4AG6A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
384
structure length
373
Chain Sequence
SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRPQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
molecule tags Hydrolase
total genus 132
structure length 373
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag6A01
2QAGB 1M7BA 2XX3A 5CLLA 2CHGA 2FFHA 2QORA 3NC0C 5SZHB 2WZQA 4TQAA 3WXMA 3LD9A 4BZPA 4F92B 3OZXA 1XD8A 3QKSA 3FKSD 1OH5A 5L3QA 4NCNA 2AK3A 3M4YA 3THWA 3FE2A 1EWRA 221PA 1XU4A 4O0MA 4RVCA 3NXSA 2R65A 2IYXA 1YQTA 4WZAE 1XEWY 1FUKA 2H8KA 1CEEA 1A5TA 3PR1A 4R2IA 3T5DA 5DISB 2ZUBA 1KK2A 4JLOA 2XITA 1G4UR 2DFKB 4D82A 4OBEA 2P5TB 4HDCA 3AGPA 2GVZC 3E1SA 4Q1EA 3DHWC 5DGXA 4P0TA 4FMCB 4DB2A 4TMKA 2ZROA 4F38A 1HTWA 1Z0KA 4BUJA 1X6VA 1K5DA 2JGNA 2OT3B 4YDSA 3O47A 1ZM4A 3BH6A 4BLQA 4GMDA 1PLJA 1KYIA 4PAMA 4IOKA 1JB1A 3MFYA 2IS1A 2AR7A 1BOFA 3OFND 4P31A 4QBFA 2KI5A 4XTCS 1GG2A 1Z0IA 2SHKA 4BLOA 1U0HC 4Q9HA 3IUYA 3OEEA 4DLUA 5FTLA 2CXXA 4M9SA 1G3IA 1U99A 3PQCA 3GLFB 4L15A 1Z5ZA 3W8NA 2VSOA 2C77A 4NP6A 1XJ0A 4ARZB 5FPYA 4MUBA 1VG1A 2W0SA 3PJRA 2HLDA 5H68A 2FSIA 2W6JA 4M9ZA 4FI3C 4JLAA 1E2DA 3BBPA 4DJTA 1OXSC 2IEZA 4HB4A 2OAQ1 1P72A 2R6CA 2BMEA 2XZLA 2MSDB 4QJ4A 2CK3D 4RCYA 3REFA 2XZOA 1JXOA 3CF0A 1RC8A 4IVQA 4Q4AA 2VO1A 2YOFA 4RSGA 4A8JA 4DVGA 1XCGB 4Q4LA 4UJ5A 1E1QD 4IXMA 3OEED 1R10A 3C8UA 1TQDA 2GAOA 5G53C 4PC1A 3U3JA 4PZLA 2BBTA 1XDBA 4MYHA 1U98A 3I5XA 2VRWA 2Z6VA 1YU9A 3ZZUA 4Q47A 1US8A 2G0TA 2A9KA 2NO7A 3RAPR 3OF5A 3SOPA 4LZZA 3IPYA 2ZSBA 5SZJA 1Q1QA 4JLVA 1Q3HA 1G5TA 1Q1BA 5D3MB 2XZPA 3CWZA 4QBIA 4I1UA 3B1VA 2ZRDA 3LW8A 4I1OA 1W44A 4PHFA 5LBIA 1JR3E 3AVYA 4DWJA 2N1BA 4MKIA 5AJZA 5AJVB 1CR0A 2YOHA 1Z29A 4Q19A 4CEHA 1RKBA 1M74A 2H18A 4A1FA 1FTNA 4XVRA 1TX4B 5TARA 3R8FA 2NPFA 5LD2B 2VP5A 2OEPA 5KSOA 1DVRA 2ONKA 2JLSA 5DI3A 4ON9A 4BRWA 1KSHA 4CT5A 2NQ2C 1KY3A 3KKPA 2JCSA 3K09C 2IF2A 2QN6A 4TYNA 2CCJA 2DWQA 3QPVA 3GJ5A 2QRNA 3BS4A 1GL9B 1P62B 1CS4C 4IDHA 1J70A 3F0TA 5G40A 1JR3D 3BFVA 3AKCA 4M8NE 3AKEA 2QE7D 3L0IB 1E2MA 4O2LA 2FEOA 1EWQA 4UXIA 3IEVA 5DLQC 1FL9A 1UEJA 1C4OA 3VU9A 2QZ4A 3U7FB 1HH4A 2GBLA 3BFKA 3SN6A 1J8YF 4O2RA 1HQCA 721PA 3RRMA 5L3SB 5DHAA 2ZAMA 3DDCA 2ZU0C 2ZYWX 1GNQA 1XWIA 1JAIA 4OK5A 1KNQA 3K0SA 1C1YA 3QXSA 2WWFA 1TNDA 3OHMA 4XWKA 4KBFA 2FV8A 3MWLA 1KMHA 1EFHA 1S1CA 2CBZA 1Z06A 2DFLA 2OBLA 5IDVA 2RB4A 1OYWA 2RKOA 3PIRA 3B8HA 3U3OA 1SHZA 4A9AA 3F3YA 3J81k 5JCPA 1UM8A 2FFBA 1Z0FA 2ZRGA 4UXJA 4PO1A 3DM9B 3LO5A 2O8DA 5EXPA 1N2CE 4BE7B 5FL7A 3UG7A 4JS0A 1ZUHA 3M6AA 4P33A 1I4DD 1G7CA 1N0VC 3CF6R 4A4DA 3C5CA 1IN7A 3ZIAA 4LYFA 1KZGB 3P20A 2IC5A 4LJAA 4C0LA 3HU1A 3OE7D 3I3SR 3EWSA 1NY5A 2BIFA 4L9SA 4GRAA 5FPKA 2W00A 3JVVA 1KI1A 2QL6A 4ZKDA 1Q3TA 3RWMB 4J0QA 1JJ7A 4OHVA 1R6BX 2Z4SA 3BOSA 1YKSA 4HB3A 4QJ5A 3IQXA 5UKDA 3H1TA 4P4SB 3WBKA 2FGJA 3TJZA 3QVUA 2ZANA 1Q21A 1TEXA 4HZUB 1NSTA 3VR4A 1B0UA 2F1RA 2YVUA 2ZRBA 2ZVPX 4LOAA 1EX6A 3NH9A 4GP7A 4DEYA 5BN4A 2B8WA 2C99A 2JATA 1Z6TA 2CEAA 3RS2A 3ZIAD 2KB0A 2XTNA 4ZCIA 4PHTA 3SJCA 3PVSA 1VG9B 3EZ9A 4NDZA 1ZRHA 5FTNA 5FOUA 1L2TA 2QPTA 4HDQB 1GFIA 1EFRD 5CDFA 4URYR 1P2UA 3GJXC 2GDJA 2O0HA 1P9RA 2UKDA 2CL6X 1VHTA 1XD2A 2PEZA 3CO5A 3DKPA 3Q8XB 2O0KA 1CXZA 3IO5A 3WRYC 1AKEA 1XCPA 4Z51A 4BGDA 5BYJA 1PJRA 4KFTA 4V0MA 4CYMA 3FWYA 4LHVA 4JLKA 4RD3A 3BORA 2PJRA 3EPLA 3AVVA 1VHLA 3PUWA 4C0QC 1PUJA 2RGGA 2ZR0A 4L16A 1TPZA 1W4CA 3E70C 2ZITA 3ZDQA 3HDTA 2HJVA 4BEBA 3QEJA 4BFYA 4EPYA 5JHHB 2VP0A 1E9CA 2P65A 5BYKA 3CR7A 4JL5A 1P2TA 4TQ9A 3E5HA 2B7CA 3WNBA 1KY2A 1OB5A 1XRJA 5C18A 3QVVA 2LKCA 4EPXA 3AB3A 1KO1A 2W2VA 2A5DA 5E3HA 1VIAA 4N1AA 1Y63A 1WF3A 1W47A 3UK6A 1DAEA 3WP0A 3N70A 2C9CA 1IOZA 5F9FA 4MYTA 1ZAKA 4DCNA 3ZQJA 3VR5A 1Q44A 2WV9A 1P61B 2CJWB 3H86A 2I1VB 2LWIA 3H2YA 3RDPA 1VPLA 1G41A 1HT2E 2OUKA 2IWHA 1ZNXA 4XD7A 1CR4A 1KI9A 1NBMA 3F5FA 4RFSB 5FPHA 4NE2A 1T5IA 2JA1A 2OCYC 3SI7A 4DSTA 1TAGA 4FD2A 4CGZA 1F2TB 2OCBA 2IXGA 3MCAA 1T8TA 2N46A 5CM8B 4LV6A 3KKQA 5K8IA 1Z2AA 2QPOA 2QSZA 4MGKR 4TN1A 1KDPA 1GITA 3D8BA 3NWJA 1M8PA 2FOLA 2B21A 1XXHA 5SZKB 5EP4A 3GFTA 3EC2A 5CM9C 4LJYA 3SR0A 4MRRA 3BH0A 1H65A 1LFDB 3CNNA 3CRRA 5FI0B 3QXHA 1M2OB 3I5YA 3K9GA 1BIFA 1XXHE 4C7OA 1R0XA 1G3MA 3ADDA 4P3YA 2IL1A 1PV4A 4JT4A 4P4TA 2ZI9A 2QMUA 1JXMA 1MT0A 1N6IA 4Q1FA 4EDHA 2ZJBA 1E9SA 1GP2A 4JJZA 3U44B 5JS8A 3THYB 2GCPA 4TT3D 2AFHE 2QT0A 3PG5A 1S3GA 4DDWA 4PAOA 4B3CA 4F91B 1OJLA 3G5UA 1VG0B 4QJ3A 5EZ5A 5FBWB 2FE4A 3T15A 3U4QA 5IF9A 3EXAA 4KFUA 4XOIA 3HYRA 2LKDA 2J0SA 3BH7A 1FQJA 1S2MA 3PUVA 1ZD1A 4IHQA 4NCKA 3B9PA 4PO8A 4G3XA 5J5CA 3VX3A 1RVDA 1G3QA 4Q7MB 1GM5A 4WXRA 1G5PA 3KFXA 4D80A 5JEDA 1O87A 1BH2A 2C03A 3PUXA 3WP1B 2NTYC 4V0KA 5J4HA 2QAGA 4NCIA 4DLVA 3LVRE 4GDFA 1Q20A 2V54A 1MRSA 2PX0A 1LW7A 4LPSA 3R8CA 3SBEA 2EFGA 4IDPA 2KE5A 3NVAA 4Q1CA 2GXAA 2PZFA 4G5QA 1HURA 2J46A 5HZKA 3VU9B 4IFBA 3OIUA 4PPQA 1Z2CA 4R9UC 2J45A 1Z3IX 1M7GA 2RGNA 4TMTA 2Z5FA 3B7GA 3MAAC 1VCOA 4W9MC 1DAKA 1RYHA 2GVDC 1R4AA 4GMXA 8OHMA 1DG1G 4CEJB 3QQ5A 1LVGA 4EUNA 2YV5A 5FFMA 2OILA 3CPJB 4NCJA 1KMHB 5CJ2A 1UBEA 2ZM5A 4W5JA 4NYIQ 4M1MA 1ANKA 5EE9A 1XEFA 1Q12A 3A1TA 4QGHA 3QENA 3FMPB 1YR9A 5DIFA 2O8DB 3V9PA 2AKAB 1Z0AA 2R6FA 4A82A 5B57C 4D4JA 3GP8A 2JLUA 1OXUA 1XEWX 2VP6A 1YR7A 4EPTA 4O25A 5CB6A 5DH9A 3BXZA 3FFBA 4Q21A 1DADA 1OH8A 4C0JA 2NPIA 3EG5A 4LHXA 4OJQA 3C5HA 2NZJA 3PXGA 3GLFA 3AF2A 3HYTA 3B1XA 4JVLA 3I73A 1OSNA 2BM0A 2OFOA 3LV8A 2OO7A 3REGA 1EGAA 4IVPA 1R2QA 1R5OA 2PT7A 4ASUA 3U61B 1J7KA 1T6NA 3FHCB 4JLNA 4UNSA 2FA9A 3NEYA 3RLFA 5HKKA 1SZPA 4TMZA 3DZ8A 1XF9A 3SHFA 4U5XA 4N0DA 6Q21A 2Q6TA 4G5SA 4MRSA 4Q9KA 3DO6A 1A2BA 1OFIA 1UKEA 3Q72A 3GQBA 4LC0A 2QSYA 3AM1A 5C46F 4P32A 1UFQA 4HAXA 4HAVA 4M4SA 1KHTA 4RJLA 3VKHA 1WP9A 4IRUB 2C04A 3UG6A 2ZRCA 5CJPA 2CLCX 1W5SA 3VHLB 2G83A 3U5ZB 2OCAA 1BYIA 1CTQA 1ZUIA 4OI2A 5KOYA 4LGMA 2XSZA 4LDJA 4PZYA 3ONWA 3EZ2A 2FZ4A 3LBIA 4DSUA 3MWJA 1P2VA 3AF3A 1E99A 1D2EA 2ODNA 5DN6D 4JLMA 1U8AA 1IXZA 1AA9A 2W58A 4TL7A 4ASUD 1NY6A 2JJ2D 1E3MA 1TADA 5DSZA 2IYWA 1WMSA 5AJWA 5HKKD 2ZJ8A 5L3VA 1VDZA 2J0VA 4UNNA 2BC9A 1CKEA 2QTHA 2E1RA 4QBHA 4JL8A 2XB4A 1DAFA 1KO4A 3DOEA 1N6OA 2VLIA 5FUYA 5KYKA 4EPRA 2WKQA 4ZIRB 2F9MA 4JVMA 1GTVA 4D25A 5AUOB 4A0RA 2A5FA 2GESA 2X2FA 1E2QA 3HU3A 4B2LA 5JLJA 1UKVY 3A1UA 1KJZA 1T8UA 3CNLA 1FNNA 4TSFA 2ZAOA 1G3RA 4BFXA 1OLOA 5DYGA 1KKMA 1LS6A 3QIAA 3KFVA 3CKLA 3SU8A 1W7AA 2H17A 1VECA 4MYUA 4OQLA 5KPDA 5GVRA 2G3YA 5JJIA 1LNZA 1YRBA 2ZXUA 4II7A 4WW0A 2ZJOA 3L43A 1KDRA 4QHTA 1GNPA 3EA0A 2O0JA 4X8MA 2VF8A 3WMGA 5BXQC 3CRW1 2I3BA 2Z0MA 5DHFA 5FUVA 1OYYA 1L8QA 4MUAA 1G8GA 5IRCD 1E1RA 2FFAA 3TAHA 4EJSB 1E9AA 4LY6A 2JEOA 3KKOA 5L3SA 3IO3A 4Q48A 2CE2X 4DCVA 4OI1A 1D8TA 3BRWD 4JJKA 4I1SA 1BMFA 1ZMXA 5JJLA 2YZ2A 1W0KA 2OBMA 4TSFD 2AK2A 2PMKA 3RS7A 4TTRA 1RE0A 2YC2C 4ITRC 1JR6A 3LY5A 2QI9C 2WJVA 3TQCA 2FEMA 2KSQA 1UF9A 3PEUA 1F3OA 4CRWB 1N6KA 4DCTA 1TF7A 3TK1A 1LTQA 2GZAA 4AK9A 3LWNA 1MO5A 1GZSA 1XB2A 1ELOA 4DC9A 5FOSA 1HE8B 1Z63A 4YXWA 1AM4D 2O8CA 3L8ZA 1X1RA 1Z6YA 2Q21A 1QF9A 1Q1ZA 4LYAA 4PFSA 2F6RA 3UMSA 2KJQA 4FN5A 2QMEA 4PR0A 2BEKA 3MSXA 1R5NA 2EWWA 1P7CA 2IYZA 5EE3A 2BVNA 4ERNA 5JCZA 1KGDA 1T3SA 1YZNA 4LJ7A 3OESA 3VR2A 2IYLD 3LLMA 4ZDIA 2AWOA 1UPTA 3QBVA 1COWA 2R2AA 2GCOA 4GP6A 4YC7A 4M1YA 4RD6A 2V1XA 3QBTA 1NVXQ 521PA 4DRZA 2H7VA 3SJBA 4G01B 5TV2A 1UAAA 5F9HA 3W90A 1KI4A 1N6HA 4B34A 3NDBB 2WIBA 3K0AA 1KDTA 4V0OA 2F43A 1DPFA 4LV5B 1S9HA 4FXPA 3CX8A 5GVSA 2WOJA 3K0EA 4MGZR 1GRNA 2BMFA 3QKRA 1GSIA 1OT3A 2AFIE 3GFPA 3U4QB 4FW9A 1G4AE 4QBGB 1M1YE 4KLZA 3HPQA 1EK0A 3AKDA 1TUIA 2JJ8A 4M2LA 1XP8A 1MO6A 1B23P 5CB8A 1HUQA 5HCNA 2XEXA 2W2XA 3ADKA 4Q1AA 5TDHA 1KTVA 4TYYA 2PL3A 3PITA 1NVUQ 4HLDA 1EESA 5AUQA 2RGEA 4M1KA 5AK0A 2GNOA 1KO7A 5ANRB 1G8PA 1MR3F 3U7EB 2B92A 3LRPA 2ZETA 3OEHD 3CONA 5K8UA 3PEVA 3QG5A 3UWOA 1ZU5A 4KVAA 1RRFA 5FL3A 2ERYA 1CF4A 2REBA 4LUCA 4ZDKA 2ZUDA 2J87A 1F6BA 4DBLC 1D9ZA 1UBGA 1N5KA 2WJYA 2ZUCA 4FMBB 5BQ5A 5EE0A 5AJYA 4C0SA 2ZRIA 2XAUA 2RH5A 4XWOA 2V6JA 2A3RA 2QMHA 4Q7KA 1AZTA 3RS4A 3K09A 2R8RA 3LXRA 3CM0A 4S2EA 2ZS9A 1XZQA 1KZ7B 2FZLA 3W5IA 4E09A 3H4MA 2WKPA 4DSOA 2R6AA 3ZGXA 1FP7A 2AXNA 2CMKA 2FN4A 3IQWA 2HJGA 1OFUX 1E0KA 2WWYA 2P0EA 1E0SA 3R9WA 4ZV4A 2IF0A 1IN4A 2G6BA 4IKEA 2ONJA 3S1AA 4TL6A 3ZS8A 2PMDA 1WE2A 2OZEA 4RD2A 1NJFA 2QU8A 1XMSA 3UXMA 2CVFA 1DO2A 2C5LA 1RPZA 3KJIA 1II8A 5FOTA 4B6FA 1CU1A 1OHHA 4DXAA 3Q5EA 3G0HA 1HEIA 4MH0R 2G77B 2D74A 3A1SA 2CJWA 2ZRHA 4NBSA 3U6BA 1CJUC 3MGCA 4JMPA 4AIIA 5EJEA 1E0JA 3AH8A 3GLGB 2YNMA 3K70C 1UDXA 1KI6B 2QP4A 2V7QA 4RFSA 1XJCA 2JLYA 4HAZA 2R6DA 2OCPA 1E79A 3KKMA 4QHSA 1F2TA 1UADA 1WXQA 1T9HA 2IYSA 3TUZC 1YJ5A 5H8WA 4DUGA 2WSSA 3HPRA 3X1YA 2ZVQX 2REOA 2ZRMA 3IILA 4G0NA 1KI8A 1S8FA 3LFUA 4LHYA 2J7PA 4ZDJA 3OAAA 2F9LA 1YZGA 2GTPA 2VP2A 4WXPA 3KQNA 1NN3A 1CJVC 4OHXA 3Q3JB 2CHQA 3B9QA 2X2EA 3ZVNA 1W49A 3O8DA 5GJVC 1YZUA 2HLDD 4D6PA 2Q3FA 3VTKA 1GVNB 2OHFA 1OIVA 2W6JD 1OF1A 3AVXA 2QRZA 2RGAA 3TW8B 1ZYUA 3GCGA 3TGPA 3U44A 1JQLB 3THYA 4NHOA 4PSKA 3NBFA 1OPXA 4XVQA 2E87A 4D4LA 2IYTA 3MJHA 2FGKA 5FBQB 4URVR 4OYHA 1S0UA 3TLXA 4F4CA 3LNCA 4BASA 4DUGD 2WSSD 1A82A 2XJ9A 3BGWA 3B5JA 4D2IA 2OM2A 1IBRA 1R7RA 2YWGA 4U7DA 1Z47A 5GADl 2P5SA 4HAUA 3OAAD 4Q00A 5BN5A 2J59A 5FR2A 2ZI5A 4LSGA 4EQ6A 3NKVA 4BQSA 3QXXA 3P26A 4NMMA 5JWOA 4A0FA 2Q9AA 2YC4C 4BFVA 4TYWA 3LXXA 4OQMA 1FW6A 2ZRLA 3K0FB 3X2SA 3SEAA 4NKRA 4JL6A 4TTPA 1WQ1R 3QXCA 4DDTA 2Q3MA 5KO2A 3QPUA 4QGGA 1W46A 4RZUA 2JIZA 1PZNA 1AKYA 3L8YA 121PA 1Z83A 1E98A 4KO8A 3RS0A 1DBSA 1ESMA 2OLJA 1KK3A 1Z6AA 1W48A 3CZQA 2C8VA 3EWAA 3IBYA 2ECKA 2DPXA 4BFZA 2V4ZA 1G1MA 3GFOA 3ZZ0A 1W0JA 4QGFA 5JECA 4A36A 1YZKA 1IY0A 3C16C 1F60A 1YHNA 3L0PA 2A30A 3NTUA 3DMDA 4FMDB 4E22A 4ZI3A 2BBSA 2B6HA 3I32A 1OKKA 5JHGB 3ZVMA 3Q7PA 4CEJA 5CIWA 1WBBA 4LCBA 1KJYA 3NC1C 3HP1A 4AG6A 3VKGA 3HU2A 1X8LA 2OESA 2VP4A 1FFHA 4GSYA 1TQ4A 2JIZD 1PLKA 2ZSFA 2JLZA 1QHIA 1JECA 3QUSA 1H8EA 3CLVA 4Y0AA 1GOTA 1NMYA 2A7QA 2W0MA 4M21A 4PC7A 4PC6A 4US0R 4B3XA 3LAWA 5FBLB 4JVSB 1ZM2A 4JZKA 4A0GA 4AY2A 3KZ1E 3AVTA 3U2QA 4QG7A 3GEIA 5HCIA 2RCNA 1SXJA 3QI2A 2O8CB 1HV8A 2XXAB 2C95A 1IONA 1K5GA 1QRAA 4BWYA 3WMFA 4URUR 4HLUA 1OFHA 1EFUA 4UQOA 3QF4B 2HUPA 4C4PA 1DO0A 1CRQA 1G8YA 2NMVA 5K8TA 3QNUA 1D5CA 4RY2A 2YWHA 4XJXA 1L4UA 4WVFA 2KBFA 3TKLA 3THOA 1W4BA 3BFXA 4YMWA 4XH9B 3T34A 1OH6A 1D6JA 3RS3A 3OIYA 1E9BA 2GCOB 2G9NA 1E2GA 4RCZA 1U90A 4JKIA 1GDDA 1NIJA 4X8OA 4DLRA 3DVLA 3NBXX 1DAHA 2V6IA 4B43A 3AP1A 4Q1DA 1U0LA 3K0AB 3RYTC 5FL7D 3SZRA 2F43B 4O3MA 2EFDB 4A8JC 4D0LB 2XNSA 4LI0A 2HCBA 3QKRB 4KJZA 1JAHA 3EIQA 3TSOA 3NDPA 3X1WA 3BB4A 1SVIA 2PH1A 2GZHA 4OKSA 3BC1A 4C0HA 3O8BA 1U0JA 5H70A 1QBKC 4QRHA 2ZJZA 3U6KA 2ZI7A 1F5NA 5FOXA 3SJZA 3KQUA 1DARA 4D81A 2VA8A 2JLVA 5EE5B 1E2NA 1ZW6A 5HE9A 2OG2A 5GJWC 4LBYA 1VYUA 2MMGA 1CJMA 1ZIOA 4D4KA 2TMKA 2F55A 5F3WB 1E2JA 3K0CA 4Q5IA 2OFXA 4LJ4A 2GA8A 5CDFE 4LJ9A 3VNUA 5P21A 4Z1MA 4ZIRA 2IUSA 3GMTA 2XJ4A 3L0SA 4MITA 2ZRJA 4DDVA 1KI2A 4MKHA 4K46A 5EE1A 2MSCB 4BFTA 3VFDA 2GWHA 2NGRA 5FBRB 3WNDA 3FYHA 5EP1A 5AR1A 3QF7A 3SQWA 2YHSA 2XNDA 4V0ME 1JEDA 4C0KA 1EX7A 4LPKA 4A2QA 3ZYCA 2JJ1A 4NU0A 4EPVA 2C2HA 2HCJB 2IEYA 4M0LA 4N3NA 2EU8A 4B3GA 3IIKA 1VCIA 2ZJ2A 3BERA 4IEIA 3CH4B 5D3QA 1X1SA 4BLSA 4B73A 2C9YA 2ZSAA 5M04A 1U9IA 4FWTA 2J5XA 1GNRA 2O52A 1TQ2A 2ZYVX 3EZ7A 1KDOA 2WJJA 3CX7A 3VKWA 1RYFA 3RWOA 2ZRFA 3KJEA 4Z54A 3CBQA 2J7KA 3VX4A 4EJSA 2AL7A 3S1AB 1E2FA 4Z1MD 3LQQA 2ZI6A 5FTKA 4B32A 2P67A 1G5RA 2GBLC 3P27A 4B3DA 1NIPA 3K9LA 3QY0A 1II8B 2H57A 1G8FA 1KSJA 4A0HA 2FFQA 5KNDA 3I4LA 3EIEA 3A4LA 2QMOA 2P6UA 2JLWA 1XTIA 1XMIA 3R20A 1K6MA 1E4VA 4Q4HB 3TAUA 2REXB 3CPEA 4QNMA 1NLYA 3FFAA 1T0JB 4JLJA 2ZPTX 2VHUA 2VHCA 4DZZA 2W6IA 1IAQA 5JRJA 2NO1A 4WZBE 1IN5A 1NG1A 5FPTA 4P4UA 4W5HA 1W2GA 1R0ZA 2ORWA 3EAQA 4OHWA 3KQLA 2FG5A 3SC3A 1NBME 1XJQA 1NVWQ 4NH0A 1AQUA 1M6NA 4TWZA 2J9RA 2ODBA 4B44A 1S1MA 4LYJA 1CIPA 4E03A 1WCV1 4QM6A 2OXRA 2BJWA 4W5WA 1EFCA 2WHXA 3AKYA 3U7HB 2QGNA 1XMVA 1XMJA 2FF7A 5TXGA 2VSXA 4LBWA 4XD7D 1NBMD 4YLGA 2QTVB 4NYJR 2QUZA 3TUJC 1DAMA 1N5IA 1ZC3A 4HEJA 2CCGA 3FTQA 5KTYA 2GJSA 3WRXC 1DEKA 2JAQA 4Q7LA 2VPPA 3RHFA 1G9XA 3BK7A 1BYUA 1KK1A 2FSFA 2XTMA 5KU1A 3B78A 4EQ6B 2ZR7A 1LV7A 1NVVR 1SVMA 2MMCA 5CIQA 4KCGA 4FCWA 4QL3A 2Q3HA 5EXXA 4UJ3A 2FNAA 2J41A 3ZD6A 3R7WA 1XX6A 3BWDD 1R0YA 1TF2A 1LB1B 3SFVA 3OIWA 4GZMA 5KDOA 1I4LD 2BM1A 2EVWX 4CDGA 2JLXA 1KO8A 4Q4JB 3LVQE 3FVQA 1CULC 3QJYA 3D31A 2XB2A 3U3MA 3RVBA 1G19A 2ATXA 1G18A 1JJVA 4NONA 3MG9A 4JYCA 3QKTA 5FH9A 4FCTA 4CT4B 4GBMA 4KFSA 2VHJA 3I8SA 4M53A 2N42A 1GAJA 4HSEA 3FGNA 3KXLA 3RANA 4WIAA 1KKLA 4G5OA 1ZINA 4IOMA 5EP2A 2GZDA 4LK2A 1G20E 2GCNA 4Q9JA 3T1QA 5DNYB 2PBRA 5JSZB 2GXUA 5JBQA 5KDDA 1DG3A 1JEEA 2YYZA 3GD7A 4GI7A 3L0OA 3GEEA 1Z28A 1SXJB 5JZVA 4PQYA 4E5UA 1O3YA 2EFEB 3OIVA 3A36A 3WHKA 1ZM3A 5HPYB 1N0UA 4RFVA 4TMVA 4L5BA 1ZIPA 4MKGA 3I72A 1N6RA 2UZ3A 3GLGA 3CUEF 4ESVA 3K1JA 3RRNA 4H1VA 1KI6A 5L3RA 3SBDA 3GLFE 3CR8A 4GZLA 4OI4A 1WB9A 3ICEA 2X77A 1C9KA 1Q0UA 2QM8A 3KUDA 4NYJQ 1W36B 3KUCA 2BHRA 4UKDA 2ODWA 3THXB 2GK6A 4M9XA 2GEUA 1Y3AA 4D4MA 4FINA 3D6TB 3W3ZB 1IXSB 2UZIR 2C98A 3C14C 4JSYA 3GJ6A 5B58C 1QHSA 2D3WA 4DLXA 1GL6A 4JT2A 4BECA 1P75A 3TRFA 2WOOA 4OJKA 3JZMA 1FTSA 1S4QA 4RD0A 2DY1A 3SFZA 1SKQA 1X86B 1E2LA 2PCJA 2QM7A 3NBYC 1TU4A 4KBGA 1NVVQ 4TYPA 3L2OB 3ZQ6A 1Z6XA 5E95A 3CH5A 3AUXA 4CW7A 4DIEA 3W6PA 1AGRA 3ND9A 5KNCA 4YMSA 1FQKA 4PHGA 4BEJA 3KL4A 4BLRA 1XTKA 2RGXA 5JS7A 2WIAA 4CEIB 1TL7C 4LJ5A 2QT1A 3KDSE 4DCUA 4E07A 2WVJA 1WDTA 1AS2A 2PEYA 3BB1A 3LX8A 5GJBA 2R62A 2BJVA 3GLIA 4I4LA 4KYIB 4EFLA 4DCSA 1P6XA 1PUIA 4RD4A 4PPGA 2IS2A 1KK0A 1GIAA 2E9SA 5B64A 4D0NA 2BCGY 4HUTA 5SZIA 1QHGA 2XSZD 5KNBA 3K0FA 2H1LA 3SDZA 1SVSA 4PC3A 4U02A 1V5WA 2D06A 2NZ8A 5FR1A 3ASYA 2FWRA 2B7BA 2QAGC 4JLBA 1CJKC 1NSFA 3T1OA 3LW7A 3DMNA 1DE0A 1YVDA 5EP3A 4Q66C 3EX7C 2ZSDA 2RAPA 5EZ6B 2EQBA 1P5ZB 3AVOA 4Y0VA 3MLEA 2ODEA 3ZLJA 1G17A 2QG6A 4LWZA 1J99A 1VMAA 3CF2A 1E0AA 1P60A 3WYFA 4C0AC 2RGNC 4QM7A 4ZCLA 4PSAA 5JFGA 3AF4A 4GL2A 3NHAA 5CK5A 4PQRA 3T06B 3T61A 2VF7A 2AD1A 2F7SA 3AP2A 1RIFA 1EXMA 3K9NA 2WSMA 4TLDA 5TVKA 1GL7A 3W9YA 1NN5A 3MD0A 3FHOA 1RRGA 3VMFA 2EYUA 4JBWA 4QFMA 1FZQA 5H1YA 3KX2A 1RZ3A 1E1RD 2ZS8A 4JBYA 2IX3A 2W83A 1HY3A 2C96A 2BCJQ 2D2FA 3B6EA 3EIHA 4HAWA 4Q9LA 5FTJA 2A5JA 4HB2A 4R71A 1NN0A 2XXAA 3WBJA 1G7SA 3GJ7A 1XD9A 2NIPA 4TL8A 3QF4A 1XTQA 2YWFA 4L9WA 3A4NA 3A58B 2AX4A 4ZDWA 2WWGA 1BMFD 4URXR 3N2EA 1W0KD 3WNCA 3KB2A 2IUUA 4R2HA 1A1VA 4PANA 3CW2A 3PV0A 1FMJA 3LBNA 2PLFA 3I61A 1KSFX 4UNQA 4JYBA 3IKJA 1QHNA 4MDEA 2Z83A 1XPUA 2O8EB 2RHDA 4YDHB 1R5BA 5FUXA 1OXXK 4RKFA 3F8TA 2WWIA 1AQYA 4LHZA 3CX6A 3HJNA 2F1HA 4MRNA 1HQYE 1R0WA 2VEDA 3NH6A 3EW9A 3KKNA 4YXWD 4BZXA 2YKGA 1ZM7A 5DI9A 1ZP6A 2HF8A 4R98A 3W34A 1QDEA 4HYYA 3RNLA 1UEIA 1P2SA 2YINC 2FSHA 2WAXA 2ERXA 5EXSA 1ZNZA 2NO9A 2CNWA 2ZSEA 2GETA 4V03A 3AVQA 4QHYA 1UKYA 5TB5A 1YR8A 5ELXA 2HXSA 1COWD 5LDDC 1VCMA 3NBZC 4Q1BA 3RSLA 3O8CA 2FX3A 4ACAA 3FKSA 3R7WB 4POAA 1DELA 1P9WA 3QEOA 2V9PA 2VHQA 3DPUA 3AVWA 2ZJAA 5AJXA 1NKSA 2OE2A 2A5YB 3VAAA 3T5GA 5TY0A 4KSBA 4KFRA 1IY2A 3HR7A 4S35A 5HE8A 4DB4A 4OHZA 5LD2C 3KTAB 1E2IA 4WOPA 1SKYB 4FWIB 3SJAA 1HA3A 4RZXA 3UPUA 3EASA 5C4GB 4G5GA 3GJ0A 2GXQA 1IXRC 3GJ3A 3ZJYA 3PUZA 1ZU4A 1LS1A 4KODA 1K8RA 2WAYA 2A78A 2PZGA 1KAOA 3AQ4A 4US1R 4XVUA 3NHBA 1NLZA 2GEDA 3R9XA 1SQ5A 2ZTSA 3OFNA 4B74A 4TLBA 4LYHA 1L7VC 2IBMA 4A15A 2JLRA 3H0KA 4TLCA 1FX0B 2ZRPA 4W7SA 2GAAA 5JJKA 3ZD7A 1QHHB 3LA6A 4RZ3A 3P32A 1XBTA 2CVHA 4JIMA 1N6NA 3SYKA 3DZDA 4DEXA 4GPTA 1CR1A 1CBUA 1E32A 2HT1A 5JMTA 4DIDA 4FMCF 4Q4HA 1HYQA 4DKXA 4IFEA 2DYKA 2AWNA 1JBKA 1N5JA 2X19A 1KMQA 1S9DA 2ZU6A 3DM5A 2D7DA 3EPHA 5E7MA 2OV2A 2CK3A 4AYTA 4OQFA 1ZVQA 5J47A 5FTMA 5F2EA 4GT1A 4B71A 1MO3A 1E1QA 3A37A 1OE0A 3VNVA 2ZJ5A 1U94A 2BMJA 2WWHA 2AXPA 4IDOA 4KVGA 3RC8A 4B3BA 4OQXA 2BBOA 1NF3A 2IHBA 1OHHD 1ZNYA 2P6RA 1E2PA 1GRRA 2G88A 2DWOA 5JWHA 1E69A 2ASEA 3UATA 3B13B 3MWKA 4A92A 2O5VA 3A8TA 4B47A 4I99A 1GRQA 3SYLA 4ZKEA 3AVPA 3LBHA 1KO5A 2V7QD 1UKZA 2X8AA 4C2TA 2OLKA 1E79D 1G21E 4UNRA 4PHHA 1AZSC 2DBYA 1QHYA 2GJAA 4H9GA 4JLDA 5G3ZA 2QA5A 3IDQA 2IHYA 1E6CA 2VH5R 4ZI2A 2AKYA 1T3LA 2BMDA 2ZYUX 3CRVA 1G8HA 2PX3A 2AN9A 4PC2A 3TMKA 5J4VA 2QBYB 2QAJA 3GLIB 2WICA 1RFLA 2IYYA 2FU5C 2J7PD 1Z07A 1GKUB 3NIBA 1HT1E 3IHWA 2PCLA 4B2PA 4QXAA 4AD8A 1U8YA 1NN1A 4URZR 1ETUA 3B85A 1JR3A 1SULA 5CYOA 2WM9B 3KXIA 2QE7A 2J3EA 3ZH9B 1XTSA 1IHUA 3W3AA 5G41A 4PTLA 5LB2A 4YONB 3WY9A 3ICQB 4WBSA 2QQEA 3GLHB 4RKEA 3QOFA 4M9QA 3RRYA 4YMVA 4Q7JB 3SHWA 4AI6A 2K5UA 1G6HA 4R7ZA 1N3BA 4Q4JA 3FMOB 4JLPA 1MOZA 2PJZA 1NLFA 3AUYA 4ZCMA 4HUQA 1CP2A 2WJIA 2ZS7A 3B82A 4HATA 2QROA 2EWVA 5EUMA 3B2EA 3MMPA 1JPJA 2JLQA 1L4YA 1GKIA 3GPLA 1Q22A 3A4MA 1ZM9A 1QG2A 5K8LA 2CHVA 2IA5A 2F3RA 4JBXA 2ZJYA 3TSWA 4DT1A 2ZE8A 4KV9A 1YZTA 1VCNA 1VYTA 1N25A 4TL9A 2X1VA 5J4LA 1NNEA 1RRPA 2HV8A 4M22A 1BS1A 1VTKA 5EQTA 4EKDA 1T3HA 5JSZA 2J0UA 2ZR9A 1QG4A 2A5GA 1WRBA 1TQ6A 1XFAA 2B8TA 2QGZA 1G64A 1IJFA 1G7TA 1UDWA 3IHLA 3P1JA 4I1VA 4N0EA 1ZUNB 3OE7A 4FMDF 1XEXA 3CRQA 3QXJA 1W0JD 2YOGA 3U7GA 5JI2E 1SGWA 1N0WA 3Q85A 3D3QA 1F2UA 2DB3A 2BWJA 1RW4A 4TZ0A 3K70B 1SXJE 1OKKD 1OFTA 1MV5A 4PO9A 4WA7A 2RGDA 3H84A 5J4KA 1NI3A 3B60A 4EIWA 2BEJA 5E7JA 2XGJA 3FMIA 3PEWA 4OK6A 1IQPA 1UBFA 3THXA 3BE4A 2DFTA 1H8ED 1E4YA 3K53A 3KB1A 2O8BB 1GUAA 2Z4RA 2JASA 1VIYA 5DE3A 3AV0B 1YRAA 2EFHB 4IDQA 5CLQA 5HTKA 1E9FA 4A2PA 1X8JA 1Z08A 2ZE6A 3HR8A 2DFNA 1SXJD 2VTKA 5AWFC 3U3KA 4TZ6A 1W5TA 2GILA 2CL0X 1EFRA 4QGAA 3MRSA 4TQUS 1DS6A 1ZCAA 2RGCA 4LBVA 3TNFA 5A4JA 5FUWA 4MGYR 3IIJA 1FUUA 1X3SA 3QG1A 3TR5A 1AN0A 3CWQA 1QHXA 4GOKA 4BLPA 1W36D 1NL3A 1TF5A 4IOLA 3KQHA 5TMPA 4CEIA 4AC9A 4CZ2A 2QPAA 5B30A 5FBVB 1CLUA 2BDTA 1LF0A 3FOZA 3NEJA 2ZI3A 1NMZA 1SVLA 4B3FX 4GOJA 2IYRA 5AUNB 4KITB 3RC3A 3U60B 4A6PA 4AKGA 3I1FA 1JI0A 2V55B 4H1UA 2ZYTX 3Q7QA 1BO6A 4XTRA 2QEQA 1QVAA 4LHWA 1NKTA 2GKSA 2I1QA 4Q01A 2WWWA 2O8FB 4A2WA 1II9A 4AYWA 2JDIA 2P2LA 1VKJA 3FMFA 4QC2A 3EPKA 3IBGA 1RJ9B 4HDOB 4KAXA 1GWNA 1XZPA 3N5CA 3M0EA 3ZVRA 2YWEA 1V43A 3ZS9A 2HF9A 4MRPA 1S3SA 2VHTA 4XWAA 4F7WA 1I2DA 2CLDX 621PA 3BAFA 2HYDA 1J90A 2KWIA 3Q5DA 1OXVA 1MO4A 3PEYA 3QKSB 4B33A 3NG1A 5L3QB 2FMXA 2BKEA 4LX0A 3TUIC 3I8XA 3THWB 4OL0A 2NOAA 4C9BA 2CLSA 4HLCA 3X1ZA 4AKIA 5B2ZA 3CIOA 2DCUA 3M1IA 5C1BA 3R9IA 1W2HA 3C15C 4EAQA 4C2UA 2XNDD 1SVWA 3LQRA 4BLTA 2JDID 3T35A 2JJ1D 5KHOC 5IK2A 2WPDA 4BRUA 2WMOB 3BIFA 3A1WA 3GJ4A 1DTSA 1ZD8A 1D2NA 4X8LA 2ZE7A 4PX9A 3SS8A 1G16A 1ZD9A 2D7CA 4NL4H 2IS6A 4B2IA 4F4JA 3VQTA 2HT6A 2R9VA 1P4SA 1MABA 4ACBA 4AYXA 2WKRA 2G0NA 2Y8EA 1A7JA 4V0NA 1SXJC 3AP3A 2QP9X 1M7HA 2IT1A 4Z8YA 4F93B 3JZAA 4HLUC 2DHRA 4KHZA 3ADCA 3ZVLA 3C4JA 4OHYA 4M1WA 1D2MA 2EFCB 1Q1EA 2LCFA 4WZ6A 3G82C 3ETLA 4NYIR 5DO9A 4MRVA 3GEHA 3UANA 4YMUA 2WPDD 4DLZA 5IK2D 1W36C 1E96A 1QVRA 4TT3A 3LX5A 2FH5B 2NO6A 2GRJA 1NG9A 2O8EA 4CF7A 1E9RA 4B75A 3V4RA 1N5LA 3ASZA 4IVRA 2W6ID 2AD5A 4Q4AB 3ECCA 4EFNA 4A8JB 2WTUA 1OB2A 2C78A 5FOVA 1NP6A 5L8VA 3KJGA 2GXSA 1TUEA 4MYCA 4TTQA 4IDNA 2W2TA 1Z0DA 3MJRA 1E9DA 5KSPA 3CRMA 1AGPA 2D4HA 5KSYA 1TEVA 1UBCA 2RGBA 3B1YA 2Q9BA 1US8B 1G6OA 2FPMA 4NZYA 2BKUA 5IHPA 4TYQA 2HXYA 3BB3A 1SHKA 2PT5A 3PENA 2Q9CA 3KJHA 5A0FA 1IJEA 2D62A 3AF1A 1DAGA 3PUYA 4PQFA 4M1SA 1J2JA 4DLWA 4ABYA 4A6XA 2GF0A 2MSEB 3K0CC 2VYFA 1Z8FA 2QTFA 2GJ9A 4KLNA 3TIFA 4AKEA 2ZIAA 3DL0A 5GJCA 4URWR 4DHEA 3EA5A 4OI0A 1ESNA 1MRNA 2P6NA 3Q9LA 3UIEA 5F98A 1II0A 3QKUA 3HWSA 2OXCA 4CEHB 1T91A 3PFIA 3IPXA 4FIDA 1D9XA 1W4AA 1AK2A 1SVOA 2ZRKA 3KTAA 3TR0A 4HUQB 4NPHA 4Q9IA 4MQBA 5DI3B 1OW3B 3VHXA 2BOVA 3W5JA 2H92A 1ZJ6A 2H5EA 4RD1A 4TLEA 3SNHA 3W6OA 3TSZA 1P3JA 3FB4A 3X1DA 4B48A 3EZFA 4UNPA 1QZXA 5KUTA 1U9IC 1SKYE 2VQSA 1U2RA 3C7KA 2F3TA 2OBNA 3FPAA 4DT1B 2QENA 1LY1A 2QP3A 4DLYA 4YMTA 2VBCA 4KSCA 2ZE5A 4IEEA 5LPNA 3QSYA 3BD9A 1R8QA 2XTZA 4L8GA 2CDNA 3EARA 4NYMR 4EJSC 1J8MF 1FX0A 2ATVA 2IYQA 2J0UB 3A1VA 2GEVA 1QHHA 4DDUA 3AGQA 2P3SA 1XEXB 2IYUA 3X1XA 1JQJC 4XIGS 1KSGA 1Z0JA 4KI0A 2L0XA 4C3ZA 1JNYA 3TVDA 2ZI4A 2ZRNA 4B6EA 1F2UB 1ODFA 4HLQB 4ESHA 1G7RA 4B76A 5IT5A 2PZEA 4KYUA 1U81A 4IJMA 2IW3A 2PLRA 2OSBA 2WMNB 3A6PC 2H16A 2F1IA 1H8HA 1XCMA 3K9HA 4OK3A 4RZ2A 4TLAA 3GLGE 2VIIA 3V4FA 5G3YA 4EPWA 4AWXA 2VL7A 3IIMA 2G1KA 4BFSA 4Z8XA 4BPBA 1NJGA 4K8OA 2HEIA 3SQXA 3FHTA 1KI7A 2ZEJA 3TBKA 3T12A 2R44A 4D26A 1PVOA 4ARZA 4JVNA 2XOKA 1XPRA 4KU4A 1OIWA 5DN6A 2DWPA 4GNKA 3TE6A 2JJ2A 4LBZA 1W4RA 1FNMA 4AG5A 1XTRA 1AJEA 1YE8A 4DLTA 4G5RA 5KSZA 2C9OA 4LV8B 1NMXA 1CRPA 5EXTA 1A2KC 1UJ2A 1YR6A 2DR3A 1E2EA 2KBEA 3L82B 1XNJA 3I92A 1H8HD 1XPOA 2GJ8A 2IWRA 4HAYA 3WYGA 1T5LA 5E4FA 1KNXA 4DSNA 3MWYW 2FJUA 4XSHA 3DEFA 4LC1A 1G291 2HYIC 2QBYA 1TMKA 3EPJA 2FPLA 5JI3E 1I2MA 3WMEA 4K81B 4LRWA 3MUFA 1XTJA 4YQFA 2XOKD 1I4TD 3N2IA 3WYAA 5BW8A 1T4GA 3GLIE 1FOEB 4IOJA 5BWMA 1E2KA 1WBDA 1KJWA 2V1UA 2ORVA 4MDFA 2FPKA 3I62A 5D3MA 1XD2B 3QPWA 3SYNA 1MH1A 2ANBA 3KQKA 2Q0HA 3B1WA 3AF0A 4PPNA 2GHIA 2I4IA 5FOWA 3CZPA 3GLHA 3WHLA 4CVNA 2ANCA 3CNOA 3TH5A 2NO0A 1HE1C 2IXFA 2VSFA 4QNRA 4NYMQ 4WAUA 4QKQA 2OAP1 1IY1A 4M1TA 3LDAA 4MKFA 5FI1B 2J1LA 3RRZA 4Q02A 3GLHE 2CE7A 3RABA 3IGFA 5AUPB 3PCRB 4ZO4A 3RSOA 4PSVA 3P4YA 3CPHA 3VR3A 3TW4A 1VYVA 3DKVA 2Z43A 5J4YA 3QE0A 4PAQA 3K8YA 5JWRA 2CCKA 4XSGA 4Q03A 3T1VA 2AHOA 821PA 2IXEA 1JPNA 1JALA 2VP9A 1Z6GA 3DOFA 1VG8A 5LB4A 3FDIA 3SE0A 4TMWA 3TVTA 3V00A 1YZQA 4IXNA 1PLLA 4DLSA 2FDCA 4V02A 5CYPA 4CIDA 1MABB 4JSTA 4LJ8A 1A4RA 1KIMA 3KXKA 1AS3A 4V0LA 4MGIR 1OIXA 1OV4A 3UMFA 5CK4A 2WBLC 4I81A 3W8RA 1TU3A 1ZBDA 3UMRA 1ZC4A 2GJKA 2RHMA 4M1OA 4MA4A 4NTZA 3W6NA 5CITA 1KI3A 4PPFA 2ZRAA 3P4XA 2IK8A 1OXTA 4D0GA 3B1ZA 4GFDA 1KAGA 1YZLA 1W1WA 1IN6A 2V8OA 2WWXA 4X8HA 1FPMA 3D7MA 3LLUA 1GILA 3O8RA 4HZIA 2J0QA 2ZREA 2FSGA 5DYIA 1IN8A 2D2EA 5BN3A 1ONBA 2IUTA 2RMKA 3ADBA 1OH7A 1M34E 1E2HA 3LH5A 4B35A 5EUQB 1AS0A 2OFWA 1MKYA 5JRZA 4ZPXA 4TMXA 2O8BA 2QY9A 1E9EA 2EYQA 4Q18A 1Q57A 4JKYA 2QQ0A 5E7IA 2V3CC 2G1JA 3FKQA 4NCHA 4IW3B 1E94E 1DAIA 2ZQ5A 5J40A 1XXHB 1SVKA 3AEZA 3EZ6A 2WJHA 2IYVA 3ZZTA 4AURA 4HB0A 4FCVA 2YJTD 1CJTC 3C41J 4PZZA 1TTTA 4AKHA 1P9NA 4HI0E 4OQNA 3RS5A 3BJIC 3CB4A 1KOFA 2F1JA 2BBWA 4US2R 1N6LA 4C7OB 1IM2A 4EFMA 1G3UA 4QOSA 3K70D 1EG7A 1F48A 1GKYA 1U8ZA 1FP6A 4P4SA 3OEHA 2ORIA 3ND8A 5FPSA 1LF5A 5KPJA 4HZUA 1WA5A 3GJ8A 2CL7X 2WJGA 2NG1A 2IS4A 4PXAA 5A5GA 5HR5A 1NRJB 2A2ZA 2UVQA 1EFTA 4C30A 4L4UA 3TQFA 4UXHA 1S96A 1BKDR 4BZQA 3T1TA 1RRCA 1N6PA 1Z22A 5JEEA 3VR6A 3AVUA 2GK7A 5KDLA 1AIPA 4C0BA 2R6GA 2BV3A 3JVUA 4KXFB 4LJ6A 4GOXA 4F4IA 2EW1A 4ILEA 3IEUA 1ZCBA 4BFWA 3UKDA 4BFUA 421PA 1X8KA 2GF9A 3U3RA 1DOAA 1T0HB 2QNRA 3E2IA 3VR1A 2HDNB 4G1UC 5C2JB 2O8FA 1FMLA 1R8SA 3EC1A 1P73A 1ZNWA 5C4MA 4U00A 1CR2A 1RJ9A 3UWKA 2CNWD 5HZHA
chains in the Genus database with same CATH superfamily
4LI3X 4UAVA 1GTJ1 1I2AA 4RELA 3C3YA 2BFEA 3TQRA 3DMPA 3MIIA 1A5TA 5DISB 3OQOA 1JFVA 3P2MA 4JITA 4FZRA 4C7MA 2X2OA 3DHWC 2O7QA 3LDGA 4F7DA 2YZNA 1QO7A 5EZSA 3O47A 4YFVA 4IOKA 3T7SA 4P31A 4OYRA 2B1IA 4OA5A 2OPFA 3DTVD 3LT1A 5INTA 5HBRA 2WYWA 4JODA 3W2IA 2WTMA 5K7SA 1ZGJA 5FPPA 2H2IA 4H7HA 4A8JA 5D5PA 2PMFA 2WSYB 1VBFA 3C24A 3AONB 3I28A 5SZJA 1G5TA 3F47A 1WJGA 5D3MB 1ZMTA 3CWZA 4GR4A 1NVFA 3HM2A 4MKIA 1O57A 4IDGA 1FTNA 1YKFA 3LPDA 1DBPA 3F46A 4CT5A 5G4KB 2CCJA 3QPVA 1P62B 3BTOA 3QUCA 1RD4A 4UTZA 5B55A 1VLVA 4D74A 2GFHA 3W1EA 1Q1GA 2JUJA 4ZAVA 1HQCA 3RRMA 3ZWCA 2GVNA 4ILKA 1EP9A 3SF0A 1Z06A 4J4BA 2RB4A 3JQ9C 1J42A 1CS0A 3G1TA 3OU6A 4EW2A 3ROMA 1O0SA 1A9OA 4UEKA 4BE7B 3CU5A 3GC6A 4J0DA 3IEPA 3ZIAA 3W05A 3G1WA 1T9ZA 4G4NA 2R7KA 1FNSA 4OHMA 1G2QA 3IP5A 4LZWA 3E22B 1JJ7A 2IYEA 5SY4A 3W06A 2R97A 1J5EB 4S3MA 1O6ZA 1XDGA 4HB3A 5JSYA 4F06A 1Q21A 2BONA 4DMUB 5CB4B 1EX6A 2ZJ1A 1ZDMA 1IOVA 2F59A 2AJLI 1SC4A 1Q77A 5T41A 2ZBFA 4Y9SA 2WZCA 3ER8A 4UMDA 6YASA 2OWDA 2APJA 3ESYA 1NJSA 1AKEA 2VTVA 3D2BA 1TVKB 5FUMA 1PSDA 4FFBA 2OCDA 4CWAA 3IS3A 3HM9A 4HWRA 1QNFA 5ETJA 2OBFA 2VDBB 3UW1A 1P2TA 1WEHA 3E5HA 1OB5A 3PQEA 3QVVA 4C22A 4MQFB 1KO1A 1Z8DA 2B98A 3WICA 4FYVA 3NQ41 4LF5B 5BWCA 4GI5A 1RI4A 1EJBA 1MU5A 3LXMA 2Y6UA 2QOEA 1Z6QA 4CKCA 1T5IA 2OCYC 1UFVA 1V92A 4JC8A 4LRUA 2VCHA 3WL5A 1RE1A 4XWWA 3KKQA 1Z2AA 1QYCA 4RK4A 1ULTA 4MMXB 3SX0A 2H7CA 4FJ1A 1XCLA 3EVDA 1FFEA 4XGKA 1ADBA 1ULSA 3EB9A 4JT4A 1M8GA 3OA2A 4ESOA 1JXMA 1ZZEA 1E9SA 4JK3A 3THYB 1S3GA 3RHSA 4PAOA 4CIWA 3G5UA 3C3PA 2JNWA 5EZ5A 2QMYA 2FW8A 4XOIA 2WHQA 3OZ7A 5EC8A 1K89A 3FSGA 4LY3A 3E9NA 2B9VA 1P7VA 4ARAA 5D84A 3W1WA 1DXQA 5J1TB 3R0JA 3IPLA 2J46A 1PR6A 2LVBA 3AR9A 2J45A 1ABEA 1M7GA 1ADCA 4TMTA 4HFNA 1VCOA 4M6WB 2NXWA 8OHMA 1LVGA 2YV5A 4Z1OA 2VEOA 2ZM5A 4MJ7A 2H9YA 3HJCA 1YR9A 2JGLA 3KZXA 4QOZC 3ILVA 3MPUA 3BXZA 5EESA 1NQ5A 4IHJA 3D1JA 1H2XA 5BV0A 3OEWA 1J7KA 4ZYLA 4CMGA 3DZ8A 2D5LA 3DO6A 3EOAI 3UY4A 5C46F 4P32A 4B3TM 3TNLA 5K3OA 4FYKA 3GVIA 4UTOA 3LBYA 5CVEA 3GL9A 3FYCA 1FFXB 1IXZA 4MINA 1NY6A 5BPHA 4ZTBA 4FFLA 5IZ7D 4QUIA 1X7XB 2WKQA 3KNZA 3O6VA 1L7QA 1KYWA 1QORA 3NHZA 2FZVA 4GM4A 5HYVA 1BN6A 3JQAB 5KPDA 2LHCA 4II7A 3L43A 4KRXA 3JATB 4R1QA 1C30A 1VJ5A 3CEHA 3WVNA 2ZP1A 2HMTA 3GNLA 3KWMA 2K6GA 3N8GA 3QE2A 2JIPA 3DOCA 3DBRA 3NEPX 4P1ZA 2A67A 2AG6A 3DSRA 2OXIA 1BDHA 4ITRC 2Y71A 2FEMA 1UBHS 4JYAB 3QVTA 2GZAA 2XDYA 5BUZA 2DAKA 4OQZA 1EZ4A 2R7NA 3D6JA 4ZJPA 3E9MA 3C7DB 5C5IA 4ETMA 3LLMA 1OTXA 4P54A 1UMBA 2V1XA 1F5SA 1Y5NA 5BNFA 4H3VA 4V0OA 1KIFA 2HA6A 5AP9A 3GFQA 1D4AA 2FW0A 5KNBH 5FO0A 1WB5A 3BD8A 1B23P 1TLLA 5T4BA 3OMWA 4I9GA 4KB5A 4WASA 5I9TA 4DMLA 3AYXB 2FJPA 1MR3F 2X0DA 2W5UA 4LUCA 4P98A 4JROA 2P1RA 2J09A 5FNVB 3ZXSA 2H4FA 5BMVF 2CWDA 1FP7A 2HLPA 3W78A 3KV3O 1GGKA 4AJIA 1FBTA 2PXAA 2QU8A 3PYMA 3Q9SA 4C7JA 2C5LA 3F7MA 1M1NB 1DJQA 5CYFA 3WGOA 4BX9A 3AH8A 1NDQA 3WKCA 4UDYX 1U80A 5LLDA 2I4MA 1N92A 4H1TA 2V6BA 3IQEA 1VE6A 1EG2A 1OTYA 3GY0A 2VP2A 4WXPA 5K9ZA 3C9PA 1XHEA 4BLVA 1IHDA 5LQAA 4WPGA 2W6JD 1Y9ZA 4U5QA 1YS6A 4G0WA 5CXUA 1MV8A 3UKJA 4DUGD 4F2GA 3QBDA 4O8CA 4IWNA 4DR1M 3P26A 3LXXA 1ZIXA 3IAFA 4HQ6A 4NCBA 3T8YA 5TJ9A 3N53A 3VC2A 2R0QC 3E5RA 2EXXA 2DAMA 3CZRA 4B81A 1WOYA 3DVSX 1G1MA 3URMA 4KGVA 2XIQA 3SX4A 2ZSJA 3DO8A 4LZOA 3ELDA 1L6IA 2CMHA 4HK4A 1KJYA 5FULA 3E9SA 4YUWA 1JTFA 2A9PA 5B7PA 4GSYA 2O19A 1FJ2A 4DR6B 2KM1A 4NR0A 4JZKA 3ZZNA 4CKBB 3KZ1E 3V42A 1QP7A 2RCNA 3JWEA 1SM4A 4HLUA 3G9ZA 4D3SA 1MHTA 3B3GA 1W4BA 4P08A 1Y1LA 2G9NA 1PGQA 4YHHM 3L1VA 3U6CA 3BZWA 4FR0A 5DXAA 3D2AA 3FDZB 3F4KA 4UCXA 3V4OA 2DENA 4D99A 3NXKA 3NU1A 3V9AA 3CHYA 1Z18A 5LKRA 2O50A 2HA7A 2EHJA 3JTEA 1G55A 1OIPA 3K0CA 2G07A 4Q5IA 2PUBA 5HIKA 5ADWA 4ZIRA 1J1UA 2ZRJA 1D1TA 2RCYA 1NQTA 1YE5A 3C48A 2XECA 3OE1A 2O4UX 5AR1A 4MYDA 4X66B 3VLFB 2O3UA 1JHXA 4IEIA 1DFGA 1SEPA 4HPWA 4DR2M 4Z54A 3TTWA 3R5KA 2J7KA 3S1AB 3BSYA 2YDYA 2FEPA 3NJRA 1KSJA 4KE7A 1K5HA 3JQAD 3FG9A 1K6MA 5LR6A 2REXB 3FFAA 1MC4A 2VHUA 5F52A 5FWYA 1TO6A 2NO1A 4WZBE 3BF7A 2R1ZA 1NVWQ 3IQFA 3O8QA 2UV8A 1NMEA 2OXRA 2E6KA 4HTFA 1Y4SA 2CBGA 3GRVA 3D54D 2CHUA 1QCZA 1N5IA 5DNVA 2I2DA 1Y5RA 4RLSA 3P8ZA 2VPPA 3RHFA 5KU1A 1EDDA 2POCA 2GDZA 1QGAA 4QYWA 5CIQA 4KTVE 1LDGA 3GK3A 2J41A 3EDOA 1R0YA 3I23A 2GN9A 2D3TA 3G8BA 1R9JA 4RE6A 3DR5A 3Q2OA 1UXKA 4I50B 4RZIA 4K9QA 1NI5A 4GMFA 3SJ7A 2OO9A 2R47A 2ATXA 1JJVA 4GBMA 1ZGBA 5L4SA 2QTCA 3FIUA 1SG9A 3A3KA 3FGNA 3S40A 3CUKA 1MORA 4GI3A 3OF3A 3IPAA 2CXPA 4X6UA 2I7TA 2YYZA 2O3QA 4E5UA 4BMDA 1AF4A 3AK4A 4N5DA 3AMVA 3I72A 1P1JA 3DWGA 2X15A 3RM3A 1R16A 1VLMA 2YCBA 4JFAA 3KUCA 4M9XA 2XZFA 2AYXA 1Y3AA 3QWBA 1C1DB 4IP0A 3RV3A 1RHMA 4QECA 3GJ6A 3FN4A 1GL6A 5AVUA 2BW0A 4LS3A 3G5TA 4I4NA 4E12A 3A9VA 3JZMA 4IQGA 5E1BA 2PU7A 2C3OA 4CL8A 4UM7A 2PKRA 2PEYA 5GJBA 1DGFA 3P0JA 3LCCA 4DCSA 1ZGAA 3RSQA 5BT9A 3GRPA 2VZ8A 5SZIA 2XSZD 4N03A 4YRBA 3I0NA 5EXEA 2PUVA 1BWRA 3LW7A 4PBRA 2XDQB 3PFKA 3ZDRA 4HY3A 4I5EA 4MO9A 3BBLA 2RAPA 4UOZA 1VMAA 1JYFA 4MNTA 3ANYB 2MU1A 2RGNC 1GFZA 3KZNA 2H85A 3T06B 5BN1A 1U2EA 1TGYA 1QWOA 5JAUA 2WSMA 5BYBA 4O6VA 4BQQA 4OQDA 3GQ4A 3OWXA 1P8JA 2JRCA 1EE2A 3EIHA 2XUZA 2HHHM 1CG6A 4R1SA 3SZGA 1FW8A 3V3TA 4BO3A 3H1EA 1EFVB 2YWFA 3C6KA 3A4NA 4CN8A 2AX4A 4FOTA 3LUKA 5CGZA 4DHWA 2XLCA 4Q24A 4D9MA 2CXSA 1R5BA 3OTOB 1Z5GA 3H5TA 4DLKA 2NU8B 4AP5A 1P5RA 4ROTA 4M0DA 5EXSA 5TQ0B 4NESA 4R0VA 1COWD 4QU8A 3QPBA 4HNVA 1J2EA 3O8CA 3R7SA 1PNRA 2QYHA 2A5YB 4P22A 4FXOA 2HAKA 3HR7A 3S8MA 4OHZA 5KTNA 4LXTA 4AQYM 2GLXA 2XMBA 4YCSA 1VBMA 2PZGA 1WQ4A 1Y4ZA 5IARA 2YFQA 6CHYA 1FIUA 5FNVF 4PX3A 3ESDA 1AKTA 2JH3A 5DKFA 2P9QA 4QDXA 3WYDA 5LZ8A 1L4EA 3ECAA 3BXHA 3AEXA 4EYEA 4JVOA 4KVGA 4D5GA 1NF3A 2P6RA 1E2PA 4X1OA 5ESDA 1OREA 2X7HA 1FEZA 2C7PA 4XIIA 1QTIA 4MTCA 4JIGA 4L3VA 2QW8A 2YWCA 7REQB 2JI9A 4JD5A 4ZRNA 6ABPA 1EE1A 1A5ZA 2BMDA 2PX3A 2WICA 2ZUSA 3QMPA 3KL2A 3MAGA 1LBTA 2WP0A 4Q3BA 1UWCA 3ORQA 3AFIA 5G41A 3TRKA 5FB3A 3ZE7A 6REQA 4HCJA 1NJ6A 5BV1A 4HNTA 1VFNA 4GPZA 4D79A 3ESXA 3QIVA 1CP2A 4DC0A 4ZCQA 5DPMA 3ZLTA 2HB6A 3RVLA 4BJ6A 3LYHA 2HPHA 5F1YA 1BRTA 2CHVA 1E7YA 2CVZA 2GM5A 4TL9A 1RABA 3WXBA 1SGWA 3ELBA 4CXMA 2DB3A 2J6CA 1U6KA 2P2SA 4I8IA 1Q50A 2O14A 4G1VA 4JQOA 3AY6A 3IV9A 5H9WA 3MTJA 3PYLA 2UXCB 1T8RA 3HR8A 1GPDG 1W5TA 1ADGA 2GTIA 2PGDA 5BSUA 3TNFA 4MGYR 1T3GA 2K9DA 4UAGA 1EK6A 2QGFA 4CZ2A 1EK1A 1RBQA 1SC6A 1FS6A 3STUA 3C1TA 1HFKA 5AUNB 4Q05A 5D2CA 1QKIA 1B6GA 3GHHA 4MUEA 3HHXA 5JAZA 3WHIA 1QVAA 2FSVC 3QEAZ 5K2OA 2I80A 4YO7A 3QFCA 1K08A 1OLSB 4Y1GA 4M1ZA 3SICE 1J90A 1SC1A 1UAYA 3TUIC 3P9KA 4MWBA 4EJ0A 4R2KA 1KFVA 4CDMA 1SVWA 3X43A 4BLTA 4QSHA 3T35A 4HV4A 1U3WA 2XFSA 3CLKA 4E94A 3HB4X 1ZD9A 4AL4A 2Y4OA 3SQOA 2R9VA 4AYXA 3DEHA 2HWKA 2HO4A 4RMJA 4L9AA 4FDMA 4CQMB 1A9PA 4E2FA 2ZWMA 5KNDD 3CLUC 4S04A 3NTVA 3PUHA 3WA6A 3EE6A 2EBFX 1N5DA 2FP3A 2C0QA 3RYFB 2PVCA 4AJ2A 4LCEA 1GEGA 2G9ZA 1YDWA 1X7WB 4NQZA 4NZYA 2HIHA 3AF1A 2IOFK 4PGFA 5HQJA 1O9HA 3DL0A 3L29A 5EY5B 3MM4A 4CEHB 4YRIA 5CYGA 3P4UA 2C0CA 1N8TA 1VL5A 3IPCA 4JQCA 3X1DA 2QN9A 4L0QA 2GLTA 1ZOIA 4I50F 1KF0A 2VBCA 5ECWA 3B8EA 1DIRA 2IOYA 1JSXA 1QHHA 3AGQA 4KZKA 2JK0A 4XIGS 4DMRA 1CK4A 4DIBA 1DWUA 5EWMB 3GZNA 4WN9A 4B76A 2ZBEA 3IT3A 4LW8A 4XX0B 5E38A 4KYUA 2DG2A 2OSBA 3AG5A 2JCVA 4BATA 4EI2A 1XQWA 5AK6A 4EPWA 4PZAA 3NWOA 3PIIA 1DOHA 3SQXA 3FHTA 1J25A 1VIVA 1XTRA 2AI3A 1NW4A 3LHKA 2QTWB 2UU9B 4LG2A 2CFCA 3PU6A 1C81A 2XH8A 5B1YA 1KBOA 2ONZA 2OBXA 2X5JO 1KNXA 4HGYA 3WE7A 5CFPA 2VDMB 4OLHA 1N77A 3PC3A 4BVBA 4LDAA 4YQFA 4TROA 4IBEA 1FDVA 3WYAA 1FOEB 1KR5A 5JW6A 3Q8MA 5EIOA 1TK3A 4IGKA 3E53A 1E1KA 2V45A 5AVYA 3CUSA 4F3RA 4HMQA 2GFQA 4YIKA 1SCAA 2C4VA 3VSAA 3PCRB 1R9NA 2DKOA 5BR4A 3CEAA 1BN7A 3L8GA 3P0FA 1IATA 3QE0A 3UQZA 4WK6A 4R3NA 4Q03A 2P4SA 4KGDA 4J9UE 3P52A 4YWJA 3Q40A 3KSZO 2NZ2A 4KHPM 5JY6A 4RHTA 3V00A 3STHA 4MV6A 1Z0ZA 2O25A 3UMVA 3KXKA 1BXRB 3UMFA 2P4EA 1KI3A 1H69A 4RPJA 5IXYA 1JQ3A 1QUTA 3AT1A 4HZIA 2O6LA 2YASA 2O2GA 1D0SA 4B35A 1MKYA 1U6JA 2IZ6A 3TO5A 2WJPA 1E94E 1K97A 1Z2NX 1J1IA 4BE9A 3AI3A 3OT5A 1N6LA 4MMYB 1NQAO 3M3PA 4RIFA 4N0QA 5KPJA 3CTMA 3TMAA 2PLWA 5KO3A 4CIZA 1YFLA 3VC3A 2DVWB 2YUIA 3QLUA 4C0BA 6LDHA 5IBCA 3B74A 3E2IA 2GUWA 2C4HA 3S2UA 3LX4A 4MVJH 4A6DA 4QDOA 5FA8A 4PLCA 3LD9A 1J49A 5IYZA 2AIRA 2AK3A 4O0MA 4TS3A 5ALYA 4R2IA 3OM0A 4JLOA 1G4UR 4X91A 1XJWA 1K0FA 3D8LA 4F0JA 2XA9A 3RRJA 2XGOA 1S4MA 1YO6A 3GCWA 1PLJA 3B1JA 1A8IA 1X7HA 4Q9HA 3AUAA 3P0IA 1P7WA 1U99A 3GLFB 1RADA 2XOEA 5LYYA 3ZC7B 2HLDA 4FI3C 4MLDA 1GG5A 1OXSC 3A10A 4KG7A 4RCYA 1Y48E 1TKBA 2VO1A 4DVGA 3IEKA 5AM0A 1XDBA 4MB7A 4CQMD 2A59A 5IPFA 2Z6VA 3ZZUA 1PWZA 2A9KA 1HDXA 2JJYA 4DCPA 4OO3A 5DHPA 4I1OA 5LBIA 5IVKA 4CFZA 3JQCA 5AJTA 1Z17A 3TKAA 4NPCA 4G4OA 2L17A 2X6QA 4M1QA 3O21A 4JYZA 2XB9A 4HDSB 3JQ8B 1U8FO 1ODJA 2A9VA 2H51A 2OMKA 2DWQA 1WPRA 3PRJA 4JUFA 4X7BA 4KR9A 5F1OA 2QE7D 3L0IB 2M9MA 1SJ9A 5JALA 3IUNA 1R3UA 4IMJB 1EHCA 1UQRA 3ZLVA 1XWIA 1RWBA 1Z5OA 1KMHA 2G71A 2PTHA 5IWAB 4D9EA 3NLLA 3P9SA 2G4VA 4F8JA 1DLIA 3ZTWA 3RC9A 3K8QA 4C0LA 2C59A 5E3JA 1PJBA 1RC0A 2C9DA 4AF6A 1E5QA 2BTQB 5F51A 3T4EA 4HEHA 4N7BA 5BN4A 4EW1A 4AZ0A 2J3MA 1TMOA 3J7BA 2OXEA 3PRYA 3ZD8A 4HDQB 4LTDA 2GDJA 1WUHS 1XHFA 2XKAA 2Q7DA 3MCUA 3WRYC 3OJFA 3VR4D 4NOKA 4Z51A 4B87A 4JLKA 3BORA 4BHTA 1QRUA 2OBYA 4HEOA 3GIWA 4MICA 2QVGA 4KGZA 2JI6A 1AQNA 4IUYA 3ZBUA 5H4GA 5MDHA 1J8FA 3GRCA 3GGJA 1V25A 5IWCA 5JSQA 4D5EA 4JJAA 1DAEA 4MV5A 2BRUA 3EMDA 1Q44A 3FVTA 3RDPA 5CCBA 5AVZA 1NBMA 4G5HA 4IIJF 4GLLA 4W8OA 5P8WA 1T8PA 4PXYA 1TJ4A 5CM9C 5E0OA 2AE2A 4QG3A 1BU5A 1X80A 4R41A 3PDJA 4QJIA 4B82A 4PPYA 4BX3A 3QE3A 1N6IA 2ZJBA 1L4KA 4W8HA 2GNPA 3ZCSA 5FBWB 1ODLA 1Z45A 4EY5A 1KJJA 4JLSA 2AOUA 2OOKA 4IHQA 2YN0A 4AZVA 1QQ7A 2RGWA 2QAGA 3KQMA 2O5EA 3WLQA 1PRBA 2V54A 4RQAA 5EOVA 1EM8B 5CG1A 4K3VA 4ENVA 1ZS9A 1QK5A 2DNAA 1F38A 1IPFA 4R9UC 4KPEC 3ROQA 1R4AA 1RFGE 4ZWNA 2R8OA 4EYSA 1R6UA 3A1TA 3W7VA 4DC1A 3AFMA 1ZD3A 3PTZA 2NPIA 4OJQA 2ENUA 3FAZA 5IT9S 4JVLA 3LVBA 2OFOA 3PCTA 4JWKA 4WXEA 4JI6B 4TMZA 1HG0A 1PG0A 1TM3E 2TSYB 4DYHA 3I51A 4HAVA 4M4SA 2HBRA 1FYEA 3VHLB 5C1IA 5F2NA 1ZUIA 3I04M 2AI1A 2WTBA 2PS0A 4GLOA 1E99A 2Q6LA 4MQEA 1JMVA 4TWJA 4ZT2A 2QHOB 2O48X 1UP4A 3VXKA 4K3UA 3HHWA 5FUYA 3HX3A 1JHUA 3P2JA 1IHPA 1I13A 5BPFA 4QSMA 2PH5A 4CQLB 4IBIA 2ZBDA 4BFXA 1A7KA 1VE5A 3HRIA 4B4KA 4MYUA 3LQKA 2VF8A 1E63A 3CRW1 2VWGA 5AVQA 3W8DA 3L6CA 1G8GA 4EJSB 5LYJB 3I9NA 3VYSB 1DQPA 4DCVA 1R4NB 4NV0A 3SDBA 1CQIB 3PWSA 2Y1FA 3BKXA 3ZY4A 4ZYWA 1DJOA 3OSZA 1GTZA 2A1TR 1PJ8A 3HLKA 1OJ7A 4WZBB 2QI9C 3L6UA 2KSQA 4AP6A 4DCTA 2A88A 3E46A 4R5MA 1HDGO 1Z4PX 3COZA 1G9TA 4MA5A 4DYVA 4LYAA 3ET4A 1KQ3A 2AFVA 5TIIA 1P7CA 1SH7A 2V6MA 4TPKA 2IYLD 2BISA 5C31A 3C8DA 1KI4A 1DPFA 4LV5B 3V1TC 4QBGB 1H66A 1ULHA 4ZT3A 2VHXA 1A5BB 3BXFA 2FHPA 3DC7A 2J6BA 5TDHA 4CM8B 3PITA 1E77A 2RGEA 2V7XA 3U4HA 2C5EA 3A31A 2FW7A 2PGXA 2WJYA 5EE0A 3HY3A 3PC7A 3ESCA 1PR5A 2HRCA 2Z3VA 2PPLA 2FEKA 1KFJB 3ZU4A 3BRQA 2CEKA 2CMKA 2V7UA 3PNMA 5D1HA 5A2QA 3H9CA 1WSDA 4AXXA 3ORFA 1CU1A 3QLVC 3BCSA 5SY9A 3U6MA 4NAUA 2VWHA 1V7CA 4M7RA 2OHHA 2BL4A 2I4TA 4DLBA 1WXQA 2HA4A 1IVNA 1YJ5A 1QH1B 2WHYA 3H5AA 2WSSA 3KB8A 4EL0A 3SLKA 4JXKA 4ZDJA 1IE3A 1M2WA 2JFQA 4UTXA 1CJVC 3Q3JB 2CHQA 5MGBA 4MUJA 4E4YA 3ZDEA 4Q3LA 4KQIA 3DXFA 2JY7A 4EHDA 1MB4A 3ZW8A 1H3NA 1B41A 5KQRA 2IXBA 4LYDA 3E58A 4QAQA 3OICA 4M60A 1NW5A 3QX8A 1F20A 4P84A 4NKRA 1SOWA 2XMRA 1Z83A 4KO8A 2IZZA 4L72A 3ZWYA 2C8VA 4GXQA 1IZ9A 3G49A 4GS5A 4E7PA 3NC1C 5CB0A 4CPDA 2A7QA 4OBWA 3PIDA 2FRDA 1DQRA 1NUQA 3AVTA 1XAIA 2PNFA 2P77A 2XXAB 4URUR 1G8YA 4ANFA 1CZNA 5AVWA 1GTL1 3KKEA 4ZZ3A 2CJPA 3MTBA 4B3JA 4RTKA 1DC5A 3K0AB 4E30A 4MAFA 1M2VB 3ZNQA 3C70A 2EZ9A 2V4MA 3RO7A 1YZ3A 1POXA 2HJRA 1DARA 4UU0A 1ZLXA 2ODAA 2V7EA 3N8IA 2H1IA 4M0CA 3L40A 1PFVA 4CQNA 3SBJA 5AKHA 1VLZA 4KAAA 2IUSA 2GTHA 4BFTA 1XO1A 3WNDA 3W2FA 3WGIA 5JTTA 3DULA 2YHSA 1QQBA 4CMIA 3JS5A 2H29A 3DMTC 5JNSA 3DAYA 1NUUA 4PRKA 1MJ5A 2O52A 5JYCA 1WL8A 5B58T 2GEKA 4BN5A 2P30A 5JJBA 4Z0TA 3LQQA 2ZI6A 3EGXB 1YONA 2GBLC 5D00A 5FOQA 3JY6A 4ZVSA 4LCJA 3TX2A 5LZ5A 3DT9A 3A1DA 1NLYA 1USKA 4GXNA 2B4QA 4G1BA 4X44A 4P4UA 3WAGA 3SC3A 3LZCA 4KWCA 2VTEA 1Z13A 1RKVA 3CF4G 4WD3A 3ZCRA 2WAAA 1PJAA 4QM6A 2BJWA 4S2UA 1UANA 4X7RA 2X1HA 4BRSA 2QUZA 3KYDB 3EVZA 1W76A 1RWOA 1IN1A 3H13A 3FTQA 2E4VA 3L02A 5KTYA 1XZNA 4YJGA 4Q7LA 3BK7A 1E64A 2ODPA 3B78A 4LKOA 3O03A 1M1XB 4F8YA 5CLGA 4KCGA 4ZEMA 4RESA 1NF9A 5IDYA 3C6YA 3GMSA 3B2QA 4CR7A 3BPSA 4RTNA 2NXEA 1FS5A 4YJFA 3V6LA 2Z5VA 3MG9A 3R0VA 5FH9A 5JNWA 2GD0A 3LRTA 3WGNA 2N42A 3TN7A 4AJKA 4G5OA 1OGIA 1E2BA 2OQ2A 1T13A 1F7VA 1C9MA 1H1LB 1VLQA 3KU4A 4LFAM 1OZHA 2UYQA 5HPYB 4QPCA 4L5BA 4D8WA 1YA4A 1X9IA 4PZDA 4H1VA 4X94A 1WB9A 1C9KA 1WEKA 3HBAA 3MSCA 3L84A 4EA9A 4ZO7A 3ZGYA 3X2FA 3UM9A 3HFSA 4JT2A 4AMVA 4BECA 4OXQA 1T8YA 1CUEA 4TXMA 9GPBA 3U1BA 1NBOA 2EIHA 4P7JA 4AQ7A 3TW8A 4PHGA 4V3BA 2Q45A 4TRRA 2OKCA 4W5OA 4GH9A 3GLRA 4RL4A 4RV4A 1YU6A 1I0LA 3WLJA 1G5FA 2ENWA 1VI2A 2A9JA 1Q7GA 1O94C 2VF7A 4MKXA 1PFQA 2QUIA 2D6FA 5M34A 1X19A 3W9YA 2NUTA 3VMFA 3HXMA 2EYUA 3HSYA 5LYJF 4Y9UA 4U8HA 2IODA 3SHQA 1E1RD 1DGHB 2VJYA 3BN3A 2W6MA 5A3RA 1PN3A 4L9WA 2IUUA 4KK3A 2Q7XA 4JC0A 3FVWA 3SCZA 2VEDA 4RY0A 3WLOA 1BVSA 1XOIA 1P3QQ 3UFXB 1AHIA 1PV2A 4ZJZA 1DKOA 2CC2A 1TCVA 4JP3A 2EW8A 1PG5A 3AV3A 1JG6A 4IIUA 2IPXA 2VPIA 5E6RA 2YZKA 1IY2A 4L8FA 2FY8A 4GZ3A 4J7UA 1XDSA 5BMVB 4US1R 2VAXA 1WR1B 1O97D 3OFNA 4H15A 4ZJYA 3BMOA 3RK1A 5U9CA 2O1WA 3CF6E 2GAAA 1T43A 4G5XA 5AVSA 1GN9A 4D8YA 4TTAA 1RPTA 1MJHA 1KMQA 3U1VA 1J2YA 4IF4A 2HIMA 2NZUG 1ZVQA 4YWHA 1MO3A 1PCXA 1Y1PA 3ODGA 3F3MA 3S44A 4EEKA 3D5EA 2G88A 4YV7A 4IWXA 5BR1A 4RF4A 2W6QA 4U0JA 1CR6A 1A9QA 1JYSA 4I36A 3QVWA 5KVVA 1E79D 3JVIA 1UPUA 2GHQA 3HYCA 4PHHA 2GJAA 2HK7A 1R37A 1GA1A 4RIEA 4JHLA 1GKUB 4MR8A 2JP7A 4QYTA 1TA4A 4EHJA 2MHCA 4L6IA 3AHFA 1M0TA 1MDBA 3FPCA 5CNMA 3EOBI 1U7XA 3FMOB 4G63A 3PLAE 3R3YA 3HO1A 1T2EA 3K0HA 2VYCA 4B5LA 2Z2IA 2QROA 4YJHB 3B2EA 4BNGA 3ZU2A 4G0QA 4I9NA 1ZN2A 4I55A 2VPTA 2CFSA 1IBLM 3BRCA 3R6TA 1CHNA 3G2IA 1I6WA 1YL6A 5K20A 1RWXA 1UBNA 4I1VA 3VNRA 1PEAA 1HR0B 3PFBA 4TSRA 5KJCA 1DEXA 4P53A 1RKUA 2IPAB 2IV3A 2C84A 4X5OA 5I5EA 4WFKA 5HJ7A 3ZJ4A 3HNPA 4BNUA 5J4KA 2ZDHA 4DJJA 4EMSA 2AI2A 5AW6A 3G0IA 3KB1A 2VKQA 4R5HA 1U63A 1YACA 1I24A 4A2PA 1TA9A 3NI2A 4WINA 2X1MA 1PDWA 1Y82A 2PUAA 1N33B 3TR5A 2HX1A 3AEYA 4CKXA 4JI8M 2X2PA 3NOQA 2RH4A 1RJDA 2Q5QA 4YI3A 5K4GA 3DDUA 4D0RA 4UMFA 4ZVVA 4HMOA 1RJ9B 1H9BA 3BF8A 2XHEA 3QYEA 1RWVA 2UUCB 3TL3A 4IIVA 3C8MA 2XUDA 3VJRA 3KPYA 3K6JA 3GFSA 2CSUA 1SBCA 3W68A 3C6QA 5CDTA 3RKSA 3MYYA 4PONA 5A62A 1Z4JA 3MXOA 4I2NA 3OPMA 2NZYA 3PQ3A 1YRWA 2HT6A 1IQ0A 1BG6A 3PNVA 4F5EA 2G0NA 1VA5A 5K8VA 3RU9A 3AP3A 2QG4A 4E32A 1M7HA 3CUTA 4LNUB 2IGTA 4UE6A 3TE7A 4AS1A 2EFCB 4LDPA 1QTQA 3G82C 5DK4A 5IK2D 2WPDD 1PT9A 5T57A 2FH5B 4CF7A 1QU3A 3K4QA 3MGBA 5DOZA 5KCZA 4KQ2A 3HDJA 1IG0A 5L8VA 1WUYA 4ZT6A 4TTQA 3KZCA 4IDNA 2DSNA 5KSPA 4EH1A 4AUEA 5BURA 1RI5A 4NK4A 2Z6QA 2XB8A 1LPSA 1X1QA 2GPAA 1IM5A 1Y8QB 1KE2A 3F7NA 1J2JA 1EWYA 3NPMA 2IOQA 3UVEA 1EJ0A 3GYBA 2Z9CA 3LUBA 3DVAA 3L0YA 3HWSA 1QKJA 1FXUA 3EIFA 2H1WA 1D9XA 1U3FA 5TNXA 4NBRA 3IG8A 3GARA 3TL4X 1ZJ6A 3A3YA 3SNHA 3V4PB 2G28A 2PDAA 1I1HA 4R2LA 2DPHA 1BWPA 3KLPX 3ORSA 4F1KA 2FPWA 3PE6A 3RTGA 1HX7A 4HSGA 1XEXB 4C3ZA 4KXQA 4Z0PA 4KLRA 1RVV1 1FQOA 4OP1A 3CVJA 4HF7A 3ME5A 5DBEX 2FN9A 1H8HA 1PSZA 3AEQA 4KIWA 3V4FA 4AWXA 3IIMA 5JVDF 2GZRA 2Z57A 3VNBA 2JY5A 3EVNA 5AVRA 5T64A 4K26A 1MAWA 2Z56A 4WKBA 4NS4A 4P36A 4PYJA 3ZE6A 4Z6YA 1LLUA 2QN8A 2NX2A 4LRWA 1QP8A 5C3MA 3OM9A 3I62A 4MIOA 1XKXA 3NFRA 1RYEA 1XZFA 3RQIA 5AQ1A 2IZ0A 3TH5A 1NO1A 3O2JA 3GLHE 3LY9A 3I9V6 4CHTB 3SBXA 1ZA2A 5HJ2A 1XE3A 2EGUA 4ZZIA 3S2YA 1K7SN 2QJRA 1EUQA 2XNKA 5C8DA 3RJZA 1XZKA 1AV7A 3D7NA 1Y9AA 2AC4A 2HMWA 1XYGA 4RY8A 4V02A 4PCVA 1W59A 3PZBA 3D3JA 3W8RA 2BTOA 3ROTA 5PNTA 4QBKA 5HDQA 1KJNA 4MUGA 3KFLA 2V8OA 3O2NA 1FPMA 1CZOA 2ZIXB 2ZREA 1IN8A 2RMKA 1GUFA 2OFWA 1CZKA 4TMXA 1UJNA 4J7CA 4UD2A 5F2KA 3RIEA 1NU6A 2EF0A 4OQNA 5CDSA 5I3CA 2A86A 4QUAA 1WMBA 4EK9A 1LC0A 2WJGA 4YYEA 3R3XA 4BO4A 1SEVA 1S96A 4UBKA 3B6MA 2QUKA 2R6GA 1S8AA 4ZQEA 3S55A 1DOAA 2PWAA 5C4MA 2R79A 3CQ9A 5DNCA 5CLLA 2HWJA 3RSFA 2WA1A 4BZPA 4UBMA 2QRVB 1XD8A 1ESCA 2BEWB 3V1LA 3AZPA 1H2AS 3THWA 5ICMA 1EVYA 1ZSYA 4EY3A 1G20B 4E5VA 2L82A 1K5DA 5DMHA 4C6SA 2GSWA 4UUQA 5CA1F 1BOFA 2GM3A 5K0ZA 5FTLA 4M9SA 3GUHA 4C5BA 4RX1A 4MRAA 2VSOA 2C77A 2P9HA 4EO7A 3AUSA 1NYTA 3WQQA 1A76A 3S8EA 4BS9A 4DJAA 3PFWO 4MW2A 1W73A 3GVPA 3HEBA 1Z62A 1JXOA 3PDIB 2UYCA 2YOFA 4IXMA 2IIQA 3MVEA 3OZBA 2G5TA 4ZREA 3LPAA 1WBJB 3D8TA 2P35A 1NJ5A 4GH5A 4J29A 5FXMA 3F49S 3INYA 2QT9A 1K6XA 4PHFA 1P5HA 5FEMA 3AVYA 1KYQA 4BB6A 1P4RA 1A5AB 2DE0X 5ITWA 1RKBA 1Z7BA 3P97A 2EKZA 4X6YA 1OU0A 5K3AA 2GT1A 1OBVA 5J2TB 1CS4C 1CZRA 3H6KA 3OZIA 2K4MA 4J43A 1LBEA 3UJBA 5ED4A 4KXUA 3SN6A 4O2RA 2EKPA 1QGZA 4PLTA 3PBKA 1UOQA 3G13A 3QUAA 1KBZA 3QFTA 1UFZA 4A9AA 3G8YA 3HBLA 4M0FA 5LQUA 5BN3B 2IC5A 2R25B 4LJAA 3WLRA 4CCWA 5CX4A 2G9VA 4ZKDA 4H3HB 4PWZA 3RWMB 5BUQA 5UKDA 2NNLD 4GNRA 4EFDA 3SMPA 4KPYA 2OQRA 5LMUM 4LQCA 3UTDA 4ALJA 4LF4M 5FLKA 3AUFA 1UOPA 3IL2A 2CDCA 1ZIYA 4UBLA 3OQBA 4YP5A 5KVQA 4URYR 3GJXC 1QE0A 1NNJA 1RWKA 4MR9B 4ZV9A 3A06A 2LVNC 1O95A 4XSVA 5IH3A 5EJ8A 3N59A 4PQEA 1PJJA 2C7BA 1XRJA 2QQ8A 5C18A 1A5SB 3WK5A 1GGMA 1N36M 1I4EB 3DD1A 4JDUA 2EJTA 3RC1A 4G6ZA 1B8VA 4UATA 1ZAKA 3ZQJA 4NSRA 2IKSA 2OA0A 4Y67A 2OUKA 3D64A 1IUPA 2CV2A 1D4OA 4WP2A 1D1SA 2YWBA 1RAGA 5DCLA 2Q7OE 2R87A 3D7LA 1WSWA 2B21A 2UAGA 5GV8A 4E4RA 1U9ZA 3AEKB 4ZQCB 3VVLA 3K9GA 2H0AA 2B82A 3MGKA 3KSAC 3U44B 4DDWA 3UWDA 2BHSA 3RE8A 4NV1A 4Y6GB 4L5IA 4RWEA 1DCTA 3B9PA 2J67A 4JXZA 3MPOA 2XCUA 4WXRA 1UEXC 1YAHA 3ZIDA 4TMYA 3FTNA 3UAGA 2ZB4A 3CJQA 5HF9A 2JHGA 4IFBA 4TN5A 2G36A 4E88A 3ZX4A 1EKXA 2E5LB 4NBLA 4R05A 4AJOA 4JT9A 2PL1A 4M0EA 4YB8A 4OH1A 5DIFA 4D4JA