3A46A

Crystal structure of mvnei1/thf complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 84
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a46A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a46A01
4JI5M 4B3SM 4LFAM 4JI2M 3GQ5A 1XNQM 4DR6M 1TDHA 1L2DA 4B3MM 4LF4M 5A2QS 4CISA 4LF6M 2HKJA 4LF8M 4NRWA 4NXMM 2F5OA 2ZM6M 3U6QA 4PCZA 3GPPA 1NNJA 1PJJA 1HNWM 4G4OA 4MB7A 3J80S 4JI3M 1XNRM 1Q3BA 3GQ3A 4AQYM 3SAVA 3GP1A 5ITRA 4JI0M 3TWMA 2UXCM 4DV0M 1XMQM 4DR2M 1TDZA 4LF9M 1K82A 1HNXM 1EE8A 4YHHM 2F5NA 3SARA 3U6EA 3J7AS 5ITXA 3GO8A 3SASA 3TWKA 4ITQA 1I94M 4B3RM 3U6LA 1R2YA 4X66M 3OTOM 4LF7M 4GKJM 3U6CA 1IBKM 2VQEM 4JI7M 3GQ4A 1L2CA 2HHHM 2F4VM 4X65M 4DR1M 2XZFA 4OX9M 4DR7M 4PD2A 3SATA 5LMNM 4G4RA 1Z5BA 2OPFA 4DV6M 3U6PA 4B3TM 1Q3CA 2XZUA 3JR5A 1XC8A 1Z59A 4DUZM 1IBMM 3U6OA 3J81S 1PM5A 2F5PA 3A45A 5ITTA 3U6MA 5ITYA 4LF5M 1FJGM 1Q39A 4NXNM 5ITQA 5ITXE 1L2BA 4DV7M 1K3XA 4JV5M 3SAWA 3SBJA 4G4QA 4JI8M 4X62M 3VK7A 3GPYA 4DV5M 4LFCM 4JYAM 5BR8M 1Z5CA 1Z5AA 3GPXA 5LMUM 1KFVA 2EA0A 1N32M 3JAMS 3W0FA 2E5LM 4PDGA 4KHPM 4DV3M 4DV4M 4DUYM 2UXBM 1L1ZA 4JI1M 5IWAM 2UU9M 3T1HM 4DR4M 1N33M 1R2ZA 1N36M 4PDIA 2F5QA 3GPUA 2UXDM 5FLXS 4DV2M 5ITUA 3C58A 1K3WA 3U6DA 4X64M 1HNZM 1IBLM 2VQFM 3U6SA 2OQ4A 3TWLA 2UUBM 2UUCM 4K0KM 4DV1M 2F5SA 4LFBM 1HR0M 4GKKM 4DR3M 3DOAA 4NRVA 3T1YM 2ZBKB 3VK8A 4JI4M 1MU5A 4DR5M 1PJIA 2Q2EB 1L1TA 3JR4A 3A46A 2UUAM 1XMOM 5IT9S 1MX0A 4G4NA 1J5EM 3A42A 4YY3M 1N34M 3SAUA 4JI6M
chains in the Genus database with same CATH superfamily
4I5SA 3TPZA 4JI2M 2LVOC 1WGLA 3FRIA 3K2LA 1NHGC 1XNQM 4FWHA 1X37A 4G6ZA 4LF4M 3SYKA 3LVVA 2C99A 5A2QS 3QAUA 2Y21A 2DXIA 2ZANA 2DNAA 3GLGE 4XK8F 2DWMA 2YR0A 2L2DA 3U6QA 4PCZA 1SXJD 1G71A 3W68A 1DO0A 1NNUC 2WSEF 4IJEA 4G4OA 1TTEA 4KLNA 3U61B 1XNRM 4KODA 2C5RA 1D0KA 1E9SA 3HZJA 2CWBA 1QUSA 1VDDA 5DNYA 1VDLA 2KRKA 2LH0A 3NWLA 4BLCA 1N78A 3VKGA 4UN2B 4Y28F 4FCTA 2UXCM 4DV0M 3L25A 3SARA 3MK6A 4YHHM 2XFTA 5FTKA 1WXQA 3U6EA 3J7BA 2DAMA 4F1IA 1NVMA 4CJ6A 5EXXA 4MGIE 4M0DA 1IBKM 4JI7M 2DVWB 1JB0F 2ZTDA 4B08A 1QUTA 2DAKA 3SYLA 4GH9A 4Q7JA 4G4RA 2OPFA 2Y0TA 3PFIA 3HKPA 2XZUA 1ZMWA 1C1KA 1OFIA 2F5PA 1S3SA 4LJ7A 2LNHC 2DAEA 2I7NA 3T15A 5ITYA 5FTMA 1NV8A 2DENA 3V76A 1Q39A 1JR3D 3ILKA 3HJ8A 5KPRA 3FUUA 2GQFA 4B7GA 3BXWA 3C9PA 5FTLA 4FCVA 3KDSE 1IY0A 1K3XA 4JV5M 3T38A 4LZZA 4G4QA 5FTJA 1DO2A 4JI8M 4CGYB 1GL7A 1P3QQ 2CP8A 1YLAA 3KOYE 4IBJA 1HT1E 4AW4A 1VEKA 3EIEA 2QCUA 1IN4A 4LFCM 1Z5AA 2ZAMA 4DBGB 2W82A 2OO9A 2QENA 3JAMS 3W0FA 2E5LM 4IBGA 4GRIA 3GLHE 4PDGA 3GLFA 4DV3M 3Q8XA 1GL6A 3QYBA 2HL7A 1HQCA 1TH3A 5DYIA 2UXBM 3L2AA 2H5XA 5JI2E 2LWXA 1TGUA 5C1BA 4AKGA 3FKEA 2F5QA 3HJQA 7CATA 2UXDM 5FLXS 2DWNA 4XBOA 4L4UA 3FD9A 4BBAA 2JNHA 3U6DA 4D80A 2L7HA 4NL4H 4A3VB 2J5YA 3U6SA 2OQ4A 4IBFA 4NC6A 2UUCM 5E26A 5GKNA 4I8OA 1HR0M 4GKKM 4AKIA 1CUKA 3K1JA 2LHGA 2RGOA 1D0MA 1DGBA 3ZH9B 3VK8A 4JI4M 2N35A 3TQSA 2K47A 3SMPA 1V92A 4IBDA 3JR4A 1G59A 1OFHA 1ZMUA 1F4IA 4NSOB 3BBZA 3FYCA 2KEBA 3IG5A 3RE8A 2H1RA 1PJTA 3PNYA 4AG6A 3L26A 1HJPA 4YY3M 2QHOB 2Z3XA 3SAUA 1BVSA 1IQPA 3RGSA 2D7EA 1QQWA 2FH0A 1IXSA 2DI0A 2WSFF 3KOZE 3W0LB 2K0BX 4B3MM 1L8QA 1UM8A 3AOGA 4GC5A 2CE7A 4L8RC 4Z8XA 1E32A 3GRVA 4LF8M 1IFYA 3J27B 3WHKA 1WHCA 1SXJB 2CRUA 4NXMM 2ZM6M 4LJ9A 3SHGB 2JZ1A 3UMMA 4GHAA 4CHTB 2R6FA 1HNWM 2CV0A 4II7A 3HJSA 4MB7A 3DFZA 3U5ZB 3SC3A 4LGMA 4AQYM 4OVZA 3GP1A 1EFUB 2QSFX 2XGNA 3RGPA 2DKLA 2JY7A 2KXEA 1OIPA 4LRSA 4RNAA 1OJLA 1XXHE 1HT2E 2LVNC 2EKFA 1TDZA 4LF9M 1TF0B 4L16A 5EXTA 2R4JA 1IN8A 3AKZA 1GJSA 3FTDA 1Q02A 3FYDA 1DGHB 3MMPA 4IBBA 1I94M 2CUZA 4X66M 3OTOM 1Y8GA 4D82A 2MROB 3U6CA 3UJNA 3GQ4A 5EP1A 2XZFA 4OX9M 2J7NA 1XXHB 1R6BX 2G5GX 3T6PA 3SMSA 5LMNM 1YSYA 2QZ4A 4REZA 3GLHA 2QPAA 1Q3CA 4FD2A 3JR5A 1JQJC 2L7IA 1Z59A 2O25A 1GO5A 1QDTA 2KZSA 2M60A 2V1CA 1GABA 2HCBA 3A45A 3FTCA 2G3QA 4LF5M 1FJGM 3Q8GA 4R3DA 1WGNA 4CIZA 3CF0A 3AL0C 4DV7M 4WURA 1V34A 1R4GA 3HHYA 3HHWA 4RF0A 4X62M 4LJ5A 2DZOB 4R7GA 3VK7A 4DV5M 2WZJA 1GJTA 3TE6A 4JYAM 3GPXA 1IN5A 1WJ7A 2VF7A 4GEWA 1N32M 3KP0E 4KHPM 1G8PA 4DV4M 2R65A 2AHMA 5EP2A 1ZAEA 3GLIB 1L1ZA 2CEAA 3KP1E 3H4MA 2FS1A 3TL4X 2UU9M 1NY5A 1N36M 3KSXA 2O01F 3CTWB 3M0EA 3HY5A 3SFZA 2XH9A 1RU3A 2KRUA 5ITUA 4DV2M 3I4VA 1N75A 1K3WA 1EIJA 2X8AA 1IN6A 1XHBA 1WIVA 3ZCBB 2R46A 3HGIA 4G3OA 4GMQA 3FUXA 2UUBM 2L4FA 4LFBM 3LMMA 1DGGA 2R4EA 4AG5A 2K9DA 3T1YM 1VQ1A 1QANA 3VFDA 3ZC7B 1ZV1A 1MU5A 1E94E 2L4EA 1T6OA 2C96A 3HHXA 2Q2EB 1G41A 1IXZA 2BNKA 2X49A 4NSRA 5E6JA 2DWLA 1XMOM 3CF6E 2JWSA 1IM2A 5IT9S 1MX0A 1AIPC 1IY1A 1UFZA 3KSJA 4FWGA 4GIPA 4RKUF 4G4NA 1J5EM 1MJGM 3FTEA 1W5TA 3K92A 1PGYA 4JI5M 1QVRA 1FNNA 2BJVA 3LCVB 5EJCA 2DHRA 2QBYB 3K9OA 3FRHA 1D0LA 3L29A 1TDHA 1YUBA 2XF3A 3FUTA 3LQRA 4LCBA 2O5RA 3B7NA 3U61A 4CISA 4LF6M 3AJIB 5DFLA 2MH8A 2Z4SA 2CFOA 2JY8A 5EP3A 3HU1A 3GLGA 2F5OA 2YNMD 4NRWA 1OKSA 4R71A 3GPPA 1H6UA 2XSZD 2R0IA 2R18A 3K8ZA 1W5SA 1PJJA 1NNJA 2APLA 3UK6A 2JUJA 4JI3M 3I01M 1Q3BA 2LVPC 4IIWA 1IY2A 2RRUA 4IBIA 2JA2A 4KT0F 3GQ3A 1I4WA 3SAVA 5ITRA 4LJ6A 4MGHA 2LVQD 3AFHA 3SHFA 2FNAA 1QAQA 3TWMA 1OAIA 4DR2M 1SXJE 1TH4A 2XFSA 4GHLA 1EE8A 2A5YB 3B7QA 1C7YA 2XSZA 2F5NA 3NBXX 3J7AS 2OOBA 2M5ZA 2JP7A 2NQ8C 3I51A 4LJAA 3VDUA 3SASA 3UZUA 2MR9A 4B3RM 3VDPA 3F92A 3U6LA 1J09A 2LHCA 5KQDA 4LF7M 4GKJM 2F4VM 2VQEM 2C9CA 1L2CA 2HHHM 2CHQA 1KYIA 2R44A 2KNZA 4LY6A 4DR7M 4PD2A 1KSFX 2EO2A 1Z5BA 2JY6B 3M7GA 4DV6M 2LXEA 2KNAA 3U6PA 4B3TM 4QOSA 3C3EA 4IJFA 8CATA 2BJWA 4DUZM 1IBMM 3U6OA 1PM5A 3ZQJA 1PJSA 2QNJA 1DGFA 2X4AA 3GRRA 3MHVC 4LZJA 5BPVA 5DYGA 1V33A 4Z6YA 1QDRA 2XLJA 2CHGA 4F2LA 1NJFA 2BWEA 3IECA 5ITXE 2CV2A 4L15A 3SAWA 3U60A 4IBCA 1G3IA 4M9XA 2Z7JA 4RF1A 3AOEA 2K6BA 4B7FA 2YQZA 4LJ8A 1ZMVA 4QNMA 3R9XB 4L6V6 4P16A 4MGYE 2P5TA 2HAKA 1G4AE 3KW6A 1Z5CA 4M9SA 5LMUM 1JR3E 1N77A 3RFWA 3GLFE 2EA0A 2V1UA 1QZEA 3L27A 4LGYA 3VKHA 2EJSA 2OOAA 4QOZC 1NHWC 2QQ8A 4FCWA 2B3TA 4LRTA 4JI1M 3H4JA 5IREB 1D2NA 2XEPA 4PDIA 2C98A 1QZMA 4AKHA 2ZTCA 5KO3A 3GLFB 3C58A 2FOIC 2RGHA 2GNOA 1HNZM 3J2PB 1XWIA 1IBLM 1R5LA 2DHYA 2JXNA 3B9PA 4JN6A 4S12A 1OAOC 3BOSA 4EIWA 5KPTA 3LW5F 2VQFM 3LCUA 3TWLA 4B7HA 3GLIE 4DV1M 1DV0A 5F3WA 2I7PA 1GKIA 1HQYE 1NSFA 3NBIA 4BB9A 2ZBKB 3R8FA 3UGJA 2VF8A 3D8LA 4OW0A 1MN3A 4DR5M 3KXEC 2UUAM 2FFJA 4ANRA 2KW0A 1NJGA 3GLGB 2MJ5B 3KOXE 1GVNA 4WW0A 2QP9X 3A42A 2FE8A 2ERCA 2CV1A 1SXJA 3PVSA 3FTFA 2JY5A 4B3SM 2Z4RA 3FUVA 4LFAM 5JI3E 3GQ5A 1AUAA 4DR6M 5FSWA 3M6AA 1L2DA 1GLNA 2LTUA 1IXRC 3U5ZA 1Z6TA 1XB2B 2C9OA 3GRUA 2HKJA 5IZ7D 1WR1B 2L09A 5C18A 3DA1A 3KOWE 1A5TA 4GITA 1IXSB 5EP4A 1NY6A 3HHZA 3W67A 3J80S 2V6ZM 4QNRA 1QAMA 3I04M 1VEGA 4NOOB 4QHTA 1J7KA 1DGHA 2JZ0A 3HWSA 5FTNA 3AOEC 4JI0M 3FUWA 3B89A 1XMQM 2Z8YM 3K9PA 1K82A 1XXHA 1HNXM 3KS4A 2DAGA 3HU3A 3L28A 5ITXA 3GO8A 4MGKE 3TWKA 4IBKA 4ITQA 3IG8A 3HX3A 3IHPA 4OVZB 2WSCF 3E46A 1R2YA 2BWBA 3PNVA 4MH0E 1PRBA 4M9ZA 4X65M 4DR1M 1VG5A 2L6OA 5EQTA 1JR3A 3A98B 4D81A 3FE3A 3E4RA 3SATA 2LVAA 5H37D 3U60B 5L8RF 3I4YA 1XC8A 3HU2A 1LTMA 4PT5A 4ZPXA 2DZNB 3J81S 1NV9A 4L78A 4HL4A 2J7OA 5ITTA 3C3DA 3U6MA 2Y0QA 4M0WA 1QYRA 2R45A 3GLHB 3LQQA 1E9RA 4LJ4A 4NXNM 4AI6A 5ITQA 2KA6B 1L2BA 3B7ZA 1LV7A 3SBJA 4TUWA 5EXPA 3GLIA 4LG2A 4GC9A 4MM3B 3GPYA 3MJ5A 2DWZB 1QAOA 3KS8A 3D8BA 5BR8M 1KFVA 1TR8A 4XGIA 5KPZA 4I4LA 5EXSA 3AV0A 1TH2A 4HEOA 4MGZE 1SXJC 2KDLA 3QWLA 4P17A 4AZFA 4DUYM 1NO1A 2KNVA 5IWAM 3T1HM 4OU7A 4DR4M 1R2ZA 1N33M 2DZLA 3PXGA 3GPUA 2KZUA 4FVMA 1R7RA 4FW9A 3QYEA 2R62A 4WP2A 1ZQ9A 3LVWA 2VDBB 2D7HA 2DAIA 2Y20A 1OIZA 2G8LA 3GRYA 1ORYB 4I81A 4X64M 2KHHA 3EIHA 1IN7A 1YE9A 4K0KM 2LBCA 2F5SA 3WHLA 4W5WA 3KFUG 2VIIA 4JXJA 1T3TA 3DOAA 4NRVA 4DR3M 2D7GA 3CGWA 1VEJA 2HWJA 4IBEA 2EUCA 3B74A 4QHSA 2RKOA 1PJIA 1L1TA 3CF2A 3A46A 2EKKA 4KO8A 3THGA 1T43A 2YFQA 4HLQA 1OQYA 3VLFB 2QBYA 2CHVA 3E9SA 3E21A 3KVWA 4FWDA 1SG9A 2ZAOA 1OTRA 1PJQA 5KQ8A 1N34M 3DZDA 2MGWA 4JI6M
chains in the Genus database with same CATH topology
4I5SA 3TPZA 4JI2M 3K2LA 1NHGC 1XNQM 4FWHA 1X37A 4G6ZA 4LF4M 3SYKA 3LVVA 2C99A 5A2QS 3QAUA 2Y21A 2DXIA 2ZANA 2DWMA 2YR0A 3U6QA 4PCZA 1SXJD 1DO0A 1NNUC 4IJEA 4G4OA 4KLNA 3U61B 1XNRM 4KODA 2C5RA 1E9SA 1VDDA 5DNYA 2KRKA 2LH0A 3NWLA 4BLCA 1N78A 3VKGA 4FCTA 2UXCM 4DV0M 3L25A 3SARA 3MK6A 4YHHM 2XFTA 5FTKA 1WXQA 3U6EA 3J7BA 1NVMA 5EXXA 4MGIE 4M0DA 1IBKM 4JI7M 2DVWB 4B08A 3SYLA 4GH9A 4G4RA 2OPFA 2Y0TA 3PFIA 3HKPA 2XZUA 1C1KA 1OFIA 2F5PA 1S3SA 4LJ7A 2LNHC 2I7NA 3T15A 5ITYA 5FTMA 1Q39A 1JR3D 3ILKA 3HJ8A 5KPRA 3FUUA 4B7GA 5FTLA 4FCVA 3KDSE 1IY0A 1K3XA 4JV5M 3T38A 4LZZA 4G4QA 5FTJA 1DO2A 4JI8M 4CGYB 1GL7A 3KOYE 4IBJA 4AW4A 1HT1E 3EIEA 2QCUA 1IN4A 4LFCM 1Z5AA 2ZAMA 2W82A 2QENA 3JAMS 3W0FA 2E5LM 4IBGA 4GRIA 4PDGA 3GLFA 4DV3M 3Q8XA 1GL6A 2HL7A 1HQCA 1TH3A 5DYIA 2UXBM 3L2AA 5JI2E 2LWXA 1TGUA 5C1BA 4AKGA 3FKEA 2F5QA 3HJQA 7CATA 2UXDM 5FLXS 2DWNA 4XBOA 4L4UA 3FD9A 4BBAA 3U6DA 4D80A 2L7HA 4NL4H 4A3VB 3U6SA 2OQ4A 4IBFA 2UUCM 5E26A 5GKNA 4I8OA 1HR0M 4GKKM 4AKIA 3K1JA 2RGOA 1DGBA 3ZH9B 3VK8A 4JI4M 3TQSA 2K47A 3SMPA 4IBDA 3JR4A 1G59A 1OFHA 4NSOB 3IG5A 3FYCA 2KEBA 3RE8A 2H1RA 3PNYA 4AG6A 3L26A 4YY3M 2Z3XA 3SAUA 3RGSA 1IQPA 2D7EA 1QQWA 3KOZE 3W0LB 4B3MM 1L8QA 1UM8A 3AOGA 4GC5A 2CE7A 4L8RC 4Z8XA 1E32A 3GRVA 4LF8M 3J27B 3WHKA 1SXJB 4NXMM 2ZM6M 4LJ9A 3SHGB 3UMMA 4GHAA 4CHTB 1HNWM 2CV0A 4II7A 3HJSA 4MB7A 3DFZA 3U5ZB 3SC3A 4LGMA 4AQYM 4OVZA 3GP1A 2XGNA 3RGPA 2KXEA 4LRSA 4RNAA 1OJLA 1HT2E 1TDZA 4LF9M 4L16A 5EXTA 2R4JA 1IN8A 3AKZA 3FTDA 1I94M 3FYDA 1DGHB 4IBBA 2CUZA 4X66M 3OTOM 4D82A 3U6CA 3UJNA 3GQ4A 5EP1A 2XZFA 4OX9M 2J7NA 1XXHB 1R6BX 2G5GX 3SMSA 5LMNM 1YSYA 2QZ4A 4REZA 3GLHA 2QPAA 1Q3CA 4FD2A 3JR5A 1JQJC 2L7IA 1Z59A 2KZSA 2M60A 2V1CA 2HCBA 3A45A 3FTCA 4LF5M 1FJGM 4R3DA 3CF0A 3AL0C 4DV7M 4WURA 3HHYA 3HHWA 4RF0A 4X62M 4LJ5A 2DZOB 4R7GA 3VK7A 4DV5M 3TE6A 4JYAM 3GPXA 1IN5A 1N32M 3KP0E 4KHPM 1G8PA 4DV4M 2R65A 2AHMA 5EP2A 1ZAEA 3GLIB 1L1ZA 2CEAA 3KP1E 3H4MA 3TL4X 2UU9M 1NY5A 1N36M 3KSXA 3CTWB 3M0EA 3SFZA 2XH9A 4DV2M 2KRUA 5ITUA 3I4VA 1N75A 1K3WA 2X8AA 1IN6A 1XHBA 3ZCBB 2R46A 3HGIA 4GMQA 3FUXA 2UUBM 4LFBM 3LMMA 1DGGA 2R4EA 4AG5A 3T1YM 1QANA 3VFDA 3ZC7B 1MU5A 1E94E 2C96A 3HHXA 2Q2EB 1G41A 1IXZA 2BNKA 2X49A 4NSRA 5E6JA 2DWLA 1XMOM 3CF6E 1IM2A 5IT9S 1MX0A 1IY1A 4G4NA 3KSJA 4FWGA 4GIPA 1J5EM 3FTEA 1W5TA 3K92A 4JI5M 1QVRA 1FNNA 2BJVA 5EJCA 2DHRA 2QBYB 3L29A 1TDHA 1YUBA 2XF3A 3FUTA 3LQRA 4LCBA 2O5RA 3U61A 4CISA 4LF6M 3AJIB 2Z4SA 2CFOA 5EP3A 3GLGA 3HU1A 4NRWA 2F5OA 2YNMD 3GPPA 1H6UA 2XSZD 2R18A 3K8ZA 1PJJA 1W5SA 1NNJA 3UK6A 4JI3M 4IIWA 1Q3BA 1IY2A 4IBIA 3GQ3A 2JA2A 1I4WA 3SAVA 5ITRA 4LJ6A 4MGHA 3AFHA 3SHFA 2FNAA 1QAQA 3TWMA 4DR2M 1SXJE 1TH4A 2XFSA 4GHLA 1EE8A 2A5YB 2F5NA 2XSZA 3J7AS 2M5ZA 2NQ8C 3I51A 3VDUA 4LJAA 3SASA 3UZUA 4B3RM 3VDPA 3U6LA 1J09A 5KQDA 4LF7M 4GKJM 2F4VM 2VQEM 2C9CA 1L2CA 2HHHM 2CHQA 1KYIA 4LY6A 4DR7M 4PD2A 1KSFX 2EO2A 1Z5BA 3M7GA 4DV6M 2LXEA 3U6PA 4B3TM 4QOSA 4IJFA 8CATA 2BJWA 4DUZM 1IBMM 3U6OA 1PM5A 2X4AA 3MHVC 1DGFA 3GRRA 4LZJA 5BPVA 5DYGA 4Z6YA 2XLJA 2CHGA 1NJFA 5ITXE 2CV2A 4L15A 3SAWA 3U60A 4IBCA 1G3IA 4M9XA 2Z7JA 4RF1A 3AOEA 4B7FA 2YQZA 4LJ8A 4QNMA 3R9XB 4P16A 4MGYE 2P5TA 3KW6A 1G4AE 4M9SA 1Z5CA 1N77A 5LMUM 3RFWA 2EA0A 2V1UA 3L27A 4LGYA 3VKHA 4QOZC 1NHWC 4FCWA 4LRTA 4JI1M 5IREB 1D2NA 2XEPA 4PDIA 2C98A 1QZMA 4AKHA 3GLFB 3C58A 2FOIC 2RGHA 1HNZM 3J2PB 1XWIA 1IBLM 3B9PA 4S12A 4JN6A 5KO3A 2VQFM 3BOSA 4EIWA 5KPTA 4AI6A 3TWLA 4B7HA 4DV1M 5F3WA 2I7PA 1GKIA 1HQYE 1NSFA 3NBIA 4BB9A 2ZBKB 3R8FA 3UGJA 3D8LA 4OW0A 4DR5M 3KXEC 2UUAM 2FFJA 1NJGA 2KW0A 3GLGB 3KOXE 1GVNA 4WW0A 2QP9X 3A42A 2FE8A 2ERCA 2CV1A 1SXJA 3PVSA 3FTFA 4B3SM 2Z4RA 3FUVA 4LFAM 5JI3E 3GQ5A 4DR6M 5FSWA 3M6AA 1L2DA 1GLNA 1IXRC 3U5ZA 1Z6TA 2C9OA 3GRUA 5IZ7D 2HKJA 2L09A 5C18A 3DA1A 3KOWE 4GITA 1IXSB 5EP4A 1NY6A 3HHZA 3J80S 2V6ZM 4QNRA 1QAMA 4NOOB 4QHTA 1J7KA 1DGHA 3HWSA 5FTNA 3AOEC 4JI0M 3FUWA 1XMQM 1K82A 1XXHA 1HNXM 3KS4A 3HU3A 3L28A 5ITXA 3GO8A 4MGKE 3TWKA 4IBKA 4ITQA 3IG8A 4OVZB 1R2YA 4MH0E 3PNVA 4M9ZA 4X65M 4DR1M 2L6OA 5EQTA 1JR3A 3A98B 4D81A 3SATA 3E4RA 5H37D 3U60B 3I4YA 1XC8A 3HU2A 4PT5A 4ZPXA 2DZNB 3J81S 4L78A 4HL4A 2J7OA 5ITTA 3U6MA 2Y0QA 4M0WA 1QYRA 2R45A 3GLHB 3LQQA 1E9RA 4LJ4A 4NXNM 5ITQA 2KA6B 1L2BA 1LV7A 3SBJA 4TUWA 5EXPA 3GLIA 4LG2A 4GC9A 4MM3B 3GPYA 3MJ5A 2DWZB 1QAOA 3KS8A 3D8BA 5BR8M 1KFVA 4XGIA 5KPZA 4I4LA 5EXSA 3AV0A 1TH2A 4MGZE 1SXJC 3QWLA 4DUYM 4AZFA 5IWAM 3T1HM 4OU7A 4DR4M 1R2ZA 1N33M 3PXGA 3GPUA 2KZUA 4FVMA 1R7RA 4FW9A 2R62A 1ZQ9A 3LVWA 3GRYA 2D7HA 2Y20A 4X64M 2G8LA 4I81A 1ORYB 3EIHA 1IN7A 1YE9A 4K0KM 2F5SA 3WHLA 4W5WA 3KFUG 2VIIA 4JXJA 1T3TA 3DOAA 4NRVA 4DR3M 2D7GA 4IBEA 2EUCA 4QHSA 2RKOA 1PJIA 1L1TA 3CF2A 3A46A 4KO8A 3THGA 2YFQA 4HLQA 3VLFB 2QBYA 3E9SA 2CHVA 3KVWA 4FWDA 2ZAOA 1N34M 5KQ8A 3DZDA 4JI6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 M;  4B3S M;  4LFA M;  4JI2 M;  3GQ5 A;  1XNQ M;  4DR6 M;  1TDH A;  1L2D A;  4B3M M;  4LF4 M;  5A2Q S;  4CIS A;  4LF6 M;  2HKJ A;  4LF8 M;  4NRW A;  4NXM M;  2F5O A;  2ZM6 M;  3U6Q A;  4PCZ A;  3GPP A;  1NNJ A;  1PJJ A;  1HNW M;  4G4O A;  4MB7 A;  3J80 S;  4JI3 M;  1XNR M;  1Q3B A;  3GQ3 A;  4AQY M;  3SAV A;  3GP1 A;  5ITR A;  4JI0 M;  3TWM A;  2UXC M;  4DV0 M;  1XMQ M;  4DR2 M;  1TDZ A;  4LF9 M;  1K82 A;  1HNX M;  1EE8 A;  4YHH M;  2F5N A;  3SAR A;  3U6E A;  3J7A S;  5ITX A;  3GO8 A;  3SAS A;  3TWK A;  4ITQ A;  1I94 M;  4B3R M;  3U6L A;  1R2Y A;  4X66 M;  3OTO M;  4LF7 M;  4GKJ M;  3U6C A;  1IBK M;  2VQE M;  4JI7 M;  3GQ4 A;  1L2C A;  2HHH M;  2F4V M;  4X65 M;  4DR1 M;  2XZF A;  4OX9 M;  4DR7 M;  4PD2 A;  3SAT A;  5LMN M;  4G4R A;  1Z5B A;  2OPF A;  4DV6 M;  3U6P A;  4B3T M;  1Q3C A;  2XZU A;  3JR5 A;  1XC8 A;  1Z59 A;  4DUZ M;  1IBM M;  3U6O A;  3J81 S;  1PM5 A;  2F5P A;  3A45 A;  5ITT A;  3U6M A;  5ITY A;  4LF5 M;  1FJG M;  1Q39 A;  4NXN M;  5ITQ A;  5ITX E;  1L2B A;  4DV7 M;  1K3X A;  4JV5 M;  3SAW A;  3SBJ A;  4G4Q A;  4JI8 M;  4X62 M;  3VK7 A;  3GPY A;  4DV5 M;  4LFC M;  4JYA M;  5BR8 M;  1Z5C A;  1Z5A A;  3GPX A;  5LMU M;  1KFV A;  2EA0 A;  1N32 M;  3JAM S;  3W0F A;  2E5L M;  4PDG A;  4KHP M;  4DV3 M;  4DV4 M;  4DUY M;  2UXB M;  1L1Z A;  4JI1 M;  5IWA M;  2UU9 M;  3T1H M;  4DR4 M;  1N33 M;  1R2Z A;  1N36 M;  4PDI A;  2F5Q A;  3GPU A;  2UXD M;  5FLX S;  4DV2 M;  5ITU A;  3C58 A;  1K3W A;  3U6D A;  4X64 M;  1HNZ M;  1IBL M;  2VQF M;  3U6S A;  2OQ4 A;  3TWL A;  2UUB M;  2UUC M;  4K0K M;  4DV1 M;  2F5S A;  4LFB M;  1HR0 M;  4GKK M;  4DR3 M;  3DOA A;  4NRV A;  3T1Y M;  2ZBK B;  3VK8 A;  4JI4 M;  1MU5 A;  4DR5 M;  1PJI A;  2Q2E B;  1L1T A;  3JR4 A;  3A46 A;  2UUA M;  1XMO M;  5IT9 S;  1MX0 A;  4G4N A;  1J5E M;  3A42 A;  4YY3 M;  1N34 M;  3SAU A;  4JI6 M; 
#chains in the Genus database with same CATH topology
 4I5S A;  3TPZ A;  4JI2 M;  2LVO C;  1WGL A;  3FRI A;  3K2L A;  1NHG C;  1XNQ M;  4FWH A;  1X37 A;  4G6Z A;  4LF4 M;  3SYK A;  3LVV A;  2C99 A;  5A2Q S;  3QAU A;  2Y21 A;  2DXI A;  2ZAN A;  2DNA A;  3GLG E;  4XK8 F;  2DWM A;  2YR0 A;  2L2D A;  3U6Q A;  4PCZ A;  1SXJ D;  1G71 A;  3W68 A;  1DO0 A;  1NNU C;  2WSE F;  4IJE A;  4G4O A;  1TTE A;  4KLN A;  3U61 B;  1XNR M;  4KOD A;  2C5R A;  1D0K A;  1E9S A;  3HZJ A;  2CWB A;  1QUS A;  1VDD A;  5DNY A;  1VDL A;  2KRK A;  2LH0 A;  3NWL A;  4BLC A;  1N78 A;  3VKG A;  4UN2 B;  4Y28 F;  4FCT A;  2UXC M;  4DV0 M;  3L25 A;  3SAR A;  3MK6 A;  4YHH M;  2XFT A;  5FTK A;  1WXQ A;  3U6E A;  3J7B A;  2DAM A;  4F1I A;  1NVM A;  4CJ6 A;  5EXX A;  4MGI E;  4M0D A;  1IBK M;  4JI7 M;  2DVW B;  1JB0 F;  2ZTD A;  4B08 A;  1QUT A;  2DAK A;  3SYL A;  4GH9 A;  4Q7J A;  4G4R A;  2OPF A;  2Y0T A;  3PFI A;  3HKP A;  2XZU A;  1ZMW A;  1C1K A;  1OFI A;  2F5P A;  1S3S A;  4LJ7 A;  2LNH C;  2DAE A;  2I7N A;  3T15 A;  5ITY A;  5FTM A;  1NV8 A;  2DEN A;  3V76 A;  1Q39 A;  1JR3 D;  3ILK A;  3HJ8 A;  5KPR A;  3FUU A;  2GQF A;  4B7G A;  3BXW A;  3C9P A;  5FTL A;  4FCV A;  3KDS E;  1IY0 A;  1K3X A;  4JV5 M;  3T38 A;  4LZZ A;  4G4Q A;  5FTJ A;  1DO2 A;  4JI8 M;  4CGY B;  1GL7 A;  1P3Q Q;  2CP8 A;  1YLA A;  3KOY E;  4IBJ A;  1HT1 E;  4AW4 A;  1VEK A;  3EIE A;  2QCU A;  1IN4 A;  4LFC M;  1Z5A A;  2ZAM A;  4DBG B;  2W82 A;  2OO9 A;  2QEN A;  3JAM S;  3W0F A;  2E5L M;  4IBG A;  4GRI A;  3GLH E;  4PDG A;  3GLF A;  4DV3 M;  3Q8X A;  1GL6 A;  3QYB A;  2HL7 A;  1HQC A;  1TH3 A;  5DYI A;  2UXB M;  3L2A A;  2H5X A;  5JI2 E;  2LWX A;  1TGU A;  5C1B A;  4AKG A;  3FKE A;  2F5Q A;  3HJQ A;  7CAT A;  2UXD M;  5FLX S;  2DWN A;  4XBO A;  4L4U A;  3FD9 A;  4BBA A;  2JNH A;  3U6D A;  4D80 A;  2L7H A;  4NL4 H;  4A3V B;  2J5Y A;  3U6S A;  2OQ4 A;  4IBF A;  4NC6 A;  2UUC M;  5E26 A;  5GKN A;  4I8O A;  1HR0 M;  4GKK M;  4AKI A;  1CUK A;  3K1J A;  2LHG A;  2RGO A;  1D0M A;  1DGB A;  3ZH9 B;  3VK8 A;  4JI4 M;  2N35 A;  3TQS A;  2K47 A;  3SMP A;  1V92 A;  4IBD A;  3JR4 A;  1G59 A;  1OFH A;  1ZMU A;  1F4I A;  4NSO B;  3BBZ A;  3FYC A;  2KEB A;  3IG5 A;  3RE8 A;  2H1R A;  1PJT A;  3PNY A;  4AG6 A;  3L26 A;  1HJP A;  4YY3 M;  2QHO B;  2Z3X A;  3SAU A;  1BVS A;  1IQP A;  3RGS A;  2D7E A;  1QQW A;  2FH0 A;  1IXS A;  2DI0 A;  2WSF F;  3KOZ E;  3W0L B;  2K0B X;  4B3M M;  1L8Q A;  1UM8 A;  3AOG A;  4GC5 A;  2CE7 A;  4L8R C;  4Z8X A;  1E32 A;  3GRV A;  4LF8 M;  1IFY A;  3J27 B;  3WHK A;  1WHC A;  1SXJ B;  2CRU A;  4NXM M;  2ZM6 M;  4LJ9 A;  3SHG B;  2JZ1 A;  3UMM A;  4GHA A;  4CHT B;  2R6F A;  1HNW M;  2CV0 A;  4II7 A;  3HJS A;  4MB7 A;  3DFZ A;  3U5Z B;  3SC3 A;  4LGM A;  4AQY M;  4OVZ A;  3GP1 A;  1EFU B;  2QSF X;  2XGN A;  3RGP A;  2DKL A;  2JY7 A;  2KXE A;  1OIP A;  4LRS A;  4RNA A;  1OJL A;  1XXH E;  1HT2 E;  2LVN C;  2EKF A;  1TDZ A;  4LF9 M;  1TF0 B;  4L16 A;  5EXT A;  2R4J A;  1IN8 A;  3AKZ A;  1GJS A;  3FTD A;  1Q02 A;  3FYD A;  1DGH B;  3MMP A;  4IBB A;  1I94 M;  2CUZ A;  4X66 M;  3OTO M;  1Y8G A;  4D82 A;  2MRO B;  3U6C A;  3UJN A;  3GQ4 A;  5EP1 A;  2XZF A;  4OX9 M;  2J7N A;  1XXH B;  1R6B X;  2G5G X;  3T6P A;  3SMS A;  5LMN M;  1YSY A;  2QZ4 A;  4REZ A;  3GLH A;  2QPA A;  1Q3C A;  4FD2 A;  3JR5 A;  1JQJ C;  2L7I A;  1Z59 A;  2O25 A;  1GO5 A;  1QDT A;  2KZS A;  2M60 A;  2V1C A;  1GAB A;  2HCB A;  3A45 A;  3FTC A;  2G3Q A;  4LF5 M;  1FJG M;  3Q8G A;  4R3D A;  1WGN A;  4CIZ A;  3CF0 A;  3AL0 C;  4DV7 M;  4WUR A;  1V34 A;  1R4G A;  3HHY A;  3HHW A;  4RF0 A;  4X62 M;  4LJ5 A;  2DZO B;  4R7G A;  3VK7 A;  4DV5 M;  2WZJ A;  1GJT A;  3TE6 A;  4JYA M;  3GPX A;  1IN5 A;  1WJ7 A;  2VF7 A;  4GEW A;  1N32 M;  3KP0 E;  4KHP M;  1G8P A;  4DV4 M;  2R65 A;  2AHM A;  5EP2 A;  1ZAE A;  3GLI B;  1L1Z A;  2CEA A;  3KP1 E;  3H4M A;  2FS1 A;  3TL4 X;  2UU9 M;  1NY5 A;  1N36 M;  3KSX A;  2O01 F;  3CTW B;  3M0E A;  3HY5 A;  3SFZ A;  2XH9 A;  1RU3 A;  2KRU A;  5ITU A;  4DV2 M;  3I4V A;  1N75 A;  1K3W A;  1EIJ A;  2X8A A;  1IN6 A;  1XHB A;  1WIV A;  3ZCB B;  2R46 A;  3HGI A;  4G3O A;  4GMQ A;  3FUX A;  2UUB M;  2L4F A;  4LFB M;  3LMM A;  1DGG A;  2R4E A;  4AG5 A;  2K9D A;  3T1Y M;  1VQ1 A;  1QAN A;  3VFD A;  3ZC7 B;  1ZV1 A;  1MU5 A;  1E94 E;  2L4E A;  1T6O A;  2C96 A;  3HHX A;  2Q2E B;  1G41 A;  1IXZ A;  2BNK A;  2X49 A;  4NSR A;  5E6J A;  2DWL A;  1XMO M;  3CF6 E;  2JWS A;  1IM2 A;  5IT9 S;  1MX0 A;  1AIP C;  1IY1 A;  1UFZ A;  3KSJ A;  4FWG A;  4GIP A;  4RKU F;  4G4N A;  1J5E M;  1MJG M;  3FTE A;  1W5T A;  3K92 A;  1PGY A;  4JI5 M;  1QVR A;  1FNN A;  2BJV A;  3LCV B;  5EJC A;  2DHR A;  2QBY B;  3K9O A;  3FRH A;  1D0L A;  3L29 A;  1TDH A;  1YUB A;  2XF3 A;  3FUT A;  3LQR A;  4LCB A;  2O5R A;  3B7N A;  3U61 A;  4CIS A;  4LF6 M;  3AJI B;  5DFL A;  2MH8 A;  2Z4S A;  2CFO A;  2JY8 A;  5EP3 A;  3HU1 A;  3GLG A;  2F5O A;  2YNM D;  4NRW A;  1OKS A;  4R71 A;  3GPP A;  1H6U A;  2XSZ D;  2R0I A;  2R18 A;  3K8Z A;  1W5S A;  1PJJ A;  1NNJ A;  2APL A;  3UK6 A;  2JUJ A;  4JI3 M;  3I01 M;  1Q3B A;  2LVP C;  4IIW A;  1IY2 A;  2RRU A;  4IBI A;  2JA2 A;  4KT0 F;  3GQ3 A;  1I4W A;  3SAV A;  5ITR A;  4LJ6 A;  4MGH A;  2LVQ D;  3AFH A;  3SHF A;  2FNA A;  1QAQ A;  3TWM A;  1OAI A;  4DR2 M;  1SXJ E;  1TH4 A;  2XFS A;  4GHL A;  1EE8 A;  2A5Y B;  3B7Q A;  1C7Y A;  2XSZ A;  2F5N A;  3NBX X;  3J7A S;  2OOB A;  2M5Z A;  2JP7 A;  2NQ8 C;  3I51 A;  4LJA A;  3VDU A;  3SAS A;  3UZU A;  2MR9 A;  4B3R M;  3VDP A;  3F92 A;  3U6L A;  1J09 A;  2LHC A;  5KQD A;  4LF7 M;  4GKJ M;  2F4V M;  2VQE M;  2C9C A;  1L2C A;  2HHH M;  2CHQ A;  1KYI A;  2R44 A;  2KNZ A;  4LY6 A;  4DR7 M;  4PD2 A;  1KSF X;  2EO2 A;  1Z5B A;  2JY6 B;  3M7G A;  4DV6 M;  2LXE A;  2KNA A;  3U6P A;  4B3T M;  4QOS A;  3C3E A;  4IJF A;  8CAT A;  2BJW A;  4DUZ M;  1IBM M;  3U6O A;  1PM5 A;  3ZQJ A;  1PJS A;  2QNJ A;  1DGF A;  2X4A A;  3GRR A;  3MHV C;  4LZJ A;  5BPV A;  5DYG A;  1V33 A;  4Z6Y A;  1QDR A;  2XLJ A;  2CHG A;  4F2L A;  1NJF A;  2BWE A;  3IEC A;  5ITX E;  2CV2 A;  4L15 A;  3SAW A;  3U60 A;  4IBC A;  1G3I A;  4M9X A;  2Z7J A;  4RF1 A;  3AOE A;  2K6B A;  4B7F A;  2YQZ A;  4LJ8 A;  1ZMV A;  4QNM A;  3R9X B;  4L6V 6;  4P16 A;  4MGY E;  2P5T A;  2HAK A;  1G4A E;  3KW6 A;  1Z5C A;  4M9S A;  5LMU M;  1JR3 E;  1N77 A;  3RFW A;  3GLF E;  2EA0 A;  2V1U A;  1QZE A;  3L27 A;  4LGY A;  3VKH A;  2EJS A;  2OOA A;  4QOZ C;  1NHW C;  2QQ8 A;  4FCW A;  2B3T A;  4LRT A;  4JI1 M;  3H4J A;  5IRE B;  1D2N A;  2XEP A;  4PDI A;  2C98 A;  1QZM A;  4AKH A;  2ZTC A;  5KO3 A;  3GLF B;  3C58 A;  2FOI C;  2RGH A;  2GNO A;  1HNZ M;  3J2P B;  1XWI A;  1IBL M;  1R5L A;  2DHY A;  2JXN A;  3B9P A;  4JN6 A;  4S12 A;  1OAO C;  3BOS A;  4EIW A;  5KPT A;  3LW5 F;  2VQF M;  3LCU A;  3TWL A;  4B7H A;  3GLI E;  4DV1 M;  1DV0 A;  5F3W A;  2I7P A;  1GKI A;  1HQY E;  1NSF A;  3NBI A;  4BB9 A;  2ZBK B;  3R8F A;  3UGJ A;  2VF8 A;  3D8L A;  4OW0 A;  1MN3 A;  4DR5 M;  3KXE C;  2UUA M;  2FFJ A;  4ANR A;  2KW0 A;  1NJG A;  3GLG B;  2MJ5 B;  3KOX E;  1GVN A;  4WW0 A;  2QP9 X;  3A42 A;  2FE8 A;  2ERC A;  2CV1 A;  1SXJ A;  3PVS A;  3FTF A;  2JY5 A;  4B3S M;  2Z4R A;  3FUV A;  4LFA M;  5JI3 E;  3GQ5 A;  1AUA A;  4DR6 M;  5FSW A;  3M6A A;  1L2D A;  1GLN A;  2LTU A;  1IXR C;  3U5Z A;  1Z6T A;  1XB2 B;  2C9O A;  3GRU A;  2HKJ A;  5IZ7 D;  1WR1 B;  2L09 A;  5C18 A;  3DA1 A;  3KOW E;  1A5T A;  4GIT A;  1IXS B;  5EP4 A;  1NY6 A;  3HHZ A;  3W67 A;  3J80 S;  2V6Z M;  4QNR A;  1QAM A;  3I04 M;  1VEG A;  4NOO B;  4QHT A;  1J7K A;  1DGH A;  2JZ0 A;  3HWS A;  5FTN A;  3AOE C;  4JI0 M;  3FUW A;  3B89 A;  1XMQ M;  2Z8Y M;  3K9P A;  1K82 A;  1XXH A;  1HNX M;  3KS4 A;  2DAG A;  3HU3 A;  3L28 A;  5ITX A;  3GO8 A;  4MGK E;  3TWK A;  4IBK A;  4ITQ A;  3IG8 A;  3HX3 A;  3IHP A;  4OVZ B;  2WSC F;  3E46 A;  1R2Y A;  2BWB A;  3PNV A;  4MH0 E;  1PRB A;  4M9Z A;  4X65 M;  4DR1 M;  1VG5 A;  2L6O A;  5EQT A;  1JR3 A;  3A98 B;  4D81 A;  3FE3 A;  3E4R A;  3SAT A;  2LVA A;  5H37 D;  3U60 B;  5L8R F;  3I4Y A;  1XC8 A;  3HU2 A;  1LTM A;  4PT5 A;  4ZPX A;  2DZN B;  3J81 S;  1NV9 A;  4L78 A;  4HL4 A;  2J7O A;  5ITT A;  3C3D A;  3U6M A;  2Y0Q A;  4M0W A;  1QYR A;  2R45 A;  3GLH B;  3LQQ A;  1E9R A;  4LJ4 A;  4NXN M;  4AI6 A;  5ITQ A;  2KA6 B;  1L2B A;  3B7Z A;  1LV7 A;  3SBJ A;  4TUW A;  5EXP A;  3GLI A;  4LG2 A;  4GC9 A;  4MM3 B;  3GPY A;  3MJ5 A;  2DWZ B;  1QAO A;  3KS8 A;  3D8B A;  5BR8 M;  1KFV A;  1TR8 A;  4XGI A;  5KPZ A;  4I4L A;  5EXS A;  3AV0 A;  1TH2 A;  4HEO A;  4MGZ E;  1SXJ C;  2KDL A;  3QWL A;  4P17 A;  4AZF A;  4DUY M;  1NO1 A;  2KNV A;  5IWA M;  3T1H M;  4OU7 A;  4DR4 M;  1R2Z A;  1N33 M;  2DZL A;  3PXG A;  3GPU A;  2KZU A;  4FVM A;  1R7R A;  4FW9 A;  3QYE A;  2R62 A;  4WP2 A;  1ZQ9 A;  3LVW A;  2VDB B;  2D7H A;  2DAI A;  2Y20 A;  1OIZ A;  2G8L A;  3GRY A;  1ORY B;  4I81 A;  4X64 M;  2KHH A;  3EIH A;  1IN7 A;  1YE9 A;  4K0K M;  2LBC A;  2F5S A;  3WHL A;  4W5W A;  3KFU G;  2VII A;  4JXJ A;  1T3T A;  3DOA A;  4NRV A;  4DR3 M;  2D7G A;  3CGW A;  1VEJ A;  2HWJ A;  4IBE A;  2EUC A;  3B74 A;  4QHS A;  2RKO A;  1PJI A;  1L1T A;  3CF2 A;  3A46 A;  2EKK A;  4KO8 A;  3THG A;  1T43 A;  2YFQ A;  4HLQ A;  1OQY A;  3VLF B;  2QBY A;  2CHV A;  3E9S A;  3E21 A;  3KVW A;  4FWD A;  1SG9 A;  2ZAO A;  1OTR A;  1PJQ A;  5KQ8 A;  1N34 M;  3DZD A;  2MGW A;  4JI6 M; 
#chains in the Genus database with same CATH homology
 4I5S A;  3TPZ A;  4JI2 M;  3K2L A;  1NHG C;  1XNQ M;  4FWH A;  1X37 A;  4G6Z A;  4LF4 M;  3SYK A;  3LVV A;  2C99 A;  5A2Q S;  3QAU A;  2Y21 A;  2DXI A;  2ZAN A;  2DWM A;  2YR0 A;  3U6Q A;  4PCZ A;  1SXJ D;  1DO0 A;  1NNU C;  4IJE A;  4G4O A;  4KLN A;  3U61 B;  1XNR M;  4KOD A;  2C5R A;  1E9S A;  1VDD A;  5DNY A;  2KRK A;  2LH0 A;  3NWL A;  4BLC A;  1N78 A;  3VKG A;  4FCT A;  2UXC M;  4DV0 M;  3L25 A;  3SAR A;  3MK6 A;  4YHH M;  2XFT A;  5FTK A;  1WXQ A;  3U6E A;  3J7B A;  1NVM A;  5EXX A;  4MGI E;  4M0D A;  1IBK M;  4JI7 M;  2DVW B;  4B08 A;  3SYL A;  4GH9 A;  4G4R A;  2OPF A;  2Y0T A;  3PFI A;  3HKP A;  2XZU A;  1C1K A;  1OFI A;  2F5P A;  1S3S A;  4LJ7 A;  2LNH C;  2I7N A;  3T15 A;  5ITY A;  5FTM A;  1Q39 A;  1JR3 D;  3ILK A;  3HJ8 A;  5KPR A;  3FUU A;  4B7G A;  5FTL A;  4FCV A;  3KDS E;  1IY0 A;  1K3X A;  4JV5 M;  3T38 A;  4LZZ A;  4G4Q A;  5FTJ A;  1DO2 A;  4JI8 M;  4CGY B;  1GL7 A;  3KOY E;  4IBJ A;  4AW4 A;  1HT1 E;  3EIE A;  2QCU A;  1IN4 A;  4LFC M;  1Z5A A;  2ZAM A;  2W82 A;  2QEN A;  3JAM S;  3W0F A;  2E5L M;  4IBG A;  4GRI A;  4PDG A;  3GLF A;  4DV3 M;  3Q8X A;  1GL6 A;  2HL7 A;  1HQC A;  1TH3 A;  5DYI A;  2UXB M;  3L2A A;  5JI2 E;  2LWX A;  1TGU A;  5C1B A;  4AKG A;  3FKE A;  2F5Q A;  3HJQ A;  7CAT A;  2UXD M;  5FLX S;  2DWN A;  4XBO A;  4L4U A;  3FD9 A;  4BBA A;  3U6D A;  4D80 A;  2L7H A;  4NL4 H;  4A3V B;  3U6S A;  2OQ4 A;  4IBF A;  2UUC M;  5E26 A;  5GKN A;  4I8O A;  1HR0 M;  4GKK M;  4AKI A;  3K1J A;  2RGO A;  1DGB A;  3ZH9 B;  3VK8 A;  4JI4 M;  3TQS A;  2K47 A;  3SMP A;  4IBD A;  3JR4 A;  1G59 A;  1OFH A;  4NSO B;  3IG5 A;  3FYC A;  2KEB A;  3RE8 A;  2H1R A;  3PNY A;  4AG6 A;  3L26 A;  4YY3 M;  2Z3X A;  3SAU A;  3RGS A;  1IQP A;  2D7E A;  1QQW A;  3KOZ E;  3W0L B;  4B3M M;  1L8Q A;  1UM8 A;  3AOG A;  4GC5 A;  2CE7 A;  4L8R C;  4Z8X A;  1E32 A;  3GRV A;  4LF8 M;  3J27 B;  3WHK A;  1SXJ B;  4NXM M;  2ZM6 M;  4LJ9 A;  3SHG B;  3UMM A;  4GHA A;  4CHT B;  1HNW M;  2CV0 A;  4II7 A;  3HJS A;  4MB7 A;  3DFZ A;  3U5Z B;  3SC3 A;  4LGM A;  4AQY M;  4OVZ A;  3GP1 A;  2XGN A;  3RGP A;  2KXE A;  4LRS A;  4RNA A;  1OJL A;  1HT2 E;  1TDZ A;  4LF9 M;  4L16 A;  5EXT A;  2R4J A;  1IN8 A;  3AKZ A;  3FTD A;  1I94 M;  3FYD A;  1DGH B;  4IBB A;  2CUZ A;  4X66 M;  3OTO M;  4D82 A;  3U6C A;  3UJN A;  3GQ4 A;  5EP1 A;  2XZF A;  4OX9 M;  2J7N A;  1XXH B;  1R6B X;  2G5G X;  3SMS A;  5LMN M;  1YSY A;  2QZ4 A;  4REZ A;  3GLH A;  2QPA A;  1Q3C A;  4FD2 A;  3JR5 A;  1JQJ C;  2L7I A;  1Z59 A;  2KZS A;  2M60 A;  2V1C A;  2HCB A;  3A45 A;  3FTC A;  4LF5 M;  1FJG M;  4R3D A;  3CF0 A;  3AL0 C;  4DV7 M;  4WUR A;  3HHY A;  3HHW A;  4RF0 A;  4X62 M;  4LJ5 A;  2DZO B;  4R7G A;  3VK7 A;  4DV5 M;  3TE6 A;  4JYA M;  3GPX A;  1IN5 A;  1N32 M;  3KP0 E;  4KHP M;  1G8P A;  4DV4 M;  2R65 A;  2AHM A;  5EP2 A;  1ZAE A;  3GLI B;  1L1Z A;  2CEA A;  3KP1 E;  3H4M A;  3TL4 X;  2UU9 M;  1NY5 A;  1N36 M;  3KSX A;  3CTW B;  3M0E A;  3SFZ A;  2XH9 A;  4DV2 M;  2KRU A;  5ITU A;  3I4V A;  1N75 A;  1K3W A;  2X8A A;  1IN6 A;  1XHB A;  3ZCB B;  2R46 A;  3HGI A;  4GMQ A;  3FUX A;  2UUB M;  4LFB M;  3LMM A;  1DGG A;  2R4E A;  4AG5 A;  3T1Y M;  1QAN A;  3VFD A;  3ZC7 B;  1MU5 A;  1E94 E;  2C96 A;  3HHX A;  2Q2E B;  1G41 A;  1IXZ A;  2BNK A;  2X49 A;  4NSR A;  5E6J A;  2DWL A;  1XMO M;  3CF6 E;  1IM2 A;  5IT9 S;  1MX0 A;  1IY1 A;  4G4N A;  3KSJ A;  4FWG A;  4GIP A;  1J5E M;  3FTE A;  1W5T A;  3K92 A;  4JI5 M;  1QVR A;  1FNN A;  2BJV A;  5EJC A;  2DHR A;  2QBY B;  3L29 A;  1TDH A;  1YUB A;  2XF3 A;  3FUT A;  3LQR A;  4LCB A;  2O5R A;  3U61 A;  4CIS A;  4LF6 M;  3AJI B;  2Z4S A;  2CFO A;  5EP3 A;  3GLG A;  3HU1 A;  4NRW A;  2F5O A;  2YNM D;  3GPP A;  1H6U A;  2XSZ D;  2R18 A;  3K8Z A;  1PJJ A;  1W5S A;  1NNJ A;  3UK6 A;  4JI3 M;  4IIW A;  1Q3B A;  1IY2 A;  4IBI A;  3GQ3 A;  2JA2 A;  1I4W A;  3SAV A;  5ITR A;  4LJ6 A;  4MGH A;  3AFH A;  3SHF A;  2FNA A;  1QAQ A;  3TWM A;  4DR2 M;  1SXJ E;  1TH4 A;  2XFS A;  4GHL A;  1EE8 A;  2A5Y B;  2F5N A;  2XSZ A;  3J7A S;  2M5Z A;  2NQ8 C;  3I51 A;  3VDU A;  4LJA A;  3SAS A;  3UZU A;  4B3R M;  3VDP A;  3U6L A;  1J09 A;  5KQD A;  4LF7 M;  4GKJ M;  2F4V M;  2VQE M;  2C9C A;  1L2C A;  2HHH M;  2CHQ A;  1KYI A;  4LY6 A;  4DR7 M;  4PD2 A;  1KSF X;  2EO2 A;  1Z5B A;  3M7G A;  4DV6 M;  2LXE A;  3U6P A;  4B3T M;  4QOS A;  4IJF A;  8CAT A;  2BJW A;  4DUZ M;  1IBM M;  3U6O A;  1PM5 A;  2X4A A;  3MHV C;  1DGF A;  3GRR A;  4LZJ A;  5BPV A;  5DYG A;  4Z6Y A;  2XLJ A;  2CHG A;  1NJF A;  5ITX E;  2CV2 A;  4L15 A;  3SAW A;  3U60 A;  4IBC A;  1G3I A;  4M9X A;  2Z7J A;  4RF1 A;  3AOE A;  4B7F A;  2YQZ A;  4LJ8 A;  4QNM A;  3R9X B;  4P16 A;  4MGY E;  2P5T A;  3KW6 A;  1G4A E;  4M9S A;  1Z5C A;  1N77 A;  5LMU M;  3RFW A;  2EA0 A;  2V1U A;  3L27 A;  4LGY A;  3VKH A;  4QOZ C;  1NHW C;  4FCW A;  4LRT A;  4JI1 M;  5IRE B;  1D2N A;  2XEP A;  4PDI A;  2C98 A;  1QZM A;  4AKH A;  3GLF B;  3C58 A;  2FOI C;  2RGH A;  1HNZ M;  3J2P B;  1XWI A;  1IBL M;  3B9P A;  4S12 A;  4JN6 A;  5KO3 A;  2VQF M;  3BOS A;  4EIW A;  5KPT A;  4AI6 A;  3TWL A;  4B7H A;  4DV1 M;  5F3W A;  2I7P A;  1GKI A;  1HQY E;  1NSF A;  3NBI A;  4BB9 A;  2ZBK B;  3R8F A;  3UGJ A;  3D8L A;  4OW0 A;  4DR5 M;  3KXE C;  2UUA M;  2FFJ A;  1NJG A;  2KW0 A;  3GLG B;  3KOX E;  1GVN A;  4WW0 A;  2QP9 X;  3A42 A;  2FE8 A;  2ERC A;  2CV1 A;  1SXJ A;  3PVS A;  3FTF A;  4B3S M;  2Z4R A;  3FUV A;  4LFA M;  5JI3 E;  3GQ5 A;  4DR6 M;  5FSW A;  3M6A A;  1L2D A;  1GLN A;  1IXR C;  3U5Z A;  1Z6T A;  2C9O A;  3GRU A;  5IZ7 D;  2HKJ A;  2L09 A;  5C18 A;  3DA1 A;  3KOW E;  4GIT A;  1IXS B;  5EP4 A;  1NY6 A;  3HHZ A;  3J80 S;  2V6Z M;  4QNR A;  1QAM A;  4NOO B;  4QHT A;  1J7K A;  1DGH A;  3HWS A;  5FTN A;  3AOE C;  4JI0 M;  3FUW A;  1XMQ M;  1K82 A;  1XXH A;  1HNX M;  3KS4 A;  3HU3 A;  3L28 A;  5ITX A;  3GO8 A;  4MGK E;  3TWK A;  4IBK A;  4ITQ A;  3IG8 A;  4OVZ B;  1R2Y A;  4MH0 E;  3PNV A;  4M9Z A;  4X65 M;  4DR1 M;  2L6O A;  5EQT A;  1JR3 A;  3A98 B;  4D81 A;  3SAT A;  3E4R A;  5H37 D;  3U60 B;  3I4Y A;  1XC8 A;  3HU2 A;  4PT5 A;  4ZPX A;  2DZN B;  3J81 S;  4L78 A;  4HL4 A;  2J7O A;  5ITT A;  3U6M A;  2Y0Q A;  4M0W A;  1QYR A;  2R45 A;  3GLH B;  3LQQ A;  1E9R A;  4LJ4 A;  4NXN M;  5ITQ A;  2KA6 B;  1L2B A;  1LV7 A;  3SBJ A;  4TUW A;  5EXP A;  3GLI A;  4LG2 A;  4GC9 A;  4MM3 B;  3GPY A;  3MJ5 A;  2DWZ B;  1QAO A;  3KS8 A;  3D8B A;  5BR8 M;  1KFV A;  4XGI A;  5KPZ A;  4I4L A;  5EXS A;  3AV0 A;  1TH2 A;  4MGZ E;  1SXJ C;  3QWL A;  4DUY M;  4AZF A;  5IWA M;  3T1H M;  4OU7 A;  4DR4 M;  1R2Z A;  1N33 M;  3PXG A;  3GPU A;  2KZU A;  4FVM A;  1R7R A;  4FW9 A;  2R62 A;  1ZQ9 A;  3LVW A;  3GRY A;  2D7H A;  2Y20 A;  4X64 M;  2G8L A;  4I81 A;  1ORY B;  3EIH A;  1IN7 A;  1YE9 A;  4K0K M;  2F5S A;  3WHL A;  4W5W A;  3KFU G;  2VII A;  4JXJ A;  1T3T A;  3DOA A;  4NRV A;  4DR3 M;  2D7G A;  4IBE A;  2EUC A;  4QHS A;  2RKO A;  1PJI A;  1L1T A;  3CF2 A;  3A46 A;  4KO8 A;  3THG A;  2YFQ A;  4HLQ A;  3VLF B;  2QBY A;  3E9S A;  2CHV A;  3KVW A;  4FWD A;  2ZAO A;  1N34 M;  5KQ8 A;  3DZD A;  4JI6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...