4DR2M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr2M02
1XC8A 2UU9M 3J80S 4LF7M 4YHHM 1Q3BA 5ITQA 1Z5BA 4DV5M 3SBJA 1L1ZA 5A2QS 4PCZA 3U6CA 4NRVA 3GO8A 4ITQA 5LMUM 3A46A 1I94M 3VK8A 1HR0M 5IT9S 3GPYA 1L2DA 1R2ZA 4B3SM 3A45A 4G4OA 2OQ4A 3JR4A 2XZFA 3DOAA 3GQ3A 1L1TA 3U6OA 2Q2EB 2F5QA 1Q3CA 1Z5CA 4DUYM 4G4NA 3TWLA 1IBMM 1N36M 1XMOM 3TWKA 4JI6M 4LF9M 1N33M 4KHPM 2E5LM 4LF5M 4LFCM 4GKJM 5FLXS 4JI5M 1MX0A 4B3MM 3OTOM 4LF6M 1FJGM 4CISA 4DV1M 4X64M 4JI8M 4JI3M 4NXMM 3U6LA 2EA0A 3JR5A 4DR7M 4DR3M 1N34M 4MB7A 4DV0M 2UUAM 5LMNM 1HNXM 4G4RA 4JI1M 5ITXA 4K0KM 1EE8A 1R2YA 2F5OA 2UXBM 1L2BA 2HHHM 4LFBM 1TDHA 4DV2M 1Q39A 3SARA 2VQEM 2ZBKB 1J5EM 1XNRM 3GPXA 3U6QA 4JV5M 1Z5AA 4B3TM 1K3WA 2F5PA 1KFVA 4DUZM 5ITTA 2OPFA 1NNJA 4LF4M 3SAVA 2ZM6M 1IBKM 3J7AS 5ITYA 3SATA 1K3XA 4JYAM 1TDZA 3T1HM 1HNWM 3TWMA 1Z59A 4NRWA 4DR6M 3GPPA 4DV7M 2F5SA 2UUBM 4X66M 4PDGA 1XMQM 2UXCM 5ITRA 4JI7M 4YY3M 5IWAM 4PD2A 1N32M 4G4QA 4DV6M 4OX9M 4DR5M 4DR2M 4PDIA 3C58A 3GPUA 4DV4M 3J81S 3GQ5A 1K82A 1PJJA 2HKJA 4X62M 3SAUA 3SASA 3VK7A 2XZUA 5ITUA 1XNQM 3GP1A 4JI4M 4AQYM 4LF8M 3U6EA 1PJIA 5BR8M 4JI2M 2VQFM 1L2CA 4NXNM 3U6MA 3A42A 3JAMS 4DR1M 3U6DA 2F5NA 3GQ4A 4LFAM 2UUCM 4DR4M 1PM5A 3W0FA 4DV3M 3T1YM 4X65M 1MU5A 4GKKM 2F4VM 3U6PA 3U6SA 4JI0M 3SAWA 1HNZM 1IBLM 4B3RM 5ITXE 2UXDM
chains in the Genus database with same CATH superfamily
4IBDA 1PJTA 4YHHM 4LJ8A 2XLJA 2K6BA 3B7QA 1Z5BA 4NC6A 2WZJA 1JR3D 1YUBA 2QQ8A 4NSRA 4RKUF 3TQSA 3V76A 3WHKA 4AG5A 4PCZA 3MK6A 4NRVA 2KA6B 1VG5A 3GO8A 3UZUA 4ITQA 1SXJA 4LJ7A 3I4VA 3VK8A 2BJVA 5IT9S 1L2DA 1R2ZA 2FFJA 3HU2A 3HY5A 1I4WA 2WSFF 1MN3A 2LVQD 3FE3A 4XBOA 3SHFA 1EIJA 4QNMA 4L16A 1IQPA 3AJIB 3CTWB 3FYCA 4QHTA 1QZEA 2VIIA 4JN6A 3TWKA 4GC5A 4B7FA 5C18A 2I7PA 4NOOB 3RGSA 4D80A 2R6FA 3LVWA 5FTMA 2ZAMA 5KO3A 4REZA 4B08A 3VLFB 1G3IA 1MJGM 1C7YA 1PRBA 3PNVA 1CUKA 1EFUB 4JI3M 5H37D 2Y0QA 2CV1A 3U6LA 4JI8M 4GHAA 1R6BX 3JR5A 2DWNA 1N34M 4LCBA 1DGHA 5E6JA 3L26A 4KT0F 4OVZB 2UUAM 2DAMA 2QPAA 4L6V6 3KW6A 2X49A 3K1JA 2JNHA 2C5RA 1IN7A 1XXHA 2BWBA 2HHHM 3T6PA 4MGZE 1QAMA 1YE9A 2FNAA 4KO8A 2YQZA 2R4EA 4PT5A 4WURA 4DV2M 3KDSE 3DA1A 2ZTCA 3E21A 5KPTA 1SXJC 1XXHE 2C96A 2KNAA 4IJEA 2QSFX 4GC9A 3LCVB 2CV2A 3GLIE 1DGGA 4R7GA 1IY2A 1QAQA 3FTFA 3KOWE 2JA2A 5EP2A 3J7AS 3B7NA 3HJSA 3E9SA 4WP2A 4LRSA 3T1HM 1HNWM 5EXSA 4NRWA 2MROB 3GPPA 2UUBM 2F5SA 2ZTDA 1GO5A 1T3TA 3AKZA 5ITRA 1WJ7A 4L4UA 2M5ZA 3FKEA 4OX9M 5EXXA 4AKIA 4QOSA 4PDIA 3C58A 2XF3A 3B7ZA 3HHYA 1L8QA 7CATA 2Y21A 3FTCA 3VK7A 2N35A 1LV7A 3BBZA 3IHPA 3B89A 3U61B 1PGYA 3U5ZA 2R46A 2EKFA 1N77A 4QOZC 1TH4A 1TR8A 2XH9A 1IY1A 5EQTA 2JUJA 1KYIA 3Q8GA 4HLQA 4XK8F 4IJFA 1IN6A 3U6MA 1JR3E 2HWJA 2C98A 5KPZA 2LHCA 1N78A 2O5RA 4DR1M 4CHTB 2P5TA 2W82A 8CATA 1IXSB 2AHMA 1D2NA 3W0FA 5FTJA 2V1UA 2RGHA 2V6ZM 1ZV1A 2KNZA 1VEJA 4GKKM 3F92A 5EJCA 1Q02A 3MMPA 3GLHE 1HT1E 1XHBA 1R7RA 2VDBB 4FWDA 1HNZM 4JXJA 1QDTA 4A3VB 3ILKA 2UXDM 2UU9M 5EXTA 1PJQA 2CFOA 3GLHA 3R8FA 1J7KA 1NY5A 1P3QQ 4LGYA 1TH2A 3QYBA 4FCTA 3HKPA 4LJ9A 4DV5M 2ERCA 2Y0TA 3FRIA 2R45A 3SFZA 3I4YA 3L28A 1HR0M 2XFSA 3AFHA 3HGIA 2QNJA 2DZLA 3PXGA 4MGYE 3T38A 4B3SM 3A45A 3KXEC 4GITA 3GRRA 3HHZA 3L27A 1KSFX 3B74A 4FWGA 3KOZE 3JR4A 4OVZA 3GQ3A 2G8LA 2LBCA 4BB9A 1Q3CA 2L2DA 3GRUA 2R4JA 4G4NA 1IBMM 3KS8A 1IN8A 2G3QA 3E46A 1XMOM 1IXRC 2CWBA 2H5XA 1N36M 2EO2A 3C9PA 2KZUA 2E5LM 4LF5M 4GKJM 3FYDA 3QWLA 4JI5M 1AUAA 4LG2A 5IZ7D 2FE8A 2EJSA 2DAKA 2KNVA 3WHLA 2DAEA 4LRTA 4M0WA 4X64M 4CISA 1D0KA 2EA0A 2DWLA 1NHWC 2JY6B 5JI3E 4DR3M 1DGFA 4MB7A 2I7NA 4DV0M 1FNNA 2K9DA 4JI1M 2A5YB 1DO2A 5ITXA 1EE8A 4K0KM 4W5WA 2GNOA 1WHCA 1QYRA 5FTKA 2NQ8C 3KP0E 1TDHA 1S3SA 3IG8A 2MR9A 4MGHA 2CP8A 3FUVA 1XNRM 2R62A 3K8ZA 2R65A 2H1RA 4LZZA 3FD9A 3U6QA 4JV5M 1Z5AA 1TH3A 1K3WA 1E9RA 3U61A 2D7HA 1KFVA 2XSZD 1VDDA 2OPFA 3TL4X 1ZMWA 3HWSA 4P16A 3LQQA 2ZM6M 1IBKM 2DWZB 1OFIA 3GLIA 1R4GA 2CV0A 3K9PA 1Y8GA 1XWIA 2R44A 3GLIB 4MH0E 3KFUG 4JYAM 3PFIA 2QZ4A 3AL0C 1G71A 2L7HA 5EXPA 1PJSA 3SC3A 4JI7M 2LVOC 5EP1A 3SYLA 2QBYA 3FRHA 4R3DA 2DNAA 2DAGA 3AOEC 4PD2A 4G6ZA 2RKOA 3KVWA 2KXEA 1OAIA 3BXWA 4DR5M 4FCWA 5F3WA 1WGLA 2EKKA 4AKGA 4P17A 3H4JA 3J81S 1YSYA 1PJJA 1GL7A 2HKJA 5C1BA 3IG5A 1G59A 4TUWA 2FS1A 2XZUA 3DFZA 4IBBA 1GABA 3D8LA 3GP1A 3QAUA 4QHSA 1PJIA 2Z4SA 3IECA 5JI2E 4Y28F 5BR8M 1AIPC 4JI2M 1ZAEA 3J27B 2LNHC 4CIZA 1V34A 4NXNM 2JZ1A 4M9XA 5DYGA 1OQYA 2KRUA 3FUWA 4AW4A 2C99A 3HHXA 4I4LA 4FCVA 1OIZA 1IN4A 1OAOC 2KW0A 3GQ4A 1T43A 4IBIA 1QUSA 1QUTA 1QZMA 4Z8XA 3RE8A 2JZ0A 1MU5A 1SXJD 2F4VM 2JY7A 3T15A 5FSWA 3J2PB 5E26A 1WXQA 3FUXA 3NBIA 3U6SA 2CRUA 3FTDA 4L15A 2LH0A 2OOBA 3HX3A 3J80S 3SHGB 4I5SA 4KODA 1JR3A 3GLHB 4CGYB 3CGWA 5ITQA 2K0BX 3LVVA 3VDUA 2BNKA 3SBJA 4M9ZA 5A2QS 2HL7A 2HAKA 1A5TA 1W5TA 3U6CA 3PNYA 4KLNA 2L6OA 2FOIC 1Z6TA 2DZOB 4HEOA 4IIWA 3W67A 2Y20A 4CJ6A 1R5LA 2OQ4A 2HCBA 2YFQA 2RGOA 3DOAA 1NO1A 3FUTA 3LCUA 2KZSA 4I8OA 2F5QA 1Z5CA 4DUYM 1JB0F 3EIEA 2D7GA 2R0IA 3UGJA 2KEBA 4JI6M 4NL4H 4LF9M 1GL6A 4KHPM 2M60A 1GVNA 3CF6E 4LFCM 2DI0A 1MX0A 3GLFB 1OIPA 4GHLA 4FVMA 4B3MM 2VF8A 1SXJE 3OTOM 2Z3XA 2DWMA 4D81A 4LF6M 4AKHA 3KSXA 1FJGM 4DV1M 4GEWA 1OJLA 5EP4A 1ZMUA 4AZFA 1VEGA 3D8BA 4AI6A 3U60B 1DO0A 2CEAA 2X8AA 3M6AA 5LMNM 4G4RA 2KRKA 1ORYB 3LMMA 1HNXM 3BOSA 1R2YA 2LVPC 3Q8XA 3UK6A 2F5OA 2LVNC 1L2BA 4LFBM 2CHQA 2L4EA 4MGIE 2OO9A 3SARA 2GQFA 2L4FA 1SXJB 2LTUA 1BVSA 1NY6A 2QP9X 2V1CA 3C3DA 5DYIA 1IN5A 3U60A 1GJSA 4ANRA 2YR0A 2YNMD 2LVAA 3LW5F 4DUZM 2G5GX 1VQ1A 5ITTA 1NNJA 1IFYA 2L09A 1ZMVA 4L78A 2DENA 3SAVA 4G3OA 3SATA 1QQWA 1K3XA 3KOYE 1TDZA 2EUCA 3UMMA 1Z59A 1E94E 2Z7JA 4DV7M 4PDGA 1XMQM 1QANA 2UXCM 3VFDA 4GH9A 4YY3M 5IWAM 2ZANA 3GRVA 2QBYB 2J5YA 4DV6M 1GLNA 1OKSA 1HQYE 1N75A 3M0EA 1NJFA 3RGPA 3GPUA 1NV9A 3NWLA 2L7IA 3K9OA 2C9OA 4LZJA 4X62M 3SAUA 1E9SA 2BJWA 5GKNA 2Z8YM 3VDPA 3DZDA 1HT2E 2X4AA 2B3TA 3KSJA 4AQYM 1TTEA 3J7BA 4FWHA 2DHYA 4LF8M 1DGHB 5DNYA 4LJAA 3VKGA 1JQJC 1L2CA 3K2LA 2DVWB 3HU3A 2CHVA 1DV0A 2JXNA 1G4AE 2UUCM 2LHGA 3C3EA 1PM5A 4GIPA 4IBEA 4DV3M 3GRYA 3T1YM 1GJTA 1UM8A 3SYKA 4X65M 4LY6A 3U6PA 5FTLA 1OFHA 2O01F 3HHWA 4LJ6A 4I81A 4JI0M 4IBJA 2RRUA 2DXIA 2D7EA 3KOXE 2JY8A 4BBAA 1XC8A 3HJQA 3HZJA 1ZQ9A 2DZNB 4LF7M 4LGMA 1Q3BA 1G8PA 4M0DA 1L1ZA 3ZH9B 1H6UA 3NBXX 3A98B 2MGWA 3AOEA 3TE6A 5KPRA 5LMUM 3A46A 5KQ8A 1I94M 2OOAA 2MH8A 2KHHA 4AG6A 3GPYA 3L2AA 4IBGA 4II7A 1C1KA 2DKLA 3HJ8A 5KQDA 2J7NA 4G4OA 2XZFA 3M7GA 1L1TA 3U6OA 2Q2EB 3W68A 3ZC7B 3MJ5A 1RU3A 3I01M 4F2LA 3TWLA 2QCUA 4B7HA 1E32A 1N33M 1LTMA 3U5ZB 3CF0A 4L8RC 3W0LB 3ZCBB 5FLXS 2WSEF 4MM3B 4F1IA 1XB2B 1SG9A 1WGNA 2QENA 1HJPA 4NXMM 5IREB 3B9PA 3I04M 4IBFA 3GLFE 4DR7M 1OTRA 4Z6YA 1NSFA 2ZAOA 4GRIA 2Z4RA 4RF1A 4UN2B 4WW0A 1IM2A 3SMPA 3AV0A 1F4IA 4LJ4A 2JWSA 1D0MA 5BPVA 4D82A 4EIWA 2UXBM 1XXHB 4MGKE 2XEPA 3R9XB 3QYEA 1NV8A 4Q7JA 3KS4A 5EP3A 4GMQA 1Q39A 2VQEM 1X37A 2ZBKB 3E4RA 1NHGC 3I51A 3MHVC 3ZQJA 3CF2A 1J5EM 3PVSA 2O25A 1UFZA 3GPXA 1IY0A 1NNUC 2KDLA 4B3TM 2F5PA 2BWEA 2MJ5B 3K92A 4LF4M 4RNAA 3H4MA 4OU7A 4LJ5A 4IBKA 2K47A 2LXEA 3KP1E 5ITYA 4BLCA 1TF0B 1VEKA 4S12A 3FUUA 1V92A 3TWMA 2CUZA 4DR6M 4IBCA 1D0LA 4X66M 1J09A 4B7GA 2CHGA 5FTNA 1YLAA 4RF0A 1NJGA 4HL4A 1VDLA 2XGNA 1QVRA 1W5SA 1N32M 3UJNA 4G4QA 2QHOB 4OW0A 2JY5A 2XSZA 4DR2M 2FH0A 3GQ5A 4DV4M 1K82A 3GLGE 3FTEA 2JP7A 4QNRA 1WIVA 4DBGB 1NVMA 1G41A 3HU1A 3SASA 5ITUA 2WSCF 1XNQM 3L25A 2DAIA 3AOGA 4JI4M 2DHRA 4M9SA 1HQCA 3GLGA 5L8RF 3U6EA 2VF7A 1IXZA 2LWXA 4R71A 4FD2A 1QDRA 4FW9A 2XFTA 3SMSA 4ZPXA 2VQFM 2C9CA 1T6OA 5DFLA 3A42A 3RFWA 3JAMS 3GLGB 3TPZA 2APLA 2J7OA 3THGA 1DGBA 3U6DA 1IXSA 4LFAM 2F5NA 1GKIA 4DR4M 3EIHA 3VKHA 3L29A 4NSOB 2CE7A 3GLFA 3LQRA 4XGIA 1WR1B 3SAWA 1QAOA 1IBLM 4B3RM 1V33A 5ITXE 1TGUA 2R18A
chains in the Genus database with same CATH topology
4IBDA 4YHHM 4LJ8A 2XLJA 1Z5BA 3WHKA 1JR3D 1YUBA 4NSRA 3TQSA 4AG5A 4PCZA 3MK6A 4NRVA 2KA6B 3GO8A 3UZUA 4ITQA 1SXJA 4LJ7A 3I4VA 3VK8A 2BJVA 5IT9S 1L2DA 1R2ZA 2FFJA 3HU2A 1I4WA 4XBOA 3SHFA 4QNMA 4L16A 1IQPA 3AJIB 3CTWB 3FYCA 4QHTA 2VIIA 4JN6A 3TWKA 4GC5A 4B7FA 5C18A 2I7PA 4NOOB 3RGSA 4D80A 3LVWA 5FTMA 2ZAMA 5KO3A 4REZA 4B08A 3VLFB 1G3IA 3PNVA 4JI8M 4JI3M 5H37D 2Y0QA 4GHAA 3U6LA 1R6BX 3JR5A 2DWNA 1N34M 4LCBA 1DGHA 5E6JA 3L26A 4OVZB 2UUAM 2QPAA 3KW6A 2X49A 3K1JA 2C5RA 1IN7A 1XXHA 2HHHM 4MGZE 1QAMA 1YE9A 2FNAA 4KO8A 2YQZA 2R4EA 4PT5A 4WURA 4DV2M 3KDSE 3DA1A 5KPTA 1SXJC 2C96A 4IJEA 4GC9A 2CV2A 1DGGA 4R7GA 1IY2A 1QAQA 3FTFA 3KOWE 2JA2A 5EP2A 3J7AS 3HJSA 3E9SA 4LRSA 3T1HM 1HNWM 5EXSA 4NRWA 3GPPA 2UUBM 2F5SA 1T3TA 3AKZA 5ITRA 4L4UA 2M5ZA 3FKEA 4OX9M 5EXXA 4AKIA 4QOSA 4PDIA 3C58A 2XF3A 3HHYA 1L8QA 7CATA 2Y21A 3FTCA 3VK7A 1LV7A 3U61B 1N77A 3U5ZA 2R46A 4QOZC 1TH4A 2XH9A 1IY1A 5EQTA 1KYIA 4HLQA 4IJFA 1IN6A 3U6MA 2C98A 5KPZA 1N78A 2O5RA 4DR1M 4CHTB 2P5TA 2W82A 8CATA 1IXSB 2AHMA 1D2NA 3W0FA 5FTJA 2V1UA 2RGHA 2V6ZM 4GKKM 5EJCA 1HT1E 1XHBA 1R7RA 4FWDA 1HNZM 4JXJA 4A3VB 3ILKA 2UXDM 2UU9M 5EXTA 2CFOA 3GLHA 3R8FA 1J7KA 1NY5A 4LGYA 1TH2A 4FCTA 3HKPA 4LJ9A 4DV5M 2ERCA 2Y0TA 2R45A 3SFZA 3I4YA 3L28A 1HR0M 2XFSA 3AFHA 3HGIA 3PXGA 4MGYE 3T38A 4B3SM 3A45A 3KXEC 4GITA 3GRRA 3HHZA 3L27A 1KSFX 4FWGA 3KOZE 3JR4A 4OVZA 3GQ3A 2G8LA 4BB9A 1Q3CA 3GRUA 2R4JA 4G4NA 1IBMM 3KS8A 1IN8A 1N36M 1XMOM 1IXRC 2EO2A 2KZUA 2E5LM 4LF5M 4GKJM 3FYDA 3QWLA 4JI5M 4LG2A 5IZ7D 2FE8A 3WHLA 4LRTA 4M0WA 4X64M 4CISA 2EA0A 2DWLA 1NHWC 5JI3E 4DR3M 1DGFA 4MB7A 2I7NA 4DV0M 1FNNA 4JI1M 2A5YB 1DO2A 5ITXA 1EE8A 4K0KM 4W5WA 1QYRA 5FTKA 2NQ8C 3KP0E 1TDHA 1S3SA 3IG8A 4MGHA 3FUVA 1XNRM 2R62A 3K8ZA 2R65A 2H1RA 4LZZA 3FD9A 3U6QA 4JV5M 1Z5AA 1TH3A 1K3WA 1E9RA 3U61A 2D7HA 1KFVA 2XSZD 1VDDA 2OPFA 3TL4X 4P16A 3HWSA 2ZM6M 3LQQA 1IBKM 2CV0A 2DWZB 1OFIA 3GLIA 3GLIB 1XWIA 3KFUG 4MH0E 4JYAM 3PFIA 2QZ4A 3AL0C 2L7HA 5EXPA 3SC3A 4JI7M 5EP1A 3SYLA 2QBYA 4R3DA 4PD2A 3AOEC 4G6ZA 2RKOA 3KVWA 2KXEA 4DR5M 5F3WA 4FCWA 4AKGA 3J81S 1YSYA 1PJJA 1GL7A 2HKJA 5C1BA 3IG5A 1G59A 4TUWA 2XZUA 3DFZA 4IBBA 3D8LA 3GP1A 3QAUA 4QHSA 1PJIA 2Z4SA 5JI2E 5BR8M 4JI2M 1ZAEA 3J27B 2LNHC 4NXNM 5DYGA 4M9XA 4AW4A 2KRUA 3FUWA 2C99A 3HHXA 4I4LA 4FCVA 1IN4A 2KW0A 3GQ4A 4IBIA 1QZMA 4Z8XA 3RE8A 1MU5A 1SXJD 2F4VM 5FSWA 3T15A 3J2PB 5E26A 1WXQA 3FUXA 3NBIA 3U6SA 3FTDA 4L15A 2LH0A 3J80S 3SHGB 4I5SA 4KODA 1JR3A 3GLHB 4CGYB 5ITQA 3VDUA 3LVVA 2BNKA 3SBJA 4M9ZA 5A2QS 2HL7A 3U6CA 1W5TA 3PNYA 4KLNA 2L6OA 2FOIC 1Z6TA 2DZOB 4IIWA 2Y20A 2OQ4A 2HCBA 2YFQA 2RGOA 3DOAA 3FUTA 2KZSA 4I8OA 2F5QA 1Z5CA 4DUYM 3EIEA 2D7GA 3UGJA 2KEBA 4JI6M 4NL4H 4LF9M 1GL6A 4KHPM 2M60A 1GVNA 3CF6E 4LFCM 1MX0A 3GLFB 4GHLA 4FVMA 4B3MM 3OTOM 1SXJE 2Z3XA 2DWMA 4D81A 4LF6M 4AKHA 3KSXA 1FJGM 4DV1M 1OJLA 5EP4A 4AZFA 3D8BA 4AI6A 3U60B 1DO0A 2CEAA 2X8AA 3M6AA 5LMNM 4G4RA 2KRKA 1ORYB 3LMMA 1HNXM 3BOSA 1R2YA 3Q8XA 2F5OA 3UK6A 1L2BA 4LFBM 2CHQA 4MGIE 3SARA 1SXJB 2QP9X 2V1CA 1NY6A 3U60A 2CV1A 5DYIA 1IN5A 2YR0A 2YNMD 4DUZM 2G5GX 5ITTA 1NNJA 2L09A 4L78A 3SAVA 3SATA 1QQWA 1K3XA 3KOYE 1TDZA 2EUCA 3UMMA 1Z59A 1E94E 2Z7JA 4DV7M 4PDGA 1XMQM 1QANA 2UXCM 3VFDA 4GH9A 4YY3M 5IWAM 2ZANA 3GRVA 2QBYB 4DV6M 1GLNA 1HQYE 1N75A 3M0EA 1NJFA 3RGPA 3GPUA 3NWLA 2L7IA 2C9OA 4LZJA 4X62M 3SAUA 1E9SA 2BJWA 5GKNA 3VDPA 3DZDA 1HT2E 2X4AA 3KSJA 4AQYM 4LF8M 3J7BA 4FWHA 1DGHB 5DNYA 4LJAA 3VKGA 1JQJC 1L2CA 3K2LA 2DVWB 3HU3A 2CHVA 1G4AE 2UUCM 1PM5A 4GIPA 4IBEA 4DV3M 3GRYA 3T1YM 1UM8A 4X65M 3SYKA 4LY6A 3U6PA 5FTLA 1OFHA 3HHWA 4LJ6A 4I81A 4JI0M 4IBJA 2DXIA 2D7EA 3KOXE 4BBAA 1XC8A 3HJQA 1ZQ9A 2DZNB 4LF7M 4LGMA 1Q3BA 1G8PA 4M0DA 1L1ZA 3ZH9B 1H6UA 3A98B 3AOEA 3TE6A 5KPRA 5LMUM 3A46A 5KQ8A 1I94M 3GPYA 4AG6A 3L2AA 4IBGA 4II7A 1C1KA 3HJ8A 5KQDA 2J7NA 4G4OA 2XZFA 3M7GA 1L1TA 3U6OA 2Q2EB 3ZC7B 3MJ5A 3TWLA 2QCUA 4B7HA 1E32A 1N33M 3U5ZB 3CF0A 4L8RC 3W0LB 3ZCBB 5FLXS 4MM3B 2QENA 4NXMM 5IREB 3B9PA 4IBFA 4DR7M 4Z6YA 1NSFA 2ZAOA 4GRIA 2Z4RA 4RF1A 4WW0A 1IM2A 3SMPA 3AV0A 4LJ4A 5BPVA 4D82A 4EIWA 2UXBM 1XXHB 4MGKE 2XEPA 3R9XB 3KS4A 5EP3A 4GMQA 1Q39A 2VQEM 1X37A 2ZBKB 3E4RA 1NHGC 3I51A 3MHVC 1J5EM 3CF2A 3PVSA 3GPXA 1IY0A 1NNUC 4B3TM 2F5PA 3K92A 4LF4M 4RNAA 3H4MA 4OU7A 4LJ5A 4IBKA 2K47A 2LXEA 3KP1E 5ITYA 4BLCA 4S12A 3FUUA 3TWMA 2CUZA 4DR6M 4IBCA 4X66M 1J09A 4B7GA 2CHGA 5FTNA 4RF0A 1NJGA 4HL4A 2XGNA 1QVRA 1W5SA 1N32M 3UJNA 4G4QA 4OW0A 2XSZA 4DR2M 4DV4M 3GQ5A 1K82A 3FTEA 3SASA 4QNRA 1NVMA 1G41A 3HU1A 5ITUA 1XNQM 3L25A 3AOGA 4JI4M 2DHRA 4M9SA 1HQCA 3GLGA 3U6EA 1IXZA 2LWXA 4FD2A 4FW9A 2XFTA 3SMSA 4ZPXA 2VQFM 2C9CA 3A42A 3RFWA 3JAMS 3GLGB 3TPZA 2J7OA 3THGA 1DGBA 3U6DA 2F5NA 4LFAM 4DR4M 1GKIA 3VKHA 3EIHA 3L29A 4NSOB 2CE7A 3GLFA 3LQRA 4XGIA 3SAWA 1QAOA 1IBLM 4B3RM 5ITXE 1TGUA 2R18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC8 A;  2UU9 M;  3J80 S;  4LF7 M;  4YHH M;  1Q3B A;  5ITQ A;  1Z5B A;  4DV5 M;  3SBJ A;  1L1Z A;  5A2Q S;  4PCZ A;  3U6C A;  4NRV A;  3GO8 A;  4ITQ A;  5LMU M;  3A46 A;  1I94 M;  3VK8 A;  1HR0 M;  5IT9 S;  3GPY A;  1L2D A;  1R2Z A;  4B3S M;  3A45 A;  4G4O A;  2OQ4 A;  3JR4 A;  2XZF A;  3DOA A;  3GQ3 A;  1L1T A;  3U6O A;  2Q2E B;  2F5Q A;  1Q3C A;  1Z5C A;  4DUY M;  4G4N A;  3TWL A;  1IBM M;  1N36 M;  1XMO M;  3TWK A;  4JI6 M;  4LF9 M;  1N33 M;  4KHP M;  2E5L M;  4LF5 M;  4LFC M;  4GKJ M;  5FLX S;  4JI5 M;  1MX0 A;  4B3M M;  3OTO M;  4LF6 M;  1FJG M;  4CIS A;  4DV1 M;  4X64 M;  4JI8 M;  4JI3 M;  4NXM M;  3U6L A;  2EA0 A;  3JR5 A;  4DR7 M;  4DR3 M;  1N34 M;  4MB7 A;  4DV0 M;  2UUA M;  5LMN M;  1HNX M;  4G4R A;  4JI1 M;  5ITX A;  4K0K M;  1EE8 A;  1R2Y A;  2F5O A;  2UXB M;  1L2B A;  2HHH M;  4LFB M;  1TDH A;  4DV2 M;  1Q39 A;  3SAR A;  2VQE M;  2ZBK B;  1J5E M;  1XNR M;  3GPX A;  3U6Q A;  4JV5 M;  1Z5A A;  4B3T M;  1K3W A;  2F5P A;  1KFV A;  4DUZ M;  5ITT A;  2OPF A;  1NNJ A;  4LF4 M;  3SAV A;  2ZM6 M;  1IBK M;  3J7A S;  5ITY A;  3SAT A;  1K3X A;  4JYA M;  1TDZ A;  3T1H M;  1HNW M;  3TWM A;  1Z59 A;  4NRW A;  4DR6 M;  3GPP A;  4DV7 M;  2F5S A;  2UUB M;  4X66 M;  4PDG A;  1XMQ M;  2UXC M;  5ITR A;  4JI7 M;  4YY3 M;  5IWA M;  4PD2 A;  1N32 M;  4G4Q A;  4DV6 M;  4OX9 M;  4DR5 M;  4DR2 M;  4PDI A;  3C58 A;  3GPU A;  4DV4 M;  3J81 S;  3GQ5 A;  1K82 A;  1PJJ A;  2HKJ A;  4X62 M;  3SAU A;  3SAS A;  3VK7 A;  2XZU A;  5ITU A;  1XNQ M;  3GP1 A;  4JI4 M;  4AQY M;  4LF8 M;  3U6E A;  1PJI A;  5BR8 M;  4JI2 M;  2VQF M;  1L2C A;  4NXN M;  3U6M A;  3A42 A;  3JAM S;  4DR1 M;  3U6D A;  2F5N A;  3GQ4 A;  4LFA M;  2UUC M;  4DR4 M;  1PM5 A;  3W0F A;  4DV3 M;  3T1Y M;  4X65 M;  1MU5 A;  4GKK M;  2F4V M;  3U6P A;  3U6S A;  4JI0 M;  3SAW A;  1HNZ M;  1IBL M;  4B3R M;  5ITX E;  2UXD M; 
#chains in the Genus database with same CATH topology
 4IBD A;  1PJT A;  4YHH M;  4LJ8 A;  2XLJ A;  2K6B A;  3B7Q A;  1Z5B A;  4NC6 A;  2WZJ A;  1JR3 D;  1YUB A;  2QQ8 A;  4NSR A;  4RKU F;  3TQS A;  3V76 A;  3WHK A;  4AG5 A;  4PCZ A;  3MK6 A;  4NRV A;  2KA6 B;  1VG5 A;  3GO8 A;  3UZU A;  4ITQ A;  1SXJ A;  4LJ7 A;  3I4V A;  3VK8 A;  2BJV A;  5IT9 S;  1L2D A;  1R2Z A;  2FFJ A;  3HU2 A;  3HY5 A;  1I4W A;  2WSF F;  1MN3 A;  2LVQ D;  3FE3 A;  4XBO A;  3SHF A;  1EIJ A;  4QNM A;  4L16 A;  1IQP A;  3AJI B;  3CTW B;  3FYC A;  4QHT A;  1QZE A;  2VII A;  4JN6 A;  3TWK A;  4GC5 A;  4B7F A;  5C18 A;  2I7P A;  4NOO B;  3RGS A;  4D80 A;  2R6F A;  3LVW A;  5FTM A;  2ZAM A;  5KO3 A;  4REZ A;  4B08 A;  3VLF B;  1G3I A;  1MJG M;  1C7Y A;  1PRB A;  3PNV A;  1CUK A;  1EFU B;  4JI3 M;  5H37 D;  2Y0Q A;  2CV1 A;  3U6L A;  4JI8 M;  4GHA A;  1R6B X;  3JR5 A;  2DWN A;  1N34 M;  4LCB A;  1DGH A;  5E6J A;  3L26 A;  4KT0 F;  4OVZ B;  2UUA M;  2DAM A;  2QPA A;  4L6V 6;  3KW6 A;  2X49 A;  3K1J A;  2JNH A;  2C5R A;  1IN7 A;  1XXH A;  2BWB A;  2HHH M;  3T6P A;  4MGZ E;  1QAM A;  1YE9 A;  2FNA A;  4KO8 A;  2YQZ A;  2R4E A;  4PT5 A;  4WUR A;  4DV2 M;  3KDS E;  3DA1 A;  2ZTC A;  3E21 A;  5KPT A;  1SXJ C;  1XXH E;  2C96 A;  2KNA A;  4IJE A;  2QSF X;  4GC9 A;  3LCV B;  2CV2 A;  3GLI E;  1DGG A;  4R7G A;  1IY2 A;  1QAQ A;  3FTF A;  3KOW E;  2JA2 A;  5EP2 A;  3J7A S;  3B7N A;  3HJS A;  3E9S A;  4WP2 A;  4LRS A;  3T1H M;  1HNW M;  5EXS A;  4NRW A;  2MRO B;  3GPP A;  2UUB M;  2F5S A;  2ZTD A;  1GO5 A;  1T3T A;  3AKZ A;  5ITR A;  1WJ7 A;  4L4U A;  2M5Z A;  3FKE A;  4OX9 M;  5EXX A;  4AKI A;  4QOS A;  4PDI A;  3C58 A;  2XF3 A;  3B7Z A;  3HHY A;  1L8Q A;  7CAT A;  2Y21 A;  3FTC A;  3VK7 A;  2N35 A;  1LV7 A;  3BBZ A;  3IHP A;  3B89 A;  3U61 B;  1PGY A;  3U5Z A;  2R46 A;  2EKF A;  1N77 A;  4QOZ C;  1TH4 A;  1TR8 A;  2XH9 A;  1IY1 A;  5EQT A;  2JUJ A;  1KYI A;  3Q8G A;  4HLQ A;  4XK8 F;  4IJF A;  1IN6 A;  3U6M A;  1JR3 E;  2HWJ A;  2C98 A;  5KPZ A;  2LHC A;  1N78 A;  2O5R A;  4DR1 M;  4CHT B;  2P5T A;  2W82 A;  8CAT A;  1IXS B;  2AHM A;  1D2N A;  3W0F A;  5FTJ A;  2V1U A;  2RGH A;  2V6Z M;  1ZV1 A;  2KNZ A;  1VEJ A;  4GKK M;  3F92 A;  5EJC A;  1Q02 A;  3MMP A;  3GLH E;  1HT1 E;  1XHB A;  1R7R A;  2VDB B;  4FWD A;  1HNZ M;  4JXJ A;  1QDT A;  4A3V B;  3ILK A;  2UXD M;  2UU9 M;  5EXT A;  1PJQ A;  2CFO A;  3GLH A;  3R8F A;  1J7K A;  1NY5 A;  1P3Q Q;  4LGY A;  1TH2 A;  3QYB A;  4FCT A;  3HKP A;  4LJ9 A;  4DV5 M;  2ERC A;  2Y0T A;  3FRI A;  2R45 A;  3SFZ A;  3I4Y A;  3L28 A;  1HR0 M;  2XFS A;  3AFH A;  3HGI A;  2QNJ A;  2DZL A;  3PXG A;  4MGY E;  3T38 A;  4B3S M;  3A45 A;  3KXE C;  4GIT A;  3GRR A;  3HHZ A;  3L27 A;  1KSF X;  3B74 A;  4FWG A;  3KOZ E;  3JR4 A;  4OVZ A;  3GQ3 A;  2G8L A;  2LBC A;  4BB9 A;  1Q3C A;  2L2D A;  3GRU A;  2R4J A;  4G4N A;  1IBM M;  3KS8 A;  1IN8 A;  2G3Q A;  3E46 A;  1XMO M;  1IXR C;  2CWB A;  2H5X A;  1N36 M;  2EO2 A;  3C9P A;  2KZU A;  2E5L M;  4LF5 M;  4GKJ M;  3FYD A;  3QWL A;  4JI5 M;  1AUA A;  4LG2 A;  5IZ7 D;  2FE8 A;  2EJS A;  2DAK A;  2KNV A;  3WHL A;  2DAE A;  4LRT A;  4M0W A;  4X64 M;  4CIS A;  1D0K A;  2EA0 A;  2DWL A;  1NHW C;  2JY6 B;  5JI3 E;  4DR3 M;  1DGF A;  4MB7 A;  2I7N A;  4DV0 M;  1FNN A;  2K9D A;  4JI1 M;  2A5Y B;  1DO2 A;  5ITX A;  1EE8 A;  4K0K M;  4W5W A;  2GNO A;  1WHC A;  1QYR A;  5FTK A;  2NQ8 C;  3KP0 E;  1TDH A;  1S3S A;  3IG8 A;  2MR9 A;  4MGH A;  2CP8 A;  3FUV A;  1XNR M;  2R62 A;  3K8Z A;  2R65 A;  2H1R A;  4LZZ A;  3FD9 A;  3U6Q A;  4JV5 M;  1Z5A A;  1TH3 A;  1K3W A;  1E9R A;  3U61 A;  2D7H A;  1KFV A;  2XSZ D;  1VDD A;  2OPF A;  3TL4 X;  1ZMW A;  3HWS A;  4P16 A;  3LQQ A;  2ZM6 M;  1IBK M;  2DWZ B;  1OFI A;  3GLI A;  1R4G A;  2CV0 A;  3K9P A;  1Y8G A;  1XWI A;  2R44 A;  3GLI B;  4MH0 E;  3KFU G;  4JYA M;  3PFI A;  2QZ4 A;  3AL0 C;  1G71 A;  2L7H A;  5EXP A;  1PJS A;  3SC3 A;  4JI7 M;  2LVO C;  5EP1 A;  3SYL A;  2QBY A;  3FRH A;  4R3D A;  2DNA A;  2DAG A;  3AOE C;  4PD2 A;  4G6Z A;  2RKO A;  3KVW A;  2KXE A;  1OAI A;  3BXW A;  4DR5 M;  4FCW A;  5F3W A;  1WGL A;  2EKK A;  4AKG A;  4P17 A;  3H4J A;  3J81 S;  1YSY A;  1PJJ A;  1GL7 A;  2HKJ A;  5C1B A;  3IG5 A;  1G59 A;  4TUW A;  2FS1 A;  2XZU A;  3DFZ A;  4IBB A;  1GAB A;  3D8L A;  3GP1 A;  3QAU A;  4QHS A;  1PJI A;  2Z4S A;  3IEC A;  5JI2 E;  4Y28 F;  5BR8 M;  1AIP C;  4JI2 M;  1ZAE A;  3J27 B;  2LNH C;  4CIZ A;  1V34 A;  4NXN M;  2JZ1 A;  4M9X A;  5DYG A;  1OQY A;  2KRU A;  3FUW A;  4AW4 A;  2C99 A;  3HHX A;  4I4L A;  4FCV A;  1OIZ A;  1IN4 A;  1OAO C;  2KW0 A;  3GQ4 A;  1T43 A;  4IBI A;  1QUS A;  1QUT A;  1QZM A;  4Z8X A;  3RE8 A;  2JZ0 A;  1MU5 A;  1SXJ D;  2F4V M;  2JY7 A;  3T15 A;  5FSW A;  3J2P B;  5E26 A;  1WXQ A;  3FUX A;  3NBI A;  3U6S A;  2CRU A;  3FTD A;  4L15 A;  2LH0 A;  2OOB A;  3HX3 A;  3J80 S;  3SHG B;  4I5S A;  4KOD A;  1JR3 A;  3GLH B;  4CGY B;  3CGW A;  5ITQ A;  2K0B X;  3LVV A;  3VDU A;  2BNK A;  3SBJ A;  4M9Z A;  5A2Q S;  2HL7 A;  2HAK A;  1A5T A;  1W5T A;  3U6C A;  3PNY A;  4KLN A;  2L6O A;  2FOI C;  1Z6T A;  2DZO B;  4HEO A;  4IIW A;  3W67 A;  2Y20 A;  4CJ6 A;  1R5L A;  2OQ4 A;  2HCB A;  2YFQ A;  2RGO A;  3DOA A;  1NO1 A;  3FUT A;  3LCU A;  2KZS A;  4I8O A;  2F5Q A;  1Z5C A;  4DUY M;  1JB0 F;  3EIE A;  2D7G A;  2R0I A;  3UGJ A;  2KEB A;  4JI6 M;  4NL4 H;  4LF9 M;  1GL6 A;  4KHP M;  2M60 A;  1GVN A;  3CF6 E;  4LFC M;  2DI0 A;  1MX0 A;  3GLF B;  1OIP A;  4GHL A;  4FVM A;  4B3M M;  2VF8 A;  1SXJ E;  3OTO M;  2Z3X A;  2DWM A;  4D81 A;  4LF6 M;  4AKH A;  3KSX A;  1FJG M;  4DV1 M;  4GEW A;  1OJL A;  5EP4 A;  1ZMU A;  4AZF A;  1VEG A;  3D8B A;  4AI6 A;  3U60 B;  1DO0 A;  2CEA A;  2X8A A;  3M6A A;  5LMN M;  4G4R A;  2KRK A;  1ORY B;  3LMM A;  1HNX M;  3BOS A;  1R2Y A;  2LVP C;  3Q8X A;  3UK6 A;  2F5O A;  2LVN C;  1L2B A;  4LFB M;  2CHQ A;  2L4E A;  4MGI E;  2OO9 A;  3SAR A;  2GQF A;  2L4F A;  1SXJ B;  2LTU A;  1BVS A;  1NY6 A;  2QP9 X;  2V1C A;  3C3D A;  5DYI A;  1IN5 A;  3U60 A;  1GJS A;  4ANR A;  2YR0 A;  2YNM D;  2LVA A;  3LW5 F;  4DUZ M;  2G5G X;  1VQ1 A;  5ITT A;  1NNJ A;  1IFY A;  2L09 A;  1ZMV A;  4L78 A;  2DEN A;  3SAV A;  4G3O A;  3SAT A;  1QQW A;  1K3X A;  3KOY E;  1TDZ A;  2EUC A;  3UMM A;  1Z59 A;  1E94 E;  2Z7J A;  4DV7 M;  4PDG A;  1XMQ M;  1QAN A;  2UXC M;  3VFD A;  4GH9 A;  4YY3 M;  5IWA M;  2ZAN A;  3GRV A;  2QBY B;  2J5Y A;  4DV6 M;  1GLN A;  1OKS A;  1HQY E;  1N75 A;  3M0E A;  1NJF A;  3RGP A;  3GPU A;  1NV9 A;  3NWL A;  2L7I A;  3K9O A;  2C9O A;  4LZJ A;  4X62 M;  3SAU A;  1E9S A;  2BJW A;  5GKN A;  2Z8Y M;  3VDP A;  3DZD A;  1HT2 E;  2X4A A;  2B3T A;  3KSJ A;  4AQY M;  1TTE A;  3J7B A;  4FWH A;  2DHY A;  4LF8 M;  1DGH B;  5DNY A;  4LJA A;  3VKG A;  1JQJ C;  1L2C A;  3K2L A;  2DVW B;  3HU3 A;  2CHV A;  1DV0 A;  2JXN A;  1G4A E;  2UUC M;  2LHG A;  3C3E A;  1PM5 A;  4GIP A;  4IBE A;  4DV3 M;  3GRY A;  3T1Y M;  1GJT A;  1UM8 A;  3SYK A;  4X65 M;  4LY6 A;  3U6P A;  5FTL A;  1OFH A;  2O01 F;  3HHW A;  4LJ6 A;  4I81 A;  4JI0 M;  4IBJ A;  2RRU A;  2DXI A;  2D7E A;  3KOX E;  2JY8 A;  4BBA A;  1XC8 A;  3HJQ A;  3HZJ A;  1ZQ9 A;  2DZN B;  4LF7 M;  4LGM A;  1Q3B A;  1G8P A;  4M0D A;  1L1Z A;  3ZH9 B;  1H6U A;  3NBX X;  3A98 B;  2MGW A;  3AOE A;  3TE6 A;  5KPR A;  5LMU M;  3A46 A;  5KQ8 A;  1I94 M;  2OOA A;  2MH8 A;  2KHH A;  4AG6 A;  3GPY A;  3L2A A;  4IBG A;  4II7 A;  1C1K A;  2DKL A;  3HJ8 A;  5KQD A;  2J7N A;  4G4O A;  2XZF A;  3M7G A;  1L1T A;  3U6O A;  2Q2E B;  3W68 A;  3ZC7 B;  3MJ5 A;  1RU3 A;  3I01 M;  4F2L A;  3TWL A;  2QCU A;  4B7H A;  1E32 A;  1N33 M;  1LTM A;  3U5Z B;  3CF0 A;  4L8R C;  3W0L B;  3ZCB B;  5FLX S;  2WSE F;  4MM3 B;  4F1I A;  1XB2 B;  1SG9 A;  1WGN A;  2QEN A;  1HJP A;  4NXM M;  5IRE B;  3B9P A;  3I04 M;  4IBF A;  3GLF E;  4DR7 M;  1OTR A;  4Z6Y A;  1NSF A;  2ZAO A;  4GRI A;  2Z4R A;  4RF1 A;  4UN2 B;  4WW0 A;  1IM2 A;  3SMP A;  3AV0 A;  1F4I A;  4LJ4 A;  2JWS A;  1D0M A;  5BPV A;  4D82 A;  4EIW A;  2UXB M;  1XXH B;  4MGK E;  2XEP A;  3R9X B;  3QYE A;  1NV8 A;  4Q7J A;  3KS4 A;  5EP3 A;  4GMQ A;  1Q39 A;  2VQE M;  1X37 A;  2ZBK B;  3E4R A;  1NHG C;  3I51 A;  3MHV C;  3ZQJ A;  3CF2 A;  1J5E M;  3PVS A;  2O25 A;  1UFZ A;  3GPX A;  1IY0 A;  1NNU C;  2KDL A;  4B3T M;  2F5P A;  2BWE A;  2MJ5 B;  3K92 A;  4LF4 M;  4RNA A;  3H4M A;  4OU7 A;  4LJ5 A;  4IBK A;  2K47 A;  2LXE A;  3KP1 E;  5ITY A;  4BLC A;  1TF0 B;  1VEK A;  4S12 A;  3FUU A;  1V92 A;  3TWM A;  2CUZ A;  4DR6 M;  4IBC A;  1D0L A;  4X66 M;  1J09 A;  4B7G A;  2CHG A;  5FTN A;  1YLA A;  4RF0 A;  1NJG A;  4HL4 A;  1VDL A;  2XGN A;  1QVR A;  1W5S A;  1N32 M;  3UJN A;  4G4Q A;  2QHO B;  4OW0 A;  2JY5 A;  2XSZ A;  4DR2 M;  2FH0 A;  3GQ5 A;  4DV4 M;  1K82 A;  3GLG E;  3FTE A;  2JP7 A;  4QNR A;  1WIV A;  4DBG B;  1NVM A;  1G41 A;  3HU1 A;  3SAS A;  5ITU A;  2WSC F;  1XNQ M;  3L25 A;  2DAI A;  3AOG A;  4JI4 M;  2DHR A;  4M9S A;  1HQC A;  3GLG A;  5L8R F;  3U6E A;  2VF7 A;  1IXZ A;  2LWX A;  4R71 A;  4FD2 A;  1QDR A;  4FW9 A;  2XFT A;  3SMS A;  4ZPX A;  2VQF M;  2C9C A;  1T6O A;  5DFL A;  3A42 A;  3RFW A;  3JAM S;  3GLG B;  3TPZ A;  2APL A;  2J7O A;  3THG A;  1DGB A;  3U6D A;  1IXS A;  4LFA M;  2F5N A;  1GKI A;  4DR4 M;  3EIH A;  3VKH A;  3L29 A;  4NSO B;  2CE7 A;  3GLF A;  3LQR A;  4XGI A;  1WR1 B;  3SAW A;  1QAO A;  1IBL M;  4B3R M;  1V33 A;  5ITX E;  1TGU A;  2R18 A; 
#chains in the Genus database with same CATH homology
 4IBD A;  4YHH M;  4LJ8 A;  2XLJ A;  1Z5B A;  3WHK A;  1JR3 D;  1YUB A;  4NSR A;  3TQS A;  4AG5 A;  4PCZ A;  3MK6 A;  4NRV A;  2KA6 B;  3GO8 A;  3UZU A;  4ITQ A;  1SXJ A;  4LJ7 A;  3I4V A;  3VK8 A;  2BJV A;  5IT9 S;  1L2D A;  1R2Z A;  2FFJ A;  3HU2 A;  1I4W A;  4XBO A;  3SHF A;  4QNM A;  4L16 A;  1IQP A;  3AJI B;  3CTW B;  3FYC A;  4QHT A;  2VII A;  4JN6 A;  3TWK A;  4GC5 A;  4B7F A;  5C18 A;  2I7P A;  4NOO B;  3RGS A;  4D80 A;  3LVW A;  5FTM A;  2ZAM A;  5KO3 A;  4REZ A;  4B08 A;  3VLF B;  1G3I A;  3PNV A;  4JI8 M;  4JI3 M;  5H37 D;  2Y0Q A;  4GHA A;  3U6L A;  1R6B X;  3JR5 A;  2DWN A;  1N34 M;  4LCB A;  1DGH A;  5E6J A;  3L26 A;  4OVZ B;  2UUA M;  2QPA A;  3KW6 A;  2X49 A;  3K1J A;  2C5R A;  1IN7 A;  1XXH A;  2HHH M;  4MGZ E;  1QAM A;  1YE9 A;  2FNA A;  4KO8 A;  2YQZ A;  2R4E A;  4PT5 A;  4WUR A;  4DV2 M;  3KDS E;  3DA1 A;  5KPT A;  1SXJ C;  2C96 A;  4IJE A;  4GC9 A;  2CV2 A;  1DGG A;  4R7G A;  1IY2 A;  1QAQ A;  3FTF A;  3KOW E;  2JA2 A;  5EP2 A;  3J7A S;  3HJS A;  3E9S A;  4LRS A;  3T1H M;  1HNW M;  5EXS A;  4NRW A;  3GPP A;  2UUB M;  2F5S A;  1T3T A;  3AKZ A;  5ITR A;  4L4U A;  2M5Z A;  3FKE A;  4OX9 M;  5EXX A;  4AKI A;  4QOS A;  4PDI A;  3C58 A;  2XF3 A;  3HHY A;  1L8Q A;  7CAT A;  2Y21 A;  3FTC A;  3VK7 A;  1LV7 A;  3U61 B;  1N77 A;  3U5Z A;  2R46 A;  4QOZ C;  1TH4 A;  2XH9 A;  1IY1 A;  5EQT A;  1KYI A;  4HLQ A;  4IJF A;  1IN6 A;  3U6M A;  2C98 A;  5KPZ A;  1N78 A;  2O5R A;  4DR1 M;  4CHT B;  2P5T A;  2W82 A;  8CAT A;  1IXS B;  2AHM A;  1D2N A;  3W0F A;  5FTJ A;  2V1U A;  2RGH A;  2V6Z M;  4GKK M;  5EJC A;  1HT1 E;  1XHB A;  1R7R A;  4FWD A;  1HNZ M;  4JXJ A;  4A3V B;  3ILK A;  2UXD M;  2UU9 M;  5EXT A;  2CFO A;  3GLH A;  3R8F A;  1J7K A;  1NY5 A;  4LGY A;  1TH2 A;  4FCT A;  3HKP A;  4LJ9 A;  4DV5 M;  2ERC A;  2Y0T A;  2R45 A;  3SFZ A;  3I4Y A;  3L28 A;  1HR0 M;  2XFS A;  3AFH A;  3HGI A;  3PXG A;  4MGY E;  3T38 A;  4B3S M;  3A45 A;  3KXE C;  4GIT A;  3GRR A;  3HHZ A;  3L27 A;  1KSF X;  4FWG A;  3KOZ E;  3JR4 A;  4OVZ A;  3GQ3 A;  2G8L A;  4BB9 A;  1Q3C A;  3GRU A;  2R4J A;  4G4N A;  1IBM M;  3KS8 A;  1IN8 A;  1N36 M;  1XMO M;  1IXR C;  2EO2 A;  2KZU A;  2E5L M;  4LF5 M;  4GKJ M;  3FYD A;  3QWL A;  4JI5 M;  4LG2 A;  5IZ7 D;  2FE8 A;  3WHL A;  4LRT A;  4M0W A;  4X64 M;  4CIS A;  2EA0 A;  2DWL A;  1NHW C;  5JI3 E;  4DR3 M;  1DGF A;  4MB7 A;  2I7N A;  4DV0 M;  1FNN A;  4JI1 M;  2A5Y B;  1DO2 A;  5ITX A;  1EE8 A;  4K0K M;  4W5W A;  1QYR A;  5FTK A;  2NQ8 C;  3KP0 E;  1TDH A;  1S3S A;  3IG8 A;  4MGH A;  3FUV A;  1XNR M;  2R62 A;  3K8Z A;  2R65 A;  2H1R A;  4LZZ A;  3FD9 A;  3U6Q A;  4JV5 M;  1Z5A A;  1TH3 A;  1K3W A;  1E9R A;  3U61 A;  2D7H A;  1KFV A;  2XSZ D;  1VDD A;  2OPF A;  3TL4 X;  4P16 A;  3HWS A;  2ZM6 M;  3LQQ A;  1IBK M;  2CV0 A;  2DWZ B;  1OFI A;  3GLI A;  3GLI B;  1XWI A;  3KFU G;  4MH0 E;  4JYA M;  3PFI A;  2QZ4 A;  3AL0 C;  2L7H A;  5EXP A;  3SC3 A;  4JI7 M;  5EP1 A;  3SYL A;  2QBY A;  4R3D A;  4PD2 A;  3AOE C;  4G6Z A;  2RKO A;  3KVW A;  2KXE A;  4DR5 M;  5F3W A;  4FCW A;  4AKG A;  3J81 S;  1YSY A;  1PJJ A;  1GL7 A;  2HKJ A;  5C1B A;  3IG5 A;  1G59 A;  4TUW A;  2XZU A;  3DFZ A;  4IBB A;  3D8L A;  3GP1 A;  3QAU A;  4QHS A;  1PJI A;  2Z4S A;  5JI2 E;  5BR8 M;  4JI2 M;  1ZAE A;  3J27 B;  2LNH C;  4NXN M;  5DYG A;  4M9X A;  4AW4 A;  2KRU A;  3FUW A;  2C99 A;  3HHX A;  4I4L A;  4FCV A;  1IN4 A;  2KW0 A;  3GQ4 A;  4IBI A;  1QZM A;  4Z8X A;  3RE8 A;  1MU5 A;  1SXJ D;  2F4V M;  5FSW A;  3T15 A;  3J2P B;  5E26 A;  1WXQ A;  3FUX A;  3NBI A;  3U6S A;  3FTD A;  4L15 A;  2LH0 A;  3J80 S;  3SHG B;  4I5S A;  4KOD A;  1JR3 A;  3GLH B;  4CGY B;  5ITQ A;  3VDU A;  3LVV A;  2BNK A;  3SBJ A;  4M9Z A;  5A2Q S;  2HL7 A;  3U6C A;  1W5T A;  3PNY A;  4KLN A;  2L6O A;  2FOI C;  1Z6T A;  2DZO B;  4IIW A;  2Y20 A;  2OQ4 A;  2HCB A;  2YFQ A;  2RGO A;  3DOA A;  3FUT A;  2KZS A;  4I8O A;  2F5Q A;  1Z5C A;  4DUY M;  3EIE A;  2D7G A;  3UGJ A;  2KEB A;  4JI6 M;  4NL4 H;  4LF9 M;  1GL6 A;  4KHP M;  2M60 A;  1GVN A;  3CF6 E;  4LFC M;  1MX0 A;  3GLF B;  4GHL A;  4FVM A;  4B3M M;  3OTO M;  1SXJ E;  2Z3X A;  2DWM A;  4D81 A;  4LF6 M;  4AKH A;  3KSX A;  1FJG M;  4DV1 M;  1OJL A;  5EP4 A;  4AZF A;  3D8B A;  4AI6 A;  3U60 B;  1DO0 A;  2CEA A;  2X8A A;  3M6A A;  5LMN M;  4G4R A;  2KRK A;  1ORY B;  3LMM A;  1HNX M;  3BOS A;  1R2Y A;  3Q8X A;  2F5O A;  3UK6 A;  1L2B A;  4LFB M;  2CHQ A;  4MGI E;  3SAR A;  1SXJ B;  2QP9 X;  2V1C A;  1NY6 A;  3U60 A;  2CV1 A;  5DYI A;  1IN5 A;  2YR0 A;  2YNM D;  4DUZ M;  2G5G X;  5ITT A;  1NNJ A;  2L09 A;  4L78 A;  3SAV A;  3SAT A;  1QQW A;  1K3X A;  3KOY E;  1TDZ A;  2EUC A;  3UMM A;  1Z59 A;  1E94 E;  2Z7J A;  4DV7 M;  4PDG A;  1XMQ M;  1QAN A;  2UXC M;  3VFD A;  4GH9 A;  4YY3 M;  5IWA M;  2ZAN A;  3GRV A;  2QBY B;  4DV6 M;  1GLN A;  1HQY E;  1N75 A;  3M0E A;  1NJF A;  3RGP A;  3GPU A;  3NWL A;  2L7I A;  2C9O A;  4LZJ A;  4X62 M;  3SAU A;  1E9S A;  2BJW A;  5GKN A;  3VDP A;  3DZD A;  1HT2 E;  2X4A A;  3KSJ A;  4AQY M;  4LF8 M;  3J7B A;  4FWH A;  1DGH B;  5DNY A;  4LJA A;  3VKG A;  1JQJ C;  1L2C A;  3K2L A;  2DVW B;  3HU3 A;  2CHV A;  1G4A E;  2UUC M;  1PM5 A;  4GIP A;  4IBE A;  4DV3 M;  3GRY A;  3T1Y M;  1UM8 A;  4X65 M;  3SYK A;  4LY6 A;  3U6P A;  5FTL A;  1OFH A;  3HHW A;  4LJ6 A;  4I81 A;  4JI0 M;  4IBJ A;  2DXI A;  2D7E A;  3KOX E;  4BBA A;  1XC8 A;  3HJQ A;  1ZQ9 A;  2DZN B;  4LF7 M;  4LGM A;  1Q3B A;  1G8P A;  4M0D A;  1L1Z A;  3ZH9 B;  1H6U A;  3A98 B;  3AOE A;  3TE6 A;  5KPR A;  5LMU M;  3A46 A;  5KQ8 A;  1I94 M;  3GPY A;  4AG6 A;  3L2A A;  4IBG A;  4II7 A;  1C1K A;  3HJ8 A;  5KQD A;  2J7N A;  4G4O A;  2XZF A;  3M7G A;  1L1T A;  3U6O A;  2Q2E B;  3ZC7 B;  3MJ5 A;  3TWL A;  2QCU A;  4B7H A;  1E32 A;  1N33 M;  3U5Z B;  3CF0 A;  4L8R C;  3W0L B;  3ZCB B;  5FLX S;  4MM3 B;  2QEN A;  4NXM M;  5IRE B;  3B9P A;  4IBF A;  4DR7 M;  4Z6Y A;  1NSF A;  2ZAO A;  4GRI A;  2Z4R A;  4RF1 A;  4WW0 A;  1IM2 A;  3SMP A;  3AV0 A;  4LJ4 A;  5BPV A;  4D82 A;  4EIW A;  2UXB M;  1XXH B;  4MGK E;  2XEP A;  3R9X B;  3KS4 A;  5EP3 A;  4GMQ A;  1Q39 A;  2VQE M;  1X37 A;  2ZBK B;  3E4R A;  1NHG C;  3I51 A;  3MHV C;  1J5E M;  3CF2 A;  3PVS A;  3GPX A;  1IY0 A;  1NNU C;  4B3T M;  2F5P A;  3K92 A;  4LF4 M;  4RNA A;  3H4M A;  4OU7 A;  4LJ5 A;  4IBK A;  2K47 A;  2LXE A;  3KP1 E;  5ITY A;  4BLC A;  4S12 A;  3FUU A;  3TWM A;  2CUZ A;  4DR6 M;  4IBC A;  4X66 M;  1J09 A;  4B7G A;  2CHG A;  5FTN A;  4RF0 A;  1NJG A;  4HL4 A;  2XGN A;  1QVR A;  1W5S A;  1N32 M;  3UJN A;  4G4Q A;  4OW0 A;  2XSZ A;  4DR2 M;  4DV4 M;  3GQ5 A;  1K82 A;  3FTE A;  3SAS A;  4QNR A;  1NVM A;  1G41 A;  3HU1 A;  5ITU A;  1XNQ M;  3L25 A;  3AOG A;  4JI4 M;  2DHR A;  4M9S A;  1HQC A;  3GLG A;  3U6E A;  1IXZ A;  2LWX A;  4FD2 A;  4FW9 A;  2XFT A;  3SMS A;  4ZPX A;  2VQF M;  2C9C A;  3A42 A;  3RFW A;  3JAM S;  3GLG B;  3TPZ A;  2J7O A;  3THG A;  1DGB A;  3U6D A;  2F5N A;  4LFA M;  4DR4 M;  1GKI A;  3VKH A;  3EIH A;  3L29 A;  4NSO B;  2CE7 A;  3GLF A;  3LQR A;  4XGI A;  3SAW A;  1QAO A;  1IBL M;  4B3R M;  5ITX E;  1TGU A;  2R18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...