1TF0B

Crystal structure of the ga module complexed with human serum albumin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Serum albumin
publication title Crystal structure and biological implications of a bacterial albumin binding module in complex with human serum albumin
pubmed doi rcsb
source organism Finegoldia magna
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1tf0B00
1GABA 2KDLA 2J5YA 1TF0B 1GJTA 2N35A 2JWSA 2LHCA 2LHGA 2FS1A 2MH8A 1GJSA 1PRBA 2VDBB
chains in the Genus database with same CATH superfamily
2OOAA 2CHVA 2G8LA 2Q2EB 2QHOB 1RU3A 2BWEA 1D0KA 2MJ5B 3L26A 4WW0A 3SARA 3MK6A 3C3DA 5H37D 5IT9S 4M9ZA 1GKIA 2Y20A 4L16A 5EP2A 2LBCA 3SAUA 1N36M 3C3EA 1UM8A 4LF7M 5IREB 1KYIA 2D7HA 5C18A 2QPAA 1PM5A 2UUCM 1G41A 1XWIA 3J27B 2QENA 3CF6E 1N33M 3W0LB 5ITQA 2CUZA 1SXJC 3VK8A 5DNYA 1L1ZA 2V1CA 2UUBM 3J7AS 2DNAA 2Y21A 4OVZA 4D80A 5EP1A 5JI3E 3GPUA 3AOEC 5EXPA 4DR4M 5FTJA 1IBKM 3FTEA 2JNHA 4II7A 4JN6A 2QBYB 1GL7A 4PCZA 2JP7A 4MGYE 3PVSA 4X62M 3SATA 2QZ4A 3F92A 4NXNM 2CWBA 2R62A 1SG9A 4B3TM 2L2DA 4UN2B 2JZ1A 3KSJA 4GITA 4LGYA 3KOYE 5A2QS 2ZANA 3U6OA 2J7NA 1ORYB 1TH2A 4NL4H 3R8FA 4NSRA 1NY6A 2OOBA 3AFHA 5FTMA 1Z5BA 2C99A 2QQ8A 4X64M 2DXIA 4OU7A 5ITXE 1TDHA 3RGSA 3GPPA 3C58A 4FWDA 2JA2A 2KNVA 2L4EA 2OPFA 4I81A 3NWLA 4R71A 1WXQA 2FNAA 4DR7M 1X37A 3IECA 4D81A 4KHPM 4LJAA 4REZA 3I04M 5IWAM 3K9PA 3RGPA 4FWHA 3FUXA 2R4EA 4NOOB 5LMNM 3IG5A 3QYBA 3MMPA 2HAKA 1G3IA 2DAEA 2RKOA 1NJGA 2VQEM 4IBBA 3GPYA 2NQ8C 1VQ1A 4LJ9A 3M7GA 1QAQA 4DV6M 3CTWB 1GJTA 2HHHM 1GJSA 2XH9A 4OW0A 3K92A 4LJ7A 3U61B 2V1UA 2X49A 1MN3A 2KW0A 5F3WA 3WHLA 4P17A 4DR2M 4XGIA 1LV7A 1AUAA 3GLIB 2DZOB 2D7EA 2F5SA 2ZM6M 1IXSB 4LFCM 4IBJA 2ERCA 2MH8A 2XFTA 3TWKA 2VDBB 2Z4RA 3V76A 3DFZA 3E4RA 3GPXA 3UGJA 1Z5AA 3PNYA 4QOSA 2XSZD 2JY6B 1NVMA 1OAIA 1K3XA 2F5PA 4KLNA 4DR6M 5EXSA 4CGYB 2R65A 5ITYA 3SBJA 4QOZC 2MGWA 3LQQA 4TUWA 3L25A 1NSFA 3U6QA 1DGHA 3ILKA 4IBFA 3KDSE 4NSOB 3SHGB 3FUWA 1ZMVA 3HU3A 4FCVA 4HLQA 3E9SA 5KPZA 2W82A 2DENA 2RGOA 3GLGA 1IXZA 4EIWA 4ANRA 1WIVA 4QHSA 4IBKA 1Q3BA 1Q3CA 1IM2A 2L7IA 3ZC7B 1DGFA 7CATA 4GIPA 4RKUF 4B3MM 3SMSA 2LHCA 2QNJA 2R45A 1G8PA 1EE8A 3GLFB 2X4AA 1F4IA 1PJQA 5DFLA 2DAKA 2M60A 2WSFF 3PNVA 3CF2A 2E5LM 1QQWA 1V92A 1R2ZA 1OFHA 4DV3M 3GRVA 3L27A 4JI2M 1WGLA 1TGUA 5E6JA 1QZEA 1XXHB 1JR3A 3SAVA 3SHFA 2JY7A 2APLA 1I4WA 1HQCA 2DWZB 1GL6A 4KO8A 3SAWA 1G4AE 4L4UA 2R6FA 1WR1B 3VKHA 2CP8A 4JI3M 4CIZA 1W5SA 2KZSA 1L2DA 4AKIA 2XGNA 3DOAA 1T6OA 4M0WA 3I4VA 2BWBA 4B3RM 1T43A 4AKGA 4IIWA 1OKSA 2FS1A 2EA0A 4FCWA 4Z6YA 1GLNA 3KSXA 3J7BA 5ITRA 4Y28F 4L6V6 5BPVA 1TR8A 4B7FA 4RF1A 3SYLA 4I5SA 4JI7M 1FNNA 2L7HA 1YE9A 1R7RA 3AV0A 3FUTA 3LVWA 1TF0B 4IBDA 3BBZA 2LNHC 4DBGB 2LVAA 3HKPA 2H5XA 2DI0A 3GRYA 3PFIA 2BJWA 2FOIC 2O25A 3FTCA 4LF6M 1WJ7A 2FFJA 3LCVB 3THGA 1TH4A 1ZQ9A 5KPTA 1K82A 2CHGA 4DV1M 4LF9M 2CE7A 2WSEF 2EKKA 3C9PA 1N77A 3KFUG 4LCBA 1NNUC 1J7KA 3T6PA 1J09A 1DGGA 3QYEA 1R4GA 3MHVC 4FD2A 2LVOC 3RFWA 5EQTA 2R44A 2KRKA 4W5WA 3WHKA 3B74A 1SXJE 3JR4A 1IBMM 1KSFX 3ZCBB 3U5ZB 1Y8GA 3HJSA 2QBYA 1T3TA 3LQRA 3U6LA 4B3SM 3TQSA 4JI6M 1L2CA 4NRWA 1SXJA 3SC3A 4GMQA 1PJTA 4GHLA 2R46A 1Z6TA 4DV7M 2EO2A 3AOEA 4IJFA 2LVQD 5EP4A 5DYIA 2K0BX 1QUTA 1VEJA 2I7PA 2MROB 4QNRA 5KO3A 4DR5M 3T1HM 2XZFA 4QHTA 2LXEA 1NY5A 4L15A 3B7ZA 3A42A 4F2LA 4HEOA 2KRUA 3HGIA 2UXDM 4F1IA 3B89A 4KT0F 1XB2B 1DV0A 1FJGM 2OO9A 1ZMUA 4LGMA 1D0LA 3NBXX 1HNZM 4LJ4A 3I01M 4G3OA 4JI5M 2FE8A 4IBGA 4XK8F 2XLJA 4DR1M 2QSFX 1MX0A 1Z59A 1IBLM 3SASA 4AG5A 1PGYA 4NRVA 3T38A 2DAGA 4AKHA 3A98B 3UMMA 1NNJA 3FYDA 3FUUA 4X66M 1OAOC 3GO8A 3U6CA 2X8AA 2JZ0A 3M6AA 4Z8XA 3MJ5A 1UFZA 3FUVA 4G4QA 4JXJA 1GABA 2OQ4A 1EFUB 3FYCA 4DV5M 2G3QA 2R4JA 4MGKE 3DA1A 4PT5A 1DO2A 4Q7JA 3Q8XA 3KS4A 4XBOA 1D0MA 1Q02A 2K9DA 1HT2E 2DAMA 3H4JA 3KS8A 4BLCA 4OX9M 2O01F 2LWXA 3AOGA 4AW4A 2BNKA 3W68A 2B3TA 2LVNC 2V6ZM 5FTNA 5ITUA 3U60A 1V33A 2L09A 1OFIA 2Y0QA 3I4YA 2LH0A 2JXNA 4MB7A 5FTKA 3TE6A 3W67A 3FTDA 3FTFA 1N32M 3GLGE 1XNRM 2ZTCA 2Z3XA 4CISA 5FTLA 4LF8M 2R0IA 3DZDA 1Q39A 1L8QA 2DAIA 3J2PB 3I51A 4LF5M 2KA6B 3HU2A 1N34M 3QWLA 1D2NA 2J7OA 4YHHM 4IBIA 4IJEA 4LFBM 3LMMA 2MR9A 4DUZM 1R6BX 4LZZA 1P3QQ 1JR3E 2J5YA 1R5LA 2XFSA 1DGHB 2KNZA 2CV2A 3D8LA 3GLFA 4LG2A 2DZNB 4DV4M 4M0DA 1E9RA 2K47A 4NXMM 4ITQA 3U6MA 5KPRA 3VFDA 1IN7A 2GNOA 5KQDA 2JWSA 3BOSA 3U6SA 2F5QA 3HX3A 3LVVA 2XSZA 3E46A 1IN8A 3R9XB 8CATA 3GLHE 5L8RF 2JY8A 1HQYE 5EJCA 2Z7JA 2G5GX 4LJ5A 1E32A 1VDLA 2DVWB 2LVPC 3GLHA 3K2LA 3L28A 1L2BA 2RGHA 1XMOM 1QANA 3LCUA 1IY2A 3UK6A 1VEGA 2C9CA 3GP1A 2CRUA 3KW6A 2KHHA 1PJJA 5ITTA 2CV1A 1N78A 4AQYM 3AJIB 1GO5A 4GRIA 3JR5A 4GKKM 1N75A 3QAUA 2BJVA 1IQPA 2HKJA 5E26A 1NJFA 3TWLA 3TWMA 3U6DA 2L4FA 4PDGA 1OTRA 3KXEC 2YNMD 2C96A 3A45A 5GKNA 1OIPA 3K9OA 2UUAM 1IY0A 3VDUA 4LF4M 4K0KM 4B7GA 1WHCA 4MH0E 3W0FA 1QYRA 3HWSA 5FLXS 3HHWA 1PJIA 5C1BA 1QZMA 3JAMS 1OJLA 3HU1A 2KEBA 2CFOA 2VIIA 4LRTA 1KFVA 4M9SA 2Z8YM 2WSCF 1A5TA 4DV0M 5IZ7D 2CV0A 3TL4X 2XEPA 3UZUA 2DWMA 2YR0A 4QNMA 4AZFA 3B9PA 4L8RC 4GC9A 3HHZA 3GRRA 4WURA 1YSYA 1JB0F 1TTEA 1L1TA 3U5ZA 2UXBM 2ZAOA 5EXXA 1WGNA 3FKEA 2DKLA 3E21A 1C1KA 4MGZE 2CHQA 4OVZB 4KODA 2YFQA 5JI2E 1XMQM 3GQ4A 1PRBA 1DO0A 1Z5CA 2HCBA 1IXRC 4JI0M 3HY5A 3T1YM 2HWJA 1HNWM 4RF0A 5KQ8A 1NV8A 2A5YB 2P5TA 3B7QA 1CUKA 4GH9A 3L2AA 4S12A 4R7GA 1SXJB 2RRUA 3KP1E 1GVNA 4L78A 4JI4M 1IN4A 3EIHA 5BR8M 2QCUA 4G6ZA 4GKJM 2DZLA 4GHAA 2HL7A 2ZAMA 3LW5F 4FVMA 4GC5A 1E94E 4DR3M 1C7YA 2JUJA 2JY5A 1NO1A 2ZBKB 4LRSA 1IN6A 2DHRA 2VF7A 2DWLA 4AI6A 1QDTA 3IG8A 2FH0A 1G71A 3K1JA 1VG5A 3GLIE 3U61A 3GRUA 4FCTA 3HZJA 1G59A 5ITXA 2EKFA 3VDPA 3OTOM 1HR0M 1IY1A 1PJSA 4DUYM 4JYAM 3GLIA 3B7NA 1W5TA 3L29A 3GQ3A 4WP2A 4LJ8A 2K6BA 1IXSA 3RE8A 1OIZA 2H1RA 2GQFA 4ZPXA 4I4LA 3GQ5A 3HHXA 3KVWA 2LTUA 2D7GA 3U6PA 2F5OA 2KZUA 1NV9A 3FD9A 1HNXM 4LY6A 1AIPC 1IN5A 3U6EA 1QAOA 1VDDA 3BXWA 4R3DA 1MU5A 4NC6A 4FW9A 4P16A 4FWGA 1EIJA 4X65M 2Z4SA 4HL4A 1XNQM 1J5EM 1S3SA 3VK7A 1K3WA 2WZJA 2KDLA 2DWNA 1JR3D 3K8ZA 4G4NA 1TH3A 3GLFE 3U60B 2UU9M 3VLFB 3FRHA 4GEWA 1XHBA 4BB9A 2C9OA 4LZJA 5EXTA 2VQFM 1IFYA 3CF0A 2N35A 5FSWA 3SFZA 3EIEA 4MGIE 1QVRA 1HT1E 5EP3A 3T15A 2C5RA 4BBAA 1XXHE 4MGHA 1MJGM 2EJSA 3GLGB 3PXGA 1QUSA 1VEKA 1XXHA 2DHYA 2O5RA 1OQYA 1R2YA 1I94M 2QP9X 4JI1M 1ZAEA 3FE3A 4A3VB 3KOXE 1XC8A 2EUCA 2KNAA 2R18A 4B08A 1LTMA 4DV2M 1H6UA 3FRIA 2VF8A 3J80S 3CGWA 5DYGA 1V34A 4CHTB 4G4RA 4MM3B 1ZV1A 3KOZE 1E9SA 3HHYA 3H4MA 3KP0E 3Q8GA 3HJQA 3SYKA 2YQZA 4LJ6A 3D8BA 2LHGA 3ZQJA 4B7HA 1HJPA 4G4OA 4RNAA 3ZH9B 5LMUM 3M0EA 2M5ZA 3SMPA 3HJ8A 1QDRA 1YUBA 2F4VM 1DGBA 1NHWC 3NBIA 4YY3M 1JQJC 3GLHB 1BVSA 3KOWE 4PDIA 3A46A 2KXEA 2I7NA 4I8OA 2F5NA 4IBEA 3VKGA 3J81S 1QAMA 1TDZA 1ZMWA 4CJ6A 3AKZA 2L6OA 3AL0C 2XZUA 1NHGC 4JI8M 4AG6A 2XF3A 3TPZA 1SXJD 4D82A 2ZTDA 4JV5M 1YLAA 4LFAM 3IHPA 4M9XA 2Y0TA 2UXCM 4PD2A 2CEAA 4IBCA 3UJNA 2C98A 2AHMA
chains in the Genus database with same CATH topology
1GABA 2KDLA 2J5YA 1TF0B 1GJTA 2N35A 2JWSA 2LHCA 2LHGA 2FS1A 2MH8A 1GJSA 1PRBA 2VDBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAB A;  2KDL A;  2J5Y A;  1TF0 B;  1GJT A;  2N35 A;  2JWS A;  2LHC A;  2LHG A;  2FS1 A;  2MH8 A;  1GJS A;  1PRB A;  2VDB B; 
#chains in the Genus database with same CATH topology
 2OOA A;  2CHV A;  2G8L A;  2Q2E B;  2QHO B;  1RU3 A;  2BWE A;  1D0K A;  2MJ5 B;  3L26 A;  4WW0 A;  3SAR A;  3MK6 A;  3C3D A;  5H37 D;  5IT9 S;  4M9Z A;  1GKI A;  2Y20 A;  4L16 A;  5EP2 A;  2LBC A;  3SAU A;  1N36 M;  3C3E A;  1UM8 A;  4LF7 M;  5IRE B;  1KYI A;  2D7H A;  5C18 A;  2QPA A;  1PM5 A;  2UUC M;  1G41 A;  1XWI A;  3J27 B;  2QEN A;  3CF6 E;  1N33 M;  3W0L B;  5ITQ A;  2CUZ A;  1SXJ C;  3VK8 A;  5DNY A;  1L1Z A;  2V1C A;  2UUB M;  3J7A S;  2DNA A;  2Y21 A;  4OVZ A;  4D80 A;  5EP1 A;  5JI3 E;  3GPU A;  3AOE C;  5EXP A;  4DR4 M;  5FTJ A;  1IBK M;  3FTE A;  2JNH A;  4II7 A;  4JN6 A;  2QBY B;  1GL7 A;  4PCZ A;  2JP7 A;  4MGY E;  3PVS A;  4X62 M;  3SAT A;  2QZ4 A;  3F92 A;  4NXN M;  2CWB A;  2R62 A;  1SG9 A;  4B3T M;  2L2D A;  4UN2 B;  2JZ1 A;  3KSJ A;  4GIT A;  4LGY A;  3KOY E;  5A2Q S;  2ZAN A;  3U6O A;  2J7N A;  1ORY B;  1TH2 A;  4NL4 H;  3R8F A;  4NSR A;  1NY6 A;  2OOB A;  3AFH A;  5FTM A;  1Z5B A;  2C99 A;  2QQ8 A;  4X64 M;  2DXI A;  4OU7 A;  5ITX E;  1TDH A;  3RGS A;  3GPP A;  3C58 A;  4FWD A;  2JA2 A;  2KNV A;  2L4E A;  2OPF A;  4I81 A;  3NWL A;  4R71 A;  1WXQ A;  2FNA A;  4DR7 M;  1X37 A;  3IEC A;  4D81 A;  4KHP M;  4LJA A;  4REZ A;  3I04 M;  5IWA M;  3K9P A;  3RGP A;  4FWH A;  3FUX A;  2R4E A;  4NOO B;  5LMN M;  3IG5 A;  3QYB A;  3MMP A;  2HAK A;  1G3I A;  2DAE A;  2RKO A;  1NJG A;  2VQE M;  4IBB A;  3GPY A;  2NQ8 C;  1VQ1 A;  4LJ9 A;  3M7G A;  1QAQ A;  4DV6 M;  3CTW B;  1GJT A;  2HHH M;  1GJS A;  2XH9 A;  4OW0 A;  3K92 A;  4LJ7 A;  3U61 B;  2V1U A;  2X49 A;  1MN3 A;  2KW0 A;  5F3W A;  3WHL A;  4P17 A;  4DR2 M;  4XGI A;  1LV7 A;  1AUA A;  3GLI B;  2DZO B;  2D7E A;  2F5S A;  2ZM6 M;  1IXS B;  4LFC M;  4IBJ A;  2ERC A;  2MH8 A;  2XFT A;  3TWK A;  2VDB B;  2Z4R A;  3V76 A;  3DFZ A;  3E4R A;  3GPX A;  3UGJ A;  1Z5A A;  3PNY A;  4QOS A;  2XSZ D;  2JY6 B;  1NVM A;  1OAI A;  1K3X A;  2F5P A;  4KLN A;  4DR6 M;  5EXS A;  4CGY B;  2R65 A;  5ITY A;  3SBJ A;  4QOZ C;  2MGW A;  3LQQ A;  4TUW A;  3L25 A;  1NSF A;  3U6Q A;  1DGH A;  3ILK A;  4IBF A;  3KDS E;  4NSO B;  3SHG B;  3FUW A;  1ZMV A;  3HU3 A;  4FCV A;  4HLQ A;  3E9S A;  5KPZ A;  2W82 A;  2DEN A;  2RGO A;  3GLG A;  1IXZ A;  4EIW A;  4ANR A;  1WIV A;  4QHS A;  4IBK A;  1Q3B A;  1Q3C A;  1IM2 A;  2L7I A;  3ZC7 B;  1DGF A;  7CAT A;  4GIP A;  4RKU F;  4B3M M;  3SMS A;  2LHC A;  2QNJ A;  2R45 A;  1G8P A;  1EE8 A;  3GLF B;  2X4A A;  1F4I A;  1PJQ A;  5DFL A;  2DAK A;  2M60 A;  2WSF F;  3PNV A;  3CF2 A;  2E5L M;  1QQW A;  1V92 A;  1R2Z A;  1OFH A;  4DV3 M;  3GRV A;  3L27 A;  4JI2 M;  1WGL A;  1TGU A;  5E6J A;  1QZE A;  1XXH B;  1JR3 A;  3SAV A;  3SHF A;  2JY7 A;  2APL A;  1I4W A;  1HQC A;  2DWZ B;  1GL6 A;  4KO8 A;  3SAW A;  1G4A E;  4L4U A;  2R6F A;  1WR1 B;  3VKH A;  2CP8 A;  4JI3 M;  4CIZ A;  1W5S A;  2KZS A;  1L2D A;  4AKI A;  2XGN A;  3DOA A;  1T6O A;  4M0W A;  3I4V A;  2BWB A;  4B3R M;  1T43 A;  4AKG A;  4IIW A;  1OKS A;  2FS1 A;  2EA0 A;  4FCW A;  4Z6Y A;  1GLN A;  3KSX A;  3J7B A;  5ITR A;  4Y28 F;  4L6V 6;  5BPV A;  1TR8 A;  4B7F A;  4RF1 A;  3SYL A;  4I5S A;  4JI7 M;  1FNN A;  2L7H A;  1YE9 A;  1R7R A;  3AV0 A;  3FUT A;  3LVW A;  1TF0 B;  4IBD A;  3BBZ A;  2LNH C;  4DBG B;  2LVA A;  3HKP A;  2H5X A;  2DI0 A;  3GRY A;  3PFI A;  2BJW A;  2FOI C;  2O25 A;  3FTC A;  4LF6 M;  1WJ7 A;  2FFJ A;  3LCV B;  3THG A;  1TH4 A;  1ZQ9 A;  5KPT A;  1K82 A;  2CHG A;  4DV1 M;  4LF9 M;  2CE7 A;  2WSE F;  2EKK A;  3C9P A;  1N77 A;  3KFU G;  4LCB A;  1NNU C;  1J7K A;  3T6P A;  1J09 A;  1DGG A;  3QYE A;  1R4G A;  3MHV C;  4FD2 A;  2LVO C;  3RFW A;  5EQT A;  2R44 A;  2KRK A;  4W5W A;  3WHK A;  3B74 A;  1SXJ E;  3JR4 A;  1IBM M;  1KSF X;  3ZCB B;  3U5Z B;  1Y8G A;  3HJS A;  2QBY A;  1T3T A;  3LQR A;  3U6L A;  4B3S M;  3TQS A;  4JI6 M;  1L2C A;  4NRW A;  1SXJ A;  3SC3 A;  4GMQ A;  1PJT A;  4GHL A;  2R46 A;  1Z6T A;  4DV7 M;  2EO2 A;  3AOE A;  4IJF A;  2LVQ D;  5EP4 A;  5DYI A;  2K0B X;  1QUT A;  1VEJ A;  2I7P A;  2MRO B;  4QNR A;  5KO3 A;  4DR5 M;  3T1H M;  2XZF A;  4QHT A;  2LXE A;  1NY5 A;  4L15 A;  3B7Z A;  3A42 A;  4F2L A;  4HEO A;  2KRU A;  3HGI A;  2UXD M;  4F1I A;  3B89 A;  4KT0 F;  1XB2 B;  1DV0 A;  1FJG M;  2OO9 A;  1ZMU A;  4LGM A;  1D0L A;  3NBX X;  1HNZ M;  4LJ4 A;  3I01 M;  4G3O A;  4JI5 M;  2FE8 A;  4IBG A;  4XK8 F;  2XLJ A;  4DR1 M;  2QSF X;  1MX0 A;  1Z59 A;  1IBL M;  3SAS A;  4AG5 A;  1PGY A;  4NRV A;  3T38 A;  2DAG A;  4AKH A;  3A98 B;  3UMM A;  1NNJ A;  3FYD A;  3FUU A;  4X66 M;  1OAO C;  3GO8 A;  3U6C A;  2X8A A;  2JZ0 A;  3M6A A;  4Z8X A;  3MJ5 A;  1UFZ A;  3FUV A;  4G4Q A;  4JXJ A;  1GAB A;  2OQ4 A;  1EFU B;  3FYC A;  4DV5 M;  2G3Q A;  2R4J A;  4MGK E;  3DA1 A;  4PT5 A;  1DO2 A;  4Q7J A;  3Q8X A;  3KS4 A;  4XBO A;  1D0M A;  1Q02 A;  2K9D A;  1HT2 E;  2DAM A;  3H4J A;  3KS8 A;  4BLC A;  4OX9 M;  2O01 F;  2LWX A;  3AOG A;  4AW4 A;  2BNK A;  3W68 A;  2B3T A;  2LVN C;  2V6Z M;  5FTN A;  5ITU A;  3U60 A;  1V33 A;  2L09 A;  1OFI A;  2Y0Q A;  3I4Y A;  2LH0 A;  2JXN A;  4MB7 A;  5FTK A;  3TE6 A;  3W67 A;  3FTD A;  3FTF A;  1N32 M;  3GLG E;  1XNR M;  2ZTC A;  2Z3X A;  4CIS A;  5FTL A;  4LF8 M;  2R0I A;  3DZD A;  1Q39 A;  1L8Q A;  2DAI A;  3J2P B;  3I51 A;  4LF5 M;  2KA6 B;  3HU2 A;  1N34 M;  3QWL A;  1D2N A;  2J7O A;  4YHH M;  4IBI A;  4IJE A;  4LFB M;  3LMM A;  2MR9 A;  4DUZ M;  1R6B X;  4LZZ A;  1P3Q Q;  1JR3 E;  2J5Y A;  1R5L A;  2XFS A;  1DGH B;  2KNZ A;  2CV2 A;  3D8L A;  3GLF A;  4LG2 A;  2DZN B;  4DV4 M;  4M0D A;  1E9R A;  2K47 A;  4NXM M;  4ITQ A;  3U6M A;  5KPR A;  3VFD A;  1IN7 A;  2GNO A;  5KQD A;  2JWS A;  3BOS A;  3U6S A;  2F5Q A;  3HX3 A;  3LVV A;  2XSZ A;  3E46 A;  1IN8 A;  3R9X B;  8CAT A;  3GLH E;  5L8R F;  2JY8 A;  1HQY E;  5EJC A;  2Z7J A;  2G5G X;  4LJ5 A;  1E32 A;  1VDL A;  2DVW B;  2LVP C;  3GLH A;  3K2L A;  3L28 A;  1L2B A;  2RGH A;  1XMO M;  1QAN A;  3LCU A;  1IY2 A;  3UK6 A;  1VEG A;  2C9C A;  3GP1 A;  2CRU A;  3KW6 A;  2KHH A;  1PJJ A;  5ITT A;  2CV1 A;  1N78 A;  4AQY M;  3AJI B;  1GO5 A;  4GRI A;  3JR5 A;  4GKK M;  1N75 A;  3QAU A;  2BJV A;  1IQP A;  2HKJ A;  5E26 A;  1NJF A;  3TWL A;  3TWM A;  3U6D A;  2L4F A;  4PDG A;  1OTR A;  3KXE C;  2YNM D;  2C96 A;  3A45 A;  5GKN A;  1OIP A;  3K9O A;  2UUA M;  1IY0 A;  3VDU A;  4LF4 M;  4K0K M;  4B7G A;  1WHC A;  4MH0 E;  3W0F A;  1QYR A;  3HWS A;  5FLX S;  3HHW A;  1PJI A;  5C1B A;  1QZM A;  3JAM S;  1OJL A;  3HU1 A;  2KEB A;  2CFO A;  2VII A;  4LRT A;  1KFV A;  4M9S A;  2Z8Y M;  2WSC F;  1A5T A;  4DV0 M;  5IZ7 D;  2CV0 A;  3TL4 X;  2XEP A;  3UZU A;  2DWM A;  2YR0 A;  4QNM A;  4AZF A;  3B9P A;  4L8R C;  4GC9 A;  3HHZ A;  3GRR A;  4WUR A;  1YSY A;  1JB0 F;  1TTE A;  1L1T A;  3U5Z A;  2UXB M;  2ZAO A;  5EXX A;  1WGN A;  3FKE A;  2DKL A;  3E21 A;  1C1K A;  4MGZ E;  2CHQ A;  4OVZ B;  4KOD A;  2YFQ A;  5JI2 E;  1XMQ M;  3GQ4 A;  1PRB A;  1DO0 A;  1Z5C A;  2HCB A;  1IXR C;  4JI0 M;  3HY5 A;  3T1Y M;  2HWJ A;  1HNW M;  4RF0 A;  5KQ8 A;  1NV8 A;  2A5Y B;  2P5T A;  3B7Q A;  1CUK A;  4GH9 A;  3L2A A;  4S12 A;  4R7G A;  1SXJ B;  2RRU A;  3KP1 E;  1GVN A;  4L78 A;  4JI4 M;  1IN4 A;  3EIH A;  5BR8 M;  2QCU A;  4G6Z A;  4GKJ M;  2DZL A;  4GHA A;  2HL7 A;  2ZAM A;  3LW5 F;  4FVM A;  4GC5 A;  1E94 E;  4DR3 M;  1C7Y A;  2JUJ A;  2JY5 A;  1NO1 A;  2ZBK B;  4LRS A;  1IN6 A;  2DHR A;  2VF7 A;  2DWL A;  4AI6 A;  1QDT A;  3IG8 A;  2FH0 A;  1G71 A;  3K1J A;  1VG5 A;  3GLI E;  3U61 A;  3GRU A;  4FCT A;  3HZJ A;  1G59 A;  5ITX A;  2EKF A;  3VDP A;  3OTO M;  1HR0 M;  1IY1 A;  1PJS A;  4DUY M;  4JYA M;  3GLI A;  3B7N A;  1W5T A;  3L29 A;  3GQ3 A;  4WP2 A;  4LJ8 A;  2K6B A;  1IXS A;  3RE8 A;  1OIZ A;  2H1R A;  2GQF A;  4ZPX A;  4I4L A;  3GQ5 A;  3HHX A;  3KVW A;  2LTU A;  2D7G A;  3U6P A;  2F5O A;  2KZU A;  1NV9 A;  3FD9 A;  1HNX M;  4LY6 A;  1AIP C;  1IN5 A;  3U6E A;  1QAO A;  1VDD A;  3BXW A;  4R3D A;  1MU5 A;  4NC6 A;  4FW9 A;  4P16 A;  4FWG A;  1EIJ A;  4X65 M;  2Z4S A;  4HL4 A;  1XNQ M;  1J5E M;  1S3S A;  3VK7 A;  1K3W A;  2WZJ A;  2KDL A;  2DWN A;  1JR3 D;  3K8Z A;  4G4N A;  1TH3 A;  3GLF E;  3U60 B;  2UU9 M;  3VLF B;  3FRH A;  4GEW A;  1XHB A;  4BB9 A;  2C9O A;  4LZJ A;  5EXT A;  2VQF M;  1IFY A;  3CF0 A;  2N35 A;  5FSW A;  3SFZ A;  3EIE A;  4MGI E;  1QVR A;  1HT1 E;  5EP3 A;  3T15 A;  2C5R A;  4BBA A;  1XXH E;  4MGH A;  1MJG M;  2EJS A;  3GLG B;  3PXG A;  1QUS A;  1VEK A;  1XXH A;  2DHY A;  2O5R A;  1OQY A;  1R2Y A;  1I94 M;  2QP9 X;  4JI1 M;  1ZAE A;  3FE3 A;  4A3V B;  3KOX E;  1XC8 A;  2EUC A;  2KNA A;  2R18 A;  4B08 A;  1LTM A;  4DV2 M;  1H6U A;  3FRI A;  2VF8 A;  3J80 S;  3CGW A;  5DYG A;  1V34 A;  4CHT B;  4G4R A;  4MM3 B;  1ZV1 A;  3KOZ E;  1E9S A;  3HHY A;  3H4M A;  3KP0 E;  3Q8G A;  3HJQ A;  3SYK A;  2YQZ A;  4LJ6 A;  3D8B A;  2LHG A;  3ZQJ A;  4B7H A;  1HJP A;  4G4O A;  4RNA A;  3ZH9 B;  5LMU M;  3M0E A;  2M5Z A;  3SMP A;  3HJ8 A;  1QDR A;  1YUB A;  2F4V M;  1DGB A;  1NHW C;  3NBI A;  4YY3 M;  1JQJ C;  3GLH B;  1BVS A;  3KOW E;  4PDI A;  3A46 A;  2KXE A;  2I7N A;  4I8O A;  2F5N A;  4IBE A;  3VKG A;  3J81 S;  1QAM A;  1TDZ A;  1ZMW A;  4CJ6 A;  3AKZ A;  2L6O A;  3AL0 C;  2XZU A;  1NHG C;  4JI8 M;  4AG6 A;  2XF3 A;  3TPZ A;  1SXJ D;  4D82 A;  2ZTD A;  4JV5 M;  1YLA A;  4LFA M;  3IHP A;  4M9X A;  2Y0T A;  2UXC M;  4PD2 A;  2CEA A;  4IBC A;  3UJN A;  2C98 A;  2AHM A; 
#chains in the Genus database with same CATH homology
 1GAB A;  2KDL A;  2J5Y A;  1TF0 B;  1GJT A;  2N35 A;  2JWS A;  2LHC A;  2LHG A;  2FS1 A;  2MH8 A;  1GJS A;  1PRB A;  2VDB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...