1TF0B

Crystal structure of the ga module complexed with human serum albumin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum albumin
publication title Crystal structure and biological implications of a bacterial albumin binding module in complex with human serum albumin
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1tf0B00
2FS1A 1TF0B 1PRBA 2J5YA 2JWSA 2MH8A 2N35A 2LHCA 1GJTA 2VDBB 1GABA 1GJSA 2KDLA 2LHGA
chains in the Genus database with same CATH superfamily
3HHYA 1UM8A 1HR0M 1TH2A 2J5YA 4M9SA 2DKLA 2QBYA 1XNQM 1L1ZA 1N75A 1WR1B 1ZAEA 3PNVA 4X66M 4PDIA 4AQYM 2CE7A 3OTOM 3E21A 4EIWA 3B7QA 4GEWA 1PJSA 4AG5A 3U61A 3THGA 4LF5M 4LJ5A 3B89A 3L26A 2VQFM 1DGBA 1LTMA 4LRSA 2LNHC 5KO3A 4JYAM 3I51A 4Q7JA 1JR3D 3GLGB 2QZ4A 4GMQA 3KS8A 2KZUA 4ITQA 1X37A 1TTEA 3AJIB 1PJTA 2DAIA 5JI2E 1UFZA 1J7KA 3PFIA 1KYIA 1GO5A 5DFLA 4R7GA 1YUBA 3U6QA 3GLHA 2G3QA 1QUTA 3T1YM 3BXWA 3HHZA 2R18A 2OOAA 1KSFX 5KQDA 4DV4M 2QCUA 2R44A 2FOIC 4MB7A 2OPFA 5LMNM 2H5XA 3SFZA 4NOOB 2DVWB 3GLFE 4DUZM 3LQRA 4K0KM 1MU5A 1R2ZA 3GQ3A 4IBEA 2F5OA 2MGWA 2EO2A 3GRYA 3KVWA 4KT0F 5EQTA 3UK6A 4DBGB 5KQ8A 3A46A 1EE8A 4QNMA 4DV2M 2KRKA 2YR0A 2DZOB 1QDTA 4DV7M 5IZ7D 4LRTA 1L2DA 5ITTA 4MGYE 3VLFB 4NRWA 2CP8A 3WHLA 1SXJA 1XXHE 1VEKA 2LWXA 3LW5F 2XLJA 4DV1M 3A45A 2Z4SA 4OU7A 1OKSA 4IBKA 5DYIA 1QQWA 3SBJA 2L7HA 3R8FA 2L6OA 4RNAA 2HHHM 4DR2M 3MHVC 1VDLA 1IFYA 5A2QS 4B3RM 4DR1M 1R4GA 4LZZA 4NL4H 4X65M 4G4OA 4M0DA 2BNKA 1E94E 2CWBA 1IY1A 2NQ8C 2D7GA 5E6JA 3A98B 3GPPA 2CFOA 3HGIA 2EKKA 2XSZA 3T6PA 2EA0A 1ORYB 5EXXA 1TF0B 1PJJA 1MX0A 1DO2A 2R65A 7CATA 4II7A 1OIPA 1WGLA 1XB2B 1RU3A 4DR5M 5JI3E 2F5NA 2LVNC 2DWLA 3FE3A 2G5GX 4LCBA 3QWLA 1HJPA 3AOEC 3KP0E 5FLXS 1QANA 3TWLA 3J81S 2RGOA 1AUAA 4IBJA 3TWKA 1OFHA 1D0MA 3HX3A 3CGWA 4FWGA 3LVVA 1GL6A 3IG8A 4FWDA 2KDLA 1EFUB 4NXNM 3SYKA 1ZQ9A 1NY6A 2HWJA 1TH4A 3FTDA 4XK8F 4DR4M 1ZV1A 2LHCA 1TR8A 1PGYA 1P3QQ 2Z4RA 1NV8A 3PXGA 2RGHA 3B7NA 2E5LM 3RGSA 2KNVA 4QHSA 4I81A 1Q02A 4X62M 3VK7A 3J27B 4LF6M 2BWEA 2X8AA 3M0EA 5EP1A 3HHWA 2V1UA 2APLA 2C9OA 4P17A 1OJLA 1QVRA 1VEGA 1CUKA 1JR3A 2CHVA 2DWZB 4GH9A 3PNYA 4KO8A 2VF7A 1IXSB 2KZSA 2LVQD 1QAOA 2VF8A 3Q8GA 4LJ9A 2KRUA 3ZH9B 4PCZA 1N36M 2R62A 3TQSA 5BPVA 3FYDA 3E9SA 4GKJM 5ITXE 1NJFA 5EXSA 4B08A 1IY2A 3FUVA 2OO9A 1SG9A 4PDGA 4YY3M 2LVPC 1S3SA 1IXRC 3VDPA 4D82A 2BJVA 4FD2A 4F2LA 2MH8A 1IBLM 3QAUA 3GLIA 3K8ZA 1GLNA 2ZTDA 1GJTA 4RF0A 4RKUF 2EUCA 3WHKA 3B74A 3UZUA 4JI4M 4JI1M 1DV0A 2R45A 2Y0TA 1NJGA 3GLGE 1J09A 3DFZA 3KOXE 4P16A 3U5ZA 4LF9M 5IT9S 2AHMA 3CF6E 3U6LA 1L2CA 2LTUA 2M5ZA 2KXEA 4GRIA 3GPUA 4JV5M 4JI3M 2ZAMA 4JI6M 1HNWM 3U60B 3U6OA 1GL7A 2VDBB 1ZMUA 4QNRA 1FNNA 4NSRA 3W0FA 3VFDA 4JI8M 2DAEA 3VKGA 1BVSA 2Y21A 2ZAOA 3M6AA 4UN2B 3GLFA 4XBOA 2XZUA 5FTNA 1T6OA 3W68A 1G59A 1XNRM 4Z6YA 4TUWA 2XEPA 2QENA 3CF2A 4LY6A 2K9DA 4GC5A 1MN3A 4LGYA 5KPTA 1ZMWA 3FUXA 3SYLA 2DHRA 5FTKA 4B3TM 1N33M 1G4AE 4IBIA 5BR8M 3HU3A 3U6PA 3J2PB 8CATA 2HL7A 2JZ1A 3EIHA 2FNAA 1XXHA 2JNHA 4NRVA 3PVSA 4OVZA 2F5SA 1WIVA 1ZMVA 3RGPA 4F1IA 1OFIA 1DGGA 2XGNA 3HZJA 1GVNA 1WHCA 2LVOC 2KEBA 2JY7A 2CHGA 3AOEA 4DV0M 2C98A 1I94M 3KOWE 4RF1A 1KFVA 4MGZE 2R46A 3HHXA 1D0LA 2C96A 3H4JA 1PM5A 1R5LA 2FS1A 2JY6B 2P5TA 2M60A 3GRRA 1G8PA 4FCWA 3U6CA 2BWBA 2OOBA 4DUYM 4NXMM 4LJAA 4REZA 1R7RA 5GKNA 3KSXA 3GPYA 4AZFA 3L29A 4JI2M 2F4VM 3C9PA 2WSEF 3B7ZA 3I4VA 4M9XA 1NHWC 4GITA 4PD2A 3TWMA 1IN5A 5ITYA 4ZPXA 1OTRA 2JWSA 2L2DA 4DR7M 1E9SA 1DGHA 1LV7A 4LZJA 4S12A 3K1JA 3L27A 4MM3B 1WXQA 3EIEA 1F4IA 3CTWB 1TDHA 4HL4A 2G8LA 2J7NA 2EJSA 1TH3A 1AIPC 1GABA 3IG5A 4DV6M 3HU2A 5FTMA 3SAUA 3FRIA 3F92A 3AOGA 3VKHA 2QBYB 1HT1E 4LJ8A 3L25A 1E9RA 2DZNB 3LCUA 4XGIA 2DZLA 3E4RA 4DV3M 1Q3BA 3J7BA 3FYCA 1K3XA 3JAMS 2ZTCA 5ITRA 4GHAA 3U6MA 3I04M 3U61B 3LCVB 1IN6A 1XMQM 5EP2A 4HLQA 4IBFA 4KHPM 2I7NA 2X49A 4L16A 4BBAA 3KP1E 4CHTB 1DO0A 2JZ0A 4CJ6A 1IN4A 4CIZA 4AKGA 3C58A 1XWIA 1PJQA 3DOAA 4R71A 1C1KA 3I01M 2KHHA 5EP3A 5LMUM 1FJGM 4LFBM 2FFJA 3KSJA 5ITUA 3GLHB 4MGKE 5EJCA 4IJEA 4WW0A 3D8LA 5L8RF 1HQCA 1TDZA 2H1RA 4M9ZA 5FTLA 3ZC7B 2UXBM 4PT5A 1G3IA 1QZMA 2CEAA 2VIIA 3VK8A 2DHYA 3T15A 1Q39A 3HKPA 4MH0E 4LJ4A 4AW4A 4CISA 4MGIE 4OW0A 4GKKM 4X64M 3SAVA 2R6FA 3GRUA 4QOZC 2L09A 3SHFA 3KOZE 4KLNA 3HU1A 3TPZA 3GLGA 4DV5M 2F5QA 5DYGA 4FCTA 1SXJB 1HNZM 1OQYA 2ERCA 1IN8A 4I8OA 4LF4M 2K6BA 1NSFA 2DAKA 5KPRA 2MR9A 2B3TA 1HNXM 3TL4X 2LH0A 2JXNA 2R4JA 1L2BA 3GQ4A 4FVMA 4L4UA 3ZQJA 4LJ7A 4B7FA 3L28A 4IBBA 4IBDA 1QAQA 2KA6B 2UXCM 2YFQA 3QYBA 3GPXA 2W82A 4DR3M 3K2LA 4KODA 1R2YA 3NBXX 2VQEM 3SARA 2UU9M 3K9PA 1Q3CA 2K0BX 2A5YB 4G4QA 1EIJA 2O5RA 4JI7M 2V6ZM 3FTEA 1D2NA 1YE9A 2ZM6M 2BJWA 3GQ5A 1N34M 3UMMA 3IHPA 2O01F 2V1CA 2JY8A 3TE6A 4LJ6A 1QUSA 1XHBA 1IBKM 2DENA 1H6UA 4AI6A 1WJ7A 5H37D 3I4YA 1YSYA 2R4EA 5C18A 3ILKA 2FE8A 3FD9A 4LFCM 1Y8GA 2UXDM 3J7AS 2FH0A 1K3WA 3KXEC 3KFUG 4Z8XA 1VQ1A 2XF3A 2DI0A 3RFWA 5IWAM 3FKEA 3VDUA 2LXEA 2DAMA 2RKOA 2XFSA 3LQQA 1G41A 4WP2A 3SC3A 2YQZA 1IY0A 5FSWA 3GLIE 2D7EA 3KDSE 1V33A 2L4FA 1I4WA 2MROB 3FTFA 4AKHA 2KNAA 4I5SA 3SATA 2R0IA 4GC9A 3FUTA 4G6ZA 4YHHM 2GQFA 2QHOB 1L1TA 3K9OA 1YLAA 5EXPA 3IECA 2YNMD 3B9PA 2LHGA 3KW6A 4BLCA 1IBMM 4Y28F 1Z6TA 1NO1A 2KW0A 3MJ5A 2OQ4A 4B3SM 1NVMA 2Y0QA 4JI5M 1VEJA 1NHGC 4JXJA 4AKIA 3HWSA 5ITQA 1QZEA 3NBIA 2HAKA 3H4MA 2MJ5B 3GLIB 1D0KA 1XMOM 5IREB 1N77A 2RRUA 4QHTA 3RE8A 3U5ZB 1IN7A 3GP1A 2Z8YM 2WZJA 1A5TA 2WSFF 3SMSA 5DNYA 3JR5A 3KOYE 2UUBM 3GRVA 2DNAA 4DR6M 3GLHE 1QDRA 2DWNA 2QQ8A 4MGHA 1J5EM 2UUCM 1IXSA 3E46A 3W0LB 4IIWA 3JR4A 3AL0C 3R9XB 4IBCA 1GKIA 1L8QA 2ZANA 3FUUA 2I7PA 2GNOA 4FW9A 4LG2A 3W67A 4GHLA 1PJIA 1K82A 3J80S 3GLFB 4LF7M 2LBCA 2QNJA 4ANRA 4L8RC 1R6BX 1JQJC 1QAMA 2JUJA 3DZDA 1DGFA 1Z5AA 2X4AA 1NY5A 4NC6A 2C5RA 3U6SA 3HJ8A 1NV9A 2WSCF 1OAOC 4D80A 3K92A 2Y20A 3MMPA 4B3MM 5E26A 3U6DA 1JB0F 1SXJE 3AFHA 4FCVA 1XXHB 4JN6A 3SAWA 3KS4A 4JI0M 1MJGM 1PRBA 2J7OA 3UJNA 4OVZB 3U60A 4A3VB 2XH9A 4HEOA 5ITXA 3LVWA 4L15A 2DWMA 2K47A 4M0WA 2Z7JA 4NSOB 1C7YA 2UUAM 1W5TA 2L7IA 4D81A 1GJSA 4W5WA 2C99A 1OIZA 1Z59A 3C3EA 1WGNA 2F5PA 3LMMA 4CGYB 3U6EA 3DA1A 1SXJD 4QOSA 3MK6A 1IQPA 3NWLA 4B7GA 3ZCBB 1T43A 3HY5A 2O25A 3D8BA 2XFTA 4L6V6 4AG6A 5KPZA 4LF8M 2JY5A 4B7HA 4OX9M 5F3WA 1T3TA 4LFAM 1IM2A 1SXJC 1Z5CA 3M7GA 3HJSA 4R3DA 4G4RA 1DGHB 3BOSA 1NNUC 2JA2A 2ZBKB 3Q8XA 3SHGB 4I4LA 4IBGA 1V34A 4G4NA 3BBZA 5C1BA 2EKFA 4GIPA 3SMPA 2XSZD 3FUWA 1HQYE 4G3OA 4IJFA 4FWHA 1HT2E 1VDDA 4LGMA 5EXTA 3SASA 2N35A 3T1HM 3T38A 3L2AA 2L4EA 1IXZA 3AV0A 5EP4A 2XZFA 1E32A 3AKZA 4BB9A 2JP7A 2Q2EB 2CV2A 3GO8A 2QSFX 2DAGA 3A42A 3CF0A 3QYEA 3HJQA 2KNZA 2QPAA 3C3DA 5FTJA 1XC8A 2CV1A 1QYRA 2QP9X 1N32M 3V76A 2DXIA 1NNJA 2D7HA 1V92A 2CRUA 4L78A 2CHQA 2C9CA 2HKJA 1TGUA 2CV0A 1VG5A 2Z3XA 3UGJA 1N78A 1JR3E 1Z5BA 2CUZA 2LVAA 3FTCA 1OAIA 1G71A 1W5SA 3FRHA 2HCBA 4WURA
chains in the Genus database with same CATH topology
2FS1A 1TF0B 1PRBA 2J5YA 2JWSA 2MH8A 2N35A 2LHCA 1GJTA 2VDBB 1GABA 1GJSA 2KDLA 2LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS1 A;  1TF0 B;  1PRB A;  2J5Y A;  2JWS A;  2MH8 A;  2N35 A;  2LHC A;  1GJT A;  2VDB B;  1GAB A;  1GJS A;  2KDL A;  2LHG A; 
#chains in the Genus database with same CATH topology
 3HHY A;  1UM8 A;  1HR0 M;  1TH2 A;  2J5Y A;  4M9S A;  2DKL A;  2QBY A;  1XNQ M;  1L1Z A;  1N75 A;  1WR1 B;  1ZAE A;  3PNV A;  4X66 M;  4PDI A;  4AQY M;  2CE7 A;  3OTO M;  3E21 A;  4EIW A;  3B7Q A;  4GEW A;  1PJS A;  4AG5 A;  3U61 A;  3THG A;  4LF5 M;  4LJ5 A;  3B89 A;  3L26 A;  2VQF M;  1DGB A;  1LTM A;  4LRS A;  2LNH C;  5KO3 A;  4JYA M;  3I51 A;  4Q7J A;  1JR3 D;  3GLG B;  2QZ4 A;  4GMQ A;  3KS8 A;  2KZU A;  4ITQ A;  1X37 A;  1TTE A;  3AJI B;  1PJT A;  2DAI A;  5JI2 E;  1UFZ A;  1J7K A;  3PFI A;  1KYI A;  1GO5 A;  5DFL A;  4R7G A;  1YUB A;  3U6Q A;  3GLH A;  2G3Q A;  1QUT A;  3T1Y M;  3BXW A;  3HHZ A;  2R18 A;  2OOA A;  1KSF X;  5KQD A;  4DV4 M;  2QCU A;  2R44 A;  2FOI C;  4MB7 A;  2OPF A;  5LMN M;  2H5X A;  3SFZ A;  4NOO B;  2DVW B;  3GLF E;  4DUZ M;  3LQR A;  4K0K M;  1MU5 A;  1R2Z A;  3GQ3 A;  4IBE A;  2F5O A;  2MGW A;  2EO2 A;  3GRY A;  3KVW A;  4KT0 F;  5EQT A;  3UK6 A;  4DBG B;  5KQ8 A;  3A46 A;  1EE8 A;  4QNM A;  4DV2 M;  2KRK A;  2YR0 A;  2DZO B;  1QDT A;  4DV7 M;  5IZ7 D;  4LRT A;  1L2D A;  5ITT A;  4MGY E;  3VLF B;  4NRW A;  2CP8 A;  3WHL A;  1SXJ A;  1XXH E;  1VEK A;  2LWX A;  3LW5 F;  2XLJ A;  4DV1 M;  3A45 A;  2Z4S A;  4OU7 A;  1OKS A;  4IBK A;  5DYI A;  1QQW A;  3SBJ A;  2L7H A;  3R8F A;  2L6O A;  4RNA A;  2HHH M;  4DR2 M;  3MHV C;  1VDL A;  1IFY A;  5A2Q S;  4B3R M;  4DR1 M;  1R4G A;  4LZZ A;  4NL4 H;  4X65 M;  4G4O A;  4M0D A;  2BNK A;  1E94 E;  2CWB A;  1IY1 A;  2NQ8 C;  2D7G A;  5E6J A;  3A98 B;  3GPP A;  2CFO A;  3HGI A;  2EKK A;  2XSZ A;  3T6P A;  2EA0 A;  1ORY B;  5EXX A;  1TF0 B;  1PJJ A;  1MX0 A;  1DO2 A;  2R65 A;  7CAT A;  4II7 A;  1OIP A;  1WGL A;  1XB2 B;  1RU3 A;  4DR5 M;  5JI3 E;  2F5N A;  2LVN C;  2DWL A;  3FE3 A;  2G5G X;  4LCB A;  3QWL A;  1HJP A;  3AOE C;  3KP0 E;  5FLX S;  1QAN A;  3TWL A;  3J81 S;  2RGO A;  1AUA A;  4IBJ A;  3TWK A;  1OFH A;  1D0M A;  3HX3 A;  3CGW A;  4FWG A;  3LVV A;  1GL6 A;  3IG8 A;  4FWD A;  2KDL A;  1EFU B;  4NXN M;  3SYK A;  1ZQ9 A;  1NY6 A;  2HWJ A;  1TH4 A;  3FTD A;  4XK8 F;  4DR4 M;  1ZV1 A;  2LHC A;  1TR8 A;  1PGY A;  1P3Q Q;  2Z4R A;  1NV8 A;  3PXG A;  2RGH A;  3B7N A;  2E5L M;  3RGS A;  2KNV A;  4QHS A;  4I81 A;  1Q02 A;  4X62 M;  3VK7 A;  3J27 B;  4LF6 M;  2BWE A;  2X8A A;  3M0E A;  5EP1 A;  3HHW A;  2V1U A;  2APL A;  2C9O A;  4P17 A;  1OJL A;  1QVR A;  1VEG A;  1CUK A;  1JR3 A;  2CHV A;  2DWZ B;  4GH9 A;  3PNY A;  4KO8 A;  2VF7 A;  1IXS B;  2KZS A;  2LVQ D;  1QAO A;  2VF8 A;  3Q8G A;  4LJ9 A;  2KRU A;  3ZH9 B;  4PCZ A;  1N36 M;  2R62 A;  3TQS A;  5BPV A;  3FYD A;  3E9S A;  4GKJ M;  5ITX E;  1NJF A;  5EXS A;  4B08 A;  1IY2 A;  3FUV A;  2OO9 A;  1SG9 A;  4PDG A;  4YY3 M;  2LVP C;  1S3S A;  1IXR C;  3VDP A;  4D82 A;  2BJV A;  4FD2 A;  4F2L A;  2MH8 A;  1IBL M;  3QAU A;  3GLI A;  3K8Z A;  1GLN A;  2ZTD A;  1GJT A;  4RF0 A;  4RKU F;  2EUC A;  3WHK A;  3B74 A;  3UZU A;  4JI4 M;  4JI1 M;  1DV0 A;  2R45 A;  2Y0T A;  1NJG A;  3GLG E;  1J09 A;  3DFZ A;  3KOX E;  4P16 A;  3U5Z A;  4LF9 M;  5IT9 S;  2AHM A;  3CF6 E;  3U6L A;  1L2C A;  2LTU A;  2M5Z A;  2KXE A;  4GRI A;  3GPU A;  4JV5 M;  4JI3 M;  2ZAM A;  4JI6 M;  1HNW M;  3U60 B;  3U6O A;  1GL7 A;  2VDB B;  1ZMU A;  4QNR A;  1FNN A;  4NSR A;  3W0F A;  3VFD A;  4JI8 M;  2DAE A;  3VKG A;  1BVS A;  2Y21 A;  2ZAO A;  3M6A A;  4UN2 B;  3GLF A;  4XBO A;  2XZU A;  5FTN A;  1T6O A;  3W68 A;  1G59 A;  1XNR M;  4Z6Y A;  4TUW A;  2XEP A;  2QEN A;  3CF2 A;  4LY6 A;  2K9D A;  4GC5 A;  1MN3 A;  4LGY A;  5KPT A;  1ZMW A;  3FUX A;  3SYL A;  2DHR A;  5FTK A;  4B3T M;  1N33 M;  1G4A E;  4IBI A;  5BR8 M;  3HU3 A;  3U6P A;  3J2P B;  8CAT A;  2HL7 A;  2JZ1 A;  3EIH A;  2FNA A;  1XXH A;  2JNH A;  4NRV A;  3PVS A;  4OVZ A;  2F5S A;  1WIV A;  1ZMV A;  3RGP A;  4F1I A;  1OFI A;  1DGG A;  2XGN A;  3HZJ A;  1GVN A;  1WHC A;  2LVO C;  2KEB A;  2JY7 A;  2CHG A;  3AOE A;  4DV0 M;  2C98 A;  1I94 M;  3KOW E;  4RF1 A;  1KFV A;  4MGZ E;  2R46 A;  3HHX A;  1D0L A;  2C96 A;  3H4J A;  1PM5 A;  1R5L A;  2FS1 A;  2JY6 B;  2P5T A;  2M60 A;  3GRR A;  1G8P A;  4FCW A;  3U6C A;  2BWB A;  2OOB A;  4DUY M;  4NXM M;  4LJA A;  4REZ A;  1R7R A;  5GKN A;  3KSX A;  3GPY A;  4AZF A;  3L29 A;  4JI2 M;  2F4V M;  3C9P A;  2WSE F;  3B7Z A;  3I4V A;  4M9X A;  1NHW C;  4GIT A;  4PD2 A;  3TWM A;  1IN5 A;  5ITY A;  4ZPX A;  1OTR A;  2JWS A;  2L2D A;  4DR7 M;  1E9S A;  1DGH A;  1LV7 A;  4LZJ A;  4S12 A;  3K1J A;  3L27 A;  4MM3 B;  1WXQ A;  3EIE A;  1F4I A;  3CTW B;  1TDH A;  4HL4 A;  2G8L A;  2J7N A;  2EJS A;  1TH3 A;  1AIP C;  1GAB A;  3IG5 A;  4DV6 M;  3HU2 A;  5FTM A;  3SAU A;  3FRI A;  3F92 A;  3AOG A;  3VKH A;  2QBY B;  1HT1 E;  4LJ8 A;  3L25 A;  1E9R A;  2DZN B;  3LCU A;  4XGI A;  2DZL A;  3E4R A;  4DV3 M;  1Q3B A;  3J7B A;  3FYC A;  1K3X A;  3JAM S;  2ZTC A;  5ITR A;  4GHA A;  3U6M A;  3I04 M;  3U61 B;  3LCV B;  1IN6 A;  1XMQ M;  5EP2 A;  4HLQ A;  4IBF A;  4KHP M;  2I7N A;  2X49 A;  4L16 A;  4BBA A;  3KP1 E;  4CHT B;  1DO0 A;  2JZ0 A;  4CJ6 A;  1IN4 A;  4CIZ A;  4AKG A;  3C58 A;  1XWI A;  1PJQ A;  3DOA A;  4R71 A;  1C1K A;  3I01 M;  2KHH A;  5EP3 A;  5LMU M;  1FJG M;  4LFB M;  2FFJ A;  3KSJ A;  5ITU A;  3GLH B;  4MGK E;  5EJC A;  4IJE A;  4WW0 A;  3D8L A;  5L8R F;  1HQC A;  1TDZ A;  2H1R A;  4M9Z A;  5FTL A;  3ZC7 B;  2UXB M;  4PT5 A;  1G3I A;  1QZM A;  2CEA A;  2VII A;  3VK8 A;  2DHY A;  3T15 A;  1Q39 A;  3HKP A;  4MH0 E;  4LJ4 A;  4AW4 A;  4CIS A;  4MGI E;  4OW0 A;  4GKK M;  4X64 M;  3SAV A;  2R6F A;  3GRU A;  4QOZ C;  2L09 A;  3SHF A;  3KOZ E;  4KLN A;  3HU1 A;  3TPZ A;  3GLG A;  4DV5 M;  2F5Q A;  5DYG A;  4FCT A;  1SXJ B;  1HNZ M;  1OQY A;  2ERC A;  1IN8 A;  4I8O A;  4LF4 M;  2K6B A;  1NSF A;  2DAK A;  5KPR A;  2MR9 A;  2B3T A;  1HNX M;  3TL4 X;  2LH0 A;  2JXN A;  2R4J A;  1L2B A;  3GQ4 A;  4FVM A;  4L4U A;  3ZQJ A;  4LJ7 A;  4B7F A;  3L28 A;  4IBB A;  4IBD A;  1QAQ A;  2KA6 B;  2UXC M;  2YFQ A;  3QYB A;  3GPX A;  2W82 A;  4DR3 M;  3K2L A;  4KOD A;  1R2Y A;  3NBX X;  2VQE M;  3SAR A;  2UU9 M;  3K9P A;  1Q3C A;  2K0B X;  2A5Y B;  4G4Q A;  1EIJ A;  2O5R A;  4JI7 M;  2V6Z M;  3FTE A;  1D2N A;  1YE9 A;  2ZM6 M;  2BJW A;  3GQ5 A;  1N34 M;  3UMM A;  3IHP A;  2O01 F;  2V1C A;  2JY8 A;  3TE6 A;  4LJ6 A;  1QUS A;  1XHB A;  1IBK M;  2DEN A;  1H6U A;  4AI6 A;  1WJ7 A;  5H37 D;  3I4Y A;  1YSY A;  2R4E A;  5C18 A;  3ILK A;  2FE8 A;  3FD9 A;  4LFC M;  1Y8G A;  2UXD M;  3J7A S;  2FH0 A;  1K3W A;  3KXE C;  3KFU G;  4Z8X A;  1VQ1 A;  2XF3 A;  2DI0 A;  3RFW A;  5IWA M;  3FKE A;  3VDU A;  2LXE A;  2DAM A;  2RKO A;  2XFS A;  3LQQ A;  1G41 A;  4WP2 A;  3SC3 A;  2YQZ A;  1IY0 A;  5FSW A;  3GLI E;  2D7E A;  3KDS E;  1V33 A;  2L4F A;  1I4W A;  2MRO B;  3FTF A;  4AKH A;  2KNA A;  4I5S A;  3SAT A;  2R0I A;  4GC9 A;  3FUT A;  4G6Z A;  4YHH M;  2GQF A;  2QHO B;  1L1T A;  3K9O A;  1YLA A;  5EXP A;  3IEC A;  2YNM D;  3B9P A;  2LHG A;  3KW6 A;  4BLC A;  1IBM M;  4Y28 F;  1Z6T A;  1NO1 A;  2KW0 A;  3MJ5 A;  2OQ4 A;  4B3S M;  1NVM A;  2Y0Q A;  4JI5 M;  1VEJ A;  1NHG C;  4JXJ A;  4AKI A;  3HWS A;  5ITQ A;  1QZE A;  3NBI A;  2HAK A;  3H4M A;  2MJ5 B;  3GLI B;  1D0K A;  1XMO M;  5IRE B;  1N77 A;  2RRU A;  4QHT A;  3RE8 A;  3U5Z B;  1IN7 A;  3GP1 A;  2Z8Y M;  2WZJ A;  1A5T A;  2WSF F;  3SMS A;  5DNY A;  3JR5 A;  3KOY E;  2UUB M;  3GRV A;  2DNA A;  4DR6 M;  3GLH E;  1QDR A;  2DWN A;  2QQ8 A;  4MGH A;  1J5E M;  2UUC M;  1IXS A;  3E46 A;  3W0L B;  4IIW A;  3JR4 A;  3AL0 C;  3R9X B;  4IBC A;  1GKI A;  1L8Q A;  2ZAN A;  3FUU A;  2I7P A;  2GNO A;  4FW9 A;  4LG2 A;  3W67 A;  4GHL A;  1PJI A;  1K82 A;  3J80 S;  3GLF B;  4LF7 M;  2LBC A;  2QNJ A;  4ANR A;  4L8R C;  1R6B X;  1JQJ C;  1QAM A;  2JUJ A;  3DZD A;  1DGF A;  1Z5A A;  2X4A A;  1NY5 A;  4NC6 A;  2C5R A;  3U6S A;  3HJ8 A;  1NV9 A;  2WSC F;  1OAO C;  4D80 A;  3K92 A;  2Y20 A;  3MMP A;  4B3M M;  5E26 A;  3U6D A;  1JB0 F;  1SXJ E;  3AFH A;  4FCV A;  1XXH B;  4JN6 A;  3SAW A;  3KS4 A;  4JI0 M;  1MJG M;  1PRB A;  2J7O A;  3UJN A;  4OVZ B;  3U60 A;  4A3V B;  2XH9 A;  4HEO A;  5ITX A;  3LVW A;  4L15 A;  2DWM A;  2K47 A;  4M0W A;  2Z7J A;  4NSO B;  1C7Y A;  2UUA M;  1W5T A;  2L7I A;  4D81 A;  1GJS A;  4W5W A;  2C99 A;  1OIZ A;  1Z59 A;  3C3E A;  1WGN A;  2F5P A;  3LMM A;  4CGY B;  3U6E A;  3DA1 A;  1SXJ D;  4QOS A;  3MK6 A;  1IQP A;  3NWL A;  4B7G A;  3ZCB B;  1T43 A;  3HY5 A;  2O25 A;  3D8B A;  2XFT A;  4L6V 6;  4AG6 A;  5KPZ A;  4LF8 M;  2JY5 A;  4B7H A;  4OX9 M;  5F3W A;  1T3T A;  4LFA M;  1IM2 A;  1SXJ C;  1Z5C A;  3M7G A;  3HJS A;  4R3D A;  4G4R A;  1DGH B;  3BOS A;  1NNU C;  2JA2 A;  2ZBK B;  3Q8X A;  3SHG B;  4I4L A;  4IBG A;  1V34 A;  4G4N A;  3BBZ A;  5C1B A;  2EKF A;  4GIP A;  3SMP A;  2XSZ D;  3FUW A;  1HQY E;  4G3O A;  4IJF A;  4FWH A;  1HT2 E;  1VDD A;  4LGM A;  5EXT A;  3SAS A;  2N35 A;  3T1H M;  3T38 A;  3L2A A;  2L4E A;  1IXZ A;  3AV0 A;  5EP4 A;  2XZF A;  1E32 A;  3AKZ A;  4BB9 A;  2JP7 A;  2Q2E B;  2CV2 A;  3GO8 A;  2QSF X;  2DAG A;  3A42 A;  3CF0 A;  3QYE A;  3HJQ A;  2KNZ A;  2QPA A;  3C3D A;  5FTJ A;  1XC8 A;  2CV1 A;  1QYR A;  2QP9 X;  1N32 M;  3V76 A;  2DXI A;  1NNJ A;  2D7H A;  1V92 A;  2CRU A;  4L78 A;  2CHQ A;  2C9C A;  2HKJ A;  1TGU A;  2CV0 A;  1VG5 A;  2Z3X A;  3UGJ A;  1N78 A;  1JR3 E;  1Z5B A;  2CUZ A;  2LVA A;  3FTC A;  1OAI A;  1G71 A;  1W5S A;  3FRH A;  2HCB A;  4WUR A; 
#chains in the Genus database with same CATH homology
 2FS1 A;  1TF0 B;  1PRB A;  2J5Y A;  2JWS A;  2MH8 A;  2N35 A;  2LHC A;  1GJT A;  2VDB B;  1GAB A;  1GJS A;  2KDL A;  2LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...