4DR2M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr2M02
4PD2A 4JI4M 4JI5M 3SAUA 3SASA 1EE8A 2UUAM 4MB7A 4JI3M 1J5EM 4LF9M 2F5OA 3SARA 4G4OA 3J81S 4NXNM 4GKKM 1N33M 2UXDM 4LF7M 3JAMS 4JI1M 4YY3M 4B3SM 1IBLM 3U6OA 4K0KM 1TDHA 5ITTA 2E5LM 3TWKA 2ZBKB 4NRVA 4X62M 4DV6M 4DV0M 1L1TA 2UU9M 3SATA 4CISA 1Q3CA 3GQ5A 4JI2M 1Q3BA 2HKJA 2UXCM 4JYAM 2UUBM 1NNJA 4DR5M 4G4QA 3TWLA 4DV7M 5A2QS 4DR3M 1XMQM 1HNWM 4B3TM 3U6SA 1XC8A 1XNRM 4NRWA 1HNXM 4JI6M 1XMOM 1L2DA 4AQYM 3GQ4A 4DUZM 1Z59A 3SBJA 3SAWA 1IBMM 4ITQA 4KHPM 3JR5A 2F5PA 4DR7M 4NXMM 4B3MM 2VQEM 3J7AS 2XZUA 4PDGA 1KFVA 3J80S 1PM5A 2F5QA 4OX9M 3TWMA 1XNQM 4DR4M 4LFAM 3GPYA 4DUYM 4DV3M 3A45A 1Z5CA 3U6QA 2Q2EB 3SAVA 1HNZM 5ITYA 1I94M 1Z5BA 5FLXS 4DV2M 4DV4M 1L2CA 3T1YM 3GO8A 1PJJA 4JI8M 4LFBM 1Q39A 4PCZA 1HR0M 1R2YA 3DOAA 4JI0M 3VK7A 4X65M 4DR2M 4LF6M 2XZFA 5BR8M 3GPXA 3U6DA 2ZM6M 4JV5M 2OPFA 3GQ3A 4B3RM 4G4RA 1MX0A 2VQFM 4YHHM 1N36M 4DV5M 1PJIA 3C58A 5LMUM 3U6LA 4GKJM 5ITQA 1L2BA 4LFCM 3A42A 3VK8A 4LF5M 1IBKM 5IT9S 3GP1A 1N32M 1K3XA 4LF8M 3U6PA 1R2ZA 4JI7M 2OQ4A 4DR6M 1K3WA 4X64M 2UXBM 2F5SA 4G4NA 2HHHM 4LF4M 3U6MA 1Z5AA 3U6EA 1L1ZA 1MU5A 2UUCM 1FJGM 4X66M 3GPUA 5IWAM 5LMNM 4PDIA 4DR1M 2F4VM 2F5NA 2EA0A 4DV1M 1N34M 3OTOM 5ITUA 3T1HM 3JR4A 5ITXA 3W0FA 5ITRA 5ITXE 1TDZA 1K82A 3GPPA 3A46A 3U6CA
chains in the Genus database with same CATH superfamily
4KT0F 4PD2A 1OIZA 2G8LA 4JI5M 2XF3A 2QBYB 5KPRA 1EE8A 5C18A 2CV0A 3J2PB 4LF9M 2JA2A 2YNMD 3BXWA 5E6JA 3TPZA 4L16A 1IY1A 2CP8A 2M60A 1AIPC 2B3TA 2O01F 2UXDM 2JY6B 5JI2E 4GC9A 4GH9A 3GLGA 2DI0A 4KHPM 4FWDA 4HEOA 1HT2E 4G3OA 1LV7A 5KPTA 2H1RA 1V34A 1TDHA 2G5GX 4IBGA 1WR1B 4NRVA 3SHGB 1ZAEA 4NC6A 1KYIA 1IM2A 2JP7A 2UXCM 3KXEC 4JYAM 3M6AA 3T15A 2R46A 1QAOA 4LJ8A 1D0MA 4RF1A 5A2QS 2DAMA 2CWBA 3J27B 5EXPA 2MGWA 1ZMWA 4KLNA 3HJSA 1S3SA 1XNRM 1HNXM 3LVWA 3PNYA 1E94E 1DGFA 1QAQA 2ZAOA 4M0WA 2KHHA 3GQ4A 4KO8A 1L2DA 4ITQA 2GNOA 4DR7M 4KODA 1IXSB 2LVQD 4ZPXA 3H4JA 3J80S 2KA6B 2VF8A 2ZANA 2DWZB 2KDLA 1IN8A 3SHFA 4M9XA 4IBCA 1SXJC 3AL0C 3B9PA 1J7KA 3A45A 4OW0A 3DA1A 4MM3B 5EP1A 2LTUA 2WSEF 4FCVA 3U6QA 1CUKA 3I4YA 3SAVA 2QCUA 1QANA 4DV2M 2MROB 4DV4M 2QNJA 2WSFF 3ZCBB 3GO8A 2FS1A 4PCZA 4CJ6A 1R5LA 2JUJA 2O25A 3QAUA 2XLJA 2KXEA 4X65M 1DV0A 3KSXA 4NL4H 2CV2A 2ZTDA 4GC5A 2DZNB 5KPZA 2ZM6M 2OPFA 4DBGB 4L4UA 3VFDA 2DHYA 3T38A 1MX0A 3I51A 2X8AA 2VQFM 2CEAA 3FUTA 4DV5M 4GHLA 1TGUA 2LNHC 1DGGA 2CHGA 2R4EA 4AKGA 5F3WA 3U6LA 2W82A 4GKJM 5FTJA 1L2BA 1VQ1A 4FVMA 3CF6E 3HJQA 3E9SA 4AKIA 3A42A 4LF5M 4LCBA 4L15A 3GP1A 3AOEA 1NHGC 2R62A 1Z6TA 1SG9A 3GLIB 1R2ZA 1K3XA 4LF8M 1YE9A 2BWBA 3C9PA 4S12A 2EKFA 1QZMA 1ZQ9A 5EXTA 3KDSE 2DWMA 4M0DA 4LF4M 3ILKA 1L1ZA 2UUCM 3B74A 1JR3E 3KOXE 5LMNM 1OIPA 2D7HA 1T3TA 4JN6A 4PDIA 1OTRA 4D82A 2F5NA 1NNUC 4CHTB 1C7YA 2CHQA 2HL7A 2DAEA 5H37D 4F2LA 3OTOM 5ITUA 1XXHE 3MJ5A 3JR4A 1JR3D 5ITXA 5ITRA 2L09A 1K82A 2JY8A 1E9RA 3GPPA 4G4NA 2LVNC 3U6CA 3K1JA 1R6BX 4AG5A 3RGSA 4JI4M 4NSRA 1NJFA 4LJ9A 2DKLA 1R7RA 1D0LA 4R3DA 3SAUA 3QYEA 4QNRA 1QDTA 4D81A 1XB2B 2RRUA 2J5YA 3K92A 1QZEA 2L4EA 4LGMA 4G4OA 2F5OA 4NXNM 3SARA 3GLIA 3R9XB 1PRBA 2LWXA 2A5YB 1WHCA 1XXHA 1WXQA 2R65A 3VKHA 1DGBA 4IJEA 1PGYA 2DWLA 2E5LM 2MH8A 2ZBKB 1OQYA 3FTCA 5EQTA 3TWKA 1L1TA 4Y28F 2UU9M 4L8RC 2QSFX 3GQ5A 4JI2M 1Q3BA 4M9ZA 3E21A 1G41A 3HGIA 2BJVA 1NNJA 2UUBM 3GLHE 5JI3E 3WHLA 3CF2A 1YSYA 2J7OA 1HNWM 2L6OA 2VF7A 1J09A 4HL4A 4NRWA 7CATA 1V92A 4OVZB 3HY5A 1V33A 3MMPA 3FUUA 4I81A 1Z59A 2DNAA 4MGIE 4MGZE 4DUZM 4AQYM 1IN6A 1KSFX 1OKSA 2CE7A 2KRUA 2F5PA 2R45A 2KNZA 3K9OA 1OJLA 3SYKA 3GLIE 3SFZA 2F5QA 4OX9M 1OAOC 5L8RF 4LFAM 2M5ZA 3KFUG 3L26A 5DYGA 1NSFA 3LQQA 4AZFA 3HHZA 2WZJA 3PNVA 4LJ7A 1HNZM 5ITYA 1I94M 5FLXS 2C98A 4GMQA 3B7QA 3SMPA 1G59A 1PJJA 4LRTA 4JI8M 4IBBA 1ZMUA 1VEKA 1HR0M 3KP1E 4G6ZA 4TUWA 2J7NA 3U5ZB 5EXXA 3ZQJA 4A3VB 4REZA 3UZUA 3VK7A 4LZJA 2LVOC 3I4VA 2XZFA 2Z7JA 3UK6A 3LCUA 1XXHB 1D0KA 3U6DA 3VDPA 2DAGA 3K8ZA 4JV5M 3FYDA 3GQ3A 3L27A 3B89A 1PJSA 1NVMA 1HQYE 3W68A 4I8OA 4Z8XA 4Q7JA 1HJPA 4IBKA 5KO3A 5LMUM 2R6FA 4EIWA 2CUZA 5ITQA 3AOEC 3LVVA 4FWGA 4LFCM 4UN2B 2QBYA 1YLAA 1IBKM 2JWSA 5IT9S 3KOYE 1BVSA 4OVZA 3KVWA 3UGJA 2Y21A 1RU3A 4JI7M 1LTMA 3W0LB 2YR0A 4DR6M 2LVAA 4XK8F 3MK6A 4X64M 3UJNA 3U5ZA 2Z8YM 2JZ0A 2HHHM 3I04M 3U6MA 3GLHA 1SXJD 2Y20A 2CHVA 2DWNA 4X66M 1PJQA 2X49A 5IWAM 4B7GA 3L25A 3T6PA 2KEBA 1PJTA 2F4VM 1NJGA 3KP0E 3SC3A 3Q8XA 1QQWA 2O5RA 5EJCA 2DENA 3AKZA 4M9SA 1VEGA 1N34M 1DO2A 1SXJE 3HU2A 3NBIA 5IREB 2LH0A 1WGLA 4CGYB 1WJ7A 4LJ6A 1QYRA 3KS4A 2C9OA 3CTWB 4D80A 1AUAA 3FYCA 3FTFA 2UUAM 4MB7A 3M7GA 3U61A 2C99A 3GRRA 4F1IA 3D8BA 1N33M 3FTDA 1NY5A 3JAMS 5EP2A 4JI1M 4YY3M 1IN7A 4L6V6 4GEWA 2CV1A 1IBLM 2DVWB 2EO2A 3U6OA 3IG5A 4K0KM 1E32A 5ITTA 2BJWA 2HWJA 1GL6A 1GL7A 1Q02A 2K9DA 2YQZA 4DV0M 2CFOA 4DV6M 3SATA 4CISA 2ZTCA 2DZLA 3K2LA 3B7ZA 5FSWA 3HKPA 4JXJA 2QHOB 4DR5M 4G4QA 3NBXX 4NOOB 3FUXA 1IXZA 1GO5A 4DV7M 1VDDA 3FUWA 4I4LA 2KZSA 2RGOA 1A5TA 3ZH9B 1IQPA 3U6SA 1E9SA 3L28A 1NV8A 2N35A 1MN3A 2XSZD 1XMOM 1ORYB 4JI6M 3SBJA 3D8LA 4ANRA 4MH0E 3JR5A 2XFTA 3QWLA 4FW9A 4II7A 2VIIA 2VQEM 1NV9A 4QNMA 2XZUA 3J7AS 1OFIA 3DZDA 2VDBB 3TWMA 4GHAA 4IBIA 2KW0A 2KNVA 2OOBA 1OFHA 2FNAA 3GPYA 4DV3M 1TTEA 3RFWA 1Z5CA 2L4FA 2EJSA 2KZUA 3FTEA 2C5RA 1OAIA 4NSOB 1Z5BA 1IFYA 3T1YM 1GJTA 1NHWC 3B7NA 3MHVC 4LY6A 4LFBM 5E26A 5EXSA 3DOAA 1W5TA 4RF0A 3AJIB 3C3DA 2C9CA 4DR2M 3L29A 3GPXA 4MGKE 2XFSA 3KSJA 3RGPA 1IY2A 3SYLA 3IHPA 1QDRA 1IN5A 1TR8A 3TQSA 4R7GA 3VLFB 1HT1E 1X37A 4YHHM 1N36M 5DNYA 4GITA 1PJIA 1ZMVA 1G4AE 2C96A 2HAKA 1UFZA 3PVSA 2I7NA 3RE8A 3UMMA 1NO1A 3GLFA 2V1UA 3E46A 1JR3A 2EUCA 1VEJA 2CRUA 1XHBA 4MGHA 4AG6A 1N32M 4FCTA 4QHTA 2JZ1A 1TH4A 1VDLA 2APLA 4W5WA 2OQ4A 3ZC7B 4AI6A 1DO0A 1G3IA 3HJ8A 2I7PA 3U61B 4AKHA 3HHWA 1SXJA 2DHRA 3IG8A 1DGHB 2MR9A 2F5SA 1QAMA 3HU1A 1Z5AA 5FTKA 2R0IA 1G71A 4QHSA 3GPUA 1FJGM 2Y0TA 2HCBA 3GLGB 1GABA 3VKGA 5FTMA 2OOAA 4DR1M 2K47A 1P3QQ 3HWSA 4QOSA 1XWIA 1Y8GA 2L7IA 2R18A 2XH9A 2JY7A 3A98B 8CATA 4OU7A 2WSCF 2XEPA 2FE8A 3GRYA 3T1HM 2JY5A 4I5SA 2NQ8C 5ITXE 1TDZA 4IJFA 1T43A 2OO9A 4LRSA 2LVPC 2BNKA 3FUVA 4WW0A 3SASA 3FRIA 1HQCA 2V1CA 4JI3M 4FD2A 4IIWA 1J5EM 4BLCA 3FE3A 5KQDA 1EFUB 3VDUA 4B7FA 1W5SA 3J81S 3BOSA 3GLHB 5GKNA 2K0BX 5KQ8A 4GKKM 1N78A 3HZJA 4LF7M 3KS8A 3FRHA 1IXSA 1ZV1A 3E4RA 2R4JA 1N75A 4LJ4A 4B3SM 2Z4RA 1IY0A 2DAIA 1JB0F 2LXEA 1SXJB 1MJGM 5IZ7D 4X62M 2H5XA 4IBFA 1Q3CA 2RKOA 3PXGA 1TF0B 1IXRC 2HKJA 3EIHA 3FD9A 2Y0QA 3KOZE 3HHYA 5C1BA 3M0EA 3K9PA 2DXIA 2X4AA 4RNAA 3I01M 3TWLA 1GVNA 1WIVA 3FKEA 3GLGE 4DR3M 1XMQM 2XSZA 3HX3A 1I4WA 4B3TM 2RGHA 5EP4A 4Z6YA 4P16A 1XC8A 2GQFA 2YFQA 4GIPA 2FH0A 3SAWA 3HU3A 2EKKA 4QOZC 1L8QA 2QP9X 4BBAA 2R44A 4NXMM 3Q8GA 3THGA 4BB9A 2QPAA 4B3MM 3U60A 4P17A 4PDGA 3KW6A 3LMMA 1KFVA 1PM5A 3GLFE 3LCVB 4DR4M 1XNQM 3PFIA 3TL4X 1TH2A 4DUYM 2QENA 2G3QA 1C1KA 2QQ8A 3V76A 1FNNA 5FTNA 4GRIA 4L78A 1F4IA 1G8PA 1NY6A 1R4GA 5BPVA 4LG2A 4LJAA 5DFLA 4RKUF 2MJ5B 1T6OA 3WHKA 1L2CA 1IBMM 3J7BA 3KOWE 1GKIA 1Q39A 5FTLA 1R2YA 4JI0M 2QZ4A 4LF6M 4B7HA 3CGWA 3QYBA 4IBEA 5BR8M 4LJ5A 4R71A 4HLQA 2L7HA 5DYIA 2ZAMA 1DGHA 2K6BA 3EIEA 4IBJA 1VG5A 3F92A 4B3RM 3W67A 4G4RA 2XGNA 3U60B 2FOIC 3DFZA 3HHXA 1EIJA 2Z4SA 4WP2A 4CIZA 3C58A 3LQRA 1QUTA 3GRUA 3SMSA 3NWLA 2ERCA 4FWHA 4LGYA 3VK8A 2AHMA 2JNHA 3AOGA 3IECA 2BWEA 2KNAA 3AFHA 4LZZA 1GLNA 1TH3A 1YUBA 2LHGA 3H4MA 3U6PA 3R8FA 4IBDA 3TE6A 2P5TA 1WGNA 2DZOB 3CF0A 2LHCA 1K3WA 4PT5A 2LBCA 1D2NA 2UXBM 4AW4A 3U6EA 1MU5A 1IN4A 2D7EA 3C3EA 4WURA 4MGYE 3AV0A 1H6UA 4B08A 2D7GA 3BBZA 2JXNA 1N77A 3L2AA 2Z3XA 1UM8A 2KRKA 3LW5F 5EP3A 3GLFB 1GJSA 2EA0A 4DV1M 2FFJA 1JQJC 1QUSA 4FCWA 1QVRA 4XBOA 2L2DA 2V6ZM 3W0FA 4XGIA 3GRVA 2Q2EB 3A46A 2DAKA
chains in the Genus database with same CATH topology
4PD2A 2G8LA 4JI5M 2XF3A 2QBYB 5KPRA 1EE8A 5C18A 2CV0A 3J2PB 4LF9M 2JA2A 2YNMD 5E6JA 3TPZA 4L16A 1IY1A 2M60A 2UXDM 5JI2E 4GC9A 4GH9A 3GLGA 4FWDA 1HT2E 1LV7A 5KPTA 2H1RA 1TDHA 2G5GX 4IBGA 4NRVA 3SHGB 1ZAEA 1KYIA 1IM2A 2UXCM 3KXEC 4JYAM 3M6AA 3T15A 2R46A 1QAOA 4LJ8A 4RF1A 5A2QS 3J27B 5EXPA 4KLNA 3HJSA 1S3SA 1XNRM 1HNXM 3LVWA 3PNYA 1E94E 1DGFA 1QAQA 2ZAOA 4M0WA 3GQ4A 1L2DA 4KO8A 4ITQA 4DR7M 4KODA 1IXSB 4ZPXA 3J80S 2KA6B 2ZANA 2DWZB 1IN8A 3SHFA 4M9XA 4IBCA 1SXJC 3AL0C 3B9PA 1J7KA 3A45A 4OW0A 3DA1A 4MM3B 5EP1A 3U6QA 4FCVA 3I4YA 3SAVA 2QCUA 1QANA 4DV2M 4DV4M 3ZCBB 3GO8A 4PCZA 3QAUA 2XLJA 2KXEA 4X65M 3KSXA 4NL4H 2CV2A 4GC5A 2DZNB 5KPZA 2ZM6M 2OPFA 4L4UA 3VFDA 3T38A 1MX0A 3I51A 2X8AA 2VQFM 2CEAA 3FUTA 4DV5M 4GHLA 1TGUA 2LNHC 1DGGA 2CHGA 2R4EA 4AKGA 5F3WA 3U6LA 2W82A 4GKJM 5FTJA 1L2BA 4FVMA 3CF6E 3HJQA 3E9SA 4AKIA 3A42A 4LF5M 4LCBA 4L15A 3GP1A 3AOEA 1NHGC 2R62A 1Z6TA 1R2ZA 3GLIB 1K3XA 4LF8M 1YE9A 4S12A 1QZMA 1ZQ9A 5EXTA 3KDSE 2DWMA 4M0DA 4LF4M 3ILKA 1L1ZA 2UUCM 3KOXE 5LMNM 2D7HA 1T3TA 4JN6A 4PDIA 4D82A 2F5NA 1NNUC 4CHTB 2CHQA 2HL7A 5H37D 3OTOM 5ITUA 3MJ5A 3JR4A 1JR3D 5ITXA 5ITRA 2L09A 1K82A 1E9RA 3GPPA 4G4NA 3U6CA 3K1JA 1R6BX 4AG5A 3RGSA 4JI4M 4NSRA 1NJFA 4LJ9A 3SAUA 1R7RA 4R3DA 4QNRA 4D81A 3K92A 2F5OA 4LGMA 3SARA 4G4OA 4NXNM 3GLIA 3R9XB 2LWXA 2A5YB 2R65A 1XXHA 1WXQA 3VKHA 1DGBA 4IJEA 2DWLA 2E5LM 3FTCA 2ZBKB 5EQTA 3TWKA 1L1TA 2UU9M 4L8RC 3GQ5A 4JI2M 1Q3BA 4M9ZA 1G41A 3HGIA 2BJVA 1NNJA 2UUBM 5JI3E 3WHLA 3CF2A 1YSYA 2J7OA 1HNWM 2L6OA 1J09A 4HL4A 4NRWA 7CATA 4OVZB 4I81A 4MGIE 4MGZE 3FUUA 4DUZM 1Z59A 4AQYM 1IBMM 4KHPM 1IN6A 1KSFX 2CE7A 2KRUA 2F5PA 2R45A 1OJLA 3SYKA 3SFZA 2F5QA 4OX9M 4LFAM 2M5ZA 3KFUG 3L26A 5DYGA 1NSFA 3LQQA 4AZFA 3HHZA 3PNVA 4LJ7A 1HNZM 5ITYA 1I94M 5FLXS 2C98A 4GMQA 3SMPA 1G59A 1PJJA 4LRTA 4JI8M 4IBBA 1HR0M 3KP1E 4G6ZA 4TUWA 2J7NA 3U5ZB 5EXXA 4A3VB 4REZA 3UZUA 3VK7A 4LZJA 3I4VA 2XZFA 2Z7JA 3UK6A 1XXHB 3U6DA 3VDPA 3K8ZA 4JV5M 3FYDA 3GQ3A 3L27A 1NVMA 1HQYE 4I8OA 4Z8XA 4IBKA 5KO3A 5LMUM 4EIWA 2CUZA 5ITQA 3AOEC 3LVVA 4FWGA 4LFCM 2QBYA 1IBKM 5IT9S 3KOYE 4OVZA 3KVWA 3UGJA 2Y21A 4JI7M 3W0LB 2YR0A 4DR6M 3MK6A 4X64M 3UJNA 3U5ZA 2HHHM 3U6MA 3GLHA 1SXJD 2Y20A 2CHVA 2DWNA 4X66M 2X49A 5IWAM 4B7GA 3L25A 2KEBA 2F4VM 1NJGA 3SC3A 3Q8XA 1QQWA 2O5RA 5EJCA 3AKZA 4M9SA 1N34M 1DO2A 1SXJE 3HU2A 3NBIA 5IREB 2LH0A 4CGYB 4LJ6A 1QYRA 3KS4A 2C9OA 3CTWB 4D80A 3FYCA 3FTFA 2UUAM 4MB7A 3M7GA 3U61A 2C99A 3GRRA 3D8BA 1N33M 3FTDA 1NY5A 3JAMS 5EP2A 4JI1M 4YY3M 1IN7A 2CV1A 1IBLM 2DVWB 2EO2A 3U6OA 3IG5A 4K0KM 1E32A 5ITTA 2BJWA 3SATA 1GL6A 1GL7A 2YQZA 4DV0M 4DV6M 2CFOA 4CISA 3K2LA 5FSWA 3HKPA 4JXJA 4DR5M 4G4QA 4NOOB 3FUXA 1IXZA 4DV7M 1VDDA 3FUWA 4I4LA 2KZSA 2RGOA 3ZH9B 1IQPA 3U6SA 1E9SA 3L28A 2XSZD 1XMOM 4JI6M 1ORYB 3SBJA 3D8LA 4MH0E 3JR5A 2XFTA 3QWLA 4FW9A 4II7A 2VIIA 2VQEM 3J7AS 4QNMA 2XZUA 1OFIA 3DZDA 3TWMA 4GHAA 4IBIA 2KW0A 1OFHA 2FNAA 3GPYA 4DV3M 3RFWA 1Z5CA 2KZUA 3FTEA 2C5RA 4NSOB 1Z5BA 3T1YM 1NHWC 3MHVC 4LY6A 4LFBM 5E26A 5EXSA 3DOAA 1W5TA 4RF0A 3AJIB 2C9CA 4DR2M 3L29A 3GPXA 4MGKE 2XFSA 3RGPA 1IY2A 3SYLA 1IN5A 3TQSA 4R7GA 3VLFB 1HT1E 1X37A 4YHHM 1N36M 5DNYA 4GITA 1PJIA 1G4AE 2C96A 3PVSA 2I7NA 3RE8A 3UMMA 3GLFA 2V1UA 1JR3A 2EUCA 4MGHA 1XHBA 4AG6A 1N32M 4FCTA 4QHTA 1TH4A 2OQ4A 4W5WA 4AI6A 3ZC7B 1DO0A 1G3IA 3HJ8A 2I7PA 3U61B 4AKHA 3HHWA 1SXJA 2DHRA 3IG8A 1DGHB 2F5SA 1QAMA 3HU1A 1Z5AA 5FTKA 4QHSA 1FJGM 3GPUA 2Y0TA 2HCBA 3GLGB 3VKGA 5FTMA 4DR1M 2K47A 3HWSA 4QOSA 1XWIA 2L7IA 2R18A 2XH9A 3A98B 8CATA 4OU7A 2XEPA 3GRYA 2FE8A 3T1HM 4I5SA 2NQ8C 5ITXE 1TDZA 4IJFA 4LRSA 2BNKA 3FUVA 4WW0A 3SASA 1HQCA 2V1CA 4JI3M 4FD2A 4IIWA 1J5EM 4BLCA 5KQDA 3VDUA 4B7FA 1W5SA 3J81S 3BOSA 3GLHB 5GKNA 5KQ8A 4GKKM 1N78A 4LF7M 3KS8A 3E4RA 2R4JA 1N75A 4LJ4A 4B3SM 2Z4RA 1IY0A 2LXEA 1SXJB 5IZ7D 4X62M 4IBFA 1Q3CA 2RKOA 3PXGA 1IXRC 2HKJA 3EIHA 3FD9A 2Y0QA 3KOZE 3HHYA 5C1BA 3M0EA 2DXIA 2X4AA 4RNAA 3TWLA 1GVNA 4DR3M 3FKEA 1XMQM 2XSZA 1I4WA 4B3TM 2RGHA 5EP4A 4Z6YA 4P16A 1XC8A 2YFQA 4GIPA 3SAWA 3HU3A 4QOZC 1L8QA 2QP9X 4BBAA 4NXMM 3THGA 4BB9A 2QPAA 4B3MM 3U60A 4PDGA 3KW6A 3LMMA 1KFVA 1PM5A 4DR4M 1XNQM 3PFIA 3TL4X 1TH2A 4DUYM 2QENA 1C1KA 1FNNA 5FTNA 4GRIA 4L78A 1G8PA 1NY6A 5BPVA 4LG2A 4LJAA 3WHKA 1L2CA 3J7BA 3KOWE 1Q39A 1GKIA 5FTLA 1R2YA 4JI0M 2QZ4A 4LF6M 4B7HA 3GRVA 4IBEA 5BR8M 4LJ5A 4HLQA 2L7HA 5DYIA 2ZAMA 1DGHA 3EIEA 4IBJA 4B3RM 4G4RA 2XGNA 3U60B 2FOIC 3DFZA 3HHXA 2Z4SA 3C58A 3LQRA 3GRUA 3SMSA 3NWLA 2ERCA 4FWHA 4LGYA 3VK8A 2AHMA 3AOGA 3AFHA 4LZZA 1GLNA 1TH3A 1YUBA 3H4MA 3U6PA 3R8FA 4IBDA 3TE6A 2P5TA 2DZOB 3CF0A 1K3WA 4PT5A 1D2NA 2UXBM 4AW4A 3U6EA 1MU5A 1IN4A 2D7EA 4WURA 4MGYE 3AV0A 1H6UA 4B08A 2D7GA 1N77A 3L2AA 2Z3XA 1UM8A 2KRKA 5EP3A 3GLFB 2EA0A 4DV1M 2FFJA 1JQJC 4FCWA 1QVRA 4XBOA 2V6ZM 3W0FA 4XGIA 3KP0E 2Q2EB 3A46A 3KSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD2 A;  4JI4 M;  4JI5 M;  3SAU A;  3SAS A;  1EE8 A;  2UUA M;  4MB7 A;  4JI3 M;  1J5E M;  4LF9 M;  2F5O A;  3SAR A;  4G4O A;  3J81 S;  4NXN M;  4GKK M;  1N33 M;  2UXD M;  4LF7 M;  3JAM S;  4JI1 M;  4YY3 M;  4B3S M;  1IBL M;  3U6O A;  4K0K M;  1TDH A;  5ITT A;  2E5L M;  3TWK A;  2ZBK B;  4NRV A;  4X62 M;  4DV6 M;  4DV0 M;  1L1T A;  2UU9 M;  3SAT A;  4CIS A;  1Q3C A;  3GQ5 A;  4JI2 M;  1Q3B A;  2HKJ A;  2UXC M;  4JYA M;  2UUB M;  1NNJ A;  4DR5 M;  4G4Q A;  3TWL A;  4DV7 M;  5A2Q S;  4DR3 M;  1XMQ M;  1HNW M;  4B3T M;  3U6S A;  1XC8 A;  1XNR M;  4NRW A;  1HNX M;  4JI6 M;  1XMO M;  1L2D A;  4AQY M;  3GQ4 A;  4DUZ M;  1Z59 A;  3SBJ A;  3SAW A;  1IBM M;  4ITQ A;  4KHP M;  3JR5 A;  2F5P A;  4DR7 M;  4NXM M;  4B3M M;  2VQE M;  3J7A S;  2XZU A;  4PDG A;  1KFV A;  3J80 S;  1PM5 A;  2F5Q A;  4OX9 M;  3TWM A;  1XNQ M;  4DR4 M;  4LFA M;  3GPY A;  4DUY M;  4DV3 M;  3A45 A;  1Z5C A;  3U6Q A;  2Q2E B;  3SAV A;  1HNZ M;  5ITY A;  1I94 M;  1Z5B A;  5FLX S;  4DV2 M;  4DV4 M;  1L2C A;  3T1Y M;  3GO8 A;  1PJJ A;  4JI8 M;  4LFB M;  1Q39 A;  4PCZ A;  1HR0 M;  1R2Y A;  3DOA A;  4JI0 M;  3VK7 A;  4X65 M;  4DR2 M;  4LF6 M;  2XZF A;  5BR8 M;  3GPX A;  3U6D A;  2ZM6 M;  4JV5 M;  2OPF A;  3GQ3 A;  4B3R M;  4G4R A;  1MX0 A;  2VQF M;  4YHH M;  1N36 M;  4DV5 M;  1PJI A;  3C58 A;  5LMU M;  3U6L A;  4GKJ M;  5ITQ A;  1L2B A;  4LFC M;  3A42 A;  3VK8 A;  4LF5 M;  1IBK M;  5IT9 S;  3GP1 A;  1N32 M;  1K3X A;  4LF8 M;  3U6P A;  1R2Z A;  4JI7 M;  2OQ4 A;  4DR6 M;  1K3W A;  4X64 M;  2UXB M;  2F5S A;  4G4N A;  2HHH M;  4LF4 M;  3U6M A;  1Z5A A;  3U6E A;  1L1Z A;  1MU5 A;  2UUC M;  1FJG M;  4X66 M;  3GPU A;  5IWA M;  5LMN M;  4PDI A;  4DR1 M;  2F4V M;  2F5N A;  2EA0 A;  4DV1 M;  1N34 M;  3OTO M;  5ITU A;  3T1H M;  3JR4 A;  5ITX A;  3W0F A;  5ITR A;  5ITX E;  1TDZ A;  1K82 A;  3GPP A;  3A46 A;  3U6C A; 
#chains in the Genus database with same CATH topology
 4KT0 F;  4PD2 A;  1OIZ A;  2G8L A;  4JI5 M;  2XF3 A;  2QBY B;  5KPR A;  1EE8 A;  5C18 A;  2CV0 A;  3J2P B;  4LF9 M;  2JA2 A;  2YNM D;  3BXW A;  5E6J A;  3TPZ A;  4L16 A;  1IY1 A;  2CP8 A;  2M60 A;  1AIP C;  2B3T A;  2O01 F;  2UXD M;  2JY6 B;  5JI2 E;  4GC9 A;  4GH9 A;  3GLG A;  2DI0 A;  4KHP M;  4FWD A;  4HEO A;  1HT2 E;  4G3O A;  1LV7 A;  5KPT A;  2H1R A;  1V34 A;  1TDH A;  2G5G X;  4IBG A;  1WR1 B;  4NRV A;  3SHG B;  1ZAE A;  4NC6 A;  1KYI A;  1IM2 A;  2JP7 A;  2UXC M;  3KXE C;  4JYA M;  3M6A A;  3T15 A;  2R46 A;  1QAO A;  4LJ8 A;  1D0M A;  4RF1 A;  5A2Q S;  2DAM A;  2CWB A;  3J27 B;  5EXP A;  2MGW A;  1ZMW A;  4KLN A;  3HJS A;  1S3S A;  1XNR M;  1HNX M;  3LVW A;  3PNY A;  1E94 E;  1DGF A;  1QAQ A;  2ZAO A;  4M0W A;  2KHH A;  3GQ4 A;  4KO8 A;  1L2D A;  4ITQ A;  2GNO A;  4DR7 M;  4KOD A;  1IXS B;  2LVQ D;  4ZPX A;  3H4J A;  3J80 S;  2KA6 B;  2VF8 A;  2ZAN A;  2DWZ B;  2KDL A;  1IN8 A;  3SHF A;  4M9X A;  4IBC A;  1SXJ C;  3AL0 C;  3B9P A;  1J7K A;  3A45 A;  4OW0 A;  3DA1 A;  4MM3 B;  5EP1 A;  2LTU A;  2WSE F;  4FCV A;  3U6Q A;  1CUK A;  3I4Y A;  3SAV A;  2QCU A;  1QAN A;  4DV2 M;  2MRO B;  4DV4 M;  2QNJ A;  2WSF F;  3ZCB B;  3GO8 A;  2FS1 A;  4PCZ A;  4CJ6 A;  1R5L A;  2JUJ A;  2O25 A;  3QAU A;  2XLJ A;  2KXE A;  4X65 M;  1DV0 A;  3KSX A;  4NL4 H;  2CV2 A;  2ZTD A;  4GC5 A;  2DZN B;  5KPZ A;  2ZM6 M;  2OPF A;  4DBG B;  4L4U A;  3VFD A;  2DHY A;  3T38 A;  1MX0 A;  3I51 A;  2X8A A;  2VQF M;  2CEA A;  3FUT A;  4DV5 M;  4GHL A;  1TGU A;  2LNH C;  1DGG A;  2CHG A;  2R4E A;  4AKG A;  5F3W A;  3U6L A;  2W82 A;  4GKJ M;  5FTJ A;  1L2B A;  1VQ1 A;  4FVM A;  3CF6 E;  3HJQ A;  3E9S A;  4AKI A;  3A42 A;  4LF5 M;  4LCB A;  4L15 A;  3GP1 A;  3AOE A;  1NHG C;  2R62 A;  1Z6T A;  1SG9 A;  3GLI B;  1R2Z A;  1K3X A;  4LF8 M;  1YE9 A;  2BWB A;  3C9P A;  4S12 A;  2EKF A;  1QZM A;  1ZQ9 A;  5EXT A;  3KDS E;  2DWM A;  4M0D A;  4LF4 M;  3ILK A;  1L1Z A;  2UUC M;  3B74 A;  1JR3 E;  3KOX E;  5LMN M;  1OIP A;  2D7H A;  1T3T A;  4JN6 A;  4PDI A;  1OTR A;  4D82 A;  2F5N A;  1NNU C;  4CHT B;  1C7Y A;  2CHQ A;  2HL7 A;  2DAE A;  5H37 D;  4F2L A;  3OTO M;  5ITU A;  1XXH E;  3MJ5 A;  3JR4 A;  1JR3 D;  5ITX A;  5ITR A;  2L09 A;  1K82 A;  2JY8 A;  1E9R A;  3GPP A;  4G4N A;  2LVN C;  3U6C A;  3K1J A;  1R6B X;  4AG5 A;  3RGS A;  4JI4 M;  4NSR A;  1NJF A;  4LJ9 A;  2DKL A;  1R7R A;  1D0L A;  4R3D A;  3SAU A;  3QYE A;  4QNR A;  1QDT A;  4D81 A;  1XB2 B;  2RRU A;  2J5Y A;  3K92 A;  1QZE A;  2L4E A;  4LGM A;  4G4O A;  2F5O A;  4NXN M;  3SAR A;  3GLI A;  3R9X B;  1PRB A;  2LWX A;  2A5Y B;  1WHC A;  1XXH A;  1WXQ A;  2R65 A;  3VKH A;  1DGB A;  4IJE A;  1PGY A;  2DWL A;  2E5L M;  2MH8 A;  2ZBK B;  1OQY A;  3FTC A;  5EQT A;  3TWK A;  1L1T A;  4Y28 F;  2UU9 M;  4L8R C;  2QSF X;  3GQ5 A;  4JI2 M;  1Q3B A;  4M9Z A;  3E21 A;  1G41 A;  3HGI A;  2BJV A;  1NNJ A;  2UUB M;  3GLH E;  5JI3 E;  3WHL A;  3CF2 A;  1YSY A;  2J7O A;  1HNW M;  2L6O A;  2VF7 A;  1J09 A;  4HL4 A;  4NRW A;  7CAT A;  1V92 A;  4OVZ B;  3HY5 A;  1V33 A;  3MMP A;  3FUU A;  4I81 A;  1Z59 A;  2DNA A;  4MGI E;  4MGZ E;  4DUZ M;  4AQY M;  1IN6 A;  1KSF X;  1OKS A;  2CE7 A;  2KRU A;  2F5P A;  2R45 A;  2KNZ A;  3K9O A;  1OJL A;  3SYK A;  3GLI E;  3SFZ A;  2F5Q A;  4OX9 M;  1OAO C;  5L8R F;  4LFA M;  2M5Z A;  3KFU G;  3L26 A;  5DYG A;  1NSF A;  3LQQ A;  4AZF A;  3HHZ A;  2WZJ A;  3PNV A;  4LJ7 A;  1HNZ M;  5ITY A;  1I94 M;  5FLX S;  2C98 A;  4GMQ A;  3B7Q A;  3SMP A;  1G59 A;  1PJJ A;  4LRT A;  4JI8 M;  4IBB A;  1ZMU A;  1VEK A;  1HR0 M;  3KP1 E;  4G6Z A;  4TUW A;  2J7N A;  3U5Z B;  5EXX A;  3ZQJ A;  4A3V B;  4REZ A;  3UZU A;  3VK7 A;  4LZJ A;  2LVO C;  3I4V A;  2XZF A;  2Z7J A;  3UK6 A;  3LCU A;  1XXH B;  1D0K A;  3U6D A;  3VDP A;  2DAG A;  3K8Z A;  4JV5 M;  3FYD A;  3GQ3 A;  3L27 A;  3B89 A;  1PJS A;  1NVM A;  1HQY E;  3W68 A;  4I8O A;  4Z8X A;  4Q7J A;  1HJP A;  4IBK A;  5KO3 A;  5LMU M;  2R6F A;  4EIW A;  2CUZ A;  5ITQ A;  3AOE C;  3LVV A;  4FWG A;  4LFC M;  4UN2 B;  2QBY A;  1YLA A;  1IBK M;  2JWS A;  5IT9 S;  3KOY E;  1BVS A;  4OVZ A;  3KVW A;  3UGJ A;  2Y21 A;  1RU3 A;  4JI7 M;  1LTM A;  3W0L B;  2YR0 A;  4DR6 M;  2LVA A;  4XK8 F;  3MK6 A;  4X64 M;  3UJN A;  3U5Z A;  2Z8Y M;  2JZ0 A;  2HHH M;  3I04 M;  3U6M A;  3GLH A;  1SXJ D;  2Y20 A;  2CHV A;  2DWN A;  4X66 M;  1PJQ A;  2X49 A;  5IWA M;  4B7G A;  3L25 A;  3T6P A;  2KEB A;  1PJT A;  2F4V M;  1NJG A;  3KP0 E;  3SC3 A;  3Q8X A;  1QQW A;  2O5R A;  5EJC A;  2DEN A;  3AKZ A;  4M9S A;  1VEG A;  1N34 M;  1DO2 A;  1SXJ E;  3HU2 A;  3NBI A;  5IRE B;  2LH0 A;  1WGL A;  4CGY B;  1WJ7 A;  4LJ6 A;  1QYR A;  3KS4 A;  2C9O A;  3CTW B;  4D80 A;  1AUA A;  3FYC A;  3FTF A;  2UUA M;  4MB7 A;  3M7G A;  3U61 A;  2C99 A;  3GRR A;  4F1I A;  3D8B A;  1N33 M;  3FTD A;  1NY5 A;  3JAM S;  5EP2 A;  4JI1 M;  4YY3 M;  1IN7 A;  4L6V 6;  4GEW A;  2CV1 A;  1IBL M;  2DVW B;  2EO2 A;  3U6O A;  3IG5 A;  4K0K M;  1E32 A;  5ITT A;  2BJW A;  2HWJ A;  1GL6 A;  1GL7 A;  1Q02 A;  2K9D A;  2YQZ A;  4DV0 M;  2CFO A;  4DV6 M;  3SAT A;  4CIS A;  2ZTC A;  2DZL A;  3K2L A;  3B7Z A;  5FSW A;  3HKP A;  4JXJ A;  2QHO B;  4DR5 M;  4G4Q A;  3NBX X;  4NOO B;  3FUX A;  1IXZ A;  1GO5 A;  4DV7 M;  1VDD A;  3FUW A;  4I4L A;  2KZS A;  2RGO A;  1A5T A;  3ZH9 B;  1IQP A;  3U6S A;  1E9S A;  3L28 A;  1NV8 A;  2N35 A;  1MN3 A;  2XSZ D;  1XMO M;  1ORY B;  4JI6 M;  3SBJ A;  3D8L A;  4ANR A;  4MH0 E;  3JR5 A;  2XFT A;  3QWL A;  4FW9 A;  4II7 A;  2VII A;  2VQE M;  1NV9 A;  4QNM A;  2XZU A;  3J7A S;  1OFI A;  3DZD A;  2VDB B;  3TWM A;  4GHA A;  4IBI A;  2KW0 A;  2KNV A;  2OOB A;  1OFH A;  2FNA A;  3GPY A;  4DV3 M;  1TTE A;  3RFW A;  1Z5C A;  2L4F A;  2EJS A;  2KZU A;  3FTE A;  2C5R A;  1OAI A;  4NSO B;  1Z5B A;  1IFY A;  3T1Y M;  1GJT A;  1NHW C;  3B7N A;  3MHV C;  4LY6 A;  4LFB M;  5E26 A;  5EXS A;  3DOA A;  1W5T A;  4RF0 A;  3AJI B;  3C3D A;  2C9C A;  4DR2 M;  3L29 A;  3GPX A;  4MGK E;  2XFS A;  3KSJ A;  3RGP A;  1IY2 A;  3SYL A;  3IHP A;  1QDR A;  1IN5 A;  1TR8 A;  3TQS A;  4R7G A;  3VLF B;  1HT1 E;  1X37 A;  4YHH M;  1N36 M;  5DNY A;  4GIT A;  1PJI A;  1ZMV A;  1G4A E;  2C96 A;  2HAK A;  1UFZ A;  3PVS A;  2I7N A;  3RE8 A;  3UMM A;  1NO1 A;  3GLF A;  2V1U A;  3E46 A;  1JR3 A;  2EUC A;  1VEJ A;  2CRU A;  1XHB A;  4MGH A;  4AG6 A;  1N32 M;  4FCT A;  4QHT A;  2JZ1 A;  1TH4 A;  1VDL A;  2APL A;  4W5W A;  2OQ4 A;  3ZC7 B;  4AI6 A;  1DO0 A;  1G3I A;  3HJ8 A;  2I7P A;  3U61 B;  4AKH A;  3HHW A;  1SXJ A;  2DHR A;  3IG8 A;  1DGH B;  2MR9 A;  2F5S A;  1QAM A;  3HU1 A;  1Z5A A;  5FTK A;  2R0I A;  1G71 A;  4QHS A;  3GPU A;  1FJG M;  2Y0T A;  2HCB A;  3GLG B;  1GAB A;  3VKG A;  5FTM A;  2OOA A;  4DR1 M;  2K47 A;  1P3Q Q;  3HWS A;  4QOS A;  1XWI A;  1Y8G A;  2L7I A;  2R18 A;  2XH9 A;  2JY7 A;  3A98 B;  8CAT A;  4OU7 A;  2WSC F;  2XEP A;  2FE8 A;  3GRY A;  3T1H M;  2JY5 A;  4I5S A;  2NQ8 C;  5ITX E;  1TDZ A;  4IJF A;  1T43 A;  2OO9 A;  4LRS A;  2LVP C;  2BNK A;  3FUV A;  4WW0 A;  3SAS A;  3FRI A;  1HQC A;  2V1C A;  4JI3 M;  4FD2 A;  4IIW A;  1J5E M;  4BLC A;  3FE3 A;  5KQD A;  1EFU B;  3VDU A;  4B7F A;  1W5S A;  3J81 S;  3BOS A;  3GLH B;  5GKN A;  2K0B X;  5KQ8 A;  4GKK M;  1N78 A;  3HZJ A;  4LF7 M;  3KS8 A;  3FRH A;  1IXS A;  1ZV1 A;  3E4R A;  2R4J A;  1N75 A;  4LJ4 A;  4B3S M;  2Z4R A;  1IY0 A;  2DAI A;  1JB0 F;  2LXE A;  1SXJ B;  1MJG M;  5IZ7 D;  4X62 M;  2H5X A;  4IBF A;  1Q3C A;  2RKO A;  3PXG A;  1TF0 B;  1IXR C;  2HKJ A;  3EIH A;  3FD9 A;  2Y0Q A;  3KOZ E;  3HHY A;  5C1B A;  3M0E A;  3K9P A;  2DXI A;  2X4A A;  4RNA A;  3I01 M;  3TWL A;  1GVN A;  1WIV A;  3FKE A;  3GLG E;  4DR3 M;  1XMQ M;  2XSZ A;  3HX3 A;  1I4W A;  4B3T M;  2RGH A;  5EP4 A;  4Z6Y A;  4P16 A;  1XC8 A;  2GQF A;  2YFQ A;  4GIP A;  2FH0 A;  3SAW A;  3HU3 A;  2EKK A;  4QOZ C;  1L8Q A;  2QP9 X;  4BBA A;  2R44 A;  4NXM M;  3Q8G A;  3THG A;  4BB9 A;  2QPA A;  4B3M M;  3U60 A;  4P17 A;  4PDG A;  3KW6 A;  3LMM A;  1KFV A;  1PM5 A;  3GLF E;  3LCV B;  4DR4 M;  1XNQ M;  3PFI A;  3TL4 X;  1TH2 A;  4DUY M;  2QEN A;  2G3Q A;  1C1K A;  2QQ8 A;  3V76 A;  1FNN A;  5FTN A;  4GRI A;  4L78 A;  1F4I A;  1G8P A;  1NY6 A;  1R4G A;  5BPV A;  4LG2 A;  4LJA A;  5DFL A;  4RKU F;  2MJ5 B;  1T6O A;  3WHK A;  1L2C A;  1IBM M;  3J7B A;  3KOW E;  1GKI A;  1Q39 A;  5FTL A;  1R2Y A;  4JI0 M;  2QZ4 A;  4LF6 M;  4B7H A;  3CGW A;  3QYB A;  4IBE A;  5BR8 M;  4LJ5 A;  4R71 A;  4HLQ A;  2L7H A;  5DYI A;  2ZAM A;  1DGH A;  2K6B A;  3EIE A;  4IBJ A;  1VG5 A;  3F92 A;  4B3R M;  3W67 A;  4G4R A;  2XGN A;  3U60 B;  2FOI C;  3DFZ A;  3HHX A;  1EIJ A;  2Z4S A;  4WP2 A;  4CIZ A;  3C58 A;  3LQR A;  1QUT A;  3GRU A;  3SMS A;  3NWL A;  2ERC A;  4FWH A;  4LGY A;  3VK8 A;  2AHM A;  2JNH A;  3AOG A;  3IEC A;  2BWE A;  2KNA A;  3AFH A;  4LZZ A;  1GLN A;  1TH3 A;  1YUB A;  2LHG A;  3H4M A;  3U6P A;  3R8F A;  4IBD A;  3TE6 A;  2P5T A;  1WGN A;  2DZO B;  3CF0 A;  2LHC A;  1K3W A;  4PT5 A;  2LBC A;  1D2N A;  2UXB M;  4AW4 A;  3U6E A;  1MU5 A;  1IN4 A;  2D7E A;  3C3E A;  4WUR A;  4MGY E;  3AV0 A;  1H6U A;  4B08 A;  2D7G A;  3BBZ A;  2JXN A;  1N77 A;  3L2A A;  2Z3X A;  1UM8 A;  2KRK A;  3LW5 F;  5EP3 A;  3GLF B;  1GJS A;  2EA0 A;  4DV1 M;  2FFJ A;  1JQJ C;  1QUS A;  4FCW A;  1QVR A;  4XBO A;  2L2D A;  2V6Z M;  3W0F A;  4XGI A;  3GRV A;  2Q2E B;  3A46 A;  2DAK A; 
#chains in the Genus database with same CATH homology
 4PD2 A;  2G8L A;  4JI5 M;  2XF3 A;  2QBY B;  5KPR A;  1EE8 A;  5C18 A;  2CV0 A;  3J2P B;  4LF9 M;  2JA2 A;  2YNM D;  5E6J A;  3TPZ A;  4L16 A;  1IY1 A;  2M60 A;  2UXD M;  5JI2 E;  4GC9 A;  4GH9 A;  3GLG A;  4FWD A;  1HT2 E;  1LV7 A;  5KPT A;  2H1R A;  1TDH A;  2G5G X;  4IBG A;  4NRV A;  3SHG B;  1ZAE A;  1KYI A;  1IM2 A;  2UXC M;  3KXE C;  4JYA M;  3M6A A;  3T15 A;  2R46 A;  1QAO A;  4LJ8 A;  4RF1 A;  5A2Q S;  3J27 B;  5EXP A;  4KLN A;  3HJS A;  1S3S A;  1XNR M;  1HNX M;  3LVW A;  3PNY A;  1E94 E;  1DGF A;  1QAQ A;  2ZAO A;  4M0W A;  3GQ4 A;  1L2D A;  4KO8 A;  4ITQ A;  4DR7 M;  4KOD A;  1IXS B;  4ZPX A;  3J80 S;  2KA6 B;  2ZAN A;  2DWZ B;  1IN8 A;  3SHF A;  4M9X A;  4IBC A;  1SXJ C;  3AL0 C;  3B9P A;  1J7K A;  3A45 A;  4OW0 A;  3DA1 A;  4MM3 B;  5EP1 A;  3U6Q A;  4FCV A;  3I4Y A;  3SAV A;  2QCU A;  1QAN A;  4DV2 M;  4DV4 M;  3ZCB B;  3GO8 A;  4PCZ A;  3QAU A;  2XLJ A;  2KXE A;  4X65 M;  3KSX A;  4NL4 H;  2CV2 A;  4GC5 A;  2DZN B;  5KPZ A;  2ZM6 M;  2OPF A;  4L4U A;  3VFD A;  3T38 A;  1MX0 A;  3I51 A;  2X8A A;  2VQF M;  2CEA A;  3FUT A;  4DV5 M;  4GHL A;  1TGU A;  2LNH C;  1DGG A;  2CHG A;  2R4E A;  4AKG A;  5F3W A;  3U6L A;  2W82 A;  4GKJ M;  5FTJ A;  1L2B A;  4FVM A;  3CF6 E;  3HJQ A;  3E9S A;  4AKI A;  3A42 A;  4LF5 M;  4LCB A;  4L15 A;  3GP1 A;  3AOE A;  1NHG C;  2R62 A;  1Z6T A;  1R2Z A;  3GLI B;  1K3X A;  4LF8 M;  1YE9 A;  4S12 A;  1QZM A;  1ZQ9 A;  5EXT A;  3KDS E;  2DWM A;  4M0D A;  4LF4 M;  3ILK A;  1L1Z A;  2UUC M;  3KOX E;  5LMN M;  2D7H A;  1T3T A;  4JN6 A;  4PDI A;  4D82 A;  2F5N A;  1NNU C;  4CHT B;  2CHQ A;  2HL7 A;  5H37 D;  3OTO M;  5ITU A;  3MJ5 A;  3JR4 A;  1JR3 D;  5ITX A;  5ITR A;  2L09 A;  1K82 A;  1E9R A;  3GPP A;  4G4N A;  3U6C A;  3K1J A;  1R6B X;  4AG5 A;  3RGS A;  4JI4 M;  4NSR A;  1NJF A;  4LJ9 A;  3SAU A;  1R7R A;  4R3D A;  4QNR A;  4D81 A;  3K92 A;  2F5O A;  4LGM A;  3SAR A;  4G4O A;  4NXN M;  3GLI A;  3R9X B;  2LWX A;  2A5Y B;  2R65 A;  1XXH A;  1WXQ A;  3VKH A;  1DGB A;  4IJE A;  2DWL A;  2E5L M;  3FTC A;  2ZBK B;  5EQT A;  3TWK A;  1L1T A;  2UU9 M;  4L8R C;  3GQ5 A;  4JI2 M;  1Q3B A;  4M9Z A;  1G41 A;  3HGI A;  2BJV A;  1NNJ A;  2UUB M;  5JI3 E;  3WHL A;  3CF2 A;  1YSY A;  2J7O A;  1HNW M;  2L6O A;  1J09 A;  4HL4 A;  4NRW A;  7CAT A;  4OVZ B;  4I81 A;  4MGI E;  4MGZ E;  3FUU A;  4DUZ M;  1Z59 A;  4AQY M;  1IBM M;  4KHP M;  1IN6 A;  1KSF X;  2CE7 A;  2KRU A;  2F5P A;  2R45 A;  1OJL A;  3SYK A;  3SFZ A;  2F5Q A;  4OX9 M;  4LFA M;  2M5Z A;  3KFU G;  3L26 A;  5DYG A;  1NSF A;  3LQQ A;  4AZF A;  3HHZ A;  3PNV A;  4LJ7 A;  1HNZ M;  5ITY A;  1I94 M;  5FLX S;  2C98 A;  4GMQ A;  3SMP A;  1G59 A;  1PJJ A;  4LRT A;  4JI8 M;  4IBB A;  1HR0 M;  3KP1 E;  4G6Z A;  4TUW A;  2J7N A;  3U5Z B;  5EXX A;  4A3V B;  4REZ A;  3UZU A;  3VK7 A;  4LZJ A;  3I4V A;  2XZF A;  2Z7J A;  3UK6 A;  1XXH B;  3U6D A;  3VDP A;  3K8Z A;  4JV5 M;  3FYD A;  3GQ3 A;  3L27 A;  1NVM A;  1HQY E;  4I8O A;  4Z8X A;  4IBK A;  5KO3 A;  5LMU M;  4EIW A;  2CUZ A;  5ITQ A;  3AOE C;  3LVV A;  4FWG A;  4LFC M;  2QBY A;  1IBK M;  5IT9 S;  3KOY E;  4OVZ A;  3KVW A;  3UGJ A;  2Y21 A;  4JI7 M;  3W0L B;  2YR0 A;  4DR6 M;  3MK6 A;  4X64 M;  3UJN A;  3U5Z A;  2HHH M;  3U6M A;  3GLH A;  1SXJ D;  2Y20 A;  2CHV A;  2DWN A;  4X66 M;  2X49 A;  5IWA M;  4B7G A;  3L25 A;  2KEB A;  2F4V M;  1NJG A;  3SC3 A;  3Q8X A;  1QQW A;  2O5R A;  5EJC A;  3AKZ A;  4M9S A;  1N34 M;  1DO2 A;  1SXJ E;  3HU2 A;  3NBI A;  5IRE B;  2LH0 A;  4CGY B;  4LJ6 A;  1QYR A;  3KS4 A;  2C9O A;  3CTW B;  4D80 A;  3FYC A;  3FTF A;  2UUA M;  4MB7 A;  3M7G A;  3U61 A;  2C99 A;  3GRR A;  3D8B A;  1N33 M;  3FTD A;  1NY5 A;  3JAM S;  5EP2 A;  4JI1 M;  4YY3 M;  1IN7 A;  2CV1 A;  1IBL M;  2DVW B;  2EO2 A;  3U6O A;  3IG5 A;  4K0K M;  1E32 A;  5ITT A;  2BJW A;  3SAT A;  1GL6 A;  1GL7 A;  2YQZ A;  4DV0 M;  4DV6 M;  2CFO A;  4CIS A;  3K2L A;  5FSW A;  3HKP A;  4JXJ A;  4DR5 M;  4G4Q A;  4NOO B;  3FUX A;  1IXZ A;  4DV7 M;  1VDD A;  3FUW A;  4I4L A;  2KZS A;  2RGO A;  3ZH9 B;  1IQP A;  3U6S A;  1E9S A;  3L28 A;  2XSZ D;  1XMO M;  4JI6 M;  1ORY B;  3SBJ A;  3D8L A;  4MH0 E;  3JR5 A;  2XFT A;  3QWL A;  4FW9 A;  4II7 A;  2VII A;  2VQE M;  3J7A S;  4QNM A;  2XZU A;  1OFI A;  3DZD A;  3TWM A;  4GHA A;  4IBI A;  2KW0 A;  1OFH A;  2FNA A;  3GPY A;  4DV3 M;  3RFW A;  1Z5C A;  2KZU A;  3FTE A;  2C5R A;  4NSO B;  1Z5B A;  3T1Y M;  1NHW C;  3MHV C;  4LY6 A;  4LFB M;  5E26 A;  5EXS A;  3DOA A;  1W5T A;  4RF0 A;  3AJI B;  2C9C A;  4DR2 M;  3L29 A;  3GPX A;  4MGK E;  2XFS A;  3RGP A;  1IY2 A;  3SYL A;  1IN5 A;  3TQS A;  4R7G A;  3VLF B;  1HT1 E;  1X37 A;  4YHH M;  1N36 M;  5DNY A;  4GIT A;  1PJI A;  1G4A E;  2C96 A;  3PVS A;  2I7N A;  3RE8 A;  3UMM A;  3GLF A;  2V1U A;  1JR3 A;  2EUC A;  4MGH A;  1XHB A;  4AG6 A;  1N32 M;  4FCT A;  4QHT A;  1TH4 A;  2OQ4 A;  4W5W A;  4AI6 A;  3ZC7 B;  1DO0 A;  1G3I A;  3HJ8 A;  2I7P A;  3U61 B;  4AKH A;  3HHW A;  1SXJ A;  2DHR A;  3IG8 A;  1DGH B;  2F5S A;  1QAM A;  3HU1 A;  1Z5A A;  5FTK A;  4QHS A;  1FJG M;  3GPU A;  2Y0T A;  2HCB A;  3GLG B;  3VKG A;  5FTM A;  4DR1 M;  2K47 A;  3HWS A;  4QOS A;  1XWI A;  2L7I A;  2R18 A;  2XH9 A;  3A98 B;  8CAT A;  4OU7 A;  2XEP A;  3GRY A;  2FE8 A;  3T1H M;  4I5S A;  2NQ8 C;  5ITX E;  1TDZ A;  4IJF A;  4LRS A;  2BNK A;  3FUV A;  4WW0 A;  3SAS A;  1HQC A;  2V1C A;  4JI3 M;  4FD2 A;  4IIW A;  1J5E M;  4BLC A;  5KQD A;  3VDU A;  4B7F A;  1W5S A;  3J81 S;  3BOS A;  3GLH B;  5GKN A;  5KQ8 A;  4GKK M;  1N78 A;  4LF7 M;  3KS8 A;  3E4R A;  2R4J A;  1N75 A;  4LJ4 A;  4B3S M;  2Z4R A;  1IY0 A;  2LXE A;  1SXJ B;  5IZ7 D;  4X62 M;  4IBF A;  1Q3C A;  2RKO A;  3PXG A;  1IXR C;  2HKJ A;  3EIH A;  3FD9 A;  2Y0Q A;  3KOZ E;  3HHY A;  5C1B A;  3M0E A;  2DXI A;  2X4A A;  4RNA A;  3TWL A;  1GVN A;  4DR3 M;  3FKE A;  1XMQ M;  2XSZ A;  1I4W A;  4B3T M;  2RGH A;  5EP4 A;  4Z6Y A;  4P16 A;  1XC8 A;  2YFQ A;  4GIP A;  3SAW A;  3HU3 A;  4QOZ C;  1L8Q A;  2QP9 X;  4BBA A;  4NXM M;  3THG A;  4BB9 A;  2QPA A;  4B3M M;  3U60 A;  4PDG A;  3KW6 A;  3LMM A;  1KFV A;  1PM5 A;  4DR4 M;  1XNQ M;  3PFI A;  3TL4 X;  1TH2 A;  4DUY M;  2QEN A;  1C1K A;  1FNN A;  5FTN A;  4GRI A;  4L78 A;  1G8P A;  1NY6 A;  5BPV A;  4LG2 A;  4LJA A;  3WHK A;  1L2C A;  3J7B A;  3KOW E;  1Q39 A;  1GKI A;  5FTL A;  1R2Y A;  4JI0 M;  2QZ4 A;  4LF6 M;  4B7H A;  3GRV A;  4IBE A;  5BR8 M;  4LJ5 A;  4HLQ A;  2L7H A;  5DYI A;  2ZAM A;  1DGH A;  3EIE A;  4IBJ A;  4B3R M;  4G4R A;  2XGN A;  3U60 B;  2FOI C;  3DFZ A;  3HHX A;  2Z4S A;  3C58 A;  3LQR A;  3GRU A;  3SMS A;  3NWL A;  2ERC A;  4FWH A;  4LGY A;  3VK8 A;  2AHM A;  3AOG A;  3AFH A;  4LZZ A;  1GLN A;  1TH3 A;  1YUB A;  3H4M A;  3U6P A;  3R8F A;  4IBD A;  3TE6 A;  2P5T A;  2DZO B;  3CF0 A;  1K3W A;  4PT5 A;  1D2N A;  2UXB M;  4AW4 A;  3U6E A;  1MU5 A;  1IN4 A;  2D7E A;  4WUR A;  4MGY E;  3AV0 A;  1H6U A;  4B08 A;  2D7G A;  1N77 A;  3L2A A;  2Z3X A;  1UM8 A;  2KRK A;  5EP3 A;  3GLF B;  2EA0 A;  4DV1 M;  2FFJ A;  1JQJ C;  4FCW A;  1QVR A;  4XBO A;  2V6Z M;  3W0F A;  4XGI A;  3KP0 E;  2Q2E B;  3A46 A;  3KSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...