2G3QA

Solution structure of ede1 uba-ubiquitin complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
43
structure length
43
Chain Sequence
b'TTPKSLAVEELSGMGFTEEEAHNALEKCNWDLEAATNFLLDSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein YBL047C
publication title Structural Basis for Monoubiquitin Recognition by the Ede1 UBA Domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/signaling protein
total genus 12
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2g3qA00
2LBCA 1HJPA 1OTRA 1BVSA 4F2LA 1WJ7A 2EKKA 1F4IA 2HAKA 1HT2E 2DAMA 1KYIA 3E21A 4DBGB 1JR3E 2G3QA 2DAGA 1TR8A 3LCUA 2EJSA 4GEWA 3GLGE 1ZV1A 1C7YA 1NV8A 3LCVB 2LTUA 1WGLA 3GLHE 2L4FA 4UN2B 1ZMWA 3GLIE 2QHOB 1DV0A 2H5XA 2JY7A 1OAIA 2KNVA 2MJ5B 2HWJA 3B89A 1VG5A 1T6OA 1UFZA 1TTEA 2LVAA 3IHPA 2JZ0A 2DHYA 3FE3A 3FRHA 1IXSA 3H4JA 1MN3A 2JZ1A 2LVNC 4G3OA 1E94E 2JP7A 1R4GA 1CUKA 1V92A 2CP8A 3GLFE 2JY5A 1IFYA 4R71A 1EFUB 1Q02A 2MROB 5DFLA 3T6PA 1HQYE 3MMPA 1VDLA 2LVOC 1G3IA 1AIPC 2DKLA 1T43A 2KNAA 1IM2A 1NV9A 1VEKA 2DI0A 2K9DA 2L2DA 3F92A 2RRUA 1DO0A 1A5TA 2QNJA 2OO9A 1YLAA 2DENA 2JNHA 2DAIA 2KHHA 2BWBA 1WR1B 1XB2B 1ZMVA 2WZJA 1QZEA 1ZMUA 3K9PA 2OOBA 1SG9A 2DNAA 4Q7JA 3E46A 1OKSA 2KNZA 4HEOA 1P3QQ 1XXHE 1HT1E 2ZTDA 2L4EA 1VEGA 5JI2E 2JUJA 2MGWA 2DAKA 1GO5A 4F1IA 2DZLA 1OQYA 3FRIA 3K9OA 1WHCA 1Y8GA 2LVPC 2O25A 2OOAA 1VQ1A 2R0IA 2LVQD 2K0BX 3BBZA 2BWEA 1G41A 2QSFX 1VEJA 1WIVA 1G4AE 2JY8A 2ZTCA 1DO2A 2EKFA 1PGYA 2CWBA 4WP2A 2JY6B 2B3TA 1WGNA 3IECA 2MR9A 2DAEA
chains in the Genus database with same CATH superfamily
1NHGC 4TUWA 3SATA 3LW5F 4NSOB 1I94M 1WJ7A 4AQYM 2F5SA 3HU2A 2CV0A 4CGYB 3T1HM 4P16A 4DBGB 1R2YA 1JR3E 2CHGA 4MGYE 3KOZE 1OFIA 4LG2A 3C58A 4AKGA 1HQCA 2DAGA 3LCUA 2EJSA 3FD9A 3GLGE 3U6QA 3SFZA 1PRBA 1IBKM 2D7EA 3DOAA 1G59A 1C7YA 4DR4M 2QQ8A 3FUVA 2LTUA 2ZAMA 2YNMD 3KP1E 2C99A 3HY5A 3GLIE 4LF6M 3TWLA 3DFZA 4LF7M 4JN6A 2MJ5B 1N78A 1NY5A 3PNVA 3CTWB 3SHGB 3J7AS 1T6OA 4KO8A 3TL4X 1DGHA 1TH3A 4Z6YA 3UK6A 2JZ0A 1GABA 3SARA 3I4YA 4GC5A 5LMUM 2LNHC 4G4OA 2J7OA 3H4JA 2QPAA 2YR0A 3U61A 2JZ1A 2KDLA 1OFHA 3GQ5A 5EXPA 3R8FA 3GPYA 1OIPA 2C98A 2JP7A 4ANRA 1R4GA 1CUKA 2R62A 3CF6E 4FWGA 3GLFE 1J5EM 2R44A 1IN7A 2NQ8C 3AOGA 1G71A 3HX3A 3HHXA 3KOWE 2W82A 2XH9A 4NXNM 2VF8A 2C9CA 2VQFM 2AHMA 1K3WA 3KP0E 4AKIA 1L8QA 1D2NA 3LQQA 2G5GX 3T6PA 2KZUA 1VDLA 4LJ8A 1S3SA 4FD2A 3KSXA 4JI3M 2F4VM 2CE7A 3HHWA 4DV6M 2KNAA 1NV9A 2KA6B 1VEKA 2DI0A 2K9DA 2MH8A 3GRRA 3HHYA 1XXHA 4FCWA 3HU1A 3LQRA 3VKHA 2Y20A 3SYLA 3J80S 2JNHA 1IN8A 2X8AA 1IXRC 3NWLA 3NBXX 4DV0M 4KODA 4MGZE 3AV0A 1IY0A 1QVRA 4B08A 2DXIA 1GL6A 1DGHB 1TF0B 3L2AA 4I4LA 1IXZA 3EIHA 3ZQJA 4DR3M 4R3DA 2DNAA 4GMQA 3UMMA 2QP9X 3E46A 1OKSA 2KNZA 4HEOA 4FCVA 2LHGA 3A98B 2VDBB 1GKIA 1Q39A 1QUTA 4GC9A 4BLCA 7CATA 1HR0M 2CV2A 4KHPM 1IBMM 1TGUA 1HNZM 1VEGA 4LZZA 2C9OA 3A46A 1GJSA 2Z4RA 4IBDA 1K82A 3DZDA 1D0MA 4M9SA 1NVMA 4PDIA 2Z4SA 2C5RA 1MU5A 2DZNB 1GVNA 1WHCA 1YE9A 2FS1A 2LVPC 2HKJA 2R6FA 2OOAA 2R0IA 2Y21A 3I01M 2LVQD 3I04M 3B9PA 3NBIA 3H4MA 2HCBA 4P17A 1N33M 2FOIC 4NOOB 4PCZA 3B7QA 4MH0E 1ZQ9A 1L2CA 2ZTCA 4OX9M 2WSFF 2R18A 1DGGA 1NHWC 1NNJA 5GKNA 2LHCA 3B7NA 2B3TA 2BNKA 3L26A 3AJIB 1TDHA 4S12A 4I81A 2GNOA 3GRVA 3FTEA 3SBJA 1HJPA 1BVSA 4AKHA 4F2LA 1SXJD 3VK8A 2L7HA 2OQ4A 2FNAA 4XBOA 1KYIA 3E21A 5EP1A 3VFDA 5IWAM 5ITQA 3UJNA 4LF5M 4AZFA 3D8LA 4DUYM 4DV3M 1C1KA 3BOSA 4JI7M 2APLA 1IQPA 1GJTA 4MGIE 2M5ZA 1HNWM 4LJ7A 3KS4A 3LCVB 1WGLA 5IREB 4OVZA 2RGOA 3J2PB 1ZMWA 4JI4M 4R7GA 1DV0A 2H5XA 4FW9A 2RKOA 5FTMA 2JY7A 4IBFA 1Z6TA 4IBGA 4AG5A 2CFOA 1R2ZA 4PDGA 3KVWA 3GLHA 2DWMA 3CF0A 3GRYA 2WSCF 3IHPA 5ITXA 3GPUA 2QENA 4DUZM 2Z3XA 2XFTA 2Z8YM 4B3SM 2LVNC 3MK6A 4GITA 2F5OA 3FYCA 3MJ5A 4M9XA 3U6SA 1OJLA 4Z8XA 1TH4A 3AFHA 1JR3D 4KLNA 4X66M 2R4EA 1NY6A 4JYAM 1QZMA 2JY5A 2K6BA 4QOSA 5ITTA 4CHTB 4NRWA 1Q02A 2FE8A 2XLJA 2RGHA 5DFLA 3AL0C 2EA0A 1KSFX 1H6UA 1R5LA 5ITRA 3DA1A 2X49A 2DKLA 3W68A 4GKKM 1J7KA 2XSZD 4D80A 5C1BA 4LJ4A 4DV7M 2XGNA 2CUZA 3AKZA 4IJEA 2L2DA 1D0LA 1A5TA 3KOXE 3B7ZA 2QNJA 2OO9A 4LGYA 4WURA 1SXJA 3LMMA 2DAIA 4LF4M 3SHFA 1QDTA 4LZJA 4YY3M 3KOYE 5KPRA 2DZOB 1XWIA 1QZEA 2QBYA 1L2DA 3GLHB 3K9PA 3VLFB 1SG9A 4PD2A 5BR8M 3TQSA 1XMOM 3KSJA 1LTMA 4IBKA 3ZCBB 4BB9A 5C18A 4AI6A 4LJAA 2VF7A 1J09A 1P3QQ 3RGSA 3M6AA 2YFQA 2LWXA 3BXWA 3HJSA 4FWDA 1HT1E 2QZ4A 4GRIA 5DYGA 3SMSA 1G8PA 2P5TA 2XFSA 2VIIA 1DGFA 2MGWA 3ZH9B 3GRUA 2Y0QA 4F1IA 3L25A 4D81A 1E32A 1Z59A 5KPZA 3K9OA 3WHLA 1Y8GA 2M60A 4IBIA 2H1RA 2J7NA 3HZJA 1QAOA 4NSRA 3L29A 1IY1A 3Q8XA 3QAUA 2LH0A 3U5ZA 1JR3A 5EJCA 1G41A 4NRVA 2UUBM 1N36M 2XEPA 1DO2A 1V33A 5ITUA 1EE8A 1QAQA 1VDDA 4WP2A 4YHHM 1UM8A 2JY6B 3W67A 1YUBA 3U6DA 3IECA 3U61B 5EP4A 3GLIA 3FKEA 5FTNA 2I7PA 2HL7A 4FWHA 1TDZA 2ZANA 4G4QA 1QAMA 2DWZB 8CATA 2F5NA 2O5RA 2EKKA 1F4IA 4LJ6A 3KXEC 4A3VB 2GQFA 2Q2EB 2R65A 1L2BA 2V1UA 2KEBA 2UXDM 4IIWA 1QYRA 2K47A 4HL4A 4RF1A 1OIZA 1YSYA 3GP1A 4GEWA 2UUAM 3KFUG 2ZBKB 3SMPA 4L6V6 1FNNA 1NV8A 4LRTA 3GLHE 4DV5M 3K1JA 2C96A 2I7NA 2L4FA 4JI1M 1Q3CA 5EXXA 2N35A 3ILKA 3MHVC 1D0KA 4OU7A 3EIEA 4WW0A 4DR6M 1OAIA 2KNVA 4XK8F 3K2LA 4DR2M 3LVWA 3SC3A 1VG5A 4MGHA 1MJGM 3JAMS 1XXHB 1UFZA 3FTDA 2OPFA 2LVAA 3GQ3A 3SASA 2ZM6M 4II7A 3FE3A 3FRHA 2KRUA 5EP3A 5KQDA 3SAWA 1IXSA 3U5ZB 1ZAEA 5DYIA 5FTLA 2XF3A 5E26A 1E94E 3HU3A 4EIWA 1AUAA 1NJFA 4JI8M 3KW6A 1V92A 4LF9M 1PJIA 3K92A 4LGMA 2R45A 3U6EA 2ERCA 4X64M 3Q8GA 1JB0F 4GHAA 1IN6A 1EFUB 3U60A 2UU9M 3HKPA 3VDUA 3KS8A 4NL4H 4GH9A 3VK7A 1I4WA 4NC6A 5FLXS 1HQYE 3MMPA 1QDRA 2LVOC 2O01F 4L78A 4B3RM 2UXCM 1HNXM 5EP2A 1AIPC 2DWNA 4DR5M 1T43A 4B3MM 4QNMA 4CJ6A 2UUCM 1IM2A 3L27A 3CGWA 1QANA 3HJQA 3U6PA 3HWSA 4K0KM 2RRUA 4B7FA 3J7BA 2EO2A 4OW0A 5LMNM 2DENA 2JXNA 4LFBM 2KHHA 2BWBA 4LJ5A 4NXMM 4RNAA 1QUSA 5FTJA 1XB2B 4LF8M 2WZJA 3L28A 4X65M 3J81S 1NSFA 3CF2A 4PT5A 2OOBA 3M7GA 5BPVA 3AOEA 1MX0A 3GPPA 4Q7JA 2CHVA 4JI2M 1IXSB 1JQJC 2A5YB 4RKUF 4DV4M 1XXHE 1SXJC 5DNYA 5EXTA 4DR1M 3GQ4A 2ZTDA 3I51A 2L4EA 3FTFA 2J5YA 3E4RA 5JI2E 5KQ8A 2JUJA 2KZSA 3FUXA 4IBBA 3UGJA 2DAKA 3SAUA 1GO5A 3C3EA 2XZUA 4GIPA 3PXGA 1XHBA 3A42A 1OQYA 3JR4A 3T1YM 3FRIA 4OVZB 5FTKA 3U60B 2F5PA 2XZFA 1RU3A 4GHLA 2O25A 1VQ1A 1T3TA 3I4VA 3PVSA 2K0BX 2ZAOA 1IN4A 2JWSA 1W5SA 3BBZA 4X62M 4MB7A 2BJVA 2BWEA 2DWLA 2QSFX 2V1CA 1VEJA 2JY8A 1PGYA 1PJSA 1L1ZA 1IY2A 3R9XB 3T38A 2UXBM 3J27B 5EXSA 1WGNA 3WHKA 3JR5A 4ITQA 2LXEA 3B74A 2V6ZM 1PJJA 3LVVA 2LBCA 3TPZA 1OTRA 3FTCA 4B7HA 2R46A 4FCTA 2HAKA 1XNQM 1HT2E 3U6MA 2DAMA 3D8BA 3W0LB 4HLQA 1PM5A 4IBCA 2G3QA 2Y0TA 3QYEA 1TR8A 1N32M 1ZV1A 4L15A 1FJGM 4GKJM 4G4RA 3TWKA 2X4AA 4UN2B 4JI0M 4CISA 1K3XA 2QHOB 4LCBA 2DVWB 2L7IA 1IBLM 4ZPXA 2WSEF 4KT0F 5FSWA 3GLGA 2G8LA 2HWJA 3B89A 2CV1A 3OTOM 2F5QA 1R6BX 2KXEA 1IN5A 1TTEA 1GL7A 2BJWA 2DHYA 3KDSE 1EIJA 1SXJB 4L16A 4REZA 3C3DA 2YQZA 3E9SA 4I8OA 4Y28F 1E9RA 1MN3A 1N34M 1WXQA 4G3OA 2QBYB 3FUUA 4M0DA 2XSZA 3TE6A 3V76A 2FH0A 4FVMA 3SAVA 2CP8A 2FFJA 5IZ7D 4DV1M 1LV7A 1IFYA 1XC8A 4R71A 2CHQA 3U6OA 4M9ZA 1NNUC 4AG6A 1Z5CA 5ITXE 5EQTA 2MROB 4D82A 4LJ9A 1QQWA 1V34A 4IBJA 4QHSA 4LFAM 4DV2M 2L6OA 1Z5AA 2D7HA 3GLFA 1W5TA 1G3IA 3FYDA 5IT9S 3M0EA 4IJFA 1L1TA 2VQEM 3A45A 4LFCM 5E6JA 1NO1A 3IG8A 1TH2A 3F92A 4XGIA 5JI3E 5ITYA 5F3WA 1DO0A 5H37D 1PJQA 4M0WA 5KO3A 3RGPA 1YLAA 1OAOC 3GPXA 2L09A 3W0FA 3C9PA 3SYKA 1R7RA 5A2QS 3HHZA 1WR1B 3GLGB 1ZMVA 3UZUA 4JI5M 5KPTA 3K8ZA 1ZMUA 4LY6A 1DGBA 1XNRM 2R4JA 3GLIB 2KRKA 3VKGA 4QNRA 2CRUA 1X37A 3FUTA 4G4NA 1PJTA 3PFIA 1GLNA 4LRSA 4MM3B 3RFWA 5L8RF 1XMQM 2DHRA 1SXJE 4B3TM 1Q3BA 3QYBA 4L4UA 3PNYA 3RE8A 4B7GA 4L8RC 3FUWA 4IBEA 2KW0A 3ZC7B 2JA2A 2EUCA 3THGA 2DZLA 3AOEC 1NJGA 3GO8A 2QCUA 4CIZA 4QOZC 3VDPA 2Z7JA 4DR7M 2D7GA 3HGIA 3U6CA 4JV5M 3HJ8A 2HHHM 4JXJA 2E5LM 2CEAA 4BBAA 3GLFB 1KFVA 1E9SA 4RF0A 1WIVA 1G4AE 4I5SA 3T15A 1N75A 3TWMA 2EKFA 1ORYB 2CWBA 1N77A 4W5WA 1Z5BA 3IG5A 4MGKE 4G6ZA 3U6LA 2MR9A 4QHTA 2DAEA 4AW4A 3QWLA 4JI6M
chains in the Genus database with same CATH topology
2LBCA 1HJPA 1OTRA 1BVSA 4F2LA 1WJ7A 2EKKA 1F4IA 2HAKA 1HT2E 2DAMA 1KYIA 3E21A 4DBGB 1JR3E 2G3QA 2DAGA 1TR8A 3LCUA 2EJSA 4GEWA 3GLGE 1ZV1A 1C7YA 1NV8A 3LCVB 2LTUA 1WGLA 3GLHE 2L4FA 4UN2B 1ZMWA 3GLIE 2QHOB 1DV0A 2H5XA 2JY7A 1OAIA 2KNVA 2MJ5B 2HWJA 3B89A 1VG5A 1T6OA 1UFZA 1TTEA 2LVAA 3IHPA 2JZ0A 2DHYA 3FE3A 3FRHA 1IXSA 3H4JA 1MN3A 2JZ1A 2LVNC 4G3OA 1E94E 2JP7A 1R4GA 1CUKA 1V92A 2CP8A 3GLFE 2JY5A 1IFYA 4R71A 1EFUB 1Q02A 2MROB 5DFLA 3T6PA 1HQYE 3MMPA 1VDLA 2LVOC 1G3IA 1AIPC 2DKLA 1T43A 2KNAA 1IM2A 1NV9A 1VEKA 2DI0A 2K9DA 2L2DA 3F92A 2RRUA 1DO0A 1A5TA 2QNJA 2OO9A 1YLAA 2DENA 2JNHA 2DAIA 2KHHA 2BWBA 1WR1B 1XB2B 1ZMVA 2WZJA 1QZEA 1ZMUA 3K9PA 2OOBA 1SG9A 2DNAA 4Q7JA 3E46A 1OKSA 2KNZA 4HEOA 1P3QQ 1XXHE 1HT1E 2ZTDA 2L4EA 1VEGA 5JI2E 2JUJA 2MGWA 2DAKA 1GO5A 4F1IA 2DZLA 1OQYA 3FRIA 3K9OA 1WHCA 1Y8GA 2LVPC 2O25A 2OOAA 1VQ1A 2R0IA 2LVQD 2K0BX 3BBZA 2BWEA 1G41A 2QSFX 1VEJA 1WIVA 1G4AE 2JY8A 2ZTCA 1DO2A 2EKFA 1PGYA 2CWBA 4WP2A 2JY6B 2B3TA 1WGNA 3IECA 2MR9A 2DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBC A;  1HJP A;  1OTR A;  1BVS A;  4F2L A;  1WJ7 A;  2EKK A;  1F4I A;  2HAK A;  1HT2 E;  2DAM A;  1KYI A;  3E21 A;  4DBG B;  1JR3 E;  2G3Q A;  2DAG A;  1TR8 A;  3LCU A;  2EJS A;  4GEW A;  3GLG E;  1ZV1 A;  1C7Y A;  1NV8 A;  3LCV B;  2LTU A;  1WGL A;  3GLH E;  2L4F A;  4UN2 B;  1ZMW A;  3GLI E;  2QHO B;  1DV0 A;  2H5X A;  2JY7 A;  1OAI A;  2KNV A;  2MJ5 B;  2HWJ A;  3B89 A;  1VG5 A;  1T6O A;  1UFZ A;  1TTE A;  2LVA A;  3IHP A;  2JZ0 A;  2DHY A;  3FE3 A;  3FRH A;  1IXS A;  3H4J A;  1MN3 A;  2JZ1 A;  2LVN C;  4G3O A;  1E94 E;  2JP7 A;  1R4G A;  1CUK A;  1V92 A;  2CP8 A;  3GLF E;  2JY5 A;  1IFY A;  4R71 A;  1EFU B;  1Q02 A;  2MRO B;  5DFL A;  3T6P A;  1HQY E;  3MMP A;  1VDL A;  2LVO C;  1G3I A;  1AIP C;  2DKL A;  1T43 A;  2KNA A;  1IM2 A;  1NV9 A;  1VEK A;  2DI0 A;  2K9D A;  2L2D A;  3F92 A;  2RRU A;  1DO0 A;  1A5T A;  2QNJ A;  2OO9 A;  1YLA A;  2DEN A;  2JNH A;  2DAI A;  2KHH A;  2BWB A;  1WR1 B;  1XB2 B;  1ZMV A;  2WZJ A;  1QZE A;  1ZMU A;  3K9P A;  2OOB A;  1SG9 A;  2DNA A;  4Q7J A;  3E46 A;  1OKS A;  2KNZ A;  4HEO A;  1P3Q Q;  1XXH E;  1HT1 E;  2ZTD A;  2L4E A;  1VEG A;  5JI2 E;  2JUJ A;  2MGW A;  2DAK A;  1GO5 A;  4F1I A;  2DZL A;  1OQY A;  3FRI A;  3K9O A;  1WHC A;  1Y8G A;  2LVP C;  2O25 A;  2OOA A;  1VQ1 A;  2R0I A;  2LVQ D;  2K0B X;  3BBZ A;  2BWE A;  1G41 A;  2QSF X;  1VEJ A;  1WIV A;  1G4A E;  2JY8 A;  2ZTC A;  1DO2 A;  2EKF A;  1PGY A;  2CWB A;  4WP2 A;  2JY6 B;  2B3T A;  1WGN A;  3IEC A;  2MR9 A;  2DAE A; 
#chains in the Genus database with same CATH topology
 1NHG C;  4TUW A;  3SAT A;  3LW5 F;  4NSO B;  1I94 M;  1WJ7 A;  4AQY M;  2F5S A;  3HU2 A;  2CV0 A;  4CGY B;  3T1H M;  4P16 A;  4DBG B;  1R2Y A;  1JR3 E;  2CHG A;  4MGY E;  3KOZ E;  1OFI A;  4LG2 A;  3C58 A;  4AKG A;  1HQC A;  2DAG A;  3LCU A;  2EJS A;  3FD9 A;  3GLG E;  3U6Q A;  3SFZ A;  1PRB A;  1IBK M;  2D7E A;  3DOA A;  1G59 A;  1C7Y A;  4DR4 M;  2QQ8 A;  3FUV A;  2LTU A;  2ZAM A;  2YNM D;  3KP1 E;  2C99 A;  3HY5 A;  3GLI E;  4LF6 M;  3TWL A;  3DFZ A;  4LF7 M;  4JN6 A;  2MJ5 B;  1N78 A;  1NY5 A;  3PNV A;  3CTW B;  3SHG B;  3J7A S;  1T6O A;  4KO8 A;  3TL4 X;  1DGH A;  1TH3 A;  4Z6Y A;  3UK6 A;  2JZ0 A;  1GAB A;  3SAR A;  3I4Y A;  4GC5 A;  5LMU M;  2LNH C;  4G4O A;  2J7O A;  3H4J A;  2QPA A;  2YR0 A;  3U61 A;  2JZ1 A;  2KDL A;  1OFH A;  3GQ5 A;  5EXP A;  3R8F A;  3GPY A;  1OIP A;  2C98 A;  2JP7 A;  4ANR A;  1R4G A;  1CUK A;  2R62 A;  3CF6 E;  4FWG A;  3GLF E;  1J5E M;  2R44 A;  1IN7 A;  2NQ8 C;  3AOG A;  1G71 A;  3HX3 A;  3HHX A;  3KOW E;  2W82 A;  2XH9 A;  4NXN M;  2VF8 A;  2C9C A;  2VQF M;  2AHM A;  1K3W A;  3KP0 E;  4AKI A;  1L8Q A;  1D2N A;  3LQQ A;  2G5G X;  3T6P A;  2KZU A;  1VDL A;  4LJ8 A;  1S3S A;  4FD2 A;  3KSX A;  4JI3 M;  2F4V M;  2CE7 A;  3HHW A;  4DV6 M;  2KNA A;  1NV9 A;  2KA6 B;  1VEK A;  2DI0 A;  2K9D A;  2MH8 A;  3GRR A;  3HHY A;  1XXH A;  4FCW A;  3HU1 A;  3LQR A;  3VKH A;  2Y20 A;  3SYL A;  3J80 S;  2JNH A;  1IN8 A;  2X8A A;  1IXR C;  3NWL A;  3NBX X;  4DV0 M;  4KOD A;  4MGZ E;  3AV0 A;  1IY0 A;  1QVR A;  4B08 A;  2DXI A;  1GL6 A;  1DGH B;  1TF0 B;  3L2A A;  4I4L A;  1IXZ A;  3EIH A;  3ZQJ A;  4DR3 M;  4R3D A;  2DNA A;  4GMQ A;  3UMM A;  2QP9 X;  3E46 A;  1OKS A;  2KNZ A;  4HEO A;  4FCV A;  2LHG A;  3A98 B;  2VDB B;  1GKI A;  1Q39 A;  1QUT A;  4GC9 A;  4BLC A;  7CAT A;  1HR0 M;  2CV2 A;  4KHP M;  1IBM M;  1TGU A;  1HNZ M;  1VEG A;  4LZZ A;  2C9O A;  3A46 A;  1GJS A;  2Z4R A;  4IBD A;  1K82 A;  3DZD A;  1D0M A;  4M9S A;  1NVM A;  4PDI A;  2Z4S A;  2C5R A;  1MU5 A;  2DZN B;  1GVN A;  1WHC A;  1YE9 A;  2FS1 A;  2LVP C;  2HKJ A;  2R6F A;  2OOA A;  2R0I A;  2Y21 A;  3I01 M;  2LVQ D;  3I04 M;  3B9P A;  3NBI A;  3H4M A;  2HCB A;  4P17 A;  1N33 M;  2FOI C;  4NOO B;  4PCZ A;  3B7Q A;  4MH0 E;  1ZQ9 A;  1L2C A;  2ZTC A;  4OX9 M;  2WSF F;  2R18 A;  1DGG A;  1NHW C;  1NNJ A;  5GKN A;  2LHC A;  3B7N A;  2B3T A;  2BNK A;  3L26 A;  3AJI B;  1TDH A;  4S12 A;  4I81 A;  2GNO A;  3GRV A;  3FTE A;  3SBJ A;  1HJP A;  1BVS A;  4AKH A;  4F2L A;  1SXJ D;  3VK8 A;  2L7H A;  2OQ4 A;  2FNA A;  4XBO A;  1KYI A;  3E21 A;  5EP1 A;  3VFD A;  5IWA M;  5ITQ A;  3UJN A;  4LF5 M;  4AZF A;  3D8L A;  4DUY M;  4DV3 M;  1C1K A;  3BOS A;  4JI7 M;  2APL A;  1IQP A;  1GJT A;  4MGI E;  2M5Z A;  1HNW M;  4LJ7 A;  3KS4 A;  3LCV B;  1WGL A;  5IRE B;  4OVZ A;  2RGO A;  3J2P B;  1ZMW A;  4JI4 M;  4R7G A;  1DV0 A;  2H5X A;  4FW9 A;  2RKO A;  5FTM A;  2JY7 A;  4IBF A;  1Z6T A;  4IBG A;  4AG5 A;  2CFO A;  1R2Z A;  4PDG A;  3KVW A;  3GLH A;  2DWM A;  3CF0 A;  3GRY A;  2WSC F;  3IHP A;  5ITX A;  3GPU A;  2QEN A;  4DUZ M;  2Z3X A;  2XFT A;  2Z8Y M;  4B3S M;  2LVN C;  3MK6 A;  4GIT A;  2F5O A;  3FYC A;  3MJ5 A;  4M9X A;  3U6S A;  1OJL A;  4Z8X A;  1TH4 A;  3AFH A;  1JR3 D;  4KLN A;  4X66 M;  2R4E A;  1NY6 A;  4JYA M;  1QZM A;  2JY5 A;  2K6B A;  4QOS A;  5ITT A;  4CHT B;  4NRW A;  1Q02 A;  2FE8 A;  2XLJ A;  2RGH A;  5DFL A;  3AL0 C;  2EA0 A;  1KSF X;  1H6U A;  1R5L A;  5ITR A;  3DA1 A;  2X49 A;  2DKL A;  3W68 A;  4GKK M;  1J7K A;  2XSZ D;  4D80 A;  5C1B A;  4LJ4 A;  4DV7 M;  2XGN A;  2CUZ A;  3AKZ A;  4IJE A;  2L2D A;  1D0L A;  1A5T A;  3KOX E;  3B7Z A;  2QNJ A;  2OO9 A;  4LGY A;  4WUR A;  1SXJ A;  3LMM A;  2DAI A;  4LF4 M;  3SHF A;  1QDT A;  4LZJ A;  4YY3 M;  3KOY E;  5KPR A;  2DZO B;  1XWI A;  1QZE A;  2QBY A;  1L2D A;  3GLH B;  3K9P A;  3VLF B;  1SG9 A;  4PD2 A;  5BR8 M;  3TQS A;  1XMO M;  3KSJ A;  1LTM A;  4IBK A;  3ZCB B;  4BB9 A;  5C18 A;  4AI6 A;  4LJA A;  2VF7 A;  1J09 A;  1P3Q Q;  3RGS A;  3M6A A;  2YFQ A;  2LWX A;  3BXW A;  3HJS A;  4FWD A;  1HT1 E;  2QZ4 A;  4GRI A;  5DYG A;  3SMS A;  1G8P A;  2P5T A;  2XFS A;  2VII A;  1DGF A;  2MGW A;  3ZH9 B;  3GRU A;  2Y0Q A;  4F1I A;  3L25 A;  4D81 A;  1E32 A;  1Z59 A;  5KPZ A;  3K9O A;  3WHL A;  1Y8G A;  2M60 A;  4IBI A;  2H1R A;  2J7N A;  3HZJ A;  1QAO A;  4NSR A;  3L29 A;  1IY1 A;  3Q8X A;  3QAU A;  2LH0 A;  3U5Z A;  1JR3 A;  5EJC A;  1G41 A;  4NRV A;  2UUB M;  1N36 M;  2XEP A;  1DO2 A;  1V33 A;  5ITU A;  1EE8 A;  1QAQ A;  1VDD A;  4WP2 A;  4YHH M;  1UM8 A;  2JY6 B;  3W67 A;  1YUB A;  3U6D A;  3IEC A;  3U61 B;  5EP4 A;  3GLI A;  3FKE A;  5FTN A;  2I7P A;  2HL7 A;  4FWH A;  1TDZ A;  2ZAN A;  4G4Q A;  1QAM A;  2DWZ B;  8CAT A;  2F5N A;  2O5R A;  2EKK A;  1F4I A;  4LJ6 A;  3KXE C;  4A3V B;  2GQF A;  2Q2E B;  2R65 A;  1L2B A;  2V1U A;  2KEB A;  2UXD M;  4IIW A;  1QYR A;  2K47 A;  4HL4 A;  4RF1 A;  1OIZ A;  1YSY A;  3GP1 A;  4GEW A;  2UUA M;  3KFU G;  2ZBK B;  3SMP A;  4L6V 6;  1FNN A;  1NV8 A;  4LRT A;  3GLH E;  4DV5 M;  3K1J A;  2C96 A;  2I7N A;  2L4F A;  4JI1 M;  1Q3C A;  5EXX A;  2N35 A;  3ILK A;  3MHV C;  1D0K A;  4OU7 A;  3EIE A;  4WW0 A;  4DR6 M;  1OAI A;  2KNV A;  4XK8 F;  3K2L A;  4DR2 M;  3LVW A;  3SC3 A;  1VG5 A;  4MGH A;  1MJG M;  3JAM S;  1XXH B;  1UFZ A;  3FTD A;  2OPF A;  2LVA A;  3GQ3 A;  3SAS A;  2ZM6 M;  4II7 A;  3FE3 A;  3FRH A;  2KRU A;  5EP3 A;  5KQD A;  3SAW A;  1IXS A;  3U5Z B;  1ZAE A;  5DYI A;  5FTL A;  2XF3 A;  5E26 A;  1E94 E;  3HU3 A;  4EIW A;  1AUA A;  1NJF A;  4JI8 M;  3KW6 A;  1V92 A;  4LF9 M;  1PJI A;  3K92 A;  4LGM A;  2R45 A;  3U6E A;  2ERC A;  4X64 M;  3Q8G A;  1JB0 F;  4GHA A;  1IN6 A;  1EFU B;  3U60 A;  2UU9 M;  3HKP A;  3VDU A;  3KS8 A;  4NL4 H;  4GH9 A;  3VK7 A;  1I4W A;  4NC6 A;  5FLX S;  1HQY E;  3MMP A;  1QDR A;  2LVO C;  2O01 F;  4L78 A;  4B3R M;  2UXC M;  1HNX M;  5EP2 A;  1AIP C;  2DWN A;  4DR5 M;  1T43 A;  4B3M M;  4QNM A;  4CJ6 A;  2UUC M;  1IM2 A;  3L27 A;  3CGW A;  1QAN A;  3HJQ A;  3U6P A;  3HWS A;  4K0K M;  2RRU A;  4B7F A;  3J7B A;  2EO2 A;  4OW0 A;  5LMN M;  2DEN A;  2JXN A;  4LFB M;  2KHH A;  2BWB A;  4LJ5 A;  4NXM M;  4RNA A;  1QUS A;  5FTJ A;  1XB2 B;  4LF8 M;  2WZJ A;  3L28 A;  4X65 M;  3J81 S;  1NSF A;  3CF2 A;  4PT5 A;  2OOB A;  3M7G A;  5BPV A;  3AOE A;  1MX0 A;  3GPP A;  4Q7J A;  2CHV A;  4JI2 M;  1IXS B;  1JQJ C;  2A5Y B;  4RKU F;  4DV4 M;  1XXH E;  1SXJ C;  5DNY A;  5EXT A;  4DR1 M;  3GQ4 A;  2ZTD A;  3I51 A;  2L4E A;  3FTF A;  2J5Y A;  3E4R A;  5JI2 E;  5KQ8 A;  2JUJ A;  2KZS A;  3FUX A;  4IBB A;  3UGJ A;  2DAK A;  3SAU A;  1GO5 A;  3C3E A;  2XZU A;  4GIP A;  3PXG A;  1XHB A;  3A42 A;  1OQY A;  3JR4 A;  3T1Y M;  3FRI A;  4OVZ B;  5FTK A;  3U60 B;  2F5P A;  2XZF A;  1RU3 A;  4GHL A;  2O25 A;  1VQ1 A;  1T3T A;  3I4V A;  3PVS A;  2K0B X;  2ZAO A;  1IN4 A;  2JWS A;  1W5S A;  3BBZ A;  4X62 M;  4MB7 A;  2BJV A;  2BWE A;  2DWL A;  2QSF X;  2V1C A;  1VEJ A;  2JY8 A;  1PGY A;  1PJS A;  1L1Z A;  1IY2 A;  3R9X B;  3T38 A;  2UXB M;  3J27 B;  5EXS A;  1WGN A;  3WHK A;  3JR5 A;  4ITQ A;  2LXE A;  3B74 A;  2V6Z M;  1PJJ A;  3LVV A;  2LBC A;  3TPZ A;  1OTR A;  3FTC A;  4B7H A;  2R46 A;  4FCT A;  2HAK A;  1XNQ M;  1HT2 E;  3U6M A;  2DAM A;  3D8B A;  3W0L B;  4HLQ A;  1PM5 A;  4IBC A;  2G3Q A;  2Y0T A;  3QYE A;  1TR8 A;  1N32 M;  1ZV1 A;  4L15 A;  1FJG M;  4GKJ M;  4G4R A;  3TWK A;  2X4A A;  4UN2 B;  4JI0 M;  4CIS A;  1K3X A;  2QHO B;  4LCB A;  2DVW B;  2L7I A;  1IBL M;  4ZPX A;  2WSE F;  4KT0 F;  5FSW A;  3GLG A;  2G8L A;  2HWJ A;  3B89 A;  2CV1 A;  3OTO M;  2F5Q A;  1R6B X;  2KXE A;  1IN5 A;  1TTE A;  1GL7 A;  2BJW A;  2DHY A;  3KDS E;  1EIJ A;  1SXJ B;  4L16 A;  4REZ A;  3C3D A;  2YQZ A;  3E9S A;  4I8O A;  4Y28 F;  1E9R A;  1MN3 A;  1N34 M;  1WXQ A;  4G3O A;  2QBY B;  3FUU A;  4M0D A;  2XSZ A;  3TE6 A;  3V76 A;  2FH0 A;  4FVM A;  3SAV A;  2CP8 A;  2FFJ A;  5IZ7 D;  4DV1 M;  1LV7 A;  1IFY A;  1XC8 A;  4R71 A;  2CHQ A;  3U6O A;  4M9Z A;  1NNU C;  4AG6 A;  1Z5C A;  5ITX E;  5EQT A;  2MRO B;  4D82 A;  4LJ9 A;  1QQW A;  1V34 A;  4IBJ A;  4QHS A;  4LFA M;  4DV2 M;  2L6O A;  1Z5A A;  2D7H A;  3GLF A;  1W5T A;  1G3I A;  3FYD A;  5IT9 S;  3M0E A;  4IJF A;  1L1T A;  2VQE M;  3A45 A;  4LFC M;  5E6J A;  1NO1 A;  3IG8 A;  1TH2 A;  3F92 A;  4XGI A;  5JI3 E;  5ITY A;  5F3W A;  1DO0 A;  5H37 D;  1PJQ A;  4M0W A;  5KO3 A;  3RGP A;  1YLA A;  1OAO C;  3GPX A;  2L09 A;  3W0F A;  3C9P A;  3SYK A;  1R7R A;  5A2Q S;  3HHZ A;  1WR1 B;  3GLG B;  1ZMV A;  3UZU A;  4JI5 M;  5KPT A;  3K8Z A;  1ZMU A;  4LY6 A;  1DGB A;  1XNR M;  2R4J A;  3GLI B;  2KRK A;  3VKG A;  4QNR A;  2CRU A;  1X37 A;  3FUT A;  4G4N A;  1PJT A;  3PFI A;  1GLN A;  4LRS A;  4MM3 B;  3RFW A;  5L8R F;  1XMQ M;  2DHR A;  1SXJ E;  4B3T M;  1Q3B A;  3QYB A;  4L4U A;  3PNY A;  3RE8 A;  4B7G A;  4L8R C;  3FUW A;  4IBE A;  2KW0 A;  3ZC7 B;  2JA2 A;  2EUC A;  3THG A;  2DZL A;  3AOE C;  1NJG A;  3GO8 A;  2QCU A;  4CIZ A;  4QOZ C;  3VDP A;  2Z7J A;  4DR7 M;  2D7G A;  3HGI A;  3U6C A;  4JV5 M;  3HJ8 A;  2HHH M;  4JXJ A;  2E5L M;  2CEA A;  4BBA A;  3GLF B;  1KFV A;  1E9S A;  4RF0 A;  1WIV A;  1G4A E;  4I5S A;  3T15 A;  1N75 A;  3TWM A;  2EKF A;  1ORY B;  2CWB A;  1N77 A;  4W5W A;  1Z5B A;  3IG5 A;  4MGK E;  4G6Z A;  3U6L A;  2MR9 A;  4QHT A;  2DAE A;  4AW4 A;  3QWL A;  4JI6 M; 
#chains in the Genus database with same CATH homology
 2LBC A;  1HJP A;  1OTR A;  1BVS A;  4F2L A;  1WJ7 A;  2EKK A;  1F4I A;  2HAK A;  1HT2 E;  2DAM A;  1KYI A;  3E21 A;  4DBG B;  1JR3 E;  2G3Q A;  2DAG A;  1TR8 A;  3LCU A;  2EJS A;  4GEW A;  3GLG E;  1ZV1 A;  1C7Y A;  1NV8 A;  3LCV B;  2LTU A;  1WGL A;  3GLH E;  2L4F A;  4UN2 B;  1ZMW A;  3GLI E;  2QHO B;  1DV0 A;  2H5X A;  2JY7 A;  1OAI A;  2KNV A;  2MJ5 B;  2HWJ A;  3B89 A;  1VG5 A;  1T6O A;  1UFZ A;  1TTE A;  2LVA A;  3IHP A;  2JZ0 A;  2DHY A;  3FE3 A;  3FRH A;  1IXS A;  3H4J A;  1MN3 A;  2JZ1 A;  2LVN C;  4G3O A;  1E94 E;  2JP7 A;  1R4G A;  1CUK A;  1V92 A;  2CP8 A;  3GLF E;  2JY5 A;  1IFY A;  4R71 A;  1EFU B;  1Q02 A;  2MRO B;  5DFL A;  3T6P A;  1HQY E;  3MMP A;  1VDL A;  2LVO C;  1G3I A;  1AIP C;  2DKL A;  1T43 A;  2KNA A;  1IM2 A;  1NV9 A;  1VEK A;  2DI0 A;  2K9D A;  2L2D A;  3F92 A;  2RRU A;  1DO0 A;  1A5T A;  2QNJ A;  2OO9 A;  1YLA A;  2DEN A;  2JNH A;  2DAI A;  2KHH A;  2BWB A;  1WR1 B;  1XB2 B;  1ZMV A;  2WZJ A;  1QZE A;  1ZMU A;  3K9P A;  2OOB A;  1SG9 A;  2DNA A;  4Q7J A;  3E46 A;  1OKS A;  2KNZ A;  4HEO A;  1P3Q Q;  1XXH E;  1HT1 E;  2ZTD A;  2L4E A;  1VEG A;  5JI2 E;  2JUJ A;  2MGW A;  2DAK A;  1GO5 A;  4F1I A;  2DZL A;  1OQY A;  3FRI A;  3K9O A;  1WHC A;  1Y8G A;  2LVP C;  2O25 A;  2OOA A;  1VQ1 A;  2R0I A;  2LVQ D;  2K0B X;  3BBZ A;  2BWE A;  1G41 A;  2QSF X;  1VEJ A;  1WIV A;  1G4A E;  2JY8 A;  2ZTC A;  1DO2 A;  2EKF A;  1PGY A;  2CWB A;  4WP2 A;  2JY6 B;  2B3T A;  1WGN A;  3IEC A;  2MR9 A;  2DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...