A;  3MK6 A;  1IY2 A;  2VF8 A;  3SAH A;  4TQR A;  4Z8X A;  3V76 A;  4O3N A;  1MQ3 A;  1ZQ9 A;  2WSC F;  4KOD A;  4Y2J A;  3GDX A;  4G4R A;  4GC5 A;  1QSY A;  3KS8 A;  4DV3 M;  4D81 A;  3HZJ A;  1TE2 A;  2KJ8 A;  5CJ7 A;  4MFF A;  3E0F A;  1X6I A;  5AHX A;  4UB1 A;  4X5V A;  3KDS E;  3SAS A;  3AV0 A;  3QU7 A;  1T94 A;  3PX6 A;  1T3Q A;  1K82 A;  4KX5 A;  4AI6 A;  3HGI A;  1DO0 A;  9ICR A;  2XH9 A;  3GIL A;  3R8F A;  1FIQ A;  1R2Y A;  4ACO A;  4AG6 A;  3QE9 Y;  1JIH A;  1HUO A;  4NRW A;  3U5Z A;  3GLI A;  2Y21 A;  3K92 A;  3AN1 A;  1S77 D;  4R3D A;  2XF3 A;  2BCR A;  4O0I A;  1XC9 A;  3U61 A;  4RT3 A;  5F3X B;  3MAB A;  1E9R A;  2PFQ A;  1TV9 A;  4DL5 A;  5FTM A;  5KQ8 A;  3A42 A;  4QNL A;  1IBK M;  3U6L A;  3MFI A;  4UAY A;  3EPI A;  2C99 A;  3OHB A;  3RBE A;  4NXN M;  2NRT A;  1DGH A;  4RF0 A;  1Z00 B;  3UMM A;  1XXH E;  3J81 j;  5ALE A;  4LJA A;  4OD0 A;  3RJF A;  4GKJ M;  3C9P A;  5ALO A;  3PFI A;  4G4N A;  3L28 A;  3UK6 A;  3MMP A;  5G5G A;  1S0V A;  2BR0 A;  2KNA A;  1PGY A;  2G5I B;  2JR5 A;  2OYY A;  5KT5 A;  4B9S A;  2UVV A;  8ICC A;  4CF4 A;  4RQ1 A;  4LFC M;  2YY6 A;  3ONN A;  1N2X A;  3QUC A;  1XU4 A;  5JU5 A;  1LTM A;  2C9O A;  5KTQ A;  2DVW B;  4EYH B;  2XCA A;  3HU1 A;  2VJ4 A;  3KKA C;  2NV3 A;  8ICP A;  2BPG A;  3C3E A;  1NK8 A;  2HKJ A;  3H40 A;  4FZL A;  3HWS A;  2CV1 A;  5KFR A;  3U6M A;  3J81 S;  3MGV A;  2HHT A;  3FTC A;  1SXJ E;  2QAR A;  3KSJ A;  1O08 A;  8ICG A;  1VG5 A;  3SZ2 A;  1WXQ A;  1Z6T A;  2LVN C;  5F9L A;  5KFM A;  3UPQ A;  4DO9 A;  3V6K A;  5IIL A;  1OJL A;  2KIC A;  5G5H A;  4ELT A;  3L4P A;  4QZE A;  3B9P A;  5DB6 A;  1NY5 A;  3WKC A;  4BGD A;  1URJ A;  2FLL A;  3MDA A;  3HJS A;  3PNV A;  1MN3 A;  4JI5 M;  5KFT A;  4CNQ A;  4JI1 M;  2MRL A;  4XUS A;  1NKE A;  1ZD3 A;  5F3W A;  2C96 A;  4MGI E;  3BOS A;  1HEK A;  1B4F A;  2KNJ A;  2NRW A;  3BQ7 A;  3ALR A;  4KN4 A;  4F4X A;  1N63 A;  8ICB A;  4BWJ A;  4OW0 A;  4I2F A;  2KHQ A;  4UW9 A;  2BZF A;  2KVC A;  2B0C A;  2Y1J A;  4DOA A;  5HR6 A;  2R45 A;  2HHQ A;  2ZAO A;  7ICV A;  4IQW A;  1LKY A;  3H4D A;  5EXX A;  1IXR C;  1IY1 A;  1V85 A;  4ECZ A;  5AIA A;  2JZB B;  2ATL A;  5JI3 E;  2L4F A;  5AKX A;  5F9N A;  5KG5 A;  2ASD A;  1X9W A;  3M6K A;  3SD7 A;  2RLT A;  4FWG A;  3A46 A;  3U6P A;  2GO7 A;  2HI0 A;  2WF9 A;  5ALN A;  7ICF A;  3TE6 A;  3HJ8 A;  4YXJ A;  2DAM A;  3L2A A;  2D3D A;  2RDI A;  4C7Y A;  1PJJ A;  5J2F A;  3M6A A;  5KFE A;  8ICE A;  5JTI A;  2W9C B;  4CHT B;  4KLI A;  4CRX A;  2XGN A;  2FPK A;  4HL4 A;  2C22 A;  5KFI A;  1NO1 A;  2DAI A;  4WP2 A;  1YZ7 A;  4F71 A;  4E0D A;  4F3O A;  3GU3 A;  4Z6D A;  3LCV B;  3SFZ A;  2EUC A;  4ICA A;  4L15 A;  7CAT A;  1SV0 A;  2ISP A;  1G8P A;  2LH0 A;  1ZQM A;  3WK9 A;  8ICO A;  2PFP A;  2N1R A;  4PHD A;  5KFB A;  4CGZ A;  4G3I A;  1OAO C;  4LZG A;  2ZAN A;  3RJK A;  4QZA A;  1FEZ A;  4PZN A;  4X64 M;  3NS1 A;  1N77 A;  2F3N A;  8ICZ A;  2ZUC A;  2EKK A;  4RNN A;  3C28 A;  1XNR M;  4RPY A;  5AKK A;  2YNM D;  2BJW A;  2G09 A;  1JAL A;  1RG6 A;  3ZDC A;  2KG5 A;  2VQF M;  3R9K A;  1S97 A;  4BLC A;  3GPU A;  4F2L A;  4FD2 A;  3THG A;  4PDG A;  2B6G A;  4NOO B;  1SKR A;  1ZJM A;  1CRX A;  2K8B B;  1Z5C A;  1WCN A;  5E26 A;  4DV6 M;  2OXO A;  1L3S A;  1T3T A;  3QNM A;  3GII A;  3WK7 A;  9ICQ A;  3KP0 E;  4DFJ A;  2V9W A;  2L5Y A;  3GFK B;  5TIS U;  4AP9 A;  2ASL A;  3HHW A;  1D8B A;  2YFQ A;  9ICX A;  1QAN A;  4DR7 M;  3D6J A;  3E2E A;  1XHB A;  4K0K M;  4D80 A;  3IM1 A;  4EEK A;  5AKH A;  5GTH U;  1N62 A;  4U6P A;  3KOY E;  4LF4 M;  2KXE A;  3HT3 A;  1ZQS A;  3E46 A;  1JRO A;  4OVZ A;  1Z3E B;  3T79 A;  1Z4O A;  3FUX A;  2I1Q A;  3NVW A;  4DQQ A;  4C8O A;  3SC3 A;  1B43 A;  1L5U A;  2VA3 A;  3FYC A;  2LWX A;  3GRU A;  1IBM M;  5AI4 A;  3TKA A;  3BBZ A;  5J0Y A;  1UQV A;  1X9M A;  4O5E A;  3VK7 A;  2N35 A;  5L1L A;  4GHL A;  2AU0 A;  2DHR A;  3L3F X;  3I51 A;  4PCZ A;  1XNQ M;  2JMG A;  2LHT A;  2C2R A;  4MGH A;  1HIW A;  3FRI A;  1JR3 A;  2JA2 A;  3Q8G A;  3RB3 A;  2R8G A;  3ZDD A;  7ICH A;  3PZP A;  2WHE A;  1QDR A;  5J2I A;  2JEI A;  2XFS A;  1NV9 A;  1LV7 A;  4YMM A;  1QCK A;  3WKB A;  5K4L A;  4XGI A;  1JN3 A;  4UB4 A;  2J6U A;  4DR6 M;  4B7F A;  4IQU A;  1V34 A;  3SMP A;  2F8K A;  2LNH C;  2VII A;  3T5H A;  4EZ6 A;  4EX7 A;  2XSZ A;  5AIB A;  1L8O A;  4C4R A;  4RU9 A;  3UZU A;  5ITX E;  4NXM M;  2KZ3 A;  4B3M M;  1SL2 A;  8ICF A;  3BDP A;  4DLG A;  3KBB A;  3C3D A;  4IBK A;  2E5S A;  5HNK A;  3L29 A;  3I4Y A;  4NL9 C;  4UAR A;  4J9L A;  3KOW E;  3IP4 B;  4B3T M;  4R64 A;  4REZ A;  4M04 A;  4ELV A;  1D2N A;  1KEJ A;  5FLX S;  2KEY A;  5AKZ A;  4RQ7 A;  2QKQ A;  4M9G A;  3PVS A;  2BQ3 A;  4GEW A;  5AK5 A;  3TAD C;  1R2Z A;  4F8R A;  2R0I A;  2WB1 F;  2X49 A;  4TUW A;  3FD9 A;  3V6H A;  4J9R A;  2E8N A;  1NNJ A;  1QAM A;  2HAK A;  2KKV A;  5C1B A;  3BS5 B;  3AOG A;  4RKU F;  3V7L A;  2CHQ A;  2G06 A;  3C2K A;  4OCZ A;  2CHV A;  2CXY A;  4O5K A;  8ICU A;  4YR0 A;  5KFV A;  1XSN A;  2FPL A;  3SYL A;  5IZ7 D;  3DEE A;  1F4I A;  5BR8 M;  1L7O A;  4LZD A;  1Y88 A;  3BQ1 A;  4RNO A;  3PV8 A;  1NY6 A;  4KLH A;  1NK9 A;  2M9N A;  3FRH A;  2FS1 A;  2ZIV B;  3KOZ E;  2VJ5 A;  3K75 D;  3WKD A;  5AK3 A;  1QSL A;  2KZS A;  1F5S A;  2JH7 A;  1JXL A;  4P0P A;  4LF7 M;  5E79 U;  3RB6 A;  2DPI A;  1ORY B;  1YLA A;  7ICQ A;  4QNM A;  4FO6 A;  5AM2 A;  5J0T A;  1ZET A;  2Z4S A;  3L25 A;  3ETR A;  1ZQH A;  2CWB A;  8ICT A;  3T5J A;  3FAH A;  2D6F C;  1SWV A;  2JH1 A;  1OKS A;  4YVZ A;  3LWL A;  4ED3 A;  3GO8 A;  1P3Q Q;  1NJY A;  2Y20 A;  1DGG A;  5HP4 A;  2JP7 A;  4KMU A;  2RHF A;  2QBY A;  5J2A A;  4M9S A;  3VC8 A;  4Z6C A;  3TAC B;  9ICG A;  4DBG B;  2AXT U;  4LJ4 A;  2J7O A;  3F92 A;  4DL6 A;  5TZV A;  4JI0 M;  4BJQ A;  1ZQT A;  4IR1 A;  4NLG A;  1GJS A;  1ZQG A;  3A45 A;  2LVQ D;  4ECX A;  4Z6Y A;  2DWL A;  1ZQB A;  2UUB M;  3QU4 A;  3RR7 A;  3J27 B;  4OO1 J;  4O3Q A;  1IXS B;  5J2K A;  4U7C A;  3VDP A;  2AQ4 A;  1IN7 A;  4DV0 M;  7ICE A;  4QHT A;  2WF7 A;  1VEG A;  5KFL A;  4KLN A;  4ZPX A;  5EQT A;  2XIC A;  2MU2 A;  2W11 A;  2ZIX B;  2HWJ A;  4OJP A;  4UAT A;  4F92 B;  4LJ7 A;  2WFA A;  2BCS A;  1DGF A;  3AOE C;  4JUZ A;  1S0M A;  3UGJ A;  1QZM A;  1D0K A;  2MUT A;  2VDB B;  3D8B A;  2YQE A;  3OGU A;  2G5G X;  2J6S A;  3HW8 A;  1CUK A;  2YML A;  2GLE A;  1DXS A;  3M9N B;  3RH4 A;  4RUC A;  4K4I A;  5J2J A;  3ETL A;  2UXC M;  3GIK A;  2B21 A;  4X62 M;  4CIZ A;  4G3O A;  4RQ2 A;  4EBE A;  2Y0S F;  2KJ9 A;  3ZD9 A;  2H3I A;  4F4Y A;  3C21 A;  3HJQ A;  2EAO A;  2CUZ A;  1RXW A;  1G59 A;  1UA0 A;  3T3F A;  2HVH A;  1KL9 A;  5DGA A;  1G3I A;  3FC4 A;  3QWL A;  3SMS A;  3WHL A;  1L1Z A;  4NLN A;  5KPT A;  3GLH A;  1NZP A;  5ALR A;  1A76 A;  3RAX A;  4DF8 A;  2VIX A;  2J7N A;  2XSZ D;  5J29 A;  2VAN A;  2ZIW B;  2KSO B;  1KKX A;  3E4R A;  5DQH A;  2O6K A;  3E9S A;  4QZ8 A;  5ALK A;  3LVW A;  4KIT B;  4MGZ E;  1BNO A;  2EAM A;  1KFT A;  1KFD A;  3IV6 A;  3QUT A;  3KXE C;  4Y2X A;  3KP1 E;  2E5L M;  1H38 A;  4O3O A;  1BPY A;  4IBD A;  2F5N A;  4FCW A;  5ALS A;  2C2D A;  4I2B A;  4RNM A;  2A3V A;  4YP3 A;  4DV4 M;  5A2Q S;  3RF9 A;  4C80 A;  2JUJ A;  4Q7J A;  4DR3 M;  5DB9 A;  3L27 A;  1DK3 A;  3C23 A;  3WU2 U;  1RZT A;  1SIJ A;  4KX3 A;  4GC6 A;  5DDM A;  3J2P B;  5CA7 A;  1BPZ A;  4NV0 A;  3QYE A;  1L3V A;  3JR4 A;  3B0Y A;  2K4I A;  2CFO A;  3JAM S;  5KG2 A;  1W5T A;  1ZQQ A;  3KW6 A;  3SEN A;  2PXI A;  1UT5 A;  1J09 A;  1TDZ A;  2AJQ A;  1S10 A;  2I7P A;  5AKE A;  1KRP A;  3GLG A;  3LDA A;  1IBL M;  5KFG A;  4KLD A;  2DKL A;  1RQN A;  4KN7 A;  2XGQ A;  1NK5 A;  2AQ0 A;  1F44 A;  1ZQD A;  3SAF A;  4GXJ A;  2OPF A;  2DWN A;  4LJ5 A;  5J0X A;  3SYZ A;  4KLG A;  3ED5 A;  3N4M B;  3M6Z A;  3BQ0 A;  3GRY A;  2F5Q A;  3TAQ A;  2A1J B;  3SMV A;  5C18 A;  3ORY A;  5DG8 A;  5IIJ A;  1QUT A;  2HBM A;  3PX0 A;  1NK0 A;  1N5W A;  4IBI A;  5C0Y A;  5J0O A;  3C1Y A;  1FNN A;  4YHH M;  1J7K A;  3I01 M;  1MX0 A;  3CNH A;  3L26 A;  3M7D A;  3E58 A;  4ECV A;  3RJE A;  2P6R A;  3AU2 A;  4KLQ A;  1Z19 A;  4F2S A;  8ICL A;  4QZF A;  5DKW A;  2W55 A;  3PST A;  2I5H A;  4ZOH C;  4M6W A;  4J9S A;  2V1U A;  1DK2 A;  3K9P A;  2FI1 A;  3T38 A;  3K8Z A;  1PJQ A;  3ISB A;  2JV3 A;  5EWE A;  2FDR A;  5J0Q A;  1Z1B A;  5IT9 S;  3GPX A;  4DSI A;  3JPR A;  3U6D A;  4AYB F;  3PO4 A;  3VCB A;  1N61 A;  3MR2 A;  3J7B A;  1NHG C;  5KFJ A;  4Q44 A;  4HEO A;  8ICN A;  4RT2 A;  2UXD M;  4RQ3 A;  4QW9 A;  1NVM A;  4NLB A;  2EO2 A;  1UM8 A;  1QVR A;  9ICV A;  5HHI A;  4IBB A;  4FCT A;  2JEF A;  4YN4 A;  1L7M A;  5KG3 A;  4Y28 F;  4UAV A;  1BNP A;  3CTW B;  4KLU A;  2XVT A;  1NHW C;  4FW9 A;  3U6O A;  2JZ0 A;  4C7Z A;  5ITR A;  3M8S A;  5L1K A;  4J9K A;  2LI6 A;  2C2E A;  4PL2 A;  4IBC A;  4BB9 A;  1X2I A;  4X66 M;  4JI2 M;  2JXJ A;  4GLX A;  1MU5 A;  4RPX A;  3MGI A;  2DEN A;  5AM5 A;  2LYA A;  3FDS A;  3OPX A;  1EE8 A;  3RTV A;  2DZL A;  2JY6 B;  3RE8 A;  2M60 A;  3AQF A;  2RP5 A;  4EZ9 A;  3SAG A;  2RQ5 A;  2O01 F;  1SWW A;  4WUR A;  1NNL A;  3IRU A;  1OIZ A;  2PFN A;  4F5P A;  5KPR A;  1SZP A;  4OJ5 A;  2XC9 A;  3GV8 B;  4O9M A;  4JV1 A;  4B9T A;  4IIW A;  5CWR A;  3I04 M;  3WKE A;  4MF2 A;  3QYP A;  3HY5 A;  1UT8 A;  1QLN A;  3BQT A;  4F72 A;  2G3Q A;  2ZAM A;  1TAQ A;  3K4G A;  5EE9 A;  5AIC A;  2IOF K;  3M8R A;  4DCC A;  1PM5 A;  4XA5 A;  4JV2 A;  7ICJ A;  1GVN A;  2DUY A;  3OTO M;  3IEC A;  5FTN A;  1Q02 A;  4LG2 A;  2HSZ A;  5JRT A;  1C20 A;  5DG9 A;  1DO2 A;  2UUC M;  2LVO C;  9ICL A;  2CRX A;  3B7Z A;  3RBD A;  2W8K A;  2V4Q A;  2MGW A;  7ICL A;  2YMQ A;  2R8K A;  3UXP A;  2C9C A;  2P66 A;  3H0M B;  3N28 A;  1T3N A;  2RGO A;  4FWD A;  2PI5 A;  5D4B A;  2ZJ5 A;  1N48 A;  2E1E A;  1XWI A;  2EZZ A;  1E9S A;  4DR4 M;  1W5S A;  2A19 A;  4CCH A;  5H2F U;  2JHD A;  4EEL A;  3RRH A;  4UB6 U;  3C5G A;  1XO0 A;  3O0F A;  4B9L A;  3GRV A;  3U5Z B;  3GLI B;  1Z4N A;  4J9P A;  1QDT A;  2WAQ F;  1WCL A;  4YXM A;  2DBY A;  3F5E A;  1B0X A;  1FFU A;  4LJX A;  2ZTC A;  2R8I A;  2DI0 A;  1ZYQ A;  3AL0 B;  2LBC A;  1R6B X;  3U61 B;  5L8R F;  2LBO A;  2V6Z M;  1MQ2 A;  3PW0 A;  2K0B X;  1G4A E;  2YB1 A;  3Q8L A;  1GO5 A;  2BJV A;  4DV7 M;  1SXD A;  2R62 A;  5J2H A;  1PK1 A;  1ZMW A;  3PXG A;  4UB2 A;  1AQ6 A;  1DGH B;  3ICX A;  1PJI A;  2QPA A;  3OJS A;  3U6Q A;  1A77 A;  2G08 A;  4WJ3 B;  1NJG A;  1UHU A;  4QJF B;  4PGY A;  2RDJ A;  3BQ2 A;  1BPE A;  3PNY A;  1ZQV A;  3HJE A;  4TQS A;  3BS7 A;  3W0L B;  8ICQ A;  1N36 M;  5B66 U;  4R8U B;  5ALI A;  1LV5 A;  1SB3 C;  2F1I A;  4PL1 A;  4UBC A;  3C2L A;  1GAB A;  5FP0 A;  5ALM A;  1WWU A;  1G41 A;  1IN6 A;  1ZQP A;  2W8L A;  3AMZ A;  3OTQ A;  4YD1 A;  2KDL A;  4D82 A;  1JX4 A;  4MEY A;  5DB8 A;  4US8 A;  1MC8 A;  4Y2V A;  4I2A A;  3MGH A;  3CRX A;  2F1J A;  3C1Z A;  2JZB A;  3PR5 B;  4PJ0 U;  5BOL A;  3I4V A;  1EFU B;  2KRK A;  3EUB 2;  3OHA A;  1J97 A;  2A1A A;  3NRZ A;  4F93 B;  4NLZ A;  2QAR B;  3ILK A;  4O3P A;  4DSL A;  4QWB A;  1QYR A;  5ALJ A;  3VLF B;  3KHG A;  3G6X A;  2KD1 A;  3N7P D;  3H7I A;  4GC9 A;  5E6J A;  1OAI A;  3V72 A;  3MFH A;  3FE3 A;  4NWI A;  4DOB A;  3RAQ A;  2YB4 A;  2M5Z A;  4NSR A;  5AKI A;  2DF4 B;  5BPV A;  1MN8 A;  2VKQ A;  5ALX A;  4PHE A;  1YZ6 A;  4M9L A;  1U48 A;  2WZJ A;  4F4W A;  3PY8 A;  2KZU A;  1XO1 A;  4DF4 A;  3PMN A;  2FJ6 A;  3F2C A;  1K1Q A;  3R9X B;  5CHG A;  3QYB A;  4DL4 A;  4TUR A;  3LQR A;  5KPZ A;  4RNA A;  2GNO A;  8ICY A;  1LKY B;  3GV7 B;  5JI2 E;  4NL4 H;  2M0N A;  3EPG A;  3JPO A;  1N56 A;  3CF6 E;  3M9O B;  5ALV A;  1N5X A;  8ICX A;  4IJF A;  3K2L A;  4UAW A;  1NK7 A;  2IHN A;  4AW4 A;  4L4U A;  1I94 M;  9ICE A;  2YMP A;  2BHN A;  3AUO A;  3G6V A;  4EBD A;  4L6V 6;  4UAZ A;  3FUU A;  1BGX T;  4DEZ A;  3LWM A;  1YUB A;  3QXG A;  4A3V B;  2E8P A;  5EE1 A;  4ED1 A;  2ES6 A;  3QEA Z;  1TKD A;  1V38 A;  8ICK A;  4II7 A;  1G71 A;  2ZXI A;  3U60 A;  3ZH9 B;  2RKO A;  1SL1 A;  4DV1 M;  3AL0 C;  1WHC A;  4DV2 M;  2DKZ A;  1DGS A;  4M47 A;  2G07 A;  2K4H A;  3UXO A;  3GLF A;  2J6T A;  4NC6 A;  8ICJ A;  3KHL A;  1A6S A;  4B9M A;  4IL6 U;  2OOA A;  2ALZ A;  2KV2 A;  4FCV A;  4QW8 A;  1ZQJ A;  2W43 A;  5HMM A;  2I9G A;  2DWZ B;  4KLE A;  1QH9 A;  9ICI A;  4F91 B;  3T6P A;  2GWS A;  2NRZ A;  1YE9 A;  3DV9 A;  2P35 A;  3T1Y M;  4I28 A;  1PVQ A;  1LVH A;  4IRK A;  5KAI U;  4IC9 A;  5J2B A;  1HR0 M;  1TH4 A;  1ZRN A;  1GKI A;  4M9X A;  1WJ7 A;  4QZI A;  5GKN A;  1HJP A;  4MF8 A;  2KFZ A;  2OO9 A;  3NTU A;  3V6J A;  4DV5 M;  4IBE A;  2WB1 C;  1Q3V A;  2W9M A;  3PSP A;  3A0H U;  4RPZ A;  4KLJ A;  3RB0 A;  2KRU A;  2E8O A;  4I27 A;  3HU2 A;  5DYI A;  4J9N A;  3RJG A;  4QOS A;  1Q8K A;  4ANR A;  3U26 A;  1S0N A;  1XS9 D;  1RDF A;  4F5N A;  5EP1 A;  4DL2 A;  2EZX A;  1OFH A;  4CIS A;  1KN5 A;  2KEB A;  1QTM A;  2PMZ F;  2JEJ A;  4WW0 A;  5ALT A;  2LHC A;  1QQ7 A;  4OVZ B;  2KE7 A;  3PX4 A;  2F2A B;  3EWA A;  2JY8 A;  3M0E A;  2NQ8 C;  4O3M A;  2KA6 B;  5AI8 A;  2UVR A;  1XXH A;  5IWA M;  3SAR A;  4YD2 A;  4MHV A;  1Q39 A;  3GLG E;  3SQI A;  2BCQ A;  3SAV A;  2F8L A;  5AI9 A;  1VLB A;  4DSJ A;  1L2C A;  4I5S A;  1ZD2 P;  2MAX A;  3U6S A;  2KZM A;  1SV4 A;  1L8L A;  3DDH A;  5AM0 A;  2G0A A;  3QZ8 A;  5LMU M;  2VF7 A;  3SBJ A;  4F1I A;  3RJI A;  2WSF F;  3MJ5 A;  4NJ8 A;  5J8Y A;  4DUY M;  3MR5 A;  1UA1 A;  4FZN A;  4C8L A;  1RQL A;  5J0R A;  2OEH A;  1OW5 A;  1RYU A;  2JGA A;  4OJO A;  3TAN A;  4B08 A;  4W5W A;  5ALF A;  4GXI A;  2OH2 A;  3MC1 A;  1HNZ M;  2ZM6 M;  2KP7 A;  4JV0 A;  5ALH A;  1WG8 A;  1GLN A;  8CAT A;  1SXJ A;  2E1F A;  5KFP A;  2MRO B;  3VKH A;  4CE6 A;  1D0M A;  2FFJ A;  3Q8S B;  3NBI A;  1MA7 A;  3I28 A;  5KL8 B;  3QUQ A;  2GOL A;  5ITY A;  1O03 A;  2F5P A;  1BPB A;  5ALD A;  2E3T A;  1D0L A;  1QAO A;  1SV0 C;  2P6U A;  9ICU A;  7ICN A;  2V4R A;  3ZDE A;  2OM6 A;  3H8M A;  3LCU A;  3FKE A;  4BX9 C;  1MSW D;  5EJC A;  4F4K A;  2JNH A;  1ZQI A;  4M9N A;  4ECU A;  4PD2 A;  4KMO B;  4Y2Q A;  1COK A;  1QQ5 A;  3DOA A;  2F76 X;  3HKZ F;  3MR3 A;  3BJY A;  1D8Y A;  5KT2 A;  4YMN A;  1SG9 A;  2KKP A;  4O3S A;  5KT6 A;  2KIW A;  4QWD A;  7ICO A;  2OCE A;  3PW5 A;  2K9D A;  4B3R M;  3TQ1 A;  1QQ6 A;  5ALW A;  5KFY A;  3JPS A;  3Q8P B;  4I2C A;  2QHO B;  5AKY A;  2R46 A;  1Q3C A;  3GPY A;  4ECS A;  3RJJ A;  2QEN A;  2L09 A;  1IXS A;  2DQN B;  4P0Q A;  5KFZ A;  2Y0S C;  1KFV A;  1ZV1 A;  5KFS A;  1QAQ A;  4JV5 M;  1X9X A;  4P0P B;  4HLQ A;  2JWS A;  4YFK A;  4R63 A;  3TPZ A;  2R6F A;  3H4M A;  4EX6 A;  3I76 A;  3F2D A;  4F4Z A;  2F4V M;  1A5T A;  2KTQ A;  4UB3 A;  4RUA A;  1KQQ A;  1ZQE A;  3OSN A;  8ICI A;  1EXN A;  3TFR A;  2Z4R A;  4DQR A;  1T6O A;  2QP9 X;  4PHP A;  1F0M A;  4GXK A;  2FMP A;  2ISO A;  4CF3 A;  5CRX A;  3HU3 A;  1NKC A;  1DGJ A;  2Y9U A;  5DNY A;  4F5R A;  4I2G A;  3GLI E;  4JI4 M;  3T1H M;  2QBY B;  4JWM A;  4ED0 A;  2PI4 A;  2I7N A;  3NVV A;  3RGP A;  2WF5 A;  4LGM A;  2ZG6 A;  2XY7 A;  1FO4 A;  1U9L A;  2Y1I A;  7ICG A;  4RQ8 A;  1L7N A;  4DL3 A;  1JR3 D;  3NAS A;  5KT3 A;  1VEK A;  2DL0 A;  2MSN A;  3PNC A;  2YR0 A;  2KJ5 A;  5L1I A;  4M9H A;  1ZOL A;  2Q4T A;  5HR7 A;  2KOB A;  1ZQK A;  3VK8 A;  1E94 E;  3D2N A;  1LB2 B;  4L8R C;  7ICT A;  5KT4 A;  5EXT A;  2BWB A;  1VEJ A;  1K1S A;  5AK4 A;  4AQY M;  2IHM A;  2MUT B;  1IIP A;  4MGY E;  4DR5 M;  4KLF A;  4QWC A;  1XSP A;  4QOZ C;  5BPC A;  2W7P A;  1BPX A;  9ICM A;  1JQJ C;  1D9D A;  1R5L A;  1L2B A;  3GIM A;  3ZCB B;  1PZN A;  1JXE A;  2JEG A;  4R65 A;  4BWM A;  2L2D A;  2W9B A;  1N34 M;  2EAN A;  7ICP A;  5KFH A;  1XMQ M;  3CF2 A;  2JRZ A;  2EKF A;  1PJT A;  2BQR A;  4M2Y A;  2I6X A;  2DHY A;  2KFN A;  4QHS A;  2KMD A;  2LVP C;  3GQ5 A;  1SGG A;  3KSX A;  2DAK A;  8ICW A;  4QWA A;  4J03 A;  3GLH B;  4JI3 M;  2PFO A;  4M0W A;  2AGQ A;  2ODG A;  4Q43 A;  1IN8 A;  3WKA A;  5KL1 B;  2YTU A;  1U49 A;  4KHP M;  4QZC A;  4RQ5 A;  2EH9 A;  5KNI A;  2VQE M;  1ZQY A;  8ICV A;  5EXP A;  1HQC A;  4JMU A;  5J2G A;  4JN6 A;  3PW2 A;  3A0B U;  1DOQ A;  2BPC A;  5DFL A;  5L1M A;  1MJG M;  4XBO A;  3M7G A;  2HCF A;  4MH0 E;  1KSF X;  4JI7 M;  8ICR A;  4DLE A;  2EQY A;  1ZQF A;  3S6J A;  4RQN A;  4LGY A; 
#chains in the Genus database with same CATH homology
 1NSF A;  4FD2 A;  3THG A;  4PDG A;  4NOO B;  1CRX A;  3VKG A;  2K8B B;  1Z5C A;  4BUG A;  1XO0 A;  5E26 A;  4DV6 M;  4L78 A;  2OXO A;  3FTE A;  3O0F A;  1T3T A;  3GRV A;  4I4L A;  3GPP A;  4GH9 A;  3GLI B;  3U5Z B;  3KP0 E;  2G8L A;  2WAQ F;  4B7H A;  3F5E A;  3AL0 B;  5ITX A;  2X4A A;  1R6B X;  2W03 A;  4X65 M;  1OUQ A;  2H3Q A;  4AKI A;  3U61 B;  3HHW A;  2LBO A;  2HBJ A;  2V6Z M;  2YFQ A;  3Q8X A;  1D8B A;  1QAN A;  1GL7 A;  1G4A E;  4DR7 M;  2D7H A;  2HBL A;  2BJV A;  2YB1 A;  3PSF A;  1XHB A;  4DV7 M;  4D80 A;  1YSY A;  2R62 A;  4LF6 M;  4K0K M;  2ZIX A;  3SHG B;  1Z5A A;  3FTD A;  3KFU G;  3KOY E;  4LF4 M;  4U6P A;  2ZIU A;  3PXG A;  3AFH A;  3GLG B;  2KXE A;  1DGH B;  1HT1 E;  4M0D A;  3ICX A;  3IN5 A;  1PJI A;  5H37 D;  2QPA A;  5EP3 A;  3J7A S;  4IBF A;  4OVZ A;  3VDU A;  3F5A A;  3T79 A;  3U6Q A;  3K1J A;  2G08 A;  3LYS A;  3FUX A;  4WJ3 B;  1NJG A;  3SC3 A;  1N78 A;  4QJF B;  3J80 S;  4QIW F;  1GL6 A;  3FYC A;  2LWX A;  3GRU A;  3PNY A;  1IBM M;  4PDI A;  4EIW A;  2HL7 A;  1FJG M;  3W0L B;  4OX9 M;  3VK7 A;  3TWM A;  1N36 M;  4P0Q B;  3CYM A;  3KVW A;  3MHV C;  4RF1 A;  4PL1 A;  4GHL A;  3SAT A;  2DHR A;  3IG8 A;  1L2D A;  3L3F X;  1G41 A;  1IN6 A;  3I51 A;  1KBU A;  4PCZ A;  1XNQ M;  2JMG A;  2LHT A;  2QZ4 A;  2X8A A;  4MGH A;  1HIW A;  4D82 A;  2HMX A;  1NZB A;  3D8L A;  1JR3 A;  2JA2 A;  2Y0Q A;  4LFA M;  3CRX A;  1DRG A;  4FZM A;  4FVM A;  4S12 A;  3I4V A;  2H1R A;  2Z7J A;  2F5S A;  3PZP A;  2KRK A;  2R4J A;  5FTK A;  2HOQ A;  2L7H A;  4LY6 A;  2ZIW A;  3SHF A;  2A5Y B;  3HHZ A;  2KW0 A;  4AZF A;  2XFS A;  2UUA M;  1LV7 A;  3ILK A;  1K3W A;  1ED1 A;  4GRI A;  4AKH A;  3LMM A;  4XGI A;  2XZU A;  4DR6 M;  2XFT A;  4B7F A;  5LMN M;  1QYR A;  1E32 A;  2CN1 A;  2XI9 A;  2ZXH A;  3SMP A;  2HOF A;  3FUW A;  2LNH C;  2VII A;  3VLF B;  3KZX A;  4OJL A;  2KD1 A;  2F77 X;  1SZH A;  3N7P D;  2XSZ A;  4LCB A;  4GC9 A;  5E6J A;  4NWI A;  3UZU A;  2YB4 A;  2M5Z A;  4NSR A;  5ITX E;  4NXM M;  4B3M M;  2DF4 B;  1HT2 E;  2YQZ A;  5BPV A;  2VKQ A;  2Q2E B;  4IBK A;  2E5S A;  3F2B A;  3L29 A;  3I4Y A;  4A8E A;  5T14 A;  2GH1 A;  1WUD A;  3U6E A;  3AKZ A;  3KOW E;  3IP4 B;  4B3T M;  2KZU A;  1L8Q A;  4REZ A;  3RFA A;  1D2N A;  5FLX S;  2R18 A;  2KEY A;  1VDD A;  3PVS A;  2L7I A;  4DR1 M;  2WAQ C;  3KOX E;  3KFU F;  1R2Z A;  3F2C A;  2WB1 F;  2X49 A;  4TUW A;  3R9X B;  2RRD A;  3FD9 A;  3LQR A;  5KPZ A;  4RNA A;  1NNJ A;  1QAM A;  3C58 A;  2KKV A;  4L16 A;  3QAU A;  2ERC A;  5C1B A;  3TWK A;  4MB7 A;  2LXE A;  1IXZ A;  3AOG A;  4NL4 H;  5JI2 E;  2M0N A;  2R4E A;  3CF6 E;  2CHQ A;  2G06 A;  3CF0 A;  2CHV A;  1YT3 A;  3SAU A;  4IJF A;  3K2L A;  4LF5 M;  2H3Z A;  4QNR A;  4MGK E;  4CDG A;  4AW4 A;  4L4U A;  1SXJ D;  1I94 M;  3NRW A;  4GMQ A;  3SYL A;  5IZ7 D;  3DEE A;  4R7G A;  5BR8 M;  4AG5 A;  4LFB M;  4LZZ A;  3FUU A;  2XEP A;  1NY6 A;  1SXJ C;  4G4Q A;  1YUB A;  4QIW C;  4A3V B;  3TWL A;  1Z59 A;  2MA1 A;  2K47 A;  2ZIV B;  3UJN A;  4LF9 M;  3HHX A;  3KOZ E;  2VJ5 A;  4P0P A;  2KZS A;  2JH7 A;  4II7 A;  4NLC A;  4LF7 M;  2ZXI A;  1Z5B A;  3U60 A;  3ZH9 B;  2CPR A;  2RKO A;  4BBA A;  1ORY B;  4GHA A;  3NWL A;  1NJF A;  4QNM A;  4DV1 M;  3HHY A;  4DV2 M;  3AL0 C;  2DGZ A;  2K8A A;  4B7G A;  4DUZ M;  2CE7 A;  2Z4S A;  3L25 A;  2G07 A;  3FYD A;  3GLF A;  5KQD A;  2K4H A;  1XC8 A;  5EP2 A;  1A6S A;  2D6F C;  3FTF A;  3SAW A;  2JH1 A;  2BDU A;  4JYA M;  2KV2 A;  4FCV A;  1Q3B A;  1IQP A;  3GO8 A;  1TGU A;  3LVV A;  3CP8 A;  2Y0T A;  2CEA A;  2DWZ B;  2Y20 A;  1DGG A;  3F53 A;  3PSI A;  3U6C A;  2AHM A;  3KS4 A;  1HQY E;  4JI6 M;  2QBY A;  2LYB A;  2RHF A;  1XNS A;  3TQS A;  1YE9 A;  2OQ4 A;  4M9S A;  3VC8 A;  3T1Y M;  4LRS A;  1PVQ A;  2R65 A;  1N32 M;  4LJ4 A;  2J7O A;  5FTJ A;  3FUV A;  4JI0 M;  1J5E M;  4IC9 A;  4M9Z A;  4BJQ A;  2DXI A;  4YY3 M;  1HR0 M;  1P7D A;  1TH4 A;  3JR5 A;  1GKI A;  4M9X A;  3A45 A;  5ITT A;  2H3F A;  5KO3 A;  5ITU A;  5EXS A;  4Z6Y A;  2DWL A;  2C98 A;  4C0Z A;  3H0L B;  3VFD A;  2UUB M;  5GKN A;  3GQ4 A;  3J27 B;  3DZD A;  4AKG A;  4OO1 J;  1IM2 A;  1IXS B;  4U7C A;  5FTL A;  3VDP A;  1IN7 A;  3H0R B;  4DV0 M;  1XMO M;  4NRV A;  4DV5 M;  2K89 A;  4QHT A;  1TH2 A;  4IBE A;  3GP1 A;  1NNU C;  2RGH A;  1IN5 A;  2K4E A;  2WB1 C;  3FUT A;  1Q3V A;  3PSP A;  4KLN A;  4ZPX A;  1QQW A;  2KRU A;  2Z3X A;  4GKK M;  3NUQ A;  5EQT A;  2XIC A;  3A98 B;  2YX8 A;  2ZIX B;  4OJP A;  4LJ7 A;  2DWM A;  3HU2 A;  1DGF A;  3DA1 A;  5DYI A;  3AOE C;  4QOS A;  2ZIU B;  2HBK A;  3TL4 X;  1QZM A;  3UGJ A;  4I8O A;  3D8B A;  4KO8 A;  5EP1 A;  1ECW A;  1OFH A;  2G5G X;  4CIS A;  3C29 A;  4GIT A;  2G5H B;  2EA0 A;  2KEB A;  3GQ3 A;  2PMZ F;  4WW0 A;  4FWH A;  1OFI A;  4OVZ B;  1Q3U A;  2UXC M;  4DR2 M;  4IBJ A;  2F2A B;  4X62 M;  2K8C B;  3LQQ A;  4AYB C;  3M0E A;  2NQ8 C;  4O3M A;  2KA6 B;  2FOI C;  2Y0S F;  2KJ9 A;  1XXH A;  5IWA M;  3SAR A;  2H3I A;  3HJQ A;  1Q39 A;  2CUZ A;  2ZBK B;  5IRE B;  3SQI A;  4IJE A;  3SAV A;  1G59 A;  2F8L A;  1L2C A;  4I5S A;  2BNK A;  3U6S A;  2HCB A;  1ZAE A;  3HKP A;  1G3I A;  2DZO B;  4JI8 M;  3MK6 A;  1IY2 A;  2G0A A;  5LMU M;  2HHH M;  1IN4 A;  3AQE A;  3QWL A;  3SMS A;  3WHL A;  1L1Z A;  3SAH A;  3SBJ A;  5KPT A;  4G4O A;  3GLH A;  3MJ5 A;  4Z8X A;  4DUY M;  1ZQ9 A;  2D7G A;  4FZN A;  4KOD A;  2VIX A;  4G4R A;  2J7N A;  2XSZ D;  4GC5 A;  2ZIW B;  3KS8 A;  3E4R A;  2JGA A;  3E9S A;  4DV3 M;  4D81 A;  4OJO A;  4B08 A;  3LVW A;  1TDH A;  4MGZ E;  4W5W A;  2KJ8 A;  2OH2 A;  3RFW A;  3E0F A;  4ITQ A;  1TH3 A;  1HNZ M;  2ZM6 M;  4GIP A;  4OJ6 A;  3KXE C;  3IG5 A;  3KDS E;  3SAS A;  3AV0 A;  3KP1 E;  2E5L M;  4IBD A;  1T94 A;  2F5N A;  1GLN A;  8CAT A;  1SXJ A;  4FCW A;  1A0P A;  2E1F A;  4G6Z A;  1K82 A;  3VKH A;  1GO3 F;  4KX5 A;  4AI6 A;  3HGI A;  1DO0 A;  2A3V A;  4DV4 M;  5A2Q S;  4NSO B;  3RF9 A;  2FFJ A;  2XH9 A;  3NBI A;  3R8F A;  1R2Y A;  1MA7 A;  4LRT A;  5KL8 B;  4ACO A;  4AG6 A;  2GOL A;  4DR3 M;  5ITY A;  3L27 A;  3GLI A;  3U5Z A;  2Y21 A;  4NRW A;  1PVP A;  2F5P A;  3K92 A;  2XLJ A;  4KX3 A;  3EIE A;  3EIH A;  4LJ9 A;  4R3D A;  1QAO A;  2XF3 A;  3J2P B;  1S3S A;  4NV0 A;  3JR4 A;  2OM6 A;  3U61 A;  3FKE A;  2CFO A;  3JAM S;  2K4I A;  4BX9 C;  5EJC A;  1W5T A;  1E9R A;  3KW6 A;  5FTM A;  5KQ8 A;  4FE3 A;  1J09 A;  3A42 A;  1TDZ A;  1IBK M;  3U6L A;  1H6U A;  4QNL A;  4PD2 A;  4KMO B;  2I7P A;  1DGB A;  5ITQ A;  3DOA A;  3GLG A;  2F76 X;  3HKZ F;  2C99 A;  1IBL M;  4NXN M;  1DGH A;  4RF0 A;  2CV0 A;  3UMM A;  4LJA A;  2KKP A;  4GKJ M;  2KIW A;  3PFI A;  2FNA A;  4G4N A;  3SAF A;  1F44 A;  3L28 A;  3UK6 A;  2OPF A;  2DWN A;  2W82 A;  4LJ5 A;  2F5O A;  4B3R M;  2PMZ C;  2G5I B;  2OYY A;  3M6Z A;  3T15 A;  3GRY A;  2F5Q A;  2R46 A;  1Q3C A;  3GPY A;  3SMV A;  1C1K A;  5C18 A;  4LFC M;  2HBM A;  2QEN A;  2L09 A;  2DQN B;  3ONN A;  4P0Q A;  1X37 A;  2Y0S C;  1KFV A;  4LZJ A;  2XID A;  1QAQ A;  4P16 A;  4JV5 M;  4P0P B;  2C9O A;  1HNW M;  4HLQ A;  4IBI A;  5FSW A;  2DVW B;  3TPZ A;  4LJ6 A;  4LJ8 A;  2LKY A;  5C0Y A;  3H4M A;  3U60 B;  4IBG A;  4LF8 M;  1FNN A;  4OU7 A;  3F2D A;  3HU1 A;  4YHH M;  2VJ4 A;  2F4V M;  1J7K A;  3SYK A;  1MX0 A;  2NV3 A;  3L26 A;  2HKJ A;  3M7D A;  3GLF B;  4FZL A;  3HWS A;  2CV1 A;  1Z19 A;  2W7O A;  3N7S C;  3RGS A;  2Z4R A;  4PT5 A;  3DFZ A;  3U6M A;  2QP9 X;  3J81 S;  2W04 A;  3MGV A;  3PST A;  5A0L A;  2DZN B;  3AOE A;  3FTC A;  1SXJ E;  3KSJ A;  2V1C A;  2V1U A;  1WXQ A;  1Z6T A;  5CRX A;  3HU3 A;  2C5R A;  5DNY A;  3T38 A;  3K8Z A;  1L1T A;  1OJL A;  2KIC A;  3W0F A;  1Z1B A;  1IY0 A;  4JI4 M;  3T1H M;  2QBY B;  3GPX A;  5IT9 S;  5DYG A;  2I7N A;  3U6D A;  4AYB F;  3B9P A;  3VCB A;  1NY5 A;  3RGP A;  4LGM A;  1L6N A;  1URJ A;  3J7B A;  1NHG C;  2ZG6 A;  3D2S A;  3HJS A;  3PNV A;  2UXD M;  1NVM A;  4JI5 M;  2EO2 A;  2QCU A;  1UM8 A;  1QVR A;  4JI1 M;  2MRL A;  4NLB A;  4IBB A;  4FCT A;  5F3W A;  2C96 A;  4MGI E;  1JR3 D;  3BOS A;  3WHK A;  1HEK A;  2KNJ A;  3CTW B;  2YR0 A;  3ALR A;  1TAM A;  2KJ5 A;  2XVT A;  3K1Z A;  1NHW C;  4FW9 A;  3U6O A;  4OW0 A;  5ITR A;  2KHQ A;  2Q4T A;  2HOI A;  2KVC A;  5HR7 A;  2KOB A;  4JXJ A;  4PL2 A;  3VK8 A;  5HR6 A;  4IBC A;  1E94 E;  2R45 A;  3D2N A;  4BB9 A;  2ZAO A;  4L8R C;  4X66 M;  4JI2 M;  1MU5 A;  5EXT A;  2KHV A;  5EXX A;  2CV2 A;  2LYA A;  1IXR C;  2P5T A;  3OPX A;  1EE8 A;  4AQY M;  1IY1 A;  1R7R A;  3RE8 A;  5JI3 E;  4MM3 B;  3HKZ C;  2M60 A;  1IIP A;  3AQF A;  2RP5 A;  3GZF A;  3M6K A;  3SAG A;  4FWG A;  3A46 A;  3U6P A;  1I4W A;  4MGY E;  4DR5 M;  4WUR A;  3TE6 A;  3HJ8 A;  4QOZ C;  3L2A A;  2W7P A;  5KPR A;  2UXB M;  1PJJ A;  1JQJ C;  4OJ5 A;  1L2B A;  3ZCB B;  4I81 A;  1N75 A;  3M6A A;  4IIW A;  4CHT B;  2ZIV A;  1XXH B;  4CRX A;  2XGN A;  1N34 M;  4HL4 A;  1KYI A;  3GRR A;  1XMQ M;  3CF2 A;  3GU3 A;  3SFZ A;  2ZAM A;  4GFJ A;  2EUC A;  3GPU A;  4L15 A;  3ZC7 B;  7CAT A;  2FE8 A;  4ICA A;  4QHS A;  5EP4 A;  1G8P A;  2LH0 A;  3GQ5 A;  1PM5 A;  3KSX A;  3N7R C;  2N1R A;  1GVN A;  1ZQ1 C;  3OTO M;  3GLH B;  4JI3 M;  2UU9 M;  4M0W A;  2H3V A;  4CGZ A;  1IN8 A;  2ZAN A;  2CHG A;  5FTN A;  1HNX M;  4LG2 A;  1UPH A;  5KL1 B;  1DO2 A;  3AJI B;  4KHP M;  4X64 M;  2UUC M;  4CGY B;  1N77 A;  2VQE M;  1N33 M;  5EXP A;  1HQC A;  2CRX A;  1PVR A;  4JMU A;  4JN6 A;  3C28 A;  1XNR M;  2XZF A;  2L6O A;  1K3X A;  2YNM D;  2BJW A;  3D2Q A;  2O5R A;  2G09 A;  2C9C A;  3H0M B;  4XBO A;  3M7G A;  2RGO A;  1KSF X;  4FWD A;  4MH0 E;  2VQF M;  4JI7 M;  4BLC A;  2E1E A;  1XWI A;  2D7E A;  1E9S A;  4DR4 M;  1W5S A;  1SXJ B;  4B3S M;  4LGY A;  2JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...