3A46A

Crystal structure of mvnei1/thf complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
molecule keywords Formamidopyrimidine-DNA glycosylase
total genus 84
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a46A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a46A01
3T1HM 1XNQM 3J80S 3J81S 3GPYA 3VK8A 4PDIA 1NNJA 4DV7M 4LF5M 3T1YM 4DV5M 2VQFM 3U6MA 1TDHA 3U6PA 4DR1M 2UXDM 4LF7M 1KFVA 3GPPA 1XC8A 4DR5M 4PD2A 1XMQM 2F5SA 3TWLA 1XNRM 4B3RM 2E5LM 1Z5CA 5A2QS 3VK7A 3TWKA 2Q2EB 1TDZA 4G4NA 3TWMA 1IBLM 4B3MM 4CISA 2XZFA 1N33M 5ITUA 3A45A 1HNXM 4LFAM 3JR4A 1PJIA 4MB7A 1MX0A 5ITTA 3GO8A 1K82A 2F5NA 3A46A 3U6EA 1IBKM 1L2DA 1L1TA 5FLXS 4AQYM 3SASA 5ITYA 4NXNM 4DUYM 4B3TM 4JI8M 4JI6M 1HNWM 4JV5M 2F5QA 3DOAA 1L1ZA 4DV3M 2UUAM 4JI7M 4G4OA 4GKKM 2OQ4A 2ZBKB 3SAUA 4DV4M 3C58A 1FJGM 4GKJM 2UXCM 5ITXA 4YY3M 4G4QA 4NRWA 2F4VM 1HNZM 2F5PA 4NXMM 2F5OA 1Z5AA 1K3WA 3J7AS 3GPXA 4X62M 1IBMM 3JR5A 3SBJA 4ITQA 4DV0M 3GQ5A 5BR8M 3JAMS 2VQEM 5LMNM 1Z59A 5LMUM 4DR2M 4DV1M 1HR0M 1R2ZA 4PDGA 4G4RA 4X65M 4JI1M 1PM5A 3A42A 5IWAM 4NRVA 1N36M 3U6LA 4JI0M 2UUBM 4JI2M 1XMOM 4B3SM 4KHPM 1PJJA 2EA0A 1J5EM 4LFCM 4YHHM 2ZM6M 4JYAM 5ITRA 1I94M 2UUCM 3SAWA 4LF4M 1Q39A 4OX9M 4DR4M 1Z5BA 5ITXE 1N34M 4JI5M 4DV2M 3GQ3A 4JI4M 3U6DA 3SAVA 4DR3M 4DR7M 3U6QA 3GPUA 3U6CA 1N32M 3GQ4A 1K3XA 4DR6M 4LFBM 3OTOM 1L2BA 1MU5A 1R2YA 2UXBM 4DV6M 1Q3BA 2HKJA 4X64M 3GP1A 4PCZA 4DUZM 5ITQA 3U6SA 3W0FA 3SARA 2XZUA 4K0KM 4LF6M 4LF9M 5IT9S 1EE8A 4X66M 1L2CA 1Q3CA 4LF8M 2UU9M 2OPFA 2HHHM 3U6OA 3SATA 4JI3M
chains in the Genus database with same CATH superfamily
3KOYE 1XB2B 1XNQM 4RF0A 3VDUA 2VF8A 2ERCA 4PDIA 4M9ZA 2KHHA 3VKGA 4DR1M 1DO2A 4IJEA 1WGLA 1QANA 4LGYA 1VEGA 3UK6A 1NVMA 1XNRM 1GLNA 1S3SA 2DZNB 2QNJA 2Y0QA 2NQ8C 3TWLA 1Z6TA 4OW0A 5FTKA 1IN5A 4B7HA 1XXHA 3AOGA 4AKGA 3KW6A 3D8LA 1QAQA 5A2QS 1IXSB 2JNHA 2ZANA 4L4UA 2LNHC 2MJ5B 2OO9A 2XF3A 5EXSA 3CGWA 2JY8A 2Z4RA 4G6ZA 3KS4A 2EO2A 3F92A 5GKNA 1YUBA 3A45A 1J7KA 3B74A 3FYCA 4LJ6A 2KNZA 4L15A 3GO8A 5ITTA 1K82A 4FWDA 1JR3A 4AG6A 1UFZA 1NO1A 3W68A 3KXEC 1QZMA 2I7NA 1GVNA 2XFTA 4DUYM 1R4GA 1OQYA 4GHAA 5EXPA 5KPZA 3KSJA 4D80A 4Z8XA 4JV5M 3GLIB 3L29A 4LRTA 4DV3M 4HEOA 4B08A 4JI7M 4G4OA 2CWBA 2DKLA 3SAUA 1FJGM 1A5TA 3AV0A 5EJCA 2DAIA 2HAKA 2JUJA 5ITXA 1NHGC 2CV2A 4G4QA 4NRWA 4HL4A 2QSFX 4P17A 4IBIA 3U60B 4KODA 3H4JA 3HGIA 3K9PA 1IBMM 3HHWA 2M5ZA 1NJFA 3NBXX 4LJAA 2DZOB 2DXIA 3B7ZA 1HT2E 3LQQA 4ITQA 2KNAA 3ZCBB 1D0KA 3KFUG 5BR8M 5LMNM 1GL6A 2P5TA 2KDLA 1L8QA 1G4AE 4UN2B 4PDGA 4WW0A 3RFWA 2K9DA 4GC9A 2D7HA 3FRHA 3SMPA 4M9XA 3ZH9B 1G3IA 4X65M 2FFJA 4MGKE 2CHQA 4BBAA 2MGWA 4RKUF 1XXHB 3ZQJA 1PJJA 2EA0A 2VDBB 3SC3A 4LFCM 1JQJC 3WHLA 1OIPA 3R9XB 4R3DA 2K0BX 3BOSA 2V1UA 5ITXE 2X4AA 4LRSA 2O01F 2EKKA 1IXRC 1QUTA 3WHKA 4DV2M 3U6DA 2DAGA 1DGFA 2JZ1A 4LG2A 3I04M 2ZTDA 3GPUA 1N32M 4JXJA 2H1RA 3FUXA 3OTOM 4W5WA 1MU5A 1R2YA 1AIPC 2R18A 3UZUA 4DV6M 2HKJA 3B9PA 4PCZA 5ITQA 1IXZA 3HKPA 3DZDA 4GEWA 2N35A 2QBYB 3BXWA 2JXNA 2LVAA 2XZUA 2DAMA 4K0KM 1W5TA 1GO5A 1G41A 3IG5A 3RGSA 2FOIC 3TQSA 1L2CA 2UU9M 5FTNA 2HHHM 4IBFA 2QBYA 3K2LA 3AOEA 3L27A 1JR3D 3LCUA 3GLHB 3J80S 3VK8A 3LVWA 2BJVA 4LF5M 1T3TA 3SYLA 4DV5M 4QNMA 5FTMA 3U6MA 1TDHA 4GMQA 3U6PA 2R46A 1DGGA 2JZ0A 3AJIB 1G8PA 1KFVA 1DGHB 4QHTA 1E32A 2DHRA 4B3RM 3CTWB 2DWMA 1IN4A 5KPTA 1Z5CA 4F1IA 2GQFA 2WSCF 5DNYA 1RU3A 4IBGA 5EP1A 4I8OA 3UGJA 3TWKA 2Q2EB 2L2DA 3TWMA 4B3MM 4CISA 4AW4A 1OTRA 4AZFA 3K9OA 2CFOA 2DWLA 2VIIA 4LFAM 3B7QA 1MJGM 2Y21A 3GLFB 1IQPA 1PJIA 4L6V6 3W67A 1Q02A 1Y8GA 1PGYA 3RGPA 4A3VB 1L1TA 4FVMA 4AQYM 3SASA 3E46A 2OOBA 1C1KA 4LJ9A 3FTEA 3K92A 5C18A 2CV0A 2UUAM 3IG8A 3GLGE 1OKSA 3L2AA 2FH0A 2OQ4A 1NJGA 4FCVA 2QCUA 1JB0F 2CP8A 3HX3A 4FWHA 5EXXA 3C58A 4FW9A 4DV4M 4LY6A 3C3EA 3GLGB 4NXMM 1Z5AA 4HLQA 1K3WA 3Q8GA 8CATA 3GPXA 4IBCA 5H37D 3KOXE 1J09A 4LZJA 2LVPC 4CIZA 3JR5A 3L28A 2HL7A 2RGOA 3HU2A 4GIPA 2DAEA 4I5SA 3GQ5A 5L8RF 4OVZB 3JAMS 1PRBA 2LWXA 2DNAA 1Z59A 1W5SA 2R4EA 1HR0M 5DYIA 1GABA 2J5YA 5EQTA 4G4RA 1NHWC 3EIHA 3KS8A 3L26A 1IM2A 2R0IA 3HU3A 1N36M 4QHSA 3U6LA 2QP9X 1QZEA 2UUBM 2JY5A 1ZMVA 3KDSE 4JI2M 2GNOA 3NBIA 2MROB 2BNKA 1G59A 1YE9A 3KP1E 3D8BA 1KSFX 3M0EA 1TH2A 4AG5A 3U61B 5F3WA 1NNUC 4AKHA 4LJ5A 5KQDA 1NY6A 5KQ8A 5ITRA 2DI0A 2JY6B 5FTJA 4MGIE 4DR4M 1Z5BA 1N34M 4LJ8A 4DBGB 4BB9A 2G3QA 3FUTA 2J7OA 2CEAA 1HJPA 3GQ3A 4DR3M 4NOOB 4JI4M 2V1CA 1EFUB 1IN7A 3IHPA 3GLHE 3HY5A 1QUSA 2YQZA 3HJQA 2UXBM 1YLAA 2ZAMA 3HJ8A 3RE8A 4X64M 3U6SA 3E21A 1TH3A 1V92A 4REZA 1E9SA 2CV1A 4IIWA 2Y0TA 3KOWE 2EUCA 1V34A 3FKEA 3KP0E 2DHYA 4LF6M 4GHLA 3QAUA 3HU1A 4NL4H 3AL0C 4X66M 1QVRA 1Q3CA 1OJLA 2R6FA 2VF7A 3KVWA 4LF8M 3UJNA 3LCVB 3QYEA 4B7FA 4JI3M 2YR0A 1R5LA 3CF2A 4MGZE 4P16A 1D0LA 3T6PA 4RF1A 3GPYA 2KW0A 2JY7A 5DYGA 3T1YM 1N78A 3MHVC 2VQFM 2Z7JA 2BJWA 3M6AA 1ORYB 3E9SA 1D0MA 2LBCA 3FRIA 3C3DA 2I7PA 4LCBA 5EXTA 2LH0A 3GRRA 5E6JA 4ANRA 3HHXA 4DR5M 2WSFF 2LHCA 4PD2A 1PJSA 2E5LM 1QDTA 1V33A 2R65A 2XFSA 4JN6A 4II7A 2XSZD 1DO0A 3VKHA 3VK7A 5EP2A 4IBEA 2R44A 1TDZA 4WURA 4G4NA 3SYKA 1IBLM 4PT5A 5EP4A 3KSXA 1N33M 2O25A 5FTLA 4OU7A 3A98B 2WZJA 2L09A 1SXJD 3GRYA 2ZTCA 2G5GX 3HWSA 2BWEA 3I4VA 3PNVA 3JR4A 4IBBA 5KPRA 1WXQA 1ZMUA 3GLFA 3TL4X 7CATA 3B89A 1NV8A 1VEJA 5IZ7D 1IBKM 2F5NA 4GITA 1L2DA 1NY5A 1QAOA 2KXEA 4GRIA 5ITYA 4XGIA 1QAMA 4B3TM 4JI8M 1HNWM 2Y20A 2RGHA 1E9RA 5IREB 3MMPA 1HQYE 3VLFB 2LVNC 3LVVA 1SXJC 5BPVA 4I81A 4GKJM 2UXCM 2KEBA 1HNZM 4B7GA 2F5PA 2F5OA 2B3TA 2DZLA 2JA2A 3AKZA 4X62M 2XSZA 1GJTA 1IY1A 3DFZA 2KZSA 4KO8A 2QQ8A 4IBKA 2X8AA 1LTMA 3I4YA 2VQEM 2RRUA 1NSFA 2L4FA 2QHOB 2C99A 3I01M 3PFIA 4DV1M 1OIZA 3LMMA 1VDDA 4NSRA 4G3OA 5JI2E 2XLJA 2EKFA 3EIEA 3HHYA 3HJSA 1T6OA 1UM8A 1JR3E 1VG5A 2LHGA 1YSYA 3B7NA 1PM5A 2DWNA 4JI1M 4LGMA 4JI0M 3VDPA 1IXSA 1IY0A 2KNVA 1IY2A 1XMOM 4B3SM 4KHPM 4XBOA 5DFLA 1PJQA 2WSEF 1J5EM 3FTFA 1BVSA 2ZM6M 3MJ5A 3PNYA 3V76A 3HZJA 1I94M 2UUCM 1DGHA 3SAWA 4LF4M 1VDLA 1Q39A 2LVOC 4OX9M 1FNNA 3J27B 2CRUA 4JI5M 2QENA 1SXJA 2C5RA 3SAVA 3NWLA 1C7YA 3HHZA 2C98A 2FNAA 1N75A 3KOZE 1H6UA 4AI6A 3U6QA 1QDRA 1TGUA 4ZPXA 3U6CA 2KA6B 4FD2A 3GQ4A 4WP2A 4DR6M 3LQRA 3C9PA 2QZ4A 4BLCA 2D7GA 1Q3BA 2X49A 3I51A 4GC5A 4DUZM 3GLHA 2Z4SA 3W0FA 3SARA 3VFDA 2CUZA 4LJ4A 4M9SA 3PXGA 2EJSA 3THGA 5IT9S 4TUWA 3K8ZA 4AKIA 1MN3A 3DA1A 1TR8A 4OVZA 2A5YB 4M0DA 3AFHA 2FE8A 2XEPA 3ILKA 3QYBA 3T1HM 3FYDA 3J81S 1NNJA 3T15A 4DV7M 4I4LA 1X37A 2HWJA 3LW5F 3FUVA 1D2NA 1XXHE 3CF0A 3GRVA 4CHTB 4LF7M 2UXDM 3GPPA 2C9OA 1XC8A 3GLFE 4D82A 3TPZA 2F5SA 2OOAA 2JWSA 4S12A 1SXJB 3AOEC 4MM3B 3U61A 1WJ7A 1DV0A 1I4WA 2Z8YM 1P3QQ 2CHVA 3SHFA 1LV7A 1R7RA 2D7EA 2M60A 4QOSA 4Y28F 5FSWA 1WIVA 1XMQM 5KO3A 3FTCA 2YNMD 4RNAA 2R62A 3SFZA 1N77A 1TTEA 4CJ6A 2XZFA 4NSOB 4L78A 2W82A 4FCTA 1TH4A 5ITUA 2O5RA 1HNXM 2RKOA 4MB7A 1OFIA 1MX0A 1WR1B 3IECA 1PJTA 2JP7A 3K1JA 3A46A 3U6EA 2CE7A 4M0WA 2YFQA 5FLXS 1VQ1A 4NXNM 2LVQD 4R7GA 4JI6M 3U60A 1OAIA 1ZQ9A 3GLGA 2F5QA 2HCBA 1DGBA 1SXJE 3DOAA 2L7IA 3J2PB 5EP3A 1L1ZA 3GLIE 1EIJA 1OFHA 4FCWA 4GKKM 2QPAA 1R6BX 5E26A 2ZBKB 3FTDA 1E94E 4IBDA 1IFYA 1WGNA 2K6BA 2DENA 4YY3M 1ZV1A 3R8FA 2F4VM 2DWZB 2L4EA 4XK8F 2DAKA 1TF0B 4D81A 4L16A 3J7AS 1XHBA 4LZZA 3SHGB 3CF6E 4QNRA 2MR9A 2C96A 2DVWB 4GH9A 4Z6YA 3SBJA 2ZAOA 4DV0M 2Z3XA 4MGYE 3GLIA 2L7HA 3QWLA 2XH9A 3L25A 2K47A 2FS1A 5LMUM 1OAOC 2AHMA 2MH8A 2V6ZM 4EIWA 4DR2M 1T43A 1R2ZA 1F4IA 3PVSA 2J7NA 4LJ7A 4Q7JA 4MGHA 1IN6A 3M7GA 3A42A 5IWAM 4NRVA 4R71A 2G8LA 2R4JA 4NC6A 3H4MA 2CHGA 3ZC7B 3UMMA 1NV9A 3U5ZA 3FE3A 2LXEA 1XWIA 1QQWA 4YHHM 2KZUA 4JYAM 4CGYB 1GKIA 2L6OA 1ZAEA 1VEKA 1SG9A 3FD9A 3SMSA 3T38A 3U5ZB 3J7BA 4IBJA 2R45A 4KT0F 4DR7M 1GJSA 3FUUA 2APLA 3MK6A 3TE6A 1IN8A 1KYIA 3Q8XA 4L8RC 4QOZC 2C9CA 1K3XA 4LFBM 1L2BA 1HT1E 3BBZA 4F2LA 3GP1A 5C1BA 3FUWA 2LTUA 4IJFA 1GL7A 2H5XA 1QYRA 4MH0E 2KRUA 4FWGA 4LF9M 1HQCA 3E4RA 2BWBA 1EE8A 1AUAA 1G71A 1ZMWA 5JI3E 1CUKA 1WHCA 2KRKA 2XGNA 2OPFA 4KLNA 3U6OA 3SATA 3GRUA 3W0LB
chains in the Genus database with same CATH topology
3KOYE 1XNQM 4RF0A 3VDUA 4PDIA 2ERCA 4M9ZA 3VKGA 4DR1M 1DO2A 4IJEA 4LGYA 1QANA 3UK6A 1NVMA 1XNRM 1GLNA 1S3SA 2DZNB 3TWLA 2Y0QA 2NQ8C 4B7HA 1Z6TA 4OW0A 5FTKA 1IN5A 1XXHA 3AOGA 4AKGA 3KW6A 3D8LA 1QAQA 5A2QS 1IXSB 2ZANA 4L4UA 2LNHC 5EXSA 2XF3A 4G6ZA 2Z4RA 3KS4A 2EO2A 5GKNA 1YUBA 3A45A 1J7KA 3FYCA 4LJ6A 4L15A 3GO8A 5ITTA 1K82A 4FWDA 1JR3A 4AG6A 3KXEC 1QZMA 2I7NA 1GVNA 2XFTA 4DUYM 4GHAA 5EXPA 5KPZA 3KSJA 4D80A 4Z8XA 4JV5M 3GLIB 3L29A 4LRTA 4DV3M 4B08A 4JI7M 4G4OA 3SAUA 1FJGM 3AV0A 5EJCA 5ITXA 1NHGC 2CV2A 4G4QA 4NRWA 4HL4A 4IBIA 3U60B 4KODA 3HGIA 1IBMM 3HHWA 2M5ZA 1NJFA 4LJAA 2DZOB 2DXIA 1HT2E 3LQQA 4ITQA 3ZCBB 3KFUG 5BR8M 5LMNM 1GL6A 2P5TA 1L8QA 1G4AE 4PDGA 4WW0A 3RFWA 4GC9A 2D7HA 3SMPA 3ZH9B 4M9XA 1G3IA 4X65M 2FFJA 4MGKE 2CHQA 4BBAA 1XXHB 1PJJA 2EA0A 3SC3A 4LFCM 1JQJC 3WHLA 3R9XB 4R3DA 3BOSA 2V1UA 5ITXE 2X4AA 4LRSA 1IXRC 3WHKA 4DV2M 3U6DA 1DGFA 4LG2A 3GPUA 1N32M 4JXJA 2H1RA 3FUXA 3OTOM 4W5WA 1MU5A 1R2YA 2R18A 4DV6M 3UZUA 2HKJA 3B9PA 4PCZA 5ITQA 1IXZA 3HKPA 3DZDA 2QBYB 2XZUA 4K0KM 1W5TA 1G41A 3IG5A 3RGSA 2FOIC 3TQSA 1L2CA 2UU9M 5FTNA 2HHHM 4IBFA 2QBYA 3K2LA 3AOEA 3L27A 1JR3D 3GLHB 3J80S 3VK8A 3LVWA 2BJVA 4LF5M 1T3TA 3SYLA 4DV5M 4QNMA 5FTMA 3U6MA 1TDHA 4GMQA 3U6PA 2R46A 1DGGA 3AJIB 1G8PA 1KFVA 1DGHB 4QHTA 1E32A 2DHRA 4B3RM 3CTWB 2DWMA 1IN4A 5KPTA 1Z5CA 5DNYA 4IBGA 5EP1A 4I8OA 3UGJA 3TWKA 2Q2EB 3TWMA 4B3MM 4CISA 4AW4A 4AZFA 2CFOA 2DWLA 2VIIA 4LFAM 3GLFB 2Y21A 1IQPA 1PJIA 3RGPA 4A3VB 1L1TA 4FVMA 4AQYM 3SASA 1C1KA 4LJ9A 3FTEA 3K92A 5C18A 2CV0A 2UUAM 3IG8A 3L2AA 2OQ4A 1NJGA 4FCVA 2QCUA 4FWHA 3C58A 4DV4M 5EXXA 4FW9A 4LY6A 3GLGB 4NXMM 1Z5AA 4HLQA 1K3WA 8CATA 3GPXA 4IBCA 5H37D 3KOXE 1J09A 4LZJA 3JR5A 3L28A 2HL7A 2RGOA 3HU2A 4GIPA 4I5SA 3GQ5A 4OVZB 3JAMS 2LWXA 1Z59A 1W5SA 2R4EA 1HR0M 5DYIA 5EQTA 4G4RA 1NHWC 3EIHA 3KS8A 3L26A 1IM2A 3HU3A 1N36M 4QHSA 3U6LA 2QP9X 2UUBM 3KDSE 4JI2M 3NBIA 2BNKA 1G59A 1YE9A 3KP1E 3D8BA 1KSFX 3M0EA 1TH2A 4AG5A 3U61B 5F3WA 1NNUC 4AKHA 4LJ5A 5KQDA 1NY6A 5KQ8A 5ITRA 5FTJA 4MGIE 4DR4M 1Z5BA 1N34M 4LJ8A 4BB9A 3GQ3A 3FUTA 2J7OA 2CEAA 4JI4M 4DR3M 4NOOB 2V1CA 1IN7A 2YQZA 3HJQA 2UXBM 2ZAMA 3HJ8A 3RE8A 4X64M 3U6SA 1TH3A 4REZA 1E9SA 2CV1A 4IIWA 2Y0TA 3KOWE 2EUCA 3FKEA 3KP0E 4LF6M 4GHLA 3QAUA 3HU1A 4NL4H 3AL0C 4X66M 1QVRA 1Q3CA 1OJLA 4LF8M 3KVWA 3UJNA 4B7FA 4JI3M 2YR0A 4P16A 3CF2A 4MGZE 4RF1A 3GPYA 2KW0A 5DYGA 3T1YM 1N78A 3MHVC 2VQFM 2Z7JA 2BJWA 3M6AA 1ORYB 3E9SA 5EXTA 2I7PA 4LCBA 2LH0A 3GRRA 5E6JA 4DR5M 3HHXA 4PD2A 2E5LM 2R65A 2XFSA 4JN6A 4II7A 2XSZD 1DO0A 3VKHA 3VK7A 5EP2A 4IBEA 1TDZA 4WURA 4G4NA 3SYKA 1IBLM 4PT5A 5EP4A 3KSXA 1N33M 5FTLA 4OU7A 3A98B 2L09A 1SXJD 3GRYA 3I4VA 2G5GX 3HWSA 3PNVA 3JR4A 4IBBA 5KPRA 1WXQA 3GLFA 3TL4X 7CATA 2F5NA 5IZ7D 1IBKM 4GITA 1L2DA 1NY5A 1QAOA 2KXEA 4GRIA 5ITYA 4XGIA 1QAMA 4B3TM 4JI8M 1HNWM 2Y20A 2RGHA 1E9RA 5IREB 1HQYE 3VLFB 3LVVA 5BPVA 1SXJC 4GKJM 4I81A 2UXCM 2KEBA 1HNZM 4B7GA 2F5PA 2F5OA 2JA2A 3AKZA 4X62M 2XSZA 1IY1A 3DFZA 2KZSA 4KO8A 4IBKA 2X8AA 3I4YA 2VQEM 1NSFA 2C99A 3PFIA 4DV1M 2XLJA 3LMMA 1VDDA 4NSRA 5JI2E 3EIEA 3HHYA 3HJSA 1UM8A 1PM5A 4JI1M 1YSYA 2DWNA 4LGMA 4JI0M 3VDPA 1IY0A 1IY2A 1XMOM 4B3SM 4KHPM 4XBOA 1J5EM 3FTFA 2ZM6M 3MJ5A 3PNYA 1I94M 2UUCM 1DGHA 3SAWA 4LF4M 1Q39A 4OX9M 1FNNA 3J27B 4JI5M 2QENA 1SXJA 2C5RA 3SAVA 3NWLA 3HHZA 2C98A 2FNAA 1N75A 3KOZE 1H6UA 4AI6A 3U6QA 1TGUA 4ZPXA 3U6CA 2KA6B 4FD2A 3GQ4A 4DR6M 3LQRA 2QZ4A 4BLCA 2D7GA 1Q3BA 2X49A 3I51A 4GC5A 4DUZM 3GLHA 2Z4SA 3W0FA 3SARA 3VFDA 2CUZA 4LJ4A 4M9SA 3PXGA 3THGA 5IT9S 4TUWA 3K8ZA 4AKIA 3DA1A 4OVZA 2A5YB 4M0DA 3ILKA 3AFHA 2XEPA 2FE8A 3T1HM 3FYDA 3J81S 1NNJA 3T15A 4DV7M 4I4LA 1X37A 3FUVA 1D2NA 3CF0A 3GRVA 4CHTB 4LF7M 2UXDM 3GPPA 2C9OA 1XC8A 4D82A 3TPZA 2F5SA 4S12A 3U61A 1SXJB 3AOEC 4MM3B 1I4WA 2CHVA 3SHFA 1LV7A 1R7RA 2D7EA 2M60A 4QOSA 5FSWA 1XMQM 5KO3A 3FTCA 2YNMD 4RNAA 2R62A 3SFZA 1N77A 2XZFA 4NSOB 4L78A 2W82A 4FCTA 1TH4A 5ITUA 2O5RA 1HNXM 2RKOA 4MB7A 1OFIA 1MX0A 3K1JA 3A46A 3U6EA 2CE7A 4M0WA 2YFQA 5FLXS 4NXNM 4R7GA 4JI6M 3U60A 1ZQ9A 3GLGA 2F5QA 2HCBA 1DGBA 1SXJE 3DOAA 2L7IA 3J2PB 5EP3A 1L1ZA 1OFHA 4FCWA 4GKKM 2QPAA 1R6BX 5E26A 2ZBKB 3FTDA 1E94E 4IBDA 4YY3M 3R8FA 2F4VM 2DWZB 4D81A 4L16A 3J7AS 1XHBA 4LZZA 3SHGB 3CF6E 4QNRA 4GH9A 2C96A 2DVWB 4Z6YA 3SBJA 2ZAOA 4DV0M 2Z3XA 4MGYE 3GLIA 2L7HA 3QWLA 2XH9A 3L25A 2K47A 5LMUM 2V6ZM 2AHMA 4DR2M 4EIWA 1R2ZA 3PVSA 2J7NA 4LJ7A 4MGHA 1IN6A 3M7GA 3A42A 5IWAM 4NRVA 2G8LA 2R4JA 3H4MA 2CHGA 3ZC7B 3UMMA 3U5ZA 2LXEA 1XWIA 1QQWA 4YHHM 2KZUA 4JYAM 4CGYB 1GKIA 2L6OA 1ZAEA 3FD9A 3SMSA 3T38A 3U5ZB 3J7BA 4IBJA 2R45A 4DR7M 3FUUA 3MK6A 3TE6A 4L8RC 1IN8A 3Q8XA 1KYIA 4QOZC 2C9CA 1K3XA 4LFBM 1L2BA 1HT1E 3GP1A 5C1BA 3FUWA 4IJFA 1GL7A 1QYRA 4MH0E 2KRUA 4FWGA 4LF9M 1HQCA 3E4RA 1EE8A 5JI3E 2KRKA 2OPFA 2XGNA 4KLNA 3U6OA 3SATA 3GRUA 3W0LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H M;  1XNQ M;  3J80 S;  3J81 S;  3GPY A;  3VK8 A;  4PDI A;  1NNJ A;  4DV7 M;  4LF5 M;  3T1Y M;  4DV5 M;  2VQF M;  3U6M A;  1TDH A;  3U6P A;  4DR1 M;  2UXD M;  4LF7 M;  1KFV A;  3GPP A;  1XC8 A;  4DR5 M;  4PD2 A;  1XMQ M;  2F5S A;  3TWL A;  1XNR M;  4B3R M;  2E5L M;  1Z5C A;  5A2Q S;  3VK7 A;  3TWK A;  2Q2E B;  1TDZ A;  4G4N A;  3TWM A;  1IBL M;  4B3M M;  4CIS A;  2XZF A;  1N33 M;  5ITU A;  3A45 A;  1HNX M;  4LFA M;  3JR4 A;  1PJI A;  4MB7 A;  1MX0 A;  5ITT A;  3GO8 A;  1K82 A;  2F5N A;  3A46 A;  3U6E A;  1IBK M;  1L2D A;  1L1T A;  5FLX S;  4AQY M;  3SAS A;  5ITY A;  4NXN M;  4DUY M;  4B3T M;  4JI8 M;  4JI6 M;  1HNW M;  4JV5 M;  2F5Q A;  3DOA A;  1L1Z A;  4DV3 M;  2UUA M;  4JI7 M;  4G4O A;  4GKK M;  2OQ4 A;  2ZBK B;  3SAU A;  4DV4 M;  3C58 A;  1FJG M;  4GKJ M;  2UXC M;  5ITX A;  4YY3 M;  4G4Q A;  4NRW A;  2F4V M;  1HNZ M;  2F5P A;  4NXM M;  2F5O A;  1Z5A A;  1K3W A;  3J7A S;  3GPX A;  4X62 M;  1IBM M;  3JR5 A;  3SBJ A;  4ITQ A;  4DV0 M;  3GQ5 A;  5BR8 M;  3JAM S;  2VQE M;  5LMN M;  1Z59 A;  5LMU M;  4DR2 M;  4DV1 M;  1HR0 M;  1R2Z A;  4PDG A;  4G4R A;  4X65 M;  4JI1 M;  1PM5 A;  3A42 A;  5IWA M;  4NRV A;  1N36 M;  3U6L A;  4JI0 M;  2UUB M;  4JI2 M;  1XMO M;  4B3S M;  4KHP M;  1PJJ A;  2EA0 A;  1J5E M;  4LFC M;  4YHH M;  2ZM6 M;  4JYA M;  5ITR A;  1I94 M;  2UUC M;  3SAW A;  4LF4 M;  1Q39 A;  4OX9 M;  4DR4 M;  1Z5B A;  5ITX E;  1N34 M;  4JI5 M;  4DV2 M;  3GQ3 A;  4JI4 M;  3U6D A;  3SAV A;  4DR3 M;  4DR7 M;  3U6Q A;  3GPU A;  3U6C A;  1N32 M;  3GQ4 A;  1K3X A;  4DR6 M;  4LFB M;  3OTO M;  1L2B A;  1MU5 A;  1R2Y A;  2UXB M;  4DV6 M;  1Q3B A;  2HKJ A;  4X64 M;  3GP1 A;  4PCZ A;  4DUZ M;  5ITQ A;  3U6S A;  3W0F A;  3SAR A;  2XZU A;  4K0K M;  4LF6 M;  4LF9 M;  5IT9 S;  1EE8 A;  4X66 M;  1L2C A;  1Q3C A;  4LF8 M;  2UU9 M;  2OPF A;  2HHH M;  3U6O A;  3SAT A;  4JI3 M; 
#chains in the Genus database with same CATH topology
 3KOY E;  1XB2 B;  1XNQ M;  4RF0 A;  3VDU A;  2VF8 A;  2ERC A;  4PDI A;  4M9Z A;  2KHH A;  3VKG A;  4DR1 M;  1DO2 A;  4IJE A;  1WGL A;  1QAN A;  4LGY A;  1VEG A;  3UK6 A;  1NVM A;  1XNR M;  1GLN A;  1S3S A;  2DZN B;  2QNJ A;  2Y0Q A;  2NQ8 C;  3TWL A;  1Z6T A;  4OW0 A;  5FTK A;  1IN5 A;  4B7H A;  1XXH A;  3AOG A;  4AKG A;  3KW6 A;  3D8L A;  1QAQ A;  5A2Q S;  1IXS B;  2JNH A;  2ZAN A;  4L4U A;  2LNH C;  2MJ5 B;  2OO9 A;  2XF3 A;  5EXS A;  3CGW A;  2JY8 A;  2Z4R A;  4G6Z A;  3KS4 A;  2EO2 A;  3F92 A;  5GKN A;  1YUB A;  3A45 A;  1J7K A;  3B74 A;  3FYC A;  4LJ6 A;  2KNZ A;  4L15 A;  3GO8 A;  5ITT A;  1K82 A;  4FWD A;  1JR3 A;  4AG6 A;  1UFZ A;  1NO1 A;  3W68 A;  3KXE C;  1QZM A;  2I7N A;  1GVN A;  2XFT A;  4DUY M;  1R4G A;  1OQY A;  4GHA A;  5EXP A;  5KPZ A;  3KSJ A;  4D80 A;  4Z8X A;  4JV5 M;  3GLI B;  3L29 A;  4LRT A;  4DV3 M;  4HEO A;  4B08 A;  4JI7 M;  4G4O A;  2CWB A;  2DKL A;  3SAU A;  1FJG M;  1A5T A;  3AV0 A;  5EJC A;  2DAI A;  2HAK A;  2JUJ A;  5ITX A;  1NHG C;  2CV2 A;  4G4Q A;  4NRW A;  4HL4 A;  2QSF X;  4P17 A;  4IBI A;  3U60 B;  4KOD A;  3H4J A;  3HGI A;  3K9P A;  1IBM M;  3HHW A;  2M5Z A;  1NJF A;  3NBX X;  4LJA A;  2DZO B;  2DXI A;  3B7Z A;  1HT2 E;  3LQQ A;  4ITQ A;  2KNA A;  3ZCB B;  1D0K A;  3KFU G;  5BR8 M;  5LMN M;  1GL6 A;  2P5T A;  2KDL A;  1L8Q A;  1G4A E;  4UN2 B;  4PDG A;  4WW0 A;  3RFW A;  2K9D A;  4GC9 A;  2D7H A;  3FRH A;  3SMP A;  4M9X A;  3ZH9 B;  1G3I A;  4X65 M;  2FFJ A;  4MGK E;  2CHQ A;  4BBA A;  2MGW A;  4RKU F;  1XXH B;  3ZQJ A;  1PJJ A;  2EA0 A;  2VDB B;  3SC3 A;  4LFC M;  1JQJ C;  3WHL A;  1OIP A;  3R9X B;  4R3D A;  2K0B X;  3BOS A;  2V1U A;  5ITX E;  2X4A A;  4LRS A;  2O01 F;  2EKK A;  1IXR C;  1QUT A;  3WHK A;  4DV2 M;  3U6D A;  2DAG A;  1DGF A;  2JZ1 A;  4LG2 A;  3I04 M;  2ZTD A;  3GPU A;  1N32 M;  4JXJ A;  2H1R A;  3FUX A;  3OTO M;  4W5W A;  1MU5 A;  1R2Y A;  1AIP C;  2R18 A;  3UZU A;  4DV6 M;  2HKJ A;  3B9P A;  4PCZ A;  5ITQ A;  1IXZ A;  3HKP A;  3DZD A;  4GEW A;  2N35 A;  2QBY B;  3BXW A;  2JXN A;  2LVA A;  2XZU A;  2DAM A;  4K0K M;  1W5T A;  1GO5 A;  1G41 A;  3IG5 A;  3RGS A;  2FOI C;  3TQS A;  1L2C A;  2UU9 M;  5FTN A;  2HHH M;  4IBF A;  2QBY A;  3K2L A;  3AOE A;  3L27 A;  1JR3 D;  3LCU A;  3GLH B;  3J80 S;  3VK8 A;  3LVW A;  2BJV A;  4LF5 M;  1T3T A;  3SYL A;  4DV5 M;  4QNM A;  5FTM A;  3U6M A;  1TDH A;  4GMQ A;  3U6P A;  2R46 A;  1DGG A;  2JZ0 A;  3AJI B;  1G8P A;  1KFV A;  1DGH B;  4QHT A;  1E32 A;  2DHR A;  4B3R M;  3CTW B;  2DWM A;  1IN4 A;  5KPT A;  1Z5C A;  4F1I A;  2GQF A;  2WSC F;  5DNY A;  1RU3 A;  4IBG A;  5EP1 A;  4I8O A;  3UGJ A;  3TWK A;  2Q2E B;  2L2D A;  3TWM A;  4B3M M;  4CIS A;  4AW4 A;  1OTR A;  4AZF A;  3K9O A;  2CFO A;  2DWL A;  2VII A;  4LFA M;  3B7Q A;  1MJG M;  2Y21 A;  3GLF B;  1IQP A;  1PJI A;  4L6V 6;  3W67 A;  1Q02 A;  1Y8G A;  1PGY A;  3RGP A;  4A3V B;  1L1T A;  4FVM A;  4AQY M;  3SAS A;  3E46 A;  2OOB A;  1C1K A;  4LJ9 A;  3FTE A;  3K92 A;  5C18 A;  2CV0 A;  2UUA M;  3IG8 A;  3GLG E;  1OKS A;  3L2A A;  2FH0 A;  2OQ4 A;  1NJG A;  4FCV A;  2QCU A;  1JB0 F;  2CP8 A;  3HX3 A;  4FWH A;  5EXX A;  3C58 A;  4FW9 A;  4DV4 M;  4LY6 A;  3C3E A;  3GLG B;  4NXM M;  1Z5A A;  4HLQ A;  1K3W A;  3Q8G A;  8CAT A;  3GPX A;  4IBC A;  5H37 D;  3KOX E;  1J09 A;  4LZJ A;  2LVP C;  4CIZ A;  3JR5 A;  3L28 A;  2HL7 A;  2RGO A;  3HU2 A;  4GIP A;  2DAE A;  4I5S A;  3GQ5 A;  5L8R F;  4OVZ B;  3JAM S;  1PRB A;  2LWX A;  2DNA A;  1Z59 A;  1W5S A;  2R4E A;  1HR0 M;  5DYI A;  1GAB A;  2J5Y A;  5EQT A;  4G4R A;  1NHW C;  3EIH A;  3KS8 A;  3L26 A;  1IM2 A;  2R0I A;  3HU3 A;  1N36 M;  4QHS A;  3U6L A;  2QP9 X;  1QZE A;  2UUB M;  2JY5 A;  1ZMV A;  3KDS E;  4JI2 M;  2GNO A;  3NBI A;  2MRO B;  2BNK A;  1G59 A;  1YE9 A;  3KP1 E;  3D8B A;  1KSF X;  3M0E A;  1TH2 A;  4AG5 A;  3U61 B;  5F3W A;  1NNU C;  4AKH A;  4LJ5 A;  5KQD A;  1NY6 A;  5KQ8 A;  5ITR A;  2DI0 A;  2JY6 B;  5FTJ A;  4MGI E;  4DR4 M;  1Z5B A;  1N34 M;  4LJ8 A;  4DBG B;  4BB9 A;  2G3Q A;  3FUT A;  2J7O A;  2CEA A;  1HJP A;  3GQ3 A;  4DR3 M;  4NOO B;  4JI4 M;  2V1C A;  1EFU B;  1IN7 A;  3IHP A;  3GLH E;  3HY5 A;  1QUS A;  2YQZ A;  3HJQ A;  2UXB M;  1YLA A;  2ZAM A;  3HJ8 A;  3RE8 A;  4X64 M;  3U6S A;  3E21 A;  1TH3 A;  1V92 A;  4REZ A;  1E9S A;  2CV1 A;  4IIW A;  2Y0T A;  3KOW E;  2EUC A;  1V34 A;  3FKE A;  3KP0 E;  2DHY A;  4LF6 M;  4GHL A;  3QAU A;  3HU1 A;  4NL4 H;  3AL0 C;  4X66 M;  1QVR A;  1Q3C A;  1OJL A;  2R6F A;  2VF7 A;  3KVW A;  4LF8 M;  3UJN A;  3LCV B;  3QYE A;  4B7F A;  4JI3 M;  2YR0 A;  1R5L A;  3CF2 A;  4MGZ E;  4P16 A;  1D0L A;  3T6P A;  4RF1 A;  3GPY A;  2KW0 A;  2JY7 A;  5DYG A;  3T1Y M;  1N78 A;  3MHV C;  2VQF M;  2Z7J A;  2BJW A;  3M6A A;  1ORY B;  3E9S A;  1D0M A;  2LBC A;  3FRI A;  3C3D A;  2I7P A;  4LCB A;  5EXT A;  2LH0 A;  3GRR A;  5E6J A;  4ANR A;  3HHX A;  4DR5 M;  2WSF F;  2LHC A;  4PD2 A;  1PJS A;  2E5L M;  1QDT A;  1V33 A;  2R65 A;  2XFS A;  4JN6 A;  4II7 A;  2XSZ D;  1DO0 A;  3VKH A;  3VK7 A;  5EP2 A;  4IBE A;  2R44 A;  1TDZ A;  4WUR A;  4G4N A;  3SYK A;  1IBL M;  4PT5 A;  5EP4 A;  3KSX A;  1N33 M;  2O25 A;  5FTL A;  4OU7 A;  3A98 B;  2WZJ A;  2L09 A;  1SXJ D;  3GRY A;  2ZTC A;  2G5G X;  3HWS A;  2BWE A;  3I4V A;  3PNV A;  3JR4 A;  4IBB A;  5KPR A;  1WXQ A;  1ZMU A;  3GLF A;  3TL4 X;  7CAT A;  3B89 A;  1NV8 A;  1VEJ A;  5IZ7 D;  1IBK M;  2F5N A;  4GIT A;  1L2D A;  1NY5 A;  1QAO A;  2KXE A;  4GRI A;  5ITY A;  4XGI A;  1QAM A;  4B3T M;  4JI8 M;  1HNW M;  2Y20 A;  2RGH A;  1E9R A;  5IRE B;  3MMP A;  1HQY E;  3VLF B;  2LVN C;  3LVV A;  1SXJ C;  5BPV A;  4I81 A;  4GKJ M;  2UXC M;  2KEB A;  1HNZ M;  4B7G A;  2F5P A;  2F5O A;  2B3T A;  2DZL A;  2JA2 A;  3AKZ A;  4X62 M;  2XSZ A;  1GJT A;  1IY1 A;  3DFZ A;  2KZS A;  4KO8 A;  2QQ8 A;  4IBK A;  2X8A A;  1LTM A;  3I4Y A;  2VQE M;  2RRU A;  1NSF A;  2L4F A;  2QHO B;  2C99 A;  3I01 M;  3PFI A;  4DV1 M;  1OIZ A;  3LMM A;  1VDD A;  4NSR A;  4G3O A;  5JI2 E;  2XLJ A;  2EKF A;  3EIE A;  3HHY A;  3HJS A;  1T6O A;  1UM8 A;  1JR3 E;  1VG5 A;  2LHG A;  1YSY A;  3B7N A;  1PM5 A;  2DWN A;  4JI1 M;  4LGM A;  4JI0 M;  3VDP A;  1IXS A;  1IY0 A;  2KNV A;  1IY2 A;  1XMO M;  4B3S M;  4KHP M;  4XBO A;  5DFL A;  1PJQ A;  2WSE F;  1J5E M;  3FTF A;  1BVS A;  2ZM6 M;  3MJ5 A;  3PNY A;  3V76 A;  3HZJ A;  1I94 M;  2UUC M;  1DGH A;  3SAW A;  4LF4 M;  1VDL A;  1Q39 A;  2LVO C;  4OX9 M;  1FNN A;  3J27 B;  2CRU A;  4JI5 M;  2QEN A;  1SXJ A;  2C5R A;  3SAV A;  3NWL A;  1C7Y A;  3HHZ A;  2C98 A;  2FNA A;  1N75 A;  3KOZ E;  1H6U A;  4AI6 A;  3U6Q A;  1QDR A;  1TGU A;  4ZPX A;  3U6C A;  2KA6 B;  4FD2 A;  3GQ4 A;  4WP2 A;  4DR6 M;  3LQR A;  3C9P A;  2QZ4 A;  4BLC A;  2D7G A;  1Q3B A;  2X49 A;  3I51 A;  4GC5 A;  4DUZ M;  3GLH A;  2Z4S A;  3W0F A;  3SAR A;  3VFD A;  2CUZ A;  4LJ4 A;  4M9S A;  3PXG A;  2EJS A;  3THG A;  5IT9 S;  4TUW A;  3K8Z A;  4AKI A;  1MN3 A;  3DA1 A;  1TR8 A;  4OVZ A;  2A5Y B;  4M0D A;  3AFH A;  2FE8 A;  2XEP A;  3ILK A;  3QYB A;  3T1H M;  3FYD A;  3J81 S;  1NNJ A;  3T15 A;  4DV7 M;  4I4L A;  1X37 A;  2HWJ A;  3LW5 F;  3FUV A;  1D2N A;  1XXH E;  3CF0 A;  3GRV A;  4CHT B;  4LF7 M;  2UXD M;  3GPP A;  2C9O A;  1XC8 A;  3GLF E;  4D82 A;  3TPZ A;  2F5S A;  2OOA A;  2JWS A;  4S12 A;  1SXJ B;  3AOE C;  4MM3 B;  3U61 A;  1WJ7 A;  1DV0 A;  1I4W A;  2Z8Y M;  1P3Q Q;  2CHV A;  3SHF A;  1LV7 A;  1R7R A;  2D7E A;  2M60 A;  4QOS A;  4Y28 F;  5FSW A;  1WIV A;  1XMQ M;  5KO3 A;  3FTC A;  2YNM D;  4RNA A;  2R62 A;  3SFZ A;  1N77 A;  1TTE A;  4CJ6 A;  2XZF A;  4NSO B;  4L78 A;  2W82 A;  4FCT A;  1TH4 A;  5ITU A;  2O5R A;  1HNX M;  2RKO A;  4MB7 A;  1OFI A;  1MX0 A;  1WR1 B;  3IEC A;  1PJT A;  2JP7 A;  3K1J A;  3A46 A;  3U6E A;  2CE7 A;  4M0W A;  2YFQ A;  5FLX S;  1VQ1 A;  4NXN M;  2LVQ D;  4R7G A;  4JI6 M;  3U60 A;  1OAI A;  1ZQ9 A;  3GLG A;  2F5Q A;  2HCB A;  1DGB A;  1SXJ E;  3DOA A;  2L7I A;  3J2P B;  5EP3 A;  1L1Z A;  3GLI E;  1EIJ A;  1OFH A;  4FCW A;  4GKK M;  2QPA A;  1R6B X;  5E26 A;  2ZBK B;  3FTD A;  1E94 E;  4IBD A;  1IFY A;  1WGN A;  2K6B A;  2DEN A;  4YY3 M;  1ZV1 A;  3R8F A;  2F4V M;  2DWZ B;  2L4E A;  4XK8 F;  2DAK A;  1TF0 B;  4D81 A;  4L16 A;  3J7A S;  1XHB A;  4LZZ A;  3SHG B;  3CF6 E;  4QNR A;  2MR9 A;  2C96 A;  2DVW B;  4GH9 A;  4Z6Y A;  3SBJ A;  2ZAO A;  4DV0 M;  2Z3X A;  4MGY E;  3GLI A;  2L7H A;  3QWL A;  2XH9 A;  3L25 A;  2K47 A;  2FS1 A;  5LMU M;  1OAO C;  2AHM A;  2MH8 A;  2V6Z M;  4EIW A;  4DR2 M;  1T43 A;  1R2Z A;  1F4I A;  3PVS A;  2J7N A;  4LJ7 A;  4Q7J A;  4MGH A;  1IN6 A;  3M7G A;  3A42 A;  5IWA M;  4NRV A;  4R71 A;  2G8L A;  2R4J A;  4NC6 A;  3H4M A;  2CHG A;  3ZC7 B;  3UMM A;  1NV9 A;  3U5Z A;  3FE3 A;  2LXE A;  1XWI A;  1QQW A;  4YHH M;  2KZU A;  4JYA M;  4CGY B;  1GKI A;  2L6O A;  1ZAE A;  1VEK A;  1SG9 A;  3FD9 A;  3SMS A;  3T38 A;  3U5Z B;  3J7B A;  4IBJ A;  2R45 A;  4KT0 F;  4DR7 M;  1GJS A;  3FUU A;  2APL A;  3MK6 A;  3TE6 A;  1IN8 A;  1KYI A;  3Q8X A;  4L8R C;  4QOZ C;  2C9C A;  1K3X A;  4LFB M;  1L2B A;  1HT1 E;  3BBZ A;  4F2L A;  3GP1 A;  5C1B A;  3FUW A;  2LTU A;  4IJF A;  1GL7 A;  2H5X A;  1QYR A;  4MH0 E;  2KRU A;  4FWG A;  4LF9 M;  1HQC A;  3E4R A;  2BWB A;  1EE8 A;  1AUA A;  1G71 A;  1ZMW A;  5JI3 E;  1CUK A;  1WHC A;  2KRK A;  2XGN A;  2OPF A;  4KLN A;  3U6O A;  3SAT A;  3GRU A;  3W0L B; 
#chains in the Genus database with same CATH homology
 3KOY E;  1XNQ M;  4RF0 A;  3VDU A;  4PDI A;  2ERC A;  4M9Z A;  3VKG A;  4DR1 M;  1DO2 A;  4IJE A;  4LGY A;  1QAN A;  3UK6 A;  1NVM A;  1XNR M;  1GLN A;  1S3S A;  2DZN B;  3TWL A;  2Y0Q A;  2NQ8 C;  4B7H A;  1Z6T A;  4OW0 A;  5FTK A;  1IN5 A;  1XXH A;  3AOG A;  4AKG A;  3KW6 A;  3D8L A;  1QAQ A;  5A2Q S;  1IXS B;  2ZAN A;  4L4U A;  2LNH C;  5EXS A;  2XF3 A;  4G6Z A;  2Z4R A;  3KS4 A;  2EO2 A;  5GKN A;  1YUB A;  3A45 A;  1J7K A;  3FYC A;  4LJ6 A;  4L15 A;  3GO8 A;  5ITT A;  1K82 A;  4FWD A;  1JR3 A;  4AG6 A;  3KXE C;  1QZM A;  2I7N A;  1GVN A;  2XFT A;  4DUY M;  4GHA A;  5EXP A;  5KPZ A;  3KSJ A;  4D80 A;  4Z8X A;  4JV5 M;  3GLI B;  3L29 A;  4LRT A;  4DV3 M;  4B08 A;  4JI7 M;  4G4O A;  3SAU A;  1FJG M;  3AV0 A;  5EJC A;  5ITX A;  1NHG C;  2CV2 A;  4G4Q A;  4NRW A;  4HL4 A;  4IBI A;  3U60 B;  4KOD A;  3HGI A;  1IBM M;  3HHW A;  2M5Z A;  1NJF A;  4LJA A;  2DZO B;  2DXI A;  1HT2 E;  3LQQ A;  4ITQ A;  3ZCB B;  3KFU G;  5BR8 M;  5LMN M;  1GL6 A;  2P5T A;  1L8Q A;  1G4A E;  4PDG A;  4WW0 A;  3RFW A;  4GC9 A;  2D7H A;  3SMP A;  3ZH9 B;  4M9X A;  1G3I A;  4X65 M;  2FFJ A;  4MGK E;  2CHQ A;  4BBA A;  1XXH B;  1PJJ A;  2EA0 A;  3SC3 A;  4LFC M;  1JQJ C;  3WHL A;  3R9X B;  4R3D A;  3BOS A;  2V1U A;  5ITX E;  2X4A A;  4LRS A;  1IXR C;  3WHK A;  4DV2 M;  3U6D A;  1DGF A;  4LG2 A;  3GPU A;  1N32 M;  4JXJ A;  2H1R A;  3FUX A;  3OTO M;  4W5W A;  1MU5 A;  1R2Y A;  2R18 A;  4DV6 M;  3UZU A;  2HKJ A;  3B9P A;  4PCZ A;  5ITQ A;  1IXZ A;  3HKP A;  3DZD A;  2QBY B;  2XZU A;  4K0K M;  1W5T A;  1G41 A;  3IG5 A;  3RGS A;  2FOI C;  3TQS A;  1L2C A;  2UU9 M;  5FTN A;  2HHH M;  4IBF A;  2QBY A;  3K2L A;  3AOE A;  3L27 A;  1JR3 D;  3GLH B;  3J80 S;  3VK8 A;  3LVW A;  2BJV A;  4LF5 M;  1T3T A;  3SYL A;  4DV5 M;  4QNM A;  5FTM A;  3U6M A;  1TDH A;  4GMQ A;  3U6P A;  2R46 A;  1DGG A;  3AJI B;  1G8P A;  1KFV A;  1DGH B;  4QHT A;  1E32 A;  2DHR A;  4B3R M;  3CTW B;  2DWM A;  1IN4 A;  5KPT A;  1Z5C A;  5DNY A;  4IBG A;  5EP1 A;  4I8O A;  3UGJ A;  3TWK A;  2Q2E B;  3TWM A;  4B3M M;  4CIS A;  4AW4 A;  4AZF A;  2CFO A;  2DWL A;  2VII A;  4LFA M;  3GLF B;  2Y21 A;  1IQP A;  1PJI A;  3RGP A;  4A3V B;  1L1T A;  4FVM A;  4AQY M;  3SAS A;  1C1K A;  4LJ9 A;  3FTE A;  3K92 A;  5C18 A;  2CV0 A;  2UUA M;  3IG8 A;  3L2A A;  2OQ4 A;  1NJG A;  4FCV A;  2QCU A;  4FWH A;  3C58 A;  4DV4 M;  5EXX A;  4FW9 A;  4LY6 A;  3GLG B;  4NXM M;  1Z5A A;  4HLQ A;  1K3W A;  8CAT A;  3GPX A;  4IBC A;  5H37 D;  3KOX E;  1J09 A;  4LZJ A;  3JR5 A;  3L28 A;  2HL7 A;  2RGO A;  3HU2 A;  4GIP A;  4I5S A;  3GQ5 A;  4OVZ B;  3JAM S;  2LWX A;  1Z59 A;  1W5S A;  2R4E A;  1HR0 M;  5DYI A;  5EQT A;  4G4R A;  1NHW C;  3EIH A;  3KS8 A;  3L26 A;  1IM2 A;  3HU3 A;  1N36 M;  4QHS A;  3U6L A;  2QP9 X;  2UUB M;  3KDS E;  4JI2 M;  3NBI A;  2BNK A;  1G59 A;  1YE9 A;  3KP1 E;  3D8B A;  1KSF X;  3M0E A;  1TH2 A;  4AG5 A;  3U61 B;  5F3W A;  1NNU C;  4AKH A;  4LJ5 A;  5KQD A;  1NY6 A;  5KQ8 A;  5ITR A;  5FTJ A;  4MGI E;  4DR4 M;  1Z5B A;  1N34 M;  4LJ8 A;  4BB9 A;  3GQ3 A;  3FUT A;  2J7O A;  2CEA A;  4JI4 M;  4DR3 M;  4NOO B;  2V1C A;  1IN7 A;  2YQZ A;  3HJQ A;  2UXB M;  2ZAM A;  3HJ8 A;  3RE8 A;  4X64 M;  3U6S A;  1TH3 A;  4REZ A;  1E9S A;  2CV1 A;  4IIW A;  2Y0T A;  3KOW E;  2EUC A;  3FKE A;  3KP0 E;  4LF6 M;  4GHL A;  3QAU A;  3HU1 A;  4NL4 H;  3AL0 C;  4X66 M;  1QVR A;  1Q3C A;  1OJL A;  4LF8 M;  3KVW A;  3UJN A;  4B7F A;  4JI3 M;  2YR0 A;  4P16 A;  3CF2 A;  4MGZ E;  4RF1 A;  3GPY A;  2KW0 A;  5DYG A;  3T1Y M;  1N78 A;  3MHV C;  2VQF M;  2Z7J A;  2BJW A;  3M6A A;  1ORY B;  3E9S A;  5EXT A;  2I7P A;  4LCB A;  2LH0 A;  3GRR A;  5E6J A;  4DR5 M;  3HHX A;  4PD2 A;  2E5L M;  2R65 A;  2XFS A;  4JN6 A;  4II7 A;  2XSZ D;  1DO0 A;  3VKH A;  3VK7 A;  5EP2 A;  4IBE A;  1TDZ A;  4WUR A;  4G4N A;  3SYK A;  1IBL M;  4PT5 A;  5EP4 A;  3KSX A;  1N33 M;  5FTL A;  4OU7 A;  3A98 B;  2L09 A;  1SXJ D;  3GRY A;  3I4V A;  2G5G X;  3HWS A;  3PNV A;  3JR4 A;  4IBB A;  5KPR A;  1WXQ A;  3GLF A;  3TL4 X;  7CAT A;  2F5N A;  5IZ7 D;  1IBK M;  4GIT A;  1L2D A;  1NY5 A;  1QAO A;  2KXE A;  4GRI A;  5ITY A;  4XGI A;  1QAM A;  4B3T M;  4JI8 M;  1HNW M;  2Y20 A;  2RGH A;  1E9R A;  5IRE B;  1HQY E;  3VLF B;  3LVV A;  5BPV A;  1SXJ C;  4GKJ M;  4I81 A;  2UXC M;  2KEB A;  1HNZ M;  4B7G A;  2F5P A;  2F5O A;  2JA2 A;  3AKZ A;  4X62 M;  2XSZ A;  1IY1 A;  3DFZ A;  2KZS A;  4KO8 A;  4IBK A;  2X8A A;  3I4Y A;  2VQE M;  1NSF A;  2C99 A;  3PFI A;  4DV1 M;  2XLJ A;  3LMM A;  1VDD A;  4NSR A;  5JI2 E;  3EIE A;  3HHY A;  3HJS A;  1UM8 A;  1PM5 A;  4JI1 M;  1YSY A;  2DWN A;  4LGM A;  4JI0 M;  3VDP A;  1IY0 A;  1IY2 A;  1XMO M;  4B3S M;  4KHP M;  4XBO A;  1J5E M;  3FTF A;  2ZM6 M;  3MJ5 A;  3PNY A;  1I94 M;  2UUC M;  1DGH A;  3SAW A;  4LF4 M;  1Q39 A;  4OX9 M;  1FNN A;  3J27 B;  4JI5 M;  2QEN A;  1SXJ A;  2C5R A;  3SAV A;  3NWL A;  3HHZ A;  2C98 A;  2FNA A;  1N75 A;  3KOZ E;  1H6U A;  4AI6 A;  3U6Q A;  1TGU A;  4ZPX A;  3U6C A;  2KA6 B;  4FD2 A;  3GQ4 A;  4DR6 M;  3LQR A;  2QZ4 A;  4BLC A;  2D7G A;  1Q3B A;  2X49 A;  3I51 A;  4GC5 A;  4DUZ M;  3GLH A;  2Z4S A;  3W0F A;  3SAR A;  3VFD A;  2CUZ A;  4LJ4 A;  4M9S A;  3PXG A;  3THG A;  5IT9 S;  4TUW A;  3K8Z A;  4AKI A;  3DA1 A;  4OVZ A;  2A5Y B;  4M0D A;  3ILK A;  3AFH A;  2XEP A;  2FE8 A;  3T1H M;  3FYD A;  3J81 S;  1NNJ A;  3T15 A;  4DV7 M;  4I4L A;  1X37 A;  3FUV A;  1D2N A;  3CF0 A;  3GRV A;  4CHT B;  4LF7 M;  2UXD M;  3GPP A;  2C9O A;  1XC8 A;  4D82 A;  3TPZ A;  2F5S A;  4S12 A;  3U61 A;  1SXJ B;  3AOE C;  4MM3 B;  1I4W A;  2CHV A;  3SHF A;  1LV7 A;  1R7R A;  2D7E A;  2M60 A;  4QOS A;  5FSW A;  1XMQ M;  5KO3 A;  3FTC A;  2YNM D;  4RNA A;  2R62 A;  3SFZ A;  1N77 A;  2XZF A;  4NSO B;  4L78 A;  2W82 A;  4FCT A;  1TH4 A;  5ITU A;  2O5R A;  1HNX M;  2RKO A;  4MB7 A;  1OFI A;  1MX0 A;  3K1J A;  3A46 A;  3U6E A;  2CE7 A;  4M0W A;  2YFQ A;  5FLX S;  4NXN M;  4R7G A;  4JI6 M;  3U60 A;  1ZQ9 A;  3GLG A;  2F5Q A;  2HCB A;  1DGB A;  1SXJ E;  3DOA A;  2L7I A;  3J2P B;  5EP3 A;  1L1Z A;  1OFH A;  4FCW A;  4GKK M;  2QPA A;  1R6B X;  5E26 A;  2ZBK B;  3FTD A;  1E94 E;  4IBD A;  4YY3 M;  3R8F A;  2F4V M;  2DWZ B;  4D81 A;  4L16 A;  3J7A S;  1XHB A;  4LZZ A;  3SHG B;  3CF6 E;  4QNR A;  4GH9 A;  2C96 A;  2DVW B;  4Z6Y A;  3SBJ A;  2ZAO A;  4DV0 M;  2Z3X A;  4MGY E;  3GLI A;  2L7H A;  3QWL A;  2XH9 A;  3L25 A;  2K47 A;  5LMU M;  2V6Z M;  2AHM A;  4DR2 M;  4EIW A;  1R2Z A;  3PVS A;  2J7N A;  4LJ7 A;  4MGH A;  1IN6 A;  3M7G A;  3A42 A;  5IWA M;  4NRV A;  2G8L A;  2R4J A;  3H4M A;  2CHG A;  3ZC7 B;  3UMM A;  3U5Z A;  2LXE A;  1XWI A;  1QQW A;  4YHH M;  2KZU A;  4JYA M;  4CGY B;  1GKI A;  2L6O A;  1ZAE A;  3FD9 A;  3SMS A;  3T38 A;  3U5Z B;  3J7B A;  4IBJ A;  2R45 A;  4DR7 M;  3FUU A;  3MK6 A;  3TE6 A;  4L8R C;  1IN8 A;  3Q8X A;  1KYI A;  4QOZ C;  2C9C A;  1K3X A;  4LFB M;  1L2B A;  1HT1 E;  3GP1 A;  5C1B A;  3FUW A;  4IJF A;  1GL7 A;  1QYR A;  4MH0 E;  2KRU A;  4FWG A;  4LF9 M;  1HQC A;  3E4R A;  1EE8 A;  5JI3 E;  2KRK A;  2OPF A;  2XGN A;  4KLN A;  3U6O A;  3SAT A;  3GRU A;  3W0L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...