3A46A

Crystal structure of mvnei1/thf complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 84
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a46A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a46A01
4DR5M 4B3RM 4DV5M 2UUAM 4GKKM 3U6OA 1NNJA 2UUBM 3U6CA 4B3TM 3U6DA 4JV5M 3DOAA 5ITRA 3A46A 1Q39A 1Z5BA 4PD2A 4PCZA 4DR3M 3U6EA 1J5EM 2OQ4A 4G4RA 1I94M 4LF9M 3SAUA 3GPPA 2ZM6M 3GP1A 4LFAM 2F5OA 3SBJA 4DV2M 1PM5A 4LF7M 4JYAM 4NXNM 5FLXS 1L2CA 1HNZM 2F4VM 4KHPM 4DUZM 4DR2M 1IBMM 4LFCM 1KFVA 4YY3M 3GPUA 2VQFM 1HNXM 5ITTA 2F5QA 4K0KM 1N32M 4DV1M 3GO8A 2XZUA 4LF4M 3TWMA 3SAWA 1Q3BA 5LMUM 1K82A 4LF6M 5ITXE 5ITYA 1R2YA 3GQ4A 1L2BA 2E5LM 2UXDM 1XNQM 4JI4M 4JI0M 5BR8M 1XC8A 4JI1M 1L2DA 2UU9M 3U6QA 2Q2EB 3TWLA 1N33M 4DUYM 3U6PA 3JR5A 2UXBM 1XNRM 4MB7A 3GPXA 1N34M 2VQEM 3OTOM 4JI8M 3SATA 4JI3M 4ITQA 1MX0A 3VK7A 1R2ZA 1HNWM 1XMOM 4PDGA 1PJJA 4B3MM 2HKJA 3GPYA 3J80S 2HHHM 2F5NA 4GKJM 4YHHM 2UUCM 5LMNM 1N36M 1L1TA 4LF8M 4DV7M 4NXMM 3SASA 1TDHA 3C58A 4DR1M 5ITXA 1HR0M 5IWAM 4X66M 4DV6M 4DR4M 1IBKM 5A2QS 4AQYM 4CISA 1FJGM 1XMQM 4NRWA 2F5SA 4LF5M 1Z5CA 4JI7M 2XZFA 4OX9M 1PJIA 2OPFA 3W0FA 3GQ5A 5ITQA 1IBLM 5ITUA 3U6MA 4JI5M 3J7AS 3SARA 4X62M 4X64M 4B3SM 4DR7M 4G4OA 3T1YM 4JI2M 2UXCM 3A45A 3J81S 3JR4A 4LFBM 4NRVA 3JAMS 3TWKA 3U6LA 3VK8A 2ZBKB 4JI6M 3GQ3A 1Z59A 4X65M 4PDIA 3U6SA 4G4QA 2EA0A 1L1ZA 3A42A 2F5PA 1Q3CA 3T1HM 1TDZA 3SAVA 1K3WA 4G4NA 1Z5AA 4DV0M 4DV3M 4DV4M 1K3XA 5IT9S 1MU5A 4DR6M 1EE8A
chains in the Genus database with same CATH superfamily
3AOEA 5C18A 4DR5M 2XGNA 4B3RM 1IY0A 1TR8A 4GKKM 1W5SA 2QQ8A 4B7GA 5KPRA 2L4FA 1ZV1A 1Z6TA 1NNJA 2UUBM 4B3TM 2VF8A 3AKZA 4R7GA 1AUAA 4GC9A 2MJ5B 3FUVA 3U6EA 2OOAA 3UGJA 4IBKA 3CGWA 2KXEA 3GRYA 3IHPA 3PNVA 5KQ8A 2K47A 2F5OA 2D7GA 3UZUA 1IN4A 3IG8A 1YE9A 4IBDA 4GIPA 1QUTA 3FUTA 3LCVB 1PM5A 1SXJB 1GJTA 1YLAA 3M7GA 3W0LB 1GL7A 1IBMM 1G3IA 3K2LA 3GPUA 3U5ZA 4D80A 2R45A 5KQDA 3KS4A 4QNMA 4P16A 1OIZA 2XLJA 1G8PA 3FRIA 2VF7A 4XBOA 4I5SA 2FFJA 3KP0E 4MGZE 5LMUM 1K82A 2KHHA 3SHGB 2M5ZA 3FYCA 5ITXE 2DZNB 2KNZA 1SG9A 3ZQJA 1OFHA 1R7RA 4QOZC 3HJ8A 4NOOB 1WR1B 3SFZA 2JY7A 1NY5A 1QZEA 3HHYA 4JI1M 4LG2A 1E94E 2UU9M 4FCWA 3H4JA 3QWLA 4R3DA 4F1IA 5IREB 3GLGE 4DUYM 3LVWA 4GHLA 5FTNA 3HY5A 3GPXA 2DZLA 2V1CA 3OTOM 3VKGA 1QQWA 3E9SA 2DNAA 1PGYA 2ZAMA 3HHXA 3VK7A 4ITQA 4TUWA 5DNYA 1XWIA 3TQSA 4PDGA 1SXJD 1NJGA 4G6ZA 3HGIA 1UFZA 3GLFA 3AOGA 3J80S 1QANA 2C98A 4IBJA 3KXEC 4LF8M 4M9ZA 3C3EA 3CF0A 2MGWA 3W67A 2DXIA 1TDHA 2C5RA 2JP7A 5ITXA 3SMSA 1HR0M 2KNAA 1NV8A 3E21A 4P17A 4DV6M 4XK8F 4IJFA 2ZANA 5A2QS 1PJTA 4CISA 1FJGM 2HL7A 1VEKA 4GEWA 1DO2A 1NHWC 2XZFA 1IFYA 3DFZA 2DZOB 2D7HA 3B89A 3KP1E 4BLCA 3GLGA 2OPFA 1DGFA 4GMQA 4AG6A 2DAGA 5ITUA 3U6MA 2C9CA 4MGKE 2MROB 2CV0A 2KW0A 1QZMA 2KNVA 4OW0A 4X64M 4DR7M 2JXNA 1RU3A 5EXTA 4EIWA 3T1YM 2KRUA 3Q8GA 3KOZE 5JI2E 3GRUA 1WJ7A 1XB2B 2KA6B 4I8OA 5DFLA 3VK8A 1IN6A 3UJNA 1TH4A 2DWNA 4LJ9A 3RGPA 4REZA 1R6BX 1PJQA 4LJ5A 4Q7JA 1HT1E 1GABA 2EA0A 2A5YB 1Q3CA 3B7NA 2CUZA 2J5YA 2JZ1A 1K3WA 1JQJC 1UM8A 4RKUF 3IECA 2JZ0A 4UN2B 1D0LA 2R4EA 4NC6A 1IY2A 4DR6M 2DAMA 1IN7A 2BNKA 4HL4A 2BWEA 4G3OA 3M6AA 3U6DA 2CP8A 1AIPC 3L29A 5E26A 2CV2A 5ITRA 1Q39A 1Z5BA 2XEPA 4PD2A 2Y0QA 4DR3M 1QYRA 3SYKA 3L26A 4QHTA 1G59A 4G4RA 3U60A 1EFUB 2YFQA 3SAUA 4L16A 3AFHA 1NY6A 3HX3A 3TPZA 2LHCA 4OVZA 1PRBA 2X8AA 3SBJA 5KPZA 2VDBB 2QCUA 1G4AE 1P3QQ 3CTWB 2W82A 3RE8A 4LF7M 4XGIA 4NXNM 5FLXS 1L2CA 4L8RC 3HU3A 4KHPM 4DUZM 4DR2M 2DAEA 2DAKA 3K8ZA 4IBCA 3ILKA 1D2NA 1IN8A 1BVSA 2GNOA 2RKOA 3LQQA 2XZUA 2FOIC 2EUCA 2G3QA 3SAWA 3U5ZB 1Q3BA 3SMPA 2X49A 1IM2A 3BOSA 3SC3A 4B7FA 5ITYA 1T43A 1XXHE 2CWBA 2E5LM 3HU2A 2WSCF 3HZJA 4PT5A 2G8LA 2QENA 5BR8M 4FVMA 4KO8A 2XSZA 5EQTA 3EIHA 5FSWA 1L2DA 3MK6A 1ORYB 3LQRA 3TWLA 5FTKA 1G41A 4L6V6 4QNRA 1L8QA 1TH3A 2CHVA 4D81A 2VQEM 3I4VA 3GLHA 1NO1A 3NBXX 2QNJA 2DHYA 7CATA 1R2ZA 4I81A 3U61A 2XSZD 1HNWM 3VDPA 4IBEA 1XMOM 4B3MM 1C7YA 3KS8A 2JY6B 4LJAA 4L78A 2R0IA 3C9PA 3GPYA 2QBYB 1E32A 2YQZA 2DENA 2F5NA 4LZJA 3GLIA 1DGGA 1N36M 2Y21A 1L1TA 4CIZA 1QAOA 3QYEA 1WIVA 3GLFB 3C58A 4DR1M 1A5TA 2I7NA 1R4GA 2QHOB 4FWDA 3HU1A 4DR4M 5E6JA 1OIPA 4KODA 3KOXE 3VKHA 3V76A 2QSFX 3WHKA 4II7A 4CGYB 2F5SA 1V92A 4LF5M 1I4WA 3B7QA 2KEBA 5KPTA 1JR3E 4HEOA 4ANRA 3W0FA 2WZJA 4LJ7A 3GQ5A 1D0MA 1DGHA 1VDLA 2L7IA 2O25A 4MH0E 2QBYA 2LXEA 4JN6A 3K1JA 2LTUA 3GLGB 3K92A 4X62M 4IBIA 1HQCA 2RGOA 4RF1A 4ZPXA 2FNAA 2L2DA 3B9PA 4JI2M 4FW9A 3J81S 3JR4A 1OKSA 2VIIA 3JAMS 1VQ1A 1HJPA 2KZSA 2X4AA 4IBGA 4LRSA 4LGMA 3I04M 2EO2A 3M0EA 2N35A 3VLFB 5GKNA 5JI3E 3GQ3A 4Y28F 3U6SA 4G4QA 2ZTDA 2R6FA 3AV0A 3FUWA 4FWGA 4GRIA 3T1HM 3FKEA 3VDUA 2KRKA 2EKKA 1Z5AA 4DV0M 3FD9A 2CHQA 1LTMA 3FUXA 1E9SA 1MU5A 5EJCA 3LW5F 3UMMA 1TF0B 1EE8A 2UUAM 2M60A 1QAMA 2C9OA 3U6OA 1T6OA 2JY5A 1OTRA 3U6CA 3L2AA 4JV5M 5F3WA 5L8RF 4RNAA 2C96A 4BB9A 4AW4A 3A46A 4KT0F 4FCTA 1JB0F 2R46A 1I94M 2FE8A 1IN5A 2QPAA 4LF9M 1GVNA 2YNMD 2FS1A 3IG5A 3ZCBB 2APLA 4AZFA 1IXZA 3GP1A 3FTFA 2LVAA 1DV0A 3QAUA 3U60B 4NSRA 5EXXA 2JNHA 4L4UA 1Y8GA 4DV2M 1HNZM 4OVZB 2F4VM 2L7HA 1NHGC 2JY8A 4FD2A 2Y0TA 4LFCM 2R62A 3FTDA 4YY3M 1KFVA 3H4MA 1HT2E 2CV1A 3LMMA 1V33A 1HNXM 5ITTA 2F5QA 1N32M 1D0KA 3C3DA 3TWMA 3T38A 1IQPA 4LZZA 5KO3A 1R2YA 1L2BA 2HWJA 2H1RA 3SHFA 2JWSA 4JI4M 1IXSA 3I51A 2XH9A 1G71A 3GRVA 4I4LA 1H6UA 3U6QA 5EP3A 1QVRA 4FWHA 5H37D 3L27A 1S3SA 3JR5A 4MB7A 1N34M 4HLQA 4JXJA 4QHSA 2O5RA 4JI3M 1QUSA 4GHAA 1MN3A 1WGLA 1QAQA 1OFIA 3DZDA 4IBBA 3R8FA 3GLHB 2QZ4A 2HHHM 3NBIA 4NSOB 4RF0A 4YHHM 3U61B 5LMNM 3PVSA 2CE7A 4DV7M 5EXPA 3SASA 3FUUA 1OQYA 1XHBA 2LHGA 3PFIA 2MH8A 3GLIB 2KDLA 3CF6E 5IWAM 4IJEA 3AOEC 3J2PB 2O01F 2Z4RA 2LBCA 2MR9A 3T15A 3LCUA 1NNUC 1X37A 3I01M 3UK6A 1GL6A 1ZMUA 2GQFA 3LVVA 1Z5CA 1NJFA 4OU7A 5IZ7D 4B7HA 1TH2A 1PJIA 3HJSA 4M0WA 4WP2A 5ITQA 3KFUG 5DYIA 1TGUA 2R18A 3FTCA 2BJVA 3HJQA 1VEJA 4B3SM 4R71A 4WURA 4G4OA 1DGHB 1NSFA 1ZAEA 1ZMVA 3A45A 1ZQ9A 4MGHA 1N77A 3FYDA 2Z4SA 3I4YA 3TWKA 3U6LA 2Z8YM 2XF3A 1SXJE 2HCBA 4GC5A 5FTLA 1V34A 1OJLA 1XXHA 1PJSA 2ZBKB 1CUKA 8CATA 2P5TA 3RFWA 3RGSA 4PDIA 3DA1A 3A98B 2Z3XA 2BWBA 4LCBA 4LJ4A 3A42A 2DWLA 1DGBA 3L28A 2HAKA 3HWSA 1TDZA 2RGHA 1C1KA 1HQYE 2L4EA 4DV3M 1GKIA 1J09A 1NV9A 3GLFE 4DBGB 5IT9S 2ERCA 2B3TA 2LWXA 2R65A 4Z8XA 4A3VB 4CHTB 1SXJC 3HKPA 5EP2A 4AQYM 4MM3B 4DV5M 1J7KA 1YUBA 2JUJA 2K6BA 4AKHA 3K9OA 3Q8XA 2NQ8C 2RRUA 3D8BA 1E9RA 3DOAA 4F2LA 2LVQD 2J7OA 4PCZA 3B7ZA 1J5EM 2OQ4A 2L09A 2D7EA 2Y20A 4IBFA 2LH0A 4L15A 5EP1A 2ZTCA 4WW0A 5EXSA 3GPPA 2DI0A 1OAIA 1SXJA 3VFDA 4LFAM 2LVOC 4LGYA 1VG5A 2ZM6M 3HHWA 3MMPA 3FE3A 3THGA 3KW6A 2ZAOA 4FCVA 1GLNA 1WXQA 3KSXA 2I7PA 4JYAM 5FTMA 1MJGM 4LJ8A 4NL4H 2AHMA 2VQFM 1JR3A 4GH9A 2QP9X 4LJ6A 3ZC7B 4K0KM 4KLNA 1WGNA 4DV1M 3GO8A 4LF4M 4S12A 3KDSE 3PNYA 2C99A 4D82A 2XFSA 1OAOC 1VEGA 5BPVA 4LF6M 1WHCA 5C1BA 3GQ4A 4AKGA 4CJ6A 2UXDM 3NWLA 3ZH9B 3FRHA 3MJ5A 1FNNA 4GITA 4JI0M 4AG5A 1XC8A 2FH0A 4W5WA 1XNQM 1JR3D 3KSJA 1QDRA 2DWMA 1GJSA 3TL4X 2V6ZM 2DKLA 1W5TA 2Q2EB 1IXSB 1N33M 3AJIB 2LVPC 4MGYE 4LRTA 3U6PA 2UXBM 1XNRM 3WHLA 2JA2A 1N75A 2OOBA 2OO9A 4JI8M 3SATA 2CEAA 1MX0A 2R44A 4AKIA 3CF2A 5FTJA 2L6OA 2YR0A 3HHZA 1PJJA 5DYGA 2J7NA 2WSEF 3EIEA 2HKJA 1LV7A 3R9XB 1IY1A 4GKJM 3B74A 3J27B 2BJWA 1F4IA 2UUCM 5EP4A 4NXMM 1NVMA 1QDTA 2G5GX 3D8LA 2K0BX 1T3TA 4X66M 2LVNC 2WSFF 3FTEA 4BBAA 1IBKM 3BXWA 1Q02A 2DVWB 1XMQM 4NRWA 2R4JA 4JI7M 4OX9M 3AL0C 1VDDA 4QOSA 1IBLM 1DO0A 3E46A 4MGIE 4JI5M 4IIWA 3J7AS 4B08A 3SARA 1GO5A 4M0DA 3J7BA 3K9PA 3MHVC 3T6PA 2Z7JA 2UXCM 2KZUA 3QYBA 3W68A 4LFBM 3KOWE 1R5LA 4NRVA 2CRUA 1IXRC 2LNHC 3KVWA 3BBZA 4M9XA 1YSYA 4Z6YA 3E4RA 4LY6A 4JI6M 1Z59A 4X65M 2H5XA 1N78A 3F92A 1KSFX 1ZMWA 2DWZB 3L25A 1L1ZA 3PXGA 1KYIA 2F5PA 2V1UA 3GLHE 1XXHB 3GRRA 4AI6A 2XFTA 3SAVA 4G4NA 3KOYE 1EIJA 3TE6A 2EKFA 2EJSA 4DV4M 2DHRA 2K9DA 2CFOA 4M9SA 1K3XA 1TTEA 2CHGA 3SYLA 3GLIE 2DAIA
chains in the Genus database with same CATH topology
3AOEA 5C18A 4DR5M 2XGNA 4B3RM 1IY0A 4GKKM 1W5SA 4B7GA 5KPRA 1Z6TA 1NNJA 2UUBM 4B3TM 3AKZA 4R7GA 4GC9A 3FUVA 3U6EA 3UGJA 4IBKA 2KXEA 3GRYA 3PNVA 5KQ8A 2K47A 2F5OA 2D7GA 3UZUA 1IN4A 3IG8A 1YE9A 4IBDA 4GIPA 3FUTA 1PM5A 1SXJB 3M7GA 3W0LB 1GL7A 1IBMM 1G3IA 3K2LA 3GPUA 3U5ZA 4D80A 2R45A 5KQDA 3KS4A 4QNMA 4P16A 2XLJA 1G8PA 4XBOA 4I5SA 2FFJA 3KP0E 4MGZE 5LMUM 1K82A 3SHGB 2M5ZA 3FYCA 5ITXE 2DZNB 1OFHA 1R7RA 4QOZC 3HJ8A 4NOOB 3SFZA 3HHYA 1NY5A 4JI1M 4LG2A 1E94E 2UU9M 4FCWA 3QWLA 4R3DA 5IREB 4DUYM 4GHLA 3LVWA 5FTNA 3GPXA 2V1CA 3OTOM 3VKGA 1QQWA 3E9SA 4ITQA 2ZAMA 3HHXA 3VK7A 4TUWA 5DNYA 1XWIA 3TQSA 4PDGA 1SXJD 1NJGA 4G6ZA 3HGIA 3GLFA 3AOGA 3J80S 1QANA 2C98A 4IBJA 3KXEC 4LF8M 4M9ZA 3CF0A 2DXIA 1TDHA 2C5RA 5ITXA 1HR0M 3SMSA 4DV6M 4IJFA 2ZANA 5A2QS 4CISA 1FJGM 2HL7A 1DO2A 1NHWC 2XZFA 3DFZA 2DZOB 2D7HA 3KP1E 3GLGA 4BLCA 2OPFA 1DGFA 4GMQA 4AG6A 5ITUA 3U6MA 2C9CA 4MGKE 2CV0A 2KW0A 1QZMA 4X64M 4OW0A 4DR7M 5EXTA 4EIWA 3T1YM 2KRUA 3KOZE 5JI2E 3GRUA 2KA6B 4I8OA 3VK8A 1IN6A 3UJNA 1TH4A 2DWNA 4LJ9A 3RGPA 4REZA 1R6BX 4LJ5A 1HT1E 2EA0A 2A5YB 1Q3CA 2CUZA 1K3WA 1JQJC 1UM8A 2R4EA 1IY2A 4DR6M 1IN7A 2BNKA 4HL4A 3M6AA 3U6DA 3L29A 5E26A 2CV2A 5ITRA 1Q39A 1Z5BA 2XEPA 4PD2A 2Y0QA 4DR3M 1QYRA 3SYKA 3L26A 4QHTA 1G59A 4G4RA 3U60A 2YFQA 3SAUA 4L16A 3AFHA 1NY6A 3TPZA 4OVZA 2X8AA 3SBJA 5KPZA 2QCUA 1G4AE 3CTWB 2W82A 3RE8A 4LF7M 4XGIA 4NXNM 5FLXS 1L2CA 4L8RC 3HU3A 4KHPM 4DUZM 4DR2M 3K8ZA 4IBCA 3ILKA 1D2NA 1IN8A 2RKOA 3LQQA 2XZUA 2FOIC 2EUCA 3SAWA 3U5ZB 1Q3BA 3SMPA 2X49A 1IM2A 3BOSA 3SC3A 4B7FA 5ITYA 2E5LM 3HU2A 4PT5A 2G8LA 2QENA 5BR8M 4FVMA 4KO8A 2XSZA 5EQTA 3EIHA 5FSWA 1L2DA 3MK6A 1ORYB 3LQRA 3TWLA 5FTKA 1G41A 4QNRA 1L8QA 1TH3A 2CHVA 4D81A 2VQEM 3I4VA 3GLHA 7CATA 1R2ZA 4I81A 3U61A 2XSZD 1HNWM 3VDPA 4IBEA 1XMOM 4B3MM 3KS8A 4LJAA 4L78A 2QBYB 3GPYA 1E32A 2YQZA 2F5NA 4LZJA 3GLIA 1DGGA 1N36M 2Y21A 1L1TA 1QAOA 3GLFB 3C58A 4DR1M 2I7NA 4FWDA 3HU1A 4DR4M 5E6JA 4KODA 3KOXE 3VKHA 3WHKA 4II7A 4CGYB 2F5SA 4LF5M 1I4WA 2KEBA 5KPTA 3W0FA 3GQ5A 4LJ7A 1DGHA 4MH0E 2L7IA 2QBYA 2LXEA 4JN6A 3K1JA 3GLGB 3K92A 4X62M 4IBIA 1HQCA 2RGOA 4RF1A 4ZPXA 2FNAA 3B9PA 4JI2M 4FW9A 3J81S 3JR4A 2VIIA 3JAMS 2KZSA 4IBGA 2X4AA 4LRSA 4LGMA 2EO2A 3M0EA 3VLFB 5GKNA 5JI3E 3GQ3A 3U6SA 4G4QA 3AV0A 3FUWA 4FWGA 4GRIA 3T1HM 3FKEA 3VDUA 2KRKA 1Z5AA 4DV0M 3FD9A 2CHQA 3FUXA 1E9SA 1MU5A 5EJCA 3UMMA 1EE8A 2UUAM 1QAMA 2C9OA 2M60A 3U6OA 3U6CA 3L2AA 4JV5M 5F3WA 4RNAA 2C96A 4BB9A 4AW4A 3A46A 4FCTA 2R46A 1I94M 2FE8A 1IN5A 2QPAA 4LF9M 1GVNA 2YNMD 3FTFA 3IG5A 3ZCBB 4AZFA 3GP1A 1IXZA 3QAUA 3U60B 4NSRA 5EXXA 4L4UA 4DV2M 1HNZM 4OVZB 2F4VM 2L7HA 1NHGC 4FD2A 2Y0TA 4LFCM 2R62A 3FTDA 4YY3M 1KFVA 3H4MA 1HT2E 2CV1A 3LMMA 1HNXM 5ITTA 2F5QA 1N32M 3TWMA 3T38A 1IQPA 4LZZA 5KO3A 1R2YA 1L2BA 2H1RA 3SHFA 4JI4M 3I51A 2XH9A 3GRVA 4I4LA 1H6UA 3U6QA 5EP3A 1QVRA 4FWHA 5H37D 3L27A 1S3SA 3JR5A 4MB7A 1N34M 4HLQA 4JXJA 4QHSA 2O5RA 4JI3M 4GHAA 1QAQA 1OFIA 3DZDA 4IBBA 3R8FA 3GLHB 2QZ4A 2HHHM 3NBIA 4NSOB 4RF0A 4YHHM 3U61B 5LMNM 3PVSA 2CE7A 4DV7M 5EXPA 3SASA 3FUUA 1XHBA 3PFIA 3GLIB 3CF6E 5IWAM 4IJEA 3AOEC 3J2PB 2Z4RA 3T15A 1NNUC 1X37A 3UK6A 1GL6A 3LVVA 1Z5CA 1NJFA 4OU7A 5IZ7D 4B7HA 1TH2A 1PJIA 3HJSA 4M0WA 5ITQA 3KFUG 5DYIA 1TGUA 2R18A 3FTCA 2BJVA 3HJQA 4B3SM 4WURA 4G4OA 1DGHB 1NSFA 1ZAEA 3A45A 1ZQ9A 4MGHA 1N77A 3FYDA 2Z4SA 3I4YA 3TWKA 3U6LA 2XF3A 1SXJE 2HCBA 4GC5A 5FTLA 1OJLA 1XXHA 2ZBKB 8CATA 2P5TA 3RFWA 3RGSA 4PDIA 3DA1A 3A98B 2Z3XA 4LCBA 4LJ4A 3A42A 2DWLA 1DGBA 3L28A 3HWSA 1TDZA 2RGHA 1C1KA 1HQYE 4DV3M 1GKIA 1J09A 5IT9S 2ERCA 2LWXA 2R65A 4Z8XA 4A3VB 4CHTB 4AQYM 1SXJC 3HKPA 5EP2A 4MM3B 4DV5M 1J7KA 1YUBA 4AKHA 3Q8XA 2NQ8C 3D8BA 1E9RA 3DOAA 2J7OA 4PCZA 1J5EM 2OQ4A 2L09A 2D7EA 2Y20A 4IBFA 2LH0A 4L15A 5EP1A 4WW0A 5EXSA 3GPPA 2ZM6M 1SXJA 3VFDA 4LFAM 4LGYA 3HHWA 3THGA 3KW6A 2ZAOA 4FCVA 1GLNA 1WXQA 3KSXA 2I7PA 4JYAM 5FTMA 4LJ8A 4NL4H 2AHMA 2VQFM 1JR3A 4GH9A 2QP9X 4LJ6A 3ZC7B 4K0KM 4KLNA 4DV1M 3GO8A 4LF4M 4S12A 3KDSE 3PNYA 2C99A 4D82A 2XFSA 5BPVA 4LF6M 5C1BA 3GQ4A 4AKGA 2UXDM 3NWLA 3ZH9B 3MJ5A 1XNQM 1FNNA 4GITA 4JI0M 4AG5A 1XC8A 4W5WA 1JR3D 3KSJA 2DWMA 3TL4X 2V6ZM 2Q2EB 1W5TA 1IXSB 1N33M 3AJIB 4MGYE 4LRTA 3U6PA 2UXBM 1XNRM 3WHLA 2JA2A 1N75A 4JI8M 3SATA 2CEAA 1MX0A 4AKIA 3CF2A 5FTJA 2L6OA 2YR0A 3HHZA 1PJJA 5DYGA 2J7NA 3EIEA 3R9XB 2HKJA 1LV7A 1IY1A 4GKJM 3J27B 2BJWA 2UUCM 5EP4A 4NXMM 1NVMA 2G5GX 3D8LA 1T3TA 4X66M 3FTEA 4BBAA 1IBKM 2DVWB 1XMQM 4NRWA 2R4JA 4JI7M 4OX9M 3AL0C 1VDDA 4QOSA 1IBLM 1DO0A 4MGIE 4JI5M 4IIWA 3J7AS 4B08A 3SARA 4M0DA 3J7BA 3MHVC 2Z7JA 2UXCM 2KZUA 4LFBM 3KOWE 4NRVA 1IXRC 2LNHC 3KVWA 4M9XA 1YSYA 4Z6YA 3E4RA 4LY6A 4JI6M 1Z59A 4X65M 1N78A 1KSFX 3L25A 2DWZB 1L1ZA 3PXGA 1KYIA 2F5PA 2V1UA 1XXHB 3GRRA 4AI6A 2XFTA 3SAVA 4G4NA 3KOYE 3TE6A 4DV4M 2DHRA 2CFOA 4M9SA 1K3XA 2CHGA 3SYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 M;  4B3R M;  4DV5 M;  2UUA M;  4GKK M;  3U6O A;  1NNJ A;  2UUB M;  3U6C A;  4B3T M;  3U6D A;  4JV5 M;  3DOA A;  5ITR A;  3A46 A;  1Q39 A;  1Z5B A;  4PD2 A;  4PCZ A;  4DR3 M;  3U6E A;  1J5E M;  2OQ4 A;  4G4R A;  1I94 M;  4LF9 M;  3SAU A;  3GPP A;  2ZM6 M;  3GP1 A;  4LFA M;  2F5O A;  3SBJ A;  4DV2 M;  1PM5 A;  4LF7 M;  4JYA M;  4NXN M;  5FLX S;  1L2C A;  1HNZ M;  2F4V M;  4KHP M;  4DUZ M;  4DR2 M;  1IBM M;  4LFC M;  1KFV A;  4YY3 M;  3GPU A;  2VQF M;  1HNX M;  5ITT A;  2F5Q A;  4K0K M;  1N32 M;  4DV1 M;  3GO8 A;  2XZU A;  4LF4 M;  3TWM A;  3SAW A;  1Q3B A;  5LMU M;  1K82 A;  4LF6 M;  5ITX E;  5ITY A;  1R2Y A;  3GQ4 A;  1L2B A;  2E5L M;  2UXD M;  1XNQ M;  4JI4 M;  4JI0 M;  5BR8 M;  1XC8 A;  4JI1 M;  1L2D A;  2UU9 M;  3U6Q A;  2Q2E B;  3TWL A;  1N33 M;  4DUY M;  3U6P A;  3JR5 A;  2UXB M;  1XNR M;  4MB7 A;  3GPX A;  1N34 M;  2VQE M;  3OTO M;  4JI8 M;  3SAT A;  4JI3 M;  4ITQ A;  1MX0 A;  3VK7 A;  1R2Z A;  1HNW M;  1XMO M;  4PDG A;  1PJJ A;  4B3M M;  2HKJ A;  3GPY A;  3J80 S;  2HHH M;  2F5N A;  4GKJ M;  4YHH M;  2UUC M;  5LMN M;  1N36 M;  1L1T A;  4LF8 M;  4DV7 M;  4NXM M;  3SAS A;  1TDH A;  3C58 A;  4DR1 M;  5ITX A;  1HR0 M;  5IWA M;  4X66 M;  4DV6 M;  4DR4 M;  1IBK M;  5A2Q S;  4AQY M;  4CIS A;  1FJG M;  1XMQ M;  4NRW A;  2F5S A;  4LF5 M;  1Z5C A;  4JI7 M;  2XZF A;  4OX9 M;  1PJI A;  2OPF A;  3W0F A;  3GQ5 A;  5ITQ A;  1IBL M;  5ITU A;  3U6M A;  4JI5 M;  3J7A S;  3SAR A;  4X62 M;  4X64 M;  4B3S M;  4DR7 M;  4G4O A;  3T1Y M;  4JI2 M;  2UXC M;  3A45 A;  3J81 S;  3JR4 A;  4LFB M;  4NRV A;  3JAM S;  3TWK A;  3U6L A;  3VK8 A;  2ZBK B;  4JI6 M;  3GQ3 A;  1Z59 A;  4X65 M;  4PDI A;  3U6S A;  4G4Q A;  2EA0 A;  1L1Z A;  3A42 A;  2F5P A;  1Q3C A;  3T1H M;  1TDZ A;  3SAV A;  1K3W A;  4G4N A;  1Z5A A;  4DV0 M;  4DV3 M;  4DV4 M;  1K3X A;  5IT9 S;  1MU5 A;  4DR6 M;  1EE8 A; 
#chains in the Genus database with same CATH topology
 3AOE A;  5C18 A;  4DR5 M;  2XGN A;  4B3R M;  1IY0 A;  1TR8 A;  4GKK M;  1W5S A;  2QQ8 A;  4B7G A;  5KPR A;  2L4F A;  1ZV1 A;  1Z6T A;  1NNJ A;  2UUB M;  4B3T M;  2VF8 A;  3AKZ A;  4R7G A;  1AUA A;  4GC9 A;  2MJ5 B;  3FUV A;  3U6E A;  2OOA A;  3UGJ A;  4IBK A;  3CGW A;  2KXE A;  3GRY A;  3IHP A;  3PNV A;  5KQ8 A;  2K47 A;  2F5O A;  2D7G A;  3UZU A;  1IN4 A;  3IG8 A;  1YE9 A;  4IBD A;  4GIP A;  1QUT A;  3FUT A;  3LCV B;  1PM5 A;  1SXJ B;  1GJT A;  1YLA A;  3M7G A;  3W0L B;  1GL7 A;  1IBM M;  1G3I A;  3K2L A;  3GPU A;  3U5Z A;  4D80 A;  2R45 A;  5KQD A;  3KS4 A;  4QNM A;  4P16 A;  1OIZ A;  2XLJ A;  1G8P A;  3FRI A;  2VF7 A;  4XBO A;  4I5S A;  2FFJ A;  3KP0 E;  4MGZ E;  5LMU M;  1K82 A;  2KHH A;  3SHG B;  2M5Z A;  3FYC A;  5ITX E;  2DZN B;  2KNZ A;  1SG9 A;  3ZQJ A;  1OFH A;  1R7R A;  4QOZ C;  3HJ8 A;  4NOO B;  1WR1 B;  3SFZ A;  2JY7 A;  1NY5 A;  1QZE A;  3HHY A;  4JI1 M;  4LG2 A;  1E94 E;  2UU9 M;  4FCW A;  3H4J A;  3QWL A;  4R3D A;  4F1I A;  5IRE B;  3GLG E;  4DUY M;  3LVW A;  4GHL A;  5FTN A;  3HY5 A;  3GPX A;  2DZL A;  2V1C A;  3OTO M;  3VKG A;  1QQW A;  3E9S A;  2DNA A;  1PGY A;  2ZAM A;  3HHX A;  3VK7 A;  4ITQ A;  4TUW A;  5DNY A;  1XWI A;  3TQS A;  4PDG A;  1SXJ D;  1NJG A;  4G6Z A;  3HGI A;  1UFZ A;  3GLF A;  3AOG A;  3J80 S;  1QAN A;  2C98 A;  4IBJ A;  3KXE C;  4LF8 M;  4M9Z A;  3C3E A;  3CF0 A;  2MGW A;  3W67 A;  2DXI A;  1TDH A;  2C5R A;  2JP7 A;  5ITX A;  3SMS A;  1HR0 M;  2KNA A;  1NV8 A;  3E21 A;  4P17 A;  4DV6 M;  4XK8 F;  4IJF A;  2ZAN A;  5A2Q S;  1PJT A;  4CIS A;  1FJG M;  2HL7 A;  1VEK A;  4GEW A;  1DO2 A;  1NHW C;  2XZF A;  1IFY A;  3DFZ A;  2DZO B;  2D7H A;  3B89 A;  3KP1 E;  4BLC A;  3GLG A;  2OPF A;  1DGF A;  4GMQ A;  4AG6 A;  2DAG A;  5ITU A;  3U6M A;  2C9C A;  4MGK E;  2MRO B;  2CV0 A;  2KW0 A;  1QZM A;  2KNV A;  4OW0 A;  4X64 M;  4DR7 M;  2JXN A;  1RU3 A;  5EXT A;  4EIW A;  3T1Y M;  2KRU A;  3Q8G A;  3KOZ E;  5JI2 E;  3GRU A;  1WJ7 A;  1XB2 B;  2KA6 B;  4I8O A;  5DFL A;  3VK8 A;  1IN6 A;  3UJN A;  1TH4 A;  2DWN A;  4LJ9 A;  3RGP A;  4REZ A;  1R6B X;  1PJQ A;  4LJ5 A;  4Q7J A;  1HT1 E;  1GAB A;  2EA0 A;  2A5Y B;  1Q3C A;  3B7N A;  2CUZ A;  2J5Y A;  2JZ1 A;  1K3W A;  1JQJ C;  1UM8 A;  4RKU F;  3IEC A;  2JZ0 A;  4UN2 B;  1D0L A;  2R4E A;  4NC6 A;  1IY2 A;  4DR6 M;  2DAM A;  1IN7 A;  2BNK A;  4HL4 A;  2BWE A;  4G3O A;  3M6A A;  3U6D A;  2CP8 A;  1AIP C;  3L29 A;  5E26 A;  2CV2 A;  5ITR A;  1Q39 A;  1Z5B A;  2XEP A;  4PD2 A;  2Y0Q A;  4DR3 M;  1QYR A;  3SYK A;  3L26 A;  4QHT A;  1G59 A;  4G4R A;  3U60 A;  1EFU B;  2YFQ A;  3SAU A;  4L16 A;  3AFH A;  1NY6 A;  3HX3 A;  3TPZ A;  2LHC A;  4OVZ A;  1PRB A;  2X8A A;  3SBJ A;  5KPZ A;  2VDB B;  2QCU A;  1G4A E;  1P3Q Q;  3CTW B;  2W82 A;  3RE8 A;  4LF7 M;  4XGI A;  4NXN M;  5FLX S;  1L2C A;  4L8R C;  3HU3 A;  4KHP M;  4DUZ M;  4DR2 M;  2DAE A;  2DAK A;  3K8Z A;  4IBC A;  3ILK A;  1D2N A;  1IN8 A;  1BVS A;  2GNO A;  2RKO A;  3LQQ A;  2XZU A;  2FOI C;  2EUC A;  2G3Q A;  3SAW A;  3U5Z B;  1Q3B A;  3SMP A;  2X49 A;  1IM2 A;  3BOS A;  3SC3 A;  4B7F A;  5ITY A;  1T43 A;  1XXH E;  2CWB A;  2E5L M;  3HU2 A;  2WSC F;  3HZJ A;  4PT5 A;  2G8L A;  2QEN A;  5BR8 M;  4FVM A;  4KO8 A;  2XSZ A;  5EQT A;  3EIH A;  5FSW A;  1L2D A;  3MK6 A;  1ORY B;  3LQR A;  3TWL A;  5FTK A;  1G41 A;  4L6V 6;  4QNR A;  1L8Q A;  1TH3 A;  2CHV A;  4D81 A;  2VQE M;  3I4V A;  3GLH A;  1NO1 A;  3NBX X;  2QNJ A;  2DHY A;  7CAT A;  1R2Z A;  4I81 A;  3U61 A;  2XSZ D;  1HNW M;  3VDP A;  4IBE A;  1XMO M;  4B3M M;  1C7Y A;  3KS8 A;  2JY6 B;  4LJA A;  4L78 A;  2R0I A;  3C9P A;  3GPY A;  2QBY B;  1E32 A;  2YQZ A;  2DEN A;  2F5N A;  4LZJ A;  3GLI A;  1DGG A;  1N36 M;  2Y21 A;  1L1T A;  4CIZ A;  1QAO A;  3QYE A;  1WIV A;  3GLF B;  3C58 A;  4DR1 M;  1A5T A;  2I7N A;  1R4G A;  2QHO B;  4FWD A;  3HU1 A;  4DR4 M;  5E6J A;  1OIP A;  4KOD A;  3KOX E;  3VKH A;  3V76 A;  2QSF X;  3WHK A;  4II7 A;  4CGY B;  2F5S A;  1V92 A;  4LF5 M;  1I4W A;  3B7Q A;  2KEB A;  5KPT A;  1JR3 E;  4HEO A;  4ANR A;  3W0F A;  2WZJ A;  4LJ7 A;  3GQ5 A;  1D0M A;  1DGH A;  1VDL A;  2L7I A;  2O25 A;  4MH0 E;  2QBY A;  2LXE A;  4JN6 A;  3K1J A;  2LTU A;  3GLG B;  3K92 A;  4X62 M;  4IBI A;  1HQC A;  2RGO A;  4RF1 A;  4ZPX A;  2FNA A;  2L2D A;  3B9P A;  4JI2 M;  4FW9 A;  3J81 S;  3JR4 A;  1OKS A;  2VII A;  3JAM S;  1VQ1 A;  1HJP A;  2KZS A;  2X4A A;  4IBG A;  4LRS A;  4LGM A;  3I04 M;  2EO2 A;  3M0E A;  2N35 A;  3VLF B;  5GKN A;  5JI3 E;  3GQ3 A;  4Y28 F;  3U6S A;  4G4Q A;  2ZTD A;  2R6F A;  3AV0 A;  3FUW A;  4FWG A;  4GRI A;  3T1H M;  3FKE A;  3VDU A;  2KRK A;  2EKK A;  1Z5A A;  4DV0 M;  3FD9 A;  2CHQ A;  1LTM A;  3FUX A;  1E9S A;  1MU5 A;  5EJC A;  3LW5 F;  3UMM A;  1TF0 B;  1EE8 A;  2UUA M;  2M60 A;  1QAM A;  2C9O A;  3U6O A;  1T6O A;  2JY5 A;  1OTR A;  3U6C A;  3L2A A;  4JV5 M;  5F3W A;  5L8R F;  4RNA A;  2C96 A;  4BB9 A;  4AW4 A;  3A46 A;  4KT0 F;  4FCT A;  1JB0 F;  2R46 A;  1I94 M;  2FE8 A;  1IN5 A;  2QPA A;  4LF9 M;  1GVN A;  2YNM D;  2FS1 A;  3IG5 A;  3ZCB B;  2APL A;  4AZF A;  1IXZ A;  3GP1 A;  3FTF A;  2LVA A;  1DV0 A;  3QAU A;  3U60 B;  4NSR A;  5EXX A;  2JNH A;  4L4U A;  1Y8G A;  4DV2 M;  1HNZ M;  4OVZ B;  2F4V M;  2L7H A;  1NHG C;  2JY8 A;  4FD2 A;  2Y0T A;  4LFC M;  2R62 A;  3FTD A;  4YY3 M;  1KFV A;  3H4M A;  1HT2 E;  2CV1 A;  3LMM A;  1V33 A;  1HNX M;  5ITT A;  2F5Q A;  1N32 M;  1D0K A;  3C3D A;  3TWM A;  3T38 A;  1IQP A;  4LZZ A;  5KO3 A;  1R2Y A;  1L2B A;  2HWJ A;  2H1R A;  3SHF A;  2JWS A;  4JI4 M;  1IXS A;  3I51 A;  2XH9 A;  1G71 A;  3GRV A;  4I4L A;  1H6U A;  3U6Q A;  5EP3 A;  1QVR A;  4FWH A;  5H37 D;  3L27 A;  1S3S A;  3JR5 A;  4MB7 A;  1N34 M;  4HLQ A;  4JXJ A;  4QHS A;  2O5R A;  4JI3 M;  1QUS A;  4GHA A;  1MN3 A;  1WGL A;  1QAQ A;  1OFI A;  3DZD A;  4IBB A;  3R8F A;  3GLH B;  2QZ4 A;  2HHH M;  3NBI A;  4NSO B;  4RF0 A;  4YHH M;  3U61 B;  5LMN M;  3PVS A;  2CE7 A;  4DV7 M;  5EXP A;  3SAS A;  3FUU A;  1OQY A;  1XHB A;  2LHG A;  3PFI A;  2MH8 A;  3GLI B;  2KDL A;  3CF6 E;  5IWA M;  4IJE A;  3AOE C;  3J2P B;  2O01 F;  2Z4R A;  2LBC A;  2MR9 A;  3T15 A;  3LCU A;  1NNU C;  1X37 A;  3I01 M;  3UK6 A;  1GL6 A;  1ZMU A;  2GQF A;  3LVV A;  1Z5C A;  1NJF A;  4OU7 A;  5IZ7 D;  4B7H A;  1TH2 A;  1PJI A;  3HJS A;  4M0W A;  4WP2 A;  5ITQ A;  3KFU G;  5DYI A;  1TGU A;  2R18 A;  3FTC A;  2BJV A;  3HJQ A;  1VEJ A;  4B3S M;  4R71 A;  4WUR A;  4G4O A;  1DGH B;  1NSF A;  1ZAE A;  1ZMV A;  3A45 A;  1ZQ9 A;  4MGH A;  1N77 A;  3FYD A;  2Z4S A;  3I4Y A;  3TWK A;  3U6L A;  2Z8Y M;  2XF3 A;  1SXJ E;  2HCB A;  4GC5 A;  5FTL A;  1V34 A;  1OJL A;  1XXH A;  1PJS A;  2ZBK B;  1CUK A;  8CAT A;  2P5T A;  3RFW A;  3RGS A;  4PDI A;  3DA1 A;  3A98 B;  2Z3X A;  2BWB A;  4LCB A;  4LJ4 A;  3A42 A;  2DWL A;  1DGB A;  3L28 A;  2HAK A;  3HWS A;  1TDZ A;  2RGH A;  1C1K A;  1HQY E;  2L4E A;  4DV3 M;  1GKI A;  1J09 A;  1NV9 A;  3GLF E;  4DBG B;  5IT9 S;  2ERC A;  2B3T A;  2LWX A;  2R65 A;  4Z8X A;  4A3V B;  4CHT B;  1SXJ C;  3HKP A;  5EP2 A;  4AQY M;  4MM3 B;  4DV5 M;  1J7K A;  1YUB A;  2JUJ A;  2K6B A;  4AKH A;  3K9O A;  3Q8X A;  2NQ8 C;  2RRU A;  3D8B A;  1E9R A;  3DOA A;  4F2L A;  2LVQ D;  2J7O A;  4PCZ A;  3B7Z A;  1J5E M;  2OQ4 A;  2L09 A;  2D7E A;  2Y20 A;  4IBF A;  2LH0 A;  4L15 A;  5EP1 A;  2ZTC A;  4WW0 A;  5EXS A;  3GPP A;  2DI0 A;  1OAI A;  1SXJ A;  3VFD A;  4LFA M;  2LVO C;  4LGY A;  1VG5 A;  2ZM6 M;  3HHW A;  3MMP A;  3FE3 A;  3THG A;  3KW6 A;  2ZAO A;  4FCV A;  1GLN A;  1WXQ A;  3KSX A;  2I7P A;  4JYA M;  5FTM A;  1MJG M;  4LJ8 A;  4NL4 H;  2AHM A;  2VQF M;  1JR3 A;  4GH9 A;  2QP9 X;  4LJ6 A;  3ZC7 B;  4K0K M;  4KLN A;  1WGN A;  4DV1 M;  3GO8 A;  4LF4 M;  4S12 A;  3KDS E;  3PNY A;  2C99 A;  4D82 A;  2XFS A;  1OAO C;  1VEG A;  5BPV A;  4LF6 M;  1WHC A;  5C1B A;  3GQ4 A;  4AKG A;  4CJ6 A;  2UXD M;  3NWL A;  3ZH9 B;  3FRH A;  3MJ5 A;  1FNN A;  4GIT A;  4JI0 M;  4AG5 A;  1XC8 A;  2FH0 A;  4W5W A;  1XNQ M;  1JR3 D;  3KSJ A;  1QDR A;  2DWM A;  1GJS A;  3TL4 X;  2V6Z M;  2DKL A;  1W5T A;  2Q2E B;  1IXS B;  1N33 M;  3AJI B;  2LVP C;  4MGY E;  4LRT A;  3U6P A;  2UXB M;  1XNR M;  3WHL A;  2JA2 A;  1N75 A;  2OOB A;  2OO9 A;  4JI8 M;  3SAT A;  2CEA A;  1MX0 A;  2R44 A;  4AKI A;  3CF2 A;  5FTJ A;  2L6O A;  2YR0 A;  3HHZ A;  1PJJ A;  5DYG A;  2J7N A;  2WSE F;  3EIE A;  2HKJ A;  1LV7 A;  3R9X B;  1IY1 A;  4GKJ M;  3B74 A;  3J27 B;  2BJW A;  1F4I A;  2UUC M;  5EP4 A;  4NXM M;  1NVM A;  1QDT A;  2G5G X;  3D8L A;  2K0B X;  1T3T A;  4X66 M;  2LVN C;  2WSF F;  3FTE A;  4BBA A;  1IBK M;  3BXW A;  1Q02 A;  2DVW B;  1XMQ M;  4NRW A;  2R4J A;  4JI7 M;  4OX9 M;  3AL0 C;  1VDD A;  4QOS A;  1IBL M;  1DO0 A;  3E46 A;  4MGI E;  4JI5 M;  4IIW A;  3J7A S;  4B08 A;  3SAR A;  1GO5 A;  4M0D A;  3J7B A;  3K9P A;  3MHV C;  3T6P A;  2Z7J A;  2UXC M;  2KZU A;  3QYB A;  3W68 A;  4LFB M;  3KOW E;  1R5L A;  4NRV A;  2CRU A;  1IXR C;  2LNH C;  3KVW A;  3BBZ A;  4M9X A;  1YSY A;  4Z6Y A;  3E4R A;  4LY6 A;  4JI6 M;  1Z59 A;  4X65 M;  2H5X A;  1N78 A;  3F92 A;  1KSF X;  1ZMW A;  2DWZ B;  3L25 A;  1L1Z A;  3PXG A;  1KYI A;  2F5P A;  2V1U A;  3GLH E;  1XXH B;  3GRR A;  4AI6 A;  2XFT A;  3SAV A;  4G4N A;  3KOY E;  1EIJ A;  3TE6 A;  2EKF A;  2EJS A;  4DV4 M;  2DHR A;  2K9D A;  2CFO A;  4M9S A;  1K3X A;  1TTE A;  2CHG A;  3SYL A;  3GLI E;  2DAI A; 
#chains in the Genus database with same CATH homology
 3AOE A;  5C18 A;  4DR5 M;  2XGN A;  4B3R M;  1IY0 A;  4GKK M;  1W5S A;  4B7G A;  5KPR A;  1Z6T A;  1NNJ A;  2UUB M;  4B3T M;  3AKZ A;  4R7G A;  4GC9 A;  3FUV A;  3U6E A;  3UGJ A;  4IBK A;  2KXE A;  3GRY A;  3PNV A;  5KQ8 A;  2K47 A;  2F5O A;  2D7G A;  3UZU A;  1IN4 A;  3IG8 A;  1YE9 A;  4IBD A;  4GIP A;  3FUT A;  1PM5 A;  1SXJ B;  3M7G A;  3W0L B;  1GL7 A;  1IBM M;  1G3I A;  3K2L A;  3GPU A;  3U5Z A;  4D80 A;  2R45 A;  5KQD A;  3KS4 A;  4QNM A;  4P16 A;  2XLJ A;  1G8P A;  4XBO A;  4I5S A;  2FFJ A;  3KP0 E;  4MGZ E;  5LMU M;  1K82 A;  3SHG B;  2M5Z A;  3FYC A;  5ITX E;  2DZN B;  1OFH A;  1R7R A;  4QOZ C;  3HJ8 A;  4NOO B;  3SFZ A;  3HHY A;  1NY5 A;  4JI1 M;  4LG2 A;  1E94 E;  2UU9 M;  4FCW A;  3QWL A;  4R3D A;  5IRE B;  4DUY M;  4GHL A;  3LVW A;  5FTN A;  3GPX A;  2V1C A;  3OTO M;  3VKG A;  1QQW A;  3E9S A;  4ITQ A;  2ZAM A;  3HHX A;  3VK7 A;  4TUW A;  5DNY A;  1XWI A;  3TQS A;  4PDG A;  1SXJ D;  1NJG A;  4G6Z A;  3HGI A;  3GLF A;  3AOG A;  3J80 S;  1QAN A;  2C98 A;  4IBJ A;  3KXE C;  4LF8 M;  4M9Z A;  3CF0 A;  2DXI A;  1TDH A;  2C5R A;  5ITX A;  1HR0 M;  3SMS A;  4DV6 M;  4IJF A;  2ZAN A;  5A2Q S;  4CIS A;  1FJG M;  2HL7 A;  1DO2 A;  1NHW C;  2XZF A;  3DFZ A;  2DZO B;  2D7H A;  3KP1 E;  3GLG A;  4BLC A;  2OPF A;  1DGF A;  4GMQ A;  4AG6 A;  5ITU A;  3U6M A;  2C9C A;  4MGK E;  2CV0 A;  2KW0 A;  1QZM A;  4X64 M;  4OW0 A;  4DR7 M;  5EXT A;  4EIW A;  3T1Y M;  2KRU A;  3KOZ E;  5JI2 E;  3GRU A;  2KA6 B;  4I8O A;  3VK8 A;  1IN6 A;  3UJN A;  1TH4 A;  2DWN A;  4LJ9 A;  3RGP A;  4REZ A;  1R6B X;  4LJ5 A;  1HT1 E;  2EA0 A;  2A5Y B;  1Q3C A;  2CUZ A;  1K3W A;  1JQJ C;  1UM8 A;  2R4E A;  1IY2 A;  4DR6 M;  1IN7 A;  2BNK A;  4HL4 A;  3M6A A;  3U6D A;  3L29 A;  5E26 A;  2CV2 A;  5ITR A;  1Q39 A;  1Z5B A;  2XEP A;  4PD2 A;  2Y0Q A;  4DR3 M;  1QYR A;  3SYK A;  3L26 A;  4QHT A;  1G59 A;  4G4R A;  3U60 A;  2YFQ A;  3SAU A;  4L16 A;  3AFH A;  1NY6 A;  3TPZ A;  4OVZ A;  2X8A A;  3SBJ A;  5KPZ A;  2QCU A;  1G4A E;  3CTW B;  2W82 A;  3RE8 A;  4LF7 M;  4XGI A;  4NXN M;  5FLX S;  1L2C A;  4L8R C;  3HU3 A;  4KHP M;  4DUZ M;  4DR2 M;  3K8Z A;  4IBC A;  3ILK A;  1D2N A;  1IN8 A;  2RKO A;  3LQQ A;  2XZU A;  2FOI C;  2EUC A;  3SAW A;  3U5Z B;  1Q3B A;  3SMP A;  2X49 A;  1IM2 A;  3BOS A;  3SC3 A;  4B7F A;  5ITY A;  2E5L M;  3HU2 A;  4PT5 A;  2G8L A;  2QEN A;  5BR8 M;  4FVM A;  4KO8 A;  2XSZ A;  5EQT A;  3EIH A;  5FSW A;  1L2D A;  3MK6 A;  1ORY B;  3LQR A;  3TWL A;  5FTK A;  1G41 A;  4QNR A;  1L8Q A;  1TH3 A;  2CHV A;  4D81 A;  2VQE M;  3I4V A;  3GLH A;  7CAT A;  1R2Z A;  4I81 A;  3U61 A;  2XSZ D;  1HNW M;  3VDP A;  4IBE A;  1XMO M;  4B3M M;  3KS8 A;  4LJA A;  4L78 A;  2QBY B;  3GPY A;  1E32 A;  2YQZ A;  2F5N A;  4LZJ A;  3GLI A;  1DGG A;  1N36 M;  2Y21 A;  1L1T A;  1QAO A;  3GLF B;  3C58 A;  4DR1 M;  2I7N A;  4FWD A;  3HU1 A;  4DR4 M;  5E6J A;  4KOD A;  3KOX E;  3VKH A;  3WHK A;  4II7 A;  4CGY B;  2F5S A;  4LF5 M;  1I4W A;  2KEB A;  5KPT A;  3W0F A;  3GQ5 A;  4LJ7 A;  1DGH A;  4MH0 E;  2L7I A;  2QBY A;  2LXE A;  4JN6 A;  3K1J A;  3GLG B;  3K92 A;  4X62 M;  4IBI A;  1HQC A;  2RGO A;  4RF1 A;  4ZPX A;  2FNA A;  3B9P A;  4JI2 M;  4FW9 A;  3J81 S;  3JR4 A;  2VII A;  3JAM S;  2KZS A;  4IBG A;  2X4A A;  4LRS A;  4LGM A;  2EO2 A;  3M0E A;  3VLF B;  5GKN A;  5JI3 E;  3GQ3 A;  3U6S A;  4G4Q A;  3AV0 A;  3FUW A;  4FWG A;  4GRI A;  3T1H M;  3FKE A;  3VDU A;  2KRK A;  1Z5A A;  4DV0 M;  3FD9 A;  2CHQ A;  3FUX A;  1E9S A;  1MU5 A;  5EJC A;  3UMM A;  1EE8 A;  2UUA M;  1QAM A;  2C9O A;  2M60 A;  3U6O A;  3U6C A;  3L2A A;  4JV5 M;  5F3W A;  4RNA A;  2C96 A;  4BB9 A;  4AW4 A;  3A46 A;  4FCT A;  2R46 A;  1I94 M;  2FE8 A;  1IN5 A;  2QPA A;  4LF9 M;  1GVN A;  2YNM D;  3FTF A;  3IG5 A;  3ZCB B;  4AZF A;  3GP1 A;  1IXZ A;  3QAU A;  3U60 B;  4NSR A;  5EXX A;  4L4U A;  4DV2 M;  1HNZ M;  4OVZ B;  2F4V M;  2L7H A;  1NHG C;  4FD2 A;  2Y0T A;  4LFC M;  2R62 A;  3FTD A;  4YY3 M;  1KFV A;  3H4M A;  1HT2 E;  2CV1 A;  3LMM A;  1HNX M;  5ITT A;  2F5Q A;  1N32 M;  3TWM A;  3T38 A;  1IQP A;  4LZZ A;  5KO3 A;  1R2Y A;  1L2B A;  2H1R A;  3SHF A;  4JI4 M;  3I51 A;  2XH9 A;  3GRV A;  4I4L A;  1H6U A;  3U6Q A;  5EP3 A;  1QVR A;  4FWH A;  5H37 D;  3L27 A;  1S3S A;  3JR5 A;  4MB7 A;  1N34 M;  4HLQ A;  4JXJ A;  4QHS A;  2O5R A;  4JI3 M;  4GHA A;  1QAQ A;  1OFI A;  3DZD A;  4IBB A;  3R8F A;  3GLH B;  2QZ4 A;  2HHH M;  3NBI A;  4NSO B;  4RF0 A;  4YHH M;  3U61 B;  5LMN M;  3PVS A;  2CE7 A;  4DV7 M;  5EXP A;  3SAS A;  3FUU A;  1XHB A;  3PFI A;  3GLI B;  3CF6 E;  5IWA M;  4IJE A;  3AOE C;  3J2P B;  2Z4R A;  3T15 A;  1NNU C;  1X37 A;  3UK6 A;  1GL6 A;  3LVV A;  1Z5C A;  1NJF A;  4OU7 A;  5IZ7 D;  4B7H A;  1TH2 A;  1PJI A;  3HJS A;  4M0W A;  5ITQ A;  3KFU G;  5DYI A;  1TGU A;  2R18 A;  3FTC A;  2BJV A;  3HJQ A;  4B3S M;  4WUR A;  4G4O A;  1DGH B;  1NSF A;  1ZAE A;  3A45 A;  1ZQ9 A;  4MGH A;  1N77 A;  3FYD A;  2Z4S A;  3I4Y A;  3TWK A;  3U6L A;  2XF3 A;  1SXJ E;  2HCB A;  4GC5 A;  5FTL A;  1OJL A;  1XXH A;  2ZBK B;  8CAT A;  2P5T A;  3RFW A;  3RGS A;  4PDI A;  3DA1 A;  3A98 B;  2Z3X A;  4LCB A;  4LJ4 A;  3A42 A;  2DWL A;  1DGB A;  3L28 A;  3HWS A;  1TDZ A;  2RGH A;  1C1K A;  1HQY E;  4DV3 M;  1GKI A;  1J09 A;  5IT9 S;  2ERC A;  2LWX A;  2R65 A;  4Z8X A;  4A3V B;  4CHT B;  4AQY M;  1SXJ C;  3HKP A;  5EP2 A;  4MM3 B;  4DV5 M;  1J7K A;  1YUB A;  4AKH A;  3Q8X A;  2NQ8 C;  3D8B A;  1E9R A;  3DOA A;  2J7O A;  4PCZ A;  1J5E M;  2OQ4 A;  2L09 A;  2D7E A;  2Y20 A;  4IBF A;  2LH0 A;  4L15 A;  5EP1 A;  4WW0 A;  5EXS A;  3GPP A;  2ZM6 M;  1SXJ A;  3VFD A;  4LFA M;  4LGY A;  3HHW A;  3THG A;  3KW6 A;  2ZAO A;  4FCV A;  1GLN A;  1WXQ A;  3KSX A;  2I7P A;  4JYA M;  5FTM A;  4LJ8 A;  4NL4 H;  2AHM A;  2VQF M;  1JR3 A;  4GH9 A;  2QP9 X;  4LJ6 A;  3ZC7 B;  4K0K M;  4KLN A;  4DV1 M;  3GO8 A;  4LF4 M;  4S12 A;  3KDS E;  3PNY A;  2C99 A;  4D82 A;  2XFS A;  5BPV A;  4LF6 M;  5C1B A;  3GQ4 A;  4AKG A;  2UXD M;  3NWL A;  3ZH9 B;  3MJ5 A;  1XNQ M;  1FNN A;  4GIT A;  4JI0 M;  4AG5 A;  1XC8 A;  4W5W A;  1JR3 D;  3KSJ A;  2DWM A;  3TL4 X;  2V6Z M;  2Q2E B;  1W5T A;  1IXS B;  1N33 M;  3AJI B;  4MGY E;  4LRT A;  3U6P A;  2UXB M;  1XNR M;  3WHL A;  2JA2 A;  1N75 A;  4JI8 M;  3SAT A;  2CEA A;  1MX0 A;  4AKI A;  3CF2 A;  5FTJ A;  2L6O A;  2YR0 A;  3HHZ A;  1PJJ A;  5DYG A;  2J7N A;  3EIE A;  3R9X B;  2HKJ A;  1LV7 A;  1IY1 A;  4GKJ M;  3J27 B;  2BJW A;  2UUC M;  5EP4 A;  4NXM M;  1NVM A;  2G5G X;  3D8L A;  1T3T A;  4X66 M;  3FTE A;  4BBA A;  1IBK M;  2DVW B;  1XMQ M;  4NRW A;  2R4J A;  4JI7 M;  4OX9 M;  3AL0 C;  1VDD A;  4QOS A;  1IBL M;  1DO0 A;  4MGI E;  4JI5 M;  4IIW A;  3J7A S;  4B08 A;  3SAR A;  4M0D A;  3J7B A;  3MHV C;  2Z7J A;  2UXC M;  2KZU A;  4LFB M;  3KOW E;  4NRV A;  1IXR C;  2LNH C;  3KVW A;  4M9X A;  1YSY A;  4Z6Y A;  3E4R A;  4LY6 A;  4JI6 M;  1Z59 A;  4X65 M;  1N78 A;  1KSF X;  3L25 A;  2DWZ B;  1L1Z A;  3PXG A;  1KYI A;  2F5P A;  2V1U A;  1XXH B;  3GRR A;  4AI6 A;  2XFT A;  3SAV A;  4G4N A;  3KOY E;  3TE6 A;  4DV4 M;  2DHR A;  2CFO A;  4M9S A;  1K3X A;  2CHG A;  3SYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...