2G3QA

Solution structure of ede1 uba-ubiquitin complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
43
structure length
43
Chain Sequence
TTPKSLAVEELSGMGFTEEEAHNALEKCNWDLEAATNFLLDSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein YBL047C
publication title Structural Basis for Monoubiquitin Recognition by the Ede1 UBA Domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/signaling protein
total genus 12
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2g3qA00
2LBCA 2K0BX 1TTEA 3K9OA 1VEKA 3LCUA 2KNAA 2DAEA 2HWJA 2JZ1A 2O25A 3BBZA 1IXSA 1NV8A 1ZMWA 1AIPC 1YLAA 1WIVA 2OO9A 2LTUA 2CP8A 2B3TA 2EJSA 2K9DA 4UN2B 2DAMA 1KYIA 3B89A 3LCVB 2CWBA 2JP7A 1Y8GA 4G3OA 2EKFA 2DENA 1WGLA 1TR8A 1ZMVA 2LVPC 3F92A 3FRHA 2JZ0A 1HJPA 2ZTDA 1EFUB 1MN3A 1QZEA 2KHHA 2LVNC 3E21A 1VDLA 4GEWA 1OQYA 2DAGA 2BWBA 4WP2A 1PGYA 2JUJA 2KNVA 1DO0A 1C7YA 1HQYE 2DI0A 2OOBA 2R0IA 5JI2E 4Q7JA 1OAIA 1G4AE 2MR9A 1A5TA 1CUKA 1G41A 1DV0A 2H5XA 1IM2A 3T6PA 1NV9A 2DZLA 1WHCA 2L4EA 1VG5A 2LVOC 3MMPA 1SG9A 2EKKA 1R4GA 2QNJA 3FRIA 1BVSA 1ZV1A 1IFYA 2G3QA 4R71A 4DBGB 1WR1B 1JR3E 1XB2B 2L2DA 3IHPA 2L4FA 4F2LA 1WGNA 1OKSA 1T6OA 2MJ5B 2LVAA 1P3QQ 3GLFE 3IECA 2WZJA 2RRUA 2JY7A 3GLGE 2QHOB 1OTRA 2LVQD 2JNHA 1UFZA 2OOAA 1GO5A 1ZMUA 2HAKA 2DNAA 1VEJA 4F1IA 4HEOA 2DKLA 1XXHE 3GLHE 1DO2A 3GLIE 2DAIA 3E46A 1F4IA 2BWEA 1WJ7A 2DHYA 1V92A 2QSFX 1G3IA 1HT1E 2ZTCA 2JY6B 1HT2E 3K9PA 1VQ1A 3H4JA 1E94E 2KNZA 2JY5A 5DFLA 2MGWA 3FE3A 1Q02A 2JY8A 1T43A 2DAKA 2MROB 1VEGA
chains in the Genus database with same CATH superfamily
3K9OA 2QQ8A 1TTEA 2ZAMA 4GRIA 4QNRA 4QOSA 5H37D 3UMMA 5LMNM 2XZFA 1PM5A 3U60A 3DFZA 2JZ1A 3PNYA 4Z8XA 3FTDA 1NV8A 1SXJD 1JR3D 2KXEA 2DWNA 4FCWA 4JI4M 3SHFA 3L2AA 3TWKA 3U6MA 2R62A 3W68A 1QDTA 3GRYA 4JI2M 4NXMM 3QWLA 3L29A 2K9DA 2DWMA 4CISA 2UUCM 2CE7A 3HY5A 5KQ8A 3J7AS 2Z8YM 4FWDA 3B89A 4GC9A 4LF5M 2F5PA 4IBJA 1R6BX 4DV3M 3ZQJA 3J2PB 2C9OA 1NSFA 4S12A 5KQDA 3VDPA 2K6BA 2GNOA 1IXSB 1MX0A 2JZ0A 3KOWE 4L6V6 2AHMA 3HU2A 3LVVA 2ZTDA 1QYRA 2HCBA 4PDIA 3J81S 3U6QA 3W0FA 3JAMS 3GLGB 3GPXA 1QVRA 4DV0M 4DV6M 1H6UA 2CHVA 1J7KA 2F5NA 1QZEA 2P5TA 3UK6A 2KHHA 1FJGM 4LZJA 3T1YM 2VQFM 1NNJA 3HJSA 3ZCBB 3FUWA 4MGHA 2V1CA 4NOOB 2UUBM 1N33M 4WURA 3GPUA 4KT0F 1XXHB 2RKOA 3GLIB 4LFAM 3GPYA 2JUJA 1R7RA 2JWSA 2KNVA 2KW0A 3SARA 2L7HA 4PT5A 1OFIA 3KOXE 4NSRA 4MM3B 2DI0A 1IN5A 5L8RF 4IBGA 3HU3A 4NXNM 1G4AE 2ZBKB 4GMQA 4B7GA 1G8PA 3FUTA 4FW9A 2LXEA 4DR6M 1IN6A 3AOGA 1VG5A 3E9SA 3KOZE 4REZA 4CJ6A 2O01F 2QNJA 4JI0M 3M0EA 1HNXM 2C99A 3K8ZA 5BPVA 5LMUM 2YNMD 4L15A 2ERCA 1SXJE 1JR3E 1WR1B 2L2DA 2R46A 3NWLA 4Y28F 3GRVA 4DV5M 1EE8A 1VDDA 1TH2A 2RGOA 1Q3BA 1GABA 3GRUA 4AG5A 3CF2A 4A3VB 3W0LB 1J5EM 1N78A 4KLNA 5JI3E 4DR5M 1Q3CA 2KZUA 2LVQD 2M5ZA 3FTFA 1YE9A 1DGGA 1YSYA 2OOAA 1QUSA 2KZSA 2HHHM 2GQFA 3LQQA 1QUTA 2DZNB 4GITA 4LJ7A 4NSOB 3T15A 4RNAA 4F1IA 2KRKA 1Z5AA 3SC3A 2X8AA 3E46A 3HGIA 2LH0A 2HL7A 3I04M 3KSJA 4CGYB 1PJJA 1KFVA 3U5ZA 2APLA 4G4OA 2FH0A 3EIEA 2F5QA 1XNRM 1XHBA 5ITUA 2OQ4A 4B3TM 3Q8GA 4DV4M 1TGUA 3KXEC 4FCTA 4JN6A 2W82A 4EIWA 3VKHA 3CF0A 3HHYA 2JY5A 3HZJA 5DFLA 3U60B 4JYAM 1L2DA 4DR1M 4R7GA 1VEGA 1ZQ9A 3LCUA 1NJGA 4LF6M 1ZAEA 4AZFA 5EP4A 4ITQA 3UGJA 2O25A 3GLFA 3ZC7B 1ORYB 4MGZE 2O5RA 1AIPC 2OO9A 4M0WA 2LTUA 1GVNA 1Q39A 2C5RA 2ZANA 2K47A 3U6SA 2B3TA 1PJSA 3T38A 1G59A 3U6CA 1XMQM 1LTMA 2QBYB 4IIWA 3AKZA 2DAMA 3C58A 4LRTA 2LHGA 4QNMA 1HNWM 4LF9M 2R65A 1W5SA 2ZAOA 3HHXA 3HX3A 4IJEA 4G3OA 2EKFA 1DGHA 4OVZB 2L7IA 2QENA 2R18A 3B7NA 3L25A 2EUCA 1K3WA 2VDBB 1ZMVA 1E32A 3F92A 4FD2A 3TWLA 3FRHA 3KP1E 1SXJA 1JR3A 1HNZM 1GL7A 4YHHM 1EFUB 5ITQA 4DR7M 3AOEA 3M7GA 2QCUA 2VQEM 3I51A 3KSXA 4IBCA 3U6LA 2L6OA 3E21A 4FCVA 4K0KM 3H4MA 2J7OA 1I4WA 4GEWA 1D2NA 2C96A 4MGKE 1G71A 2DAGA 1QANA 4I8OA 1L2BA 1PJQA 4X62M 4JI8M 4XGIA 1KSFX 2UXBM 1C7YA 4X66M 3HJ8A 3TWMA 3VDUA 5JI2E 3W67A 2BNKA 2Z3XA 2MR9A 2WSEF 3Q8XA 1NHWC 4I5SA 3PXGA 4B3MM 2QZ4A 1D0MA 1LV7A 4LJ5A 2CFOA 3UJNA 4GKKM 3LQRA 5A2QS 2LVOC 1QQWA 3KOYE 3KP0E 2DHRA 3CGWA 3QAUA 1R4GA 4HL4A 4LJ6A 1BVSA 1ZV1A 4B08A 1XWIA 4R71A 4CIZA 3AFHA 2Q2EB 3SMSA 1IY2A 5IREB 1WXQA 3SATA 3CF6E 1OKSA 3IG8A 2H1RA 1XC8A 4NRVA 2LVAA 4L78A 3C3EA 3R9XB 3UZUA 3GLFE 1IXRC 4LGMA 3U61A 4PDGA 4XBOA 4JV5M 1OTRA 4I81A 2JNHA 5EXTA 3KFUG 1QAQA 1K82A 2JXNA 1GO5A 3D8LA 3SYKA 2XLJA 4FWGA 3U5ZB 4G6ZA 3R8FA 2HAKA 4JI5M 2DXIA 3RFWA 3FYDA 2DKLA 3GLHE 1N34M 1IXZA 1DO2A 2FFJA 2DAIA 3MHVC 1QDRA 3KS4A 5C18A 1PJIA 4NRWA 4LCBA 3OTOM 4M9SA 1HR0M 2C9CA 1IY1A 2XEPA 3U6EA 5EQTA 2JY6B 3SFZA 3AJIB 3HHZA 4HLQA 3K9PA 4B3SM 2D7EA 3VK8A 3GO8A 4NC6A 3PNVA 1Q02A 2JY8A 4WW0A 3IG5A 3SAVA 3A98B 4LFBM 2XF3A 5GKNA 4L8RC 5EP1A 4QHSA 1NNUC 2LBCA 2K0BX 3WHKA 1NY6A 2R4JA 2XZUA 3B7QA 4LF7M 4M9ZA 1IN7A 1IXSA 3C3DA 4RF0A 5BR8M 1QAMA 1OIZA 3BXWA 1YUBA 2YQZA 1DGFA 1DGHB 4LFCM 2CP8A 1XMOM 3V76A 2CHGA 1IN4A 1GL6A 2DVWB 5E26A 3FTEA 4AKIA 2CV0A 5EXPA 2WSCF 4RF1A 1KYIA 2FNAA 1SXJB 2J7NA 3TPZA 4LG2A 2XSZD 2CWBA 2JP7A 1Y8GA 1C1KA 2DENA 1XXHA 1OIPA 2D7HA 4W5WA 4II7A 4PCZA 4LF4M 3U6OA 2CUZA 2KA6B 3AL0C 3K1JA 1HJPA 4D81A 2VF7A 5FSWA 3J80S 1TH4A 4GHAA 2EA0A 2EO2A 4AI6A 4R3DA 2KRUA 3VFDA 4IBDA 4LJAA 1D0LA 4L16A 4OU7A 4LF8M 4AW4A 1D0KA 1VDLA 3FTCA 4BLCA 1NO1A 1OQYA 3VK7A 3SHGB 2M60A 4M9XA 5ITTA 4WP2A 5IT9S 3E4RA 2JA2A 2Y0QA 4FVMA 3RGPA 5EJCA 1L1TA 3HWSA 2QPAA 4GC5A 4CHTB 4GIPA 2R0IA 3JR4A 2DWLA 4LJ4A 1OJLA 3GLHA 3LW5F 3FUVA 4LJ8A 1CUKA 4LJ9A 1G41A 2NQ8C 5ITRA 2DWZB 3I4YA 3T6PA 1EIJA 2FOIC 5FTLA 2DZLA 1GLNA 1R5LA 1WHCA 2MH8A 2Z4SA 4D82A 3U6PA 3NBXX 1S3SA 2L09A 1PRBA 2EKKA 4OW0A 2R4EA 3GRRA 4MB7A 4G4NA 4KHPM 2G3QA 2QP9X 4DBGB 4LZZA 3HKPA 2XGNA 1TH3A 5EP3A 1XB2B 2DZOB 2L4FA 2D7GA 5EXSA 3U61B 3SAWA 1TDZA 1T6OA 2KDLA 2MJ5B 4JI6M 3B7ZA 1R2ZA 5DYIA 4IBEA 2CV2A 4FWHA 3J7BA 3AV0A 3SMPA 4MH0E 3GQ3A 4DR2M 1L2CA 2WZJA 2RRUA 2UXDM 4AKHA 3VLFB 2JY7A 1DGBA 4JXJA 4BB9A 3PVSA 4GH9A 3C9PA 5KO3A 3GLGE 2XH9A 1K3XA 2RGHA 3L26A 1N77A 2F4VM 3L27A 1IQPA 1V33A 3TE6A 2X49A 3WHLA 5ITXA 4G4RA 1N36M 4GKJM 4DR4M 3LMMA 5IZ7D 1OFHA 2YFQA 4YY3M 2R45A 2N35A 4AKGA 2Y21A 4HEOA 1XXHE 3I4VA 3GLIE 3D8BA 1GJTA 3TQSA 1MU5A 4IBIA 4DUYM 4QOZC 7CATA 2LWXA 4OX9M 1L8QA 1WJ7A 1I94M 3DOAA 4X65M 4JI7M 5C1BA 2QSFX 2F5OA 2ZTCA 3JR5A 4TUWA 1HT2E 1NHGC 2BJVA 2I7NA 4DR3M 1VQ1A 3KVWA 4JI3M 4KODA 2KNZA 2R44A 2QBYA 1MJGM 2MGWA 1Z5CA 3FE3A 3NBIA 4Z6YA 4ZPXA 1T43A 3J27B 5KPTA 4DV1M 1W5TA 2MROB 4IBBA 1IBMM 4OVZA 5FTMA 1UM8A 1VEKA 2A5YB 2KNAA 3TL4X 1R2YA 2DAEA 3DZDA 4QHTA 2HWJA 2KEBA 3BBZA 1PJTA 3A42A 1ZMWA 5KPZA 2VF8A 1YLAA 1WIVA 5FTJA 5FTKA 1N32M 4P16A 4P17A 1AUAA 3FD9A 2F5SA 1JQJC 2EJSA 1SXJC 4JI1M 3BOSA 4UN2B 1J09A 2VIIA 3CTWB 3HHWA 2ZM6M 3AOEC 2E5LM 3LCVB 3MK6A 3KDSE 5EXXA 3L28A 2I7PA 2LHCA 5FLXS 1GJSA 1WGLA 2XFTA 1TR8A 2LVPC 4IBKA 3GLFB 3B74A 4IBFA 3GPPA 4PD2A 3VKGA 3GP1A 2X4AA 1N75A 1MN3A 8CATA 1L1ZA 4DUZM 4NL4H 3GQ5A 2LVNC 2CV1A 1GKIA 2FS1A 2J5YA 1XNQM 3GLGA 3MJ5A 1T3TA 1NY5A 2XSZA 4L4UA 5E6JA 5EP2A 2BWBA 4RKUF 4IJFA 3GLHB 5ITXE 1PGYA 4KO8A 4GHLA 3B9PA 2UU9M 1DO0A 2YR0A 3ILKA 3U6DA 1HQYE 2OOBA 4AQYM 2CEAA 1IN8A 4Q7JA 1OAIA 4B3RM 1IBKM 3GLIA 1A5TA 1IY0A 1DV0A 2H5XA 1IM2A 2XFSA 4I4LA 3ZH9B 5DNYA 2OPFA 2V1UA 3SASA 1E9SA 1NV9A 2R6FA 3RE8A 2L4EA 2WSFF 3A46A 5ITYA 3LVWA 3MMPA 1SG9A 1NVMA 1RU3A 2C98A 2V6ZM 2Z7JA 3FRIA 4B7HA 4X64M 1FNNA 1Z59A 1JB0F 4ANRA 1IFYA 1OAOC 1NJFA 1IBLM 3SBJA 3FUXA 1Z6TA 4LRSA 2BJWA 2UUAM 3IHPA 3I01M 4F2LA 2UXCM 1WGNA 2G8LA 3THGA 3GQ4A 5IWAM 5KPRA 2LNHC 1X37A 4DV7M 1HQCA 1P3QQ 2HKJA 3HU1A 3EIHA 3IECA 3PFIA 4BBAA 2Z4RA 3M6AA 3QYEA 3SAUA 3RGSA 4MGIE 2QHOB 3T1HM 4B7FA 1UFZA 4M0DA 4D80A 2G5GX 3FKEA 5F3WA 1ZMUA 4AG6A 3DA1A 3KS8A 2DNAA 1V34A 1VEJA 4LGYA 2FE8A 3HJQA 1QAOA 2CRUA 3FYCA 1F4IA 3FUUA 1TF0B 2BWEA 2Y0TA 1TDHA 2DHYA 3SYLA 1V92A 4G4QA 1G3IA 4DV2M 1HT1E 3KW6A 2Y20A 1QZMA 3A45A 5DYGA 1E9RA 3K2LA 3H4JA 4LY6A 4XK8F 5FTNA 1E94E 4MGYE 1Z5BA 2DAKA 3K92A 3QYBA 2CHQA
chains in the Genus database with same CATH topology
2LBCA 2K0BX 1TTEA 3K9OA 1VEKA 3LCUA 2KNAA 2DAEA 2HWJA 2JZ1A 2O25A 3BBZA 1IXSA 1NV8A 1ZMWA 1AIPC 1YLAA 1WIVA 2OO9A 2LTUA 2CP8A 2B3TA 2EJSA 2K9DA 4UN2B 2DAMA 1KYIA 3B89A 3LCVB 2CWBA 2JP7A 1Y8GA 4G3OA 2EKFA 2DENA 1WGLA 1TR8A 1ZMVA 2LVPC 3F92A 3FRHA 2JZ0A 1HJPA 2ZTDA 1EFUB 1MN3A 1QZEA 2KHHA 2LVNC 3E21A 1VDLA 4GEWA 1OQYA 2DAGA 2BWBA 4WP2A 1PGYA 2JUJA 2KNVA 1DO0A 1C7YA 1HQYE 2DI0A 2OOBA 2R0IA 5JI2E 4Q7JA 1OAIA 1G4AE 2MR9A 1A5TA 1CUKA 1G41A 1DV0A 2H5XA 1IM2A 3T6PA 1NV9A 2DZLA 1WHCA 2L4EA 1VG5A 2LVOC 3MMPA 1SG9A 2EKKA 1R4GA 2QNJA 3FRIA 1BVSA 1ZV1A 1IFYA 2G3QA 4R71A 4DBGB 1WR1B 1JR3E 1XB2B 2L2DA 3IHPA 2L4FA 4F2LA 1WGNA 1OKSA 1T6OA 2MJ5B 2LVAA 1P3QQ 3GLFE 3IECA 2WZJA 2RRUA 2JY7A 3GLGE 2QHOB 1OTRA 2LVQD 2JNHA 1UFZA 2OOAA 1GO5A 1ZMUA 2HAKA 2DNAA 1VEJA 4F1IA 4HEOA 2DKLA 1XXHE 3GLHE 1DO2A 3GLIE 2DAIA 3E46A 1F4IA 2BWEA 1WJ7A 2DHYA 1V92A 2QSFX 1G3IA 1HT1E 2ZTCA 2JY6B 1HT2E 3K9PA 1VQ1A 3H4JA 1E94E 2KNZA 2JY5A 5DFLA 2MGWA 3FE3A 1Q02A 2JY8A 1T43A 2DAKA 2MROB 1VEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBC A;  2K0B X;  1TTE A;  3K9O A;  1VEK A;  3LCU A;  2KNA A;  2DAE A;  2HWJ A;  2JZ1 A;  2O25 A;  3BBZ A;  1IXS A;  1NV8 A;  1ZMW A;  1AIP C;  1YLA A;  1WIV A;  2OO9 A;  2LTU A;  2CP8 A;  2B3T A;  2EJS A;  2K9D A;  4UN2 B;  2DAM A;  1KYI A;  3B89 A;  3LCV B;  2CWB A;  2JP7 A;  1Y8G A;  4G3O A;  2EKF A;  2DEN A;  1WGL A;  1TR8 A;  1ZMV A;  2LVP C;  3F92 A;  3FRH A;  2JZ0 A;  1HJP A;  2ZTD A;  1EFU B;  1MN3 A;  1QZE A;  2KHH A;  2LVN C;  3E21 A;  1VDL A;  4GEW A;  1OQY A;  2DAG A;  2BWB A;  4WP2 A;  1PGY A;  2JUJ A;  2KNV A;  1DO0 A;  1C7Y A;  1HQY E;  2DI0 A;  2OOB A;  2R0I A;  5JI2 E;  4Q7J A;  1OAI A;  1G4A E;  2MR9 A;  1A5T A;  1CUK A;  1G41 A;  1DV0 A;  2H5X A;  1IM2 A;  3T6P A;  1NV9 A;  2DZL A;  1WHC A;  2L4E A;  1VG5 A;  2LVO C;  3MMP A;  1SG9 A;  2EKK A;  1R4G A;  2QNJ A;  3FRI A;  1BVS A;  1ZV1 A;  1IFY A;  2G3Q A;  4R71 A;  4DBG B;  1WR1 B;  1JR3 E;  1XB2 B;  2L2D A;  3IHP A;  2L4F A;  4F2L A;  1WGN A;  1OKS A;  1T6O A;  2MJ5 B;  2LVA A;  1P3Q Q;  3GLF E;  3IEC A;  2WZJ A;  2RRU A;  2JY7 A;  3GLG E;  2QHO B;  1OTR A;  2LVQ D;  2JNH A;  1UFZ A;  2OOA A;  1GO5 A;  1ZMU A;  2HAK A;  2DNA A;  1VEJ A;  4F1I A;  4HEO A;  2DKL A;  1XXH E;  3GLH E;  1DO2 A;  3GLI E;  2DAI A;  3E46 A;  1F4I A;  2BWE A;  1WJ7 A;  2DHY A;  1V92 A;  2QSF X;  1G3I A;  1HT1 E;  2ZTC A;  2JY6 B;  1HT2 E;  3K9P A;  1VQ1 A;  3H4J A;  1E94 E;  2KNZ A;  2JY5 A;  5DFL A;  2MGW A;  3FE3 A;  1Q02 A;  2JY8 A;  1T43 A;  2DAK A;  2MRO B;  1VEG A; 
#chains in the Genus database with same CATH topology
 3K9O A;  2QQ8 A;  1TTE A;  2ZAM A;  4GRI A;  4QNR A;  4QOS A;  5H37 D;  3UMM A;  5LMN M;  2XZF A;  1PM5 A;  3U60 A;  3DFZ A;  2JZ1 A;  3PNY A;  4Z8X A;  3FTD A;  1NV8 A;  1SXJ D;  1JR3 D;  2KXE A;  2DWN A;  4FCW A;  4JI4 M;  3SHF A;  3L2A A;  3TWK A;  3U6M A;  2R62 A;  3W68 A;  1QDT A;  3GRY A;  4JI2 M;  4NXM M;  3QWL A;  3L29 A;  2K9D A;  2DWM A;  4CIS A;  2UUC M;  2CE7 A;  3HY5 A;  5KQ8 A;  3J7A S;  2Z8Y M;  4FWD A;  3B89 A;  4GC9 A;  4LF5 M;  2F5P A;  4IBJ A;  1R6B X;  4DV3 M;  3ZQJ A;  3J2P B;  2C9O A;  1NSF A;  4S12 A;  5KQD A;  3VDP A;  2K6B A;  2GNO A;  1IXS B;  1MX0 A;  2JZ0 A;  3KOW E;  4L6V 6;  2AHM A;  3HU2 A;  3LVV A;  2ZTD A;  1QYR A;  2HCB A;  4PDI A;  3J81 S;  3U6Q A;  3W0F A;  3JAM S;  3GLG B;  3GPX A;  1QVR A;  4DV0 M;  4DV6 M;  1H6U A;  2CHV A;  1J7K A;  2F5N A;  1QZE A;  2P5T A;  3UK6 A;  2KHH A;  1FJG M;  4LZJ A;  3T1Y M;  2VQF M;  1NNJ A;  3HJS A;  3ZCB B;  3FUW A;  4MGH A;  2V1C A;  4NOO B;  2UUB M;  1N33 M;  4WUR A;  3GPU A;  4KT0 F;  1XXH B;  2RKO A;  3GLI B;  4LFA M;  3GPY A;  2JUJ A;  1R7R A;  2JWS A;  2KNV A;  2KW0 A;  3SAR A;  2L7H A;  4PT5 A;  1OFI A;  3KOX E;  4NSR A;  4MM3 B;  2DI0 A;  1IN5 A;  5L8R F;  4IBG A;  3HU3 A;  4NXN M;  1G4A E;  2ZBK B;  4GMQ A;  4B7G A;  1G8P A;  3FUT A;  4FW9 A;  2LXE A;  4DR6 M;  1IN6 A;  3AOG A;  1VG5 A;  3E9S A;  3KOZ E;  4REZ A;  4CJ6 A;  2O01 F;  2QNJ A;  4JI0 M;  3M0E A;  1HNX M;  2C99 A;  3K8Z A;  5BPV A;  5LMU M;  2YNM D;  4L15 A;  2ERC A;  1SXJ E;  1JR3 E;  1WR1 B;  2L2D A;  2R46 A;  3NWL A;  4Y28 F;  3GRV A;  4DV5 M;  1EE8 A;  1VDD A;  1TH2 A;  2RGO A;  1Q3B A;  1GAB A;  3GRU A;  4AG5 A;  3CF2 A;  4A3V B;  3W0L B;  1J5E M;  1N78 A;  4KLN A;  5JI3 E;  4DR5 M;  1Q3C A;  2KZU A;  2LVQ D;  2M5Z A;  3FTF A;  1YE9 A;  1DGG A;  1YSY A;  2OOA A;  1QUS A;  2KZS A;  2HHH M;  2GQF A;  3LQQ A;  1QUT A;  2DZN B;  4GIT A;  4LJ7 A;  4NSO B;  3T15 A;  4RNA A;  4F1I A;  2KRK A;  1Z5A A;  3SC3 A;  2X8A A;  3E46 A;  3HGI A;  2LH0 A;  2HL7 A;  3I04 M;  3KSJ A;  4CGY B;  1PJJ A;  1KFV A;  3U5Z A;  2APL A;  4G4O A;  2FH0 A;  3EIE A;  2F5Q A;  1XNR M;  1XHB A;  5ITU A;  2OQ4 A;  4B3T M;  3Q8G A;  4DV4 M;  1TGU A;  3KXE C;  4FCT A;  4JN6 A;  2W82 A;  4EIW A;  3VKH A;  3CF0 A;  3HHY A;  2JY5 A;  3HZJ A;  5DFL A;  3U60 B;  4JYA M;  1L2D A;  4DR1 M;  4R7G A;  1VEG A;  1ZQ9 A;  3LCU A;  1NJG A;  4LF6 M;  1ZAE A;  4AZF A;  5EP4 A;  4ITQ A;  3UGJ A;  2O25 A;  3GLF A;  3ZC7 B;  1ORY B;  4MGZ E;  2O5R A;  1AIP C;  2OO9 A;  4M0W A;  2LTU A;  1GVN A;  1Q39 A;  2C5R A;  2ZAN A;  2K47 A;  3U6S A;  2B3T A;  1PJS A;  3T38 A;  1G59 A;  3U6C A;  1XMQ M;  1LTM A;  2QBY B;  4IIW A;  3AKZ A;  2DAM A;  3C58 A;  4LRT A;  2LHG A;  4QNM A;  1HNW M;  4LF9 M;  2R65 A;  1W5S A;  2ZAO A;  3HHX A;  3HX3 A;  4IJE A;  4G3O A;  2EKF A;  1DGH A;  4OVZ B;  2L7I A;  2QEN A;  2R18 A;  3B7N A;  3L25 A;  2EUC A;  1K3W A;  2VDB B;  1ZMV A;  1E32 A;  3F92 A;  4FD2 A;  3TWL A;  3FRH A;  3KP1 E;  1SXJ A;  1JR3 A;  1HNZ M;  1GL7 A;  4YHH M;  1EFU B;  5ITQ A;  4DR7 M;  3AOE A;  3M7G A;  2QCU A;  2VQE M;  3I51 A;  3KSX A;  4IBC A;  3U6L A;  2L6O A;  3E21 A;  4FCV A;  4K0K M;  3H4M A;  2J7O A;  1I4W A;  4GEW A;  1D2N A;  2C96 A;  4MGK E;  1G71 A;  2DAG A;  1QAN A;  4I8O A;  1L2B A;  1PJQ A;  4X62 M;  4JI8 M;  4XGI A;  1KSF X;  2UXB M;  1C7Y A;  4X66 M;  3HJ8 A;  3TWM A;  3VDU A;  5JI2 E;  3W67 A;  2BNK A;  2Z3X A;  2MR9 A;  2WSE F;  3Q8X A;  1NHW C;  4I5S A;  3PXG A;  4B3M M;  2QZ4 A;  1D0M A;  1LV7 A;  4LJ5 A;  2CFO A;  3UJN A;  4GKK M;  3LQR A;  5A2Q S;  2LVO C;  1QQW A;  3KOY E;  3KP0 E;  2DHR A;  3CGW A;  3QAU A;  1R4G A;  4HL4 A;  4LJ6 A;  1BVS A;  1ZV1 A;  4B08 A;  1XWI A;  4R71 A;  4CIZ A;  3AFH A;  2Q2E B;  3SMS A;  1IY2 A;  5IRE B;  1WXQ A;  3SAT A;  3CF6 E;  1OKS A;  3IG8 A;  2H1R A;  1XC8 A;  4NRV A;  2LVA A;  4L78 A;  3C3E A;  3R9X B;  3UZU A;  3GLF E;  1IXR C;  4LGM A;  3U61 A;  4PDG A;  4XBO A;  4JV5 M;  1OTR A;  4I81 A;  2JNH A;  5EXT A;  3KFU G;  1QAQ A;  1K82 A;  2JXN A;  1GO5 A;  3D8L A;  3SYK A;  2XLJ A;  4FWG A;  3U5Z B;  4G6Z A;  3R8F A;  2HAK A;  4JI5 M;  2DXI A;  3RFW A;  3FYD A;  2DKL A;  3GLH E;  1N34 M;  1IXZ A;  1DO2 A;  2FFJ A;  2DAI A;  3MHV C;  1QDR A;  3KS4 A;  5C18 A;  1PJI A;  4NRW A;  4LCB A;  3OTO M;  4M9S A;  1HR0 M;  2C9C A;  1IY1 A;  2XEP A;  3U6E A;  5EQT A;  2JY6 B;  3SFZ A;  3AJI B;  3HHZ A;  4HLQ A;  3K9P A;  4B3S M;  2D7E A;  3VK8 A;  3GO8 A;  4NC6 A;  3PNV A;  1Q02 A;  2JY8 A;  4WW0 A;  3IG5 A;  3SAV A;  3A98 B;  4LFB M;  2XF3 A;  5GKN A;  4L8R C;  5EP1 A;  4QHS A;  1NNU C;  2LBC A;  2K0B X;  3WHK A;  1NY6 A;  2R4J A;  2XZU A;  3B7Q A;  4LF7 M;  4M9Z A;  1IN7 A;  1IXS A;  3C3D A;  4RF0 A;  5BR8 M;  1QAM A;  1OIZ A;  3BXW A;  1YUB A;  2YQZ A;  1DGF A;  1DGH B;  4LFC M;  2CP8 A;  1XMO M;  3V76 A;  2CHG A;  1IN4 A;  1GL6 A;  2DVW B;  5E26 A;  3FTE A;  4AKI A;  2CV0 A;  5EXP A;  2WSC F;  4RF1 A;  1KYI A;  2FNA A;  1SXJ B;  2J7N A;  3TPZ A;  4LG2 A;  2XSZ D;  2CWB A;  2JP7 A;  1Y8G A;  1C1K A;  2DEN A;  1XXH A;  1OIP A;  2D7H A;  4W5W A;  4II7 A;  4PCZ A;  4LF4 M;  3U6O A;  2CUZ A;  2KA6 B;  3AL0 C;  3K1J A;  1HJP A;  4D81 A;  2VF7 A;  5FSW A;  3J80 S;  1TH4 A;  4GHA A;  2EA0 A;  2EO2 A;  4AI6 A;  4R3D A;  2KRU A;  3VFD A;  4IBD A;  4LJA A;  1D0L A;  4L16 A;  4OU7 A;  4LF8 M;  4AW4 A;  1D0K A;  1VDL A;  3FTC A;  4BLC A;  1NO1 A;  1OQY A;  3VK7 A;  3SHG B;  2M60 A;  4M9X A;  5ITT A;  4WP2 A;  5IT9 S;  3E4R A;  2JA2 A;  2Y0Q A;  4FVM A;  3RGP A;  5EJC A;  1L1T A;  3HWS A;  2QPA A;  4GC5 A;  4CHT B;  4GIP A;  2R0I A;  3JR4 A;  2DWL A;  4LJ4 A;  1OJL A;  3GLH A;  3LW5 F;  3FUV A;  4LJ8 A;  1CUK A;  4LJ9 A;  1G41 A;  2NQ8 C;  5ITR A;  2DWZ B;  3I4Y A;  3T6P A;  1EIJ A;  2FOI C;  5FTL A;  2DZL A;  1GLN A;  1R5L A;  1WHC A;  2MH8 A;  2Z4S A;  4D82 A;  3U6P A;  3NBX X;  1S3S A;  2L09 A;  1PRB A;  2EKK A;  4OW0 A;  2R4E A;  3GRR A;  4MB7 A;  4G4N A;  4KHP M;  2G3Q A;  2QP9 X;  4DBG B;  4LZZ A;  3HKP A;  2XGN A;  1TH3 A;  5EP3 A;  1XB2 B;  2DZO B;  2L4F A;  2D7G A;  5EXS A;  3U61 B;  3SAW A;  1TDZ A;  1T6O A;  2KDL A;  2MJ5 B;  4JI6 M;  3B7Z A;  1R2Z A;  5DYI A;  4IBE A;  2CV2 A;  4FWH A;  3J7B A;  3AV0 A;  3SMP A;  4MH0 E;  3GQ3 A;  4DR2 M;  1L2C A;  2WZJ A;  2RRU A;  2UXD M;  4AKH A;  3VLF B;  2JY7 A;  1DGB A;  4JXJ A;  4BB9 A;  3PVS A;  4GH9 A;  3C9P A;  5KO3 A;  3GLG E;  2XH9 A;  1K3X A;  2RGH A;  3L26 A;  1N77 A;  2F4V M;  3L27 A;  1IQP A;  1V33 A;  3TE6 A;  2X49 A;  3WHL A;  5ITX A;  4G4R A;  1N36 M;  4GKJ M;  4DR4 M;  3LMM A;  5IZ7 D;  1OFH A;  2YFQ A;  4YY3 M;  2R45 A;  2N35 A;  4AKG A;  2Y21 A;  4HEO A;  1XXH E;  3I4V A;  3GLI E;  3D8B A;  1GJT A;  3TQS A;  1MU5 A;  4IBI A;  4DUY M;  4QOZ C;  7CAT A;  2LWX A;  4OX9 M;  1L8Q A;  1WJ7 A;  1I94 M;  3DOA A;  4X65 M;  4JI7 M;  5C1B A;  2QSF X;  2F5O A;  2ZTC A;  3JR5 A;  4TUW A;  1HT2 E;  1NHG C;  2BJV A;  2I7N A;  4DR3 M;  1VQ1 A;  3KVW A;  4JI3 M;  4KOD A;  2KNZ A;  2R44 A;  2QBY A;  1MJG M;  2MGW A;  1Z5C A;  3FE3 A;  3NBI A;  4Z6Y A;  4ZPX A;  1T43 A;  3J27 B;  5KPT A;  4DV1 M;  1W5T A;  2MRO B;  4IBB A;  1IBM M;  4OVZ A;  5FTM A;  1UM8 A;  1VEK A;  2A5Y B;  2KNA A;  3TL4 X;  1R2Y A;  2DAE A;  3DZD A;  4QHT A;  2HWJ A;  2KEB A;  3BBZ A;  1PJT A;  3A42 A;  1ZMW A;  5KPZ A;  2VF8 A;  1YLA A;  1WIV A;  5FTJ A;  5FTK A;  1N32 M;  4P16 A;  4P17 A;  1AUA A;  3FD9 A;  2F5S A;  1JQJ C;  2EJS A;  1SXJ C;  4JI1 M;  3BOS A;  4UN2 B;  1J09 A;  2VII A;  3CTW B;  3HHW A;  2ZM6 M;  3AOE C;  2E5L M;  3LCV B;  3MK6 A;  3KDS E;  5EXX A;  3L28 A;  2I7P A;  2LHC A;  5FLX S;  1GJS A;  1WGL A;  2XFT A;  1TR8 A;  2LVP C;  4IBK A;  3GLF B;  3B74 A;  4IBF A;  3GPP A;  4PD2 A;  3VKG A;  3GP1 A;  2X4A A;  1N75 A;  1MN3 A;  8CAT A;  1L1Z A;  4DUZ M;  4NL4 H;  3GQ5 A;  2LVN C;  2CV1 A;  1GKI A;  2FS1 A;  2J5Y A;  1XNQ M;  3GLG A;  3MJ5 A;  1T3T A;  1NY5 A;  2XSZ A;  4L4U A;  5E6J A;  5EP2 A;  2BWB A;  4RKU F;  4IJF A;  3GLH B;  5ITX E;  1PGY A;  4KO8 A;  4GHL A;  3B9P A;  2UU9 M;  1DO0 A;  2YR0 A;  3ILK A;  3U6D A;  1HQY E;  2OOB A;  4AQY M;  2CEA A;  1IN8 A;  4Q7J A;  1OAI A;  4B3R M;  1IBK M;  3GLI A;  1A5T A;  1IY0 A;  1DV0 A;  2H5X A;  1IM2 A;  2XFS A;  4I4L A;  3ZH9 B;  5DNY A;  2OPF A;  2V1U A;  3SAS A;  1E9S A;  1NV9 A;  2R6F A;  3RE8 A;  2L4E A;  2WSF F;  3A46 A;  5ITY A;  3LVW A;  3MMP A;  1SG9 A;  1NVM A;  1RU3 A;  2C98 A;  2V6Z M;  2Z7J A;  3FRI A;  4B7H A;  4X64 M;  1FNN A;  1Z59 A;  1JB0 F;  4ANR A;  1IFY A;  1OAO C;  1NJF A;  1IBL M;  3SBJ A;  3FUX A;  1Z6T A;  4LRS A;  2BJW A;  2UUA M;  3IHP A;  3I01 M;  4F2L A;  2UXC M;  1WGN A;  2G8L A;  3THG A;  3GQ4 A;  5IWA M;  5KPR A;  2LNH C;  1X37 A;  4DV7 M;  1HQC A;  1P3Q Q;  2HKJ A;  3HU1 A;  3EIH A;  3IEC A;  3PFI A;  4BBA A;  2Z4R A;  3M6A A;  3QYE A;  3SAU A;  3RGS A;  4MGI E;  2QHO B;  3T1H M;  4B7F A;  1UFZ A;  4M0D A;  4D80 A;  2G5G X;  3FKE A;  5F3W A;  1ZMU A;  4AG6 A;  3DA1 A;  3KS8 A;  2DNA A;  1V34 A;  1VEJ A;  4LGY A;  2FE8 A;  3HJQ A;  1QAO A;  2CRU A;  3FYC A;  1F4I A;  3FUU A;  1TF0 B;  2BWE A;  2Y0T A;  1TDH A;  2DHY A;  3SYL A;  1V92 A;  4G4Q A;  1G3I A;  4DV2 M;  1HT1 E;  3KW6 A;  2Y20 A;  1QZM A;  3A45 A;  5DYG A;  1E9R A;  3K2L A;  3H4J A;  4LY6 A;  4XK8 F;  5FTN A;  1E94 E;  4MGY E;  1Z5B A;  2DAK A;  3K92 A;  3QYB A;  2CHQ A; 
#chains in the Genus database with same CATH homology
 2LBC A;  2K0B X;  1TTE A;  3K9O A;  1VEK A;  3LCU A;  2KNA A;  2DAE A;  2HWJ A;  2JZ1 A;  2O25 A;  3BBZ A;  1IXS A;  1NV8 A;  1ZMW A;  1AIP C;  1YLA A;  1WIV A;  2OO9 A;  2LTU A;  2CP8 A;  2B3T A;  2EJS A;  2K9D A;  4UN2 B;  2DAM A;  1KYI A;  3B89 A;  3LCV B;  2CWB A;  2JP7 A;  1Y8G A;  4G3O A;  2EKF A;  2DEN A;  1WGL A;  1TR8 A;  1ZMV A;  2LVP C;  3F92 A;  3FRH A;  2JZ0 A;  1HJP A;  2ZTD A;  1EFU B;  1MN3 A;  1QZE A;  2KHH A;  2LVN C;  3E21 A;  1VDL A;  4GEW A;  1OQY A;  2DAG A;  2BWB A;  4WP2 A;  1PGY A;  2JUJ A;  2KNV A;  1DO0 A;  1C7Y A;  1HQY E;  2DI0 A;  2OOB A;  2R0I A;  5JI2 E;  4Q7J A;  1OAI A;  1G4A E;  2MR9 A;  1A5T A;  1CUK A;  1G41 A;  1DV0 A;  2H5X A;  1IM2 A;  3T6P A;  1NV9 A;  2DZL A;  1WHC A;  2L4E A;  1VG5 A;  2LVO C;  3MMP A;  1SG9 A;  2EKK A;  1R4G A;  2QNJ A;  3FRI A;  1BVS A;  1ZV1 A;  1IFY A;  2G3Q A;  4R71 A;  4DBG B;  1WR1 B;  1JR3 E;  1XB2 B;  2L2D A;  3IHP A;  2L4F A;  4F2L A;  1WGN A;  1OKS A;  1T6O A;  2MJ5 B;  2LVA A;  1P3Q Q;  3GLF E;  3IEC A;  2WZJ A;  2RRU A;  2JY7 A;  3GLG E;  2QHO B;  1OTR A;  2LVQ D;  2JNH A;  1UFZ A;  2OOA A;  1GO5 A;  1ZMU A;  2HAK A;  2DNA A;  1VEJ A;  4F1I A;  4HEO A;  2DKL A;  1XXH E;  3GLH E;  1DO2 A;  3GLI E;  2DAI A;  3E46 A;  1F4I A;  2BWE A;  1WJ7 A;  2DHY A;  1V92 A;  2QSF X;  1G3I A;  1HT1 E;  2ZTC A;  2JY6 B;  1HT2 E;  3K9P A;  1VQ1 A;  3H4J A;  1E94 E;  2KNZ A;  2JY5 A;  5DFL A;  2MGW A;  3FE3 A;  1Q02 A;  2JY8 A;  1T43 A;  2DAK A;  2MRO B;  1VEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...