4DR2M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr2M02
4NXNM 1HR0M 4JYAM 4LF9M 4K0KM 1J5EM 4LFAM 1NNJA 3SBJA 5A2QS 4DUYM 3TWMA 4DV4M 3A42A 3TWKA 3GPYA 5ITYA 5ITXE 1K82A 1KFVA 4LF8M 3U6EA 2UUBM 4DR4M 3DOAA 1L2CA 4JI4M 3SATA 1PM5A 2F5SA 4B3RM 1PJIA 4DV0M 1L1ZA 3GQ3A 5LMNM 4GKKM 3VK7A 3GPUA 4NXMM 3SASA 4YY3M 2UU9M 1N33M 4LFCM 4PDGA 4X65M 3U6OA 1K3XA 1XNRM 3GQ4A 1XMQM 2F4VM 4X64M 2E5LM 1HNXM 4G4RA 1N36M 2VQFM 4AQYM 4DV6M 1L2DA 3W0FA 4DV5M 2F5QA 4CISA 2ZM6M 3U6DA 2UXCM 2UXDM 4NRVA 4DR5M 4X66M 2XZFA 2UXBM 3U6CA 2Q2EB 4DR7M 3T1YM 4DV3M 1IBKM 1R2YA 1IBMM 4LF5M 5IT9S 3GO8A 1Q3BA 2F5OA 4MB7A 5IWAM 1N34M 3JR5A 4DUZM 3J7AS 1XNQM 4B3SM 1Z5CA 4LF7M 3GP1A 4JI2M 4G4QA 3J81S 4JI3M 3VK8A 2ZBKB 1XMOM 4DR3M 5ITXA 3U6PA 4NRWA 5ITRA 2F5PA 3SARA 4DV1M 4YHHM 2UUAM 1K3WA 4GKJM 1HNWM 4PCZA 2EA0A 4B3TM 4LF6M 5ITTA 3C58A 3SAUA 1XC8A 4PD2A 2VQEM 3SAVA 4DV7M 2HKJA 4JI7M 3JAMS 1TDZA 4JI0M 4G4OA 5BR8M 4B3MM 1Z5AA 1Q3CA 3GQ5A 4ITQA 4X62M 2OPFA 4JI1M 4DR1M 1TDHA 3TWLA 2XZUA 2F5NA 4DR6M 4KHPM 1MU5A 1Q39A 4DR2M 1Z59A 3A45A 4PDIA 5ITQA 3GPPA 4G4NA 3U6LA 1EE8A 1Z5BA 1L1TA 4JI5M 5ITUA 5FLXS 1L2BA 4OX9M 3A46A 3U6QA 1MX0A 3J80S 1I94M 2HHHM 5LMUM 4DV2M 3OTOM 1N32M 1IBLM 4JI6M 3T1HM 4LF4M 3GPXA 1R2ZA 3SAWA 2UUCM 4JV5M 3U6MA 3JR4A 2OQ4A 3U6SA 1HNZM 1PJJA 1FJGM 4LFBM 4JI8M
chains in the Genus database with same CATH superfamily
2Z7JA 1PJSA 2JA2A 2CHQA 3GRYA 3VDPA 3AOGA 1HR0M 3B7NA 4L78A 2DXIA 1WXQA 3VLFB 4LF9M 4L4UA 1S3SA 3HWSA 3GLHA 3D8BA 4LFAM 1PGYA 3W68A 1NNJA 3SBJA 1OKSA 3FTCA 5A2QS 2L4FA 4LRTA 4QOSA 3SHFA 3A42A 4IBCA 1KFVA 1QAMA 2UUBM 1HQCA 3SC3A 1SXJD 2DKLA 3UGJA 1GJTA 4RKUF 4I4LA 3TE6A 5F3WA 2OO9A 1OFHA 1L2CA 4JI4M 4B3RM 2OOAA 5LMNM 1JB0F 3PNVA 3DFZA 1L8QA 2L7HA 3GPUA 3HU2A 1QAOA 1N33M 1IN8A 3BOSA 1XNRM 1G59A 3U60A 3GQ4A 3J27B 4GITA 4Y28F 1NO1A 1R7RA 4FCVA 1MN3A 1UM8A 4DV6M 3I01M 1L2DA 4II7A 2CUZA 2L4EA 3ZH9B 4DV5M 3WHKA 2ZM6M 4LJ6A 2CV0A 1QANA 3KVWA 1WR1B 1OQYA 2DZNB 3FE3A 3MMPA 4X66M 3EIHA 4QOZC 4AKHA 1VDDA 2LHGA 2W82A 4DR7M 2EJSA 3T1YM 2Z8YM 3KS8A 1VEJA 1N34M 4TUWA 1IXZA 1Y8GA 3E4RA 2K47A 2Y21A 2KA6B 4CHTB 3CF2A 4GIPA 4LF7M 1XNQM 2MR9A 3FUXA 4L6V6 1IN7A 4M9XA 4NL4H 2CRUA 2R44A 4LJ9A 1QVRA 4AG6A 3GLIA 2ZBKB 4MGHA 3FYCA 2D7HA 3QAUA 3U6PA 1OIZA 1GLNA 4KODA 5ITRA 1GL7A 3U5ZA 3R8FA 2XFTA 4KT0F 3LCVB 4OVZA 3L27A 5BPVA 7CATA 1OJLA 4D80A 1T3TA 2QPAA 1MJGM 2JWSA 5EXTA 3V76A 1N77A 3SAUA 1XC8A 1ZMWA 2JZ1A 3I51A 3SAVA 3GRVA 3T38A 1KSFX 2HKJA 1VDLA 2FOIC 4W5WA 4S12A 2JY6B 4ITQA 1TH4A 4X62M 3M7GA 3KOZE 4MH0E 3B9PA 2R46A 3SYKA 3AOEC 4IBIA 2I7PA 1ZMVA 3VKHA 5ITQA 5L8RF 1HT1E 1IXRC 4JI5M 4GH9A 4B7FA 4KLNA 5ITUA 2A5YB 3ZC7B 1EIJA 2BJVA 2RKOA 3GLHE 4JXJA 4BBAA 4RNAA 1D0LA 2ZANA 1I94M 4G6ZA 2JXNA 4LJ4A 1N32M 1XXHE 4LGMA 1Z6TA 4PT5A 5EXSA 3GLFE 2CV2A 1JR3A 5EXXA 8CATA 2HAKA 2DVWB 3RGSA 5FSWA 1DO0A 1DGHB 3CTWB 4NC6A 3GLFA 2UUCM 2G8LA 2XSZD 1DGFA 3AKZA 4R3DA 1LTMA 1GJSA 2HL7A 3ZQJA 3CF0A 1VEKA 2YQZA 5KQDA 3UMMA 1C7YA 4JI8M 4FD2A 4NSOB 3LVVA 1OTRA 3RFWA 3QWLA 4OW0A 3FTEA 4JYAM 3PVSA 4G3OA 3CF6E 2DWZB 3GLGA 5FTMA 3SYLA 3RE8A 3TWMA 1XXHA 3L29A 2X4AA 4P16A 3KFUG 3TWKA 4L15A 5DNYA 4LF8M 4ANRA 3HJSA 4DR4M 3U6EA 2KNAA 3FRHA 4FCTA 4LZZA 2JUJA 5EP1A 3U60B 3FUVA 2KW0A 2DHYA 3QYEA 3K9PA 2CP8A 4CGYB 1YE9A 1N78A 4NXMM 3SASA 4P17A 5KPTA 1KYIA 2C96A 4YY3M 2UU9M 4RF1A 4PDGA 3J7BA 1NY6A 4L8RC 3KXEC 1XMQM 2F4VM 4X64M 1R5LA 3FD9A 3HGIA 3L2AA 4M0WA 2I7NA 1D0MA 4B08A 4M9SA 1HQYE 2V1CA 3SHGB 4A3VB 2MH8A 1E9SA 1XXHB 5EP4A 2UXDM 2WSCF 3K9OA 3K1JA 5EXPA 3GLGB 2ZTCA 4DR5M 5IZ7D 2XZFA 2L09A 1NV9A 2VF7A 2DAEA 4F1IA 1VEGA 2JP7A 5IT9S 3FKEA 1Q3BA 4QHTA 5EP2A 4FVMA 2KZUA 4DUZM 2LH0A 1C1KA 1QZEA 2L2DA 2ZAOA 3FUUA 1WGLA 2R45A 4EIWA 3GP1A 4B3SM 2JZ0A 2QP9X 4JI3M 2CV1A 2FE8A 4FWDA 2RGOA 4Q7JA 3K2LA 4DR3M 4CIZA 2F5PA 3DZDA 3SARA 3THGA 2LVQD 3C9PA 4YHHM 3KW6A 1NV8A 4D82A 2EA0A 3DA1A 2HWJA 3KSJA 3HHWA 3B74A 1IM2A 4PD2A 4FCWA 3NBIA 3AFHA 4IJEA 1OAIA 1WHCA 4JI0M 4ZPXA 1PRBA 1OFIA 4B3MM 1ZQ9A 4LCBA 1Q3CA 5DFLA 1ZMUA 1A5TA 3I04M 3QYBA 3GQ5A 3GLIE 1G71A 3M0EA 2R18A 4LY6A 4LGYA 4JI1M 4OU7A 2FH0A 3R9XB 1NVMA 2XGNA 1Q39A 1ZAEA 3TL4X 1Z59A 3ZCBB 3FTDA 3GPPA 3U6LA 1L1TA 2QQ8A 2CE7A 3HKPA 5FLXS 3HZJA 1G4AE 5E6JA 4IIWA 4F2LA 1TTEA 1E94E 1OIPA 1NHGC 1TH3A 2EKFA 4OVZB 5KQ8A 2HHHM 2XSZA 3U5ZB 1T6OA 1IBLM 1G3IA 5KO3A 4KO8A 4I8OA 4I5SA 3RGPA 3GPXA 4FWHA 4BLCA 2LTUA 4IBGA 3TQSA 3LQRA 1VQ1A 3KS4A 3LMMA 1CUKA 1G8PA 4B7GA 2Z4RA 3HHZA 3UK6A 2NQ8C 2KDLA 2DENA 2Y20A 3M6AA 1PJJA 1OAOC 4L16A 2VF8A 3E9SA 4NXNM 1QUTA 2LVNC 3UJNA 1Q02A 5FTNA 2LBCA 3FYDA 4WURA 2BNKA 2P5TA 2KEBA 4DUYM 1T43A 4DV4M 1RU3A 4FW9A 4AG5A 4MGIE 1K82A 5ITXE 3FUTA 2JY7A 1P3QQ 3GRRA 1NHWC 5FTLA 2V1UA 3BBZA 3DOAA 4JN6A 1YLAA 3L25A 3BXWA 1BVSA 3IG8A 2V6ZM 4LJ5A 2QZ4A 1H6UA 3SATA 1PM5A 2QHOB 1PJIA 1L1ZA 1IFYA 1V33A 2CHGA 4GKKM 2XF3A 2YFQA 3VK7A 4I81A 2DAGA 4MGZE 2KNVA 1YUBA 4LFCM 3IHPA 3SFZA 4X65M 5H37D 2JNHA 2MGWA 2R62A 1PJTA 1QZMA 2DZLA 1SXJE 4G4RA 1WJ7A 2QENA 3KP0E 4MM3B 4QNRA 2VQFM 4AQYM 1N36M 2QNJA 2O01F 2QCUA 1QDRA 4CISA 3U6DA 1E9RA 1IN6A 4NRVA 3VKGA 1QDTA 3IG5A 2B3TA 5FTJA 3FRIA 2UXBM 3C3DA 4CJ6A 5JI2E 3F92A 3T15A 4R7GA 2XLJA 1QQWA 2Z3XA 2O25A 3MHVC 4LJAA 2J7OA 1AIPC 1R2YA 1IBKM 2R4JA 2X8AA 3HY5A 3L28A 5E26A 3GO8A 2EKKA 3LVWA 3K8ZA 4XBOA 1N75A 2DZOB 2LVAA 2RGHA 4MGYE 1W5TA 1DV0A 2L7IA 3UZUA 1GO5A 1Z5CA 1IXSB 2LXEA 2CWBA 4G4QA 1LV7A 2LVPC 4JI2M 3B7QA 3J81S 4WW0A 1NJGA 1AUAA 3H4JA 1DGGA 3FUWA 3PFIA 1XMOM 2WSEF 2K6BA 5ITXA 3WHLA 5C18A 4DV1M 3A98B 2EUCA 3EIEA 4Z8XA 1UFZA 3J2PB 3VFDA 1NNUC 1K3WA 4GKJM 4PCZA 3TPZA 2DNAA 1VG5A 3C58A 3B7ZA 2O5RA 4AKGA 4JI7M 4RF0A 3SMSA 2DAKA 2LHCA 4MGKE 5BR8M 2DAIA 4B7HA 3AOEA 2MJ5B 1YSYA 1F4IA 2ERCA 1SXJB 2BJWA 3HU3A 1IY2A 1TDHA 4HL4A 2YR0A 3TWLA 2XZUA 1J7KA 3HHXA 5KPRA 2WZJA 4QNMA 3VDUA 2LVOC 4G4NA 3HJ8A 1SG9A 1IY0A 1WIVA 1TH2A 3AV0A 2D7EA 2MROB 2ZTDA 1D0KA 4NOOB 5DYIA 4GEWA 4M0DA 4OX9M 4GHAA 3Q8XA 5FTKA 4DBGB 1R4GA 2J7NA 3IECA 4GC5A 3J80S 1XB2B 5KPZA 2LNHC 2BWEA 3GLHB 4IJFA 4BB9A 3OTOM 4DV2M 2QSFX 1IBMM 1NJFA 1DO2A 1NSFA 2BWBA 2CHVA 2K0BX 1V92A 3T1HM 2F5OA 3W0LB 4LF4M 1R2ZA 2AHMA 2KXEA 3SAWA 1QYRA 2VDBB 5IREB 4GRIA 1IXSA 3NWLA 1TF0B 3U6SA 3KOYE 1DGHA 3GLFB 4IBJA 2DWMA 3ILKA 4LG2A 2WSFF 1NY5A 2Y0TA 3C3EA 3KOWE 3LQQA 5C1BA 4REZA 2M60A 4K0KM 1J5EM 1FNNA 2GNOA 2C99A 3KDSE 3GPYA 2XFSA 5ITYA 2Z4SA 4M9ZA 1EFUB 4WP2A 2FNAA 1SXJC 2QBYB 5EJCA 2R0IA 1TR8A 3HJQA 4LZJA 1I4WA 2F5SA 1QUSA 4DV0M 2R65A 3GQ3A 1IN4A 1IY1A 3HX3A 2H5XA 2VIIA 3AJIB 2H1RA 2DWNA 3U6OA 1K3XA 1J09A 1XHBA 2KZSA 2E5LM 1HNXM 3FTFA 1GABA 3W67A 1E32A 3NBXX 4LRSA 3L26A 1GVNA 3W0FA 2F5QA 1QAQA 2C9OA 4IBDA 5EQTA 1X37A 2LWXA 2FS1A 2UXCM 2XEPA 4QHSA 2HCBA 3E21A 4IBFA 4IBEA 3U6CA 5DYGA 2L6OA 2Q2EB 3Q8GA 2RRUA 2XH9A 4DV3M 2C5RA 1GL6A 4LF5M 3GLIB 4MB7A 5IWAM 3AL0C 3JR5A 3U61B 3I4YA 2D7GA 2YNMD 3J7AS 4XK8F 1D2NA 1JR3E 1ORYB 3GRUA 3U61A 3VK8A 2KRUA 2KRKA 3E46A 2Y0QA 4AKIA 2G5GX 4HEOA 4IBKA 4NRWA 2DI0A 3T6PA 2X49A 4FWGA 4UN2B 2M5ZA 1DGBA 1HJPA 3LCUA 2UUAM 1ZV1A 2DHRA 1IN5A 3I4VA 3D8LA 1HNWM 4B3TM 4LF6M 3MJ5A 5ITTA 2FFJA 3CGWA 4HLQA 2VQEM 2C98A 3GLGE 3B89A 2CEAA 4DV7M 4IBBA 3JAMS 1TDZA 2R6FA 3LW5F 4XGIA 4AW4A 4G4OA 1XWIA 2C9CA 3KOXE 1HT2E 1Z5AA 2JY5A 2N35A 2DWLA 1SXJA 4Z6YA 3MK6A 2OPFA 5EP3A 4GHLA 4DR1M 3PXGA 5JI3E 4DR6M 2F5NA 3KP1E 3K92A 1MU5A 4KHPM 2EO2A 4DR2M 3A45A 4PDIA 2QBYA 4GC9A 2DAMA 1EE8A 1Z5BA 3HU1A 4LJ7A 2KHHA 4AI6A 1PJQA 2G3QA 1L2BA 4AZFA 3HHYA 3A46A 1JR3D 4LJ8A 4NSRA 3U6QA 1MX0A 1JQJC 2R4EA 5LMUM 4R71A 2CFOA 5GKNA 2APLA 1W5SA 3KSXA 2J5YA 2K9DA 4JI6M 3H4MA 4GMQA 1IQPA 1G41A 1TGUA 2OOBA 4JV5M 1WGNA 3SMPA 2JY8A 3JR4A 3U6MA 2GQFA 1GKIA 2KNZA 2OQ4A 1V34A 1HNZM 1R6BX 1FJGM 2ZAMA 4LFBM 3PNYA 4D81A
chains in the Genus database with same CATH topology
2Z7JA 2JA2A 2CHQA 3GRYA 3VDPA 3AOGA 1HR0M 2DXIA 4L78A 1WXQA 3VLFB 4LF9M 4L4UA 1S3SA 3HWSA 3GLHA 3D8BA 4LFAM 1NNJA 3SBJA 3FTCA 5A2QS 4LRTA 4QOSA 3SHFA 3A42A 4IBCA 1KFVA 1QAMA 2UUBM 1HQCA 3SC3A 1SXJD 3UGJA 4I4LA 3TE6A 5F3WA 1OFHA 1L2CA 4JI4M 4B3RM 5LMNM 3PNVA 3DFZA 1L8QA 2L7HA 3GPUA 3HU2A 1QAOA 1N33M 1IN8A 3BOSA 1XNRM 1G59A 3U60A 3GQ4A 3J27B 4GITA 1R7RA 4FCVA 1UM8A 1L2DA 4DV6M 4II7A 2CUZA 3ZH9B 4DV5M 3WHKA 2ZM6M 4LJ6A 2CV0A 1QANA 3KVWA 4AKHA 2DZNB 4X66M 4QOZC 3EIHA 1VDDA 2W82A 4DR7M 3T1YM 3KS8A 1N34M 4TUWA 1IXZA 3E4RA 2K47A 2Y21A 2KA6B 4CHTB 3CF2A 4GIPA 4LF7M 1XNQM 3FUXA 1IN7A 4M9XA 4NL4H 4LJ9A 1QVRA 4AG6A 3GLIA 2ZBKB 4MGHA 3FYCA 2D7HA 3QAUA 3U6PA 4KODA 1GLNA 5ITRA 3U5ZA 1GL7A 3R8FA 2XFTA 4OVZA 5BPVA 7CATA 3L27A 1OJLA 4D80A 1T3TA 2QPAA 5EXTA 1N77A 3SAUA 1XC8A 3I51A 3SAVA 3GRVA 3T38A 1KSFX 2HKJA 2FOIC 4W5WA 4S12A 4ITQA 1TH4A 4X62M 3M7GA 3KOZE 4MH0E 3B9PA 2R46A 3SYKA 3AOEC 4IBIA 2I7PA 3VKHA 5ITQA 1HT1E 1IXRC 4JI5M 4GH9A 4B7FA 4KLNA 5ITUA 2A5YB 3ZC7B 2BJVA 2RKOA 4BBAA 4JXJA 1I94M 4RNAA 2ZANA 4G6ZA 4LJ4A 1N32M 4LGMA 5EXSA 1Z6TA 4PT5A 2CV2A 1JR3A 5EXXA 8CATA 2DVWB 3RGSA 5FSWA 1DO0A 1DGHB 3CTWB 3GLFA 2UUCM 2G8LA 2XSZD 1DGFA 3AKZA 4R3DA 2HL7A 3CF0A 2YQZA 5KQDA 3UMMA 4JI8M 4FD2A 4NSOB 3LVVA 3RFWA 3QWLA 4OW0A 3FTEA 4JYAM 3PVSA 3CF6E 2DWZB 3GLGA 5FTMA 3SYLA 3RE8A 3TWMA 1XXHA 3L29A 2X4AA 4P16A 3KFUG 3TWKA 4L15A 5DNYA 4LF8M 3HJSA 4DR4M 3U6EA 4FCTA 4LZZA 5EP1A 3U60B 3FUVA 2KW0A 4CGYB 1YE9A 1N78A 4NXMM 3SASA 4YY3M 5KPTA 1KYIA 2C96A 2UU9M 4RF1A 4PDGA 3J7BA 1NY6A 3KXEC 1XMQM 2F4VM 4X64M 3HGIA 3FD9A 3L2AA 4M0WA 2I7NA 4B08A 4M9SA 1HQYE 2V1CA 3SHGB 4A3VB 1E9SA 1XXHB 5EP4A 2UXDM 3K1JA 5EXPA 3GLGB 4DR5M 5IZ7D 2XZFA 2L09A 5IT9S 3FKEA 1Q3BA 4QHTA 5EP2A 4FVMA 2KZUA 4DUZM 2LH0A 1C1KA 2ZAOA 4EIWA 3FUUA 4B3SM 2R45A 3GP1A 2QP9X 4JI3M 2CV1A 2FE8A 4FWDA 2RGOA 3K2LA 4DR3M 2F5PA 3DZDA 3SARA 3THGA 4YHHM 3KW6A 4D82A 2EA0A 3DA1A 3KSJA 3HHWA 1IM2A 4PD2A 4FCWA 3NBIA 3AFHA 4IJEA 4JI0M 4ZPXA 1OFIA 4B3MM 1ZQ9A 4LCBA 1Q3CA 3GQ5A 3M0EA 2R18A 4LY6A 4LGYA 4JI1M 4OU7A 3R9XB 1NVMA 2XGNA 1Q39A 1ZAEA 3TL4X 1Z59A 3ZCBB 3FTDA 3GPPA 3U6LA 1L1TA 2CE7A 3HKPA 5FLXS 1G4AE 5E6JA 4IIWA 1E94E 5KQ8A 1NHGC 1TH3A 4OVZB 2HHHM 2XSZA 3U5ZB 1IBLM 1G3IA 5KO3A 4KO8A 4I8OA 4I5SA 3RGPA 3GPXA 4FWHA 4BLCA 4IBGA 3TQSA 3LQRA 3LMMA 3KS4A 4B7GA 3HHZA 1G8PA 2Z4RA 1PJJA 3UK6A 2NQ8C 3M6AA 2Y20A 4L16A 3E9SA 4NXNM 3UJNA 5FTNA 3FYDA 4WURA 2BNKA 2P5TA 2KEBA 4DUYM 4DV4M 4FW9A 4AG5A 4MGIE 1K82A 5ITXE 3FUTA 5FTLA 3GRRA 1NHWC 2V1UA 3DOAA 4JN6A 3L25A 3IG8A 2V6ZM 4LJ5A 2QZ4A 1H6UA 3SATA 1PM5A 1PJIA 1L1ZA 2CHGA 4GKKM 2XF3A 2YFQA 3VK7A 4I81A 4MGZE 1YUBA 4LFCM 3SFZA 4X65M 5H37D 2R62A 1QZMA 1SXJE 4G4RA 1N36M 2QENA 3KP0E 4MM3B 4QNRA 2VQFM 4AQYM 2QCUA 4CISA 3U6DA 1E9RA 1IN6A 4NRVA 3VKGA 3IG5A 5FTJA 2UXBM 5JI2E 3T15A 4R7GA 2XLJA 1QQWA 2Z3XA 3MHVC 4LJAA 1IBKM 2J7OA 1R2YA 1IBMM 4L8RC 2R4JA 2X8AA 3GO8A 3L28A 5E26A 2F5OA 3LVWA 3K8ZA 4XBOA 1N75A 2DZOB 2RGHA 4MGYE 1W5TA 2L7IA 3UZUA 1Z5CA 1IXSB 2LXEA 4JI2M 4G4QA 1LV7A 3J81S 4WW0A 1NJGA 1DGGA 3FUWA 3PFIA 1XMOM 5ITXA 3WHLA 5C18A 4DV1M 3A98B 2EUCA 3EIEA 4Z8XA 3J2PB 3VFDA 1NNUC 1K3WA 4GKJM 4PCZA 3TPZA 3C58A 2O5RA 4AKGA 4JI7M 4RF0A 3SMSA 4MGKE 5BR8M 4B7HA 3AOEA 1YSYA 2ERCA 1SXJB 2BJWA 3HU3A 1IY2A 1TDHA 4HL4A 2YR0A 3TWLA 2XZUA 1J7KA 3HHXA 5KPRA 4QNMA 3VDUA 4G4NA 3HJ8A 1IY0A 1TH2A 3AV0A 2D7EA 4NOOB 5DYIA 4M0DA 4OX9M 4GHAA 3Q8XA 5FTKA 2J7NA 4GC5A 3J80S 5KPZA 2LNHC 3GLHB 4IJFA 4BB9A 3OTOM 4DV2M 1NJFA 1DO2A 1NSFA 2CHVA 3T1HM 3W0LB 4LF4M 1R2ZA 2AHMA 2KXEA 3SAWA 1QYRA 5IREB 4GRIA 3NWLA 3U6SA 3KOYE 1DGHA 3GLFB 4IBJA 2DWMA 3ILKA 4LG2A 5C1BA 1NY5A 2Y0TA 3KOWE 3LQQA 4REZA 2M60A 4K0KM 1J5EM 1FNNA 2C99A 3KDSE 3GPYA 2XFSA 5ITYA 2Z4SA 4M9ZA 2FNAA 1SXJC 2QBYB 5EJCA 3HJQA 4LZJA 1I4WA 2F5SA 4DV0M 2R65A 3GQ3A 1IN4A 1IY1A 2VIIA 3AJIB 2H1RA 2DWNA 3U6OA 1K3XA 1J09A 1XHBA 2KZSA 2E5LM 1HNXM 3FTFA 1E32A 4LRSA 3L26A 1GVNA 3W0FA 2F5QA 1QAQA 2C9OA 4IBDA 5EQTA 1X37A 2LWXA 2UXCM 2XEPA 4QHSA 2HCBA 4IBFA 4IBEA 3U6CA 5DYGA 2L6OA 2Q2EB 4DV3M 2XH9A 2C5RA 1GL6A 4LF5M 3GLIB 4MB7A 5IWAM 3AL0C 3JR5A 3U61B 3I4YA 2D7GA 2YNMD 3J7AS 1D2NA 1ORYB 3GRUA 3U61A 3VK8A 2KRUA 2KRKA 2Y0QA 4AKIA 2G5GX 4IBKA 4NRWA 2X49A 4FWGA 2M5ZA 1DGBA 2UUAM 2DHRA 1IN5A 3I4VA 3D8LA 1HNWM 4B3TM 4LF6M 3MJ5A 5ITTA 2FFJA 4HLQA 2VQEM 2C98A 2CEAA 4DV7M 4IBBA 3JAMS 1TDZA 4XGIA 4AW4A 4G4OA 1XWIA 2C9CA 3KOXE 1HT2E 1Z5AA 2DWLA 1SXJA 4Z6YA 3MK6A 2OPFA 5EP3A 4GHLA 4DR1M 3PXGA 5JI3E 4DR6M 2F5NA 3KP1E 3K92A 1MU5A 4KHPM 2EO2A 4DR2M 3A45A 4PDIA 2QBYA 4GC9A 1EE8A 1Z5BA 3HU1A 4LJ7A 4AI6A 1L2BA 4AZFA 3HHYA 3A46A 1JR3D 4LJ8A 4NSRA 3U6QA 1MX0A 1JQJC 2R4EA 5LMUM 2CFOA 5GKNA 1W5SA 3KSXA 4JI6M 3H4MA 4GMQA 1IQPA 1G41A 1TGUA 4JV5M 3SMPA 3U6MA 3JR4A 1GKIA 2OQ4A 1HNZM 1R6BX 1FJGM 2ZAMA 4LFBM 3PNYA 4D81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN M;  1HR0 M;  4JYA M;  4LF9 M;  4K0K M;  1J5E M;  4LFA M;  1NNJ A;  3SBJ A;  5A2Q S;  4DUY M;  3TWM A;  4DV4 M;  3A42 A;  3TWK A;  3GPY A;  5ITY A;  5ITX E;  1K82 A;  1KFV A;  4LF8 M;  3U6E A;  2UUB M;  4DR4 M;  3DOA A;  1L2C A;  4JI4 M;  3SAT A;  1PM5 A;  2F5S A;  4B3R M;  1PJI A;  4DV0 M;  1L1Z A;  3GQ3 A;  5LMN M;  4GKK M;  3VK7 A;  3GPU A;  4NXM M;  3SAS A;  4YY3 M;  2UU9 M;  1N33 M;  4LFC M;  4PDG A;  4X65 M;  3U6O A;  1K3X A;  1XNR M;  3GQ4 A;  1XMQ M;  2F4V M;  4X64 M;  2E5L M;  1HNX M;  4G4R A;  1N36 M;  2VQF M;  4AQY M;  4DV6 M;  1L2D A;  3W0F A;  4DV5 M;  2F5Q A;  4CIS A;  2ZM6 M;  3U6D A;  2UXC M;  2UXD M;  4NRV A;  4DR5 M;  4X66 M;  2XZF A;  2UXB M;  3U6C A;  2Q2E B;  4DR7 M;  3T1Y M;  4DV3 M;  1IBK M;  1R2Y A;  1IBM M;  4LF5 M;  5IT9 S;  3GO8 A;  1Q3B A;  2F5O A;  4MB7 A;  5IWA M;  1N34 M;  3JR5 A;  4DUZ M;  3J7A S;  1XNQ M;  4B3S M;  1Z5C A;  4LF7 M;  3GP1 A;  4JI2 M;  4G4Q A;  3J81 S;  4JI3 M;  3VK8 A;  2ZBK B;  1XMO M;  4DR3 M;  5ITX A;  3U6P A;  4NRW A;  5ITR A;  2F5P A;  3SAR A;  4DV1 M;  4YHH M;  2UUA M;  1K3W A;  4GKJ M;  1HNW M;  4PCZ A;  2EA0 A;  4B3T M;  4LF6 M;  5ITT A;  3C58 A;  3SAU A;  1XC8 A;  4PD2 A;  2VQE M;  3SAV A;  4DV7 M;  2HKJ A;  4JI7 M;  3JAM S;  1TDZ A;  4JI0 M;  4G4O A;  5BR8 M;  4B3M M;  1Z5A A;  1Q3C A;  3GQ5 A;  4ITQ A;  4X62 M;  2OPF A;  4JI1 M;  4DR1 M;  1TDH A;  3TWL A;  2XZU A;  2F5N A;  4DR6 M;  4KHP M;  1MU5 A;  1Q39 A;  4DR2 M;  1Z59 A;  3A45 A;  4PDI A;  5ITQ A;  3GPP A;  4G4N A;  3U6L A;  1EE8 A;  1Z5B A;  1L1T A;  4JI5 M;  5ITU A;  5FLX S;  1L2B A;  4OX9 M;  3A46 A;  3U6Q A;  1MX0 A;  3J80 S;  1I94 M;  2HHH M;  5LMU M;  4DV2 M;  3OTO M;  1N32 M;  1IBL M;  4JI6 M;  3T1H M;  4LF4 M;  3GPX A;  1R2Z A;  3SAW A;  2UUC M;  4JV5 M;  3U6M A;  3JR4 A;  2OQ4 A;  3U6S A;  1HNZ M;  1PJJ A;  1FJG M;  4LFB M;  4JI8 M; 
#chains in the Genus database with same CATH topology
 2Z7J A;  1PJS A;  2JA2 A;  2CHQ A;  3GRY A;  3VDP A;  3AOG A;  1HR0 M;  3B7N A;  4L78 A;  2DXI A;  1WXQ A;  3VLF B;  4LF9 M;  4L4U A;  1S3S A;  3HWS A;  3GLH A;  3D8B A;  4LFA M;  1PGY A;  3W68 A;  1NNJ A;  3SBJ A;  1OKS A;  3FTC A;  5A2Q S;  2L4F A;  4LRT A;  4QOS A;  3SHF A;  3A42 A;  4IBC A;  1KFV A;  1QAM A;  2UUB M;  1HQC A;  3SC3 A;  1SXJ D;  2DKL A;  3UGJ A;  1GJT A;  4RKU F;  4I4L A;  3TE6 A;  5F3W A;  2OO9 A;  1OFH A;  1L2C A;  4JI4 M;  4B3R M;  2OOA A;  5LMN M;  1JB0 F;  3PNV A;  3DFZ A;  1L8Q A;  2L7H A;  3GPU A;  3HU2 A;  1QAO A;  1N33 M;  1IN8 A;  3BOS A;  1XNR M;  1G59 A;  3U60 A;  3GQ4 A;  3J27 B;  4GIT A;  4Y28 F;  1NO1 A;  1R7R A;  4FCV A;  1MN3 A;  1UM8 A;  4DV6 M;  3I01 M;  1L2D A;  4II7 A;  2CUZ A;  2L4E A;  3ZH9 B;  4DV5 M;  3WHK A;  2ZM6 M;  4LJ6 A;  2CV0 A;  1QAN A;  3KVW A;  1WR1 B;  1OQY A;  2DZN B;  3FE3 A;  3MMP A;  4X66 M;  3EIH A;  4QOZ C;  4AKH A;  1VDD A;  2LHG A;  2W82 A;  4DR7 M;  2EJS A;  3T1Y M;  2Z8Y M;  3KS8 A;  1VEJ A;  1N34 M;  4TUW A;  1IXZ A;  1Y8G A;  3E4R A;  2K47 A;  2Y21 A;  2KA6 B;  4CHT B;  3CF2 A;  4GIP A;  4LF7 M;  1XNQ M;  2MR9 A;  3FUX A;  4L6V 6;  1IN7 A;  4M9X A;  4NL4 H;  2CRU A;  2R44 A;  4LJ9 A;  1QVR A;  4AG6 A;  3GLI A;  2ZBK B;  4MGH A;  3FYC A;  2D7H A;  3QAU A;  3U6P A;  1OIZ A;  1GLN A;  4KOD A;  5ITR A;  1GL7 A;  3U5Z A;  3R8F A;  2XFT A;  4KT0 F;  3LCV B;  4OVZ A;  3L27 A;  5BPV A;  7CAT A;  1OJL A;  4D80 A;  1T3T A;  2QPA A;  1MJG M;  2JWS A;  5EXT A;  3V76 A;  1N77 A;  3SAU A;  1XC8 A;  1ZMW A;  2JZ1 A;  3I51 A;  3SAV A;  3GRV A;  3T38 A;  1KSF X;  2HKJ A;  1VDL A;  2FOI C;  4W5W A;  4S12 A;  2JY6 B;  4ITQ A;  1TH4 A;  4X62 M;  3M7G A;  3KOZ E;  4MH0 E;  3B9P A;  2R46 A;  3SYK A;  3AOE C;  4IBI A;  2I7P A;  1ZMV A;  3VKH A;  5ITQ A;  5L8R F;  1HT1 E;  1IXR C;  4JI5 M;  4GH9 A;  4B7F A;  4KLN A;  5ITU A;  2A5Y B;  3ZC7 B;  1EIJ A;  2BJV A;  2RKO A;  3GLH E;  4JXJ A;  4BBA A;  4RNA A;  1D0L A;  2ZAN A;  1I94 M;  4G6Z A;  2JXN A;  4LJ4 A;  1N32 M;  1XXH E;  4LGM A;  1Z6T A;  4PT5 A;  5EXS A;  3GLF E;  2CV2 A;  1JR3 A;  5EXX A;  8CAT A;  2HAK A;  2DVW B;  3RGS A;  5FSW A;  1DO0 A;  1DGH B;  3CTW B;  4NC6 A;  3GLF A;  2UUC M;  2G8L A;  2XSZ D;  1DGF A;  3AKZ A;  4R3D A;  1LTM A;  1GJS A;  2HL7 A;  3ZQJ A;  3CF0 A;  1VEK A;  2YQZ A;  5KQD A;  3UMM A;  1C7Y A;  4JI8 M;  4FD2 A;  4NSO B;  3LVV A;  1OTR A;  3RFW A;  3QWL A;  4OW0 A;  3FTE A;  4JYA M;  3PVS A;  4G3O A;  3CF6 E;  2DWZ B;  3GLG A;  5FTM A;  3SYL A;  3RE8 A;  3TWM A;  1XXH A;  3L29 A;  2X4A A;  4P16 A;  3KFU G;  3TWK A;  4L15 A;  5DNY A;  4LF8 M;  4ANR A;  3HJS A;  4DR4 M;  3U6E A;  2KNA A;  3FRH A;  4FCT A;  4LZZ A;  2JUJ A;  5EP1 A;  3U60 B;  3FUV A;  2KW0 A;  2DHY A;  3QYE A;  3K9P A;  2CP8 A;  4CGY B;  1YE9 A;  1N78 A;  4NXM M;  3SAS A;  4P17 A;  5KPT A;  1KYI A;  2C96 A;  4YY3 M;  2UU9 M;  4RF1 A;  4PDG A;  3J7B A;  1NY6 A;  4L8R C;  3KXE C;  1XMQ M;  2F4V M;  4X64 M;  1R5L A;  3FD9 A;  3HGI A;  3L2A A;  4M0W A;  2I7N A;  1D0M A;  4B08 A;  4M9S A;  1HQY E;  2V1C A;  3SHG B;  4A3V B;  2MH8 A;  1E9S A;  1XXH B;  5EP4 A;  2UXD M;  2WSC F;  3K9O A;  3K1J A;  5EXP A;  3GLG B;  2ZTC A;  4DR5 M;  5IZ7 D;  2XZF A;  2L09 A;  1NV9 A;  2VF7 A;  2DAE A;  4F1I A;  1VEG A;  2JP7 A;  5IT9 S;  3FKE A;  1Q3B A;  4QHT A;  5EP2 A;  4FVM A;  2KZU A;  4DUZ M;  2LH0 A;  1C1K A;  1QZE A;  2L2D A;  2ZAO A;  3FUU A;  1WGL A;  2R45 A;  4EIW A;  3GP1 A;  4B3S M;  2JZ0 A;  2QP9 X;  4JI3 M;  2CV1 A;  2FE8 A;  4FWD A;  2RGO A;  4Q7J A;  3K2L A;  4DR3 M;  4CIZ A;  2F5P A;  3DZD A;  3SAR A;  3THG A;  2LVQ D;  3C9P A;  4YHH M;  3KW6 A;  1NV8 A;  4D82 A;  2EA0 A;  3DA1 A;  2HWJ A;  3KSJ A;  3HHW A;  3B74 A;  1IM2 A;  4PD2 A;  4FCW A;  3NBI A;  3AFH A;  4IJE A;  1OAI A;  1WHC A;  4JI0 M;  4ZPX A;  1PRB A;  1OFI A;  4B3M M;  1ZQ9 A;  4LCB A;  1Q3C A;  5DFL A;  1ZMU A;  1A5T A;  3I04 M;  3QYB A;  3GQ5 A;  3GLI E;  1G71 A;  3M0E A;  2R18 A;  4LY6 A;  4LGY A;  4JI1 M;  4OU7 A;  2FH0 A;  3R9X B;  1NVM A;  2XGN A;  1Q39 A;  1ZAE A;  3TL4 X;  1Z59 A;  3ZCB B;  3FTD A;  3GPP A;  3U6L A;  1L1T A;  2QQ8 A;  2CE7 A;  3HKP A;  5FLX S;  3HZJ A;  1G4A E;  5E6J A;  4IIW A;  4F2L A;  1TTE A;  1E94 E;  1OIP A;  1NHG C;  1TH3 A;  2EKF A;  4OVZ B;  5KQ8 A;  2HHH M;  2XSZ A;  3U5Z B;  1T6O A;  1IBL M;  1G3I A;  5KO3 A;  4KO8 A;  4I8O A;  4I5S A;  3RGP A;  3GPX A;  4FWH A;  4BLC A;  2LTU A;  4IBG A;  3TQS A;  3LQR A;  1VQ1 A;  3KS4 A;  3LMM A;  1CUK A;  1G8P A;  4B7G A;  2Z4R A;  3HHZ A;  3UK6 A;  2NQ8 C;  2KDL A;  2DEN A;  2Y20 A;  3M6A A;  1PJJ A;  1OAO C;  4L16 A;  2VF8 A;  3E9S A;  4NXN M;  1QUT A;  2LVN C;  3UJN A;  1Q02 A;  5FTN A;  2LBC A;  3FYD A;  4WUR A;  2BNK A;  2P5T A;  2KEB A;  4DUY M;  1T43 A;  4DV4 M;  1RU3 A;  4FW9 A;  4AG5 A;  4MGI E;  1K82 A;  5ITX E;  3FUT A;  2JY7 A;  1P3Q Q;  3GRR A;  1NHW C;  5FTL A;  2V1U A;  3BBZ A;  3DOA A;  4JN6 A;  1YLA A;  3L25 A;  3BXW A;  1BVS A;  3IG8 A;  2V6Z M;  4LJ5 A;  2QZ4 A;  1H6U A;  3SAT A;  1PM5 A;  2QHO B;  1PJI A;  1L1Z A;  1IFY A;  1V33 A;  2CHG A;  4GKK M;  2XF3 A;  2YFQ A;  3VK7 A;  4I81 A;  2DAG A;  4MGZ E;  2KNV A;  1YUB A;  4LFC M;  3IHP A;  3SFZ A;  4X65 M;  5H37 D;  2JNH A;  2MGW A;  2R62 A;  1PJT A;  1QZM A;  2DZL A;  1SXJ E;  4G4R A;  1WJ7 A;  2QEN A;  3KP0 E;  4MM3 B;  4QNR A;  2VQF M;  4AQY M;  1N36 M;  2QNJ A;  2O01 F;  2QCU A;  1QDR A;  4CIS A;  3U6D A;  1E9R A;  1IN6 A;  4NRV A;  3VKG A;  1QDT A;  3IG5 A;  2B3T A;  5FTJ A;  3FRI A;  2UXB M;  3C3D A;  4CJ6 A;  5JI2 E;  3F92 A;  3T15 A;  4R7G A;  2XLJ A;  1QQW A;  2Z3X A;  2O25 A;  3MHV C;  4LJA A;  2J7O A;  1AIP C;  1R2Y A;  1IBK M;  2R4J A;  2X8A A;  3HY5 A;  3L28 A;  5E26 A;  3GO8 A;  2EKK A;  3LVW A;  3K8Z A;  4XBO A;  1N75 A;  2DZO B;  2LVA A;  2RGH A;  4MGY E;  1W5T A;  1DV0 A;  2L7I A;  3UZU A;  1GO5 A;  1Z5C A;  1IXS B;  2LXE A;  2CWB A;  4G4Q A;  1LV7 A;  2LVP C;  4JI2 M;  3B7Q A;  3J81 S;  4WW0 A;  1NJG A;  1AUA A;  3H4J A;  1DGG A;  3FUW A;  3PFI A;  1XMO M;  2WSE F;  2K6B A;  5ITX A;  3WHL A;  5C18 A;  4DV1 M;  3A98 B;  2EUC A;  3EIE A;  4Z8X A;  1UFZ A;  3J2P B;  3VFD A;  1NNU C;  1K3W A;  4GKJ M;  4PCZ A;  3TPZ A;  2DNA A;  1VG5 A;  3C58 A;  3B7Z A;  2O5R A;  4AKG A;  4JI7 M;  4RF0 A;  3SMS A;  2DAK A;  2LHC A;  4MGK E;  5BR8 M;  2DAI A;  4B7H A;  3AOE A;  2MJ5 B;  1YSY A;  1F4I A;  2ERC A;  1SXJ B;  2BJW A;  3HU3 A;  1IY2 A;  1TDH A;  4HL4 A;  2YR0 A;  3TWL A;  2XZU A;  1J7K A;  3HHX A;  5KPR A;  2WZJ A;  4QNM A;  3VDU A;  2LVO C;  4G4N A;  3HJ8 A;  1SG9 A;  1IY0 A;  1WIV A;  1TH2 A;  3AV0 A;  2D7E A;  2MRO B;  2ZTD A;  1D0K A;  4NOO B;  5DYI A;  4GEW A;  4M0D A;  4OX9 M;  4GHA A;  3Q8X A;  5FTK A;  4DBG B;  1R4G A;  2J7N A;  3IEC A;  4GC5 A;  3J80 S;  1XB2 B;  5KPZ A;  2LNH C;  2BWE A;  3GLH B;  4IJF A;  4BB9 A;  3OTO M;  4DV2 M;  2QSF X;  1IBM M;  1NJF A;  1DO2 A;  1NSF A;  2BWB A;  2CHV A;  2K0B X;  1V92 A;  3T1H M;  2F5O A;  3W0L B;  4LF4 M;  1R2Z A;  2AHM A;  2KXE A;  3SAW A;  1QYR A;  2VDB B;  5IRE B;  4GRI A;  1IXS A;  3NWL A;  1TF0 B;  3U6S A;  3KOY E;  1DGH A;  3GLF B;  4IBJ A;  2DWM A;  3ILK A;  4LG2 A;  2WSF F;  1NY5 A;  2Y0T A;  3C3E A;  3KOW E;  3LQQ A;  5C1B A;  4REZ A;  2M60 A;  4K0K M;  1J5E M;  1FNN A;  2GNO A;  2C99 A;  3KDS E;  3GPY A;  2XFS A;  5ITY A;  2Z4S A;  4M9Z A;  1EFU B;  4WP2 A;  2FNA A;  1SXJ C;  2QBY B;  5EJC A;  2R0I A;  1TR8 A;  3HJQ A;  4LZJ A;  1I4W A;  2F5S A;  1QUS A;  4DV0 M;  2R65 A;  3GQ3 A;  1IN4 A;  1IY1 A;  3HX3 A;  2H5X A;  2VII A;  3AJI B;  2H1R A;  2DWN A;  3U6O A;  1K3X A;  1J09 A;  1XHB A;  2KZS A;  2E5L M;  1HNX M;  3FTF A;  1GAB A;  3W67 A;  1E32 A;  3NBX X;  4LRS A;  3L26 A;  1GVN A;  3W0F A;  2F5Q A;  1QAQ A;  2C9O A;  4IBD A;  5EQT A;  1X37 A;  2LWX A;  2FS1 A;  2UXC M;  2XEP A;  4QHS A;  2HCB A;  3E21 A;  4IBF A;  4IBE A;  3U6C A;  5DYG A;  2L6O A;  2Q2E B;  3Q8G A;  2RRU A;  2XH9 A;  4DV3 M;  2C5R A;  1GL6 A;  4LF5 M;  3GLI B;  4MB7 A;  5IWA M;  3AL0 C;  3JR5 A;  3U61 B;  3I4Y A;  2D7G A;  2YNM D;  3J7A S;  4XK8 F;  1D2N A;  1JR3 E;  1ORY B;  3GRU A;  3U61 A;  3VK8 A;  2KRU A;  2KRK A;  3E46 A;  2Y0Q A;  4AKI A;  2G5G X;  4HEO A;  4IBK A;  4NRW A;  2DI0 A;  3T6P A;  2X49 A;  4FWG A;  4UN2 B;  2M5Z A;  1DGB A;  1HJP A;  3LCU A;  2UUA M;  1ZV1 A;  2DHR A;  1IN5 A;  3I4V A;  3D8L A;  1HNW M;  4B3T M;  4LF6 M;  3MJ5 A;  5ITT A;  2FFJ A;  3CGW A;  4HLQ A;  2VQE M;  2C98 A;  3GLG E;  3B89 A;  2CEA A;  4DV7 M;  4IBB A;  3JAM S;  1TDZ A;  2R6F A;  3LW5 F;  4XGI A;  4AW4 A;  4G4O A;  1XWI A;  2C9C A;  3KOX E;  1HT2 E;  1Z5A A;  2JY5 A;  2N35 A;  2DWL A;  1SXJ A;  4Z6Y A;  3MK6 A;  2OPF A;  5EP3 A;  4GHL A;  4DR1 M;  3PXG A;  5JI3 E;  4DR6 M;  2F5N A;  3KP1 E;  3K92 A;  1MU5 A;  4KHP M;  2EO2 A;  4DR2 M;  3A45 A;  4PDI A;  2QBY A;  4GC9 A;  2DAM A;  1EE8 A;  1Z5B A;  3HU1 A;  4LJ7 A;  2KHH A;  4AI6 A;  1PJQ A;  2G3Q A;  1L2B A;  4AZF A;  3HHY A;  3A46 A;  1JR3 D;  4LJ8 A;  4NSR A;  3U6Q A;  1MX0 A;  1JQJ C;  2R4E A;  5LMU M;  4R71 A;  2CFO A;  5GKN A;  2APL A;  1W5S A;  3KSX A;  2J5Y A;  2K9D A;  4JI6 M;  3H4M A;  4GMQ A;  1IQP A;  1G41 A;  1TGU A;  2OOB A;  4JV5 M;  1WGN A;  3SMP A;  2JY8 A;  3JR4 A;  3U6M A;  2GQF A;  1GKI A;  2KNZ A;  2OQ4 A;  1V34 A;  1HNZ M;  1R6B X;  1FJG M;  2ZAM A;  4LFB M;  3PNY A;  4D81 A; 
#chains in the Genus database with same CATH homology
 2Z7J A;  2JA2 A;  2CHQ A;  3GRY A;  3VDP A;  3AOG A;  1HR0 M;  2DXI A;  4L78 A;  1WXQ A;  3VLF B;  4LF9 M;  4L4U A;  1S3S A;  3HWS A;  3GLH A;  3D8B A;  4LFA M;  1NNJ A;  3SBJ A;  3FTC A;  5A2Q S;  4LRT A;  4QOS A;  3SHF A;  3A42 A;  4IBC A;  1KFV A;  1QAM A;  2UUB M;  1HQC A;  3SC3 A;  1SXJ D;  3UGJ A;  4I4L A;  3TE6 A;  5F3W A;  1OFH A;  1L2C A;  4JI4 M;  4B3R M;  5LMN M;  3PNV A;  3DFZ A;  1L8Q A;  2L7H A;  3GPU A;  3HU2 A;  1QAO A;  1N33 M;  1IN8 A;  3BOS A;  1XNR M;  1G59 A;  3U60 A;  3GQ4 A;  3J27 B;  4GIT A;  1R7R A;  4FCV A;  1UM8 A;  1L2D A;  4DV6 M;  4II7 A;  2CUZ A;  3ZH9 B;  4DV5 M;  3WHK A;  2ZM6 M;  4LJ6 A;  2CV0 A;  1QAN A;  3KVW A;  4AKH A;  2DZN B;  4X66 M;  4QOZ C;  3EIH A;  1VDD A;  2W82 A;  4DR7 M;  3T1Y M;  3KS8 A;  1N34 M;  4TUW A;  1IXZ A;  3E4R A;  2K47 A;  2Y21 A;  2KA6 B;  4CHT B;  3CF2 A;  4GIP A;  4LF7 M;  1XNQ M;  3FUX A;  1IN7 A;  4M9X A;  4NL4 H;  4LJ9 A;  1QVR A;  4AG6 A;  3GLI A;  2ZBK B;  4MGH A;  3FYC A;  2D7H A;  3QAU A;  3U6P A;  4KOD A;  1GLN A;  5ITR A;  3U5Z A;  1GL7 A;  3R8F A;  2XFT A;  4OVZ A;  5BPV A;  7CAT A;  3L27 A;  1OJL A;  4D80 A;  1T3T A;  2QPA A;  5EXT A;  1N77 A;  3SAU A;  1XC8 A;  3I51 A;  3SAV A;  3GRV A;  3T38 A;  1KSF X;  2HKJ A;  2FOI C;  4W5W A;  4S12 A;  4ITQ A;  1TH4 A;  4X62 M;  3M7G A;  3KOZ E;  4MH0 E;  3B9P A;  2R46 A;  3SYK A;  3AOE C;  4IBI A;  2I7P A;  3VKH A;  5ITQ A;  1HT1 E;  1IXR C;  4JI5 M;  4GH9 A;  4B7F A;  4KLN A;  5ITU A;  2A5Y B;  3ZC7 B;  2BJV A;  2RKO A;  4BBA A;  4JXJ A;  1I94 M;  4RNA A;  2ZAN A;  4G6Z A;  4LJ4 A;  1N32 M;  4LGM A;  5EXS A;  1Z6T A;  4PT5 A;  2CV2 A;  1JR3 A;  5EXX A;  8CAT A;  2DVW B;  3RGS A;  5FSW A;  1DO0 A;  1DGH B;  3CTW B;  3GLF A;  2UUC M;  2G8L A;  2XSZ D;  1DGF A;  3AKZ A;  4R3D A;  2HL7 A;  3CF0 A;  2YQZ A;  5KQD A;  3UMM A;  4JI8 M;  4FD2 A;  4NSO B;  3LVV A;  3RFW A;  3QWL A;  4OW0 A;  3FTE A;  4JYA M;  3PVS A;  3CF6 E;  2DWZ B;  3GLG A;  5FTM A;  3SYL A;  3RE8 A;  3TWM A;  1XXH A;  3L29 A;  2X4A A;  4P16 A;  3KFU G;  3TWK A;  4L15 A;  5DNY A;  4LF8 M;  3HJS A;  4DR4 M;  3U6E A;  4FCT A;  4LZZ A;  5EP1 A;  3U60 B;  3FUV A;  2KW0 A;  4CGY B;  1YE9 A;  1N78 A;  4NXM M;  3SAS A;  4YY3 M;  5KPT A;  1KYI A;  2C96 A;  2UU9 M;  4RF1 A;  4PDG A;  3J7B A;  1NY6 A;  3KXE C;  1XMQ M;  2F4V M;  4X64 M;  3HGI A;  3FD9 A;  3L2A A;  4M0W A;  2I7N A;  4B08 A;  4M9S A;  1HQY E;  2V1C A;  3SHG B;  4A3V B;  1E9S A;  1XXH B;  5EP4 A;  2UXD M;  3K1J A;  5EXP A;  3GLG B;  4DR5 M;  5IZ7 D;  2XZF A;  2L09 A;  5IT9 S;  3FKE A;  1Q3B A;  4QHT A;  5EP2 A;  4FVM A;  2KZU A;  4DUZ M;  2LH0 A;  1C1K A;  2ZAO A;  4EIW A;  3FUU A;  4B3S M;  2R45 A;  3GP1 A;  2QP9 X;  4JI3 M;  2CV1 A;  2FE8 A;  4FWD A;  2RGO A;  3K2L A;  4DR3 M;  2F5P A;  3DZD A;  3SAR A;  3THG A;  4YHH M;  3KW6 A;  4D82 A;  2EA0 A;  3DA1 A;  3KSJ A;  3HHW A;  1IM2 A;  4PD2 A;  4FCW A;  3NBI A;  3AFH A;  4IJE A;  4JI0 M;  4ZPX A;  1OFI A;  4B3M M;  1ZQ9 A;  4LCB A;  1Q3C A;  3GQ5 A;  3M0E A;  2R18 A;  4LY6 A;  4LGY A;  4JI1 M;  4OU7 A;  3R9X B;  1NVM A;  2XGN A;  1Q39 A;  1ZAE A;  3TL4 X;  1Z59 A;  3ZCB B;  3FTD A;  3GPP A;  3U6L A;  1L1T A;  2CE7 A;  3HKP A;  5FLX S;  1G4A E;  5E6J A;  4IIW A;  1E94 E;  5KQ8 A;  1NHG C;  1TH3 A;  4OVZ B;  2HHH M;  2XSZ A;  3U5Z B;  1IBL M;  1G3I A;  5KO3 A;  4KO8 A;  4I8O A;  4I5S A;  3RGP A;  3GPX A;  4FWH A;  4BLC A;  4IBG A;  3TQS A;  3LQR A;  3LMM A;  3KS4 A;  4B7G A;  3HHZ A;  1G8P A;  2Z4R A;  1PJJ A;  3UK6 A;  2NQ8 C;  3M6A A;  2Y20 A;  4L16 A;  3E9S A;  4NXN M;  3UJN A;  5FTN A;  3FYD A;  4WUR A;  2BNK A;  2P5T A;  2KEB A;  4DUY M;  4DV4 M;  4FW9 A;  4AG5 A;  4MGI E;  1K82 A;  5ITX E;  3FUT A;  5FTL A;  3GRR A;  1NHW C;  2V1U A;  3DOA A;  4JN6 A;  3L25 A;  3IG8 A;  2V6Z M;  4LJ5 A;  2QZ4 A;  1H6U A;  3SAT A;  1PM5 A;  1PJI A;  1L1Z A;  2CHG A;  4GKK M;  2XF3 A;  2YFQ A;  3VK7 A;  4I81 A;  4MGZ E;  1YUB A;  4LFC M;  3SFZ A;  4X65 M;  5H37 D;  2R62 A;  1QZM A;  1SXJ E;  4G4R A;  1N36 M;  2QEN A;  3KP0 E;  4MM3 B;  4QNR A;  2VQF M;  4AQY M;  2QCU A;  4CIS A;  3U6D A;  1E9R A;  1IN6 A;  4NRV A;  3VKG A;  3IG5 A;  5FTJ A;  2UXB M;  5JI2 E;  3T15 A;  4R7G A;  2XLJ A;  1QQW A;  2Z3X A;  3MHV C;  4LJA A;  1IBK M;  2J7O A;  1R2Y A;  1IBM M;  4L8R C;  2R4J A;  2X8A A;  3GO8 A;  3L28 A;  5E26 A;  2F5O A;  3LVW A;  3K8Z A;  4XBO A;  1N75 A;  2DZO B;  2RGH A;  4MGY E;  1W5T A;  2L7I A;  3UZU A;  1Z5C A;  1IXS B;  2LXE A;  4JI2 M;  4G4Q A;  1LV7 A;  3J81 S;  4WW0 A;  1NJG A;  1DGG A;  3FUW A;  3PFI A;  1XMO M;  5ITX A;  3WHL A;  5C18 A;  4DV1 M;  3A98 B;  2EUC A;  3EIE A;  4Z8X A;  3J2P B;  3VFD A;  1NNU C;  1K3W A;  4GKJ M;  4PCZ A;  3TPZ A;  3C58 A;  2O5R A;  4AKG A;  4JI7 M;  4RF0 A;  3SMS A;  4MGK E;  5BR8 M;  4B7H A;  3AOE A;  1YSY A;  2ERC A;  1SXJ B;  2BJW A;  3HU3 A;  1IY2 A;  1TDH A;  4HL4 A;  2YR0 A;  3TWL A;  2XZU A;  1J7K A;  3HHX A;  5KPR A;  4QNM A;  3VDU A;  4G4N A;  3HJ8 A;  1IY0 A;  1TH2 A;  3AV0 A;  2D7E A;  4NOO B;  5DYI A;  4M0D A;  4OX9 M;  4GHA A;  3Q8X A;  5FTK A;  2J7N A;  4GC5 A;  3J80 S;  5KPZ A;  2LNH C;  3GLH B;  4IJF A;  4BB9 A;  3OTO M;  4DV2 M;  1NJF A;  1DO2 A;  1NSF A;  2CHV A;  3T1H M;  3W0L B;  4LF4 M;  1R2Z A;  2AHM A;  2KXE A;  3SAW A;  1QYR A;  5IRE B;  4GRI A;  3NWL A;  3U6S A;  3KOY E;  1DGH A;  3GLF B;  4IBJ A;  2DWM A;  3ILK A;  4LG2 A;  5C1B A;  1NY5 A;  2Y0T A;  3KOW E;  3LQQ A;  4REZ A;  2M60 A;  4K0K M;  1J5E M;  1FNN A;  2C99 A;  3KDS E;  3GPY A;  2XFS A;  5ITY A;  2Z4S A;  4M9Z A;  2FNA A;  1SXJ C;  2QBY B;  5EJC A;  3HJQ A;  4LZJ A;  1I4W A;  2F5S A;  4DV0 M;  2R65 A;  3GQ3 A;  1IN4 A;  1IY1 A;  2VII A;  3AJI B;  2H1R A;  2DWN A;  3U6O A;  1K3X A;  1J09 A;  1XHB A;  2KZS A;  2E5L M;  1HNX M;  3FTF A;  1E32 A;  4LRS A;  3L26 A;  1GVN A;  3W0F A;  2F5Q A;  1QAQ A;  2C9O A;  4IBD A;  5EQT A;  1X37 A;  2LWX A;  2UXC M;  2XEP A;  4QHS A;  2HCB A;  4IBF A;  4IBE A;  3U6C A;  5DYG A;  2L6O A;  2Q2E B;  4DV3 M;  2XH9 A;  2C5R A;  1GL6 A;  4LF5 M;  3GLI B;  4MB7 A;  5IWA M;  3AL0 C;  3JR5 A;  3U61 B;  3I4Y A;  2D7G A;  2YNM D;  3J7A S;  1D2N A;  1ORY B;  3GRU A;  3U61 A;  3VK8 A;  2KRU A;  2KRK A;  2Y0Q A;  4AKI A;  2G5G X;  4IBK A;  4NRW A;  2X49 A;  4FWG A;  2M5Z A;  1DGB A;  2UUA M;  2DHR A;  1IN5 A;  3I4V A;  3D8L A;  1HNW M;  4B3T M;  4LF6 M;  3MJ5 A;  5ITT A;  2FFJ A;  4HLQ A;  2VQE M;  2C98 A;  2CEA A;  4DV7 M;  4IBB A;  3JAM S;  1TDZ A;  4XGI A;  4AW4 A;  4G4O A;  1XWI A;  2C9C A;  3KOX E;  1HT2 E;  1Z5A A;  2DWL A;  1SXJ A;  4Z6Y A;  3MK6 A;  2OPF A;  5EP3 A;  4GHL A;  4DR1 M;  3PXG A;  5JI3 E;  4DR6 M;  2F5N A;  3KP1 E;  3K92 A;  1MU5 A;  4KHP M;  2EO2 A;  4DR2 M;  3A45 A;  4PDI A;  2QBY A;  4GC9 A;  1EE8 A;  1Z5B A;  3HU1 A;  4LJ7 A;  4AI6 A;  1L2B A;  4AZF A;  3HHY A;  3A46 A;  1JR3 D;  4LJ8 A;  4NSR A;  3U6Q A;  1MX0 A;  1JQJ C;  2R4E A;  5LMU M;  2CFO A;  5GKN A;  1W5S A;  3KSX A;  4JI6 M;  3H4M A;  4GMQ A;  1IQP A;  1G41 A;  1TGU A;  4JV5 M;  3SMP A;  3U6M A;  3JR4 A;  1GKI A;  2OQ4 A;  1HNZ M;  1R6B X;  1FJG M;  2ZAM A;  4LFB M;  3PNY A;  4D81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...