4AG6A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
384
structure length
373
Chain Sequence
SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRPQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
total genus 132
structure length 373
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag6A01
5DISB 4A8JC 3IO5A 3AVWA 1P72A 3BS4A 4C4PA 4ZDIA 4F7WA 1J99A 2QI9C 4S2EA 1W5TA 2ERXA 1QHHB 2WJIA 4AG5A 3TVDA 5EE3A 2CBZA 3OEED 4DZZA 4WZBE 4CT4B 2FZLA 2H92A 3VR5A 2LKDA 4WA7A 2R6DA 2ZI9A 4IKEA 4G5OA 4XD7A 1RKBA 4BLTA 4MGKR 5HR5A 4C0LA 3AF2A 1E2QA 2WAXA 2WMNB 2YWEA 3C14C 1G6HA 1U99A 4NYIQ 3BERA 2IUTA 2KI5A 4Q7MB 3CX6A 3IKJA 1AKEA 2W6JD 4OQNA 1XTSA 3KQLA 1WB9A 2K5UA 3VFDA 4HLUA 5LD2B 4OYHA 5KSPA 4Q1EA 2BDTA 1LS1A 3QG1A 2PL3A 4JLKA 4JJZA 1Z0DA 3AVPA 2PT7A 2IYUA 5FR1A 2HEIA 1SVSA 4WOPA 1ANKA 1T3SA 2D74A 3QENA 4C30A 2YHSA 1OH6A 4AKHA 1LFDB 5FOUA 4PPFA 2F9LA 1MABA 4OHYA 2HT1A 4JYCA 1II9A 1OFUX 2AK2A 2W0MA 4HLUC 1OPXA 3ETLA 2FPLA 4NCKA 3BIFA 3NG1A 4RD1A 3WP0A 3DZDA 1PUJA 1DAMA 4EPRA 4YXWD 1S3GA 3P27A 2ZPTX 4LY6A 2WWWA 3MRSA 5K8TA 1EESA 3GLIB 1E9RA 1G4UR 2GCOA 4KLZA 1X8LA 1HH4A 2AKAB 4G1UC 4LHZA 1I2DA 4EPWA 3MSXA 4TTPA 2PMDA 2JJ1A 2Q3HA 1E2HA 1XFAA 1GSIA 2JIZD 3T61A 1SULA 3KKMA 3C8UA 2DFNA 4KODA 4MGIR 5HKKA 2BCJQ 2VHJA 3RLFA 5JHHB 1NLZA 2NO0A 4D4KA 4Q66C 2QY9A 4NKRA 3ASYA 4H9GA 5EUQB 4M8NE 3RRZA 1ESMA 3SYLA 2QPOA 3RWOA 2GJSA 3B82A 3K1JA 1E1QA 3LVRE 4UNQA 2ORWA 3GP8A 3E5HA 3ONWA 4N1AA 2C77A 2DWOA 3KFVA 4LK2A 3KUCA 4X8OA 3BC1A 4JL8A 4M1OA 4OK3A 5FI0B 5FPTA 4BECA 2ZE6A 1E0AA 5JECA 1JB1A 1E9FA 1B23P 2WPDA 5A0FA 3NVAA 3EC1A 4IJMA 5FTMA 1ZNWA 1XD2A 2VBCA 2O8FA 1CBUA 4NU0A 2RHDA 1WDTA 2GF0A 3QNUA 4H1UA 3ZS8A 3K0FA 1XJ0A 1QDEA 5JCPA 4TTRA 1OYYA 2VP2A 2QPTA 1KY2A 5GVRA 4C0SA 4Q18A 3LX8A 3AF0A 3K70B 3UMRA 4MKFA 3V9PA 4URXR 2O5VA 1WP9A 3EXAA 2ZE5A 4HUQB 4HYYA 1CKEA 3LLMA 3HR8A 2ZR9A 1NMXA 3JZMA 1GL6A 5FH9A 1SGWA 2OCAA 2X1VA 1CJKC 2C95A 4XOIA 2OCPA 1DAIA 3RRMA 3PEUA 2ZXUA 1Z8FA 1TNDA 1J90A 1M34E 2F6RA 2JLRA 4IVQA 1OH7A 2VP0A 4TYPA 3A58B 1KI2A 5FBQB 1FX0B 2XEXA 4LYHA 4HUTA 4Q03A 1FFHA 3T1QA 2QPAA 1CR4A 1U0JA 1MO5A 3LV8A 3TQFA 2MSDB 1ZM4A 3TUZC 1KJWA 1TL7C 3AVOA 5JRZA 1KK0A 1XP8A 4NHOA 4ZKEA 3PUXA 4XVQA 3GLFE 3NTUA 3SHWA 3FDIA 3R7WA 2F3RA 2FF7A 1N6IA 3LXXA 2IW3A 2ZRIA 4Q9LA 1GRNA 2RB4A 4ERNA 4Q1BA 5JEEA 3I73A 1G16A 3AF3A 3X1ZA 4HLQB 4JT4A 2WWHA 4NYJR 4XTCS 4US1R 1EX7A 4JJKA 2QQEA 2CVHA 4M0LA 3VHXA 5L8VA 1E69A 2HYIC 3RHFA 1Z0AA 1R0WA 2LCFA 4K46A 4KFRA 4LJ8A 4NCHA 1YZGA 3MCAA 5UKDA 3THYB 2ONKA 2IUSA 3R9IA 3I5XA 1KMHA 4EFNA 1CS4C 1HE1C 5CDFE 1E1RA 1JQLB 2A78A 1R4AA 4FD2A 3GJ3A 2QL6A 3RC3A 1PLLA 3GFTA 2XSZD 2ECKA 1JJ7A 1HT1E 4D6PA 1RJ9B 4RZ2A 1S1MA 2VLIA 4MUBA 1BYIA 2DYKA 4L9SA 5CJPA 4QGGA 3N70A 4ZCIA 3AP2A 1DG1G 4DDWA 3U3OA 3UKDA 4DT1A 1HE8B 1ZVQA 4EFLA 2HF9A 4RD4A 2RGAA 1GKYA 1D9ZA 1Z28A 2KE5A 4CVNA 2ZU6A 2XZLA 3GLHB 2KSQA 2V4ZA 2ZROA 3FYHA 3AM1A 3IQXA 2QAGB 1M7HA 4HAXA 1XXHE 4TYQA 2FPKA 5FOWA 2BEJA 4Q4HB 4RJLA 1XZQA 3DMDA 1UBCA 1ZUNB 2ATXA 4A2WA 1KTVA 4EJSA 4ZI2A 1S9HA 3FTQA 3LLUA 4BWYA 4DC9A 1JEDA 1EX6A 1VHLA 2ZJ8A 4U5XA 4BLPA 1KNQA 1XX6A 2LKCA 4IOKA 4F4CA 1GVNB 1L7VC 2VF7A 1IY2A 1TQDA 2BM1A 1S9DA 4HB0A 3NBZC 4DUGA 3EPLA 3CW2A 2BEKA 1J8MF 3U44B 2VRWA 4ZIRB 1DO2A 4EKDA 1XEWX 2WJGA 4TYNA 2C04A 5KU1A 4EJSC 4Q01A 2GWHA 1FMLA 4DSUA 3V4RA 5DE3A 5DLQC 1E2NA 4C0HA 4EFMA 2ZJ5A 1OIVA 4IDOA 5C2JB 2JASA 2YJTD 4BEBA 1E4YA 1N6KA 2ODBA 4FCWA 4JLBA 4PAOA 1T8TA 4QG7A 2A7QA 2XXAA 1M1YE 4US0R 5EUMA 4MITA 4C0QC 2GESA 1GIAA 5FR2A 2AD5A 4IDNA 4E5UA 3PJRA 2WM9B 2OXCA 5EP4A 4HAVA 4FN5A 1Z63A 2QEQA 5KOYA 5D3MB 1CR1A 2GAOA 4Y0AA 3VAAA 3SBDA 2QTHA 4MKHA 3TSWA 3DDCA 4OQFA 4K8OA 2QP9X 3T1OA 1WCV1 4M1MA 3T34A 4A0GA 3E2IA 4RD3A 2FDCA 2QE7D 4LBVA 2HV8A 4BPBA 4KITB 2ZYUX 1ZYUA 1Z29A 2XTZA 1A5TA 3IGFA 3X1XA 4ESVA 1FNNA 2C8VA 2P3SA 4R2IA 1EWQA 1ZMXA 1EGAA 2YVUA 2R8RA 1ZM2A 4ZPXA 3WYFA 1ZNXA 2DY1A 3U7GA 4O3MA 3EZ2A 2XITA 3IDQA 1AZTA 4BLRA 4C0BA 4GP7A 4CW7A 4MRRA 3GCGA 3EC2A 4KFTA 2FFQA 1JR6A 1JAIA 3RSLA 5EP1A 4RFVA 1YZLA 3OAAD 3W3ZB 2WICA 2XTMA 3ADCA 2QT0A 3F0TA 1KOFA 3PUYA 4JYBA 4PSKA 5AUNB 4C7OA 2C99A 2OBNA 2BC9A 4P0TA 521PA 3I62A 1NY5A 2YC4C 3RS4A 4LUCA 2KWIA 1S1CA 3E70C 3QE0A 4TN1A 4KLNA 4M53A 3ZVLA 4EPVA 4AKEA 2GAAA 1UJ2A 4O2LA 3A4MA 4P3YA 1W4AA 3KFXA 3QBTA 4AURA 2BM0A 4YONB 1G3UA 1YRBA 1OW3B 1HV8A 3VTKA 1QZXA 1UM8A 1XRJA 4KVGA 5FOVA 1KK2A 1Z0FA 2VHUA 4PC7A 1OH5A 2GBLC 4ZCMA 3EX7C 4URVR 2OM2A 5F98A 3MWLA 1E2JA 4JVLA 4LHWA 4Q00A 4BFSA 1XTKA 3QG5A 4NYMQ 2IXEA 1P2UA 4QBHA 4I1VA 3OEHD 4IHQA 2Y8EA 2ZIAA 2XAUA 3C4JA 3F8TA 1OKKD 3LBNA 3VR2A 1HYQA 1KI9A 1NP6A 3QXSA 4OI2A 3U61B 1R8QA 4OK6A 3ZJYA 1W4CA 3QKRB 2Z5FA 4EPTA 1RPZA 3P4XA 1T9HA 4V0MA 4MDEA 2ATVA 3EPKA 5CIWA 5FPHA 1PZNA 1VYUA 4QBFA 4TYWA 5KNBA 4YMWA 5C4MA 1E0SA 1Q3TA 5B30A 3LAWA 2OZEA 5HCNA 2IS4A 2HUPA 3BH7A 5FTLA 4PZLA 2ZYTX 3AVXA 4XSHA 3KXLA 5BN5A 3B60A 2C98A 1NMZA 4TQUS 3LBHA 1AKYA 2Q6TA 5LB4A 3ZD6A 3VR1A 3ADBA 1UADA 4NONA 2BMDA 3KTAB 3OZXA 2ANCA 4KAXA 4ASUD 3AH8A 3G5UA 2CK3A 1BIFA 5BWMA 5CK4A 2OE2A 3G0HA 1VYVA 2B8TA 1LNZA 3RSOA 1XPOA 1Q20A 4OHWA 2FE4A 2N1BA 4HSEA 4PZYA 4OQXA 3MG9A 3SJCA 3W6OA 2IT1A 2DWPA 4CT5A 4Q4LA 5HZHA 4KHZA 5EE9A 2Z4RA 3TK1A 3PITA 3H4MA 1JALA 2WSSA 3Q5EA 4TSFD 3RS2A 1SVMA 3I4LA 1XTJA 2QGZA 2RKOA 1E2PA 1TF5A 3UPUA 2QMUA 2O0KA 2RCNA 1KK3A 3A37A 1FTNA 3AF4A 3TQCA 1CU1A 3GEHA 3OHMA 3W3AA 4KBGA 3I92A 5L3RA 1Z0JA 3THWA 5TXGA 2OCBA 2R6AA 3EAQA 2XX3A 4TT3D 5DYGA 4ZKDA 3KJEA 1OXTA 2J45A 2BHRA 2JATA 2VTKA 2O8EA 2IWHA 3ZLJA 2PH1A 4QXAA 3CR7A 2EWVA 4TL8A 5G3ZA 2BJVA 4OK5A 2J87A 4WZAE 3U6KA 1GAJA 4LBZA 2GXAA 4P4SA 3GJ0A 4JVMA 5TDHA 4EUNA 1V43A 2GEDA 2IYSA 2HLDD 4BLQA 4FMCF 1TAGA 5IRCD 1IY1A 2B7BA 2P65A 1ODFA 2VQSA 2WOOA 4QHYA 5L3SB 1E9EA 2IS6A 4A92A 1SXJE 1ZIPA 2C9OA 3SC3A 3ICQB 4DSOA 1QVAA 1TU3A 5IHPA 4A6PA 1G19A 2NQ2C 1CJMA 4PC3A 1KY3A 2YV5A 3U7FB 4B48A 2ZRMA 1MO3A 1MV5A 2YC2C 4YMSA 1ESNA 4B32A 1R5NA 1MO4A 1E79D 1N25A 1HEIA 2EWWA 1ZNYA 4PHFA 5CM9C 5J40A 3WBKA 2ZE7A 4LYAA 3ZGXA 1XCPA 1E9DA 4Q9KA 4Z1MA 2GZAA 2IXFA 1W36B 4HLDA 2QU8A 4I1SA 3H84A 3GLGB 5EE1A 1UEJA 3VX3A 2ZS9A 1X86B 4B74A 1E6CA 1KGDA 4JVSB 1M8PA 4FW9A 3W8RA 4DB2A 1SXJC 1OE0A 4HDCA 3TR5A 3TGPA 2DPXA 5AK0A 1XEXA 3MWKA 1NNEA 3M0EA 2NMVA 2CJWB 3VR6A 2JDID 4LHVA 2B7CA 2QSZA 1A7JA 3FFAA 1CRPA 4GNKA 2O8BB 1NN1A 3HJNA 4PX9A 1C4OA 4Q7LA 5EZ5A 2JLUA 5EXSA 1JR3E 4TMXA 5FOSA 3IEVA 2IHBA 1OHHD 3KKPA 4B35A 1RRFA 3MWJA 1C1YA 1RVDA 4LCBA 3X1WA 3WNCA 4DLSA 2WWXA 5J4HA 2O8DB 3NHBA 3SHFA 2OBMA 3QVUA 1VDZA 4RVCA 3ZS9A 4Z54A 3B1ZA 4FMCB 1F3OA 2WSMA 2WZQA 5BN4A 2QN6A 5FBWB 3FKSA 3QKSA 1IJEA 1E9SA 4YDHB 4MGYR 2GEVA 2BBOA 4EPXA 2P6UA 1U0LA 2JLXA 1VIYA 3QPWA 4TL6A 4BEJA 4QKQA 2R6CA 1Z3IX 3UXMA 1QHGA 1DBSA 1RW4A 2XOKD 1M7BA 2F43A 5AUQA 2IYLD 1L4UA 1L4YA 1P7CA 1N6LA 5KTYA 4CEJA 4MRSA 4M9SA 3NC1C 4BE7B 4DIEA 1WRBA 4IRUB 4R9UC 1PLKA 3U3MA 3EZFA 4DLZA 4W5WA 2GZHA 3BB4A 4EDHA 2GNOA 1Z83A 1T4GA 1YRAA 4E09A 3ICEA 5H68A 2CDNA 2PT5A 3BFVA 5BXQC 1R0YA 4D4JA 2AN9A 2NZ8A 2D2FA 3AVVA 3J81k 3D6TB 3LX5A 3GLIE 4A6XA 1HT2E 4LJYA 2RGNA 4DCUA 1BH2A 1GKIA 1DAGA 4V02A 5JRJA 2OAQ1 2REOA 4US2R 4V0LA 5K8LA 1TUIA 1AM4D 4BLSA 2GZDA 1X1SA 5AR1A 3ZQJA 1OB2A 2IUUA 2VIIA 4HAUA 3UATA 5M04A 3HDTA 1P9WA 1YZNA 3H0KA 2GETA 2PLRA 3NEYA 1ZBDA 1WQ1R 1COWA 2P0EA 4QNMA 1EWRA 5AJVB 1UBFA 2ZAOA 4A0RA 1I4LD 1ZRHA 1GTVA 1ZJ6A 4JLJA 1VG0B 2GKSA 2JJ1D 1ZD9A 3QUSA 3ZZUA 2ZJAA 3IO3A 1N3BA 1R0ZA 3NBXX 4B3FX 1G64A 1S3SA 4URWR 1UKZA 3K0CA 4UXJA 5AJXA 3WNDA 1IM2A 4QBIA 1TU4A 3WY9A 4A2PA 3L0PA 4EQ6B 4G5SA 1VTKA 1S96A 1B0UA 3MUFA 4Q4JB 1W4BA 3IIKA 5FUVA 3U6BA 1E1QD 3ZH9B 2P67A 5CLLA 2AK3A 2FEOA 1J7KA 1FPMA 4QOSA 1KI6A 4PTLA 5EZ6B 1OH8A 1FMJA 2ASEA 3QBVA 4JL6A 4A8JA 2ZJ2A 1MT0A 2WPDD 1EFHA 2DR3A 2CCJA 2PLFA 4Q7KA 1DEKA 2QMEA 1DAKA 1G7SA 2F1JA 3LNCA 2G9NA 2OBLA 2V54A 2N42A 2X77A 3KJIA 4R7ZA 2AX4A 4URYR 2FA9A 4HUQA 4M1SA 3I5YA 2V7QD 1K8RA 1X8JA 1NBMA 5BQ5A 1FOEB 5KNDA 3NBFA 1W0KA 4L4UA 4LPKA 4W7SA 1ZU4A 3DPUA 3K70C 4B2PA 1S8FA 3O8RA 1E2FA 2P6RA 1XMIA 4JIMA 5DI3A 2JLVA 1OFIA 4CF7A 3T1VA 3Q3JB 2BCGY 3S1AA 4D0GA 3HYTA 3I8XA 3DMNA 1JNYA 3BFXA 3B1XA 3BB3A 1KIMA 5CB6A 3BWDD 3THXA 4H1VA 1E0JA 2HYDA 3DKVA 3CZQA 4PC6A 2A5GA 3TLXA 2W2XA 1LVGA 3SJZA 4BFZA 3F5FA 2ZQ5A 4AC9A 4PPGA 3W8NA 4XIGS 4JBWA 1KI4A 3CF0A 2ONJA 5F3WB 2OAP1 4PHGA 4AYXA 3I32A 1OXSC 1WBDA 3WYAA 2QBYB 2FFHA 3VNVA 2F1IA 2G3YA 4RZ3A 2OLKA 1L8QA 2NO1A 2D7CA 3ZQ6A 5B64A 2IYXA 1JQJC 4AY2A 1FNMA 4UJ3A 1YR6A 1WXQA 2ZI3A 4KXFB 3CX8A 2ODWA 2YNMA 4GL2A 2CMKA 1G291 5TARA 2C03A 3SYKA 2ZUCA 4IXMA 2VHCA 2OXRA 4IDHA 2KJQA 4LJ5A 2ZANA 1M6NA 1TF7A 4BRUA 3SOPA 3AKYA 4G5RA 4N3NA 3TNFA 2QM7A 1CJTC 2A9KA 2QENA 3SS8A 4B47A 5K8IA 4L5BA 4DDTA 2J7PD 4B3GA 1PVOA 4TLDA 4W5HA 1PJRA 1A2BA 1E1RD 2Z43A 1RJ9A 3L43A 5AWFC 2DB3A 1RIFA 4PQRA 5DN6A 2WTUA 4B76A 3BJIC 2J1LA 3GLHE 5EE5B 2C96A 2B21A 2QM8A 3CPJB 1G5TA 1RFLA 3VKWA 4QGHA 1T8UA 4NCJA 3TR0A 4MYUA 4D26A 4A36A 4B73A 4UQOA 2XZOA 1X8KA 4UJ5A 3O8DA 2ZS7A 3TUJC 1BKDR 3HU2A 1VG9B 4JMPA 4M9ZA 4C9BA 3X2SA 5CYPA 3KB1A 1Q1ZA 4FCTA 3GQBA 4BZQA 1U98A 3SE0A 2PBRA 1Y3AA 2ZUBA 2QSYA 1K6MA 3CBQA 3P4YA 1YZTA 1KO8A 3DOEA 3GD7A 3A1TA 4EIWA 1W0JA 4B75A 3TH5A 3BAFA 2IF2A 4ZDJA 2QAGC 3GMTA 3NDBB 3VMFA 2OFWA 5DSZA 1IXSB 3I1FA 1NVVQ 1I4TD 2GTPA 1CEEA 3IHLA 4RSGA 3T5GA 4DLWA 1IN6A 1YZUA 4DUGD 2X2FA 4QBGB 2BKUA 3UIEA 5L3QB 4A0HA 4PC1A 4URZR 4BZXA 4RD0A 4LJ7A 4Y0VA 3FWYA 4NYIR 1E98A 1D2MA 4PAQA 4GOXA 4R71A 4HB2A 1SVIA 5KSYA 4IOLA 2JLYA 4A0FA 5JSZB 3HU3A 4PPNA 2FFAA 1R2QA 1F2UB 3TRFA 3PENA 2YOHA 1Z2CA 4Q4AB 3SDZA 5B58C 3N2IA 1Q1EA 4JS0A 1A4RA 1II8B 5KO2A 3KUDA 4UXHA 2ZI4A 3SQXA 3KQHA 3SU8A 4QJ4A 1QRAA 2D62A 3PXGA 4OJKA 2IYWA 3OEEA 5E7MA 1CULC 1OFHA 5JMTA 1GUAA 5IF9A 1A82A 1GRRA 1W2HA 2GVDC 4GZLA 3D7MA 3I8SA 3WMFA 2Z4SA 4OI0A 1E9AA 3T1TA 2R65A 1WF3A 3IBYA 3GLFA 2JLSA 1P3JA 5C1BA 4XWKA 1R5OA 4D80A 1LW7A 1HQYE 1G18A 1XCGB 4XVRA 1Z6AA 4WW0A 3GJ5A 2W6JA 1U9IC 3UG7A 1QHIA 4KO8A 2RH5A 3UK6A 2EFGA 3K9GA 4NP6A 1ZCAA 1G8FA 5CM8B 3O8CA 3REGA 2J0UA 1KDTA 3A1VA 2A3RA 4IEEA 3NEJA 2W6ID 3JVUA 4MQBA 4EAQA 4HEJA 5JCZA 1FP7A 5DGXA 1E3MA 1MOZA 2A30A 1ZD8A 2D06A 5IT5A 3EA0A 4Q19A 3RDPA 4BFXA 5HCIA 4YQFA 1Q22A 721PA 3RRYA 1CJVC 4L16A 1NY6A 2OESA 5G3YA 2CNWA 2NO9A 4M22A 4YXWA 1R10A 3RAPR 5CDFA 4V0OA 4AD8A 3PEWA 1W36D 4I1UA 3QKTA 5FTNA 2BBSA 4CEHB 5FBVB 3X1YA 1RYHA 3Q7QA 4LGMA 1MH1A 2N46A 3B9QA 2PCLA 3W6NA 2GXQA 2EYQA 4AYWA 3X1DA 1LF0A 3LO5A 3LVQE 221PA 3KL4A 4GI7A 2IYTA 3V4FA 4MYCA 2Q3FA 1UBEA 3B1YA 2WKRA 5GVSA 2J41A 4HB3A 3QEOA 4HZUA 4DSTA 3WMGA 1DO0A 2ZI6A 1IBRA 1DAEA 2QG6A 5DH9A 1BOFA 2PZGA 2ZSAA 1G7TA 1N2CE 3CUEF 1EFTA 1UKEA 1ZIOA 5B2ZA 1E99A 2FMXA 1F48A 1Z6XA 3BOSA 1DTSA 5E4FA 1GG2A 2D4HA 3NDPA 1XXHA 1U8YA 1N6PA 2H17A 2AL7A 2CCKA 2QAJA 2W2VA 4ACBA 1FL9A 1GITA 3WRXC 4QJ3A 2CLSA 1I4DD 3KX2A 4Q9HA 2YOGA 4P32A 3IHWA 3WHLA 2VL7A 3PVSA 3CRMA 4OBEA 1G41A 1CIPA 2FSGA 2OSBA 1ZD1A 4B6EA 2IBMA 2VO1A 1I2MA 4JZKA 2MMGA 4MRNA 5LBIA 2WIAA 1XD2B 1P73A 1LTQA 2P2LA 3OF5A 4GRAA 1P4SA 1JJVA 2GK6A 3HWSA 1UEIA 2OILA 2CLCX 2F1RA 3T15A 4B34A 3IEUA 4LDJA 1KAOA 1G21E 2WJVA 5L3VA 3VQTA 3K09A 2IA5A 1OT3A 4NCIA 1C9KA 1NVUQ 1AGRA 1Z22A 1VG8A 2PEZA 3ADDA 1OIXA 4LJ4A 4V0NA 4E22A 1EFUA 3TJZA 4QL3A 4V0KA 1NG1A 1FTSA 2GHIA 2ODNA 1XMVA 3FHCB 1R0XA 1T6NA 3TBKA 3U3KA 1ONBA 3MLEA 3VKGA 5FBRB 3SQWA 2CHGA 3TKLA 3B7GA 3K09C 3L82B 3WHKA 4ARZA 4JKYA 1NN3A 2IEYA 5KDLA 2HJGA 1XCMA 2YINC 2CHQA 5JI2E 2O0HA 2WSSD 1VKJA 1VHTA 3R8CA 2BMEA 2VF8A 1UDXA 3KKQA 2R44A 4K81B 1XPUA 4M1KA 3VX4A 1GFIA 1IJFA 2QRZA 1G7RA 4JBYA 5DNYB 1ZUHA 1P2SA 3BXZA 3W34A 5EXTA 3OE7A 4XWOA 3DM9B 2UZ3A 5TVKA 3R7WB 2X2EA 3KJGA 4RFSA 3R20A 1OSNA 4AIIA 1SKYB 1E2IA 2ANBA 4D0NA 2CHVA 5J4LA 3CRRA 4C2TA 4FCVA 4CEIB 4X8MA 1XMJA 3U3JA 621PA 5JS7A 2CVFA 5A4JA 2C9CA 2HXSA 2GBLA 1SHZA 4C0JA 2C9YA 3PEYA 5E3HA 1QHYA 5KSZA 1JEEA 1N0UA 4MRPA 1KMQA 4PZZA 4HDOB 2VSOA 3K0AA 2EFCB 121PA 5EJEA 1RZ3A 3U4QB 5H1YA 1E96A 4KI0A 5F2EA 5JBQA 4BASA 2PMKA 3GLGE 1NSTA 3I61A 1DADA 3GJ4A 2Q9BA 3A36A 4A9AA 1AS2A 2WWIA 4Q1DA 3D31A 3KKNA 3OIVA 1FQKA 1TQ4A 3L0IB 3D8BA 2YWFA 3T5DA 5FPKA 1T0JB 2OFOA 2O8CA 4OI1A 4M9XA 2JCSA 3B78A 2H57A 2QA5A 2FOLA 1EFCA 2RGDA 3D3QA 5FFMA 2KBFA 4NBSA 1UBGA 4HAWA 4JKIA 3A4LA 1XWIA 4KFSA 1E2KA 2J3EA 4BFYA 1US8A 2BMFA 4KV9A 2UZIR 4DT1B 3EZ6A 2ZYVX 1AJEA 3TIFA 2ZRKA 3REFA 4QRHA 3TAUA 4E07A 3W6PA 2BJWA 2J5XA 5IK2A 3BH6A 1IXZA 5G53C 3DZ8A 3IIJA 2FN4A 3NWJA 4XVUA 3PUZA 1QHNA 3A1WA 4XSGA 3SI7A 4TZ0A 1F2TA 1Q0UA 1Q12A 3CH5A 4A15A 1VCMA 2WWGA 2V6IA 3H1TA 2PZFA 3DVLA 4Q9IA 4LHYA 5TY0A 4D2IA 2EW1A 5CB8A 2QZ4A 4PO1A 4BLOA 3AGQA 3QF7A 1NL3A 2G88A 3LD9A 4TMVA 1VECA 1W44A 4YMUA 4RZUA 4QHSA 3BB1A 4CGZA 4N0DA 2ZETA 4IVPA 2REBA 2V55B 5FTJA 3L8ZA 4ON9A 3NH9A 3P26A 4M21A 1LY1A 3ND8A 3WXMA 1GM5A 1GOTA 2NGRA 5KHOC 1N6RA 1RRPA 1SVLA 2DWQA 2A5FA 3NIBA 4GOJA 1E2DA 1R8SA 4NMMA 4F92B 3AQ4A 4A1FA 2J46A 1TEXA 4JLNA 1QG2A 3WMEA 1EFRD 4B3DA 5EXXA 5J4VA 4KJZA 1OXXK 4TLEA 2JA1A 4HI0E 2WBLC 1JXOA 3FFBA 5LB2A 3EA5A 4DCVA 1RRCA 5DI9A 2PJRA 4QGFA 5H70A 3FMPB 1XEFA 2QE7A 1D6JA 1W4RA 2PJZA 3FB4A 1IONA 4CYMA 1CTQA 4GT1A 3KXKA 2RHMA 1JBKA 5EQTA 3ZYCA 1LB1B 1FW6A 5BYKA 3THOA 5GADl 5KUTA 3VU9A 1UKYA 4EPYA 1O87A 1GZSA 2KB0A 4B3CA 2Q0HA 3ZVNA 3SN6A 3CWQA 1YU9A 1XDBA 3GEEA 1VYTA 3AUXA 1DS6A 1XU4A 1COWD 1IN5A 1G17A 3BGWA 4O0MA 2DBYA 3FHOA 3LRPA 3WRYC 4BUJA 2IX3A 5BYJA 5SZJA 4LJ9A 4RCYA 1UKVY 4NYMR 3AF1A 4IFBA 2BKEA 4HAYA 1SXJA 1D5CA 3QPUA 5AUPB 2DFKB 2ZYWX 3RC8A 4MGZR 4UNSA 3B2EA 4AWXA 4C7OB 2DCUA 3AKEA 2FPMA 4LWZA 4QJ5A 2WWFA 2CEAA 2FWRA 2EFDB 3KZ1E 5FUXA 1NF3A 4PFSA 4HZIA 3OFND 1SQ5A 2XTNA 4LJ6A 2OO7A 2B6HA 5JFGA 5JI3E 3Q8XB 2W83A 4ZI3A 3EW9A 5FPYA 3ZDQA 4E03A 4OQMA 4Q02A 3FOZA 5E95A 3QI2A 4UKDA 2IYVA 3U2QA 5E7JA 2QQ0A 3DOFA 2X8AA 4LV5B 4TLAA 2BMJA 2GJKA 2IYYA 4Q1FA 1DE0A 3QF4A 5JHGB 3B8HA 1NLFA 3UWOA 1ZC4A 4D81A 3CPEA 3MJRA 3R9WA 1H8HA 2IC5A 2QTFA 1T0HB 4LYFA 1OKKA 1Z47A 1NBMD 2JJ2D 1KO5A 3UMFA 4YMVA 5ANRB 3CX7A 1JR3A 2F7SA 1GDDA 1QHHA 5GJCA 3KKOA 1YQTA 2FX3A 3HPRA 4YLGA 4M1TA 1F6BA 5CYOA 1F60A 1T3LA 1YVDA 3B1VA 3MWYW 4TMKA 3VR3A 1HY3A 3EIHA 3MFYA 3TSOA 2GJ8A 3GJ6A 1YKSA 1J70A 2ZSEA 3Q85A 4DHEA 4DLXA 1MRNA 1CP2A 5JLJA 4AKGA 4LC1A 5LPNA 4XD7D 1FZQA 4FMBB 5BW8A 2QUZA 2Z83A 4KBFA 1KDPA 3FGNA 1PUIA 4ASUA 4I4LA 1Z5ZA 4ILEA 1P5ZB 4POAA 1Y63A 2SHKA 4ZO4A 2Z6VA 3QQ5A 5HTKA 2AFHE 1JAHA 1JPNA 1AS3A 3KJHA 1ZINA 1AA9A 3ZD7A 1P9RA 2ERYA 3IILA 2QBYA 2VHTA 2J0SA 4DEYA 2OV2A 4PR0A 2ZRCA 3UG6A 3H86A 1XTIA 2HJVA 3IPYA 3LW8A 2C5LA 4X8LA 5LD2C 1HUQA 1QVRA 2GF9A 2RGEA 3MAAC 4BFTA 1E2MA 4KSCA 5FUYA 4B33A 5FUWA 3U60B 4DCTA 3L0SA 1DARA 3C5CA 2VP9A 1N0VC 2G77B 2GCPA 3SYNA 3QSYA 3L0OA 2W2TA 3CPHA 1W7AA 3GLIA 2BIFA 4C0AC 1U0HC 2ZUDA 1EK0A 2VSXA 4AK9A 1E2LA 1IN4A 4JLAA 5B57C 1S0UA 4GFDA 5HPYB 4LYJA 4C2UA 1IY0A 3CM0A 2H1LA 1NG9A 2EQBA 3CONA 3IBGA 4GBMA 2YYZA 4DDUA 1DAFA 2FH5B 3B13B 1GRQA 4P4TA 4C0KA 4ITRC 1GILA 3CRW1 2NPFA 4TT3A 4KVAA 2H7VA 2XNSA 5CJ2A 4MYTA 5TV2A 1W49A 4OHXA 2WV9A 3RWMB 2R6GA 3FHTA 2D3WA 5GJWC 4ZDKA 5HKKD 3CKLA 2ODEA 3EZ7A 4LBWA 1VMAA 2LWIA 4P4UA 1KSJA 2E9SA 4IW3B 3AEZA 3QIAA 2X19A 5EP2A 2WJJA 2FGJA 3LQQA 2FSFA 4ZV4A 1ZUIA 1A2KC 2WKPA 1OB5A 1AN0A 2Q9AA 1NI3A 1NKTA 2I3BA 3KDSE 1TMKA 4GPTA 4M4SA 3EIEA 1E79A 1XD8A 4TL7A 3WYGA 3CB4A 2ZE8A 1YE8A 1N0WA 3EASA 4GZMA 3KQUA 2W58A 1KDRA 1JECA 4PSAA 4G5QA 3QXHA 3HYRA 4UXIA 3TVTA 3C41J 4S35A 3AV0B 2PX0A 2JEOA 3SNHA 5L3QA 2VEDA 4FWIB 1KI7A 4DLUA 1NIJA 3K9HA 5A5GA 3FPAA 1U94A 1J8YF 1P2TA 4JVNA 2GXUA 3LY5A 1VCOA 5K8UA 5CITA 4WAUA 1T91A 4V03A 1XEXB 1EXMA 2AKYA 3QVVA 5FL7A 1CLUA 2NPIA 2F55A 3KB2A 1P75A 1FX0A 3LBIA 5SZHB 2AD1A 4HATA 3AVTA 1T5LA 2GILA 4BFWA 3K0SA 4XH9B 1Q1BA 1QHXA 5KDOA 2GVZC 2KBEA 4F38A 1DOAA 1N6HA 4BFUA 2A5YB 3VR4A 3ADKA 4QM6A 1G20E 1WA5A 4MA4A 4O2RA 1OLOA 2VSFA 4IFEA 1D8TA 2CL6X 2VA8A 1KKMA 3HPQA 5AJYA 2H18A 2ZI7A 3PIRA 3QKSB 3DEFA 3IQWA 4PQFA 3I72A 2XOKA 3AVYA 2H5EA 2WVJA 3Q5DA 1X1RA 2C2HA 4JL5A 2QMOA 5KPDA 3GFPA 2IXGA 2REXB 1OJLA 1U8AA 2F43B 3EARA 4QNRA 5FPSA 1NN5A 3FKQA 4UNRA 1CR0A 4CEJB 3GJXC 3BE4A 1SVWA 3BK7A 3SBEA 2BVNA 2XNDA 1Z07A 1HA3A 3G82C 1G4AE 3M6AA 5G41A 2ZVQX 2NOAA 5DIFA 1R6BX 4AYTA 3THYA 1Z06A 2Q9CA 3U5ZB 1TTTA 3EWAA 4WIAA 2J0QA 2XJ9A 1SKQA 4NDZA 4B3BA 1CF4A 2GJ9A 2AHOA 2J59A 3Q72A 4IOJA 1ZM7A 4LV6A 2QP3A 1II0A 4CEHA 1OXVA 4OKSA 2HT6A 2NO7A 1H8EA 5GJVC 4LI0A 1BMFA 2CNWD 3C15C 2XB4A 3NKVA 1VCNA 2VH5R 5IDVA 4LPSA 4D82A 4LJAA 1AQYA 2RGXA 2WIBA 4NYJQ 5G40A 1NKSA 1WBBA 4Q1CA 4DJTA 3GLHA 1SVOA 4XTRA 1IHUA 2FGKA 4NCNA 4Z8YA 2QAGA 1XJCA 2R2AA 2O0JA 5LDDC 2V6JA 4Q4HA 4FWTA 1Z0IA 3KQKA 2AFIE 1SZPA 2EFEB 1D2NA 2ZRFA 4NE2A 4DXAA 3WNBA 3A8TA 3GEIA 1N5JA 3CRQA 4GOKA 2RAPA 3EWSA 1XMSA 3L8YA 3N5CA 1Q21A 3ZIAA 3U44A 2G0NA 4DDVA 1KO4A 4ZIRA 4P33A 1NRJB 3LQRA 3PUVA 4DCNA 2FEMA 4DLVA 1E0KA 2FNAA 4HDQB 1CR2A 1KI6B 4RD6A 4Q21A 1MRSA 1AQUA 3CRVA 2DHRA 4HLCA 2GEUA 4RKEA 1DAHA 4A8JB 4OHVA 2FFBA 5CLQA 2ZJBA 2WAYA 2ZI5A 1G7CA 3CNNA 2V7QA 2ORIA 4DB4A 1S4QA 2P5SA 3A4NA 2G1KA 2H8KA 4U7DA 3QY0A 1XTQA 4PQYA 2V8OA 2EFHB 2J7KA 2QGNA 3NXSA 5D3MA 3V00A 4CZ2A 4W5JA 5F9HA 3QPVA 1XJQA 2PX3A 3IUYA 1GWNA 2O52A 5FOTA 4M9QA 4W9MC 1QF9A 6Q21A 1U9IA 3RS5A 4YMTA 2ZR7A 3NH6A 1PV4A 2IS1A 3QXJA 1K5DA 5DI3B 3S1AB 1XBTA 1TX4B 1G3RA 4A82A 1XB2A 4CIDA 4WVFA 4ABYA 1TADA 1TUEA 2MMCA 3FVQA 1KZGB 3THXB 3AP1A 4BFVA 1SKYE 1KK1A 2G0TA 2Z0MA 2PZEA 4LV8B 2IYRA 4B3XA 4D0LB 4F93B 2NG1A 3B5JA 5JEDA 3DHWC 2FSHA 2QT1A 3OE7D 2AWOA 2G6BA 1TQ2A 1DELA 1HTWA 2CE7A 4RY2A 2ZSBA 1ZW6A 1S2MA 4C3ZA 3EG5A 4KFUA 2WJYA 4CEIA 2WKQA 4JLOA 3P32A 3KQNA 4I81A 5C18A 1MABB 1CRQA 2ZS8A 4RKFA 2FJUA 2GJAA 3T35A 3LFUA 2ZU0C 3TAHA 5FBLB 4TTQA 1G9XA 2ZJZA 3PR1A 4TWZA 3LWNA 2HCJB 2XZPA 3U4QA 5DHFA 1UPTA 8OHMA 5SZKB 1K5GA 1W48A 2J7PA 2WJHA 3SJBA 1TF2A 5ELXA 2GCOB 4G0NA 2IL1A 2JIZA 1OYWA 5CK5A 1HQCA 1KI3A 4BGDA 3FMFA 3JZAA 2YKGA 4M2LA 1NVVR 4G01B 2OG2A 3O47A 1E2GA 1SVKA 2QTVB 4I99A 3W9YA 3BBPA 2ZRHA 3M1IA 2F9MA 2PCJA 3BH0A 2IK8A 3FMOB 5FI1B 1IN8A 3K9LA 3ECCA 1W5SA 2IYZA 5JZVA 3TW8B 3CWZA 5C46F 2JLQA 2YWGA 3QKRA 2GRJA 4QM7A 1WMSA 4BQSA 4U02A 3RS7A 3W5JA 1G8YA 1MR3F 5FOXA 2FZ4A 1Q57A 4YDSA 3MMPA 2GXSA 5IK2D 4IVRA 2UKDA 1KZ7B 2OT3B 3O8BA 5J4YA 2O8FB 2MSCB 3LXRA 1E32A 3ND9A 2IF0A 2OCYC 3FE2A 2NIPA 2E1RA 4HB4A 3K0FB 3SFZA 4L9WA 2UVQA 2ZREA 1N5LA 1Z6YA 2GA8A 3K9NA 4CRWB 1EG7A 2ZVPX 3KTAA 5CIQA 3W90A 2JGNA 4TLBA 5EXPA 1IAQA 1NN0A 4IEIA 2ZRGA 3B9PA 2P6NA 2ZRAA 1O3YA 2CL7X 1G3QA 4PO9A 4A2QA 2Q21A 4ESHA 4QFMA 3FMIA 3QJYA 5TB5A 1LV7A 1NVWQ 4LSGA 1QHSA 5DO9A 2OUKA 2CK3D 1F5NA 1LF5A 4XWAA 3SR0A 3GJ7A 2BWJA 2TMKA 3P20A 2R62A 4MKIA 4A4DA 1Q3HA 2P5TB 3K53A 5C4GB 2H16A 5JWOA 4RCZA 4D4MA 5FTKA 4BRWA 2FSIA 2V3CC 3UWKA 2AXPA 4UNNA 1KHTA 1JPJA 4TLCA 4ZCLA 1JI0A 1PLJA 1E9CA 1GNQA 1KI8A 1KJZA 1D9XA 3DL0A 3QOFA 3VKHA 1AS0A 2ZRPA 3KXIA 2ORVA 1XPRA 3EIQA 2CL0X 3OIYA 4M1WA 4GMXA 3OIUA 4JT2A 4TMTA 3K0EA 2MSEB 3P1JA 3GLFB 3R8FA 5TMPA 5JJKA 2J9RA 3C5HA 4F91B 3CZPA 5AJWA 1P9NA 2QNRA 5J47A 3QEJA 5KDDA 4DSNA 5L3SA 2ZSDA 3PEVA 1IQPA 3HP1A 1LS6A 4NZYA 1YR7A 2W6IA 3VNUA 3MGCA 1DG3A 2J0UB 2V9PA 3CNLA 1W46A 2ZR0A 4L8GA 1N5KA 4PXAA 1Z08A 4NH0A 1YZQA 3BFKA 1GP2A 3B85A 3M4YA 2I1QA 4M1YA 1JXMA 4AG6A 2ZRBA 2XSZA 1AK2A 1KMHB 1E2EA 2RGGA 3Q9LA 4IXNA 1VCIA 1SXJD 3TSZA 3Q7PA 3QKUA 4KSBA 3NC0C 3HR7A 1G3IA 2FG5A 3TW4A 421PA 1KDOA 3GLGA 1MKYA 4AKIA 1P60A 4Z1MD 5J5CA 1TEVA 2GDJA 1XNJA 3AKCA 3AP3A 3WP1B 1IN7A 4B43A 2ZSFA 1N6NA 3RNLA 4PANA 3UMSA 4KYIB 3R9XA 1IXRC 1SHKA 4FINA 4AI6A 2D2EA 2VP5A 4MYHA 1X6VA 4JLPA 2CJWA 4TMWA 1H65A 1UF9A 4OQLA 4B2IA 4GSYA 1W36C 3C16C 2O8BA 821PA 3B6EA 3ZVMA 1M74A 4HZUB 2JLZA 4URUR 2C78A 4I1OA 1ZM9A 4DCSA 3LA6A 4PHHA 2O8DA 4EJSB 4QGAA 1KSGA 2F3TA 4V0ME 4DRZA 1H8HD 1XXHB 2B92A 3T12A 2CE2X 4LOAA 3I3SR 1Z6GA 3PQCA 1JR3D 1G5RA 1W47A 1MO6A 4R2HA 1TPZA 2VP6A 2ZRJA 3ZZTA 2FU5C 3IIMA 1AGPA 1V5WA 2ZRLA 2GCNA 3FKSD 1KSHA 4FMDF 2DFTA 1RE0A 4F4JA 5JJLA 1P62B 1KJYA 2R9VA 5P21A 1XTRA 1AIPA 1Z2AA 2E87A 4NTZA 4FIDA 2AR7A 1DPFA 4R98A 4PAMA 2AXNA 3A1UA 1GNPA 4DIDA 5EP3A 2XXAB 1KSFX 3AGPA 4L15A 4TQAA 3IPXA 4ACAA 2BOVA 4WBSA 2BV3A 1A1VA 1RYFA 2XJ4A 5JWHA 4B44A 2B8WA 2WMOB 4WZ6A 5BN3A 1KAGA 4B6FA 3ZVRA 3RS3A 1KO7A 1YJ5A 4LHXA 2VP4A 4NL4H 3EPHA 1FQJA 2HXYA 4Z51A 1Q44A 2IEZA 1E94E 5SZIA 4ARZB 2YZ2A 2J0VA 2NTYC 1NSFA 3ASZA 1P61B 3EPJA 1T5IA 2ZAMA 3W5IA 4DVGA 2JAQA 4JBXA 4LX0A 2L0XA 2JJ8A 1YZKA 4G5GA 1NJFA 2W00A 3GPLA 1M7GA 5H8WA 5F9FA 3OAAA 4OJQA 4P31A 1G6OA 1UDWA 3GJ8A 1Z6TA 2EYUA 3N2EA 4JSTA 1NLYA 4RFSB 4FMDB 4EQ6A 3RYTC 2QRNA 3T06B 4IOMA 4Q4JA 2D7DA 3RVBA 3A6PC 1BS1A 1KKLA 1D2EA 4DWJA 5KPJA 1U8ZA 3F3YA 2RMKA 1G5PA 4Q5IA 2ZEJA 4KYUA 4Z8XA 1Q1QA 4TZ6A 3DKPA 1ZU5A 3VHLB 2R6FA 4PHTA 3UANA 3B1WA 4JLMA 2CCGA 1ETUA 5J4KA 5HZKA 5KSOA 3K0AB 1FUKA 3AUYA 4Q9JA 3RS0A 1XZPA 5FL3A 3U3RA 1OF1A 4DLRA 1HURA 3TE6A 1QG4A 1NMYA 5KYKA 2F1HA 3EZ9A 4DLTA 3WBJA 3DO6A 1RRGA 4GMDA 2ZITA 4U00A 1N6OA 4TMZA 4QC2A 5JWRA 4LBYA 3K70D 2O8CB 2ZRNA 1J2JA 2IYQA 4N0EA 3ZZ0A 3OEHA 1WE2A 1AZSC 3CF2A 3SFVA 3PFIA 2IWRA 2I1VB 2XGJA 4II7A 2OLJA 2YOFA 1US8B 1G8HA 1VG1A 1W0KD 1XEWY 2ZJYA 4X8HA 2ZRDA 2CXXA 3LH5A 4Q47A 5AUOB 1IOZA 5FL7D 4IDPA 2RGCA 4PSVA 2NO6A 1NJGA 1VPLA 2A5JA 2BBTA 3MJHA 4FXPA 4QHTA 4XJXA 5JS8A 1F2TB 2PEYA 2EVWX 1L2TA 2VYFA 4NPHA 3SJAA 1E4VA 3C7KA 2A5DA 3SZRA 4LZZA 4Q7JB 4CDGA 1OFTA 1FUUA 4OL0A 2GK7A 3SEAA 5KNCA 2QP4A 4DEXA 3PCRB 4PO8A 4F4IA 2ZM5A 4D25A 3U7EB 4PC2A 1YR8A 4MUAA 4TL9A 1XD9A 4WXPA 2G83A 4TYYA 4B71A 3CF6R 3QXXA 1NVXQ 4PPQA 1X3SA 3QXCA 1TQ6A 3LDAA 4IDQA 1OV4A 2HDNB 1OIWA 2WOJA 4MRVA 1EFRA 4TSFA 1UAAA 4JLDA 1G8PA 5DHAA 2JLWA 2W0SA 1U2RA 2RGBA 2XNDD 2OEPA 1N5IA 1ZP6A 4HAZA 4UNPA 2Q3MA 1KO1A 1P6XA 3PUWA 5DYIA 3PV0A 1P2VA 4G3XA 1DVRA 2CLDX 3RANA 3CR8A 2VHQA 3OIWA 1GL7A 1XF9A 2QROA 1G1MA 2NZJA 2HF8A 1G3MA 1ZC3A 1FP6A 3THWB 2QORA 4LRWA 1VIAA 3BRWD 1RC8A 3HU1A 3L2OB 5D3QA 2G1JA 4ZDWA 4Q1AA 2VPPA 1ZM3A 3A1SA 5DN6D 3CNOA 2YWHA 2O8EB 4JLVA 1CXZA 1ZNZA 3JVVA 2OHFA 1BO6A 1BYUA 2I4IA 1H8ED 1GNRA 2HLDA 4MDFA 1BMFD 4B2LA 3TMKA 4GDFA 1QBKC 3VU9B 2EU8A 5HE9A 1NIPA 4P4SB 4DBLC 4KCGA 3CH4B 2RGNC 1G8GA 1R5BA 1U90A 3BORA 4GP6A 4RZXA 4J0QA 3CIOA 5JJIA 4JSYA 1Z0KA 2BBWA 2OFXA 5HE8A 3MD0A 4OI4A 3K8YA 4KU4A 2ZJOA 2DFLA 3DM5A 3GFOA 3BD9A 4TQ9A 5E7IA 4WXRA 1KYIA 1ELOA 1ZCBA 1SXJB 3CLVA 4OHZA 1R7RA 2HCBA 4MH0R 4RD2A 5AJZA 1W0JD 1YHNA 1GL9B 3TUIC 1ZAKA 4BZPA 3CO5A 4Q48A 4YC7A 3OFNA 3H2YA 2V1XA 4MKGA 3RRNA 3AB3A 1CJUC 4FI3C 2FV8A 1GKUB 3ZIAD 2IS2A 2AWNA 1E9BA 1W1WA 3RABA 2XB2A 3K0CC 1W2GA 3LW7A 3AVQA 2JDIA 1OXUA 4DKXA 5JSZA 5EE0A 3U7HB 4DLYA 1NBME 1T3HA 1F2UA 3AVUA 2WWYA 4D4LA 4Q4AA 3NBYC 1OHHA 3PG5A 1KI1A 2WHXA 4LC0A 1M2OB 3AKDA 1KNXA 2V1UA 1II8A 1U81A 2IHYA 2ZTSA 3E1SA 2A2ZA 3OESA 3QF4B 2QMHA 4O25A 5GJBA 3NHAA 2JJ2A 1YR9A 1UFQA
chains in the Genus database with same CATH superfamily
3PI7A 1Y7LA 3LLVA 3KLBA 1ZQ9A 3E9ZA 1V95A 2Q1SA 5AVUA 3OEED 1CV2A 4KDFA 3S2YA 1RQ2A 1NXVA 1YJXA 1G20A 4WA7A 4XM0A 4RHYA 1XDWA 2XWQA 3ZEAA 3ZDCA 4KJXA 4OP3A 4WOPA 1ANKA 2DWMA 3B7ZA 1OLXB 3WGOA 5KNBH 3EMDA 3KYIB 3W78A 1AH2A 3UKJA 2Z8ZA 3IJRA 1FFEA 3WWZA 1AUAA 1DEHA 1N2GA 2ZIVB 2J7NA 2FEXA 4B7ZA 4UEKA 4XYBA 4QSMA 2NO0A 1X1AA 3RIHA 4D4KA 3ESXA 4RANA 4X1KB 3OT1B 3SYLA 2HRDA 1ZSYA 5HW0A 3DVAB 3VM6A 4N1AA 5EIFA 3QWBA 5FI0B 3R44A 3FLEA 4KKXB 5EFOA 2H2AA 5B1DA 3ENQA 3UT6A 1LNQA 3I9KA 3LCCA 5J2TA 3O82A 3U6LA 3GJZA 5J23A 4HYYA 2I9PA 5K3AA 4KQIA 2OCAA 3RBAA 1CJKC 2R7LA 4J7CA 4CKBB 2QPAA 1X2BA 1J1ZA 3LV8A 1SXHA 4NFSA 4XASA 4Z99A 1KJWA 4WI1A 3GLFE 3AUAA 3LF2A 4JP3A 2JFPA 3E15A 3G1WA 3D4NA 4CKZA 1UFZA 5K7SA 1Z0AA 5IH7A 1KH2A 1X0VA 1YZGA 3I5XA 1V11A 1XJWA 3VDUA 1YRQA 1HT1E 1YBHA 2VK8A 4ZCIA 1Z8HA 5DK4A 4DT1A 1GKYA 4OX9Y 3GLHB 2BUAA 2CVOA 1Q74A 4QECA 1VGVA 4RJLA 3JYLA 1PQ4A 1UBCA 4EJSA 3BWYA 1KF0A 4DC9A 1A4IA 2WF7A 4WMLA 4K1XA 4F06A 1ADCA 1PI3A 4TKZA 4ENWA 3EY4A 1QIHA 1HC7A 5B1YA 1E6WA 4DSUA 2FF5A 3ZI7A 3RVJA 2JASA 4TOIA 2Y21A 2PX5A 3FG9A 4LI3X 4US0R 3PKIA 4MITA 1C1XA 1L3BA 4E5UA 1Z63A 3PDWA 4M1MA 1PEDA 3E2IA 3I9V1 4LBVA 1APBA 3B2QA 1EB9A 3F3MA 1Z3CA 3SATA 1QK3A 2RB5A 3E23A 2YIMA 2YVUA 2A9RA 2FI1A 1A7AA 1QPGA 3LQ4A 4M1QA 5DX8A 1I30A 5H4GA 2IXDA 4NEGA 1EUDA 3OKFA 3W3ZB 4ZYYA 3H8WA 4P0TA 3DC7A 3P0JA 1XCLA 4TN1A 3RIMA 4AY3A 4O2LA 4DL9A 4IHKA 3ZYZA 2KA6B 4P3YA 2BM0A 2OHXA 1OW3B 4TS4A 3A32A 5FOVA 1I1NA 3QEBZ 3Q3GE 4KP7A 3MWLA 5LXTB 4QBHA 1ZH4A 3A7DA 3C4JA 4QOEA 1ABFA 4V0MA 1DJLA 3ET4A 1Q3TA 3ZCTA 5CRIA 3NEPX 5B4TA 1GR0A 1X92A 4IHAA 4MPJA 2DUUA 4FR2A 1WVIA 1TYBE 3DAGA 3G0HA 1JT9A 1M73E 1DFHA 5KQPA 4PZYA 3W6OA 5HZHA 4DR3B 3E46A 3PITA 1JLKA 4TSFD 2D2IA 3STUA 1E2PA 3ZOZA 4LF5M 3ZCRA 2XDQB 2O0KA 4UUMA 4NOJA 2R6AA 1VPTA 2UXCB 2VTKA 2X0IA 1JILA 3A3PA 5KPTA 4UN2B 1P1CA 4AS2A 1HDEA 5IRCD 2NO4A 4C0XA 4CG2A 3WAGA 1SXJE 3SC3A 1SG9A 1MO3A 1DLJA 3RYFA 3W8RA 2H0RA 1XKTA 3MWKA 1NNEA 3DDSA 2QSZA 3TQSA 2PQMA 4ZPJA 4JR0A 2JJMA 4FM9A 4JZYA 3NVMB 3GPDG 2WWXA 5EIEA 3GGDA 1N3IA 3B1ZA 1SN7A 3CW8X 1D2RA 4MPPA 2QN6A 1P5HA 1XKXA 1IJEA 4YMGA 2C5EA 2E85A 3U0BA 3UXMA 1DXOA 4MYSA 2IYLD 5K1ZA 4B7AA 1GCOA 1MC8A 3U3MA 4EDHA 5A03A 5IZ7D 3DO8A 3WSTA 4EECA 4ZAFA 2XUFA 1DAGA 4HS9A 5JG7A 1ZA1A 2IUUA 1KEUA 1GPBA 3ESYA 4GX1A 1ZBDA 1ZRHA 1GTVA 2JJ1D 4F04A 4GX5A 3IO3A 3KYJB 1C3OB 4OM7A 1EVLA 3QVWA 4A5SA 1ECBA 4E70A 1AZWA 4IBDA 5AKZA 2P67A 5HFAA 4B3SM 2PD3A 2VATA 1J7KA 1LPMA 3EUFA 5E8RA 3IR5A 4QO7A 4NQZA 1DAKA 1WF6A 3A3NA 4JV5M 1ZMWA 1CUHA 1HNXB 3UQZA 1IEXA 5F3RA 4FGKA 2PJDA 4AJHA 3PXEA 2ZUUA 2CMGA 1DQPA 3M6FA 1S89A 4YRGA 1SIBE 4IIWA 1S8FA 2PR7A 3O8RA 2A58A 2Y2VA 4GI5A 4PX3A 3FIJA 3EGXB 4YO7A 3BB3A 3LUPA 2YMQA 3TRHA 1IZ7A 2X4LA 3CZQA 1RKVA 1V7PC 4XIGS 4MO9A 4CDNA 3MRXA 4INZA 5IAGA 3SVLA 3RTCA 3EHEA 2G3YA 5JY6A 1L8QA 3ZQ6A 5LZ2A 3CX8A 1MRZA 1K7CA 4W5RA 1WSBA 1NNJA 2LPMA 2PSSA 3TNFA 4B47A 1PJAA 3AEYA 4G86A 4M3NA 3DUFB 4DBZA 4EKEA 1HJPA 2HADA 4D9MA 2DXIA 3CURA 1X8KA 2ZS7A 2C7GA 4FCTA 3GQBA 1RPNA 4G8JA 3WGUA 2XUZA 1RAAA 3WLFA 3MTBA 2B78A 5TRTA 3NPMA 3M5DA 1NVVQ 2Q4EA 2BKUA 1QGDA 1C7ZA 4PAQA 4YCSA 4B40A 4JI5B 2JS7A 2JLYA 3HU3A 2YOHA 1JFTA 3KLOA 5JCOA 4UXHA 1M34A 2JZ1A 2CJYA 1UC8A 4C22A 1A82A 2J3KA 2C4WA 2CLIB 3JD2A 2XMPA 5TGTA 3KR2A 4JI1B 4NP6A 3WL3A 5AO9A 2GLTA 4EZEA 3JVUA 2HMUA 4Q19A 3MWFA 1TDJA 1KY4A 1M6HA 5J2TF 1GFSA 1BS9A 3NWOA 3HFSA 1JTVA 2N46A 2DUNA 4L3OA 4MVJH 4BBPA 3FRHA 1UBEA 2LBPA 5GVSA 7MHTA 3D4BA 1Z73A 3AESB 5J58A 4XKJA 3D2LA 2A9FA 1JZTA 2CLSA 2GPNA 4CHTB 2XTAA 4RVNA 4KQMA 3BHNA 1I2MA 3L1KA 1P73A 2NTEA 2FWIA 3G59A 5A4FS 5L3VA 2MGWA 2X7JA 3TRIA 3SXUA 3N74A 4LJ4A 5T3YA 4C7JA 4YP6A 3SNKA 2WW8A 3VKGA 3P4UA 3TKLA 3DZIA 2PMWB 3UK7A 4M1KA 1GFZA 4AQYM 3BXZA 1E63A 1HTBA 2AOWA 4W7IA 1UBLS 4D0NA 4P0PB 3OTHA 1OX4A 1Z5WA 1XMJA 2WUWE 3H5IA 3TFOA 2OGUA 1V8PA 4Y1RB 5E3HA 1UBKS 1NPDA 4O4LA 4DMHA 4L8FA 1G98A 2E49A 4K6MA 5LA6B 3HM2A 3I04A 3TYXA 3B78A 1YGYA 4JKIA 4TTTS 1V3VA 4N8SA 4S1PA 3RFWA 2GN6A 2WTBA 1IXYA 4C1NA 2J5XA 5DGDA 5G53C 1Y6JA 2ARKA 5F1YA 3MGAA 4ZJYA 1Q12A 3LUAA 1OBCA 2WWGA 4P7FA 4ZYXA 3T95A 2IPXA 9ABPA 4CGZA 1H1LA 2BRUA 5FTJA 4GPIB 2BI4A 3F4BA 2DUWA 4IBJA 3NHLA 2GZMA 1ULBA 4P7GA 1Q19A 3EYAA 3HCFA 3DTYA 1EFRD 1F8UA 3IQHX 3IMKA 2G1PA 1FYVA 4B7CA 2VWPA 4HGQA 3T1HB 1A8IA 1K82A 1ODCA 2JCXA 3A2LA 4QTXA 4IQGA 3GARA 3H9BA 1WXHA 1JBKA 3ZYCA 3A98B 4XX0A 3IUEA 5AJTA 4EPYA 4KNWA 3ZVNA 4EUKA 3WLJA 1EFKA 1DS6A 1MHTA 1VJGA 2IX3A 5BYJA 1A69A 1UKVY 1H9BA 3QPUA 4FNGA 4UNSA 1MX3A 2DCUA 1DOHA 4X7BA 3GZNA 1FA9A 2OO7A 3AY3A 4E4YA 2WYOA 5FPYA 2NXNA 2Q0XA 5CXSA 3QI2A 3VYTB 1DQZA 1QDUA 3U2QA 3PPXA 2VT3A 4MDHA 4HFNA 2O1XA 3OO0A 3TSAA 5K5EA 1T3LA 5THQA 4DLXA 4J0KA 3PL5A 4D5GA 2DJ5A 1F2DA 3CVUA 5LR6A 2FG7C 1TFRA 5F33A 4V2UA 4R8KA 1Y5LA 2HJVA 3IPYA 1I8TA 3LW8A 4D0RA 3U60B 1DARA 1FF9A 4HQRA 2W2TA 4UU7A 2H8GA 1WKVA 1BE1A 1KXJA 2VSXA 1R2ZA 4II2A 4DDUA 1V96A 1W8DA 4LDNA 1E1MA 4WK0B 5EOVA 3PYXA 2PH5A 2ODEA 3EZ7A 1LI4A 1T8PA 1VMAA 4X90A 4AXXA 1E7QA 1ZG3A 5K9ZA 4Z3OA 3LQQA 4OB6A 4AMBA 1E59A 2QL5A 3U4HA 1VI5A 3EIEA 1S2OA 2ZE8A 1T1EA 3H6GA 1N0WA 3A06A 3C0KA 3NU1A 1KDRA 4G5QA 4UXIA 4EG7A 3AV0B 4YJFB 3FTCA 2KLHA 5JD6A 2QR3A 1BEUB 3DT6A 2V0CA 3C7AA 1PKEA 1U3DA 2OCDA 5AXCA 4Y2TA 3DOJA 1XEXB 2RH8A 1X7XA 1AB6A 1FX0A 2DKFA 4HWOA 4F38A 1FLAA 4JI4M 2GO1A 3PSHA 3K35A 1GGJA 1PG0A 1ZJYA 2VP3A 3I72A 3ED1A 2C0QA 1X1RA 3Q5DA 4CODB 2NP7A 4TVOA 4BATA 4OMCA 2D1YA 2DPYA 4ESEA 4KN8A 1GDTA 3WLMA 4LV6A 1E5TA 1S3FA 4MNTA 3EG9B 3ZW8A 3BCSA 2VH5R 2FGKA 1SQSA 5CT6A 4K40A 4F8EA 3OQIA 3DOOA 3ZWCA 3N8KA 4E5NA 2FVYA 1HYEA 3CPSA 5KWJA 3N6XA 4X66B 1GVNA 1N5JA 3CF4A 4UMFA 5IXSA 1Q21A 1A9PA 4MR9B 3HDVA 1X7YB 3WMWA 1PFWA 2A67A 1KI6B 1PGQA 3QLJA 3QMPA 3HHYA 4RKEA 3O83A 3OETA 3J7TA 2G1KA 4WWHA 3CEPB 2V8OA 3TXXA 1E1DA 1Y3IA 4GITA 2VNAA 4EY8A 2XQGA 1QO9A 1GCUA 3LUBA 2GBGA 1XBTA 2WD9A 4ISBA 2DH5A 5HFNA 3U19A 4FUTA 5BYAA 1ZGCA 3CT4A 3KK0A 2G0TA 4OGGA 4ZT5A 2NG1A 4EJMA 1BXZA 3OE7D 5EKDA 4O1HA 3ETEA 1HTWA 3GMDA 4IGAA 2YICA 5HTOA 3H05A 2A9QA 3LP5A 5ECGC 2FJUA 1USVA 2ZU0C 5LM3A 1M8KA 1ZH2A 2FPWA 4LDQA 3NNNA 2BR5A 4I9UA 3ZE0B 1ZAYA 4DNXA 2OHOA 4N48A 2YFHA 4BGDA 1KI3A 4P2GA 4ND2A 4OAQA 1VJ0A 2ZRHA 3BH0A 3TRJA 2PA0A 3ZE9A 2I03A 2Q5IA 4MR8B 5COBA 1NPTO 1MR3F 4HMOA 3C8MA 4JB2A 2BFCA 4LXHA 1Z0ZA 3QPCA 3IBSA 3ND9A 1E32A 3O75A 2ZREA 4RQAA 2ZVPX 1K68A 1EWVA 1LF5A 3ZHTA 4YMLA 4YGYA 2BWJA 4I1YA 1JIQA 4YUAA 4M8LA 5E3JA 3BCUA 5DGIA 1FYXA 3ANNA 5AVYA 4K6OA 1QZEA 1KPHA 2AHRA 3PWKA 3P9NA 4DNOA 4I5IA 4TMTA 4TWRA 2O2HA 1BA3A 3K0EA 4OSPA 5BSHA 3UM9A 1YI0A 3FD8A 4H3HB 2POCA 1TM4E 1DG3A 1WEHA 3W5CA 3E05A 1K0FA 4AG6A 4FFMA 3Q9LA 4PY2A 1CF9A 3OIGA 4KQ2A 2C58A 3RFFA 1MKYA 4Z1MD 1TEVA 3OHSX 3QVLA 4XCQA 1L7PA 3EDMA 4TMWA 3VJLA 4W8HA 3ENVA 4BX8A 2JLZA 5HNKA 4PHHA 2B9VA 2E89A 1RHKA 2BTQA 3T12A 2CE2X 2W2KB 5LBTA 1ZCZA 2V9CA 4YRFA 1E18A 2IZ6A 4V0QA 3PSAA 4UEJA 2C54A 4M7OA 1N0HA 1HE5A 3RT9A 2OTCA 3COJA 4O4LF 1C0LA 1YQGA 4L76A 4I50B 4NL4H 2VP4A 3FPLA 3N5KA 5H80A 2WJWA 4EO7A 1JDTA 4KO3S 3C1AA 5EESA 4KMMA 4LYEA 1TA9A 3EE6A 3EPJA 3O4HA 1T5IA 1SOAA 5HQ3B 1VFPA 3EIFA 3TWKA 4Z3DA 2PSHA 4HN2A 3N2NA 4L4RA 2WE8A 1LPPA 4YJ2B 4HCJA 4JT8A 1TD9A 3LZDA 3T06B 1T5SA 2P9YA 4HEOA 3F9RA 2JI6A 2RMKA 1UMCB 4KT0F 1EB8A 2O01F 3HFGA 3I6YA 2R6FA 3ESZA 5IUKC 1XLVA 4MW6A 1GQ2A 2X5JO 3HB9A 1Y9AA 2C7PA 3H5VA 3NVDA 4MCIA 3VOAA 3KBBA 1VG1A 4MW7A 1JMKC 3SAUA 1SUFA 1I94M 1M2NA 1AUOA 1RMTA 1T1RA 4XJXA 5KKAA 2EVWX 3HXOA 3G5MA 3L7MA 2VXCA 5D6NA 2HGZA 3O94A 4PSCA 3NNSA 3BWCA 2J3MA 3PQ3A 3BIOA 5KYGA 2CC2A 1J00A 4PPQA 1QXSA 7AT1A 4FDUA 2YNMD 3VYUB 2JLWA 2VK4A 2OEPA 2E5LM 1MN3A 2PZMA 3CR8A 1CETA 2QROA 2NADA 5DASA 1YE3A 4WCVA 4D41A 5AK5A 4EG8A 1XLTA 4ZV7A 1POXA 5D87A 5KVSA 2NU7B 1K5PA 5BSVA 5MFPA 3DTVB 4G41A 1KXZA 1QH8A 4RHEA 5KQMA 3B1KA 3PFKA 2KNZA 1CRZA 3VMMA 2ZTCA 2JAOA 3KP1E 2BFFA 3CLHA 1XZIA 3BVPA 3M49A 3PC8A 4GC5A 1ZMBA 1J2RA 3LW7A 4YY3B 1NQVA 3AVQA 4MLCA 1MF7A 4DKXA 2VPIA 5U4QA 2F90A 3GZTB 4HDRA 3OESA 3QF4B 1P80A 3QU2A 3LT2A 4GWKA 1OIZA 2CBZA 1MA0A 1Q6ZA 4BLTA 2QVLA 1ORRA 2PFKA 1E2QA 2QLTA 5U1PA 1N1EA 1ADGA 4CN9A 2BONA 4OQNA 1JIIA 4CGYB 4OYHA 1YAHA 4ZVQA 3K6RA 1EGMB 2C1EA 3H18A 2F9LA 1MABA 5IAOA 3H83A 2W0MA 4AULA 3NG1A 5AM1A 1AXRA 2F5QA 2GCOA 4OAOA 3FF1A 3H1PA 2PMDA 1A4XA 4AO8A 2HK6A 2GCIA 4KODA 3FNIA 2NZUG 4DV2B 2OA0A 3ZI0A 4OQEA 4Q66C 4QOJA 3OA0A 4RHUA 1IBMM 3DD1A 3B82A 4UNQA 1BMDA 3E5HA 2C77A 4X8OA 5GY7A 5JCXA 4KRFA 4CJXA 1NYQA 1ZNWA 4NU0A 3WYCA 2CKMA 5C35A 3UMGA 1M6VA 4MKFA 4DQVA 1YH3A 1RI5A 3K2QA 4ZZ0A 3JARA 4LNHA 3FXAA 4O4JA 3TL2A 3PEUA 3RC2A 4DV3B 3GJYA 2JLRA 1OH7A 3GFFA 3EMBA 3NAQA 1ZK3A 3UYLA 4K2HA 3AVOA 2BR3A 5SV2A 4ICIA 5FAKA 2IW3A 1YU6A 1QR6A 3GNQA 3UJCA 4GUAA 1DRVA 4F3CA 2HYIC 2ZIEA 3EGEA 3UYKA 1RAIA 1VC2A 1AKTA 3OICA 3GFTA 4NV0A 2AXQA 3DMYA 1ZBQA 4UCXA 3WNVA 3SVZA 1XDGA 1FFDA 3AV3A 1PSWA 1D9ZA 3FF4A 1CUSA 2XZLA 3DMFA 5K3FB 3JSAA 1CCWA 4YPFA 2OENG 3KJFA 2FPKA 1SA0A 1ZWLA 2DMRA 1U0OC 1IU9A 2AMLA 3OOYA 1NAIA 1FRZA 1NBIA 4LG1A 5KU1A 3CTMA 1V8OA 2PSDA 3DA8A 3IP8A 4IDNA 4C7MA 4ENQA 1VKZA 2C3OA 4J7UA 4MKHA 2UZ1A 2LNHC 4UHKA 5AYVA 2PKXA 2K6BA 4Z6KA 1PR5A 4K05A 2RFLA 2QDXA 1MX1A 2GQ0A 5JYEA 2G08A 4ZTZB 1UP7A 1RDFA 1T5HX 4BLRA 2QQFA 3GCGA 2R8YA 1O94A 1SIOA 3CN9A 4GSLA 3IMCA 4JKOA 3L0ZA 5AUNB 4MP3A 2EKPA 2FKAA 2YC4C 1CUYA 1DDOA 1B26A 4FVMA 1GGVA 1N3LA 1IHDA 3LX6A 1I0ZA 4DTIA 1OBFO 1M1NB 2IY9A 3SMQA 3P52A 3KYDB 1U2TA 3WGNA 4IDEA 2OHJA 1SOWA 2W4QA 3PLRA 3WGJA 4GKAA 4OI2A 1O08A 5LYJB 3DBLB 4MDEA 4YMWA 2XYRA 1E0SA 2JAPA 5DF1A 1GTRA 1I32A 1MBZA 4Z53A 1AKYA 4A73A 1MX5A 3H4IA 5JTTA 1Z36A 1O57A 4RM2A 3VZPA 3GEMA 1RC0A 2Q2VA 1DRJA 2IITA 3WHIA 5B7QA 2FTKE 1KYWA 1C1KA 5ICEA 2QGZA 3H7AA 3VOTA 5LQDA 3S40A 1XNHA 2XUGA 4P22A 1YB4A 1R6AA 3NLLA 4XM2A 3CJQA 4TL8A 2YCBA 3LS2A 4ZAZA 1V43A 3MERA 2CZQA 4F9FA 1PZGA 1E9EA 2BFAA 5FI3A 1ZZGA 4JNCA 4DSOA 2JG3A 1QP0A 2YC2C 1MO4A 1G60A 2AI3A 5J40A 1XCPA 1V41E 4DR4M 3D1VA 4OU7A 1HTTA 2B83A 4MUGA 4ZMRA 3AYXB 3KR9A 1MHPA 1C8LA 4HFJA 4PX9A 4TM8A 3LHFA 2BGWA 3RF7A 4EKGA 2AOVA 1YNSA 1C3JA 4O8CA 2XYGA 3HCPA 4CQJA 3BMQB 2GEVA 3CGGA 4TL6A 4CISA 2EIXA 2M1ZA 1QHGA 3CQ9A 1DBSA 4JJEA 1GTG1 2F43A 5HF8A 3D7RA 1V16B 4CEJA 4ZJZA 2JFZA 2IE8A 4FSHA 4AZWA 3EZFA 2X8WA 4W5WA 4HN9A 2CUTA 2WT8A 2ZIFA 1KVUA 3E9SA 5BN3B 5TS2A 1E6UA 4MDYA 3J81k 4KSYA 2RGNA 1RBYA 5LYYA 1P2FA 4YO8A 3JD1A 1R6XA 2XUKA 4A0RA 1JFFA 1U28C 5IPFA 5CT9A 4CT0A 3FZNA 3QUSA 2JFFA 1FMFA 3F47A 1TU4A 1SBYA 5FWXB 5JD5A 4OU5A 4O8ZA 2WTMA 2C4KA 4PTLA 3C1TA 2O57A 3RC7A 4WP2A 1N33M 5IWAM 1L5QA 1C2TA 2QMEA 5ENVA 2C9DA 3AUTA 2AX4A 3ORYA 1CWUA 3RYCA 2IXAA 3LQ2A 5KNDA 4WUVA 3RSCA 2PUEA 5JVDB 2IIBA 4DRYA 2XT0A 3IAUA 4R83A 3EUEA 3AY0A 1OBVA 2IXBA 3R3XA 4Q16A 2FQ1A 1KIMA 1G8MA 3IT2A 3H87A 4L9RA 5EUCA 3FOEC 4BJHB 2FR0A 3R23A 4PPGA 2RHGB 1PSDA 1WBDA 5J3JA 4X6LA 4GDMA 1U8XX 5M7EA 1FNMA 5CEJA 1D0MA 1NVGA 2WM2A 2CMKA 1V1JA 1PFYA 1ZDMA 3H2IA 4IXMA 4LJ5A 2ZANA 2C0PA 3SOPA 1CJTC 3AEUB 1N32M 5HMLA 3ZKAA 3E18A 1N2BA 4PQRA 3RIXA 3BJIC 3NANA 2GBCA 3UMVA 1NVMB 2B21A 3KVNA 2JGDA 4JNKA 3TR0A 1WCWA 1FDVA 3KB1A 3RTAA 3ZY3A 1U98A 3BXWA 3P4YA 4CKYA 3SE7A 4EIWA 2C8JA 3GH3A 4FLMA 5C4IA 2V7WA 4J0CA 1QSGA 1V71A 2UZ4A 1TLTA 2DLDA 3LY7A 4Y0VA 3PRJA 1P45A 1FNSA 2NZXA 2PNFA 4GIBA 3B3JA 1EVJA 4FQ8A 5G0VA 3E4RA 3R09A 2JUJA 1O95C 2VDWA 4YLYA 2OQIA 2IYWA 3EDQA 1RXEA 2X76A 3HO8A 2GVDC 2JA2A 3JQ9C 3IBYA 2WT4A 3WDMA 3HEAA 1SOMA 1H4QA 2V1CA 2WSLA 3UG7A 3MBIA 1EFPB 4E6PA 3GAAA 4HL6A 2GOYA 1ZD8A 3EA0A 3G2OA 4FKZA 5F64A 2NO5A 3G2KA 3RRYA 3HKDB 4BTEA 4ZT3A 3Q0TA 3RAPR 5FTNA 3QKTA 2JHGA 4LGMA 5KKNB 4J6FA 3SYRA 2JKYA 1YIOA 4GI7A 3JQGA 3B1YA 4HDSB 2J41A 4HB3A 4KPEC 1IBRA 3HJRA 3L7IA 3J7AC 4P17A 1HK7A 1U8YA 3L4SO 1AKVA 3VR2D 1QO0D 1QO7A 4HL4A 1ZCJA 1JJVA 4B34A 1YI8A 3IEUA 4ZEMA 1DGHA 1AMOA 3A9CA 4DR6B 4CF5A 4E22A 3P2OA 5CG2A 4QL3A 4EJ6A 3C6QA 2DTEA 3TNJA 1AKUA 4JKYA 3V2GA 5DYWA 3O2QB 3SAVA 3KKQA 4N3AA 2G28A 3O1IC 1IJFA 2XCQA 1TVKA 3MJSA 1DCMA 1P2SA 1E6EA 4JC5A 4JGBA 4UEQA 5GV7A 1PBNA 1E2IA 2ANBA 4CM5A 2HIMA 4WJLA 3T3OA 1I6MA 5CVJA 3AI2A 4C3VA 2VSNA 1P0FA 4LOKA 3PEYA 3P0IA 1QHYA 1R18A 3UV7A 3E7WA 1CVRA 1PO7A 5F2EA 2CSUA 3FKJA 3GGCA 3K5PA 5L8VA 2AZDA 3LXMA 2EBUA 2R5NA 3SC2A 4G1CA 2CLLB 2QN8A 2R6JA 4KGDA 4NC6A 1V35A 4JT9A 4QRHA 1ZUWA 3G1TA 4MS1A 1UXGA 1MPXA 4DLLA 1T2VA 2XBMA 1S6YA 4C07A 3H1TA 2NXWA 4OM8A 5CB8A 1RYYA 2QZ4A 3T9CA 4YRMA 1B42A 3PA6A 3KFUG 3L29A 1XZBA 4RZUA 4QHSA 5LZ5A 3H99A 4NJMA 1RRPA 1L5YA 4MW9A 2XGOA 4ZQCB 1E2DA 4IZHA 5A1TA 5CX1B 4U7TB 3GLQA 2VDBB 1SXQA 1RRCA 3SEQA 1IIBA 4FB5A 4LGYA 5KWSA 1JB9A 3N59A 2L17A 3FB4A 3UBMA 1JUDA 4Z4GA 2HSDA 2P79A 4GU5A 4B3CA 2GPBA 4C21A 4WZAA 4LWPA 1M75A 1TD1A 2C5SA 4FQ7A 1D5CA 4BO6A 3RC8A 2B4QA 1H69A 3TNYA 4HZIA 4EARA 3O8QA 1UJMA 3Q8XB 5BORA 4ZC1A 4QG3A 3NEAA 1LCIA 1QU2A 2C2XA 4DRXA 3UWDA 4D81A 3C3XA 3CPEA 2J4FA 5GJCA 3F2IA 1YTUA 1X77A 2GJ8A 2H59A 2OAEA 2EUCA 4YRAA 4FMBB 3ZG6A 4OUDA 2HK7A 2DVWB 2EZ4A 3DDNA 3ZWNA 5LMNM 1XDUA 2PO5A 3MAAC 1HBJA 4PD2A 1JLRA 2ZJ6A 1QLJA 2QMZA 2AFVA 3E61A 1BMQA 5KKCA 1E2LA 4GBMA 4JEUA 1GRQA 3KJQA 4EEKA 2WV9A 1FPQA 4HYTA 5GJWC 4GZ6A 4ZDKA 5CFOA 1XMOM 4J0HA 3HDGA 4RTLA 5EHXA 1A2KC 2MSLA 4NMXB 4DMFA 5KX5B 3ABOB 3H0EA 1G4HA 3L7AA 3L06A 2HMAA 1NSYA 3UB2A 2J9GA 4KRGA 3C41J 1M8FA 3UOAB 4OFXA 2WJ3A 1GN8A 1U94A 4KE6A 5ALEA 5BWNA 4HH4A 1Q7EA 1RQNA 2XB6A 1GTZA 3LBIA 1TOAA 2Y0BA 3COVA 3MMXA 1LFAA 4RNDB 3A0UA 3H6HA 2VA8A 1F8GA 2XOKA 3IP7A 4RDXA 4IQ0A 3LC0A 2FAXA 1KQGA 2REXB 4X24A 3BK7A 3HY5A 4EMSA 1RYNA 5I9NA 2MU1A 2F1OA 4AZ0B 3E0QA 1QVZA 2E4ZA 1M2VA 5CW1A 2AHOA 1ZI9A 2H4WA 4L73A 3BDVA 2I4RA 3K05A 1YKGA 1Y4UA 3RYIA 5LZ4A 3SVTA 1VLZA 1DMRA 4QUEA 1CHDA 3R7FA 3PNVA 3R75A 4LXYA 3UAOA 4Q4HA 4G23A 1V37A 2ZRFA 5CD1A 4NFLA 1CQIB 4JEMA 2XD4A 1WGNA 5EGNA 3SEFA 5JNRA 1G5IA 3BPSA 4Q21A 3W68A 3V1YA 5BWLA 2V7QA 1KH1A 5FBKA 2O07A 4HDKA 3IEPA 2QJOA 1XJQA 4BO8A 1EINA 2ZR7A 4CIVA 1TUEA 2CZGA 5TMBA 3WSWA 4F4HA 2H2DA 3I4CA 1GARA 2Y1XA 1TZKA 1U3TA 1OTHA 2G6BA 3EG5A 3FCXA 3HHPA 2WKQA 4NJOA 2EL7A 3A1EA 1JNXX 2O2IA 2GJAA 1UANA 4TWZA 5FF9A 3I0NA 3B36A 4FFLA 4RK6A 2OK7A 2ECFA 4FHFA 3KOZA 3FMFA 4M2LA 1FVXA 3O47A 3GVCA 5FYQA 1JXQA 1GPLA 4G36A 4M36A 4GNRA 5HQJA 3I2JA 1FSZA 2H07A 1J20A 4E11A 3T5CA 1U3FA 3O8BA 5I7HA 4GRDA 1YRWA 2IF0A 2OCYC 2Z56A 4Y1EA 4LF7B 3ZGVA 2L09A 1JDJA 2WVHA 5TJHA 2R85A 4I36A 1O3YA 4HWPA 4L8VA 4H6VA 3WE7A 4LSGA 5DO9A 3DAFA 3RFCA 4A4DA 5LU9A 4BUZA 3ZHUA 5C4GB 4CDRA 3UAVA 1TI7A 4NH4A 4LF9M 4Y30A 1DAPA 3CLKA 4ZCLA 5KMGA 3TPFA 3Q2IA 4MX8A 1D9XA 2CN1A 1W0CA 2L6OA 2L4EA 3FYCA 1VE3A 4XI9A 5KDDA 3DTVD 4WK4B 2IOFA 2J0UB 3TAXA 1TVCA 3B85A 3E9CA 2XSZA 1FU7A 3RAEC 3AJDA 3TSZA 1NT4A 3NC0C 2JKVA 3HR7A 3ICOA 1KDOA 2PKEA 4L6IA 2GDJA 5LIRA 4KYIB 1TJ3A 3VRHA 2F4VB 4LIPD 4L6CA 3ZVMA 5KTTA 3JQFA 4HZUB 1QCCA 3ZWAA 5J5AA 2X9GA 1Y7HA 4TXHA 4UPDA 2B92A 5HA5A 1Y3HA 3KWJA 2FU5C 1YSYA 3EXHA 5F23A 1RE0A 2ZQZA 3GRAA 1QFZA 5AICA 1Z2AA 2J31A 4M0FA 3HKBB 2HTEA 1RM0A 2FOIA 4LXTA 1A1VA 1N2OA 5BW6B 4B6FA 1M1YB 3OF2A 3RS3A 3G2HA 1EQAA 3ZKWB 4PE5B 2DPLA 5D3KA 3T52A 3IPAA 4ARZB 2HCRA 4JUBA 3DFFA 4LX0A 4IF4A 1G38A 4AP5A 3CLTD 2Z3WA 3LOUA 4EQ6A 2Z8XA 2D7DA 4ER7A 1CQJA 2QRMA 3ZXUB 1M1UA 3LHDA 3IEIA 2QN1A 3RS0A 5IWCA 2Q28A 1OF1A 1ENOA 3MOIA 2QYTA 4DLTA 5BWCA 3I76A 3GJTA 4DW8A 2PDAA 1CY2A 1J2JA 3QYPA 2UUBB 3PFIA 1AURA 4ZT6A 4II7A 2BGGA 3IVXA 4MVCA 2Q5LA 3AWDA 4FHGA 2ZIGA 1H1TA 5AKGA 2NO6A 1A9YA 1LI5A 1KP2A 2HBZA 3N2YA 2NN3C 1LRJA 3UN1A 3WMRA 2VYFA 3SZRA 5FD8A 2IY8A 3EF1A 5KNCA 4F4IA 3Q7SA 4BU0A 1N9ZA 2REQB 3OF3A 4TYYA 4CCYA 1J09A 3ABIA 5LOVA 3DKKA 2ZK7A 4DG9A 1TT5B 3KZNA 2Z98A 2XYVA 3SP1A 1KY5A 3AIKA 5DNEA 3GVIA 1D6SA 1L7XA 4GGOA 3HU1A 1A76A 3ROGA 1H8ED 2W2LA 3PJGA 5EHNA 4GDFA 2FPIB 2QVZX 1D2CA 2WNIA 3FE3A 1NX6A 2P68A 2R97A 2BBWA 4IDFA 2XCIA 4MPTA 4DDKA 4PLTA 1FS5A 2Y0PA 3ABQB 1ZCBA 5DPMA 1T13A 1IXSA 1WHTB 4Z0HO 1UPBA 4KDEA 4LY0A 3Q2OA 5ICCA 2K4MA 4O2AA 3IQGX 3ROZA 1F2UA 4BNTA 3G0BA 3SYTA 4IJKA 1K6XA 1H6UA 1OD6A 5GOZA 3BS4A 2A6PA 2ERXA 4AJLA 1T0UA 3OVMA 3VR5A 2H51A 3TJRA 4C0LA 1SUBA 4P08A 2QTBA 5F7JA 3BERA 1WB9A 3KQLA 1DKOA 3ETDA 3L4EA 3TVYA 3W6ZA 2YHSA 4BO2A 2FSVA 3JYQA 3TDNA 3N2KA 2FPPB 3PDJA 4UTVA 1PUJA 1LBEA 4OOEA 3M1YA 2ZPTX 1YZHA 3GLIB 3MLBA 1A8SA 1GA1A 4F97A 1LTKA 4EPWA 4J4TA 3SK0A 3V1MA 5A06A 2F2TA 5HKKA 1UOQA 2QPOA 2I62A 3AL0C 4FT2A 4MVJM 4PV7A 1T3ZA 1A2QA 1XD2A 1AO3A 2GF0A 4EGSA 4ALJA 4XQ9A 1ESEA 2VP2A 2Z4TA 4KR2A 3NONA 1FMTA 2O3JA 1S2DA 4Q15A 3NJ8A 2ZE5A 2EZ8A 1H6CA 4M0MA 1SGWA 4DYVA 3U09A 1P1IA 4RVFA 5AW0A 4Z7NB 1F20A 4QYSA 4TYPA 1MN6A 1T26A 4ZRDA 2V5VA 2N9UA 3R7WA 1TR8A 3IR6A 4HLQB 2ISQA 2Z9DA 1C7EA 1TEZA 3AINA 1W93A 4A0QA 1HKUA 3KKLA 3QV2A 3MCAA 5UKDA 2GHRA 5H9WA 3LVBA 1QRUA 3ZVKA 1XQVA 4NXMB 2EP5A 4EUEA 2WV7A 1H5UA 1ZVQA 1PEAA 4IJVA 1QS0A 1XZ8A 1TUBA 2KSQA 2ZROA 3AJ8A 4QO8A 3WQRA 3RVKA 5DGTA 3DMDA 1ZUNB 3TRKA 3JR4A 1S9HA 5L6MB 2Z9BA 4OBXA 3U56A 3MS4A 2M60A 1L7VC 1P3QQ 1Q0QA 5A05A 3DFMA 3UZUA 3GI1A 2QYHA 4BB6A 3ZHYA 4F4FA 4J1SA 2AD5A 3CKYA 2KM1A 4EMTA 4J16A 5GGYA 1L2DA 4NZNA 3IVCA 2D0DA 4OGLA 1RQGA 3X1XA 1FNNA 1WL8A 3KR0A 4XDZA 2OWEA 1AZTA 4B17A 4YB8A 4C5BA 3OAAD 3ADCA 1Z8NA 4FHCA 3K9FC 3RS4A 4Q3AA 3KOXA 1J42A 4M53A 4WT7A 1XMPA 3JR5A 1HV8A 5CIYA 4MK4A 4N0PA 1C14A 3G13A 1AQNA 3OQVA 4N7RA 1TGVA 4OGFA 2IXEA 4MIEA 5BUZA 4I1VA 4C0WA 3LOPA 1SKBA 1R4NA 1OKKD 5D5QA 4M8IA 3K31A 4D9CA 3ZJYA 4C6RA 1RPZA 2A35A 3HJCA 5TE9A 2HUPA 4D9HA 1QC5B 3B60A 4QYTA 5LB4A 2KQUA 3MJTA 4IGFA 4HGNA 3TCKA 1Y1RA 2WD8A 1H05A 4WBNB 2NW6A 3H3XA 1M2EA 4HGOA 5HHTA 3OE5A 4FFNA 1EDEA 1ND6A 2QR5A 3WRWA 3HZHA 1YUMA 4L0QA 2QJFA 1XYVA 2QMUA 3QKIA 1G55A 4M1EA 1IEVA 1UOEA 1Q16A 3MOGA 5TXGA 4FEEA 5FADA 4ZKDA 1PJQA 1QUEA 5LZ8A 3CR7A 1HXHA 1EFVB 4XW2A 4ND3A 3F6PA 3G5LA 5L3SB 2B2CA 2C9OA 2QN7A 1KY3A 4MAMA 1GZ3A 1VCHA 7ADHA 1DMSA 4XWWA 4B3RB 1H94A 1UEJA 1P3DA 5AVZA 4WADA 2QG4A 2ZT8A 4EGCB 1TW2A 2ORYA 3FD9A 5GZ3A