4AG6A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
384
structure length
373
Chain Sequence
SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRPQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
molecule tags Hydrolase
total genus 132
structure length 373
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag6A01
1XTSA 2A7QA 1KO4A 4C0BA 4WIAA 1WB9A 3FDIA 3KUDA 4Q4HA 5E7MA 3FYHA 3VR3A 3EPJA 2J45A 1QF9A 4LV8B 1XD8A 3D7MA 4RZ3A 4C3ZA 1IY0A 3I8SA 1E2FA 3RRMA 3RAPR 4B6FA 1W36C 4NKRA 2RGBA 4BPBA 5CM9C 2C98A 4JMPA 4M21A 2EWWA 4N0DA 1E99A 3IGFA 4LUCA 1A82A 1ZM7A 3RSLA 2Q21A 3IQWA 3P32A 4BFSA 3EW9A 1SVWA 1W2GA 5FPSA 4TT3D 1HT2E 1P2TA 1XWIA 3QKRA 4V03A 1XP8A 4HDOB 4ZPXA 4FN5A 1VCIA 1HQYE 4P0TA 2ZJBA 2QZ4A 1SKYE 3MWKA 1AS3A 4IRUB 3SJZA 1YU9A 4JBWA 3RYTC 5DN6D 3W6OA 4TYNA 2ZRBA 2FG5A 3PJRA 3SC3A 3T12A 2VA8A 3RDPA 4GFDA 2D4HA 3UWOA 2H5EA 2VHUA 1X8KA 3UG6A 4WXRA 1XEXA 2WM9B 2OBNA 2FZ4A 3IPXA 5HCIA 3GLGB 2GEVA 2C04A 3ICQB 3GLIE 4DLSA 4XD7D 2NGRA 2ZREA 3VHXA 4BFTA 1J7KA 5G53C 1O87A 3LBNA 1YE8A 4ZV4A 2C96A 2KJQA 1XMSA 3VR5A 2QE7A 3CONA 4L4UA 4UXIA 1US8B 2YC2C 3AVQA 4NCJA 1D8TA 4NE2A 1DPFA 4NCHA 1ZUNB 4FMCF 4HZIA 3PEYA 2AK2A 1G8GA 1T5IA 3KKQA 4LJ5A 3MSXA 1NMYA 1KJWA 2WMNB 3H0KA 1T91A 1OH7A 4R7ZA 2N46A 3LBIA 4IDPA 3LQQA 3MRSA 4TTRA 1E0KA 2ZJOA 1XXHB 3L0OA 4HUQA 1M7BA 4LJAA 4QGGA 2E9SA 1IXSB 2Q9CA 4QGAA 4EPXA 2YWGA 1XTIA 3UMSA 3VKHA 4HUTA 1RRFA 1XTJA 3GEHA 5DYGA 5FOTA 1P2VA 5ANRB 3MG9A 1ZU4A 3W90A 2WIAA 3LLUA 1JALA 4M53A 5E3HA 1OFUX 3JZMA 2VYFA 3OEHD 4M8NE 3FOZA 4BECA 3LVRE 3CF0A 3CW2A 1Z2CA 2ANCA 4YXWD 1VHLA 5BN5A 1VKJA 1I4TD 1W7AA 4XD7A 2EFDB 5UKDA 3V4FA 1JNYA 3NKVA 2ODBA 3HR8A 1A5TA 3SJBA 4AYTA 1R7RA 3KXLA 4RZ2A 2AHOA 4DCSA 4Q66C 4OQFA 4JVNA 1Z22A 4OQXA 2FZLA 4BRUA 1E0SA 1VYTA 3GCGA 2CLSA 3ZYCA 4NHOA 4NL4H 2JEOA 4A82A 2CK3D 1T0JB 2OO7A 2QAJA 3IBGA 4ARZA 2H18A 4PC7A 4BLSA 2E1RA 4IJMA 1HUQA 1ZM2A 2ZRFA 1CR2A 1YZTA 4B75A 2QRNA 3H1TA 2ZR0A 4DWJA 3TSOA 2GXQA 3GLIA 1N6NA 4TQ9A 4D80A 3TGPA 1Z63A 1OXVA 4OI0A 5JWHA 4MKHA 2W83A 4KU4A 2IUUA 2IYZA 5DSZA 2XSZD 3QKRB 4DIEA 3K0SA 1GKYA 2QA5A 3IPYA 4YONB 4TMKA 1VYUA 4PXAA 5TMPA 1KSFX 3AB3A 2R6GA 3ZS9A 3NC0C 2BVNA 3ND8A 4LBVA 1N5JA 4YXWA 3BXZA 1SXJC 5JSZB 3QXXA 2GDJA 4JSTA 4DCVA 4IXNA 2HYDA 3K70B 2MMGA 1S8FA 2RHMA 1QHGA 2PX0A 5JJLA 3B1XA 4PSKA 4XWKA 1XEXB 1Z5ZA 2J0QA 4MKGA 1KI7A 2X77A 2CL6X 5FR1A 2J7KA 1GP2A 1Z08A 4DEYA 4Q5IA 3EZ6A 5F9HA 1E9SA 4FMCB 2LKDA 4B34A 2ZI3A 3SDZA 4HSEA 2IUTA 4B33A 1YZUA 1YJ5A 4EQ6B 3WP1B 3IDQA 2ZQ5A 4GRAA 5K8TA 1QHYA 2ORIA 3KFXA 2QM7A 4KLNA 4LC0A 4L9WA 3SZRA 4WZBE 2FMXA 3CPJB 2QSZA 2MSEB 5J4VA 3QXJA 5L8VA 4QJ3A 3RRYA 2JLYA 2VBCA 1E32A 3WRXC 4LZZA 1F5NA 2P3SA 4F92B 3BBPA 1GRNA 1U9IC 3DMNA 4NBSA 1NMZA 2YV5A 2QORA 3GMTA 4KLZA 4L16A 1TQ6A 4HUQB 1FZQA 4II7A 4JIMA 4PQRA 5JWRA 2W6JD 2QBYB 1EFCA 3L0PA 4MDFA 1QG4A 2O8CA 2BJVA 2ZI5A 4IDHA 2P6RA 4JLVA 3MWYW 2BKEA 3GJ5A 4HEJA 4NYIQ 4ZCMA 1ZRHA 5DH9A 2RGDA 2VL7A 5CK4A 2HV8A 2XB2A 2GETA 1OW3B 2REXB 2FU5C 2NPFA 4OI1A 1X1RA 2CJWA 4RKEA 1I4DD 2P6NA 3U3MA 2J41A 4JSYA 4XVRA 1E79D 2Q9BA 1KI8A 1L4YA 1W2HA 2EFGA 3RS3A 1XD2A 2O8BA 5FL3A 3SS8A 2VF8A 2Z83A 2IA5A 1OSNA 4C30A 3ZVMA 5K8UA 2PT5A 1E1QA 2EFCB 3UATA 1HY3A 3H86A 4NYJQ 4BFWA 1JQLB 1ZINA 4MA4A 1YR7A 4BASA 2IXEA 4A36A 4KV9A 8OHMA 4EJSB 2PH1A 3TSZA 4ARZB 3B7GA 1V43A 1NVUQ 3K0AB 4I1OA 1DAEA 1NSTA 4ACAA 2ZE8A 1EESA 1GL6A 3PENA 2W6JA 4A8JC 4ZCLA 3AP2A 2J0VA 5BXQC 4NMMA 4JLDA 2FA9A 4DLYA 1EX7A 4QBIA 1FTSA 2EFEB 5DNYB 2ATXA 2FGJA 2VTKA 1RYHA 2WHXA 2RMKA 2ZS8A 2YHSA 3LNCA 3KXKA 4ILEA 1HE8B 3CM0A 3CR7A 2OLKA 2OV2A 2EYQA 3LBHA 4PPNA 1NRJB 4M1KA 3FFBA 4HLUA 4UJ5A 1G41A 1JPNA 2W00A 5G41A 3SI7A 1W0JD 3O47A 1XPUA 4C7OB 2ZU0C 1S9HA 3RWMB 5HPYB 4A6PA 4G5RA 2O8DA 3O8CA 2GKSA 4Q4AA 4P4UA 1GOTA 1Z06A 1Q21A 1KMHB 3AF4A 5KSZA 2WVJA 4AWXA 1FQKA 2ZI4A 4LCBA 1UKVY 1XCGB 4MGZR 3DO6A 2BDTA 4WXPA 4BE7B 1XFAA 2ONKA 3W5JA 1T3HA 3P4YA 1JQJC 1R8QA 3IO5A 2ZVPX 2WPDD 3ZQ6A 2QT1A 3TMKA 1F2TA 2GJ9A 5JMTA 1VMAA 2IYTA 1KMQA 1W0KD 4DBLC 2NO1A 2ZYWX 3SYLA 4CEHB 3B9PA 5HE9A 4PSAA 4Q19A 5JI3E 1II9A 2IEYA 5D3MA 5EE0A 3SEAA 5JEEA 2EVWX 4NDZA 5FBLB 1MABA 1UFQA 1Z0JA 3I8XA 4K81B 4D0NA 3PUVA 1KNQA 1Z6GA 2PBRA 3OFNA 2G77B 1XBTA 2EWVA 2RHDA 1ZD1A 2GVDC 4BLTA 2CEAA 5DI3A 4V02A 2PLFA 3HU3A 2GF9A 5K8IA 2DPXA 4LBYA 2HT1A 2IHYA 1IN5A 5TVKA 1ZC3A 5GADl 4DCTA 2F3RA 3T35A 1IY2A 3GJXC 4MGIR 4H1VA 2O8BB 3QG5A 1CRQA 1JBKA 2ZANA 1XF9A 3CRW1 4CRWB 2RGAA 1TPZA 2FN4A 4KFSA 3SNHA 4D82A 2QGZA 3TBKA 1KK0A 1Q44A 1K6MA 4YMUA 1Z6TA 1RZ3A 5K8LA 2WWIA 3KX2A 1T0HB 3Q85A 1SQ5A 2AL7A 4JKYA 3QI2A 5DGXA 5CITA 4PHTA 2PEYA 5FTNA 1W0KA 3LV8A 4U00A 1LNZA 5KOYA 1DAGA 2I3BA 5CK5A 5EP1A 2WAYA 5SZKB 2G1KA 2XTMA 1KKMA 4LHZA 4NZYA 4ITRC 1CR1A 2A5DA 2AN9A 5CIWA 5GJWC 3ADBA 2Q6TA 2VSFA 3WY9A 2GK7A 4R2HA 3OESA 2QBYA 1E2QA 3AVTA 3FHTA 2KSQA 3K9NA 1AZTA 4IFBA 2YOHA 2ZI9A 4X8OA 4CT4B 1LY1A 2WWXA 3F0TA 1LW7A 1MO5A 2GZAA 4XTCS 1XPRA 4HB4A 3OAAA 2ZJYA 1UDWA 1G5PA 1IAQA 3IIKA 4CYMA 3VR6A 2B7CA 1E3MA 2HCBA 1VG9B 4MKIA 2ZE5A 4XVQA 2R6DA 1E2DA 1ONBA 3LDAA 5AJYA 3SHWA 4A6XA 3WYGA 4FD2A 3B9QA 3RRZA 2CBZA 4MKFA 2PJRA 1UBGA 4TL9A 1IN6A 2CL0X 4Q4AB 821PA 4A2QA 5JBQA 1KI9A 4DT1A 4Q7KA 5C2JB 3K70C 1W36B 4ESHA 5JLJA 4HB0A 1XCMA 4Q02A 3CUEF 5EE5B 3GLFE 4XVUA 3LH5A 4B73A 1E96A 2PCJA 4Z1MD 4F4CA 4JL6A 5AUOB 5JWOA 4UNSA 1OH5A 3U4QA 3U61B 1F2UB 3SQXA 1T3SA 3DMDA 3EASA 4I99A 2VP0A 4URUR 2PX3A 1ZIOA 4W5WA 5JJIA 2J0UA 4OQMA 4OK3A 1FX0B 3AUXA 1ZC4A 4GBMA 4LJ6A 2K5UA 1F48A 5KDLA 1E2HA 3CZQA 2F7SA 4MH0R 3R20A 5J4LA 4Q47A 4FWTA 1G8PA 1TEXA 3QY0A 4QHSA 4Q03A 5HCNA 1X1SA 3TJZA 1HH4A 1X6VA 2FOLA 3KTAB 5DI3B 3R9IA 2GAAA 2ZRPA 1RPZA 2WWHA 2G1JA 3X2SA 1UAAA 3KKOA 1UF9A 2D2EA 2D2FA 1DS6A 4LBZA 3T1VA 4DKXA 4ABYA 2AD1A 3LVQE 1NY6A 4GMDA 4EPYA 1IN4A 3OEED 1X8LA 1AS2A 1NJGA 5EP2A 4Z1MA 2GBLA 2Z4SA 5KNDA 3VNVA 2IUSA 3EIQA 2BHRA 4G5QA 4GPTA 1P7CA 3CX6A 2JA1A 3CRRA 4F4IA 2NPIA 4A92A 4Y0AA 1OIVA 1N6HA 4D2IA 2V6JA 3CNLA 3K0FA 3CKLA 2ERYA 2QTVB 2FNAA 4UNQA 1VCNA 3X1WA 4EFMA 3VNUA 4AIIA 3T1OA 4LV6A 1E2IA 3FMFA 3EWSA 2OESA 3NDPA 1S0UA 5E4FA 3GLFA 1E9RA 2YJTD 4UNPA 3AKCA 1IOZA 4JLBA 2P65A 5CYOA 4NYMR 1S1MA 4C0QC 3OZXA 1KZ7B 5FOVA 3ECCA 4H9GA 1IHUA 1P3JA 1NVVR 2WJJA 3UPUA 5A0FA 2ZRIA 3NEJA 1MH1A 4PPFA 3WNCA 4AK9A 1JR6A 2GK6A 1DADA 1GDDA 3VX3A 5A4JA 1S9DA 3OEEA 3QPWA 2HLDD 1N6LA 3PUXA 1TUIA 2GTPA 3SOPA 1VG0B 3ZD6A 2QU8A 1HTWA 3W3ZB 1GAJA 1M1YE 4POAA 2I4IA 3KZ1E 3A1WA 1E94E 2FJUA 2CHVA 2GVZC 3EAQA 3EC2A 3PEWA 1COWD 4WAUA 3E1SA 2L0XA 2OXRA 4M9SA 4BFUA 1W4RA 4RFVA 5CB6A 2YC4C 5FOXA 2F1RA 2QL6A 3B82A 4OL0A 1CJTC 1G19A 3VU9A 1EFTA 4KI0A 2G0TA 2ZETA 3LLMA 4RD6A 1C9KA 1PVOA 2KBEA 4C2TA 5FI0B 4Q48A 2A5JA 1YZLA 2CVFA 1G8HA 4DIDA 3UMFA 2O8EB 4F4JA 2J0UB 1LF0A 1Z0IA 4RSGA 1OYWA 1TL7C 1YVDA 4WZ6A 4AI6A 2ZR9A 3NBFA 4DZZA 3AF3A 3WBJA 4TYYA 1EWRA 2GZHA 2QPAA 4W7SA 2HCJB 3U7HB 5IK2D 1OHHA 1KJYA 2OCBA 4HZUB 2EYUA 5H68A 2GAOA 3MCAA 1QHXA 1A4RA 2A2ZA 4MRRA 4Q9KA 3PG5A 2WJIA 2R9VA 4Q4JA 3WYAA 1OIWA 1RRCA 1R6BX 1T9HA 2BBWA 2BMEA 3TW4A 1S3GA 1U0HC 2R6FA 2XXAB 2CMKA 2HLDA 4ZI3A 1AZSC 2XTNA 4JVLA 3MJRA 4P32A 4Q1FA 3TR0A 2OFXA 1W49A 4DLWA 2P0EA 4G3XA 2NZJA 3JVVA 1VTKA 1E9FA 2OAP1 2YWFA 3JVUA 1COWA 1BOFA 3DKVA 3I73A 1M8PA 3X1YA 2V1UA 2NZ8A 3ZGXA 1CLUA 1M7GA 2A78A 2J0SA 1YR9A 2UKDA 3EXAA 1Z6YA 4P4SB 4CEJB 4Q4LA 3BRWD 2F6RA 3RS0A 3ZVRA 1QDEA 4XWOA 2NO9A 4ASUA 4NP6A 3EARA 4A0GA 1QG2A 2QAGA 1PZNA 1P9RA 3L0IB 2A5GA 5J4KA 1EFRA 5KU1A 4D25A 3QUSA 3P4XA 5LB4A 2BOVA 4YLGA 1NSFA 5IK2A 1MT0A 4M1TA 2KE5A 2RAPA 2P2LA 2Z6VA 4MYCA 2ONJA 1I2MA 1Q20A 2XB4A 1OXTA 2NIPA 3X1ZA 2HF9A 3RNLA 1HT1E 4OJQA 4URWR 1OYYA 3HYRA 1W47A 4M1WA 4XSHA 2IS2A 2WSSD 2QGNA 4RD3A 4TLBA 3B8HA 4Y0VA 2O8FA 4EPRA 3QEJA 4UXJA 2V6IA 5KDOA 4HLUC 4PC1A 5J4HA 1W5SA 4IOLA 1XJQA 3EX7C 2B7BA 4QKQA 4DCNA 3QJYA 2ZUCA 4CT5A 5B30A 3FE2A 1GILA 3B1VA 2BEJA 3FMIA 3M1IA 1BMFD 5DIFA 4A8JB 1RC8A 1WE2A 4PZYA 1XTKA 1U8ZA 5J5CA 5FUXA 4ZIRA 3GFTA 1EX6A 5BQ5A 1F3OA 5FR2A 5DHAA 3GJ0A 3EWAA 1KNXA 2X2EA 4O0MA 4DEXA 3THWA 1WA5A 2QMEA 3JZAA 3NTUA 4CVNA 4ESVA 2IHBA 3AVYA 2IK8A 3CZPA 2IWHA 5E7JA 2QEQA 5GVSA 2Z4RA 3ZZ0A 4AKEA 2ZJ8A 4LHVA 1G21E 3KKNA 1OE0A 2TMKA 3KKMA 1C1YA 5IRCD 1R5OA 1R0XA 4X8MA 3U7FB 2WSSA 4L15A 3W34A 3N5CA 3X1DA 1G4AE 4URYR 2J59A 3I32A 4NTZA 4B2LA 2P67A 2KWIA 2JAQA 4WZAE 2OBLA 4BZXA 2VH5R 4DLVA 5KHOC 1NKSA 2ZEJA 2C5LA 4A0RA 1IONA 4KYIB 3SJCA 3T5DA 4QHYA 4X8LA 5AR1A 4DUGD 4KJZA 3K53A 1E2KA 3C5CA 1NLZA 3VR4A 1TNDA 1ZW6A 1G8YA 1UKZA 4E07A 4FIDA 1QHIA 2ZSDA 1BMFA 3KJGA 1CULC 3MUFA 1VPLA 1XU4A 2H16A 4V0KA 4X8HA 1EK0A 3SHFA 2DY1A 4C2UA 4DB2A 4WOPA 1G3UA 3Q8XB 1PLKA 3UG7A 4DDWA 4UNRA 2V1XA 4TWZA 1VECA 3Q7QA 2R44A 2BJWA 2FSFA 3GFPA 4TT3A 3H84A 4C0HA 3B6EA 3O8RA 2ZTSA 2GA8A 3VKWA 1CF4A 4TMZA 1G6HA 1BS1A 4DSNA 3TH5A 4EKDA 2QAGB 2C77A 1HA3A 1N3BA 2C9YA 2XEXA 1Q3TA 1VCMA 4LK2A 4GP6A 5DN6A 4AG5A 1AKYA 3EA5A 2R6AA 3DOFA 5CYPA 5AUQA 3ZIAD 1OB2A 1OPXA 2ASEA 3QXHA 4C0LA 1ZIPA 3A1VA 3TAHA 2AD5A 3QNUA 2C99A 4E09A 3EG5A 1U8AA 5JS7A 1P60A 3AVPA 4DUGA 2WSMA 3O8BA 3X1XA 5J40A 3VR2A 1U81A 2DFTA 4KHZA 4KBFA 3CPHA 4Q00A 3SBEA 3BIFA 5KDDA 3IKJA 4K8OA 3ASZA 4YMSA 3K0EA 3KJHA 5EXPA 1E0JA 2BEKA 3BB4A 4EPWA 4JYBA 3ADKA 3LD9A 1WMSA 1GM5A 4LJ9A 1W1WA 3HR7A 1SKQA 5JCPA 4E5UA 3SQWA 4Q4HB 2YYZA 2YWEA 2PMDA 3QKUA 2G0NA 4JT2A 421PA 4BZQA 2IBMA 3KL4A 2WTUA 3GJ3A 1ZNXA 1N5IA 2VHJA 1GSIA 4Q7MB 4B44A 2G83A 5CLLA 1UKEA 3THWB 2Z5FA 4PANA 1XMIA 3D3QA 1IXRC 1L4UA 3F8TA 3KKPA 3QKSA 5KPJA 1HYQA 2FFHA 3MLEA 1OH6A 2GXAA 4QNRA 5FFMA 4TMVA 3CNNA 4LYJA 5LD2B 1P75A 3OEHA 4FCVA 4IOMA 3C4JA 3P27A 3PXGA 1RFLA 5ELXA 3HU2A 2JLXA 2WZQA 2R65A 2WIBA 2EQBA 3OIVA 4C4PA 3NBXX 3FWYA 2OEPA 4DSOA 2REOA 1ANKA 3E2IA 4M9ZA 1G64A 3U7EB 3Q3JB 4ACBA 4OKSA 5C18A 1ZNZA 1T4GA 3HDTA 4LHXA 2G3YA 2SHKA 5DE3A 3A4LA 4F7WA 4Q18A 3CRMA 3GD7A 3U7GA 3F5FA 3AKDA 4ZCIA 4G5SA 1ZCBA 2CK3A 2RKOA 3I1FA 4DLRA 1CXZA 2F1IA 4HAXA 4BLPA 4OHYA 5FUVA 1OV4A 5FL7D 4ZI2A 3WNDA 1RRGA 3IEVA 2C8VA 4KSCA 3A4MA 1LV7A 1NN0A 1UADA 2CHGA 4AD8A 3U5ZB 4TZ0A 3NIBA 1C4OA 2QMHA 1DELA 3AF2A 1LB1B 3G5UA 4ZKEA 1SHZA 1S1CA 5AJVB 3S1AA 4RVCA 2ZAOA 1KI1A 1NL3A 4DC9A 2QTFA 2XSZA 4QOSA 1DAIA 1D9ZA 4O2LA 1R8SA 3Q9LA 4N1AA 1KHTA 2GJ8A 5FPKA 2BV3A 4G1UC 4LHYA 4KAXA 2G9NA 2ZSBA 5KO2A 4TZ6A 3LAWA 3IHWA 3HU1A 4RCYA 1E9DA 3AGPA 3WYFA 3BH6A 3PITA 3CPEA 5FOWA 4RD2A 3VFDA 2O52A 2YKGA 1VHTA 2ORWA 4WW0A 1HURA 2QSYA 1DARA 1RW4A 2GRJA 2VHTA 4BFVA 1II8A 1MO6A 1FQJA 1KOFA 2AXNA 1FP7A 1OJLA 4YDHB 2RGGA 3MAAC 4AY2A 2OCYC 1NVVQ 1RIFA 3CH4B 2DHRA 1H8ED 1RKBA 3QXSA 3D8BA 5BWMA 1X86B 1R5BA 1FW6A 3RRNA 4QGHA 1TADA 1KY2A 3AF1A 5FL7A 5JHHB 1SKYB 4QFMA 1EGAA 5H70A 5M04A 4JLAA 2OT3B 4G01B 3ZVNA 1G291 1ZP6A 3QPVA 2ZUBA 3B78A 4R98A 4DDTA 1SULA 5IF9A 4M22A 2IXFA 4Q1BA 1E2EA 5KNBA 3D6TB 2G88A 2QY9A 3BFXA 4HYYA 3VKGA 3ZZUA 2IF0A 2QI9C 3QIAA 3CX7A 2IT1A 1DG3A 3GLIB 4AKHA 1A2BA 2W0MA 2WOJA 2I1VB 2ZR7A 4A0HA 3ETLA 1WP9A 2PCLA 4A4DA 2JLUA 1IY1A 2G6BA 1MV5A 1W36D 3A8TA 4EAQA 4BFXA 5GJBA 1TQ4A 5CJ2A 4UXHA 5G3YA 2WJVA 4HDQB 1WDTA 4B32A 1E79A 1FNNA 2QENA 4DDUA 3C5HA 5E95A 4GOKA 1U99A 4R9UC 1DTSA 3HWSA 4BFZA 4HAYA 3K09A 2PZGA 1LVGA 3U6BA 1D2MA 1Y3AA 1PV4A 1W44A 2WJHA 1ESMA 1DE0A 1IM2A 5JRZA 3DDCA 5EXTA 1N6OA 1OIXA 3IILA 4BLOA 4V0LA 2ZJAA 1LS1A 3NXSA 3Q5DA 2OZEA 4ZO4A 5FH9A 4KCGA 1E2MA 1TEVA 4EUNA 4KODA 1OXSC 3DHWC 3K0CC 5JECA 2FSGA 3PEVA 1R2QA 1CJKC 1I2DA 1JEEA 2WWFA 2ZU6A 4C9BA 1Q3HA 3ZD7A 2C78A 2VP5A 2JDID 3B13B 3O8DA 2H8KA 4B71A 5L3RA 1CTQA 1F6BA 3WMFA 4RZXA 4HATA 1Q1QA 2O8CB 521PA 1FNMA 2GXUA 1CS4C 3U60B 1CKEA 1WBBA 1K5DA 1JB1A 2VSXA 5EXXA 2FGKA 1W0JA 3GEIA 2QAGC 3KJEA 1TU3A 3BS4A 5FBQB 4C0KA 2CJWB 4TMWA 4JLMA 5LDDC 4RFSA 2FDCA 3W8RA 4JT4A 4D4LA 4D4KA 1LTQA 2IC5A 2JJ1D 2ZRAA 4JVMA 2JIZD 1XD2B 3F3YA 1DAKA 4QG7A 3PV0A 3TUJC 4Z51A 3GJ8A 2Q3FA 4B2IA 2AXPA 5L3SA 1E1RD 3QE0A 3KB2A 3WMEA 3L43A 3G0HA 2J5XA 2WPDA 2HEIA 2GEDA 2OE2A 1N6IA 1MR3F 2OFOA 2RGNC 2VEDA 1D2EA 3DM9B 1AM4D 3WP0A 2EW1A 2Q3MA 2QQEA 4ZDWA 3T34A 5CDFE 2J7PD 3LQRA 1XTRA 2EFHB 1FTNA 5BN3A 5KYKA 5FTKA 2B21A 3U3JA 3PVSA 2JDIA 3QQ5A 4U02A 2BM0A 3REFA 4IVPA 5A5GA 4GT1A 1DBSA 1SHKA 4PHGA 2BMJA 3FPAA 4B2PA 4BEBA 2D7DA 3OF5A 3OIUA 3SN6A 4IEIA 3GLHE 3FHOA 4I1SA 2X2FA 2O0KA 2RGCA 4MDEA 3THXA 1XEWY 3TE6A 4BLQA 2V7QD 4IDOA 3BK7A 1JJVA 4PFSA 2ZYUX 2FEOA 3CO5A 4QGFA 2R8RA 1KI4A 1Q1EA 2ANBA 1L2TA 5J47A 5LD2C 2JIZA 1YZQA 1Z2AA 2F9MA 4PHHA 1RRPA 5L3QA 4LY6A 3BAFA 2X1VA 1OT3A 1UBFA 2JASA 2O8DB 4Q9JA 2BKUA 1R0YA 1ZBDA 1E1RA 1SXJD 1KK3A 2VHCA 2W58A 2AR7A 4YQFA 2ZRCA 2FF7A 2D62A 1G7RA 1SVOA 1TQ2A 1NLYA 1PJRA 4LPKA 2FEMA 4PR0A 3QENA 2J7PA 1YZKA 4TL6A 4CEIA 3A1UA 3AP3A 4GZMA 2FSHA 5TDHA 3R9XA 4BGDA 2R2AA 1HQCA 3RANA 3G82C 3GP8A 1TUEA 2BMDA 2Z43A 1GKUB 1AA9A 3U6KA 5AUNB 1F2TB 1GZSA 3CWQA 4US0R 1ZD9A 4Z8XA 1L8QA 1M7HA 2W0SA 4A2PA 2DFKB 1G9XA 5AJXA 1P9NA 1Z6AA 2GXSA 1Z47A 2V7QA 5D3MB 1R0WA 2H7VA 6Q21A 1HE1C 1HV8A 5DO9A 4M9XA 1MABB 4WVFA 1Z0KA 4WA7A 1NG1A 4EPTA 2CE7A 1DG1G 5CDFA 3CF6R 1NVXQ 3L8YA 4HB3A 2ZRGA 2YOFA 3AKYA 4XWAA 5EE1A 2YOGA 2MMCA 2ZRKA 3LW7A 3I3SR 2AFHE 1ZNYA 4URZR 3W8NA 3VTKA 4IHQA 3V9PA 4PHFA 4PSVA 1AQUA 4RZUA 4GOXA 4FMBB 3CRQA 3NHBA 4OBEA 3GLHA 1CBUA 5C1BA 4LX0A 4P3YA 1ZJ6A 3OIWA 1OH8A 3RSOA 1SVMA 3B2EA 1NBME 3FFAA 1JXMA 4GZLA 4JJKA 1XJ0A 5CLQA 1O3YA 2VQSA 1J2JA 2AX4A 4BWYA 3KUCA 5GJCA 4IOKA 1FP6A 4KO8A 1Y63A 2HT6A 4QXAA 5C4MA 2W6ID 3QSYA 2ZSEA 1E69A 2GWHA 2YNMA 2REBA 1YHNA 3H4MA 4MITA 2OBMA 2GJSA 1QRAA 5KSYA 4L9SA 4RY2A 3Q5EA 3THYA 1N0WA 2ZIAA 1U9IA 4OHVA 3BE4A 4QNMA 4HB2A 2VP9A 2ZYTX 2DFNA 1GITA 2J87A 2RCNA 1JAIA 2RGEA 2C2HA 1KJZA 1NBMD 1QHHA 1G3MA 1GG2A 2WJGA 4FXPA 4MQBA 4QHTA 4DHEA 5C4GB 3WMGA 1SVKA 4QM6A 5JCZA 1YR6A 3WRYC 1W48A 1KY3A 2BM1A 4MYUA 5D3QA 3MJHA 5JFGA 3TVTA 1FPMA 5FPYA 3KB1A 4US2R 3EIHA 5B64A 3LXRA 4Z8YA 2QN6A 3C14C 1I4LD 2I1QA 3QBTA 3BH7A 3GLGE 2XNDD 5J4YA 1NF3A 2QM8A 2H92A 4NCKA 4NYIR 1RJ9A 2XOKD 5FTJA 2UVQA 4LV5B 1G20E 3MMPA 3VAAA 1CIPA 4DT1B 3QF7A 1Q1ZA 5BYJA 3TW8B 4MRSA 4B3CA 2OCPA 4CGZA 4LBWA 3MD0A 2WAXA 1KI3A 1S4QA 1E2PA 3TR5A 1NI3A 3R9WA 1OXXK 1NKTA 1FUUA 5HKKD 1W5TA 2JJ8A 3FTQA 5KPDA 4M2LA 1CJVC 2X8AA 3U4QB 1U2RA 3T15A 1XX6A 4B76A 4MYTA 4B3XA 1KI6A 2F3TA 3MFYA 1QZXA 5CM8B 4FMDB 1NN1A 1F60A 2EU8A 2VSOA 4JVSB 4Q1CA 4QBHA 3TQCA 3SE0A 1NBMA 4DB4A 3DOEA 4PTLA 3BH0A 4P33A 4URXR 2IS4A 2ODWA 4OYHA 3AH8A 4A9AA 1CU1A 4GMXA 4CIDA 1LS6A 3T5GA 1XCPA 3BC1A 4FINA 5FOUA 3AV0B 2AWOA 2DWPA 1GL9B 4D4JA 2FE4A 2VPPA 4JL5A 2Q0HA 4W9MC 1G8FA 4B47A 2PT7A 3N2EA 2B92A 2ZRJA 1IJFA 3SYNA 2O5VA 5EE3A 1YQTA 3A1TA 1PLLA 1KSGA 2HYIC 1TF7A 1SVSA 2DBYA 4GSYA 4DRZA 4IW3B 5HKKA 3QOFA 4HLCA 2FX3A 3U3RA 2MSDB 2ZE7A 2QTHA 1B23P 1GL7A 2NO6A 2ZYVX 3RS5A 2PL3A 3B1ZA 4KFTA 3CR8A 2JLQA 3GLGA 5EUMA 1KSJA 2QQ0A 3BFVA 3K0FB 3B1WA 3NWJA 5BYKA 1AS0A 4DSTA 5GJVC 4DSUA 1G7TA 4EIWA 1AK2A 4I1UA 1GRRA 4J0QA 3E5HA 4A2WA 4S2EA 3NVAA 4HLQB 1US8A 1J99A 4G5GA 2DWOA 4TQUS 3B85A 4IDQA 4Q1EA 4D81A 1XRJA 1D6JA 5DISB 3GLFB 2AK3A 5LPNA 4AKGA 1VCOA 1XJCA 5FPTA 1IBRA 4URVR 1EFHA 1X8JA 2FFBA 1WRBA 4TYWA 2C95A 1HEIA 3AGQA 2F1HA 4D0LB 3TSWA 2ZJZA 1R4AA 1FOEB 1RJ9B 1XMVA 2OG2A 4HI0E 2ZSFA 3BB1A 2D7CA 4JS0A 5FTMA 3CWZA 3TKLA 5C46F 4OHWA 2UZ3A 5SZHB 3U2QA 4GP7A 4FCTA 4I4LA 3FGNA 2B8TA 5EP3A 1S96A 1Z29A 4TMXA 3RLFA 1ETUA 1P4SA 3K09C 1WF3A 3LA6A 2XNSA 3VU9B 3QVVA 4OHXA 1VDZA 1X3SA 3K70D 2PZEA 3V00A 3DVLA 3C8UA 2NQ2C 2ZJ5A 3CB4A 1G17A 2BBOA 3AVWA 4ZDJA 2ERXA 1EXMA 2GJAA 3PIRA 4L8GA 4PPGA 1SVIA 1N6RA 1ZUIA 4QBFA 3TNFA 3FKQA 2QE7D 1ZYUA 1DAFA 3QPUA 1J8MF 3EZ7A 2AFIE 4BRWA 3CX8A 1E6CA 4Q4JB 5DHFA 4AURA 2J3EA 2BIFA 2NO7A 3QEOA 5FBVB 1NNEA 2BMFA 4OQNA 621PA 5JI2E 3LX5A 1E4VA 1Q57A 2NMVA 3LY5A 2D3WA 1JAHA 3IIJA 2JGNA 1GNRA 1R5NA 1FMJA 1XNJA 3ZQJA 2DB3A 1TQDA 1UPTA 4C0JA 1TX4B 1EG7A 3CLVA 2F1JA 3ICEA 4V0NA 4Q9IA 3DKPA 1TTTA 5JSZA 3U3KA 4JLOA 5FOSA 1E0AA 2ECKA 3BWDD 5TB5A 5AWFC 3W6PA 2OILA 4PC6A 4LSGA 3SFZA 5GVRA 3ASYA 4P4TA 2ZS7A 4KBGA 4HDCA 4LOAA 1ZD8A 4TLCA 3MGCA 3WHKA 2B8WA 5F9FA 2BCGY 1VG1A 2X19A 2ZSAA 4EQ6A 1XEWX 4QJ5A 1RYFA 1BKDR 3BGWA 3CBQA 3T1TA 3GPLA 2IS1A 4IVRA 5EZ6B 2ODEA 4JLJA 2PMKA 4D6PA 1KZGB 1KO5A 1W4AA 2BC9A 1G1MA 3U3OA 1NP6A 3LXXA 4YMTA 2VRWA 2FPMA 1CEEA 3NC1C 1Q0UA 1P5ZB 3BB3A 4HLDA 4QL3A 4KFRA 4M0LA 4HAZA 3VR1A 1N25A 2FFQA 5BW8A 4K46A 4B74A 2QMUA 3SYKA 2HF8A 1A1VA 1BH2A 1KAOA 2O8FB 1AIPA 2NTYC 2HXYA 2KI5A 1JECA 1Q22A 2BCJQ 1OFIA 3PUZA 1G4UR 1SGWA 1GNQA 1WCV1 2CCKA 1V5WA 2ZUDA 3GFOA 1E9BA 1YRBA 1G6OA 3FMOB 3OIYA 4AYXA 4BFYA 2DFLA 1JJ7A 1P73A 2IL1A 1YR8A 1S3SA 2LWIA 1E9CA 3QKTA 4OK6A 5TY0A 1OKKD 3KXIA 2YWHA 2FV8A 3C7KA 1E9EA 4N3NA 4PO9A 5CIQA 4AYWA 4ZIRB 3AVXA 4IVQA 1QBKC 2W2VA 3M0EA 3RS4A 4NCNA 3EZFA 2XJ9A 3DZ8A 3L8ZA 3M6AA 3C41J 4A0FA 4IXMA 3EIEA 4KXFB 3TRFA 2CL7X 3TVDA 1UBCA 3ZIAA 1JPJA 4I1VA 4LYFA 3HJNA 4CW7A 2H57A 3PQCA 1YRAA 1DO0A 3WNBA 1DEKA 1LF5A 2CCGA 2QP3A 4EJSA 3UIEA 4V0OA 2PZFA 1KAGA 4LJ4A 1MO4A 3K0AA 4PO8A 1NN5A 3I72A 2OCAA 3RWOA 4JBYA 3KFVA 2JLVA 2IYWA 4M1OA 4R2IA 5KTYA 4JZKA 3QG1A 4KFUA 2QT0A 1Q12A 1VIYA 4LC1A 1QHNA 4TMTA 3WHLA 4ZDKA 2FSIA 4D4MA 2F55A 2A3RA 5F3WB 2Q9AA 2W2XA 1OFHA 4W5JA 3BOSA 4QBGB 1FMLA 1KO8A 2ZRDA 1OKKA 1EFUA 4JYCA 1OLOA 2RB4A 3BD9A 1P2UA 2GCOA 5FPHA 5F98A 1TF5A 3GQBA 4M1SA 4QRHA 2JLZA 4C7OA 2FH5B 2BWJA 1E2LA 3Q7PA 3SBDA 4KVGA 1U98A 2UZIR 2JJ2D 4QM7A 1MKYA 4LYHA 2R6CA 4MGKR 1Z6XA 1ZCAA 1KMHA 2GBLC 1KDOA 1G7SA 3UMRA 3EZ2A 2GEUA 3QBVA 4RD1A 2IW3A 2WJYA 2ZRNA 1KYIA 3GEEA 1B0UA 1KK2A 1GUAA 3R8CA 4OJKA 1IXZA 3RVBA 4PAOA 5DLQC 1G3RA 5JEDA 3J81k 4Q9LA 3U44A 1H8HD 1E1QD 3P20A 3CRVA 4GNKA 4U5XA 5HE8A 2JLWA 4M1YA 1L7VC 4WBSA 4IDNA 2D74A 3I5YA 2HDNB 2OXCA 4B6EA 1K5GA 1GNPA 1G5TA 4B35A 2RH5A 2XZOA 5IT5A 4NYMQ 2ZVQX 1U90A 1UDXA 1KDPA 3A36A 3P1JA 3QF4A 5CJPA 4CEHA 1U94A 1P62B 4G5OA 3AVUA 2NO0A 2JCSA 2QP9X 1FUKA 1BYUA 3AQ4A 4DDVA 2ZI6A 2B6HA 1KIMA 221PA 4U7DA 2OLJA 4TLAA 1R0ZA 1T8UA 2OFWA 3AEZA 3AKEA 3RS2A 3MWLA 2ORVA 3PR1A 1AGRA 4LYAA 4N0EA 4NU0A 3EPLA 5JJKA 1KK1A 2V54A 1Q1BA 4JLPA 1WXQA 2JJ2A 4KITB 2F9LA 5FUYA 4PAMA 2BBTA 3LRPA 4O2RA 2AKYA 3LX8A 3B1YA 3B5JA 3D31A 4BZPA 4DCUA 3GJ4A 3B60A 3FHCB 1OFTA 5EE9A 4PZZA 3TUZC 3L0SA 3A6PC 3DEFA 4Q7JB 1J8YF 4F91B 1GVNB 3C16C 2ODNA 3QKSB 3KDSE 4M1MA 1H8HA 3A37A 3RABA 3ZS8A 1ZUHA 2N1BA 2QNRA 3K9GA 2ZRMA 2P5SA 4RD4A 2GJKA 3EPHA 4B3FX 2CVHA 2NG1A 2A5FA 1WQ1R 2VO1A 4W5HA 5DI9A 1P6XA 3FMPB 2PEZA 3RHFA 5CB8A 2XZLA 1N6KA 2KB0A 4PC3A 1YKSA 3L82B 3OE7D 1H8EA 3SU8A 1MRSA 4H1UA 5SZJA 1PUIA 3KJIA 3TLXA 2GNOA 4Z54A 2IWRA 1TU4A 3CF2A 5LBIA 2WBLC 1ZM3A 3AF0A 1Z83A 2XTZA 3E70C 3NG1A 4TSFD 4FI3C 3UKDA 3CH5A 2CDNA 3T1QA 2HJVA 2XITA 4ZKDA 4EPVA 4E03A 4TQAA 4OHZA 1U0LA 3SJAA 1TAGA 1IJEA 3UXMA 3RC8A 4HAWA 2GCOB 3V4RA 5AJWA 1BIFA 1E4YA 3AM1A 3IBYA 2XZPA 2J9RA 3UANA 2ZRLA 3A4NA 3OFND 4XIGS 5EQTA 3I92A 3I61A 3S1AB 1ZM9A 5TV2A 3VQTA 2V3CC 1EWQA 1FFHA 2FPLA 1W46A 3AVVA 2CHQA 3WXMA 2CXXA 2WWYA 4UNNA 4NPHA 3QVUA 2IYXA 4JKIA 5HZHA 3T06B 3DM5A 1TMKA 4NH0A 1GTVA 2C9CA 3VX4A 1NMXA 3U44B 4ERNA 4GL2A 3DZDA 1N0UA 4TTPA 1F2UA 2H1LA 3OE7A 1NG9A 4KSBA 2J46A 1P61B 1XDBA 2QRZA 3PFIA 1II8B 3H2YA 2Y8EA 3N2IA 3QF4B 3QXCA 4TSFA 3N70A 3HP1A 4FWIB 1E2NA 2OM2A 2QROA 1FX0A 4RCZA 1GIAA 2CCJA 3IO3A 4YDSA 3M4YA 2MSCB 1FL9A 4UJ3A 2QPTA 3HPQA 4JJZA 2E87A 1GRQA 3KQHA 3BJIC 1P72A 1BYIA 1VIAA 3MWJA 2VP2A 3KTAA 5KUTA 1Z3IX 4US1R 4CZ2A 5G3ZA 4IEEA 5HZKA 3OAAD 3L2OB 4TL7A 1CJMA 4V0ME 3P26A 3THOA 2NOAA 3IQXA 4A1FA 3NH6A 2A5YB 1N5LA 1T5LA 2AKAB 2VIIA 1GKIA 3NH9A 1SXJE 1Z8FA 2P6UA 4OI2A 4D0GA 4DLZA 3I5XA 3IUYA 1OXUA 4PAQA 5KSOA 4TYQA 2FWRA 2OAQ1 2VF7A 4PC2A 1ESNA 3CIOA 1KKLA 3LO5A 3Q72A 5DYIA 5JS8A 5G40A 3DPUA 1ZAKA 1CR0A 1G3IA 2BBSA 4KVAA 3W5IA 4LWZA 1J90A 4MYHA 1NY5A 2GILA 2OSBA 5JHGB 1K8RA 2RGXA 2A30A 4DVGA 2ZXUA 3I4LA 1AJEA 2PLRA 1DVRA 2W2TA 2JJ1A 2HUPA 3ND9A 4LJ8A 4M4SA 1W4CA 4F38A 2GZDA 121PA 1Z0AA 1XZQA 2GCNA 4Q1DA 4NCIA 2C9OA 5HTKA 3FVQA 1PUJA 5P21A 2VP4A 3IIMA 3ADCA 2IXGA 5KNCA 1KTVA 4Q1AA 2F43A 2Z0MA 4LJ7A 3SFVA 5TARA 4I81A 1XB2A 2XX3A 1DAMA 1XD9A 3LFUA 4TLDA 1AKEA 1Z07A 3VMFA 5EP4A 1T3LA 3LWNA 2KBFA 4LGMA 4ON9A 1N2CE 5F2EA 2ZAMA 3KQUA 2GF0A 4PO1A 3NHAA 4FCWA 4QC2A 1G5RA 5E7IA 2VP6A 2ZRHA 3GJ7A 1Z28A 1GFIA 3TUIC 4ZDIA 4MRVA 3AVOA 2IF2A 1CP2A 2IYYA 4Q21A 4TLEA 2HJGA 1W4BA 3OHMA 4LJYA 4RD0A 2QG6A 4MUBA 4FW9A 1XEFA 1VG8A 1QVAA 2DCUA 4IOJA 1M2OB 1MRNA 1ZVQA 4JLKA 2WMOB 2LKCA 3PUYA 4PQYA 1JR3E 4FMDF 2WKQA 2WWWA 4BUJA 4LRWA 4V0MA 3K1JA 4EFLA 4Q01A 5EXSA 4MUAA 5FUWA 1A7JA 1MO3A 4RFSB 1SXJA 2O8EA 3AP1A 3TIFA 2PJZA 4DJTA 5BN4A 5L3VA 5SZIA 1II0A 4GOJA 1UJ2A 4KYUA 3BORA 1UEJA 1QHSA 4CF7A 3K9HA 5L3SB 1YZGA 3R7WA 4HZUA 4EDHA 1CJUC 2J1LA 1UKYA 4LI0A 4TN1A 1JXOA 1ELOA 1JR3D 2CNWD 3NBZC 4XTRA 2GCPA 2XXAA 5JZVA 1RVDA 1Z0FA 1JI0A 1M34E 4RJLA 5IDVA 721PA 3DL0A 3PCRB 5TXGA 1YZNA 1UM8A 4BLRA 2R62A 1G3QA 1N5KA 4S35A 1P9WA 1QVRA 1ZU5A 3CNOA 4PPQA 1SZPA 1D9XA 1XTQA 4OQLA 4AC9A 2DR3A 2ZJ2A 1KSHA 3THXB 5H1YA 3RS7A 4P4SA 1T6NA 4TL8A 4TYPA 5AJZA 3K9LA 4HAVA 4CEJA 1BO6A 3BFKA 1Z0DA 4M9QA 1OB5A 5AK0A 2JLRA 1E9AA 1NVWQ 3EA0A 3C15C 3PEUA 1J70A 2A9KA 4B43A 5FBWB 3WBKA 3ZH9B 5L3QB 3ZDQA 1IN7A 2FPKA 5KSPA 2CLDX 2WWGA 4EJSC 4DLUA 2FFAA 3FB4A 1IQPA 4GI7A 3ZJYA 4AG6A 3W9YA 2IYRA 2F43B 1A2KC 1KO1A 2XAUA 2C03A 2IEZA 3NEYA 1IN8A 1JR3A 2QMOA 3GJ6A 2CNWA 2IYQA 4O3MA 1KDTA 1XMJA 2AWNA 2W6IA 5FTLA 4CEIB 4UQOA 1G16A 3ZZTA 2WKRA 1OHHD 1G7CA 1E98A 4XJXA 1DAHA 1WBDA 1E2JA 1H65A 1NIJA 1XZPA 4B3DA 4YC7A 2V55B 2Q3HA 5EJEA 1XXHE 3R8FA 4NYJR 4PX9A 5B58C 2XJ4A 1KDRA 1KGDA 2V4ZA 4YMVA 2ZM5A 4G0NA 5FBRB 2IYSA 2YINC 1ZNWA 2GHIA 1ODFA 1P2SA 4A8JA 5AUPB 2IYLD 3NDBB 2QPOA 3FKSD 2LCFA 3HYTA 2V8OA 1AN0A 4O25A 2XNDA 2VHQA 1KO7A 3KQKA 2ZITA 2QUZA 2XOKA 5EZ5A 2GESA 3K8YA 5H8WA 3I62A 1SXJB 2JATA 3W6NA 3ONWA 2OUKA 3TK1A 4ASUD 1M74A 1AGPA 2HXSA 1D2NA 1RE0A 3HPRA 4OK5A 3GLHB 1N6PA 3TQFA 4BEJA 2OHFA 1CR4A 2YZ2A 1EFRD 1MOZA 1VYVA 2ATVA 2VLIA 3TAUA 1R10A 3A1SA 2ZPTX 2WOOA 1G18A 2DWQA 2IX3A 2IYVA 4E22A 3R7WB 3EZ9A 4UKDA 1M6NA 1U0JA 4XOIA 4MRNA 1D5CA 4XSGA 1PLJA 3EPKA 1DOAA 4LDJA 3KQNA 3IHLA 2H17A 5JRJA 2N42A 4CDGA 4XH9B 3K0CA 3T61A 3NBYC 4C0SA 4JL8A 1OF1A 3THYB 3FKSA 3W3AA 1S2MA 1TF2A 3EC1A 2CE2X 1NLFA 1SVLA 4YMWA 4F93B 4BQSA 2YVUA 4NONA 4DLTA 2V9PA 1ZM4A 3BERA 4JLNA 3SR0A 1QHHB 2JLSA 1N0VC 5B57C 3IEUA 4IFEA 2ZI7A 4MRPA 4R71A 5FI1B 4B3BA 3VHLB 1XPOA 5HR5A 2DYKA 2XGJA 5LB2A 2WICA 4LHWA 2CLCX 3RC3A 1JEDA 3ADDA 1XXHA 4P31A 1U8YA 4Q9HA 3ZVLA 1CRPA 4MGYR 4DXAA 2ZS9A 5IHPA 1NN3A 1UEIA 4IKEA 3PUWA 2IYUA 1UBEA 4QJ4A 2D06A 4GDFA 1NIPA 3UWKA 1KI2A 4B3GA 4AKIA 4Q7LA 2IS6A 1GWNA 4C0AC 4L5BA 3ZLJA 5EUQB 3A58B 4PQFA 4TTQA 3KQLA 3LW8A 2O0JA 2P5TB 4RKFA 1ZMXA 4JBXA 2WV9A 3AUYA 4EFNA 4LPSA 1DO2A 3REGA 1NJFA 4HAUA 4B48A 4A15A 3UK6A 2RGNA 2ZE6A 1E2GA 4PZLA 5B2ZA 1AQYA 1LFDB 2WKPA 4OI4A 4DLXA 2QP4A 1KI6B 2ZROA 4D26A 1T8TA 2O0HA
chains in the Genus database with same CATH superfamily
1XTSA 1RZVA 2VZ0A 3FY4A 3FYHA 5DWVA 3VR3A 4RVOA 4LV8B 1VBNA 4NJMA 1NXXA 5EYPA 1E5VA 1W36C 1VMIA 2Q21A 4FDVA 1FYWA 5ERYA 1HQYE 3N58A 3WB2A 3MRXA 2Z04A 2YQ4A 4JBWA 1NX6A 3QMMA 3W6OA 3PJRA 1CNFA 4LRYA 2QN9A 2X14A 3Q7RA 4JB3A 3TZLA 2B69A 3G2QA 4WESA 1XLVA 2WQ6A 2XNCA 4B7UA 2P11A 1T5IA 3KKQA 4QPCA 5FDFA 1PEDA 3HCCA 3PXUA 4J1QA 4DDMA 1WB4A 4IJEA 4PG7A 4DRYA 1E1LA 1LSJA 5KNLA 5E6UB 1VI5A 4M8NE 1UP4A 3H9GA 4I6JA 1VKJA 1ZIYA 3HR8A 3RBVA 3DXZA 5CNMA 1R7RA 3OPYA 5E2BA 3EVTA 3FNRA 5ALFA 3URMA 3UY4A 1OXMA 4LFCM 4PBSA 1T29A 1ZM2A 2B6NA 5JWHA 4KU4A 3STTA 5DSZA 4G0XA 3IPYA 4QXPA 4WNIA 5I7EA 5HMLA 2GI4A 3K0HA 4UEQA 4DCVA 3GLSA 3N07A 4PLPA 2GBIA 1S8FA 1V37A 3LT0A 4W9NA 4EB0A 3ID6C 4MKGA 2J7KA 3IKVA 4D6YA 4B33A 2ZQ5A 4DTIA 3WLOA 3KFXA 2VBCA 1F8FA 2WHPB 2V65A 4HWOA 2YWJA 1M5UA 1A88A 3UUGA 4PQRA 4DR2M 3P9XA 3FAZA 3UHAA 8ADHA 1ZL0A 3WSTA 1O6BA 3UWPA 4RX1A 2VK2A 3AJ9A 3FNGA 3JWEA 4FWHA 4WGGA 2C3OA 3ZVMA 5A4IS 1X19A 1IPHA 3QFSA 1JQLB 2C0QA 2PH1A 3K0AB 3QM1A 1UZLA 4WACA 4YQZA 3GRAA 4KMSA 4GLOA 4W6QA 2W6JA 2XODA 4ZCLA 1VZ3A 5FD8A 1HE3A 2QMZA 1QU3A 5AW8A 4WZBA 3JR5A 1NRJB 2H2FA 2HRRA 2HMAA 4N6OA 2X8LA 2ZU0C 3G2LA 2TMYA 1I3OA 2Z5LA 2R66A 2KMLA 3K0KA 4TN5A 1Q21A 4EJFA 4MVJE 2ZI4A 2C3YA 1UMCB 4IMPA 4A1OA 3RSCA 3L49A 4V1CB 2ACEA 4GC9A 3HXOA 1RKQA 3IO5A 2PMFA 3PQ5A 1KMQA 1V3QE 1W6UA 2NO1A 3SYLA 3EIUA 3QOYA 3CIFA 4R9VA 3N2ZB 3DKIA 1QGDA 4OHRA 1QDTA 1ULZA 2DFPA 2QLMA 3UYKA 1ZAEA 2EWVA 2CEAA 5CEFA 2HU7A 2XVZA 3WC4A 1MOPA 2RGAA 1ZH0A 3O5AA 1RZ3A 5BXYA 3Q85A 3E84A 3QI2A 3GAMA 3ISTA 2YFKA 3PCXA 2A5DA 3RQIA 4U2KA 2GK7A 1C30A 3FHTA 1LW7A 1P19A 3SLGA 1JU3A 1C9NA 3VZCA 1U0FA 3SARA 3NWOA 3HEMA 3FMVA 5B4UA 1PR1A 4YP1A 3OQOA 1CJSA 5EGSA 3CWCA 4ID9A 4F4CA 3DMDA 4URUR 4HPWA 1ZIOA 5KOHB 3EGCA 4OK3A 2OYRA 4F5EA 2W90A 1Q02A 4RIHA 3KOWE 3KQYA 3ER9A 3AFGA 2WWHA 2AZ4A 1GKLA 1DKUA 4H7EA 1CHDA 3NZEA 4NZOA 3ZY5A 1M72A 3L7DA 4OBXA 4GMDA 4EPYA 4NXMM 1X8LA 2IUSA 4L8LA 4O8CA 1USWA 1P7CA 1QPBA 4BL5A 3AKZA 3QTLA 4D2IA 2ZKIA 2ERYA 4UAUA 4EFMA 1NLUA 3VNUA 3H87A 4HLQA 1IM8A 1ZG3A 4DY4A 4P3PA 1YGYA 1SBNE 4WY8A 3C3CA 1ML4A 3UPUA 3IS3A 4ARCA 2W2MA 2C07A 2O06A 1JBEA 4Y9SA 2Q07A 1DGHB 4JXKA 3QBDA 1SCKA 4AZVA 3QFFA 2GCGA 3ZVKA 2IP2A 1H0RA 4FE4A 4RFVA 5HWSA 1VLZA 2QL6A 1D0LA 3ZX4A 3LOUA 4F3CA 1HEUA 1Z0IA 1WXEA 2R96A 4ZVVA 2QPAA 3SC4A 3SJUA 1CS0A 2EYUA 1MEOA 2R9VA 4UM9D 5JD4A 1U0HC 4ZRNA 2DX7A 3O1LA 3FLEA 3H13A 5FBZA 5DIZA 3FPKA 3UUFA 1GLNA 3KOYE 4KR3A 2BWEA 1T1JA 3KOZA 4P84A 4U0KA 4JIGA 1DAPA 4NSRA 1ICIA 2ZUWA 1PT9A 3W1WA 4UXJA 2IVFA 5FJJA 5GZ6A 3RARA 4ROSA 3VR4D 5BNWA 3B1VA 2BEJA 3QVJA 1KXZA 1U8ZA 5ITQA 2IZ7A 2P9JA 3WK5A 2GZRA 1Z37A 1D0KA 2A5LA 2BEWB 3PL1A 3BD7A 4KWEA 4I19A 2VDVE 3ZZ0A 1I5EA 4OJTA 3DDUA 3MOIA 4L57A 4X8MA 4R5MA 3I32A 4UU1A 1KZYC 3WNQA 2YZNA 3Q7TA 3K53A 4L8YA 5H59A 3NC4A 1MD9A 1G3UA 3Q8XB 1I3LA 4IBFA 1M76A 3VGJA 2ZTSA 3PX2A 2QDXA 3NOVA 3CUWA 4YV1A 4IIXA 3P96A 3AB7A 1PS8A 1U8AA 3SHTA 1WSWA 3COZA 1VE6A 4MIEA 4HFJA 2JLAA 2BFCA 4EM6A 1YCFA 2YRXA 3NWBA 4XGQA 4BZQA 3KL4A 5TGTA 3HKCB 4RVUA 4Q7JA 3D3QA 4MS4B 1Z8DA 4KO1S 3E2PA 1ORYB 3DNMA 4Z4CA 3KUXA 1X38A 4ZYTA 1DOZA 4L3VA 3PJFA 3NFYA 1DWUA 4CGYB 2Z6UA 2VNKA 2DXIA 1NU8A 1XZJA 2CHGA 4AD8A 3VMMA 5FB3A 4V0RA 3KB8A 5IC5A 2VYQA 1R8SA 4N1AA 1Y7LA 3D5EA 2I6TA 4L85A 2G9NA 4V38A 3KPYA 1VGRA 4RCYA 3KJZA 3LCUA 4KV7A 1N8NA 4E1VA 1LU9A 4TTJA 2IBSA 1FQJA 3KAQA 2DHRA 1FW6A 1KY2A 6GPBA 1NHGA 3LP6A 1JV2B 3VUEA 2IW1A 3H7AA 3ZV4A 5MGNA 1SZCA 3BFXA 3QIAA 3BHJA 3WFIA 1MX1A 2CDBA 1FP1D 3UFBA 4TUWA 2WRZA 4KXQA 4H4DA 2IYNA 2ZW9A 3K9FC 3RNOA 2J6HA 2VXYA 5BOVA 1U7OA 3DMFA 1T6OA 1F4PA 2IFTA 5EXTA 3UV7A 4ZO4A 2G0AA 1LS1A 4EUNA 2X76A 3AJEA 4Z6KA 4OG2A 4HNVA 5ALLA 2H8KA 5HILA 1AMUA 5JV5A 1PZHA 1CS4C 1UH5A 5EXXA 1NJSA 1W0JA 2QAGC 2UUAB 3O2SB 2O7VA 9LDBA 2P9EA 5T8KC 1DX4A 2IQIA 4WK4B 4N12A 2QSFX 3OT1A 5BN3A 4RHYA 2BMJA 4YJGB 3A4VA 3BT7A 1VXOA 4W8GA 4FUQA 3DHEA 3QRWA 3BK7A 3TWKA 3QUQA 5JXGA 5DRTA 3AI3A 5JAIA 1CY1A 1FYFA 3MCZA 1OT3A 1UBFA 2JASA 1KEKA 1GQFA 1YDFA 1I36A 2J7PA 3D3WB 3NRBA 4GZMA 1YAJA 4QLOA 1HQCA 1LUAA 4WP2A 4EFKA 9GPBA 4Z8XA 1CQZA 1L8QA 4GBED 2B8NA 4Y2QA 1R0WA 4QWMA 5EHZA 2JNHA 1NG1A 6YASA 3TTXA 4NF2A 4C6SA 4IUDS 4MV7A 2C4KA 4QO8A 1FLNA 3HKBA 3B6MA 1QORA 1CUUA 2B2CA 1AQUA 3JQ7B 4XB2A 4BV9A 3W9SA 4MPPA 4GZLA 2OPFA 3MILA 2AX4A 5AIAA 2FR8A 1Y7TA 1MX9A 2NPOA 3C1UA 1LCIA 4LHEA 4Z9YA 1I3MA 3I4YA 4D9KA 4KXVA 2GJSA 3H2BA 4RY2A 16PKA 3SVTA 4X3OA 3FZGA 1NBMD 4J0CA 4QM6A 3TOZA 2GQ0A 2D1YA 2J9XB 3KYDA 1PZEA 3C14C 2C9BA 3V8RA 3N0VA 4NYIR 5DFLA 5BYJA 3R6DA 1BHO1 1CVRA 1OIPA 3JZDA 4JI5M 3R9XB 2MTBA 3IH5A 1DRVA 3PNQA 3U4QB 1U2RA 4B3XA 2XTJA 1J49A 2VSOA 2XECA 4JR0A 3C4QA 4OD0A 1GU1A 3AH8A 1CU1A 2E37A 3BC1A 5IWAM 2C0CA 3G6KA 3GFSA 4E5KA 2XF2A 3LW5F 1IJFA 3SYNA 1JB0F 1NJ6A 2BLNA 4L0DA 3IQIX 3PC8C 4EB6B 1KSGA 5ALPA 4JI7B 1CEQA 4HLCA 1INLA 1B23P 3QWFA 3B1ZA 3LT2A 3QWIA 4RK7A 2FTKE 1G20A 5BYKA 1G42A 3N7AA 3JX9A 4EIWA 5ABPA 2BR3A 2WNHA 2R8PA 2QM3A 3A3NA 4JWTA 1D6JA 2DQKA 5FPTA 5LUBA 5HZMA 2Q7XA 2ZK7A 3B7PA 3TSWA 1FOEB 1RJ9B 2GK3A 3ZU6A 3CWZA 2H1RA 3HHXA 4DMHA 1D6MA 2UZ3A 2C7OA 3FCCA 2MYPA 2RAUA 5EP3A 4RH0A 1C8LA 3QVVA 3RU3A 3KS4A 1RKVA 1MT3A 2AXEA 2XHZA 4GPD1 3F90A 2IOHA 3LQKA 4L8GA 3FBTA 4YR7A 3PQ6A 1ZJWA 1FUEA 3KHUA 5KU7A 2J48A 2AFIE 1IEQA 4DMMA 5IM5A 1C41A 3QEOA 3EPPA 3OBBA 3IT3A 1XNJA 3E9NA 2XD9A 3DP9A 3DLPX 4MICA 4X66M 4QVIA 4PTYA 3O4IA 2AI1A 2HADA 3G13A 1V8PA 1V8DA 3TDKA 1IBLB 4UAJA 4EBBA 4J0GA 1HM5A 2PGAA 3JWPA 3AYXB 3DAGA 4FKMA 4M1EA 1FYVA 2QJFA 3QW2A 1MNAA 3AY6A 4DYVA 1WNTA 3C58A 4JOQA 3PUZA 5J3JA 1PG2A 1VDLA 4O2BA 5CIQA 3MS7A 1H42A 4IIYA 4IVQA 4NCNA 1YVEI 2Z5GA 4BX0A 3RUEA 5LNK1 1PTJA 3C41J 1GT91 1XDDA 4KDCA 2CUNA 5T4BA 1FUYB 2IX9A 5AVQA 2CVPA 1F7VA 4M7RA 3I9V1 4LC1A 4D4MA 5K05A 3OZBA 5F3WB 2W6QA 2Q9AA 1OFHA 3USZA 4YJ2B 4JXZA 3AG5A 4YO7A 1G60A 4UATA 5ALEA 3UAXA 3DTNA 1J1IA 2UZIR 4GICA 3GZNA 4PCLA 4LYEA 1G7SA 3EZ2A 2WJYA 2ZRNA 4IQ8A 3WGMA 1IXZA 1IOVA 1XU7A 4AQDA 3TWLA 1SC9A 5K3CA 2HDNB 4JFAA 4IGFA 3V8VA 2DZLA 4R8KA 5H3HA 1FUKA 4DDVA 3VVMA 1XNRB 2VT6A 4OATA 4DGQA 3RS2A 4XUEA 5CHYA 1AGRA 3WDLA 3BSSA 2EJWA 4JI1B 1VEJA 1ONOA 1CK4A 4Q7EA 3GEMA 2J67A 3DEJA 3ZBPA 1NM5A 4ZCTA 1SCQA 2ODNA 2OVBA 4C20A 3T9AA 2Z3VA 4NOKA 4DPMA 2FEXA 1Z0UA 2ZRMA 1GSAA 4UQPA 4JI2B 3BDVA 4B3FX 1QO7A 4BXOB 5DI9A 3OP4A 5FX2A 2KB0A 5E3JA 3DB1A 3KJIA 3BXEA 3DLHA 4TSFD 1PBNA 4K9PA 5CGQB 3KP0E 4RESA 3WK4A 4JDUA 1YH3A 4TQAA 4F2GA 4LF9M 4R0MA 3MD9A 1Y9ZA 5CURA 1C50A 5K45A 4P5DA 5IDYA 1E4EB 1FFHA 4TKUA 5KJ1A 2VPZA 3IP6A 1Y3IA 4PN7A 4MSUA 1I7SB 5LJLA 3L7YA 4Y9RA 1TDZA 1ILEA 5J2TA 4FWIB 4ZQIA 2CCJA 4YB8A 3IO3A 1ZGCA 1XI2A 1GRQA 1BYIA 4BNVA 1X3LA 3R0ZA 1X87A 3SCZA 2ACWA 4NATA 4RDHA 2RD2A 4PC2A 1ZAKA 3RR2A 2MYNA 4BMNA 3UJCA 4MYHA 2OZPA 1Y37A 2OSBA 4NJEA 4DVGA 3D81A 3NTXA 1Z0AA 4Q1DA 4WNCA 1TYAE 2B4YA 1C3OA 2YJ5A 2IXGA 1KTVA 4I81A 2XX3A 4TLDA 2B20A 1ISMA 4ON9A 4XWTA 1RADA 1BEZA 2ARKA 2BGMA 4FCWA 4JH0A 4BC0A 1J6UA 4QYIA 1CCWA 2H1HA 2IF2A 2SKCA 4C22A 1QVAA 2Z30A 3AL0C 4IICA 2WMOB 3PUYA 3P9QA 2WKQA 3MIIA 4H77A 1N2BA 2WDZA 4OHKA 3T3DA 3L6OO 2R5WA 3H5NA 2ZYAA 1B4DA 1TM3E 3EZLA 3PUIA 4TVSA 2R86A 3AFHA 1UJ2A 2XQGA 1KVSA 4WK0B 1SHLA 1I2BA 5A4FS 3JZIA 4BLRA 4OP1A 1ZJYA 2BFBB 2BEVA 3OCUA 2V6MA 3GIWA 5AJZA 4TYPA 4D9EA 4Y2UA 1E62A 4XYGA 1E3TA 5K7SA 4OP2A 3KLPX 4DV5M 2IYRA 2ZIZA 3H7IA 2L69A 2R68A 3WLQA 2PYZA 2BJHA 3GLRA 4ZALA 2AWNA 9ATCA 1PG0A 3AM3A 3VSDA 1H65A 2FQ1A 5JQGB 4B3DA 5EJEA 3R5SA 2XJ4A 1KGDA 4P7BA 3WLPA 4CQNA 4R01A 1RI1A 2P2GA 1A1SA 3MUNA 5ITRA 2RI1A 3FKSD 1EXWA 2QTBA 2CHFA 1NVMB 2Z98A 3LHFA 3K8YA 4IZ6A 1SXJB 1NVGA 5TPWA 1YTUA 4JFRA 1XHFA 4UHHA 2DWQA 2O3UA 1D2RA 1YS9A 3UBMA 5JYEA 5JNUA 4XSGA 3L1UA 4P7GA 3V7UA 4LDJA 1FY2A 3DA8A 3T61A 3A1EA 4RK6A 4KR6A 1I94M 5FORA 2Z4TA 1KMMA 4J03A 3IT1A 2PUDA 3I1YA 2OHOA 2DYKA 2DOKA 2CNOA 5BR7A 1GRVA 3GLVA 3SBJA 5FOQA 4ZWNA 3IEMA 2D06A 1NIPA 5EJ2A 4PQFA 1X7ZA 6AT1A 3WDMA 1T8TA 1TM1E 3INNA 3MHPA 4ZAGA 3D7MA 5IT9A 3JARA 1WVMA 5KZMB 1ZM7A 3IQWA 2G6TA 3TNLA 3ORRA 3O31A 3TL3A 4N8DA 1U28C 3E7PA 1XHLA 1Q6YA 4NZZA 2FG5A 3NGXA 5FWXB 3SKYA 3WL3A 5KX5B 4HSGA 4CMKA 2X5JO 4H7JA 3GVHA 4ES6A 2C5SA 1XRMA 2ZREA 4ZI5A 2HPZA 4BNYA 2WSLA 3PE6A 4CISA 3E27A 3QLVA 3B51X 3X43A 4ZOLA 3IAHA 4CKXA 1XXHB 2GERA 3VSEA 2VYCA 4ZAWA 3DMTA 3AI2A 3L1KA 5BN5A 1H4VB 2AOTB 2ON6A 1DX9A 4EWLA 4K8RB 4P8RA 3SJBA 4O2BF 3L7IA 5LYYA 1ECLA 5CVUA 1XCBA 1OFUA 4A82A 4NL4H 2A0FA 4Z1OA 1A8SA 1S8AA 4ARZA 1WL8A 4PZPA 1GLVA 2Y1XA 2PD6A 2GXQA 1KPGA 1OXVA 5AT1A 5AI6A 3AUUA 3VDPA 5BSRA 3JZFA 2YDYA 1QO0A 1A9SA 4QXOA 3T7RA 1QHGA 4FHDA 4KOAA 1KI7A 2PPVA 2Q29A 4IIBA 3SHVA 3COJA 2LKDA 1SIBE 1JLMA 4L9WA 2HPVA 4X94A 4ZYLA 1VIMA 5H7XA 1U9IC 1VKNA 3H5RA 2EKKA 3PYMA 1YCHA 1WMAA 1EFCA 3TFOA 4YCAA 2P6RA 1D07A 1OLUA 4WBXC 2REXB 5LKRA 3DVRX 3C3WA 5DXFA 4KK4A 2RDMA 2O0LA 3FZQA 4C30A 2O5RA 1HBJA 4BFWA 2JKVA 3S1SA 3P2MA 2J30A 4DLPA 4MWOA 1ZJ5A 1YHYA 4PD2A 1GL6A 3MQ4A 3SC6A 1S5PA 1J0AA 2ATXA 3EQ6A 2OV2A 4PPNA 3FFBA 4HLUA 5B3JA 4PYRA 1FTGA 2O2XA 5DHRA 2XAAA 5HKOA 2Z6QA 2A35A 2GKSA 4D9HA 1P4JA 2ZULA 3QPCA 4JYAB 2G1UA 1LPBB 1P7YA 1N3LA 1Y8AA 1KYXA 4IHAA 2ZT5A 4LWOA 4M0CA 2P0AA 4K81B 5J2TF 3PXXA 3VDRA 3ORSA 1U2SA 4QYWA 3MT8A 2YMLA 3HU3A 3PNYA 1IN5A 3M6LA 1AO3A 1QBGA 4CRWB 3SNHA 4U7FA 5K8LA 3OA0A 3RIHA 1Z6TA 2YHIA 3EG9B 3LCJA 3IQHX 2XTMA 4LHZA 4ZANA 2YFYA 3WY9A 3WISA 1E2QA 2OXTA 2EJSA 1V1MB 4H60A 4CT4B 2RE8A 2QXUA 2B1JA 4FGJA 2DGDA 1TB4A 3KEQA 5BSFA 3L41A 3RSFA 2WU8A 4DIOA 3GVIA 4HB0A 1J00A 1JHUA 1KYQA 3V42A 4A5OA 1YQ9A 2FEAA 5A02A 2Q6OA 1KPHA 4F4FA 1V71A 1F2UB 1QRSA 2B5OA 5B7QA 2YNMD 1MFPA 3TD6A 4KMMA 1NRXA 2EBHX 1KMIY 2GK4A 2CBGA 2FOLA 1PFWA 1X6VA 2PTHA 5F7JA 1IU9A 1XHEA 3O8NA 1GGHA 1I5RA 1NMSA 2XE7A 4Y2SA 3G1UA 2GBLA 1XEAA 4K6GA 5DHUA 4Y0AA 4G89A 5E7QA 1TUBA 1G9SA 1RYMA 3TO5A 2OBFA 3ZQ4A 2F5PA 1MB9A 5HBRA 3GLFA 5B55A 1YULA 1Z0SA 5EFZA 1I1HA 3UT5B 1GY8A 1E77A 5B7PA 1EX9A 1DADA 4RLFA 5K09A 2I6GA 2GFIA 1FX1A 2R6ZA 3TZBA 3I9FA 5KQMA 4J3JA 2C42A 4PWYA 1Q0LA 2LCQA 3TLBA 2CVFA 5ALZA 3PRKE 3NBQA 1OHHA 3EB9A 4ZU3A 1QHXA 4PCAA 7MHTA 2J5BA 1TO2E 2EZTA 5L95A 1CEXA 1XC7A 4JSRA 2OFXA 4JITA 1W49A 4X65B 3MEQA 5LDGA 3SS9X 1USKA 1COWA 2YMQA 2IE8A 1W73A 1M2WA 2VSNA 1BXGB 1YR9A 4XYEA 4LDAA 3BRWD 3DV9A 4ASUA 4NP6A 8LDHA 3EARA 5EVJA 1Y1TA 3AL3A 4WNAB 5KU1A 4W5TA 2PBFA 3SP1A 4CFSA 5GINE 2KRKA 3AXTA 3H9EO 1RRMA 2X41A 1WD7A 3NWEA 3OPYI 2X7XA 2ZSJA 1R4NA 8GPBA 3JAWA 5A3JA 1SC1A 2O3RA 2PX8A 5BNFA 4H0NA 3BIJA 4CT5A 4UBIA 1TPYA 4BCCA 2E4YA 3I76A 2TECE 1SUPA 3NWLA 5DHAA 2PVSA 4K5QA 2EZUA 3JZAA 5INTA 3I2FA 3I2YX 2KLBA 5FQNA 4NRWA 1SELA 3KKNA 5E6SA 1A9YA 1HOXA 3W34A 4URYR 5KHOC 4O2AA 1UBUS 3C5CA 1G8YA 1EH5A 2JY8A 3KJGA 4TTIA 4L1KA 3G8YA 3A9VA 1EK0A 3WL4A 3K7EA 3HQ4O 1Y1RA 1XTUA 4TT3A 2WI8A 3U3DA 3EIWA 4ZOLF 4QVKA 1FNBA 4YP9A 2VRNA 2IU0A 5ALQA 3ZDYB 1N8KA 2WF6A 4YCNA 4KHZA 2MH8A 4V24A 5DVZA 4ZT2A 1JGTA 1W88B 3PFFA 5LYJB 1CW2B 4HEHA 3C8DA 4KDEA 5HRAA 4KHPM 2ZB3A 2B37A 1GSIA 4R3UC 2HJSA 2FFHA 4WFQA 2ZBGA 3WQSB 4QDKA 4QNRA 4JJ6A 1P75A 3LUBA 4RCVA 4MNTA 3GMSA 4LGVA 3HU2A 2WZQA 2G71A 1E92A 2WG0A 1E8MA 2JZOA 4AY6A 3ZCVA 5HJEA 4KKXB 4CG2A 4LKOA 2EJTA 1T4GA 2Y2VA 3VHXB 3EGDA 2CDCA 3EMKA 5T3YA 4DLRA 1OV4A 4TZ0A 3G8AA 2CSUA 1SHZA 2RBKA 6NULA 2ZAOA 3LF1A 4QOSA 4O2LA 4B3TB 4MQFB 4LHYA 3LAWA 5EAIA 3WYFA 3HTXA 4JDPA 1SVNA 1UWLA 1USGA 5BSVA 3Q9NA 4L4SA 4X6UA 5GONA 3DR5A 1NVVQ 1K75A 2O8NA 5JHHB 3NXKA 2Z1MA 1KOJA 2OENG 3HGMA 3I5AA 1X7HA 1KL7A 3ICCA 2QY9A 3GDHA 1Y5NA 2H4WA 3HUUA 5KWVA 1T0BA 1MV5A 1GZ5A 3W1VA 4TVOA 3DW3X 2I22A 4Y2JA 1R5JA 1QIKA 4E12A 1DE0A 4B3IA 2VUHB 4Z5XA 4MGEA 3E18A 3UT0A 3DHWC 1O4WA 5CA1B 1SCJA 1R2QA 3TI9A 4LY3A 2RAVA 3W05A 1JS1X 1RQPA 3M2PA 2LHCA 521PA 2GXUA 1WCWA 3GDOA 2ZUFA 2DEUA 3UO8B 3OJEA 4JLWA 3W8RA 1F4VA 3L29A 3A0RB 3ZBUA 3F7TA 2V5AA 3DOOA 1MP0A 1H5NA 3WMEA 5JBNA 4P54A 4BNXA 1KJ8A 2IDKA 1BHJA 4G5YA 4H1TA 5H80A 3QU4A 3I5MA 1DBSA 1XZCA 3H4IA 2D7DA 5FV7A 1IK6A 2EAUA 2FAXA 1QK5A 2R8RA 3RFVA 1O94A 2G06A 4P38A 3D6AA 1RRPA 4PLTA 2EDAA 4B79A 1NOJA 4Q9JA 1FJGB 3Q6NA 4Q1VA 4BOYA 3QENA 3M3DA 3A1UA 1AURA 3L0DA 2YZ7A 2Q2EB 2QYHA 3E1KA 4GZ6A 6Q21A 5DO9A 3X1KA 5B2FA 4JJ4A 1MABB 2J4CA 4GYKA 3TZEA 2ZWAA 3S3TA 5CDFA 3N9IA 3L8YA 3NYIA 1HJPA 2QD5A 3KFUG 3O9VA 5IXYA 1L5VA 4OQ4A 3GLHA 4LX0A 5TMEA 3WLSA 2Y77A 1O3YA 3DA1A 4ZVKA 1J2JA 5A4DA 3OP1A 4ARBA 3RJ5A 2QRPA 2HM7A 4N7RA 5D5PA 5A04A 1E69A 4TM7A 1VKZA 1AKRA 5IJ0A 4MGIE 1A5SB 1BGWA 1QVWA 1P1KA 2DZOB 1H5QA 1QTQA 1BVYF 4J91A 3AEKB 4UHEA 3K5HA 4NMHA 3FH0A 1W48A 4AXXA 3E8XA 1TO6A 1K88A 5B64A 3L79A 2H9IA 5FTJA 4GOOD 1SEVA 1CIPA 2VZLA 1MB2A 3L0YA 1WBJB 1RXEA 1G38A 5HKKD 5HRCA 1W5TA 1TD1A 5IKXA 2B78A 2G9QA 4YACA 5JZSA 3BWXA 4MYTA 1ISGA 3FDZA 5FAXA 1SOUA 4JVSB 4Q1CA 4WBNB 4CMIB 4UUAA 5DT2A 3SE0A 3FXAA 3FZEA 4CIDA 4LTDA 4IS3A 1QIIA 2B92A 5BV1A 3PR3A 4QOZC 7MDHA 4H7DA 1U5BB 3IXLA 3RYIA 3OX4A 1OI2A 2QIOA 2E5LB 1XTPA 2ZYVX 4OAPA 4N0MA 3HSKA 2BDUA 3M33A 1JX6A 3K0FB 4MR8A 5BR1A 4HBGA 4LSMA 4KAJA 2I3GA 4ZVQA 2DKNA 4KPUA 2RHHA 3ETJA 4FE7A 1T9CA 1H1TA 2F1KA 1WRBA 2CNDA 3U1BA 1JSZA 2ZJZA 1KQOA 4JS0A 5DF1A 1DKNA 3Q2IA 4FCTA 1DHRA 2FMUA 4ZHQA 3L0CA 4MUXA 1YR2A 2GAFA 3WLTA 5IC4A 3VH3A 4DFDA 3DVLA 2JJYA 3C8UA 2GM5A 4Q3LA 1TMOA 2GM9A 3WOVA 4QOJA 1ZWKA 5JJ5A 2VPTA 1DAFA 4TZKA 2CMGA 3O03A 1A9PA 4WLNA 2PRYA 5C8XA 1W5EA 5ITWA 1GO5A 3EIXA 2HA5A 2X5OA 3LY5A 1JAHA 2Y1CA 1XZDA 4OHUA 1RYYA 4DHWA 3ZR4B 2AJDA 4O2AF 4FTWA 5AD1A 2VAPA 2FW0A 4EW2A 4EMSA 3EYWA 4I6GA 2Q8PA 4LSGA 5GVRA 4C7VA 3BGSA 1RXWA 4PRLA 1RMTA 2VJOA 1SB9A 3B1JA 4IVRA 4B09A 1JSLA 1M3SA 4QEZA 4DA0A 2GUWA 2C92A 4KFRA 3PXAA 2Q28A 1F0NA 1AIPA 5ILGA 1V5WA 3EEIA 2DWMA 4OK6A 1ZMVA 1FU4A 1HPLA 2WZJA 3V8NA 5AHWA 3OQMA 3HVRA 5DFAA 4I1VA 3CN7A 3RTAA 1YRAA 5E4YA 4LJ4A 1MO4A 5CEEA 1TM4E 4E08A 1DIHA 2H4JA 4RE6A 4MR7B 4PHCA 1YS1X 3UTDA 4CCSA 1NNI1 1IB6A 1X7GA 3DDNA 3W6UA 4CLOA 3CLRC 3PHGA 2BGLA 2WU1A 2DTEA 2AV6A 4HGOA 1WMBA 4BVAA 3SBDA 2JIRA 3QTTA 2EGUA 5AKIA 1WPXA 3FTPA 4U5XA 1V9LA 3PXDA 4J1TA 4B35A 4F6LA 5IT5A 3GFFA 3P1JA 1U94A 4UVGA 5IAKA 4HVLA 1MOQA 4JI6M 1BWPA 3MW8A 3FYTA 3MWLA 1L4HA 3R8XA 2ZRQA 5F2NA 4CKWB 2F9LA 5EIFA 2AJBA 2QN2A 1OFTA 3EUFA 5IEBA 4DIMA 3DEFA 3RABA 2XEPA 2GOYA 1QFYA 2EHJA 4DV7B 1EVKA 3OF3A 1NOIA 1N78A 2WD7B 3R5HA 3TDMA 1C8VB 1G8MA 4BNWA 4MK4A 2GNOA 3KJNA 5AKKA 3UQYS 4G2NA 4HRXA 4ZKDA 4CMBA 5BSEA 2C94A 5K9ZA 3IXQA 1X2BA 4PPYA 3IJ5A 1BIFA 1R0KA 3QSGA 2QTTA 1WXDA 3UICA 4LKRA 2ID9A 3PWKA 3WBFA 2PYIA 3AVVA 3EXHC 5DNUA 3OIDA 4JKIA 5JNRA 5DRYA 3ZZNA 2H08A 1V8OA 2PIAA 2O1SA 3GRFA 4GL2A 1TM7E 4FVTA 4GMKA 4KSBA 3MHVC 1FXUA 1MAAA 1DXOA 3N2IA 1E60A 3B74A 4CFZA 6LDHA 4MLPA 3ZC7B 2QPTA 2FOXA 2FZKA 3K9QO 3KTAA 1GPAA 3QLUC 3N6XA 2F8SA 3JPYA 1NJ1A 5GKNA 3I5XA 4FJ1A 1EX1A 2FJ0A 3L84A 1U2TA 3CE6A 4N3CA 3UXEA 3V80A 2ZXUA 3G2PA 3R0QA 4KIJA 2JJ1A 1LQTA 4KEAA 4Q1AA 3SFVA 2R7KA 3DQQA 2EWMA 1K63A 3OX3A 5CXSA 4TV8B 4LGMA 1QZ3A 2C1EA 1O6CA 1AO0A 2DPMA 1TK2A 3HVJA 4ZDIA 4AO7A 3S8EA 3CLSD 3VPHA 4RGVA 3S8YA 5A3SA 1DJNA 4PQYA 1N2IA 4BUJA 1L9XA 2NAPA 4MUAA 4QUDA 4G5FA 5JZOA 4XQ0A 2PJZA 2XMSA 4R2JA 1NSYA 3PE3A 1QTNA 2O2GA 2Z56A 1UCFA 2GHTA 1DWOA 2B9EA 3D1VA 4W8OA 4INOA 1GYRA 3PCRB 2REQB 1JFRA 1M0WA 2QRQA 2BFOA 2JI9A 3UJ6A 3GO8A 1XCLA 1A72A 1T6NA 1CP3A 1OB5A 1OR8A 4E2YA 2R8BA 2DU8A 2WP8J 1P7PA 4X92A 4V3BA 3HB1A 3C15C 1WUJS 1XZNA 1U2PA 3ZDQA 5FSWA 5KYYA 4KVFA 2F43B 5ESWA 4BEVA 2P9QA 2X2OA 4H3KB 2EW2A 1ACJA 3KQWA 1TOAA 4K87A 4I8IA 3GDWA 2VJBA 2PUAA 4NYJR 1ONPA 1SURA 3CEJA 1I0LA 1EVYA 5KVVA 1YS2X 3C7CB 3L1JA 3I0ZA 2Q5IA 3WQBA 1C81A 5A06A 2ZITA 3I62A 4GOND 3IAS1 4GM4A 2PXXA 5I9BA 4LOIA 1IHOA 4B6PA 1QU2A 2H17A 2VAXA 4RTQA 4LXQA 5DWQA 3HHWA 3U4AA 2PX5A 2FZGA 3BIXA 2O1XA 1G1AA 1KETA 4I4NA 4QLAA 4JLNA 2JLSA 3HDYA 4LHWA 2SICE 5E1OA 1NUPA 4Q9HA 4ZCSA 3PYLA 1ZEMA 3KHSA 2MROB 4L02A 1QF6A 3FA2A 1CZRA 1KQNA 1E8NA 2BELA 1IK4A 2R7MA 4I4TA 3WHIA 4ZHQF 3PF9A 2ZROA 3CLHA 2E5FA 5KIAA 4KL8S 4EY7A 2NXCA 3KUDA 3HVUA 3G85A 2J45A 3H3FA 3VR5D 3FDXA 3M9XA 3TRKA 5A5DA 3JS5A 4JMPA 1E99A 4IGKA 3D4PA 4MWDA 3LBYA 1VCIA 3LP8A 4DNPA 3F1LA 1XDWA 3T12A 4BWGA 1G55A 2Q46A 3ICQB 3GLIE 4UASA 4MB0A 4UMVA 5T41A 5CB4A 2QY6A 4H3SA 4L4UA 1V45E 2H9AA 5TT1A 2DUMA 3WXBA 3AZQA 3LUHA 4WURA 1Y8RB 3E2MA 2YVAA 1KH1A 1ZD3A 4J0HA 1VMEA 1IXSB 1L6RA 1SG6A 4D46A 5CUQA 3W90A 5E3HA 3DKKA 4Z0HO 2ANCA 2ZUTA 1Y8GA 2AHMA 4LXXA 3NKVA 1A5TA 1SKAA 1AB5A 1O57A 3DUFA 5EJCA 1XWWA 1BFDA 5JC8A 5A9SB 3DEKA 1YE3A 2CK3D 1H6CA 4MA0A 4MI9A 2CP8A 5H81A 1WEHA 3TGPA 1PGOA 4K1LA 1KSFX 3ETNA 2J3IA 4CL8A 1ZCJA 3D3EA 1E64A 1Z08A 3RGWS 4W6ZA 4ZYXA 4B34A 1KJJA 3WP1B 2ORIA 4LC0A 2UUBM 3QXJA 2V0NA 1KAHA 2PUWA 3HWX1 1E3QA 4KO3S 4KLZA 4II7A 1FS4A 4NBRA 1E5DA 1QG0A 1V8FA 3TX6A 3MWYW 3HZOA 4IQFA 4Q3AA 2WMYA 3H9QA 2AFIB 3BQ9A 2WM2A 3MA0A 3A1NA 2P6NA 2MWMA 5FL3A 4RLSA 2EA0A 4JI8M 3QY9A 2P41A 2EFCB 1W2WB 4FOLA 1ABEA 2AOUA 1YRLA 1V43A 1UMKA 4UUOA 1EESA 1P39A 2J0VA 2VNSA 3D8HA 2MDTA 4O33A 1T9GR 2PRZA 1U6JA 2VCEA 2EYQA 5DXAA 4RKWA 1RYBA 5G41A 3I4VA 3GQBB 1I6LA 4G09A 3TIIA 4F9TA 4RLQA 3AIIA 1AF7A 1E6UA 3GPUA 3MFQA 4ZJZA 4Z7QB 4JGBA 4HWSA 3ANSA 4N8EA 4OM7A 2O2JA 1AK9A 1JQJC 3ZCTA 4WFIA 1F2TA 1X7XB 3I9JA 3UK0A 2Y6VA 1PKEA 1GO2A 2IEYA 4WTOA 5BQPA 3UAWA 4WOBA 2JHFA 3FNBA 3TQHA 4RTJA 1HDOA 2H3EA 1OPRA 1ZC3A 1B8UA 4DUZM 4EP1A 3CRW1 1CUDA 3GFGA 4KFSA 4X54A 1YHZA 3DE2X 1T4MA 7GPBA 3I9NA 3LV8A 3MELA 1HL7A 2PRIA 3N8HA 2Q6TA 4FUTA 4OUDB 4IFBA 3LCCA 3D0OA 2WWXA 3RS9A 3KU1A 5LOVB 5A5FA 3FLMA 2WYUA 2ORYA 3FGZA 3LL4A 1RCUA 1M6EX 4YJDA 1TI7A 4ESHA 5COAA 1K8XB 5IVIA 2AQ8A 3LH5A 4YXFA 3MTQA 5KNDD 4GS5A 4UNSA 3JU3A 1K9VF 1MEEA 1XQXA 4NV1A 1AQIA 2G36A 2SCUA 3UB3A 4FWBA 1QE5A 2GEFA 1X9HA 4I9GA 1Q1AA 4D97A 1SCIA 1E5TA 3WGYA 1GUBA 3P9PA 5BPFA 1Y8QB 3KKOA 1UF9A 1VIDA 2FXVA 4K2HA 3HU5A 5LXTA 1U1EA 5DCYA 1PQPA 2OGUA 5EP2A 5SY6A 3KYJB 2FOIC 3EIQA 2WM8A 3QJGA 2NWQA 4F7DA 4F5YA 2H4ZA 3NDRA 1XOIA 1E2IA 3NORA 1S0UA 1L7NA 5FNVB 4NYMR 5EC8A