4DR2M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr2M02
2ZM6M 1IBKM 3GPPA 5ITXA 3TWKA 1N33M 4DV7M 2VQEM 1FJGM 1I94M 4X65M 2Q2EB 3C58A 5BR8M 4MB7A 5ITQA 4PDIA 4AQYM 1MX0A 3T1YM 4DV1M 4DR3M 1K3XA 1N32M 3GPUA 4LF5M 3A45A 4JI8M 4JI3M 3OTOM 3GQ3A 1EE8A 4DR5M 3GO8A 4JV5M 4PDGA 3U6OA 5ITXE 4X62M 5IT9S 4K0KM 3SAUA 4JI6M 1Z5AA 1J5EM 4KHPM 1IBMM 3U6MA 4B3TM 4LF7M 3SARA 4B3SM 4LF4M 4LF9M 1NNJA 4LFCM 2F5NA 2UXCM 4GKJM 3JR5A 4YHHM 3SAVA 5FLXS 3U6DA 4CISA 4LFBM 5ITYA 4PCZA 4DR4M 4JI5M 1PM5A 1L1TA 1HNZM 4NXMM 4G4OA 1L2CA 3VK8A 1XC8A 2UUCM 3GPYA 4DV2M 4NRWA 4DR7M 3SASA 4LF6M 1R2ZA 3GQ4A 4PD2A 3VK7A 3U6LA 3GPXA 3A46A 5LMUM 3U6SA 1L2BA 4DR1M 3U6PA 3GP1A 2XZUA 2E5LM 2HHHM 1XMOM 1L1ZA 1PJIA 3SATA 4DR2M 4DV5M 2UXDM 1PJJA 4JI2M 4G4RA 2ZBKB 3A42A 4DUZM 1K3WA 4DV4M 1Q39A 2VQFM 4ITQA 1HNWM 4OX9M 1Z5BA 1Q3CA 4DV6M 4DV3M 2HKJA 2OQ4A 1HR0M 4NXNM 5LMNM 3J7AS 3TWMA 3W0FA 2F5OA 3T1HM 2XZFA 1N36M 3TWLA 4G4NA 3DOAA 5ITUA 1N34M 4JI4M 1MU5A 1R2YA 4G4QA 2UUBM 1KFVA 1K82A 2F5QA 2UU9M 5ITRA 5A2QS 3J81S 4JYAM 2F4VM 4DR6M 1TDHA 3SAWA 2F5PA 2F5SA 4JI7M 4GKKM 4B3RM 3SBJA 2EA0A 4LF8M 3J80S 3GQ5A 4DUYM 4NRVA 4JI0M 4X66M 1Q3BA 3JR4A 4B3MM 1XNQM 1Z59A 4LFAM 5IWAM 3U6EA 4JI1M 1XMQM 4YY3M 3JAMS 4X64M 1XNRM 3U6QA 1L2DA 2UUAM 3U6CA 5ITTA 2OPFA 1IBLM 4DV0M 1Z5CA 1TDZA 2UXBM 1HNXM
chains in the Genus database with same CATH superfamily
4D80A 2VF7A 1QUSA 5DYGA 4FWDA 5ITXA 3ZCBB 3CTWB 4DV7M 2DKLA 1I94M 2KNAA 4X65M 2Q2EB 3UK6A 1T6OA 3GLFE 2G5GX 4FCTA 1IY1A 3HHWA 1VG5A 3KOXE 4LJ7A 2CEAA 4I5SA 4A3VB 5ITQA 5JI3E 4G6ZA 1MX0A 3T1YM 4AKHA 3GLHE 2KNZA 2HWJA 4GIPA 2XSZA 2XF3A 4GHAA 3B7QA 1R6BX 3BOSA 1T43A 3LMMA 3HHXA 2VF8A 2WZJA 3VLFB 5ITXE 2FFJA 5IT9S 2LNHC 3T15A 2VIIA 2DI0A 1PJSA 2LBCA 1J5EM 3FKEA 4MGZE 3PFIA 4B3TM 3R9XB 1YSYA 1IXSA 4G3OA 3AOEA 1HT2E 1P3QQ 3LVVA 4CIZA 1WXQA 4EIWA 2FOIC 3FUUA 2ZTCA 3LVWA 4II7A 2CV2A 2LWXA 3TQSA 5F3WA 4PCZA 1GVNA 4LFBM 4DR4M 3I51A 2DZOB 1PM5A 2XGNA 1NVMA 1IN6A 1QYRA 1HNZM 2ZAOA 1VEKA 1N78A 1G59A 1XC8A 2APLA 1JR3D 1GLNA 3E46A 4LCBA 3SASA 3GQ4A 4NSRA 2YNMD 1YLAA 5IREB 3KS8A 2DNAA 4FWGA 4M9ZA 1D2NA 1MJGM 2RGOA 3M0EA 2LVQD 3FTFA 3AJIB 4XBOA 1IY2A 4LJ4A 1XMOM 1L1ZA 3U5ZA 3SATA 2DZNB 4WP2A 1IFYA 3E21A 1PJJA 2EKFA 2ZBKB 2LHCA 1PRBA 1K3WA 1IXSB 1Q39A 1QAQA 4MGYE 3WHLA 4ITQA 3Q8GA 1Q3CA 4QHTA 3SYLA 3SHFA 4IBKA 2X4AA 5E6JA 2KRKA 1HR0M 5C18A 4NXNM 5BPVA 3KS4A 2LVOC 3W0FA 2HAKA 2K9DA 3T1HM 1DGHB 3FTCA 2RRUA 2KZUA 4NC6A 3TWLA 3GLFB 5FTMA 1NV8A 1PGYA 2KZSA 1OKSA 1QZMA 1X37A 2KW0A 3HU1A 3K8ZA 3H4MA 1GJTA 3TPZA 2QZ4A 4G4QA 7CATA 1WJ7A 1IXRC 1QQWA 3D8BA 3D8LA 4JYAM 3IECA 1F4IA 2CHGA 4LJ8A 1AUAA 2KRUA 1SXJD 3NWLA 3SAWA 3MHVC 1N75A 2DZLA 4IBIA 4B3RM 3NBXX 4W5WA 5DYIA 2EA0A 4XK8F 3HJQA 3J80S 2DAEA 3EIHA 3RE8A 3GLGE 4QNRA 3FYDA 2JY5A 3HHZA 3MJ5A 4B3MM 4OU7A 4NRWA 2K6BA 2B3TA 4LFAM 5KPRA 2XEPA 4LRSA 2Y20A 1E94E 2OPFA 4DV0M 3IG8A 1A5TA 4M9XA 1Z5CA 4F1IA 3I04M 5JI2E 1ZV1A 3I4VA 1TDZA 3AV0A 4AKGA 2V6ZM 3FUVA 5FTNA 1OJLA 1DGFA 2LTUA 1FJGM 1V34A 4M0DA 3KSJA 3AKZA 3C58A 2Z7JA 2JWSA 3K1JA 2CHQA 1DO0A 5BR8M 3GRVA 2N35A 5C1BA 1GO5A 2CRUA 4KODA 2CV1A 1QVRA 4KLNA 3GPUA 2LHGA 1QZEA 5EXPA 1ZAEA 3A45A 3PNYA 1TH2A 4JI8M 4JI3M 5DFLA 2P5TA 3CGWA 5FTJA 4DR5M 2XFTA 3B9PA 3K9PA 1WHCA 3U6OA 3DA1A 4MM3B 3BXWA 3SAUA 1Z5AA 3U60A 4FCWA 4KHPM 2EKKA 3VKHA 1DGBA 1D0KA 1NV9A 1VEGA 2HCBA 2KEBA 5EP1A 1FNNA 4B3SM 3UZUA 4OVZB 4LF9M 2BJWA 1NNJA 1OFIA 2I7PA 3L29A 3DFZA 4R7GA 2JY6B 3QYEA 3SHGB 5KO3A 2F5NA 1IXZA 4GKJM 3FRIA 5L8RF 1IN8A 1J7KA 3BBZA 4YHHM 5FLXS 1XWIA 2DVWB 5ITYA 3KFUG 2Z3XA 3VDPA 1G4AE 2YQZA 3ZH9B 1L1TA 4OW0A 5EQTA 1W5SA 2L4FA 4GC5A 5IZ7D 3GLIE 2DHYA 1QUTA 2M5ZA 3GPYA 4DV2M 2MH8A 4DBGB 1R2ZA 4R3DA 1LTMA 4JXJA 3VK7A 1UM8A 1R5LA 2LVPC 3GPXA 1D0LA 2RKOA 2V1CA 3DZDA 4MH0E 2QP9X 5FTLA 2WSFF 3U6PA 1QAOA 2R65A 2R45A 3GP1A 2LVNC 3PVSA 3MK6A 4LRTA 1PJIA 3AOGA 4WW0A 3K9OA 4M9SA 5EXSA 3T6PA 3B7ZA 4DUZM 3LCVB 1NSFA 3R8FA 1IN7A 3J7BA 1HNWM 2JY7A 2HKJA 4DV3M 3L26A 5EP4A 3J7AS 1UFZA 1W5TA 3K92A 4Q7JA 2EUCA 2MROB 4GRIA 2XFSA 1G41A 4LJ6A 4MGKE 4FWHA 3FUTA 4IIWA 3U60B 4L16A 8CATA 1MU5A 2A5YB 1R2YA 4L8RC 2ERCA 3F92A 1KFVA 2KNVA 1K82A 2F5QA 3KW6A 4JN6A 2QQ8A 5A2QS 4IBBA 1E9RA 4I8OA 1EIJA 3AL0C 1MN3A 2CFOA 1OAIA 3GRUA 1TDHA 2D7GA 4RF0A 4WURA 3SFZA 1HQCA 4B7GA 3UGJA 4LF8M 2L2DA 3VKGA 4DUYM 5H37D 1I4WA 2J7OA 2C5RA 3J27B 4JI0M 1TF0B 4X66M 1DV0A 1OQYA 3KDSE 2CE7A 1XXHE 1NJFA 2L09A 3LW5F 4GH9A 4QHSA 3RGPA 4B7HA 2BNKA 4CJ6A 1TR8A 4HLQA 4REZA 1E9SA 2M60A 1XMQM 4YY3M 3GLGA 4CGYB 2XH9A 3U6QA 2UUAM 3U6CA 5ITTA 5KPZA 3QYBA 1NNUC 3KSXA 1XXHA 2L7IA 2R44A 4RF1A 1HNXM 3GPPA 1ORYB 1SXJB 3CF0A 3CF6E 3HU3A 3TWKA 1N33M 2NQ8C 3V76A 4FW9A 1OIZA 3E9SA 1R7RA 4KO8A 4L15A 4LZZA 3AFHA 2XSZD 4IBDA 4B7FA 4AKIA 1N32M 3FRHA 1GJSA 3FD9A 1ZMWA 2ZAMA 1VEJA 2X49A 4LGYA 2L4EA 1HQYE 4FCVA 1AIPC 4Y28F 4IJFA 3OTOM 3KP1E 3GQ3A 1C1KA 1EE8A 1YUBA 3HWSA 2DWMA 3E4RA 2C99A 2QENA 3FE3A 4PDGA 4D81A 2OOBA 1OFHA 2QPAA 4LF7M 5EXTA 1XXHB 3B7NA 3LQQA 1VDDA 2O5RA 1S3SA 1Z6TA 2Z8YM 1XB2B 2UXCM 5KPTA 3FYCA 3SMSA 3JR5A 2DXIA 3U6DA 1NO1A 3KVWA 5EJCA 2JZ1A 2KHHA 2EO2A 3EIEA 3GLFA 3LQRA 1IM2A 2ZTDA 4IBJA 4LJ5A 4NXMM 1OIPA 1NY6A 1ZMUA 2FNAA 4TUWA 3ILKA 2UUCM 3ZC7B 2BJVA 1QDTA 1HT1E 1SXJE 3IHPA 3KOYE 4LZJA 4MGIE 4DR7M 2LH0A 4QOSA 3Q8XA 3GLHA 2JUJA 3MMPA 2DWZB 4I4LA 3VFDA 3L2AA 5KQDA 3U6LA 2MGWA 3HX3A 2Y21A 2X8AA 3A46A 3C3EA 2R62A 4I81A 4IBGA 5LMUM 1L2BA 4DR1M 4BLCA 2JY8A 2R4JA 4GITA 5EP2A 2QBYA 3A98B 4QNMA 1E32A 2FH0A 1WGNA 1ZQ9A 3C3DA 3ZQJA 4S12A 3FTEA 4DV4M 4OX9M 3VDUA 2I7NA 1EFUB 1QDRA 1Z5BA 2KA6B 1GABA 1NY5A 3TE6A 1JQJC 1V33A 2OQ4A 2LVAA 5LMNM 2GQFA 1IN5A 3TWMA 2BWEA 3CF2A 4L6V6 3M7GA 3UJNA 2XZFA 2RGHA 3HJ8A 2F5OA 1WR1B 2JNHA 1GKIA 1G3IA 3H4JA 3HGIA 3DOAA 5ITUA 4HL4A 2CWBA 4AZFA 1JR3A 5FSWA 2UUBM 2CHVA 3L25A 2JZ0A 4LG2A 3KOZE 5ITRA 1V92A 1QAMA 1TH3A 4IBCA 2F4VM 3B74A 2F5PA 2F5SA 2JXNA 4JI7M 2H5XA 4NSOB 3M6AA 3SBJA 2L6OA 1C7YA 1HJPA 3K2LA 4NRVA 3JR4A 1Q3BA 1LV7A 4AW4A 1Z59A 2FS1A 4ANRA 5EP3A 2V1UA 2YR0A 5IWAM 3WHKA 3U6EA 1OAOC 2C9CA 4RKUF 3KXEC 1KYIA 1DGHA 1L2DA 5E26A 4NOOB 2EJSA 2QBYB 4OVZA 3HKPA 2DENA 2DAMA 3LCUA 4BBAA 3U5ZB 2J5YA 2ZM6M 1IBKM 1GL7A 1TGUA 4FVMA 4RNAA 1NHGC 3T38A 1IN4A 2VQEM 2G8LA 4AI6A 2J7NA 3SC3A 2QNJA 4IBEA 2K0BX 1L8QA 3PNVA 1SXJA 4MB7A 1D0MA 1H6UA 1YE9A 5FTKA 4PDIA 4AQYM 2DHRA 4DV1M 1PJTA 2MR9A 3QAUA 1TH4A 1SXJC 2DAIA 4KT0F 2BWBA 1Q02A 2DAGA 4DR3M 1K3XA 4LF5M 2C9OA 1JB0F 3PXGA 3SYKA 2H1RA 3I01M 4QOZC 2C96A 3L27A 3GO8A 4JV5M 4X62M 3HY5A 2MJ5B 4K0KM 2O01F 4BB9A 3FUXA 3GLIA 1DO2A 4JI6M 1R4GA 2OOAA 2KDLA 4XGIA 2WSEF 4GMQA 2QHOB 2JP7A 4D82A 3U6MA 1IBMM 2DWLA 3SARA 4LF4M 2CP8A 4GHLA 4LFCM 2K47A 1DGGA 2QCUA 4LJAA 4LJ9A 4CHTB 4Z6YA 3SAVA 2KXEA 4PT5A 4CISA 1PJQA 4GC9A 1SG9A 2R4EA 4JI5M 1WGLA 1T3TA 1G71A 2AHMA 2GNOA 4G4OA 1L2CA 3B89A 3VK8A 1OTRA 4AG6A 2O25A 2Y0TA 2L7HA 5GKNA 4M0WA 4LF6M 1IY0A 1J09A 4PD2A 4Z8XA 1GL6A 3U61B 4LY6A 2QSFX 3GLGB 2WSCF 1QANA 1NHWC 3U6SA 3W0LB 2XZUA 3GRYA 2E5LM 2HHHM 2Y0QA 3GLHB 3HJSA 3HZJA 2DWNA 3GLIB 1G8PA 4DV5M 3KP0E 4DR2M 4JI2M 4G4RA 2UXDM 3A42A 2Z4SA 2VQFM 3HU2A 3QWLA 4HEOA 4NL4H 1BVSA 3RFWA 4ZPXA 4DV6M 2Z4RA 4FD2A 5KQ8A 1NJGA 2R18A 4P17A 1XHBA 3AOEC 1KSFX 3J2PB 3SMPA 1IQPA 2W82A 4AG5A 3I4YA 3IG5A 1N36M 4G4NA 4JI4M 2HL7A 3L28A 2ZANA 2UU9M 2DAKA 4GEWA 3W68A 1VQ1A 4F2LA 4IBFA 5DNYA 1CUKA 3J81S 5EXXA 4IJEA 2R6FA 3HHYA 2FE8A 4DR6M 4R71A 3U61A 1Y8GA 1WIVA 2D7HA 4GKKM 2VDBB 2LXEA 2R46A 3FUWA 4L78A 2OO9A 2C98A 3GQ5A 4P16A 2R0IA 1N34M 2JA2A 2CV0A 1XNQM 1JR3E 4B08A 3KOWE 4L4UA 4LGMA 2YFQA 2G3QA 4UN2B 3UMMA 2D7EA 3GRRA 4MGHA 1VDLA 4JI1M 2XLJA 3RGSA 3THGA 3FTDA 3JAMS 3TL4X 4X64M 1XNRM 1N77A 3NBIA 1TTEA 1IBLM 1RU3A 2CUZA 1ZMVA 3W67A 2UXBM 3C9PA
chains in the Genus database with same CATH topology
4D80A 5DYGA 4FWDA 5ITXA 3ZCBB 3CTWB 4DV7M 1I94M 4X65M 2Q2EB 3UK6A 2G5GX 4FCTA 1IY1A 3HHWA 3KOXE 4LJ7A 4A3VB 2CEAA 4I5SA 5ITQA 5JI3E 4G6ZA 1MX0A 3T1YM 4AKHA 4GIPA 2XSZA 2XF3A 4GHAA 3BOSA 1R6BX 3LMMA 3HHXA 3VLFB 5ITXE 2FFJA 5IT9S 2LNHC 3T15A 2VIIA 1J5EM 3FKEA 4MGZE 3PFIA 4B3TM 3R9XB 1YSYA 3AOEA 1HT2E 3LVVA 1WXQA 4EIWA 2FOIC 3FUUA 3LVWA 4II7A 2CV2A 2LWXA 3TQSA 5F3WA 4PCZA 1GVNA 4LFBM 4DR4M 3I51A 2DZOB 1PM5A 2XGNA 1NVMA 1IN6A 1QYRA 1HNZM 2ZAOA 1N78A 1G59A 1XC8A 1JR3D 1GLNA 4LCBA 3SASA 3GQ4A 4NSRA 2YNMD 5IREB 3KS8A 4FWGA 4M9ZA 3M0EA 1D2NA 2RGOA 3FTFA 3AJIB 4XBOA 1IY2A 4LJ4A 1XMOM 1L1ZA 3U5ZA 3SATA 2DZNB 1PJJA 2ZBKB 1K3WA 1IXSB 1Q39A 1QAQA 4MGYE 3WHLA 4ITQA 1Q3CA 4QHTA 3SYLA 3SHFA 4IBKA 2X4AA 5E6JA 2KRKA 1HR0M 5C18A 4NXNM 5BPVA 3KS4A 3W0FA 3T1HM 1DGHB 3FTCA 2KZUA 3TWLA 3GLFB 5FTMA 1QZMA 1X37A 2KW0A 2KZSA 3K8ZA 3HU1A 3TPZA 3H4MA 1N34M 4G4QA 2QZ4A 2DWLA 7CATA 1IXRC 1QQWA 3D8BA 3D8LA 4JYAM 2CHGA 4LJ8A 2KRUA 1SXJD 3NWLA 3SAWA 3MHVC 1N75A 4IBIA 4B3RM 4W5WA 5DYIA 2EA0A 3HJQA 3J80S 3EIHA 3RE8A 4QNRA 3FYDA 3HHZA 3MJ5A 4B3MM 4OU7A 4LFAM 5KPRA 2XEPA 4LRSA 2Y20A 1E94E 2OPFA 4DV0M 3IG8A 4M9XA 1Z5CA 5JI2E 1TDZA 3I4VA 3AV0A 4AKGA 2V6ZM 3FUVA 5FTNA 1OJLA 1DGFA 1FJGM 4M0DA 3KSJA 3AKZA 3C58A 2Z7JA 3K1JA 2CHQA 1DO0A 5BR8M 3GRVA 5C1BA 2CV1A 4KODA 1QVRA 4KLNA 3GPUA 5EXPA 1ZAEA 3PNYA 3A45A 1TH2A 4JI8M 4JI3M 2P5TA 5FTJA 4DR5M 2XFTA 3B9PA 3U6OA 3DA1A 4MM3B 3SAUA 1Z5AA 3U60A 4FCWA 4KHPM 3VKHA 1DGBA 2KEBA 5EP1A 2HCBA 1FNNA 4B3SM 3UZUA 4OVZB 4LF9M 2BJWA 1NNJA 1OFIA 2I7PA 3L29A 3DFZA 4R7GA 3SHGB 5KO3A 2F5NA 4GKJM 1IXZA 1IN8A 1J7KA 4YHHM 5FLXS 1XWIA 2DVWB 5ITYA 3KFUG 2Z3XA 3VDPA 1G4AE 2YQZA 3ZH9B 1L1TA 4OW0A 5EQTA 1W5SA 4GC5A 5IZ7D 2M5ZA 3GPYA 4DV2M 1R2ZA 4R3DA 3VK7A 4JXJA 1UM8A 3GPXA 2RKOA 2V1CA 3DZDA 4MH0E 2QP9X 5FTLA 3U6PA 1QAOA 2R65A 2R45A 3GP1A 3PVSA 3MK6A 4LRTA 1PJIA 3AOGA 4WW0A 4M9SA 5EXSA 4DUZM 1NSFA 3R8FA 1IN7A 3J7BA 1HNWM 2HKJA 4DV3M 3L26A 5EP4A 3J7AS 1W5TA 3K92A 2EUCA 4GRIA 2XFSA 1G41A 4LJ6A 4MGKE 4FWHA 3FUTA 4IIWA 3U60B 4L16A 8CATA 1MU5A 2A5YB 1R2YA 4L8RC 2ERCA 1KFVA 1K82A 2F5QA 3KW6A 4JN6A 5A2QS 4IBBA 1E9RA 4I8OA 3AL0C 2CFOA 3GRUA 4RF0A 1TDHA 2D7GA 4WURA 3SFZA 1HQCA 4B7GA 3UGJA 4LF8M 3VKGA 4DUYM 5H37D 1I4WA 2J7OA 2C5RA 3J27B 4JI0M 4X66M 3KDSE 2CE7A 2L09A 1NJFA 4GH9A 3RGPA 4B7HA 4QHSA 2BNKA 4HLQA 4REZA 1E9SA 2M60A 1XMQM 4YY3M 3GLGA 4CGYB 2XH9A 3U6QA 2UUAM 3U6CA 5ITTA 5KPZA 1NNUC 3KSXA 1XXHA 2L7IA 4RF1A 1HNXM 3GPPA 1ORYB 1SXJB 3CF0A 3CF6E 3HU3A 3TWKA 1N33M 2NQ8C 4FW9A 3E9SA 1R7RA 4KO8A 4L15A 4LZZA 3AFHA 2XSZD 4IBDA 4B7FA 4AKIA 1N32M 3FD9A 4LGYA 2ZAMA 2X49A 4FCVA 1HQYE 3OTOM 4IJFA 3KP1E 3GQ3A 1C1KA 1EE8A 1YUBA 3HWSA 2DWMA 3E4RA 2C99A 2QENA 4PDGA 4D81A 1OFHA 2QPAA 4LF7M 5EXTA 1XXHB 3LQQA 1VDDA 2O5RA 1S3SA 1Z6TA 2UXCM 5KPTA 3FYCA 3SMSA 3JR5A 2DXIA 3U6DA 3KVWA 5EJCA 3GLFA 3EIEA 2EO2A 3LQRA 1IM2A 4NXMM 4IBJA 4LJ5A 1NY6A 2FNAA 4TUWA 3ILKA 2UUCM 3ZC7B 2BJVA 1SXJE 1HT1E 4LZJA 4MGIE 3KOYE 4NRWA 4DR7M 2LH0A 4QOSA 3Q8XA 3GLHA 5KQDA 2DWZB 4I4LA 3VFDA 3L2AA 3U6LA 2Y21A 2X8AA 3A46A 2R62A 4I81A 4IBGA 5LMUM 1L2BA 4DR1M 4BLCA 2R4JA 4GITA 5EP2A 2QBYA 3A98B 4QNMA 1E32A 1ZQ9A 4S12A 3FTEA 4DV4M 4OX9M 3VDUA 2I7NA 1Z5BA 2KA6B 1NY5A 3TE6A 1JQJC 2OQ4A 5LMNM 1IN5A 3TWMA 3CF2A 3M7GA 3UJNA 2XZFA 2RGHA 3HJ8A 2F5OA 3HGIA 1GKIA 1G3IA 3DOAA 5ITUA 4HL4A 4AZFA 1JR3A 5FSWA 2UUBM 2CHVA 3L25A 4LG2A 3KOZE 5ITRA 1QAMA 1TH3A 4IBCA 2F4VM 2F5PA 2F5SA 4JI7M 4NSOB 3M6AA 3SBJA 2L6OA 3K2LA 4NRVA 3JR4A 1Q3BA 1LV7A 4AW4A 1Z59A 5EP3A 2V1UA 2YR0A 5IWAM 3WHKA 3U6EA 2C9CA 3KXEC 1KYIA 1DGHA 1L2DA 5E26A 4NOOB 2QBYB 4OVZA 3HKPA 3U5ZB 4BBAA 2ZM6M 1IBKM 1GL7A 1TGUA 4FVMA 4RNAA 1NHGC 3T38A 1IN4A 2VQEM 2G8LA 4AI6A 2J7NA 3SC3A 4IBEA 3PNVA 1L8QA 1SXJA 4MB7A 1YE9A 1H6UA 5FTKA 4PDIA 4AQYM 2DHRA 4DV1M 3QAUA 4DR3M 1TH4A 1SXJC 1K3XA 4LF5M 2C9OA 3PXGA 3SYKA 2H1RA 4QOZC 2C96A 3L27A 3GO8A 4JV5M 4X62M 4K0KM 4BB9A 3GLIA 3FUXA 1DO2A 4JI6M 4XGIA 4GMQA 4D82A 3U6MA 1IBMM 3SARA 4LF4M 4GHLA 4LFCM 2K47A 1DGGA 2QCUA 4LJAA 4LJ9A 4CHTB 4Z6YA 3SAVA 2KXEA 4PT5A 4CISA 4GC9A 2R4EA 4JI5M 1T3TA 2AHMA 4G4OA 1L2CA 3VK8A 4AG6A 2Y0TA 5GKNA 2L7HA 4LF6M 4M0WA 1IY0A 1J09A 4PD2A 4Z8XA 1GL6A 3U61B 4LY6A 3GLGB 1QANA 1NHWC 3U6SA 3W0LB 2XZUA 3GRYA 2E5LM 2HHHM 2Y0QA 3GLHB 3HJSA 2DWNA 3GLIB 1G8PA 4DV5M 3KP0E 4DR2M 4JI2M 4G4RA 2UXDM 3A42A 2Z4SA 2VQFM 3HU2A 3QWLA 4NL4H 3RFWA 4ZPXA 4DV6M 2Z4RA 4FD2A 5KQ8A 1NJGA 2R18A 1XHBA 3AOEC 1KSFX 3J2PB 3SMPA 1IQPA 2W82A 4AG5A 3I4YA 3IG5A 1N36M 4G4NA 4JI4M 2HL7A 3L28A 2ZANA 2UU9M 4IBFA 5DNYA 3J81S 5EXXA 4IJEA 3HHYA 2FE8A 4DR6M 3U61A 2D7HA 4GKKM 2LXEA 2R46A 3FUWA 4L78A 2C98A 3GQ5A 4P16A 2JA2A 2CV0A 1XNQM 4B08A 3KOWE 4L4UA 4LGMA 2YFQA 3UMMA 2D7EA 3GRRA 4MGHA 4JI1M 2XLJA 3RGSA 3THGA 3FTDA 3JAMS 3TL4X 4X64M 1XNRM 1N77A 3NBIA 1IBLM 2CUZA 2UXBM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 M;  1IBK M;  3GPP A;  5ITX A;  3TWK A;  1N33 M;  4DV7 M;  2VQE M;  1FJG M;  1I94 M;  4X65 M;  2Q2E B;  3C58 A;  5BR8 M;  4MB7 A;  5ITQ A;  4PDI A;  4AQY M;  1MX0 A;  3T1Y M;  4DV1 M;  4DR3 M;  1K3X A;  1N32 M;  3GPU A;  4LF5 M;  3A45 A;  4JI8 M;  4JI3 M;  3OTO M;  3GQ3 A;  1EE8 A;  4DR5 M;  3GO8 A;  4JV5 M;  4PDG A;  3U6O A;  5ITX E;  4X62 M;  5IT9 S;  4K0K M;  3SAU A;  4JI6 M;  1Z5A A;  1J5E M;  4KHP M;  1IBM M;  3U6M A;  4B3T M;  4LF7 M;  3SAR A;  4B3S M;  4LF4 M;  4LF9 M;  1NNJ A;  4LFC M;  2F5N A;  2UXC M;  4GKJ M;  3JR5 A;  4YHH M;  3SAV A;  5FLX S;  3U6D A;  4CIS A;  4LFB M;  5ITY A;  4PCZ A;  4DR4 M;  4JI5 M;  1PM5 A;  1L1T A;  1HNZ M;  4NXM M;  4G4O A;  1L2C A;  3VK8 A;  1XC8 A;  2UUC M;  3GPY A;  4DV2 M;  4NRW A;  4DR7 M;  3SAS A;  4LF6 M;  1R2Z A;  3GQ4 A;  4PD2 A;  3VK7 A;  3U6L A;  3GPX A;  3A46 A;  5LMU M;  3U6S A;  1L2B A;  4DR1 M;  3U6P A;  3GP1 A;  2XZU A;  2E5L M;  2HHH M;  1XMO M;  1L1Z A;  1PJI A;  3SAT A;  4DR2 M;  4DV5 M;  2UXD M;  1PJJ A;  4JI2 M;  4G4R A;  2ZBK B;  3A42 A;  4DUZ M;  1K3W A;  4DV4 M;  1Q39 A;  2VQF M;  4ITQ A;  1HNW M;  4OX9 M;  1Z5B A;  1Q3C A;  4DV6 M;  4DV3 M;  2HKJ A;  2OQ4 A;  1HR0 M;  4NXN M;  5LMN M;  3J7A S;  3TWM A;  3W0F A;  2F5O A;  3T1H M;  2XZF A;  1N36 M;  3TWL A;  4G4N A;  3DOA A;  5ITU A;  1N34 M;  4JI4 M;  1MU5 A;  1R2Y A;  4G4Q A;  2UUB M;  1KFV A;  1K82 A;  2F5Q A;  2UU9 M;  5ITR A;  5A2Q S;  3J81 S;  4JYA M;  2F4V M;  4DR6 M;  1TDH A;  3SAW A;  2F5P A;  2F5S A;  4JI7 M;  4GKK M;  4B3R M;  3SBJ A;  2EA0 A;  4LF8 M;  3J80 S;  3GQ5 A;  4DUY M;  4NRV A;  4JI0 M;  4X66 M;  1Q3B A;  3JR4 A;  4B3M M;  1XNQ M;  1Z59 A;  4LFA M;  5IWA M;  3U6E A;  4JI1 M;  1XMQ M;  4YY3 M;  3JAM S;  4X64 M;  1XNR M;  3U6Q A;  1L2D A;  2UUA M;  3U6C A;  5ITT A;  2OPF A;  1IBL M;  4DV0 M;  1Z5C A;  1TDZ A;  2UXB M;  1HNX M; 
#chains in the Genus database with same CATH topology
 4D80 A;  2VF7 A;  1QUS A;  5DYG A;  4FWD A;  5ITX A;  3ZCB B;  3CTW B;  4DV7 M;  2DKL A;  1I94 M;  2KNA A;  4X65 M;  2Q2E B;  3UK6 A;  1T6O A;  3GLF E;  2G5G X;  4FCT A;  1IY1 A;  3HHW A;  1VG5 A;  3KOX E;  4LJ7 A;  2CEA A;  4I5S A;  4A3V B;  5ITQ A;  5JI3 E;  4G6Z A;  1MX0 A;  3T1Y M;  4AKH A;  3GLH E;  2KNZ A;  2HWJ A;  4GIP A;  2XSZ A;  2XF3 A;  4GHA A;  3B7Q A;  1R6B X;  3BOS A;  1T43 A;  3LMM A;  3HHX A;  2VF8 A;  2WZJ A;  3VLF B;  5ITX E;  2FFJ A;  5IT9 S;  2LNH C;  3T15 A;  2VII A;  2DI0 A;  1PJS A;  2LBC A;  1J5E M;  3FKE A;  4MGZ E;  3PFI A;  4B3T M;  3R9X B;  1YSY A;  1IXS A;  4G3O A;  3AOE A;  1HT2 E;  1P3Q Q;  3LVV A;  4CIZ A;  1WXQ A;  4EIW A;  2FOI C;  3FUU A;  2ZTC A;  3LVW A;  4II7 A;  2CV2 A;  2LWX A;  3TQS A;  5F3W A;  4PCZ A;  1GVN A;  4LFB M;  4DR4 M;  3I51 A;  2DZO B;  1PM5 A;  2XGN A;  1NVM A;  1IN6 A;  1QYR A;  1HNZ M;  2ZAO A;  1VEK A;  1N78 A;  1G59 A;  1XC8 A;  2APL A;  1JR3 D;  1GLN A;  3E46 A;  4LCB A;  3SAS A;  3GQ4 A;  4NSR A;  2YNM D;  1YLA A;  5IRE B;  3KS8 A;  2DNA A;  4FWG A;  4M9Z A;  1D2N A;  1MJG M;  2RGO A;  3M0E A;  2LVQ D;  3FTF A;  3AJI B;  4XBO A;  1IY2 A;  4LJ4 A;  1XMO M;  1L1Z A;  3U5Z A;  3SAT A;  2DZN B;  4WP2 A;  1IFY A;  3E21 A;  1PJJ A;  2EKF A;  2ZBK B;  2LHC A;  1PRB A;  1K3W A;  1IXS B;  1Q39 A;  1QAQ A;  4MGY E;  3WHL A;  4ITQ A;  3Q8G A;  1Q3C A;  4QHT A;  3SYL A;  3SHF A;  4IBK A;  2X4A A;  5E6J A;  2KRK A;  1HR0 M;  5C18 A;  4NXN M;  5BPV A;  3KS4 A;  2LVO C;  3W0F A;  2HAK A;  2K9D A;  3T1H M;  1DGH B;  3FTC A;  2RRU A;  2KZU A;  4NC6 A;  3TWL A;  3GLF B;  5FTM A;  1NV8 A;  1PGY A;  2KZS A;  1OKS A;  1QZM A;  1X37 A;  2KW0 A;  3HU1 A;  3K8Z A;  3H4M A;  1GJT A;  3TPZ A;  2QZ4 A;  4G4Q A;  7CAT A;  1WJ7 A;  1IXR C;  1QQW A;  3D8B A;  3D8L A;  4JYA M;  3IEC A;  1F4I A;  2CHG A;  4LJ8 A;  1AUA A;  2KRU A;  1SXJ D;  3NWL A;  3SAW A;  3MHV C;  1N75 A;  2DZL A;  4IBI A;  4B3R M;  3NBX X;  4W5W A;  5DYI A;  2EA0 A;  4XK8 F;  3HJQ A;  3J80 S;  2DAE A;  3EIH A;  3RE8 A;  3GLG E;  4QNR A;  3FYD A;  2JY5 A;  3HHZ A;  3MJ5 A;  4B3M M;  4OU7 A;  4NRW A;  2K6B A;  2B3T A;  4LFA M;  5KPR A;  2XEP A;  4LRS A;  2Y20 A;  1E94 E;  2OPF A;  4DV0 M;  3IG8 A;  1A5T A;  4M9X A;  1Z5C A;  4F1I A;  3I04 M;  5JI2 E;  1ZV1 A;  3I4V A;  1TDZ A;  3AV0 A;  4AKG A;  2V6Z M;  3FUV A;  5FTN A;  1OJL A;  1DGF A;  2LTU A;  1FJG M;  1V34 A;  4M0D A;  3KSJ A;  3AKZ A;  3C58 A;  2Z7J A;  2JWS A;  3K1J A;  2CHQ A;  1DO0 A;  5BR8 M;  3GRV A;  2N35 A;  5C1B A;  1GO5 A;  2CRU A;  4KOD A;  2CV1 A;  1QVR A;  4KLN A;  3GPU A;  2LHG A;  1QZE A;  5EXP A;  1ZAE A;  3A45 A;  3PNY A;  1TH2 A;  4JI8 M;  4JI3 M;  5DFL A;  2P5T A;  3CGW A;  5FTJ A;  4DR5 M;  2XFT A;  3B9P A;  3K9P A;  1WHC A;  3U6O A;  3DA1 A;  4MM3 B;  3BXW A;  3SAU A;  1Z5A A;  3U60 A;  4FCW A;  4KHP M;  2EKK A;  3VKH A;  1DGB A;  1D0K A;  1NV9 A;  1VEG A;  2HCB A;  2KEB A;  5EP1 A;  1FNN A;  4B3S M;  3UZU A;  4OVZ B;  4LF9 M;  2BJW A;  1NNJ A;  1OFI A;  2I7P A;  3L29 A;  3DFZ A;  4R7G A;  2JY6 B;  3QYE A;  3SHG B;  5KO3 A;  2F5N A;  1IXZ A;  4GKJ M;  3FRI A;  5L8R F;  1IN8 A;  1J7K A;  3BBZ A;  4YHH M;  5FLX S;  1XWI A;  2DVW B;  5ITY A;  3KFU G;  2Z3X A;  3VDP A;  1G4A E;  2YQZ A;  3ZH9 B;  1L1T A;  4OW0 A;  5EQT A;  1W5S A;  2L4F A;  4GC5 A;  5IZ7 D;  3GLI E;  2DHY A;  1QUT A;  2M5Z A;  3GPY A;  4DV2 M;  2MH8 A;  4DBG B;  1R2Z A;  4R3D A;  1LTM A;  4JXJ A;  3VK7 A;  1UM8 A;  1R5L A;  2LVP C;  3GPX A;  1D0L A;  2RKO A;  2V1C A;  3DZD A;  4MH0 E;  2QP9 X;  5FTL A;  2WSF F;  3U6P A;  1QAO A;  2R65 A;  2R45 A;  3GP1 A;  2LVN C;  3PVS A;  3MK6 A;  4LRT A;  1PJI A;  3AOG A;  4WW0 A;  3K9O A;  4M9S A;  5EXS A;  3T6P A;  3B7Z A;  4DUZ M;  3LCV B;  1NSF A;  3R8F A;  1IN7 A;  3J7B A;  1HNW M;  2JY7 A;  2HKJ A;  4DV3 M;  3L26 A;  5EP4 A;  3J7A S;  1UFZ A;  1W5T A;  3K92 A;  4Q7J A;  2EUC A;  2MRO B;  4GRI A;  2XFS A;  1G41 A;  4LJ6 A;  4MGK E;  4FWH A;  3FUT A;  4IIW A;  3U60 B;  4L16 A;  8CAT A;  1MU5 A;  2A5Y B;  1R2Y A;  4L8R C;  2ERC A;  3F92 A;  1KFV A;  2KNV A;  1K82 A;  2F5Q A;  3KW6 A;  4JN6 A;  2QQ8 A;  5A2Q S;  4IBB A;  1E9R A;  4I8O A;  1EIJ A;  3AL0 C;  1MN3 A;  2CFO A;  1OAI A;  3GRU A;  1TDH A;  2D7G A;  4RF0 A;  4WUR A;  3SFZ A;  1HQC A;  4B7G A;  3UGJ A;  4LF8 M;  2L2D A;  3VKG A;  4DUY M;  5H37 D;  1I4W A;  2J7O A;  2C5R A;  3J27 B;  4JI0 M;  1TF0 B;  4X66 M;  1DV0 A;  1OQY A;  3KDS E;  2CE7 A;  1XXH E;  1NJF A;  2L09 A;  3LW5 F;  4GH9 A;  4QHS A;  3RGP A;  4B7H A;  2BNK A;  4CJ6 A;  1TR8 A;  4HLQ A;  4REZ A;  1E9S A;  2M60 A;  1XMQ M;  4YY3 M;  3GLG A;  4CGY B;  2XH9 A;  3U6Q A;  2UUA M;  3U6C A;  5ITT A;  5KPZ A;  3QYB A;  1NNU C;  3KSX A;  1XXH A;  2L7I A;  2R44 A;  4RF1 A;  1HNX M;  3GPP A;  1ORY B;  1SXJ B;  3CF0 A;  3CF6 E;  3HU3 A;  3TWK A;  1N33 M;  2NQ8 C;  3V76 A;  4FW9 A;  1OIZ A;  3E9S A;  1R7R A;  4KO8 A;  4L15 A;  4LZZ A;  3AFH A;  2XSZ D;  4IBD A;  4B7F A;  4AKI A;  1N32 M;  3FRH A;  1GJS A;  3FD9 A;  1ZMW A;  2ZAM A;  1VEJ A;  2X49 A;  4LGY A;  2L4E A;  1HQY E;  4FCV A;  1AIP C;  4Y28 F;  4IJF A;  3OTO M;  3KP1 E;  3GQ3 A;  1C1K A;  1EE8 A;  1YUB A;  3HWS A;  2DWM A;  3E4R A;  2C99 A;  2QEN A;  3FE3 A;  4PDG A;  4D81 A;  2OOB A;  1OFH A;  2QPA A;  4LF7 M;  5EXT A;  1XXH B;  3B7N A;  3LQQ A;  1VDD A;  2O5R A;  1S3S A;  1Z6T A;  2Z8Y M;  1XB2 B;  2UXC M;  5KPT A;  3FYC A;  3SMS A;  3JR5 A;  2DXI A;  3U6D A;  1NO1 A;  3KVW A;  5EJC A;  2JZ1 A;  2KHH A;  2EO2 A;  3EIE A;  3GLF A;  3LQR A;  1IM2 A;  2ZTD A;  4IBJ A;  4LJ5 A;  4NXM M;  1OIP A;  1NY6 A;  1ZMU A;  2FNA A;  4TUW A;  3ILK A;  2UUC M;  3ZC7 B;  2BJV A;  1QDT A;  1HT1 E;  1SXJ E;  3IHP A;  3KOY E;  4LZJ A;  4MGI E;  4DR7 M;  2LH0 A;  4QOS A;  3Q8X A;  3GLH A;  2JUJ A;  3MMP A;  2DWZ B;  4I4L A;  3VFD A;  3L2A A;  5KQD A;  3U6L A;  2MGW A;  3HX3 A;  2Y21 A;  2X8A A;  3A46 A;  3C3E A;  2R62 A;  4I81 A;  4IBG A;  5LMU M;  1L2B A;  4DR1 M;  4BLC A;  2JY8 A;  2R4J A;  4GIT A;  5EP2 A;  2QBY A;  3A98 B;  4QNM A;  1E32 A;  2FH0 A;  1WGN A;  1ZQ9 A;  3C3D A;  3ZQJ A;  4S12 A;  3FTE A;  4DV4 M;  4OX9 M;  3VDU A;  2I7N A;  1EFU B;  1QDR A;  1Z5B A;  2KA6 B;  1GAB A;  1NY5 A;  3TE6 A;  1JQJ C;  1V33 A;  2OQ4 A;  2LVA A;  5LMN M;  2GQF A;  1IN5 A;  3TWM A;  2BWE A;  3CF2 A;  4L6V 6;  3M7G A;  3UJN A;  2XZF A;  2RGH A;  3HJ8 A;  2F5O A;  1WR1 B;  2JNH A;  1GKI A;  1G3I A;  3H4J A;  3HGI A;  3DOA A;  5ITU A;  4HL4 A;  2CWB A;  4AZF A;  1JR3 A;  5FSW A;  2UUB M;  2CHV A;  3L25 A;  2JZ0 A;  4LG2 A;  3KOZ E;  5ITR A;  1V92 A;  1QAM A;  1TH3 A;  4IBC A;  2F4V M;  3B74 A;  2F5P A;  2F5S A;  2JXN A;  4JI7 M;  2H5X A;  4NSO B;  3M6A A;  3SBJ A;  2L6O A;  1C7Y A;  1HJP A;  3K2L A;  4NRV A;  3JR4 A;  1Q3B A;  1LV7 A;  4AW4 A;  1Z59 A;  2FS1 A;  4ANR A;  5EP3 A;  2V1U A;  2YR0 A;  5IWA M;  3WHK A;  3U6E A;  1OAO C;  2C9C A;  4RKU F;  3KXE C;  1KYI A;  1DGH A;  1L2D A;  5E26 A;  4NOO B;  2EJS A;  2QBY B;  4OVZ A;  3HKP A;  2DEN A;  2DAM A;  3LCU A;  4BBA A;  3U5Z B;  2J5Y A;  2ZM6 M;  1IBK M;  1GL7 A;  1TGU A;  4FVM A;  4RNA A;  1NHG C;  3T38 A;  1IN4 A;  2VQE M;  2G8L A;  4AI6 A;  2J7N A;  3SC3 A;  2QNJ A;  4IBE A;  2K0B X;  1L8Q A;  3PNV A;  1SXJ A;  4MB7 A;  1D0M A;  1H6U A;  1YE9 A;  5FTK A;  4PDI A;  4AQY M;  2DHR A;  4DV1 M;  1PJT A;  2MR9 A;  3QAU A;  1TH4 A;  1SXJ C;  2DAI A;  4KT0 F;  2BWB A;  1Q02 A;  2DAG A;  4DR3 M;  1K3X A;  4LF5 M;  2C9O A;  1JB0 F;  3PXG A;  3SYK A;  2H1R A;  3I01 M;  4QOZ C;  2C96 A;  3L27 A;  3GO8 A;  4JV5 M;  4X62 M;  3HY5 A;  2MJ5 B;  4K0K M;  2O01 F;  4BB9 A;  3FUX A;  3GLI A;  1DO2 A;  4JI6 M;  1R4G A;  2OOA A;  2KDL A;  4XGI A;  2WSE F;  4GMQ A;  2QHO B;  2JP7 A;  4D82 A;  3U6M A;  1IBM M;  2DWL A;  3SAR A;  4LF4 M;  2CP8 A;  4GHL A;  4LFC M;  2K47 A;  1DGG A;  2QCU A;  4LJA A;  4LJ9 A;  4CHT B;  4Z6Y A;  3SAV A;  2KXE A;  4PT5 A;  4CIS A;  1PJQ A;  4GC9 A;  1SG9 A;  2R4E A;  4JI5 M;  1WGL A;  1T3T A;  1G71 A;  2AHM A;  2GNO A;  4G4O A;  1L2C A;  3B89 A;  3VK8 A;  1OTR A;  4AG6 A;  2O25 A;  2Y0T A;  2L7H A;  5GKN A;  4M0W A;  4LF6 M;  1IY0 A;  1J09 A;  4PD2 A;  4Z8X A;  1GL6 A;  3U61 B;  4LY6 A;  2QSF X;  3GLG B;  2WSC F;  1QAN A;  1NHW C;  3U6S A;  3W0L B;  2XZU A;  3GRY A;  2E5L M;  2HHH M;  2Y0Q A;  3GLH B;  3HJS A;  3HZJ A;  2DWN A;  3GLI B;  1G8P A;  4DV5 M;  3KP0 E;  4DR2 M;  4JI2 M;  4G4R A;  2UXD M;  3A42 A;  2Z4S A;  2VQF M;  3HU2 A;  3QWL A;  4HEO A;  4NL4 H;  1BVS A;  3RFW A;  4ZPX A;  4DV6 M;  2Z4R A;  4FD2 A;  5KQ8 A;  1NJG A;  2R18 A;  4P17 A;  1XHB A;  3AOE C;  1KSF X;  3J2P B;  3SMP A;  1IQP A;  2W82 A;  4AG5 A;  3I4Y A;  3IG5 A;  1N36 M;  4G4N A;  4JI4 M;  2HL7 A;  3L28 A;  2ZAN A;  2UU9 M;  2DAK A;  4GEW A;  3W68 A;  1VQ1 A;  4F2L A;  4IBF A;  5DNY A;  1CUK A;  3J81 S;  5EXX A;  4IJE A;  2R6F A;  3HHY A;  2FE8 A;  4DR6 M;  4R71 A;  3U61 A;  1Y8G A;  1WIV A;  2D7H A;  4GKK M;  2VDB B;  2LXE A;  2R46 A;  3FUW A;  4L78 A;  2OO9 A;  2C98 A;  3GQ5 A;  4P16 A;  2R0I A;  1N34 M;  2JA2 A;  2CV0 A;  1XNQ M;  1JR3 E;  4B08 A;  3KOW E;  4L4U A;  4LGM A;  2YFQ A;  2G3Q A;  4UN2 B;  3UMM A;  2D7E A;  3GRR A;  4MGH A;  1VDL A;  4JI1 M;  2XLJ A;  3RGS A;  3THG A;  3FTD A;  3JAM S;  3TL4 X;  4X64 M;  1XNR M;  1N77 A;  3NBI A;  1TTE A;  1IBL M;  1RU3 A;  2CUZ A;  1ZMV A;  3W67 A;  2UXB M;  3C9P A; 
#chains in the Genus database with same CATH homology
 4D80 A;  5DYG A;  4FWD A;  5ITX A;  3ZCB B;  3CTW B;  4DV7 M;  1I94 M;  4X65 M;  2Q2E B;  3UK6 A;  2G5G X;  4FCT A;  1IY1 A;  3HHW A;  3KOX E;  4LJ7 A;  4A3V B;  2CEA A;  4I5S A;  5ITQ A;  5JI3 E;  4G6Z A;  1MX0 A;  3T1Y M;  4AKH A;  4GIP A;  2XSZ A;  2XF3 A;  4GHA A;  3BOS A;  1R6B X;  3LMM A;  3HHX A;  3VLF B;  5ITX E;  2FFJ A;  5IT9 S;  2LNH C;  3T15 A;  2VII A;  1J5E M;  3FKE A;  4MGZ E;  3PFI A;  4B3T M;  3R9X B;  1YSY A;  3AOE A;  1HT2 E;  3LVV A;  1WXQ A;  4EIW A;  2FOI C;  3FUU A;  3LVW A;  4II7 A;  2CV2 A;  2LWX A;  3TQS A;  5F3W A;  4PCZ A;  1GVN A;  4LFB M;  4DR4 M;  3I51 A;  2DZO B;  1PM5 A;  2XGN A;  1NVM A;  1IN6 A;  1QYR A;  1HNZ M;  2ZAO A;  1N78 A;  1G59 A;  1XC8 A;  1JR3 D;  1GLN A;  4LCB A;  3SAS A;  3GQ4 A;  4NSR A;  2YNM D;  5IRE B;  3KS8 A;  4FWG A;  4M9Z A;  3M0E A;  1D2N A;  2RGO A;  3FTF A;  3AJI B;  4XBO A;  1IY2 A;  4LJ4 A;  1XMO M;  1L1Z A;  3U5Z A;  3SAT A;  2DZN B;  1PJJ A;  2ZBK B;  1K3W A;  1IXS B;  1Q39 A;  1QAQ A;  4MGY E;  3WHL A;  4ITQ A;  1Q3C A;  4QHT A;  3SYL A;  3SHF A;  4IBK A;  2X4A A;  5E6J A;  2KRK A;  1HR0 M;  5C18 A;  4NXN M;  5BPV A;  3KS4 A;  3W0F A;  3T1H M;  1DGH B;  3FTC A;  2KZU A;  3TWL A;  3GLF B;  5FTM A;  1QZM A;  1X37 A;  2KW0 A;  2KZS A;  3K8Z A;  3HU1 A;  3TPZ A;  3H4M A;  1N34 M;  4G4Q A;  2QZ4 A;  2DWL A;  7CAT A;  1IXR C;  1QQW A;  3D8B A;  3D8L A;  4JYA M;  2CHG A;  4LJ8 A;  2KRU A;  1SXJ D;  3NWL A;  3SAW A;  3MHV C;  1N75 A;  4IBI A;  4B3R M;  4W5W A;  5DYI A;  2EA0 A;  3HJQ A;  3J80 S;  3EIH A;  3RE8 A;  4QNR A;  3FYD A;  3HHZ A;  3MJ5 A;  4B3M M;  4OU7 A;  4LFA M;  5KPR A;  2XEP A;  4LRS A;  2Y20 A;  1E94 E;  2OPF A;  4DV0 M;  3IG8 A;  4M9X A;  1Z5C A;  5JI2 E;  1TDZ A;  3I4V A;  3AV0 A;  4AKG A;  2V6Z M;  3FUV A;  5FTN A;  1OJL A;  1DGF A;  1FJG M;  4M0D A;  3KSJ A;  3AKZ A;  3C58 A;  2Z7J A;  3K1J A;  2CHQ A;  1DO0 A;  5BR8 M;  3GRV A;  5C1B A;  2CV1 A;  4KOD A;  1QVR A;  4KLN A;  3GPU A;  5EXP A;  1ZAE A;  3PNY A;  3A45 A;  1TH2 A;  4JI8 M;  4JI3 M;  2P5T A;  5FTJ A;  4DR5 M;  2XFT A;  3B9P A;  3U6O A;  3DA1 A;  4MM3 B;  3SAU A;  1Z5A A;  3U60 A;  4FCW A;  4KHP M;  3VKH A;  1DGB A;  2KEB A;  5EP1 A;  2HCB A;  1FNN A;  4B3S M;  3UZU A;  4OVZ B;  4LF9 M;  2BJW A;  1NNJ A;  1OFI A;  2I7P A;  3L29 A;  3DFZ A;  4R7G A;  3SHG B;  5KO3 A;  2F5N A;  4GKJ M;  1IXZ A;  1IN8 A;  1J7K A;  4YHH M;  5FLX S;  1XWI A;  2DVW B;  5ITY A;  3KFU G;  2Z3X A;  3VDP A;  1G4A E;  2YQZ A;  3ZH9 B;  1L1T A;  4OW0 A;  5EQT A;  1W5S A;  4GC5 A;  5IZ7 D;  2M5Z A;  3GPY A;  4DV2 M;  1R2Z A;  4R3D A;  3VK7 A;  4JXJ A;  1UM8 A;  3GPX A;  2RKO A;  2V1C A;  3DZD A;  4MH0 E;  2QP9 X;  5FTL A;  3U6P A;  1QAO A;  2R65 A;  2R45 A;  3GP1 A;  3PVS A;  3MK6 A;  4LRT A;  1PJI A;  3AOG A;  4WW0 A;  4M9S A;  5EXS A;  4DUZ M;  1NSF A;  3R8F A;  1IN7 A;  3J7B A;  1HNW M;  2HKJ A;  4DV3 M;  3L26 A;  5EP4 A;  3J7A S;  1W5T A;  3K92 A;  2EUC A;  4GRI A;  2XFS A;  1G41 A;  4LJ6 A;  4MGK E;  4FWH A;  3FUT A;  4IIW A;  3U60 B;  4L16 A;  8CAT A;  1MU5 A;  2A5Y B;  1R2Y A;  4L8R C;  2ERC A;  1KFV A;  1K82 A;  2F5Q A;  3KW6 A;  4JN6 A;  5A2Q S;  4IBB A;  1E9R A;  4I8O A;  3AL0 C;  2CFO A;  3GRU A;  4RF0 A;  1TDH A;  2D7G A;  4WUR A;  3SFZ A;  1HQC A;  4B7G A;  3UGJ A;  4LF8 M;  3VKG A;  4DUY M;  5H37 D;  1I4W A;  2J7O A;  2C5R A;  3J27 B;  4JI0 M;  4X66 M;  3KDS E;  2CE7 A;  2L09 A;  1NJF A;  4GH9 A;  3RGP A;  4B7H A;  4QHS A;  2BNK A;  4HLQ A;  4REZ A;  1E9S A;  2M60 A;  1XMQ M;  4YY3 M;  3GLG A;  4CGY B;  2XH9 A;  3U6Q A;  2UUA M;  3U6C A;  5ITT A;  5KPZ A;  1NNU C;  3KSX A;  1XXH A;  2L7I A;  4RF1 A;  1HNX M;  3GPP A;  1ORY B;  1SXJ B;  3CF0 A;  3CF6 E;  3HU3 A;  3TWK A;  1N33 M;  2NQ8 C;  4FW9 A;  3E9S A;  1R7R A;  4KO8 A;  4L15 A;  4LZZ A;  3AFH A;  2XSZ D;  4IBD A;  4B7F A;  4AKI A;  1N32 M;  3FD9 A;  4LGY A;  2ZAM A;  2X49 A;  4FCV A;  1HQY E;  3OTO M;  4IJF A;  3KP1 E;  3GQ3 A;  1C1K A;  1EE8 A;  1YUB A;  3HWS A;  2DWM A;  3E4R A;  2C99 A;  2QEN A;  4PDG A;  4D81 A;  1OFH A;  2QPA A;  4LF7 M;  5EXT A;  1XXH B;  3LQQ A;  1VDD A;  2O5R A;  1S3S A;  1Z6T A;  2UXC M;  5KPT A;  3FYC A;  3SMS A;  3JR5 A;  2DXI A;  3U6D A;  3KVW A;  5EJC A;  3GLF A;  3EIE A;  2EO2 A;  3LQR A;  1IM2 A;  4NXM M;  4IBJ A;  4LJ5 A;  1NY6 A;  2FNA A;  4TUW A;  3ILK A;  2UUC M;  3ZC7 B;  2BJV A;  1SXJ E;  1HT1 E;  4LZJ A;  4MGI E;  3KOY E;  4NRW A;  4DR7 M;  2LH0 A;  4QOS A;  3Q8X A;  3GLH A;  5KQD A;  2DWZ B;  4I4L A;  3VFD A;  3L2A A;  3U6L A;  2Y21 A;  2X8A A;  3A46 A;  2R62 A;  4I81 A;  4IBG A;  5LMU M;  1L2B A;  4DR1 M;  4BLC A;  2R4J A;  4GIT A;  5EP2 A;  2QBY A;  3A98 B;  4QNM A;  1E32 A;  1ZQ9 A;  4S12 A;  3FTE A;  4DV4 M;  4OX9 M;  3VDU A;  2I7N A;  1Z5B A;  2KA6 B;  1NY5 A;  3TE6 A;  1JQJ C;  2OQ4 A;  5LMN M;  1IN5 A;  3TWM A;  3CF2 A;  3M7G A;  3UJN A;  2XZF A;  2RGH A;  3HJ8 A;  2F5O A;  3HGI A;  1GKI A;  1G3I A;  3DOA A;  5ITU A;  4HL4 A;  4AZF A;  1JR3 A;  5FSW A;  2UUB M;  2CHV A;  3L25 A;  4LG2 A;  3KOZ E;  5ITR A;  1QAM A;  1TH3 A;  4IBC A;  2F4V M;  2F5P A;  2F5S A;  4JI7 M;  4NSO B;  3M6A A;  3SBJ A;  2L6O A;  3K2L A;  4NRV A;  3JR4 A;  1Q3B A;  1LV7 A;  4AW4 A;  1Z59 A;  5EP3 A;  2V1U A;  2YR0 A;  5IWA M;  3WHK A;  3U6E A;  2C9C A;  3KXE C;  1KYI A;  1DGH A;  1L2D A;  5E26 A;  4NOO B;  2QBY B;  4OVZ A;  3HKP A;  3U5Z B;  4BBA A;  2ZM6 M;  1IBK M;  1GL7 A;  1TGU A;  4FVM A;  4RNA A;  1NHG C;  3T38 A;  1IN4 A;  2VQE M;  2G8L A;  4AI6 A;  2J7N A;  3SC3 A;  4IBE A;  3PNV A;  1L8Q A;  1SXJ A;  4MB7 A;  1YE9 A;  1H6U A;  5FTK A;  4PDI A;  4AQY M;  2DHR A;  4DV1 M;  3QAU A;  4DR3 M;  1TH4 A;  1SXJ C;  1K3X A;  4LF5 M;  2C9O A;  3PXG A;  3SYK A;  2H1R A;  4QOZ C;  2C96 A;  3L27 A;  3GO8 A;  4JV5 M;  4X62 M;  4K0K M;  4BB9 A;  3GLI A;  3FUX A;  1DO2 A;  4JI6 M;  4XGI A;  4GMQ A;  4D82 A;  3U6M A;  1IBM M;  3SAR A;  4LF4 M;  4GHL A;  4LFC M;  2K47 A;  1DGG A;  2QCU A;  4LJA A;  4LJ9 A;  4CHT B;  4Z6Y A;  3SAV A;  2KXE A;  4PT5 A;  4CIS A;  4GC9 A;  2R4E A;  4JI5 M;  1T3T A;  2AHM A;  4G4O A;  1L2C A;  3VK8 A;  4AG6 A;  2Y0T A;  5GKN A;  2L7H A;  4LF6 M;  4M0W A;  1IY0 A;  1J09 A;  4PD2 A;  4Z8X A;  1GL6 A;  3U61 B;  4LY6 A;  3GLG B;  1QAN A;  1NHW C;  3U6S A;  3W0L B;  2XZU A;  3GRY A;  2E5L M;  2HHH M;  2Y0Q A;  3GLH B;  3HJS A;  2DWN A;  3GLI B;  1G8P A;  4DV5 M;  3KP0 E;  4DR2 M;  4JI2 M;  4G4R A;  2UXD M;  3A42 A;  2Z4S A;  2VQF M;  3HU2 A;  3QWL A;  4NL4 H;  3RFW A;  4ZPX A;  4DV6 M;  2Z4R A;  4FD2 A;  5KQ8 A;  1NJG A;  2R18 A;  1XHB A;  3AOE C;  1KSF X;  3J2P B;  3SMP A;  1IQP A;  2W82 A;  4AG5 A;  3I4Y A;  3IG5 A;  1N36 M;  4G4N A;  4JI4 M;  2HL7 A;  3L28 A;  2ZAN A;  2UU9 M;  4IBF A;  5DNY A;  3J81 S;  5EXX A;  4IJE A;  3HHY A;  2FE8 A;  4DR6 M;  3U61 A;  2D7H A;  4GKK M;  2LXE A;  2R46 A;  3FUW A;  4L78 A;  2C98 A;  3GQ5 A;  4P16 A;  2JA2 A;  2CV0 A;  1XNQ M;  4B08 A;  3KOW E;  4L4U A;  4LGM A;  2YFQ A;  3UMM A;  2D7E A;  3GRR A;  4MGH A;  4JI1 M;  2XLJ A;  3RGS A;  3THG A;  3FTD A;  3JAM S;  3TL4 X;  4X64 M;  1XNR M;  1N77 A;  3NBI A;  1IBL M;  2CUZ A;  2UXB M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...