1TF0B

Crystal structure of the ga module complexed with human serum albumin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
b'TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum albumin
publication title Crystal structure and biological implications of a bacterial albumin binding module in complex with human serum albumin
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1tf0B00
1TF0B 2N35A 1GJSA 2MH8A 1PRBA 2J5YA 2VDBB 2FS1A 1GJTA 2LHGA 1GABA 2LHCA 2JWSA 2KDLA
chains in the Genus database with same CATH superfamily
4IJEA 4MM3B 4QOZC 1NY6A 1H6UA 3SMSA 4LJAA 1E32A 5DYIA 1DGHB 1L8QA 2BNKA 2Z8YM 3QYBA 2N35A 4GRIA 1QZMA 4WP2A 2DI0A 2VDBB 4IBGA 4LJ4A 4DV1M 4HLQA 1OQYA 3TWMA 1IN5A 2WSFF 1QAOA 2YFQA 4KHPM 1ZAEA 2EUCA 4NRWA 4LG2A 3B74A 4LJ8A 4PDGA 1IXSB 3TPZA 2DWNA 4GC9A 2QZ4A 1SXJB 5JI3E 1ZMVA 2KNVA 5EXXA 5ITTA 3NBXX 2R44A 3SMPA 1KYIA 1IM2A 3LCUA 3FUUA 3GLFB 3T15A 2X4AA 4NSRA 2Y21A 3SATA 5EJCA 4ANRA 2I7PA 3KXEC 4R71A 1R6BX 3FYDA 3MK6A 4CJ6A 3L2AA 4S12A 2CHVA 2JY7A 4WURA 3AV0A 3FRIA 1EIJA 1Z6TA 3SC3A 4QNMA 2DWLA 2C99A 3HJQA 4DUYM 2C9OA 4TUWA 5ITXA 2Y20A 4JI0M 3ZQJA 3VK8A 3L29A 5JI2E 4W5WA 5EXSA 2LHGA 2JA2A 2O5RA 2ERCA 3HU1A 3M7GA 4IBEA 3T38A 3PNVA 3SHFA 4JI2M 1ORYB 4PCZA 1TDZA 2CV0A 3D8LA 1TH4A 4DV4M 2UXCM 1G3IA 3H4JA 4IBDA 3K2LA 4BLCA 5C18A 2LHCA 2QP9X 4MGKE 1XMOM 1FNNA 3NBIA 4IBCA 8CATA 1GLNA 4JXJA 3GLGA 3SBJA 2XF3A 5H37D 2QBYB 1QUSA 1YLAA 2R65A 3ILKA 1GL7A 3K8ZA 2ZM6M 3B7ZA 4QHTA 1L2CA 4MGIE 1J5EM 4QNRA 1IN7A 3HHYA 4PD2A 5EP1A 5DNYA 1SXJC 3ZH9B 1XWIA 2EJSA 3M6AA 1WGNA 4FCWA 4I81A 3F92A 2DHYA 4DUZM 1K3XA 4GKKM 4NC6A 5EQTA 1HR0M 1MU5A 1SXJE 2QHOB 3PFIA 3UZUA 1VDLA 1QDTA 4WW0A 3GLFE 2EA0A 1HNWM 2VQEM 3CGWA 2LH0A 2UXDM 4KT0F 4L4UA 1Z5AA 3C3EA 2DAGA 2L4EA 2J7NA 3J7BA 2FH0A 3K9OA 1AIPC 4LGYA 4FCTA 1N77A 1A5TA 1L1TA 2KZSA 2FFJA 2G5GX 3UGJA 4JI7M 1OAIA 3K1JA 2F5QA 2MR9A 1HJPA 1TTEA 4QHSA 1NV8A 4LGMA 2F5SA 2NQ8C 3GQ3A 2VF7A 4FCVA 3U6OA 3GPPA 4GHLA 1DGBA 1L2BA 4JV5M 3J7AS 1Z59A 1UM8A 3RFWA 1VEKA 4GEWA 2LTUA 5FTKA 1OTRA 1SXJD 1OIZA 1NHWC 4XGIA 3VKHA 1PJTA 5IT9S 4AI6A 3T6PA 2ZAMA 5BR8M 2R45A 3R8FA 1IBLM 2E5LM 3KS4A 2ZAOA 4HEOA 4BBAA 2DAEA 2F4VM 2MROB 2EKKA 1C1KA 3A42A 2UUAM 3VKGA 3QWLA 3U61A 1J09A 1PJIA 2BWEA 2XFSA 2W82A 2HL7A 1NVMA 3PNYA 2K47A 1HNXM 2LVPC 3TWKA 2RGOA 3VLFB 4X66M 5ITYA 2QSFX 1Q02A 2JZ1A 2XH9A 3E46A 2RRUA 2KRUA 4XK8F 1ZMUA 4GMQA 3GPXA 4M9XA 1GABA 4FWHA 1RU3A 4LZZA 4LY6A 1XNRM 5GKNA 3HU2A 2F5OA 1VG5A 2HKJA 5IZ7D 5A2QS 3JAMS 3U6QA 2V1UA 1ZMWA 3U60B 2F5PA 4JI1M 5ITUA 1NY5A 3CF6E 4AKIA 1FJGM 4R3DA 3U6EA 5EXPA 1WXQA 1XB2B 3U6MA 2OPFA 4DR4M 2L7IA 1T3TA 1X37A 4DR7M 1HQYE 1IY1A 1R7RA 1T6OA 1TF0B 2I7NA 2XEPA 4MB7A 2HAKA 2XFTA 2LNHC 4NXMM 1N78A 2KHHA 3AKZA 3ZC7B 2JY5A 3V76A 3FUXA 4BB9A 3L25A 3LW5F 2OOAA 4FVMA 1Q3BA 2KEBA 4JI5M 2LVAA 3FRHA 3QYEA 3UJNA 3GLGB 1ZV1A 4MGZE 1SG9A 3RE8A 5FTNA 1YE9A 3LMMA 4DV5M 1IN4A 3KVWA 4A3VB 4L6V6 4M0DA 4REZA 1T43A 5FTMA 3FD9A 5IREB 4DV7M 4LFCM 2CV1A 3QAUA 3SYKA 1GJSA 4KODA 4NXNM 2G8LA 4RF0A 5EP2A 5KQDA 4YHHM 3GQ5A 3T1HM 1XC8A 1N34M 3GRRA 1JQJC 3KOYE 3GLIA 2HHHM 2XZUA 3NWLA 3I4YA 1XMQM 5DFLA 3A98B 3IG8A 4D81A 2K6BA 4GIPA 3U6SA 4OX9M 1IXRC 2J7OA 1YUBA 2DAKA 4JI4M 3A46A 3HJSA 2Y0QA 3Q8GA 4LFAM 4G4OA 4B3MM 4IIWA 1E9RA 3W0FA 2MJ5B 3DZDA 4LF9M 2OO9A 4I8OA 1CUKA 2R0IA 3U6DA 2D7HA 1GKIA 4L15A 4X65M 1XHBA 4IJFA 2DAIA 4XBOA 4YY3M 4FWGA 3OTOM 1GO5A 4FW9A 1L2DA 2JXNA 4LZJA 2UXBM 4ZPXA 4IBFA 3SAUA 5ITXE 1NV9A 1P3QQ 5LMNM 1QAQA 4L8RC 1JR3A 3JR4A 3WHLA 5C1BA 3DA1A 1DO0A 2X8AA 3GRUA 4DV2M 1OFIA 3SAVA 4II7A 2CV2A 5KPTA 3VK7A 3JR5A 4AKGA 4AG5A 3PVSA 2KNAA 3J27B 3GLGE 4FD2A 4JI6M 2R46A 3GQ4A 3GRVA 5FSWA 3U61B 2YQZA 2VIIA 4P16A 1KSFX 1QYRA 4IBIA 5KO3A 3I51A 3L27A 4NSOB 1G59A 1G4AE 4DBGB 2G3QA 4DR1M 3FTFA 2O01F 1K82A 2LBCA 1QANA 3IG5A 5KPZA 4JYAM 4G4QA 1EE8A 1PGYA 1IBKM 1DGFA 5EP3A 4RKUF 3DFZA 2C98A 2M60A 1VEJA 1IN6A 2KDLA 2A5YB 4GH9A 1R2ZA 2RKOA 3KW6A 4PT5A 4OU7A 2LVQD 2XSZA 4K0KM 2L6OA 3I4VA 4JI3M 1L1ZA 3BBZA 1HQCA 1D2NA 1XXHA 5E26A 2R18A 3FTCA 4F2LA 2VF8A 4I4LA 3FE3A 3UK6A 1QVRA 4LJ9A 3KSXA 4CHTB 4GKJM 1QAMA 3AOEA 5KPRA 2R4EA 1IXZA 1WJ7A 4X64M 3VFDA 2CEAA 1JB0F 3SYLA 4B3TM 2FE8A 4FWDA 1TGUA 2DENA 4DR2M 2L2DA 2WSEF 4QOSA 3EIEA 2L7HA 3IECA 3L26A 4D82A 2LVOC 3KP0E 2P5TA 2LVNC 3E21A 1W5TA 3KFUG 3KS8A 2BJVA 5EP4A 3GLHA 2DWMA 1WHCA 5FTLA 2Z4SA 4PDIA 2XZFA 2JP7A 4GITA 4NL4H 2FOIC 3HKPA 3RGSA 1UFZA 1HT1E 3TWLA 2DZOB 2DZLA 2RGHA 1KFVA 2D7EA 2CHQA 1G8PA 1V92A 5DYGA 3MJ5A 1TH3A 2R6FA 3GLIB 4EIWA 2MH8A 1PRBA 4LF6M 2GQFA 4ITQA 3KOZE 2H1RA 3FYCA 4L16A 2LXEA 3K9PA 2BJWA 3C3DA 3KP1E 4AZFA 3U5ZA 3LCVB 3PXGA 1WGLA 2Q2EB 3J2PB 2CUZA 3VDUA 2OQ4A 4LRTA 2Z3XA 4B08A 4DR5M 2R62A 4DV0M 1AUAA 2F5NA 2DNAA 4RF1A 3TQSA 2OOBA 4D80A 2CWBA 3I01M 2UUCM 1E9SA 3KDSE 7CATA 1IBMM 1GL6A 3E9SA 4IBKA 4GC5A 4DV6M 2EO2A 1G71A 4OVZA 3U6PA 2K0BX 2VQFM 2L09A 5FLXS 2ZTCA 1QUTA 2FS1A 1WR1B 4Z8XA 1N75A 2DWZB 4M9SA 2CFOA 3GP1A 3H4MA 2XLJA 5ITQA 1XNQM 3CTWB 1K3WA 4B3SM 3FTEA 4B7HA 3B9PA 1PJJA 2XGNA 4Z6YA 2BWBA 2C9CA 3B7NA 1NO1A 2KRKA 4G6ZA 4LF5M 2DKLA 1IQPA 2H5XA 2V6ZM 1IY2A 3WHKA 3U60A 2KXEA 2KNZA 2CE7A 2DVWB 5E6JA 4JN6A 1F4IA 3KOXE 2JNHA 3FUTA 2JWSA 3GLIE 1V33A 3HHZA 3U6LA 2X49A 1EFUB 1OAOC 2C96A 3HY5A 2Z7JA 3BOSA 3T1YM 4LJ6A 1Y8GA 1GJTA 1NJFA 1QQWA 3ZCBB 1DGHA 2Y0TA 4KLNA 3SASA 3KSJA 4MGYE 1DV0A 1C7YA 2WSCF 2EKFA 4LCBA 4RNAA 3D8BA 1D0KA 5BPVA 5KQ8A 4OW0A 2CRUA 1OJLA 2QENA 1TH2A 2QCUA 3KOWE 4NOOB 4LRSA 1XXHB 4B7FA 5ITRA 3SARA 1OIPA 1I94M 5L8RF 1NNUC 4M0WA 5F3WA 1IXSA 2V1CA 1Z5CA 3LVVA 5FTJA 4CGYB 3B7QA 1IY0A 1QZEA 1SXJA 1YSYA 1Z5BA 3GLFA 2JY8A 4LFBM 3DOAA 2ZANA 1JR3E 4X62M 5EXTA 4NRVA 2KA6B 3GO8A 2UU9M 1TDHA 2C5RA 4F1IA 2QQ8A 4CIZA 3VDPA 2AHMA 3C9PA 4LJ5A 1QDRA 2ZBKB 4R7GA 3E4RA 1NHGC 1D0MA 3TE6A 2J5YA 4MH0E 1N32M 1WIVA 4G4RA 2JZ0A 2KZUA 4G4NA 2DZNB 3GLHB 4LF8M 2QPAA 1R4GA 2QNJA 1E94E 2O25A 4Y28F 2M5ZA 1VDDA 4LJ7A 3SHGB 3C58A 4HL4A 3GPUA 1N36M 4L78A 1LTMA 5LMUM 4GHAA 3K92A 4MGHA 2K9DA 4LF7M 3FUWA 3HX3A 3LQRA 3J81S 3GPYA 4AQYM 4M9ZA 2HWJA 2MGWA 3UMMA 4LF4M 2Z4RA 3AJIB 4I5SA 2UUBM 1NNJA 1OFHA 3R9XB 2L4FA 4JI8M 2FNAA 1JR3D 3A45A 4AKHA 4P17A 4B7GA 2B3TA 5IWAM 2HCBA 1IN8A 2CP8A 3SAWA 2QBYA 2LWXA 3TL4X 1MN3A 3AFHA 1Q39A 3HU3A 3U5ZB 1Q3CA 2DHRA 1MJGM 1W5SA 4DR6M 3AOGA 3W0LB 3I04M 1J7KA 4AG6A 1XXHE 3AOEC 4G3OA 1PM5A 3EIHA 1TR8A 2APLA 4B3RM 3BXWA 4CISA 1N33M 1NJGA 3HHXA 3MMPA 2JY6B 1OKSA 3IHPA 3CF0A 4OVZB 4KO8A 1DGGA 1S3SA 3W67A 1BVSA 3THGA 4DV3M 1PJQA 1HT2E 1R5LA 3AL0C 3B89A 2CHGA 1PJSA 2ZTDA 3LQQA 2D7GA 3U6CA 4Q7JA 1V34A 2JUJA 3SFZA 1HNZM 2DXIA 3LVWA 3HZJA 4UN2B 1DO2A 3HGIA 3RGPA 2WZJA 1NSFA 2DAMA 2GNOA 3CF2A 4AW4A 1IFYA 3FUVA 2R4JA 3GLHE 2YNMD 3W68A 2XSZD 3FKEA 3HJ8A 2KW0A 4IBJA 1LV7A 3Q8XA 1D0LA 3L28A 3HHWA 4IBBA 3M0EA 3MHVC 1MX0A 3GRYA 3FTDA 1G41A 3HWSA 1GVNA 1I4WA 1VEGA 3J80S 4DR3M 1R2YA 1ZQ9A 2YR0A 1VQ1A
chains in the Genus database with same CATH topology
1TF0B 2N35A 1GJSA 2MH8A 1PRBA 2J5YA 2VDBB 2FS1A 1GJTA 2LHGA 1GABA 2LHCA 2JWSA 2KDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF0 B;  2N35 A;  1GJS A;  2MH8 A;  1PRB A;  2J5Y A;  2VDB B;  2FS1 A;  1GJT A;  2LHG A;  1GAB A;  2LHC A;  2JWS A;  2KDL A; 
#chains in the Genus database with same CATH topology
 4IJE A;  4MM3 B;  4QOZ C;  1NY6 A;  1H6U A;  3SMS A;  4LJA A;  1E32 A;  5DYI A;  1DGH B;  1L8Q A;  2BNK A;  2Z8Y M;  3QYB A;  2N35 A;  4GRI A;  1QZM A;  4WP2 A;  2DI0 A;  2VDB B;  4IBG A;  4LJ4 A;  4DV1 M;  4HLQ A;  1OQY A;  3TWM A;  1IN5 A;  2WSF F;  1QAO A;  2YFQ A;  4KHP M;  1ZAE A;  2EUC A;  4NRW A;  4LG2 A;  3B74 A;  4LJ8 A;  4PDG A;  1IXS B;  3TPZ A;  2DWN A;  4GC9 A;  2QZ4 A;  1SXJ B;  5JI3 E;  1ZMV A;  2KNV A;  5EXX A;  5ITT A;  3NBX X;  2R44 A;  3SMP A;  1KYI A;  1IM2 A;  3LCU A;  3FUU A;  3GLF B;  3T15 A;  2X4A A;  4NSR A;  2Y21 A;  3SAT A;  5EJC A;  4ANR A;  2I7P A;  3KXE C;  4R71 A;  1R6B X;  3FYD A;  3MK6 A;  4CJ6 A;  3L2A A;  4S12 A;  2CHV A;  2JY7 A;  4WUR A;  3AV0 A;  3FRI A;  1EIJ A;  1Z6T A;  3SC3 A;  4QNM A;  2DWL A;  2C99 A;  3HJQ A;  4DUY M;  2C9O A;  4TUW A;  5ITX A;  2Y20 A;  4JI0 M;  3ZQJ A;  3VK8 A;  3L29 A;  5JI2 E;  4W5W A;  5EXS A;  2LHG A;  2JA2 A;  2O5R A;  2ERC A;  3HU1 A;  3M7G A;  4IBE A;  3T38 A;  3PNV A;  3SHF A;  4JI2 M;  1ORY B;  4PCZ A;  1TDZ A;  2CV0 A;  3D8L A;  1TH4 A;  4DV4 M;  2UXC M;  1G3I A;  3H4J A;  4IBD A;  3K2L A;  4BLC A;  5C18 A;  2LHC A;  2QP9 X;  4MGK E;  1XMO M;  1FNN A;  3NBI A;  4IBC A;  8CAT A;  1GLN A;  4JXJ A;  3GLG A;  3SBJ A;  2XF3 A;  5H37 D;  2QBY B;  1QUS A;  1YLA A;  2R65 A;  3ILK A;  1GL7 A;  3K8Z A;  2ZM6 M;  3B7Z A;  4QHT A;  1L2C A;  4MGI E;  1J5E M;  4QNR A;  1IN7 A;  3HHY A;  4PD2 A;  5EP1 A;  5DNY A;  1SXJ C;  3ZH9 B;  1XWI A;  2EJS A;  3M6A A;  1WGN A;  4FCW A;  4I81 A;  3F92 A;  2DHY A;  4DUZ M;  1K3X A;  4GKK M;  4NC6 A;  5EQT A;  1HR0 M;  1MU5 A;  1SXJ E;  2QHO B;  3PFI A;  3UZU A;  1VDL A;  1QDT A;  4WW0 A;  3GLF E;  2EA0 A;  1HNW M;  2VQE M;  3CGW A;  2LH0 A;  2UXD M;  4KT0 F;  4L4U A;  1Z5A A;  3C3E A;  2DAG A;  2L4E A;  2J7N A;  3J7B A;  2FH0 A;  3K9O A;  1AIP C;  4LGY A;  4FCT A;  1N77 A;  1A5T A;  1L1T A;  2KZS A;  2FFJ A;  2G5G X;  3UGJ A;  4JI7 M;  1OAI A;  3K1J A;  2F5Q A;  2MR9 A;  1HJP A;  1TTE A;  4QHS A;  1NV8 A;  4LGM A;  2F5S A;  2NQ8 C;  3GQ3 A;  2VF7 A;  4FCV A;  3U6O A;  3GPP A;  4GHL A;  1DGB A;  1L2B A;  4JV5 M;  3J7A S;  1Z59 A;  1UM8 A;  3RFW A;  1VEK A;  4GEW A;  2LTU A;  5FTK A;  1OTR A;  1SXJ D;  1OIZ A;  1NHW C;  4XGI A;  3VKH A;  1PJT A;  5IT9 S;  4AI6 A;  3T6P A;  2ZAM A;  5BR8 M;  2R45 A;  3R8F A;  1IBL M;  2E5L M;  3KS4 A;  2ZAO A;  4HEO A;  4BBA A;  2DAE A;  2F4V M;  2MRO B;  2EKK A;  1C1K A;  3A42 A;  2UUA M;  3VKG A;  3QWL A;  3U61 A;  1J09 A;  1PJI A;  2BWE A;  2XFS A;  2W82 A;  2HL7 A;  1NVM A;  3PNY A;  2K47 A;  1HNX M;  2LVP C;  3TWK A;  2RGO A;  3VLF B;  4X66 M;  5ITY A;  2QSF X;  1Q02 A;  2JZ1 A;  2XH9 A;  3E46 A;  2RRU A;  2KRU A;  4XK8 F;  1ZMU A;  4GMQ A;  3GPX A;  4M9X A;  1GAB A;  4FWH A;  1RU3 A;  4LZZ A;  4LY6 A;  1XNR M;  5GKN A;  3HU2 A;  2F5O A;  1VG5 A;  2HKJ A;  5IZ7 D;  5A2Q S;  3JAM S;  3U6Q A;  2V1U A;  1ZMW A;  3U60 B;  2F5P A;  4JI1 M;  5ITU A;  1NY5 A;  3CF6 E;  4AKI A;  1FJG M;  4R3D A;  3U6E A;  5EXP A;  1WXQ A;  1XB2 B;  3U6M A;  2OPF A;  4DR4 M;  2L7I A;  1T3T A;  1X37 A;  4DR7 M;  1HQY E;  1IY1 A;  1R7R A;  1T6O A;  1TF0 B;  2I7N A;  2XEP A;  4MB7 A;  2HAK A;  2XFT A;  2LNH C;  4NXM M;  1N78 A;  2KHH A;  3AKZ A;  3ZC7 B;  2JY5 A;  3V76 A;  3FUX A;  4BB9 A;  3L25 A;  3LW5 F;  2OOA A;  4FVM A;  1Q3B A;  2KEB A;  4JI5 M;  2LVA A;  3FRH A;  3QYE A;  3UJN A;  3GLG B;  1ZV1 A;  4MGZ E;  1SG9 A;  3RE8 A;  5FTN A;  1YE9 A;  3LMM A;  4DV5 M;  1IN4 A;  3KVW A;  4A3V B;  4L6V 6;  4M0D A;  4REZ A;  1T43 A;  5FTM A;  3FD9 A;  5IRE B;  4DV7 M;  4LFC M;  2CV1 A;  3QAU A;  3SYK A;  1GJS A;  4KOD A;  4NXN M;  2G8L A;  4RF0 A;  5EP2 A;  5KQD A;  4YHH M;  3GQ5 A;  3T1H M;  1XC8 A;  1N34 M;  3GRR A;  1JQJ C;  3KOY E;  3GLI A;  2HHH M;  2XZU A;  3NWL A;  3I4Y A;  1XMQ M;  5DFL A;  3A98 B;  3IG8 A;  4D81 A;  2K6B A;  4GIP A;  3U6S A;  4OX9 M;  1IXR C;  2J7O A;  1YUB A;  2DAK A;  4JI4 M;  3A46 A;  3HJS A;  2Y0Q A;  3Q8G A;  4LFA M;  4G4O A;  4B3M M;  4IIW A;  1E9R A;  3W0F A;  2MJ5 B;  3DZD A;  4LF9 M;  2OO9 A;  4I8O A;  1CUK A;  2R0I A;  3U6D A;  2D7H A;  1GKI A;  4L15 A;  4X65 M;  1XHB A;  4IJF A;  2DAI A;  4XBO A;  4YY3 M;  4FWG A;  3OTO M;  1GO5 A;  4FW9 A;  1L2D A;  2JXN A;  4LZJ A;  2UXB M;  4ZPX A;  4IBF A;  3SAU A;  5ITX E;  1NV9 A;  1P3Q Q;  5LMN M;  1QAQ A;  4L8R C;  1JR3 A;  3JR4 A;  3WHL A;  5C1B A;  3DA1 A;  1DO0 A;  2X8A A;  3GRU A;  4DV2 M;  1OFI A;  3SAV A;  4II7 A;  2CV2 A;  5KPT A;  3VK7 A;  3JR5 A;  4AKG A;  4AG5 A;  3PVS A;  2KNA A;  3J27 B;  3GLG E;  4FD2 A;  4JI6 M;  2R46 A;  3GQ4 A;  3GRV A;  5FSW A;  3U61 B;  2YQZ A;  2VII A;  4P16 A;  1KSF X;  1QYR A;  4IBI A;  5KO3 A;  3I51 A;  3L27 A;  4NSO B;  1G59 A;  1G4A E;  4DBG B;  2G3Q A;  4DR1 M;  3FTF A;  2O01 F;  1K82 A;  2LBC A;  1QAN A;  3IG5 A;  5KPZ A;  4JYA M;  4G4Q A;  1EE8 A;  1PGY A;  1IBK M;  1DGF A;  5EP3 A;  4RKU F;  3DFZ A;  2C98 A;  2M60 A;  1VEJ A;  1IN6 A;  2KDL A;  2A5Y B;  4GH9 A;  1R2Z A;  2RKO A;  3KW6 A;  4PT5 A;  4OU7 A;  2LVQ D;  2XSZ A;  4K0K M;  2L6O A;  3I4V A;  4JI3 M;  1L1Z A;  3BBZ A;  1HQC A;  1D2N A;  1XXH A;  5E26 A;  2R18 A;  3FTC A;  4F2L A;  2VF8 A;  4I4L A;  3FE3 A;  3UK6 A;  1QVR A;  4LJ9 A;  3KSX A;  4CHT B;  4GKJ M;  1QAM A;  3AOE A;  5KPR A;  2R4E A;  1IXZ A;  1WJ7 A;  4X64 M;  3VFD A;  2CEA A;  1JB0 F;  3SYL A;  4B3T M;  2FE8 A;  4FWD A;  1TGU A;  2DEN A;  4DR2 M;  2L2D A;  2WSE F;  4QOS A;  3EIE A;  2L7H A;  3IEC A;  3L26 A;  4D82 A;  2LVO C;  3KP0 E;  2P5T A;  2LVN C;  3E21 A;  1W5T A;  3KFU G;  3KS8 A;  2BJV A;  5EP4 A;  3GLH A;  2DWM A;  1WHC A;  5FTL A;  2Z4S A;  4PDI A;  2XZF A;  2JP7 A;  4GIT A;  4NL4 H;  2FOI C;  3HKP A;  3RGS A;  1UFZ A;  1HT1 E;  3TWL A;  2DZO B;  2DZL A;  2RGH A;  1KFV A;  2D7E A;  2CHQ A;  1G8P A;  1V92 A;  5DYG A;  3MJ5 A;  1TH3 A;  2R6F A;  3GLI B;  4EIW A;  2MH8 A;  1PRB A;  4LF6 M;  2GQF A;  4ITQ A;  3KOZ E;  2H1R A;  3FYC A;  4L16 A;  2LXE A;  3K9P A;  2BJW A;  3C3D A;  3KP1 E;  4AZF A;  3U5Z A;  3LCV B;  3PXG A;  1WGL A;  2Q2E B;  3J2P B;  2CUZ A;  3VDU A;  2OQ4 A;  4LRT A;  2Z3X A;  4B08 A;  4DR5 M;  2R62 A;  4DV0 M;  1AUA A;  2F5N A;  2DNA A;  4RF1 A;  3TQS A;  2OOB A;  4D80 A;  2CWB A;  3I01 M;  2UUC M;  1E9S A;  3KDS E;  7CAT A;  1IBM M;  1GL6 A;  3E9S A;  4IBK A;  4GC5 A;  4DV6 M;  2EO2 A;  1G71 A;  4OVZ A;  3U6P A;  2K0B X;  2VQF M;  2L09 A;  5FLX S;  2ZTC A;  1QUT A;  2FS1 A;  1WR1 B;  4Z8X A;  1N75 A;  2DWZ B;  4M9S A;  2CFO A;  3GP1 A;  3H4M A;  2XLJ A;  5ITQ A;  1XNQ M;  3CTW B;  1K3W A;  4B3S M;  3FTE A;  4B7H A;  3B9P A;  1PJJ A;  2XGN A;  4Z6Y A;  2BWB A;  2C9C A;  3B7N A;  1NO1 A;  2KRK A;  4G6Z A;  4LF5 M;  2DKL A;  1IQP A;  2H5X A;  2V6Z M;  1IY2 A;  3WHK A;  3U60 A;  2KXE A;  2KNZ A;  2CE7 A;  2DVW B;  5E6J A;  4JN6 A;  1F4I A;  3KOX E;  2JNH A;  3FUT A;  2JWS A;  3GLI E;  1V33 A;  3HHZ A;  3U6L A;  2X49 A;  1EFU B;  1OAO C;  2C96 A;  3HY5 A;  2Z7J A;  3BOS A;  3T1Y M;  4LJ6 A;  1Y8G A;  1GJT A;  1NJF A;  1QQW A;  3ZCB B;  1DGH A;  2Y0T A;  4KLN A;  3SAS A;  3KSJ A;  4MGY E;  1DV0 A;  1C7Y A;  2WSC F;  2EKF A;  4LCB A;  4RNA A;  3D8B A;  1D0K A;  5BPV A;  5KQ8 A;  4OW0 A;  2CRU A;  1OJL A;  2QEN A;  1TH2 A;  2QCU A;  3KOW E;  4NOO B;  4LRS A;  1XXH B;  4B7F A;  5ITR A;  3SAR A;  1OIP A;  1I94 M;  5L8R F;  1NNU C;  4M0W A;  5F3W A;  1IXS A;  2V1C A;  1Z5C A;  3LVV A;  5FTJ A;  4CGY B;  3B7Q A;  1IY0 A;  1QZE A;  1SXJ A;  1YSY A;  1Z5B A;  3GLF A;  2JY8 A;  4LFB M;  3DOA A;  2ZAN A;  1JR3 E;  4X62 M;  5EXT A;  4NRV A;  2KA6 B;  3GO8 A;  2UU9 M;  1TDH A;  2C5R A;  4F1I A;  2QQ8 A;  4CIZ A;  3VDP A;  2AHM A;  3C9P A;  4LJ5 A;  1QDR A;  2ZBK B;  4R7G A;  3E4R A;  1NHG C;  1D0M A;  3TE6 A;  2J5Y A;  4MH0 E;  1N32 M;  1WIV A;  4G4R A;  2JZ0 A;  2KZU A;  4G4N A;  2DZN B;  3GLH B;  4LF8 M;  2QPA A;  1R4G A;  2QNJ A;  1E94 E;  2O25 A;  4Y28 F;  2M5Z A;  1VDD A;  4LJ7 A;  3SHG B;  3C58 A;  4HL4 A;  3GPU A;  1N36 M;  4L78 A;  1LTM A;  5LMU M;  4GHA A;  3K92 A;  4MGH A;  2K9D A;  4LF7 M;  3FUW A;  3HX3 A;  3LQR A;  3J81 S;  3GPY A;  4AQY M;  4M9Z A;  2HWJ A;  2MGW A;  3UMM A;  4LF4 M;  2Z4R A;  3AJI B;  4I5S A;  2UUB M;  1NNJ A;  1OFH A;  3R9X B;  2L4F A;  4JI8 M;  2FNA A;  1JR3 D;  3A45 A;  4AKH A;  4P17 A;  4B7G A;  2B3T A;  5IWA M;  2HCB A;  1IN8 A;  2CP8 A;  3SAW A;  2QBY A;  2LWX A;  3TL4 X;  1MN3 A;  3AFH A;  1Q39 A;  3HU3 A;  3U5Z B;  1Q3C A;  2DHR A;  1MJG M;  1W5S A;  4DR6 M;  3AOG A;  3W0L B;  3I04 M;  1J7K A;  4AG6 A;  1XXH E;  3AOE C;  4G3O A;  1PM5 A;  3EIH A;  1TR8 A;  2APL A;  4B3R M;  3BXW A;  4CIS A;  1N33 M;  1NJG A;  3HHX A;  3MMP A;  2JY6 B;  1OKS A;  3IHP A;  3CF0 A;  4OVZ B;  4KO8 A;  1DGG A;  1S3S A;  3W67 A;  1BVS A;  3THG A;  4DV3 M;  1PJQ A;  1HT2 E;  1R5L A;  3AL0 C;  3B89 A;  2CHG A;  1PJS A;  2ZTD A;  3LQQ A;  2D7G A;  3U6C A;  4Q7J A;  1V34 A;  2JUJ A;  3SFZ A;  1HNZ M;  2DXI A;  3LVW A;  3HZJ A;  4UN2 B;  1DO2 A;  3HGI A;  3RGP A;  2WZJ A;  1NSF A;  2DAM A;  2GNO A;  3CF2 A;  4AW4 A;  1IFY A;  3FUV A;  2R4J A;  3GLH E;  2YNM D;  3W68 A;  2XSZ D;  3FKE A;  3HJ8 A;  2KW0 A;  4IBJ A;  1LV7 A;  3Q8X A;  1D0L A;  3L28 A;  3HHW A;  4IBB A;  3M0E A;  3MHV C;  1MX0 A;  3GRY A;  3FTD A;  1G41 A;  3HWS A;  1GVN A;  1I4W A;  1VEG A;  3J80 S;  4DR3 M;  1R2Y A;  1ZQ9 A;  2YR0 A;  1VQ1 A; 
#chains in the Genus database with same CATH homology
 1TF0 B;  2N35 A;  1GJS A;  2MH8 A;  1PRB A;  2J5Y A;  2VDB B;  2FS1 A;  1GJT A;  2LHG A;  1GAB A;  2LHC A;  2JWS A;  2KDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...