1TF0B

Crystal structure of the ga module complexed with human serum albumin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum albumin
publication title Crystal structure and biological implications of a bacterial albumin binding module in complex with human serum albumin
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1tf0B00
2LHCA 1GABA 2VDBB 1GJSA 2J5YA 2FS1A 1PRBA 2JWSA 2KDLA 2LHGA 2MH8A 1GJTA 1TF0B 2N35A
chains in the Genus database with same CATH superfamily
1QZMA 2A5YB 2MROB 3HHXA 4NSRA 5BPVA 4NOOB 4PDGA 1KFVA 1WXQA 4IBDA 2OOAA 3KS4A 3KOWE 4ITQA 3IG5A 2VQEM 2QP9X 1NNUC 1V34A 3GRYA 1DGHB 4LZZA 4JI6M 2FS1A 2C96A 1D0MA 2Z8YM 2KNZA 4LF5M 1TDZA 2DWLA 3J27B 2ZTCA 3J7AS 1WGNA 4G3OA 3SMSA 2N35A 2V1UA 4L6V6 3VKHA 4QNRA 1X37A 4WP2A 2R4EA 3FYCA 1ZMUA 2FNAA 3IHPA 1QAOA 3T1YM 2DWMA 1V92A 2I7NA 1TF0B 4FCTA 4DR4M 3RFWA 4NSOB 4X62M 3LQQA 2YNMD 2F5NA 1NV9A 1N33M 3W0LB 4DR1M 1L8QA 1G71A 1YLAA 4ANRA 1I4WA 1OFIA 2DNAA 4M9XA 5EP3A 3HHZA 4JI8M 2QCUA 1VG5A 2L6OA 5ITTA 3U6OA 5KO3A 4QHSA 4HEOA 5EJCA 1SXJA 3J7BA 1W5TA 3FTEA 2XFTA 4GC9A 4R71A 1OQYA 1DO0A 2DWNA 3U6DA 1A5TA 2EKFA 3L26A 2K47A 3RE8A 1VDDA 1ORYB 1T6OA 1T3TA 3HY5A 2BNKA 1SXJC 2QQ8A 1SXJE 3A98B 4MGYE 1N77A 3MHVC 2JZ0A 2XGNA 1KSFX 5BR8M 2VDBB 3UMMA 2JWSA 3GPPA 4GIPA 2MGWA 4KODA 4AKIA 2LNHC 4ZPXA 1HNWM 3ZCBB 2CRUA 3VKGA 3E46A 1MX0A 2H5XA 4G4QA 5GKNA 4GEWA 3WHLA 3Q8XA 1IN6A 4JN6A 1QDTA 3A45A 1XXHA 4I4LA 3AOGA 1OAIA 3KW6A 2BJVA 5LMUM 2UXCM 1IXSA 3KVWA 3GLGA 4PCZA 3ZC7B 4FD2A 1EIJA 2XEPA 4DR3M 3W67A 1R4GA 2O01F 3AKZA 2FFJA 1TH4A 4DV6M 3T38A 3TPZA 4DR5M 3VK8A 4P16A 3GLGE 2RGOA 3GLIA 3L27A 2KZUA 3UZUA 2AHMA 3FUXA 4IBGA 5IT9S 5EP4A 1CUKA 4LG2A 4FWGA 2DHRA 2OOBA 3CF6E 4YHHM 2LHCA 2CE7A 3EIHA 3UGJA 5EP2A 5FTNA 5KPTA 3GLIE 4GKKM 4KHPM 2CP8A 5ITRA 2VF8A 1GVNA 2CHVA 1R6BX 2JY8A 1DGHA 2DENA 4UN2B 2P5TA 5DYIA 3L28A 1JR3A 2KA6B 2VIIA 2HAKA 3UK6A 3FUTA 1GO5A 2LVOC 2ZAOA 1HQCA 2GNOA 2JUJA 1NSFA 2VF7A 3C9PA 1T43A 3QAUA 3B7QA 4X66M 2JA2A 2DVWB 2C5RA 2DXIA 3SYLA 1JR3E 1QZEA 1IXZA 1WIVA 4P17A 3RGPA 5IZ7D 3U6QA 2L09A 2Q2EB 3VK7A 4K0KM 1NJGA 2LH0A 4JI7M 1LTMA 5EP1A 1XWIA 2KRKA 3SHGB 1XXHB 2EJSA 3GPYA 4RNAA 2UUAM 4F2LA 3LCVB 4RKUF 4F1IA 2XZFA 4AZFA 3CGWA 2LWXA 3IECA 1OFHA 1L1TA 1YSYA 1FJGM 1N78A 3I51A 3B74A 4GMQA 4IBFA 1OIZA 3HGIA 3TWKA 1WGLA 3B7ZA 3CTWB 1EFUB 2MR9A 3UJNA 4LFBM 4DV1M 1G59A 2R45A 2DWZB 3FKEA 3FTDA 3LW5F 4B7GA 3U60A 3D8LA 2UXDM 2KZSA 4OVZB 3VDUA 5DYGA 1HT1E 4B3MM 1UFZA 4JI3M 3T1HM 1G8PA 4LF9M 3KSJA 1J5EM 4LJAA 2HL7A 3B7NA 3HZJA 4B08A 3KS8A 2QNJA 1E9RA 2DAKA 2ZTDA 3HJQA 3K92A 5ITXE 1N75A 4LF4M 1Z6TA 4LJ6A 3FRHA 4QHTA 4AQYM 1DV0A 5KPZA 3GQ4A 4WURA 3GQ5A 4L78A 2UUBM 3M0EA 1JB0F 1Q39A 2J5YA 4L4UA 1OJLA 4MGKE 4DV2M 5H37D 4CJ6A 2LBCA 3TWMA 3C58A 2CV0A 1WHCA 2RRUA 3AV0A 3AOEA 4BB9A 2L7IA 2CUZA 1OTRA 1OKSA 3U6EA 3MJ5A 1ZMVA 2JP7A 3NBXX 3H4JA 3A42A 2APLA 4G4NA 1QVRA 3PVSA 2GQFA 2KXEA 2ERCA 3LMMA 4GH9A 4LJ8A 4DV5M 1R2YA 1IY0A 2D7GA 1W5SA 5F3WA 3U5ZB 1IBKM 1QANA 1DGGA 3C3EA 1XC8A 1K82A 3M7GA 4BLCA 1PJQA 3IG8A 4M0DA 3K1JA 2OPFA 2LHGA 3MMPA 4B3RM 3K9OA 3HWSA 2V6ZM 2ZM6M 3U60B 4DV7M 4CIZA 4FVMA 2LVNC 5ITQA 2X49A 3FD9A 2F4VM 3B89A 3K8ZA 4CGYB 1QDRA 4X64M 3I01M 1GLNA 1PRBA 2JNHA 3B9PA 2Z4RA 4MM3B 4CHTB 2JXNA 1IQPA 5EXPA 3FYDA 3T6PA 2Z7JA 4AKGA 2YQZA 1AIPC 2XSZD 2M5ZA 3DOAA 4G6ZA 1AUAA 2KW0A 4KT0F 1LV7A 4MB7A 5LMNM 2CEAA 2MJ5B 4QOSA 3KOYE 1I94M 1NY5A 3HJSA 1K3XA 3ZH9B 3GO8A 3SHFA 2CV2A 2F5QA 4JI2M 1PJSA 3PNVA 1TH3A 3HKPA 4XGIA 2D7EA 2Z3XA 2UU9M 3SASA 3LVWA 1TH2A 5KQDA 2J7OA 1Q3CA 3HHWA 1E32A 4XK8F 2H1RA 1XXHE 4LJ5A 3J81S 3FUWA 3GPXA 1PGYA 4NRWA 7CATA 3I4YA 2O25A 1NY6A 3FUVA 1XNQM 1NHGC 5JI3E 1DO2A 2QSFX 4RF0A 4IBIA 3JAMS 3R8FA 3C3DA 2RKOA 4LFAM 4OVZA 1E94E 4GC5A 1D0LA 4GRIA 5IWAM 2L7HA 1ZV1A 1HNZM 2WSFF 2EUCA 2FH0A 4AG5A 3I4VA 2DAMA 1S3SA 4IBEA 4DV0M 3KFUG 4JV5M 1UM8A 2LTUA 3HX3A 4PDIA 2Y20A 2WSEF 4QNMA 3U6PA 2DKLA 3GRRA 1PJJA 1J09A 4LZJA 4D81A 4LGYA 2HHHM 2KRUA 3KP1E 5EXTA 3SC3A 1IBMM 4IJFA 1L2BA 1D2NA 3SARA 4D82A 3LVVA 2WSCF 2K6BA 4JI1M 2MH8A 5FTJA 4GHLA 5FTMA 3FE3A 4M9ZA 1DGBA 4JI5M 3U61A 2JY7A 1OIPA 1PJTA 1QUTA 1Z59A 3D8BA 3GLHA 4NRVA 4DBGB 4B3TM 3FRIA 5A2QS 4DR6M 4HL4A 1WR1B 3BOSA 3F92A 2ZBKB 2KHHA 1MU5A 1Y8GA 2DZLA 3JR5A 5DFLA 2DI0A 3K2LA 3U5ZA 4FWDA 4LRTA 1L2CA 1HQYE 2YR0A 5FTKA 3SAVA 3FTFA 2XFSA 3A46A 1TR8A 3GPUA 1VEKA 2F5PA 1N36M 2QZ4A 1YE9A 2XF3A 4B3SM 3JR4A 4LF8M 3J80S 1ZMWA 2QBYB 1NO1A 1IY1A 1Z5BA 1EE8A 4RF1A 1R2ZA 4HLQA 4L8RC 2KEBA 3SMPA 4R3DA 4L16A 3KDSE 3HU1A 5L8RF 4DV4M 3SAUA 2FOIC 4R7GA 5E6JA 4FCWA 4LF7M 5EXXA 4JYAM 1IN8A 2J7NA 2R44A 2HCBA 3VFDA 3FUUA 1L1ZA 3RGSA 2UXBM 3BXWA 2W82A 4YY3M 3CF2A 4IBKA 4DUYM 1XNRM 1WJ7A 1QUSA 1HNXM 2RGHA 3HU3A 2LVQD 2L4EA 3THGA 1HT2E 1Q02A 1Z5AA 4Q7JA 3KP0E 3E21A 4Z8XA 1N34M 4LJ4A 4IIWA 4JXJA 3TL4X 2DAGA 5JI2E 4BBAA 2EA0A 3TQSA 4MH0E 4G4RA 3U61B 3J2PB 3I04M 4GHAA 3GLHB 2VQFM 1VEJA 1F4IA 2CV1A 3AOEC 2K9DA 3EIEA 4DV3M 4OW0A 1ZQ9A 1ZAEA 1J7KA 4LGMA 1IM2A 3E9SA 2CHGA 4I81A 2C98A 2R0IA 5FSWA 1C1KA 4M9SA 1IN4A 4EIWA 3U6CA 3VLFB 2OO9A 1E9SA 2NQ8C 3ZQJA 1XB2B 3CF0A 4MGZE 1K3WA 3SBJA 2I7PA 2KNVA 3KOZE 1GJSA 2XSZA 3U6LA 4AKHA 2R18A 2Z4SA 2EO2A 3SYKA 4CISA 1N32M 2LVAA 4OU7A 3KSXA 2DAEA 4NXMM 2FE8A 1NV8A 1GKIA 3U6MA 2QENA 4REZA 3DA1A 5KPRA 5FLXS 2KNAA 4AI6A 1RU3A 3GLFA 2R6FA 1JQJC 3SAWA 4AW4A 1DGFA 5KQ8A 5E26A 1PM5A 4DUZM 4FW9A 4FCVA 4NL4H 1QYRA 2CWBA 1VDLA 3DFZA 4IBJA 3ILKA 2UUCM 3GLFE 1GABA 2G3QA 2ZAMA 3GRUA 2Y0QA 1NVMA 1NHWC 1G4AE 2JY5A 4B7HA 2XZUA 2F5SA 2LVPC 4I8OA 1TDHA 4Z6YA 1NNJA 4L15A 2C9CA 1IN7A 2L4FA 1R7RA 3R9XB 3AJIB 4IBBA 4LRSA 1XHBA 3QWLA 2XLJA 2V1CA 3W68A 4NXNM 4LJ7A 1OAOC 1SXJD 3HHYA 1KYIA 4I5SA 2BWEA 3DZDA 5IREB 4DR7M 2CFOA 2QBYA 2HWJA 2C99A 2WZJA 3GRVA 3OTOM 1G41A 3HJ8A 4FWHA 5ITYA 4LF6M 2DAIA 1GJTA 3NBIA 2K0BX 1FNNA 2F5OA 4GKJM 3M6AA 4II7A 3PXGA 4QOZC 3K9PA 4G4OA 1XMQM 3GP1A 1G3IA 1QAMA 2EKKA 2X8AA 3W0FA 1QQWA 5EQTA 3QYBA 4B7FA 1IN5A 3TE6A 3BBZA 4W5WA 1PJIA 3SFZA 2L2DA 2KDLA 2CHQA 1VEGA 8CATA 3GLFB 2BJWA 5C18A 2DZOB 3QYEA 4PT5A 3L2AA 4KO8A 2M60A 3L29A 2YFQA 2R62A 3HU2A 1BVSA 2XH9A 4DR2M 1SXJB 3L25A 1IFYA 2LXEA 4XBOA 2OQ4A 3AL0C 2D7HA 1R5LA 4KLNA 1V33A 4A3VB 4S12A 1TGUA 1XMOM 1MN3A 1Q3BA 5ITUA 2R65A 4Y28F 4LCBA 5FTLA 3PNYA 1NJFA 2QPAA 3LCUA 4LFCM 1QAQA 4LJ9A 2R46A 2DZNB 1H6UA 3GLHE 1GL6A 2E5LM 2Y0TA 2R4JA 1TTEA 2G5GX 4LY6A 3Q8GA 3VDPA 3T15A 3WHKA 4IBCA 4TUWA 3MK6A 4WW0A 5EXSA 1IBLM 3KOXE 3H4MA 3E4RA 2B3TA 1JR3D 4MGIE 2BWBA 3SATA 4JI4M 2QHOB 1D0KA 1HJPA 3FTCA 1MJGM 4GITA 1IXSB 3U6SA 3GLGB 5C1BA 2DHYA 2JY6B 2HKJA 3KXEC 1IY2A 1SG9A 1VQ1A 3GQ3A 2G8LA 1GL7A 1IXRC 1YUBA 2JZ1A 3AFHA 4D80A 4AG6A 4M0WA 3NWLA 2ZANA 3V76A 4NC6A 3GLIB 1P3QQ 2C9OA 3PFIA 4MGHA 4X65M 1L2DA 1HR0M 2Y21A 5DNYA 3LQRA 4OX9M 4JI0M 4IJEA 5ITXA 4PD2A 3TWLA 1C7YA 2O5RA 2X4AA 1Z5CA
chains in the Genus database with same CATH topology
2LHCA 1GABA 2VDBB 1GJSA 2J5YA 2FS1A 1PRBA 2JWSA 2KDLA 2LHGA 2MH8A 1GJTA 1TF0B 2N35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHC A;  1GAB A;  2VDB B;  1GJS A;  2J5Y A;  2FS1 A;  1PRB A;  2JWS A;  2KDL A;  2LHG A;  2MH8 A;  1GJT A;  1TF0 B;  2N35 A; 
#chains in the Genus database with same CATH topology
 1QZM A;  2A5Y B;  2MRO B;  3HHX A;  4NSR A;  5BPV A;  4NOO B;  4PDG A;  1KFV A;  1WXQ A;  4IBD A;  2OOA A;  3KS4 A;  3KOW E;  4ITQ A;  3IG5 A;  2VQE M;  2QP9 X;  1NNU C;  1V34 A;  3GRY A;  1DGH B;  4LZZ A;  4JI6 M;  2FS1 A;  2C96 A;  1D0M A;  2Z8Y M;  2KNZ A;  4LF5 M;  1TDZ A;  2DWL A;  3J27 B;  2ZTC A;  3J7A S;  1WGN A;  4G3O A;  3SMS A;  2N35 A;  2V1U A;  4L6V 6;  3VKH A;  4QNR A;  1X37 A;  4WP2 A;  2R4E A;  3FYC A;  1ZMU A;  2FNA A;  3IHP A;  1QAO A;  3T1Y M;  2DWM A;  1V92 A;  2I7N A;  1TF0 B;  4FCT A;  4DR4 M;  3RFW A;  4NSO B;  4X62 M;  3LQQ A;  2YNM D;  2F5N A;  1NV9 A;  1N33 M;  3W0L B;  4DR1 M;  1L8Q A;  1G71 A;  1YLA A;  4ANR A;  1I4W A;  1OFI A;  2DNA A;  4M9X A;  5EP3 A;  3HHZ A;  4JI8 M;  2QCU A;  1VG5 A;  2L6O A;  5ITT A;  3U6O A;  5KO3 A;  4QHS A;  4HEO A;  5EJC A;  1SXJ A;  3J7B A;  1W5T A;  3FTE A;  2XFT A;  4GC9 A;  4R71 A;  1OQY A;  1DO0 A;  2DWN A;  3U6D A;  1A5T A;  2EKF A;  3L26 A;  2K47 A;  3RE8 A;  1VDD A;  1ORY B;  1T6O A;  1T3T A;  3HY5 A;  2BNK A;  1SXJ C;  2QQ8 A;  1SXJ E;  3A98 B;  4MGY E;  1N77 A;  3MHV C;  2JZ0 A;  2XGN A;  1KSF X;  5BR8 M;  2VDB B;  3UMM A;  2JWS A;  3GPP A;  4GIP A;  2MGW A;  4KOD A;  4AKI A;  2LNH C;  4ZPX A;  1HNW M;  3ZCB B;  2CRU A;  3VKG A;  3E46 A;  1MX0 A;  2H5X A;  4G4Q A;  5GKN A;  4GEW A;  3WHL A;  3Q8X A;  1IN6 A;  4JN6 A;  1QDT A;  3A45 A;  1XXH A;  4I4L A;  3AOG A;  1OAI A;  3KW6 A;  2BJV A;  5LMU M;  2UXC M;  1IXS A;  3KVW A;  3GLG A;  4PCZ A;  3ZC7 B;  4FD2 A;  1EIJ A;  2XEP A;  4DR3 M;  3W67 A;  1R4G A;  2O01 F;  3AKZ A;  2FFJ A;  1TH4 A;  4DV6 M;  3T38 A;  3TPZ A;  4DR5 M;  3VK8 A;  4P16 A;  3GLG E;  2RGO A;  3GLI A;  3L27 A;  2KZU A;  3UZU A;  2AHM A;  3FUX A;  4IBG A;  5IT9 S;  5EP4 A;  1CUK A;  4LG2 A;  4FWG A;  2DHR A;  2OOB A;  3CF6 E;  4YHH M;  2LHC A;  2CE7 A;  3EIH A;  3UGJ A;  5EP2 A;  5FTN A;  5KPT A;  3GLI E;  4GKK M;  4KHP M;  2CP8 A;  5ITR A;  2VF8 A;  1GVN A;  2CHV A;  1R6B X;  2JY8 A;  1DGH A;  2DEN A;  4UN2 B;  2P5T A;  5DYI A;  3L28 A;  1JR3 A;  2KA6 B;  2VII A;  2HAK A;  3UK6 A;  3FUT A;  1GO5 A;  2LVO C;  2ZAO A;  1HQC A;  2GNO A;  2JUJ A;  1NSF A;  2VF7 A;  3C9P A;  1T43 A;  3QAU A;  3B7Q A;  4X66 M;  2JA2 A;  2DVW B;  2C5R A;  2DXI A;  3SYL A;  1JR3 E;  1QZE A;  1IXZ A;  1WIV A;  4P17 A;  3RGP A;  5IZ7 D;  3U6Q A;  2L09 A;  2Q2E B;  3VK7 A;  4K0K M;  1NJG A;  2LH0 A;  4JI7 M;  1LTM A;  5EP1 A;  1XWI A;  2KRK A;  3SHG B;  1XXH B;  2EJS A;  3GPY A;  4RNA A;  2UUA M;  4F2L A;  3LCV B;  4RKU F;  4F1I A;  2XZF A;  4AZF A;  3CGW A;  2LWX A;  3IEC A;  1OFH A;  1L1T A;  1YSY A;  1FJG M;  1N78 A;  3I51 A;  3B74 A;  4GMQ A;  4IBF A;  1OIZ A;  3HGI A;  3TWK A;  1WGL A;  3B7Z A;  3CTW B;  1EFU B;  2MR9 A;  3UJN A;  4LFB M;  4DV1 M;  1G59 A;  2R45 A;  2DWZ B;  3FKE A;  3FTD A;  3LW5 F;  4B7G A;  3U60 A;  3D8L A;  2UXD M;  2KZS A;  4OVZ B;  3VDU A;  5DYG A;  1HT1 E;  4B3M M;  1UFZ A;  4JI3 M;  3T1H M;  1G8P A;  4LF9 M;  3KSJ A;  1J5E M;  4LJA A;  2HL7 A;  3B7N A;  3HZJ A;  4B08 A;  3KS8 A;  2QNJ A;  1E9R A;  2DAK A;  2ZTD A;  3HJQ A;  3K92 A;  5ITX E;  1N75 A;  4LF4 M;  1Z6T A;  4LJ6 A;  3FRH A;  4QHT A;  4AQY M;  1DV0 A;  5KPZ A;  3GQ4 A;  4WUR A;  3GQ5 A;  4L78 A;  2UUB M;  3M0E A;  1JB0 F;  1Q39 A;  2J5Y A;  4L4U A;  1OJL A;  4MGK E;  4DV2 M;  5H37 D;  4CJ6 A;  2LBC A;  3TWM A;  3C58 A;  2CV0 A;  1WHC A;  2RRU A;  3AV0 A;  3AOE A;  4BB9 A;  2L7I A;  2CUZ A;  1OTR A;  1OKS A;  3U6E A;  3MJ5 A;  1ZMV A;  2JP7 A;  3NBX X;  3H4J A;  3A42 A;  2APL A;  4G4N A;  1QVR A;  3PVS A;  2GQF A;  2KXE A;  2ERC A;  3LMM A;  4GH9 A;  4LJ8 A;  4DV5 M;  1R2Y A;  1IY0 A;  2D7G A;  1W5S A;  5F3W A;  3U5Z B;  1IBK M;  1QAN A;  1DGG A;  3C3E A;  1XC8 A;  1K82 A;  3M7G A;  4BLC A;  1PJQ A;  3IG8 A;  4M0D A;  3K1J A;  2OPF A;  2LHG A;  3MMP A;  4B3R M;  3K9O A;  3HWS A;  2V6Z M;  2ZM6 M;  3U60 B;  4DV7 M;  4CIZ A;  4FVM A;  2LVN C;  5ITQ A;  2X49 A;  3FD9 A;  2F4V M;  3B89 A;  3K8Z A;  4CGY B;  1QDR A;  4X64 M;  3I01 M;  1GLN A;  1PRB A;  2JNH A;  3B9P A;  2Z4R A;  4MM3 B;  4CHT B;  2JXN A;  1IQP A;  5EXP A;  3FYD A;  3T6P A;  2Z7J A;  4AKG A;  2YQZ A;  1AIP C;  2XSZ D;  2M5Z A;  3DOA A;  4G6Z A;  1AUA A;  2KW0 A;  4KT0 F;  1LV7 A;  4MB7 A;  5LMN M;  2CEA A;  2MJ5 B;  4QOS A;  3KOY E;  1I94 M;  1NY5 A;  3HJS A;  1K3X A;  3ZH9 B;  3GO8 A;  3SHF A;  2CV2 A;  2F5Q A;  4JI2 M;  1PJS A;  3PNV A;  1TH3 A;  3HKP A;  4XGI A;  2D7E A;  2Z3X A;  2UU9 M;  3SAS A;  3LVW A;  1TH2 A;  5KQD A;  2J7O A;  1Q3C A;  3HHW A;  1E32 A;  4XK8 F;  2H1R A;  1XXH E;  4LJ5 A;  3J81 S;  3FUW A;  3GPX A;  1PGY A;  4NRW A;  7CAT A;  3I4Y A;  2O25 A;  1NY6 A;  3FUV A;  1XNQ M;  1NHG C;  5JI3 E;  1DO2 A;  2QSF X;  4RF0 A;  4IBI A;  3JAM S;  3R8F A;  3C3D A;  2RKO A;  4LFA M;  4OVZ A;  1E94 E;  4GC5 A;  1D0L A;  4GRI A;  5IWA M;  2L7H A;  1ZV1 A;  1HNZ M;  2WSF F;  2EUC A;  2FH0 A;  4AG5 A;  3I4V A;  2DAM A;  1S3S A;  4IBE A;  4DV0 M;  3KFU G;  4JV5 M;  1UM8 A;  2LTU A;  3HX3 A;  4PDI A;  2Y20 A;  2WSE F;  4QNM A;  3U6P A;  2DKL A;  3GRR A;  1PJJ A;  1J09 A;  4LZJ A;  4D81 A;  4LGY A;  2HHH M;  2KRU A;  3KP1 E;  5EXT A;  3SC3 A;  1IBM M;  4IJF A;  1L2B A;  1D2N A;  3SAR A;  4D82 A;  3LVV A;  2WSC F;  2K6B A;  4JI1 M;  2MH8 A;  5FTJ A;  4GHL A;  5FTM A;  3FE3 A;  4M9Z A;  1DGB A;  4JI5 M;  3U61 A;  2JY7 A;  1OIP A;  1PJT A;  1QUT A;  1Z59 A;  3D8B A;  3GLH A;  4NRV A;  4DBG B;  4B3T M;  3FRI A;  5A2Q S;  4DR6 M;  4HL4 A;  1WR1 B;  3BOS A;  3F92 A;  2ZBK B;  2KHH A;  1MU5 A;  1Y8G A;  2DZL A;  3JR5 A;  5DFL A;  2DI0 A;  3K2L A;  3U5Z A;  4FWD A;  4LRT A;  1L2C A;  1HQY E;  2YR0 A;  5FTK A;  3SAV A;  3FTF A;  2XFS A;  3A46 A;  1TR8 A;  3GPU A;  1VEK A;  2F5P A;  1N36 M;  2QZ4 A;  1YE9 A;  2XF3 A;  4B3S M;  3JR4 A;  4LF8 M;  3J80 S;  1ZMW A;  2QBY B;  1NO1 A;  1IY1 A;  1Z5B A;  1EE8 A;  4RF1 A;  1R2Z A;  4HLQ A;  4L8R C;  2KEB A;  3SMP A;  4R3D A;  4L16 A;  3KDS E;  3HU1 A;  5L8R F;  4DV4 M;  3SAU A;  2FOI C;  4R7G A;  5E6J A;  4FCW A;  4LF7 M;  5EXX A;  4JYA M;  1IN8 A;  2J7N A;  2R44 A;  2HCB A;  3VFD A;  3FUU A;  1L1Z A;  3RGS A;  2UXB M;  3BXW A;  2W82 A;  4YY3 M;  3CF2 A;  4IBK A;  4DUY M;  1XNR M;  1WJ7 A;  1QUS A;  1HNX M;  2RGH A;  3HU3 A;  2LVQ D;  2L4E A;  3THG A;  1HT2 E;  1Q02 A;  1Z5A A;  4Q7J A;  3KP0 E;  3E21 A;  4Z8X A;  1N34 M;  4LJ4 A;  4IIW A;  4JXJ A;  3TL4 X;  2DAG A;  5JI2 E;  4BBA A;  2EA0 A;  3TQS A;  4MH0 E;  4G4R A;  3U61 B;  3J2P B;  3I04 M;  4GHA A;  3GLH B;  2VQF M;  1VEJ A;  1F4I A;  2CV1 A;  3AOE C;  2K9D A;  3EIE A;  4DV3 M;  4OW0 A;  1ZQ9 A;  1ZAE A;  1J7K A;  4LGM A;  1IM2 A;  3E9S A;  2CHG A;  4I81 A;  2C98 A;  2R0I A;  5FSW A;  1C1K A;  4M9S A;  1IN4 A;  4EIW A;  3U6C A;  3VLF B;  2OO9 A;  1E9S A;  2NQ8 C;  3ZQJ A;  1XB2 B;  3CF0 A;  4MGZ E;  1K3W A;  3SBJ A;  2I7P A;  2KNV A;  3KOZ E;  1GJS A;  2XSZ A;  3U6L A;  4AKH A;  2R18 A;  2Z4S A;  2EO2 A;  3SYK A;  4CIS A;  1N32 M;  2LVA A;  4OU7 A;  3KSX A;  2DAE A;  4NXM M;  2FE8 A;  1NV8 A;  1GKI A;  3U6M A;  2QEN A;  4REZ A;  3DA1 A;  5KPR A;  5FLX S;  2KNA A;  4AI6 A;  1RU3 A;  3GLF A;  2R6F A;  1JQJ C;  3SAW A;  4AW4 A;  1DGF A;  5KQ8 A;  5E26 A;  1PM5 A;  4DUZ M;  4FW9 A;  4FCV A;  4NL4 H;  1QYR A;  2CWB A;  1VDL A;  3DFZ A;  4IBJ A;  3ILK A;  2UUC M;  3GLF E;  1GAB A;  2G3Q A;  2ZAM A;  3GRU A;  2Y0Q A;  1NVM A;  1NHW C;  1G4A E;  2JY5 A;  4B7H A;  2XZU A;  2F5S A;  2LVP C;  4I8O A;  1TDH A;  4Z6Y A;  1NNJ A;  4L15 A;  2C9C A;  1IN7 A;  2L4F A;  1R7R A;  3R9X B;  3AJI B;  4IBB A;  4LRS A;  1XHB A;  3QWL A;  2XLJ A;  2V1C A;  3W68 A;  4NXN M;  4LJ7 A;  1OAO C;  1SXJ D;  3HHY A;  1KYI A;  4I5S A;  2BWE A;  3DZD A;  5IRE B;  4DR7 M;  2CFO A;  2QBY A;  2HWJ A;  2C99 A;  2WZJ A;  3GRV A;  3OTO M;  1G41 A;  3HJ8 A;  4FWH A;  5ITY A;  4LF6 M;  2DAI A;  1GJT A;  3NBI A;  2K0B X;  1FNN A;  2F5O A;  4GKJ M;  3M6A A;  4II7 A;  3PXG A;  4QOZ C;  3K9P A;  4G4O A;  1XMQ M;  3GP1 A;  1G3I A;  1QAM A;  2EKK A;  2X8A A;  3W0F A;  1QQW A;  5EQT A;  3QYB A;  4B7F A;  1IN5 A;  3TE6 A;  3BBZ A;  4W5W A;  1PJI A;  3SFZ A;  2L2D A;  2KDL A;  2CHQ A;  1VEG A;  8CAT A;  3GLF B;  2BJW A;  5C18 A;  2DZO B;  3QYE A;  4PT5 A;  3L2A A;  4KO8 A;  2M60 A;  3L29 A;  2YFQ A;  2R62 A;  3HU2 A;  1BVS A;  2XH9 A;  4DR2 M;  1SXJ B;  3L25 A;  1IFY A;  2LXE A;  4XBO A;  2OQ4 A;  3AL0 C;  2D7H A;  1R5L A;  4KLN A;  1V33 A;  4A3V B;  4S12 A;  1TGU A;  1XMO M;  1MN3 A;  1Q3B A;  5ITU A;  2R65 A;  4Y28 F;  4LCB A;  5FTL A;  3PNY A;  1NJF A;  2QPA A;  3LCU A;  4LFC M;  1QAQ A;  4LJ9 A;  2R46 A;  2DZN B;  1H6U A;  3GLH E;  1GL6 A;  2E5L M;  2Y0T A;  2R4J A;  1TTE A;  2G5G X;  4LY6 A;  3Q8G A;  3VDP A;  3T15 A;  3WHK A;  4IBC A;  4TUW A;  3MK6 A;  4WW0 A;  5EXS A;  1IBL M;  3KOX E;  3H4M A;  3E4R A;  2B3T A;  1JR3 D;  4MGI E;  2BWB A;  3SAT A;  4JI4 M;  2QHO B;  1D0K A;  1HJP A;  3FTC A;  1MJG M;  4GIT A;  1IXS B;  3U6S A;  3GLG B;  5C1B A;  2DHY A;  2JY6 B;  2HKJ A;  3KXE C;  1IY2 A;  1SG9 A;  1VQ1 A;  3GQ3 A;  2G8L A;  1GL7 A;  1IXR C;  1YUB A;  2JZ1 A;  3AFH A;  4D80 A;  4AG6 A;  4M0W A;  3NWL A;  2ZAN A;  3V76 A;  4NC6 A;  3GLI B;  1P3Q Q;  2C9O A;  3PFI A;  4MGH A;  4X65 M;  1L2D A;  1HR0 M;  2Y21 A;  5DNY A;  3LQR A;  4OX9 M;  4JI0 M;  4IJE A;  5ITX A;  4PD2 A;  3TWL A;  1C7Y A;  2O5R A;  2X4A A;  1Z5C A; 
#chains in the Genus database with same CATH homology
 2LHC A;  1GAB A;  2VDB B;  1GJS A;  2J5Y A;  2FS1 A;  1PRB A;  2JWS A;  2KDL A;  2LHG A;  2MH8 A;  1GJT A;  1TF0 B;  2N35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...