3A46A

Crystal structure of mvnei1/thf complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
288
Chain Sequence
b'PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 84
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a46A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a46A01
4X66M 4JI8M 1N33M 1HNWM 1XMOM 1HR0M 5ITRA 3DOAA 3U6SA 4B3TM 4ITQA 4JI4M 3JR4A 3GQ3A 3GQ4A 1N32M 4LF5M 2VQFM 1MU5A 4G4RA 4LF7M 3U6EA 4DR6M 1K82A 2XZFA 1I94M 1N34M 4LFCM 2F5SA 3OTOM 4NXMM 1Z59A 2HKJA 3A46A 3SASA 2ZBKB 3GPUA 4DR1M 1K3WA 4JI5M 2F5OA 1N36M 4JI3M 5ITYA 4DV5M 3W0FA 4G4NA 2UXCM 5IT9S 4DR3M 4DV3M 4NRWA 1Z5AA 3SAVA 4DV1M 4OX9M 4DR4M 1TDHA 3A45A 2F5QA 3J80S 4PD2A 4YY3M 4B3RM 1XNQM 3JAMS 4LFBM 4DR5M 3SATA 1XNRM 2EA0A 4JV5M 1XC8A 4JI2M 5ITUA 4JYAM 1XMQM 4JI6M 5LMUM 2UUAM 4GKKM 2OPFA 1NNJA 4CISA 4DV4M 1L2BA 4PDGA 5LMNM 4DV0M 2F4VM 1PM5A 2F5NA 3GPXA 5IWAM 3GP1A 3VK8A 3T1YM 4K0KM 4NXNM 3GPPA 5BR8M 1IBMM 4AQYM 3J81S 4LF9M 5ITQA 4LF4M 1IBLM 5ITXA 4DV2M 3U6CA 3TWLA 2OQ4A 4DR7M 1Z5CA 4B3MM 2VQEM 4DR2M 3VK7A 5FLXS 2UUBM 1L2CA 1R2YA 3SBJA 3U6MA 1HNXM 3U6DA 2HHHM 4NRVA 5ITXE 4LFAM 3GQ5A 4B3SM 1MX0A 1L2DA 4G4QA 3TWMA 4LF8M 3SARA 3T1HM 4JI0M 4DV7M 4JI1M 2UXDM 1K3XA 2ZM6M 2UXBM 4MB7A 4YHHM 3J7AS 1IBKM 4DUZM 5ITTA 4DV6M 1EE8A 1Q3CA 3C58A 4G4OA 4KHPM 1L1ZA 1Z5BA 3U6LA 3JR5A 2F5PA 1HNZM 1R2ZA 3GPYA 3SAWA 1KFVA 2XZUA 1PJJA 1L1TA 1Q39A 4X62M 4DUYM 2UU9M 3SAUA 4LF6M 3U6OA 2Q2EB 4JI7M 3TWKA 1FJGM 3A42A 2UUCM 3GO8A 2E5LM 4PDIA 1TDZA 4X64M 1Q3BA 4PCZA 3U6QA 1PJIA 4GKJM 1J5EM 5A2QS 3U6PA 4X65M
chains in the Genus database with same CATH superfamily
1Y8GA 3C9PA 5GKNA 1G4AE 1WIVA 3GRRA 4M0DA 1N33M 1VEKA 3E9SA 1HR0M 1G41A 1X37A 3AKZA 1DGHA 2LVAA 4IBKA 2KZUA 3U6SA 4ITQA 3PNYA 4NSOB 4M9SA 2L6OA 4LF7M 2FE8A 3GLFA 3HWSA 3U6EA 1K82A 3T6PA 2XZFA 4QHTA 4RKUF 4P17A 1TH4A 4KT0F 5DFLA 2GNOA 3HU1A 4JI5M 4G4NA 4B7HA 5IT9S 2AHMA 1CUKA 2FFJA 2DWNA 2JUJA 1ZMWA 4DV3M 4KO8A 2LWXA 2DZNB 2M5ZA 4FD2A 3I4YA 3SMSA 4YY3M 2JY7A 2JXNA 4DR5M 2C98A 3F92A 1XC8A 3HHYA 5DNYA 3KXEC 5ITUA 2APLA 1JR3A 1P3QQ 2MH8A 2K9DA 4GKKM 1JQJC 2OPFA 2FH0A 4DV4M 2F4VM 4DV0M 2K47A 4QHSA 1AUAA 1QUSA 1VDDA 3LQQA 1ZQ9A 4NXNM 2MROB 2CV0A 1N77A 4FW9A 3J81S 3SHFA 5ITXA 1N75A 3KVWA 4QOSA 3K92A 3FUTA 2JY5A 4GMQA 4KLNA 2JZ0A 2P5TA 2C9OA 4AKGA 1EIJA 1GLNA 3NWLA 4NOOB 3HKPA 2KDLA 2XLJA 3M7GA 2V1UA 3LW5F 1IQPA 2VQEM 3C3EA 4B3MM 1XB2B 1V92A 2LVOC 3GLHA 1R5LA 2OOAA 1VDLA 3AV0A 1R2YA 2HHHM 2KNVA 3U6DA 2MJ5B 4NRVA 1SXJC 2D7EA 4B3SM 4RF1A 3QYBA 4G4QA 4LF8M 4MGYE 1WHCA 4DV7M 2VF8A 1D2NA 1L8QA 1NJFA 1HT1E 4MB7A 1DGGA 2V6ZM 3E21A 2L4EA 2Z7JA 2WSCF 3C58A 3J7BA 3ZQJA 1NO1A 1QDRA 3RE8A 2J7OA 1GO5A 3VLFB 3EIEA 5KPRA 3PFIA 3E46A 3UZUA 3KP0E 3L26A 3VKGA 3PXGA 1ZAEA 3HHZA 3SAWA 1MJGM 2XZUA 1PJJA 3KS4A 5EXPA 3UK6A 2ERCA 3MHVC 5EXSA 3TE6A 1IN4A 2VIIA 1DGHB 4DUYM 3U6OA 2QSFX 2UUBM 3W67A 4GRIA 4F1IA 3CF6E 3K9PA 5EP3A 2LNHC 2XF3A 4IBCA 3TWKA 5EJCA 1FJGM 2DAGA 5FTLA 1OAOC 3GLFB 1OIZA 1PJSA 1QVRA 2XSZD 4IIWA 4PDIA 4GH9A 4X64M 1Q3BA 1YUBA 3FTCA 2CP8A 4BLCA 2LXEA 2Z4RA 1J5EM 3U6PA 2R62A 4X65M 2JP7A 3FKEA 4JI8M 3LMMA 3BOSA 1XMOM 2EUCA 3MJ5A 4KODA 1HQYE 4MGHA 1S3SA 2R65A 4REZA 3QAUA 1KSFX 5KQDA 3HU3A 1HQCA 3VDUA 4JI4M 2BJWA 3GQ4A 4OW0A 1MU5A 2DZLA 3GLIA 4W5WA 3RGSA 1N34M 2F5SA 2XH9A 3OTOM 4NXMM 1GVNA 3KS8A 3SASA 2HCBA 3GPUA 4LCBA 2CWBA 3L27A 4LZJA 4DR1M 2YQZA 1VG5A 2KRUA 3L25A 2Y0TA 1Z6TA 2DAMA 2M60A 1NNUC 5ITYA 2LHCA 4DV5M 2C99A 1EFUB 4DR3M 3A98B 1NJGA 4LJ4A 4LZZA 4QOZC 4HEOA 1Z5AA 3U61A 2L2DA 1RU3A 4IBEA 1TDHA 4FCVA 3U60A 2R18A 2VF7A 3SATA 2DVWB 3KW6A 3LCUA 4IJEA 4PT5A 7CATA 2EA0A 2EJSA 3KSXA 2D7GA 1XMQM 1MN3A 1ZMVA 3L2AA 1E9SA 1C1KA 2QHOB 4CISA 3GLHB 5LMNM 4KHPM 3KSJA 1QAQA 2L4FA 4IBIA 1A5TA 1IBMM 2EO2A 3KP1E 5BR8M 4L4UA 4LJAA 2QQ8A 1C7YA 1ZMUA 4XGIA 2DWMA 1W5TA 3HY5A 1QDTA 4FWDA 1V34A 4FWHA 3HGIA 2CEAA 4MGZE 2Y0QA 3TWLA 1WR1B 1SG9A 2XSZA 4LJ8A 3SHGB 3J27B 2OQ4A 3B9PA 3V76A 4RNAA 1QAOA 5EP4A 4MGKE 1XWIA 5EXTA 4DR2M 4BB9A 1IXSB 1NHGC 1UM8A 1G8PA 3J2PB 3CF0A 1L2CA 3U6MA 1YLAA 4GHLA 3SYKA 4L16A 5ITXE 4LFAM 3GQ5A 1XXHA 5DYGA 3SFZA 2LHGA 2LVPC 3SARA 4JI1M 2DAEA 1SXJD 4L78A 2UXBM 3J7AS 5H37D 3FRIA 3TL4X 8CATA 4DV6M 4FCTA 3T38A 1R7RA 4M9ZA 2DAIA 3I4VA 2QZ4A 3M6AA 1Z5BA 3VDPA 2F5PA 4OVZA 2XEPA 1HNZM 2ZTDA 5BPVA 2CFOA 4TUWA 1TH2A 3SC3A 1R2ZA 1W5SA 1IY0A 1KFVA 4LRSA 1OFIA 4UN2B 4IBFA 2JWSA 3I04M 2DAKA 2Y20A 1TGUA 2EKKA 2UU9M 4XBOA 4AW4A 1IN5A 4L8RC 3GRVA 3B7ZA 1T43A 3TQSA 5L8RF 1TTEA 2O5RA 2QNJA 1G71A 2OO9A 4LJ6A 4R7GA 3FD9A 2X4AA 2QPAA 3A42A 3GLIB 5FTKA 4I8OA 1NY5A 4PCZA 1IM2A 4WP2A 1GL7A 5EXXA 3GRYA 2D7HA 4CGYB 4B7GA 3BXWA 1IXSA 2CUZA 5EP2A 3FTFA 2HAKA 2I7NA 3B89A 2G3QA 1HNWM 5ITRA 3LVVA 2K0BX 2YNMD 2DENA 1GJSA 3QWLA 1D0LA 3Q8GA 3AOGA 3IG5A 4QNRA 3JR4A 3U61B 3DZDA 2O25A 1N32M 5KPZA 2G5GX 1IN6A 2LVNC 3GLGA 2VQFM 4G4RA 4LF5M 3IG8A 2N35A 2ZAOA 3KOXE 3U60B 4L6V6 3HJSA 2JA2A 4B7FA 4S12A 4DBGB 1Z59A 2ZBKB 4D82A 1DO0A 4P16A 4EIWA 1K3WA 4FVMA 1J09A 3K9OA 5KO3A 2C5RA 3B7NA 4M9XA 1F4IA 5C1BA 3W0FA 2LVQD 1HJPA 2KEBA 1NVMA 1SXJA 3VFDA 3M0EA 1VEJA 4OX9M 3GLIE 2DI0A 3A45A 3J80S 2X8AA 4GEWA 2R6FA 1IN7A 1R6BX 4HLQA 3FYCA 1XNQM 3JAMS 4B3RM 4LFBM 2WZJA 2HL7A 4JYAM 3IHPA 4JI6M 2ZAMA 4I81A 2KNAA 4NSRA 1D0KA 2C96A 3ZCBB 3FYDA 2L7HA 2X49A 1PM5A 3Q8XA 3HX3A 2F5NA 3GPXA 4LY6A 5IWAM 3GP1A 2DZOB 3FUXA 3T1YM 4K0KM 4M0WA 3TPZA 4Z6YA 1XXHB 1TR8A 4LF9M 5ITQA 1IBLM 1KYIA 4WW0A 4DV2M 2Y21A 4GC9A 1YE9A 3FTDA 2G8LA 3EIHA 1LTMA 4FWGA 2BNKA 2LTUA 2K6BA 3I51A 2KW0A 2Z8YM 2H1RA 3KDSE 5C18A 3GLFE 1QYRA 2RRUA 3HJ8A 2CHVA 1IY1A 3D8LA 3NBIA 1VEGA 4WURA 3AFHA 5FLXS 4OU7A 2XFTA 2KXEA 4OVZB 3C3DA 2R0IA 4A3VB 3SBJA 2RGHA 1IN8A 4LGYA 2JNHA 1HNXM 1TH3A 1HT2E 1YSYA 4R71A 1H6UA 1MX0A 5FSWA 4CIZA 5FTJA 2CV2A 1OQYA 1T3TA 4JI0M 1WJ7A 1OAIA 4XK8F 1K3XA 1IXRC 4YHHM 1N78A 2R4EA 4Y28F 2ZTCA 3T15A 1TF0B 2EKFA 1IXZA 1EE8A 1QANA 1XHBA 2MGWA 2R45A 2WSFF 3B74A 4IBGA 2C9CA 4LGMA 1L1ZA 1Q02A 1FNNA 4Z8XA 1JR3E 4HL4A 4NC6A 2CV1A 4GITA 1XXHE 1GKIA 3FUUA 2NQ8C 3GPYA 3R9XB 1NV9A 2ZANA 2JZ1A 3U5ZA 2FS1A 4I5SA 4IJFA 1L1TA 1Q39A 4AKIA 2HWJA 4LF6M 3CGWA 2KRKA 2CRUA 2Q2EB 2Z4SA 1QUTA 3ZC7B 4BBAA 3PVSA 3E4RA 4QNMA 1NY6A 3GLGB 1OIPA 4JN6A 1NSFA 1VQ1A 2FOIC 2RKOA 5E26A 2UUCM 4AG6A 2LH0A 2E5LM 2I7PA 3U6QA 1PJIA 3GLHE 3K8ZA 3R8FA 4X66M 4MM3B 3CF2A 5FTMA 1R4GA 1LV7A 1QZMA 1UFZA 5KPTA 4LJ7A 3THGA 1SXJB 2DWZB 3DOAA 3IECA 4GHAA 3HHWA 4B3TM 2KNZA 3GQ3A 1PRBA 4CJ6A 1T6OA 4LG2A 4I4LA 4F2LA 3PNVA 1IY2A 1PJQA 4DR6M 1I94M 3VKHA 2QBYA 4LFCM 3KFUG 2HKJA 3A46A 1GABA 3AOEC 5E6JA 1DO2A 4L15A 2DXIA 2F5OA 1N36M 4G6ZA 4JI3M 2O01F 4RF0A 1NHWC 3BBZA 4LRTA 2V1CA 3KOZE 1ORYB 2CHGA 2WSEF 3FTEA 3AL0C 2XFSA 1QAMA 2CHQA 4NRWA 3GLGE 4G3OA 3SAVA 4DV1M 4DR4M 2F5QA 4AKHA 4PD2A 1I4WA 3FUWA 2GQFA 1XNRM 2OOBA 4JV5M 2QP9X 3SYLA 4JI2M 5FTNA 4ANRA 4CHTB 4IBBA 2L7IA 2BJVA 1E9RA 1OTRA 5LMUM 2UUAM 1WXQA 2J5YA 1NNJA 1SXJE 1L2BA 4PDGA 2KHHA 1OKSA 3AJIB 2CE7A 4IBDA 2R46A 3D8BA 1E94E 3VK8A 1QZEA 2DKLA 5IZ7D 3HZJA 3GPPA 1JB0F 2MR9A 1BVSA 1DGBA 2BWEA 4AQYM 1G3IA 4ZPXA 1GJTA 2DWLA 4LF4M 4AI6A 2RGOA 3W68A 3MMPA 4D80A 5KQ8A 5DYIA 1DV0A 3QYEA 5IREB 3U6CA 1V33A 2LBCA 3AOEA 1WGLA 3ILKA 3L28A 4LJ5A 4AG5A 2R4JA 4DR7M 1Z5CA 2L09A 2QCUA 3B7QA 5F3WA 3FUVA 1GL6A 4LJ9A 1OFHA 3FE3A 3VK7A 4B08A 4IBJA 1QQWA 2XGNA 1WGNA 3H4MA 3KOYE 4Q7JA 3DA1A 3HJQA 1AIPC 3RFWA 3MK6A 4MH0E 4R3DA 2J7NA 5JI2E 3TWMA 3U5ZB 1L2DA 2BWBA 3LVWA 4NL4H 3T1HM 2UXDM 1ZV1A 1IFYA 3HU2A 3L29A 3K1JA 1PJTA 5EQTA 3UMMA 3HHXA 2ZM6M 2YR0A 3ZH9B 1IBKM 4DUZM 1PGYA 5ITTA 4G4OA 1Q3CA 3LCVB 2B3TA 2JY6B 2W82A 4D81A 3CTWB 2Z3XA 3U6LA 2KZSA 2R44A 3JR5A 3W0LB 2A5YB 2DHRA 3UGJA 1JR3D 1G59A 3GRUA 2DHYA 2VDBB 3KOWE 2FNAA 3DFZA 4GIPA 1E32A 4II7A 1D0MA 3WHKA 4X62M 4JXJA 3UJNA 3WHLA 1J7KA 3NBXX 3K2LA 3SAUA 4GC5A 3RGPA 2H5XA 4JI7M 2KA6B 5JI3E 4FCWA 2QENA 1DGFA 3GO8A 3FRHA 4MGIE 1TDZA 2QBYB 3H4JA 4AZFA 2YFQA 2DNAA 3I01M 3SMPA 2JY8A 4GKJM 5EP1A 5A2QS 1OJLA 2UXCM 1NV8A 3LQRA
chains in the Genus database with same CATH topology
5GKNA 1G4AE 3GRRA 4M0DA 1N33M 3E9SA 1HR0M 1G41A 1X37A 3AKZA 1DGHA 4IBKA 2KZUA 3U6SA 4ITQA 3PNYA 4NSOB 4M9SA 2L6OA 4LF7M 2FE8A 3GLFA 3HWSA 3U6EA 1K82A 2XZFA 4QHTA 1TH4A 3HU1A 4JI5M 4G4NA 4B7HA 5IT9S 2AHMA 2FFJA 2DWNA 4DV3M 4KO8A 2LWXA 2DZNB 2M5ZA 4FD2A 3I4YA 3SMSA 4YY3M 4DR5M 2C98A 1OJLA 1XC8A 3HHYA 5DNYA 3KXEC 5ITUA 1JR3A 4GKKM 1JQJC 2OPFA 4DV4M 2F4VM 4DV0M 2K47A 4QHSA 1VDDA 3LQQA 1ZQ9A 4NXNM 2CV0A 1N77A 4FW9A 3J81S 3SHFA 5ITXA 1N75A 3KVWA 4QOSA 3K92A 3FUTA 4GMQA 4KLNA 2P5TA 2C9OA 4AKGA 1GLNA 3NWLA 4NOOB 3HKPA 2XLJA 3M7GA 2V1UA 1IQPA 2VQEM 4B3MM 3GLHA 3AV0A 1R2YA 2HHHM 3U6DA 4NRVA 1SXJC 2D7EA 4B3SM 4RF1A 4G4QA 4LF8M 4MGYE 4DV7M 1D2NA 1L8QA 1NJFA 1HT1E 4MB7A 1DGGA 2V6ZM 2Z7JA 3C58A 3J7BA 3RE8A 2J7OA 3VLFB 3EIEA 5KPRA 3PFIA 3UZUA 3KP0E 3L26A 3VKGA 3PXGA 1ZAEA 3HHZA 3SAWA 2XZUA 1PJJA 3KS4A 5EXPA 3UK6A 2ERCA 3MHVC 5EXSA 3TE6A 1IN4A 2VIIA 1DGHB 4DUYM 3U6OA 4GRIA 3CF6E 5EP3A 2LNHC 2XF3A 4IBCA 3TWKA 5EJCA 1FJGM 5FTLA 3GLFB 2XSZD 1QVRA 4IIWA 4PDIA 4GH9A 4X64M 1Q3BA 1YUBA 3FTCA 4BLCA 2LXEA 2Z4RA 1J5EM 3U6PA 2R62A 4X65M 3FKEA 4JI8M 3LMMA 3BOSA 1XMOM 2EUCA 3MJ5A 4KODA 1HQYE 4MGHA 1S3SA 2R65A 4REZA 3QAUA 1KSFX 5KQDA 3HU3A 1HQCA 3VDUA 4JI4M 2BJWA 3GQ4A 4OW0A 1MU5A 3GLIA 4W5WA 3RGSA 1N34M 2F5SA 2XH9A 3OTOM 4NXMM 1GVNA 3KS8A 3SASA 2HCBA 3GPUA 4LCBA 3L27A 4DR1M 4LZJA 3L25A 2YQZA 2KRUA 2Y0TA 1Z6TA 2M60A 1NNUC 5ITYA 4DV5M 2C99A 4DR3M 3A98B 1NJGA 4LJ4A 4LZZA 4QOZC 1Z5AA 3U61A 4IBEA 1TDHA 4FCVA 3U60A 2R18A 3SATA 2DVWB 3KW6A 4IJEA 7CATA 4PT5A 2EA0A 3KSXA 2D7GA 1XMQM 3L2AA 1E9SA 1C1KA 4CISA 3GLHB 5LMNM 3KSJA 1QAQA 4IBIA 1IBMM 2EO2A 3KP1E 5BR8M 4L4UA 4LJAA 4XGIA 2DWMA 1W5TA 4FWDA 4FWHA 3HGIA 2CEAA 4MGZE 2Y0QA 3TWLA 3SHGB 2XSZA 4LJ8A 3J27B 2OQ4A 3B9PA 4RNAA 1QAOA 5EP4A 4MGKE 1XWIA 5EXTA 4DR2M 4BB9A 1IXSB 1NHGC 1UM8A 1G8PA 3J2PB 3CF0A 1L2CA 3U6MA 4GHLA 3SYKA 4L16A 5ITXE 4LFAM 3GQ5A 1XXHA 5DYGA 3SFZA 3SARA 4JI1M 1SXJD 4L78A 2UXBM 3J7AS 5H37D 3TL4X 8CATA 4DV6M 4FCTA 3T38A 1R7RA 4M9ZA 3I4VA 2QZ4A 3M6AA 1Z5BA 3VDPA 2F5PA 4OVZA 2XEPA 1HNZM 5BPVA 2CFOA 4TUWA 1TH2A 3SC3A 1R2ZA 1W5SA 1IY0A 1KFVA 4LRSA 1OFIA 4IBFA 2Y20A 1TGUA 2UU9M 4XBOA 4AW4A 1IN5A 4L8RC 3GRVA 3TQSA 2O5RA 4LJ6A 4R7GA 3FD9A 2X4AA 2QPAA 3A42A 3GLIB 5FTKA 4I8OA 1NY5A 4PCZA 1IM2A 5EXXA 1GL7A 3GRYA 2D7HA 4CGYB 4B7GA 3FTFA 2CUZA 5EP2A 2I7NA 1HNWM 5ITRA 3LVVA 2YNMD 3QWLA 3AOGA 3IG5A 4QNRA 3JR4A 3U61B 3DZDA 1N32M 5KPZA 2G5GX 1IN6A 2VQFM 3GLGA 4LF5M 4G4RA 3IG8A 2ZAOA 3KOXE 3U60B 3HJSA 2JA2A 4B7FA 4S12A 1Z59A 2ZBKB 4D82A 1DO0A 4P16A 4EIWA 1K3WA 4FVMA 1J09A 5KO3A 2C5RA 4M9XA 5C1BA 3W0FA 2KEBA 1NVMA 1SXJA 3VFDA 3M0EA 4OX9M 3A45A 3J80S 2X8AA 1IN7A 1R6BX 4HLQA 3FYCA 1XNQM 3JAMS 4B3RM 4LFBM 2HL7A 4JYAM 4JI6M 2ZAMA 4I81A 4NSRA 2C96A 3ZCBB 3FYDA 2L7HA 2X49A 1PM5A 3Q8XA 2F5NA 3GPXA 4LY6A 5IWAM 3GP1A 2DZOB 3FUXA 3T1YM 4K0KM 4M0WA 3TPZA 4Z6YA 1XXHB 4LF9M 5ITQA 1IBLM 1KYIA 4WW0A 4DV2M 2Y21A 4GC9A 1YE9A 3FTDA 2G8LA 3EIHA 4FWGA 2BNKA 3I51A 2KW0A 3KDSE 2H1RA 5C18A 1QYRA 3HJ8A 2CHVA 1IY1A 3D8LA 3NBIA 4WURA 3AFHA 5FLXS 4OU7A 2XFTA 2KXEA 4OVZB 4A3VB 2UUBM 3SBJA 1HNXM 2RGHA 1IN8A 4LGYA 1TH3A 1HT2E 1YSYA 1H6UA 1MX0A 5FSWA 5FTJA 2CV2A 1T3TA 4JI0M 1K3XA 1IXRC 4YHHM 1N78A 2R4EA 3T15A 1IXZA 1EE8A 1QANA 1XHBA 2R45A 4KHPM 4IBGA 1L1ZA 2C9CA 4LGMA 1FNNA 4Z8XA 4HL4A 2CV1A 4GITA 1GKIA 3FUUA 2NQ8C 3GPYA 3R9XB 2ZANA 3U5ZA 4I5SA 4IJFA 1L1TA 1Q39A 4AKIA 4LF6M 2KRKA 2Q2EB 2Z4SA 3ZC7B 4BBAA 3PVSA 3E4RA 4QNMA 1NY6A 3GLGB 4JN6A 1NSFA 2FOIC 2RKOA 5E26A 2UUCM 4AG6A 2LH0A 2E5LM 2I7PA 3U6QA 1PJIA 3K8ZA 3R8FA 4X66M 4MM3B 3CF2A 5FTMA 1LV7A 1QZMA 5KPTA 4LJ7A 3THGA 1SXJB 2DWZB 3DOAA 4GHAA 3HHWA 4B3TM 3GQ3A 4LG2A 4I4LA 3PNVA 1IY2A 4DR6M 1I94M 3VKHA 2QBYA 4LFCM 3KFUG 2HKJA 3A46A 3AOEC 5E6JA 1DO2A 4L15A 2DXIA 2F5OA 1N36M 4G6ZA 4JI3M 4RF0A 1NHWC 4LRTA 3AL0C 2V1CA 3KOZE 1ORYB 2CHGA 3FTEA 2XFSA 1QAMA 2CHQA 4NRWA 3SAVA 4DV1M 4DR4M 2F5QA 4AKHA 4PD2A 1I4WA 3FUWA 1XNRM 4JV5M 2QP9X 3SYLA 4JI2M 5FTNA 4CHTB 4IBBA 2L7IA 2BJVA 1E9RA 5LMUM 2UUAM 1WXQA 1NNJA 1SXJE 1L2BA 4PDGA 3AJIB 2CE7A 4IBDA 2R46A 3D8BA 1E94E 3VK8A 5IZ7D 3GPPA 1DGBA 4AQYM 4AI6A 1G3IA 4ZPXA 2DWLA 4LF4M 2RGOA 4D80A 5KQ8A 5DYIA 5IREB 3U6CA 3AOEA 3L28A 3ILKA 4LJ5A 4AG5A 2R4JA 4DR7M 1Z5CA 2L09A 2QCUA 5F3WA 3FUVA 1GL6A 4LJ9A 1OFHA 3VK7A 4B08A 4IBJA 1QQWA 2XGNA 3H4MA 3KOYE 3DA1A 3HJQA 3RFWA 3MK6A 4MH0E 4R3DA 2J7NA 5JI2E 3TWMA 3U5ZB 1L2DA 3LVWA 4NL4H 3T1HM 2UXDM 3HU2A 3L29A 3K1JA 5EQTA 3UMMA 2ZM6M 3HHXA 2YR0A 3ZH9B 1IBKM 4DUZM 5ITTA 4G4OA 1Q3CA 2W82A 4D81A 3CTWB 2Z3XA 3U6LA 2KZSA 3JR5A 3W0LB 2A5YB 2DHRA 3UGJA 1JR3D 1G59A 3GRUA 3KOWE 3DFZA 4GIPA 1E32A 4II7A 3WHKA 4X62M 4JXJA 3UJNA 3WHLA 1J7KA 3SAUA 3K2LA 4GC5A 3RGPA 4JI7M 2KA6B 5JI3E 4FCWA 2QENA 1DGFA 3GO8A 4MGIE 1TDZA 2QBYB 4AZFA 2YFQA 3SMPA 4GKJM 5EP1A 5A2QS 2FNAA 2UXCM 3LQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 M;  4JI8 M;  1N33 M;  1HNW M;  1XMO M;  1HR0 M;  5ITR A;  3DOA A;  3U6S A;  4B3T M;  4ITQ A;  4JI4 M;  3JR4 A;  3GQ3 A;  3GQ4 A;  1N32 M;  4LF5 M;  2VQF M;  1MU5 A;  4G4R A;  4LF7 M;  3U6E A;  4DR6 M;  1K82 A;  2XZF A;  1I94 M;  1N34 M;  4LFC M;  2F5S A;  3OTO M;  4NXM M;  1Z59 A;  2HKJ A;  3A46 A;  3SAS A;  2ZBK B;  3GPU A;  4DR1 M;  1K3W A;  4JI5 M;  2F5O A;  1N36 M;  4JI3 M;  5ITY A;  4DV5 M;  3W0F A;  4G4N A;  2UXC M;  5IT9 S;  4DR3 M;  4DV3 M;  4NRW A;  1Z5A A;  3SAV A;  4DV1 M;  4OX9 M;  4DR4 M;  1TDH A;  3A45 A;  2F5Q A;  3J80 S;  4PD2 A;  4YY3 M;  4B3R M;  1XNQ M;  3JAM S;  4LFB M;  4DR5 M;  3SAT A;  1XNR M;  2EA0 A;  4JV5 M;  1XC8 A;  4JI2 M;  5ITU A;  4JYA M;  1XMQ M;  4JI6 M;  5LMU M;  2UUA M;  4GKK M;  2OPF A;  1NNJ A;  4CIS A;  4DV4 M;  1L2B A;  4PDG A;  5LMN M;  4DV0 M;  2F4V M;  1PM5 A;  2F5N A;  3GPX A;  5IWA M;  3GP1 A;  3VK8 A;  3T1Y M;  4K0K M;  4NXN M;  3GPP A;  5BR8 M;  1IBM M;  4AQY M;  3J81 S;  4LF9 M;  5ITQ A;  4LF4 M;  1IBL M;  5ITX A;  4DV2 M;  3U6C A;  3TWL A;  2OQ4 A;  4DR7 M;  1Z5C A;  4B3M M;  2VQE M;  4DR2 M;  3VK7 A;  5FLX S;  2UUB M;  1L2C A;  1R2Y A;  3SBJ A;  3U6M A;  1HNX M;  3U6D A;  2HHH M;  4NRV A;  5ITX E;  4LFA M;  3GQ5 A;  4B3S M;  1MX0 A;  1L2D A;  4G4Q A;  3TWM A;  4LF8 M;  3SAR A;  3T1H M;  4JI0 M;  4DV7 M;  4JI1 M;  2UXD M;  1K3X A;  2ZM6 M;  2UXB M;  4MB7 A;  4YHH M;  3J7A S;  1IBK M;  4DUZ M;  5ITT A;  4DV6 M;  1EE8 A;  1Q3C A;  3C58 A;  4G4O A;  4KHP M;  1L1Z A;  1Z5B A;  3U6L A;  3JR5 A;  2F5P A;  1HNZ M;  1R2Z A;  3GPY A;  3SAW A;  1KFV A;  2XZU A;  1PJJ A;  1L1T A;  1Q39 A;  4X62 M;  4DUY M;  2UU9 M;  3SAU A;  4LF6 M;  3U6O A;  2Q2E B;  4JI7 M;  3TWK A;  1FJG M;  3A42 A;  2UUC M;  3GO8 A;  2E5L M;  4PDI A;  1TDZ A;  4X64 M;  1Q3B A;  4PCZ A;  3U6Q A;  1PJI A;  4GKJ M;  1J5E M;  5A2Q S;  3U6P A;  4X65 M; 
#chains in the Genus database with same CATH topology
 1Y8G A;  3C9P A;  5GKN A;  1G4A E;  1WIV A;  3GRR A;  4M0D A;  1N33 M;  1VEK A;  3E9S A;  1HR0 M;  1G41 A;  1X37 A;  3AKZ A;  1DGH A;  2LVA A;  4IBK A;  2KZU A;  3U6S A;  4ITQ A;  3PNY A;  4NSO B;  4M9S A;  2L6O A;  4LF7 M;  2FE8 A;  3GLF A;  3HWS A;  3U6E A;  1K82 A;  3T6P A;  2XZF A;  4QHT A;  4RKU F;  4P17 A;  1TH4 A;  4KT0 F;  5DFL A;  2GNO A;  3HU1 A;  4JI5 M;  4G4N A;  4B7H A;  5IT9 S;  2AHM A;  1CUK A;  2FFJ A;  2DWN A;  2JUJ A;  1ZMW A;  4DV3 M;  4KO8 A;  2LWX A;  2DZN B;  2M5Z A;  4FD2 A;  3I4Y A;  3SMS A;  4YY3 M;  2JY7 A;  2JXN A;  4DR5 M;  2C98 A;  3F92 A;  1XC8 A;  3HHY A;  5DNY A;  3KXE C;  5ITU A;  2APL A;  1JR3 A;  1P3Q Q;  2MH8 A;  2K9D A;  4GKK M;  1JQJ C;  2OPF A;  2FH0 A;  4DV4 M;  2F4V M;  4DV0 M;  2K47 A;  4QHS A;  1AUA A;  1QUS A;  1VDD A;  3LQQ A;  1ZQ9 A;  4NXN M;  2MRO B;  2CV0 A;  1N77 A;  4FW9 A;  3J81 S;  3SHF A;  5ITX A;  1N75 A;  3KVW A;  4QOS A;  3K92 A;  3FUT A;  2JY5 A;  4GMQ A;  4KLN A;  2JZ0 A;  2P5T A;  2C9O A;  4AKG A;  1EIJ A;  1GLN A;  3NWL A;  4NOO B;  3HKP A;  2KDL A;  2XLJ A;  3M7G A;  2V1U A;  3LW5 F;  1IQP A;  2VQE M;  3C3E A;  4B3M M;  1XB2 B;  1V92 A;  2LVO C;  3GLH A;  1R5L A;  2OOA A;  1VDL A;  3AV0 A;  1R2Y A;  2HHH M;  2KNV A;  3U6D A;  2MJ5 B;  4NRV A;  1SXJ C;  2D7E A;  4B3S M;  4RF1 A;  3QYB A;  4G4Q A;  4LF8 M;  4MGY E;  1WHC A;  4DV7 M;  2VF8 A;  1D2N A;  1L8Q A;  1NJF A;  1HT1 E;  4MB7 A;  1DGG A;  2V6Z M;  3E21 A;  2L4E A;  2Z7J A;  2WSC F;  3C58 A;  3J7B A;  3ZQJ A;  1NO1 A;  1QDR A;  3RE8 A;  2J7O A;  1GO5 A;  3VLF B;  3EIE A;  5KPR A;  3PFI A;  3E46 A;  3UZU A;  3KP0 E;  3L26 A;  3VKG A;  3PXG A;  1ZAE A;  3HHZ A;  3SAW A;  1MJG M;  2XZU A;  1PJJ A;  3KS4 A;  5EXP A;  3UK6 A;  2ERC A;  3MHV C;  5EXS A;  3TE6 A;  1IN4 A;  2VII A;  1DGH B;  4DUY M;  3U6O A;  2QSF X;  2UUB M;  3W67 A;  4GRI A;  4F1I A;  3CF6 E;  3K9P A;  5EP3 A;  2LNH C;  2XF3 A;  4IBC A;  3TWK A;  5EJC A;  1FJG M;  2DAG A;  5FTL A;  1OAO C;  3GLF B;  1OIZ A;  1PJS A;  1QVR A;  2XSZ D;  4IIW A;  4PDI A;  4GH9 A;  4X64 M;  1Q3B A;  1YUB A;  3FTC A;  2CP8 A;  4BLC A;  2LXE A;  2Z4R A;  1J5E M;  3U6P A;  2R62 A;  4X65 M;  2JP7 A;  3FKE A;  4JI8 M;  3LMM A;  3BOS A;  1XMO M;  2EUC A;  3MJ5 A;  4KOD A;  1HQY E;  4MGH A;  1S3S A;  2R65 A;  4REZ A;  3QAU A;  1KSF X;  5KQD A;  3HU3 A;  1HQC A;  3VDU A;  4JI4 M;  2BJW A;  3GQ4 A;  4OW0 A;  1MU5 A;  2DZL A;  3GLI A;  4W5W A;  3RGS A;  1N34 M;  2F5S A;  2XH9 A;  3OTO M;  4NXM M;  1GVN A;  3KS8 A;  3SAS A;  2HCB A;  3GPU A;  4LCB A;  2CWB A;  3L27 A;  4LZJ A;  4DR1 M;  2YQZ A;  1VG5 A;  2KRU A;  3L25 A;  2Y0T A;  1Z6T A;  2DAM A;  2M60 A;  1NNU C;  5ITY A;  2LHC A;  4DV5 M;  2C99 A;  1EFU B;  4DR3 M;  3A98 B;  1NJG A;  4LJ4 A;  4LZZ A;  4QOZ C;  4HEO A;  1Z5A A;  3U61 A;  2L2D A;  1RU3 A;  4IBE A;  1TDH A;  4FCV A;  3U60 A;  2R18 A;  2VF7 A;  3SAT A;  2DVW B;  3KW6 A;  3LCU A;  4IJE A;  4PT5 A;  7CAT A;  2EA0 A;  2EJS A;  3KSX A;  2D7G A;  1XMQ M;  1MN3 A;  1ZMV A;  3L2A A;  1E9S A;  1C1K A;  2QHO B;  4CIS A;  3GLH B;  5LMN M;  4KHP M;  3KSJ A;  1QAQ A;  2L4F A;  4IBI A;  1A5T A;  1IBM M;  2EO2 A;  3KP1 E;  5BR8 M;  4L4U A;  4LJA A;  2QQ8 A;  1C7Y A;  1ZMU A;  4XGI A;  2DWM A;  1W5T A;  3HY5 A;  1QDT A;  4FWD A;  1V34 A;  4FWH A;  3HGI A;  2CEA A;  4MGZ E;  2Y0Q A;  3TWL A;  1WR1 B;  1SG9 A;  2XSZ A;  4LJ8 A;  3SHG B;  3J27 B;  2OQ4 A;  3B9P A;  3V76 A;  4RNA A;  1QAO A;  5EP4 A;  4MGK E;  1XWI A;  5EXT A;  4DR2 M;  4BB9 A;  1IXS B;  1NHG C;  1UM8 A;  1G8P A;  3J2P B;  3CF0 A;  1L2C A;  3U6M A;  1YLA A;  4GHL A;  3SYK A;  4L16 A;  5ITX E;  4LFA M;  3GQ5 A;  1XXH A;  5DYG A;  3SFZ A;  2LHG A;  2LVP C;  3SAR A;  4JI1 M;  2DAE A;  1SXJ D;  4L78 A;  2UXB M;  3J7A S;  5H37 D;  3FRI A;  3TL4 X;  8CAT A;  4DV6 M;  4FCT A;  3T38 A;  1R7R A;  4M9Z A;  2DAI A;  3I4V A;  2QZ4 A;  3M6A A;  1Z5B A;  3VDP A;  2F5P A;  4OVZ A;  2XEP A;  1HNZ M;  2ZTD A;  5BPV A;  2CFO A;  4TUW A;  1TH2 A;  3SC3 A;  1R2Z A;  1W5S A;  1IY0 A;  1KFV A;  4LRS A;  1OFI A;  4UN2 B;  4IBF A;  2JWS A;  3I04 M;  2DAK A;  2Y20 A;  1TGU A;  2EKK A;  2UU9 M;  4XBO A;  4AW4 A;  1IN5 A;  4L8R C;  3GRV A;  3B7Z A;  1T43 A;  3TQS A;  5L8R F;  1TTE A;  2O5R A;  2QNJ A;  1G71 A;  2OO9 A;  4LJ6 A;  4R7G A;  3FD9 A;  2X4A A;  2QPA A;  3A42 A;  3GLI B;  5FTK A;  4I8O A;  1NY5 A;  4PCZ A;  1IM2 A;  4WP2 A;  1GL7 A;  5EXX A;  3GRY A;  2D7H A;  4CGY B;  4B7G A;  3BXW A;  1IXS A;  2CUZ A;  5EP2 A;  3FTF A;  2HAK A;  2I7N A;  3B89 A;  2G3Q A;  1HNW M;  5ITR A;  3LVV A;  2K0B X;  2YNM D;  2DEN A;  1GJS A;  3QWL A;  1D0L A;  3Q8G A;  3AOG A;  3IG5 A;  4QNR A;  3JR4 A;  3U61 B;  3DZD A;  2O25 A;  1N32 M;  5KPZ A;  2G5G X;  1IN6 A;  2LVN C;  3GLG A;  2VQF M;  4G4R A;  4LF5 M;  3IG8 A;  2N35 A;  2ZAO A;  3KOX E;  3U60 B;  4L6V 6;  3HJS A;  2JA2 A;  4B7F A;  4S12 A;  4DBG B;  1Z59 A;  2ZBK B;  4D82 A;  1DO0 A;  4P16 A;  4EIW A;  1K3W A;  4FVM A;  1J09 A;  3K9O A;  5KO3 A;  2C5R A;  3B7N A;  4M9X A;  1F4I A;  5C1B A;  3W0F A;  2LVQ D;  1HJP A;  2KEB A;  1NVM A;  1SXJ A;  3VFD A;  3M0E A;  1VEJ A;  4OX9 M;  3GLI E;  2DI0 A;  3A45 A;  3J80 S;  2X8A A;  4GEW A;  2R6F A;  1IN7 A;  1R6B X;  4HLQ A;  3FYC A;  1XNQ M;  3JAM S;  4B3R M;  4LFB M;  2WZJ A;  2HL7 A;  4JYA M;  3IHP A;  4JI6 M;  2ZAM A;  4I81 A;  2KNA A;  4NSR A;  1D0K A;  2C96 A;  3ZCB B;  3FYD A;  2L7H A;  2X49 A;  1PM5 A;  3Q8X A;  3HX3 A;  2F5N A;  3GPX A;  4LY6 A;  5IWA M;  3GP1 A;  2DZO B;  3FUX A;  3T1Y M;  4K0K M;  4M0W A;  3TPZ A;  4Z6Y A;  1XXH B;  1TR8 A;  4LF9 M;  5ITQ A;  1IBL M;  1KYI A;  4WW0 A;  4DV2 M;  2Y21 A;  4GC9 A;  1YE9 A;  3FTD A;  2G8L A;  3EIH A;  1LTM A;  4FWG A;  2BNK A;  2LTU A;  2K6B A;  3I51 A;  2KW0 A;  2Z8Y M;  2H1R A;  3KDS E;  5C18 A;  3GLF E;  1QYR A;  2RRU A;  3HJ8 A;  2CHV A;  1IY1 A;  3D8L A;  3NBI A;  1VEG A;  4WUR A;  3AFH A;  5FLX S;  4OU7 A;  2XFT A;  2KXE A;  4OVZ B;  3C3D A;  2R0I A;  4A3V B;  3SBJ A;  2RGH A;  1IN8 A;  4LGY A;  2JNH A;  1HNX M;  1TH3 A;  1HT2 E;  1YSY A;  4R71 A;  1H6U A;  1MX0 A;  5FSW A;  4CIZ A;  5FTJ A;  2CV2 A;  1OQY A;  1T3T A;  4JI0 M;  1WJ7 A;  1OAI A;  4XK8 F;  1K3X A;  1IXR C;  4YHH M;  1N78 A;  2R4E A;  4Y28 F;  2ZTC A;  3T15 A;  1TF0 B;  2EKF A;  1IXZ A;  1EE8 A;  1QAN A;  1XHB A;  2MGW A;  2R45 A;  2WSF F;  3B74 A;  4IBG A;  2C9C A;  4LGM A;  1L1Z A;  1Q02 A;  1FNN A;  4Z8X A;  1JR3 E;  4HL4 A;  4NC6 A;  2CV1 A;  4GIT A;  1XXH E;  1GKI A;  3FUU A;  2NQ8 C;  3GPY A;  3R9X B;  1NV9 A;  2ZAN A;  2JZ1 A;  3U5Z A;  2FS1 A;  4I5S A;  4IJF A;  1L1T A;  1Q39 A;  4AKI A;  2HWJ A;  4LF6 M;  3CGW A;  2KRK A;  2CRU A;  2Q2E B;  2Z4S A;  1QUT A;  3ZC7 B;  4BBA A;  3PVS A;  3E4R A;  4QNM A;  1NY6 A;  3GLG B;  1OIP A;  4JN6 A;  1NSF A;  1VQ1 A;  2FOI C;  2RKO A;  5E26 A;  2UUC M;  4AG6 A;  2LH0 A;  2E5L M;  2I7P A;  3U6Q A;  1PJI A;  3GLH E;  3K8Z A;  3R8F A;  4X66 M;  4MM3 B;  3CF2 A;  5FTM A;  1R4G A;  1LV7 A;  1QZM A;  1UFZ A;  5KPT A;  4LJ7 A;  3THG A;  1SXJ B;  2DWZ B;  3DOA A;  3IEC A;  4GHA A;  3HHW A;  4B3T M;  2KNZ A;  3GQ3 A;  1PRB A;  4CJ6 A;  1T6O A;  4LG2 A;  4I4L A;  4F2L A;  3PNV A;  1IY2 A;  1PJQ A;  4DR6 M;  1I94 M;  3VKH A;  2QBY A;  4LFC M;  3KFU G;  2HKJ A;  3A46 A;  1GAB A;  3AOE C;  5E6J A;  1DO2 A;  4L15 A;  2DXI A;  2F5O A;  1N36 M;  4G6Z A;  4JI3 M;  2O01 F;  4RF0 A;  1NHW C;  3BBZ A;  4LRT A;  2V1C A;  3KOZ E;  1ORY B;  2CHG A;  2WSE F;  3FTE A;  3AL0 C;  2XFS A;  1QAM A;  2CHQ A;  4NRW A;  3GLG E;  4G3O A;  3SAV A;  4DV1 M;  4DR4 M;  2F5Q A;  4AKH A;  4PD2 A;  1I4W A;  3FUW A;  2GQF A;  1XNR M;  2OOB A;  4JV5 M;  2QP9 X;  3SYL A;  4JI2 M;  5FTN A;  4ANR A;  4CHT B;  4IBB A;  2L7I A;  2BJV A;  1E9R A;  1OTR A;  5LMU M;  2UUA M;  1WXQ A;  2J5Y A;  1NNJ A;  1SXJ E;  1L2B A;  4PDG A;  2KHH A;  1OKS A;  3AJI B;  2CE7 A;  4IBD A;  2R46 A;  3D8B A;  1E94 E;  3VK8 A;  1QZE A;  2DKL A;  5IZ7 D;  3HZJ A;  3GPP A;  1JB0 F;  2MR9 A;  1BVS A;  1DGB A;  2BWE A;  4AQY M;  1G3I A;  4ZPX A;  1GJT A;  2DWL A;  4LF4 M;  4AI6 A;  2RGO A;  3W68 A;  3MMP A;  4D80 A;  5KQ8 A;  5DYI A;  1DV0 A;  3QYE A;  5IRE B;  3U6C A;  1V33 A;  2LBC A;  3AOE A;  1WGL A;  3ILK A;  3L28 A;  4LJ5 A;  4AG5 A;  2R4J A;  4DR7 M;  1Z5C A;  2L09 A;  2QCU A;  3B7Q A;  5F3W A;  3FUV A;  1GL6 A;  4LJ9 A;  1OFH A;  3FE3 A;  3VK7 A;  4B08 A;  4IBJ A;  1QQW A;  2XGN A;  1WGN A;  3H4M A;  3KOY E;  4Q7J A;  3DA1 A;  3HJQ A;  1AIP C;  3RFW A;  3MK6 A;  4MH0 E;  4R3D A;  2J7N A;  5JI2 E;  3TWM A;  3U5Z B;  1L2D A;  2BWB A;  3LVW A;  4NL4 H;  3T1H M;  2UXD M;  1ZV1 A;  1IFY A;  3HU2 A;  3L29 A;  3K1J A;  1PJT A;  5EQT A;  3UMM A;  3HHX A;  2ZM6 M;  2YR0 A;  3ZH9 B;  1IBK M;  4DUZ M;  1PGY A;  5ITT A;  4G4O A;  1Q3C A;  3LCV B;  2B3T A;  2JY6 B;  2W82 A;  4D81 A;  3CTW B;  2Z3X A;  3U6L A;  2KZS A;  2R44 A;  3JR5 A;  3W0L B;  2A5Y B;  2DHR A;  3UGJ A;  1JR3 D;  1G59 A;  3GRU A;  2DHY A;  2VDB B;  3KOW E;  2FNA A;  3DFZ A;  4GIP A;  1E32 A;  4II7 A;  1D0M A;  3WHK A;  4X62 M;  4JXJ A;  3UJN A;  3WHL A;  1J7K A;  3NBX X;  3K2L A;  3SAU A;  4GC5 A;  3RGP A;  2H5X A;  4JI7 M;  2KA6 B;  5JI3 E;  4FCW A;  2QEN A;  1DGF A;  3GO8 A;  3FRH A;  4MGI E;  1TDZ A;  2QBY B;  3H4J A;  4AZF A;  2YFQ A;  2DNA A;  3I01 M;  3SMP A;  2JY8 A;  4GKJ M;  5EP1 A;  5A2Q S;  1OJL A;  2UXC M;  1NV8 A;  3LQR A; 
#chains in the Genus database with same CATH homology
 5GKN A;  1G4A E;  3GRR A;  4M0D A;  1N33 M;  3E9S A;  1HR0 M;  1G41 A;  1X37 A;  3AKZ A;  1DGH A;  4IBK A;  2KZU A;  3U6S A;  4ITQ A;  3PNY A;  4NSO B;  4M9S A;  2L6O A;  4LF7 M;  2FE8 A;  3GLF A;  3HWS A;  3U6E A;  1K82 A;  2XZF A;  4QHT A;  1TH4 A;  3HU1 A;  4JI5 M;  4G4N A;  4B7H A;  5IT9 S;  2AHM A;  2FFJ A;  2DWN A;  4DV3 M;  4KO8 A;  2LWX A;  2DZN B;  2M5Z A;  4FD2 A;  3I4Y A;  3SMS A;  4YY3 M;  4DR5 M;  2C98 A;  1OJL A;  1XC8 A;  3HHY A;  5DNY A;  3KXE C;  5ITU A;  1JR3 A;  4GKK M;  1JQJ C;  2OPF A;  4DV4 M;  2F4V M;  4DV0 M;  2K47 A;  4QHS A;  1VDD A;  3LQQ A;  1ZQ9 A;  4NXN M;  2CV0 A;  1N77 A;  4FW9 A;  3J81 S;  3SHF A;  5ITX A;  1N75 A;  3KVW A;  4QOS A;  3K92 A;  3FUT A;  4GMQ A;  4KLN A;  2P5T A;  2C9O A;  4AKG A;  1GLN A;  3NWL A;  4NOO B;  3HKP A;  2XLJ A;  3M7G A;  2V1U A;  1IQP A;  2VQE M;  4B3M M;  3GLH A;  3AV0 A;  1R2Y A;  2HHH M;  3U6D A;  4NRV A;  1SXJ C;  2D7E A;  4B3S M;  4RF1 A;  4G4Q A;  4LF8 M;  4MGY E;  4DV7 M;  1D2N A;  1L8Q A;  1NJF A;  1HT1 E;  4MB7 A;  1DGG A;  2V6Z M;  2Z7J A;  3C58 A;  3J7B A;  3RE8 A;  2J7O A;  3VLF B;  3EIE A;  5KPR A;  3PFI A;  3UZU A;  3KP0 E;  3L26 A;  3VKG A;  3PXG A;  1ZAE A;  3HHZ A;  3SAW A;  2XZU A;  1PJJ A;  3KS4 A;  5EXP A;  3UK6 A;  2ERC A;  3MHV C;  5EXS A;  3TE6 A;  1IN4 A;  2VII A;  1DGH B;  4DUY M;  3U6O A;  4GRI A;  3CF6 E;  5EP3 A;  2LNH C;  2XF3 A;  4IBC A;  3TWK A;  5EJC A;  1FJG M;  5FTL A;  3GLF B;  2XSZ D;  1QVR A;  4IIW A;  4PDI A;  4GH9 A;  4X64 M;  1Q3B A;  1YUB A;  3FTC A;  4BLC A;  2LXE A;  2Z4R A;  1J5E M;  3U6P A;  2R62 A;  4X65 M;  3FKE A;  4JI8 M;  3LMM A;  3BOS A;  1XMO M;  2EUC A;  3MJ5 A;  4KOD A;  1HQY E;  4MGH A;  1S3S A;  2R65 A;  4REZ A;  3QAU A;  1KSF X;  5KQD A;  3HU3 A;  1HQC A;  3VDU A;  4JI4 M;  2BJW A;  3GQ4 A;  4OW0 A;  1MU5 A;  3GLI A;  4W5W A;  3RGS A;  1N34 M;  2F5S A;  2XH9 A;  3OTO M;  4NXM M;  1GVN A;  3KS8 A;  3SAS A;  2HCB A;  3GPU A;  4LCB A;  3L27 A;  4DR1 M;  4LZJ A;  3L25 A;  2YQZ A;  2KRU A;  2Y0T A;  1Z6T A;  2M60 A;  1NNU C;  5ITY A;  4DV5 M;  2C99 A;  4DR3 M;  3A98 B;  1NJG A;  4LJ4 A;  4LZZ A;  4QOZ C;  1Z5A A;  3U61 A;  4IBE A;  1TDH A;  4FCV A;  3U60 A;  2R18 A;  3SAT A;  2DVW B;  3KW6 A;  4IJE A;  7CAT A;  4PT5 A;  2EA0 A;  3KSX A;  2D7G A;  1XMQ M;  3L2A A;  1E9S A;  1C1K A;  4CIS A;  3GLH B;  5LMN M;  3KSJ A;  1QAQ A;  4IBI A;  1IBM M;  2EO2 A;  3KP1 E;  5BR8 M;  4L4U A;  4LJA A;  4XGI A;  2DWM A;  1W5T A;  4FWD A;  4FWH A;  3HGI A;  2CEA A;  4MGZ E;  2Y0Q A;  3TWL A;  3SHG B;  2XSZ A;  4LJ8 A;  3J27 B;  2OQ4 A;  3B9P A;  4RNA A;  1QAO A;  5EP4 A;  4MGK E;  1XWI A;  5EXT A;  4DR2 M;  4BB9 A;  1IXS B;  1NHG C;  1UM8 A;  1G8P A;  3J2P B;  3CF0 A;  1L2C A;  3U6M A;  4GHL A;  3SYK A;  4L16 A;  5ITX E;  4LFA M;  3GQ5 A;  1XXH A;  5DYG A;  3SFZ A;  3SAR A;  4JI1 M;  1SXJ D;  4L78 A;  2UXB M;  3J7A S;  5H37 D;  3TL4 X;  8CAT A;  4DV6 M;  4FCT A;  3T38 A;  1R7R A;  4M9Z A;  3I4V A;  2QZ4 A;  3M6A A;  1Z5B A;  3VDP A;  2F5P A;  4OVZ A;  2XEP A;  1HNZ M;  5BPV A;  2CFO A;  4TUW A;  1TH2 A;  3SC3 A;  1R2Z A;  1W5S A;  1IY0 A;  1KFV A;  4LRS A;  1OFI A;  4IBF A;  2Y20 A;  1TGU A;  2UU9 M;  4XBO A;  4AW4 A;  1IN5 A;  4L8R C;  3GRV A;  3TQS A;  2O5R A;  4LJ6 A;  4R7G A;  3FD9 A;  2X4A A;  2QPA A;  3A42 A;  3GLI B;  5FTK A;  4I8O A;  1NY5 A;  4PCZ A;  1IM2 A;  5EXX A;  1GL7 A;  3GRY A;  2D7H A;  4CGY B;  4B7G A;  3FTF A;  2CUZ A;  5EP2 A;  2I7N A;  1HNW M;  5ITR A;  3LVV A;  2YNM D;  3QWL A;  3AOG A;  3IG5 A;  4QNR A;  3JR4 A;  3U61 B;  3DZD A;  1N32 M;  5KPZ A;  2G5G X;  1IN6 A;  2VQF M;  3GLG A;  4LF5 M;  4G4R A;  3IG8 A;  2ZAO A;  3KOX E;  3U60 B;  3HJS A;  2JA2 A;  4B7F A;  4S12 A;  1Z59 A;  2ZBK B;  4D82 A;  1DO0 A;  4P16 A;  4EIW A;  1K3W A;  4FVM A;  1J09 A;  5KO3 A;  2C5R A;  4M9X A;  5C1B A;  3W0F A;  2KEB A;  1NVM A;  1SXJ A;  3VFD A;  3M0E A;  4OX9 M;  3A45 A;  3J80 S;  2X8A A;  1IN7 A;  1R6B X;  4HLQ A;  3FYC A;  1XNQ M;  3JAM S;  4B3R M;  4LFB M;  2HL7 A;  4JYA M;  4JI6 M;  2ZAM A;  4I81 A;  4NSR A;  2C96 A;  3ZCB B;  3FYD A;  2L7H A;  2X49 A;  1PM5 A;  3Q8X A;  2F5N A;  3GPX A;  4LY6 A;  5IWA M;  3GP1 A;  2DZO B;  3FUX A;  3T1Y M;  4K0K M;  4M0W A;  3TPZ A;  4Z6Y A;  1XXH B;  4LF9 M;  5ITQ A;  1IBL M;  1KYI A;  4WW0 A;  4DV2 M;  2Y21 A;  4GC9 A;  1YE9 A;  3FTD A;  2G8L A;  3EIH A;  4FWG A;  2BNK A;  3I51 A;  2KW0 A;  3KDS E;  2H1R A;  5C18 A;  1QYR A;  3HJ8 A;  2CHV A;  1IY1 A;  3D8L A;  3NBI A;  4WUR A;  3AFH A;  5FLX S;  4OU7 A;  2XFT A;  2KXE A;  4OVZ B;  4A3V B;  2UUB M;  3SBJ A;  1HNX M;  2RGH A;  1IN8 A;  4LGY A;  1TH3 A;  1HT2 E;  1YSY A;  1H6U A;  1MX0 A;  5FSW A;  5FTJ A;  2CV2 A;  1T3T A;  4JI0 M;  1K3X A;  1IXR C;  4YHH M;  1N78 A;  2R4E A;  3T15 A;  1IXZ A;  1EE8 A;  1QAN A;  1XHB A;  2R45 A;  4KHP M;  4IBG A;  1L1Z A;  2C9C A;  4LGM A;  1FNN A;  4Z8X A;  4HL4 A;  2CV1 A;  4GIT A;  1GKI A;  3FUU A;  2NQ8 C;  3GPY A;  3R9X B;  2ZAN A;  3U5Z A;  4I5S A;  4IJF A;  1L1T A;  1Q39 A;  4AKI A;  4LF6 M;  2KRK A;  2Q2E B;  2Z4S A;  3ZC7 B;  4BBA A;  3PVS A;  3E4R A;  4QNM A;  1NY6 A;  3GLG B;  4JN6 A;  1NSF A;  2FOI C;  2RKO A;  5E26 A;  2UUC M;  4AG6 A;  2LH0 A;  2E5L M;  2I7P A;  3U6Q A;  1PJI A;  3K8Z A;  3R8F A;  4X66 M;  4MM3 B;  3CF2 A;  5FTM A;  1LV7 A;  1QZM A;  5KPT A;  4LJ7 A;  3THG A;  1SXJ B;  2DWZ B;  3DOA A;  4GHA A;  3HHW A;  4B3T M;  3GQ3 A;  4LG2 A;  4I4L A;  3PNV A;  1IY2 A;  4DR6 M;  1I94 M;  3VKH A;  2QBY A;  4LFC M;  3KFU G;  2HKJ A;  3A46 A;  3AOE C;  5E6J A;  1DO2 A;  4L15 A;  2DXI A;  2F5O A;  1N36 M;  4G6Z A;  4JI3 M;  4RF0 A;  1NHW C;  4LRT A;  3AL0 C;  2V1C A;  3KOZ E;  1ORY B;  2CHG A;  3FTE A;  2XFS A;  1QAM A;  2CHQ A;  4NRW A;  3SAV A;  4DV1 M;  4DR4 M;  2F5Q A;  4AKH A;  4PD2 A;  1I4W A;  3FUW A;  1XNR M;  4JV5 M;  2QP9 X;  3SYL A;  4JI2 M;  5FTN A;  4CHT B;  4IBB A;  2L7I A;  2BJV A;  1E9R A;  5LMU M;  2UUA M;  1WXQ A;  1NNJ A;  1SXJ E;  1L2B A;  4PDG A;  3AJI B;  2CE7 A;  4IBD A;  2R46 A;  3D8B A;  1E94 E;  3VK8 A;  5IZ7 D;  3GPP A;  1DGB A;  4AQY M;  4AI6 A;  1G3I A;  4ZPX A;  2DWL A;  4LF4 M;  2RGO A;  4D80 A;  5KQ8 A;  5DYI A;  5IRE B;  3U6C A;  3AOE A;  3L28 A;  3ILK A;  4LJ5 A;  4AG5 A;  2R4J A;  4DR7 M;  1Z5C A;  2L09 A;  2QCU A;  5F3W A;  3FUV A;  1GL6 A;  4LJ9 A;  1OFH A;  3VK7 A;  4B08 A;  4IBJ A;  1QQW A;  2XGN A;  3H4M A;  3KOY E;  3DA1 A;  3HJQ A;  3RFW A;  3MK6 A;  4MH0 E;  4R3D A;  2J7N A;  5JI2 E;  3TWM A;  3U5Z B;  1L2D A;  3LVW A;  4NL4 H;  3T1H M;  2UXD M;  3HU2 A;  3L29 A;  3K1J A;  5EQT A;  3UMM A;  2ZM6 M;  3HHX A;  2YR0 A;  3ZH9 B;  1IBK M;  4DUZ M;  5ITT A;  4G4O A;  1Q3C A;  2W82 A;  4D81 A;  3CTW B;  2Z3X A;  3U6L A;  2KZS A;  3JR5 A;  3W0L B;  2A5Y B;  2DHR A;  3UGJ A;  1JR3 D;  1G59 A;  3GRU A;  3KOW E;  3DFZ A;  4GIP A;  1E32 A;  4II7 A;  3WHK A;  4X62 M;  4JXJ A;  3UJN A;  3WHL A;  1J7K A;  3SAU A;  3K2L A;  4GC5 A;  3RGP A;  4JI7 M;  2KA6 B;  5JI3 E;  4FCW A;  2QEN A;  1DGF A;  3GO8 A;  4MGI E;  1TDZ A;  2QBY B;  4AZF A;  2YFQ A;  3SMP A;  4GKJ M;  5EP1 A;  5A2Q S;  2FNA A;  2UXC M;  3LQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...