2D7GA

Crystal structure of the aa complex of the n-terminal domain of pria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
PVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7gA01
2D7EA 2DWMA 2DWLA 2DWNA 2D7GA 2D7HA 4NL4H
chains in the Genus database with same CATH superfamily
4PDGA 2C96A 2Y21A 1Q02A 3TWKA 1QZMA 1SXJD 2DHYA 3SASA 4JI5M 1XNRM 1JR3A 2H1RA 3GRYA 2D7HA 2X8AA 3Q8XA 1D0LA 2HAKA 1WR1B 4NSRA 3PNYA 3E9SA 2YQZA 3D8LA 3F92A 3CF6E 2CHVA 3CF2A 3QYEA 1AUAA 1R5LA 2NQ8C 4G4RA 4QHTA 4DV4M 1OFIA 1R6BX 2LHGA 3HZJA 4M9XA 2LVOC 1G3IA 2EA0A 2Z4SA 4LFAM 1EIJA 1GJTA 1XXHA 2QQ8A 4DR4M 2CHQA 1QDTA 4LZZA 2DAIA 3SAWA 3TWLA 1TDZA 2BWEA 2KXEA 4B7HA 3GPUA 3GPYA 1IY1A 2LVNC 4FWHA 3FYDA 4FWDA 4OW0A 2ZANA 1GJSA 4G4NA 2OQ4A 2ZTCA 3IECA 1OFHA 3HJ8A 1VEKA 3OTOM 3GLIB 1V34A 2EO2A 4AW4A 4JI6M 4LF7M 4REZA 1J7KA 2APLA 2QBYA 2K47A 1DGFA 1IY2A 2G8LA 3FYCA 1G41A 2KNZA 5A2QS 2OPFA 3I51A 3MK6A 4M0WA 3GLHB 1HQYE 4I5SA 3DA1A 2WZJA 3VLFB 3TE6A 1NNJA 2E5LM 1NSFA 2P5TA 4L8RC 4NOOB 3U6LA 2QCUA 4JI4M 4L6V6 2A5YB 2ZBKB 4LF5M 5KO3A 3NWLA 2L4EA 1R2ZA 1Q39A 3KSJA 5ITXA 1ZV1A 3L26A 5FTKA 1QUSA 4JI1M 1I4WA 2F5SA 1PJJA 1Z59A 4DUYM 2YFQA 2WSEF 3FRIA 1IXSA 1MX0A 2QSFX 3EIHA 1DGGA 4P17A 3L25A 2KRUA 4RF0A 5DYIA 3IG5A 3J7AS 2UXDM 2QPAA 2R4JA 3U6EA 2I7NA 4G6ZA 4NXMM 1IFYA 3A98B 3U6MA 2FNAA 2JY6B 4I81A 1V33A 1Z5AA 4LFBM 5KQDA 3GLIE 3CTWB 3LVVA 1HNWM 1TTEA 3LW5F 4DV1M 1ZMVA 1IBLM 4IBJA 5DYGA 4Y28F 2DAGA 1N75A 3K1JA 3L28A 1OIZA 1JR3D 5JI3E 3UMMA 3GLHE 3B7NA 4L15A 1IN6A 1DGHA 3TPZA 4GRIA 3AFHA 2DENA 4IJFA 3HX3A 3U6PA 4GKKM 2ZAMA 3PVSA 2FE8A 1L8QA 3K9OA 3V76A 3U6SA 2J7NA 3HHXA 2DAKA 2DXIA 2KA6B 3FE3A 3HY5A 4F2LA 4DR7M 1NO1A 2MROB 2XLJA 3THGA 1JR3E 3AOEA 4LF4M 1PRBA 1TH3A 2K0BX 4LJ8A 2R65A 3AOGA 2L4FA 4DR5M 2QBYB 2YR0A 5LMUM 1EE8A 4RKUF 4DV0M 1BVSA 3KDSE 3LCUA 3U6CA 2XSZD 2K9DA 3KSXA 2BNKA 2XGNA 1LTMA 2CUZA 3HGIA 4LCBA 4GIPA 4JI2M 3QWLA 2FH0A 3K8ZA 3ZQJA 3JR4A 1UFZA 4DR6M 3L29A 3GQ3A 1YSYA 2L7HA 2Z7JA 4XK8F 3C58A 2F5OA 2JP7A 3SMSA 1OIPA 4AKHA 1VEJA 2HCBA 5EXSA 2I7PA 1QQWA 3HU1A 3K2LA 2DZLA 1IXSB 1CUKA 4HL4A 3T15A 2Z3XA 3W0FA 4K0KM 4QNMA 4BBAA 1UM8A 5FTMA 3U6OA 1GL6A 3GRVA 2VF8A 4KLNA 2RGOA 1XWIA 4NC6A 3L2AA 2DVWB 4JXJA 3FUVA 4L16A 1K3WA 1K82A 2OOAA 2CV1A 1QDRA 4AKIA 3BXWA 1VEGA 4MGYE 4X64M 4LRTA 1GLNA 1IY0A 2RRUA 5EP1A 1DO2A 1DGHB 2KEBA 2CWBA 1G71A 2JWSA 3LVWA 2W82A 5C1BA 3LQRA 2UXBM 1DV0A 4GHLA 3U60A 4MB7A 4MGZE 1K3XA 2FS1A 1HQCA 3UZUA 3WHKA 1P3QQ 3HWSA 2C9OA 5ITXE 1MJGM 3Q8GA 4IBGA 4MH0E 3EIEA 4BB9A 5BR8M 3FTFA 3JAMS 3T1HM 1TR8A 2KNVA 3B7QA 1VG5A 1MN3A 2JA2A 3QAUA 2LNHC 3RE8A 1GKIA 3IHPA 2LVQD 1J09A 1HT1E 2HKJA 3C3DA 3SBJA 3H4JA 1HJPA 4FCTA 2BWBA 2L09A 2UXCM 1HT2E 1VDLA 3BOSA 1Y8GA 1L2CA 1FJGM 1GABA 3KVWA 1D0MA 3LQQA 1QVRA 3FTDA 1DGBA 4ANRA 4LJ6A 4NRVA 5EXXA 3DFZA 3FD9A 2CHGA 5LMNM 3U5ZA 1L1ZA 1V92A 1XMOM 3A45A 3HJQA 3T6PA 2HHHM 1R7RA 3WHLA 4P16A 3GLGA 4JN6A 1NV8A 5EXTA 3VDPA 5FTJA 4B08A 1RU3A 2KDLA 5EXPA 2C5RA 1L2DA 1E9SA 2JNHA 3KOZE 2DWLA 1NJGA 2CE7A 2XFSA 3FUUA 4S12A 5H37D 2YNMD 3FRHA 1GVNA 1N78A 4FVMA 4HLQA 4R7GA 1WGLA 5KQ8A 2Y20A 2KW0A 2JZ1A 3LMMA 2Q2EB 2J7OA 3W67A 4X62M 1W5TA 3GLFA 1ZMUA 5DNYA 3J2PB 2MR9A 5ITRA 3SARA 2ERCA 3KOYE 3U60B 3E4RA 4FWGA 4AI6A 3VK7A 3W0LB 3I4YA 1OKSA 1PJQA 4DR3M 1W5SA 2FOIC 3IG8A 2LTUA 3GRUA 4HEOA 5F3WA 1KYIA 1OAIA 1E9RA 2HL7A 5EP3A 3DZDA 3SHGB 3H4MA 1JQJC 1QUTA 2C98A 1R4GA 3A42A 3HHYA 3VDUA 1XXHB 4MGKE 1SXJA 2R44A 2BJVA 1ZAEA 3AKZA 3GO8A 1NHGC 1XHBA 2OO9A 3HHWA 2VIIA 5FTNA 3KOXE 3M0EA 5GKNA 1HNXM 3U6DA 2G5GX 2M5ZA 5IZ7D 4CISA 1XNQM 5IREB 3W68A 1QYRA 4F1IA 1NHWC 5IT9S 3SC3A 2QZ4A 2QNJA 4AG6A 3MMPA 3U5ZB 2DI0A 2KNAA 4PCZA 2D7GA 1H6UA 1XMQM 2F5QA 3HHZA 2DKLA 3ZH9B 1OJLA 4NSOB 4D82A 2DWZB 1N36M 3GLGB 4LF9M 3L27A 2C9CA 3UK6A 4LJ9A 3TL4X 3U61A 3T1YM 2LBCA 2WSCF 4I4LA 3GPPA 1OTRA 1SG9A 2XEPA 1NNUC 4PT5A 3GPXA 5EJCA 4X65M 4IJEA 1N33M 3SFZA 3PNVA 2RKOA 4D80A 2J5YA 2K6BA 3M7GA 1VDDA 5FTLA 1XXHE 1G4AE 4L78A 1PJIA 4AKGA 2V6ZM 1AIPC 2CFOA 2Y0QA 2WSFF 1PGYA 3D8BA 4PD2A 3GLFB 1OQYA 4W5WA 4WP2A 4LFCM 1F4IA 4IBIA 4FD2A 2DNAA 5C18A 4CIZA 4QOZC 4AZFA 4LJ7A 3NBIA 4KO8A 3GQ4A 4DV7M 2CP8A 3KP0E 4R3DA 2CV0A 2CEAA 1Z5BA 4IBCA 3TQSA 1XC8A 4OU7A 3PFIA 2XF3A 4IIWA 3ZCBB 4QNRA 3GLGE 4FW9A 3RFWA 5IWAM 3ILKA 2DWMA 1SXJB 3RGSA 1GO5A 2XFTA 4M0DA 2F5NA 1IQPA 3VFDA 5ITQA 4OX9M 3I04M 1HNZM 2L2DA 3SAVA 3FUWA 3UJNA 2XZFA 2QP9X 2JZ0A 2QHOB 2V1CA 3JR5A 2DWNA 4JV5M 4DV3M 4KHPM 3SYKA 4L4UA 2KZUA 1X37A 2KZSA 3GLFE 4GEWA 1TDHA 4UN2B 5FSWA 1C1KA 4G4OA 3HU2A 4MGHA 2UUAM 5KPTA 4GC9A 3U61B 4II7A 4LJ4A 2R4EA 2R62A 3HKPA 3M6AA 4Q7JA 4B3MM 1MU5A 3AOEC 2ZM6M 1N77A 4Z6YA 2LVAA 1Q3BA 2ZTDA 1L1TA 3SMPA 3HU3A 3KW6A 4JI8M 3R9XB 3K92A 4LGMA 2JUJA 2M60A 1WJ7A 4JI7M 1G8PA 1LV7A 1Q3CA 4Z8XA 1ZMWA 1YE9A 5KPRA 3AL0C 1SXJE 3B74A 4FCVA 3J7BA 4IBDA 1IN8A 3U6QA 5ITTA 1E32A 2LVPC 4CJ6A 4MM3B 2MH8A 3GQ5A 2Y0TA 4JI0M 4IBKA 2XSZA 3FTCA 4CHTB 2UUBM 4G4QA 1HR0M 3KOWE 2D7EA 4LGYA 4YHHM 2JY8A 1D0KA 1C7YA 1L2BA 2UUCM 2LXEA 2R0IA 3I4VA 8CATA 4KODA 1A5TA 3ZC7B 2X49A 4DV2M 2F5PA 5DFLA 1IN7A 3BBZA 4QOSA 4X66M 1E94E 1KFVA 4OVZA 4CGYB 3CGWA 2R45A 4EIWA 4M9SA 4IBBA 2RGHA 1IN5A 5L8RF 1I94M 2ZAOA 4LRSA 3K9PA 2GQFA 3LCVB 3TWMA 4IBEA 1KSFX 2G3QA 2N35A 3KFUG 1Z5CA 1ZQ9A 3J27B 4FCWA 4RF1A 2VF7A 4NL4H 5E6JA 4QHSA 4TUWA 3HJSA 4LJAA 2MJ5B 3UGJA 3KXEC 1NJFA 2CRUA 2F4VM 2OOBA 4NXNM 2XZUA 3A46A 5EP2A 1TH4A 2B3TA 2L6OA 1T3TA 3KS4A 3MHVC 1IM2A 2XH9A 1J5EM 4B3SM 2DAMA 1QANA 1N32M 2AHMA 2LWXA 4B3RM 4NRWA 3B89A 4DR1M 2X4AA 2C99A 5BPVA 1IN4A 1Z6TA 1WIVA 3KS8A 2EJSA 4GC5A 2R46A 2H5XA 4B7FA 4GKJM 4XGIA 1FNNA 2DZOB 3B7ZA 2R6FA 1IBMM 1YUBA 3AJIB 1ORYB 4IBFA 4LF6M 4WW0A 2JY7A 3SATA 7CATA 4DV6M 1QAMA 4PDIA 1IBKM 4ZPXA 3T38A 3J80S 4DUZM 1EFUB 1JB0F 5ITYA 3VKGA 4LY6A 3SYLA 4LZJA 2V1UA 1IXZA 1N34M 1OAOC 3C3EA 3SAUA 1WXQA 1R2YA 1DO0A 3GRRA 2CV2A 4B7GA 1IXRC 1NV9A 2MGWA 3FUTA 2VQEM 3FUXA 1TH2A 3VKHA 1PJSA 1PM5A 1TGUA 4AQYM 4ITQA 4JYAM 3R8FA 4B3TM 5JI2E 2Z8YM 3FTEA 4OVZB 3DOAA 2O25A 4GH9A 3PXGA 3I01M 2UU9M 2R18A 1NY6A 4DBGB 1WGNA 3E46A 2EKKA 4YY3M 5ITUA 2KRKA 4MGIE 2BJWA 2O5RA 2L7IA 5E26A 4D81A 2EKFA 4GMQA 3AV0A 4GHAA 2GNOA 1NY5A 3CF0A 3KP1E 2DAEA 2JXNA 1XB2B 2EUCA 3SHFA 4I8OA 2DHRA 4LG2A 4DV5M 5KPZA 1QAQA 3FKEA 5EP4A 4AG5A 4LF8M 3MJ5A 2LH0A 3NBXX 1QAOA 3E21A 1VQ1A 5FLXS 1S3SA 1YLAA 2DZNB 4G3OA 3GLIA 4WURA 1QZEA 3J81S 4DR2M 1WHCA 2LHCA 2VDBB 4LJ5A 5EQTA 1GL7A 2FFJA 2JY5A 2KHHA 4XBOA 2O01F 3C9PA 4KT0F 1T43A 1TF0B 4RNAA 4A3VB 3GLHA 1NVMA 1T6OA 3B9PA 1D2NA 4R71A 2VQFM 3QYBA 1SXJC 2HWJA 3VK8A 1PJTA 4GITA 1G59A 3RGPA 3GP1A 2Z4RA 4JI3M 4BLCA 2QENA 4M9ZA
chains in the Genus database with same CATH topology
4PDGA 2C96A 2Y21A 3TWKA 1QZMA 1SXJD 3SASA 4JI5M 1XNRM 1JR3A 2H1RA 3GRYA 2D7HA 2X8AA 3Q8XA 4NSRA 3PNYA 3E9SA 2YQZA 3D8LA 3CF6E 2CHVA 3CF2A 2NQ8C 4G4RA 4QHTA 4DV4M 1OFIA 1R6BX 4M9XA 1G3IA 2EA0A 2Z4SA 4LFAM 1XXHA 4DR4M 2CHQA 4LZZA 3SAWA 3TWLA 1TDZA 2KXEA 4B7HA 3GPUA 3GPYA 1IY1A 4FWDA 4FWHA 3FYDA 4OW0A 2ZANA 4G4NA 2OQ4A 1OFHA 3HJ8A 3GLIB 3OTOM 4LF7M 2EO2A 4AW4A 4JI6M 4REZA 1J7KA 2QBYA 2K47A 1DGFA 1IY2A 2G8LA 3FYCA 1G41A 5A2QS 2OPFA 3I51A 3MK6A 4M0WA 3GLHB 1HQYE 4I5SA 3DA1A 3VLFB 3TE6A 1NNJA 2E5LM 1NSFA 2P5TA 4L8RC 4NOOB 3U6LA 2QCUA 4JI4M 2A5YB 2ZBKB 4LF5M 5KO3A 3NWLA 1R2ZA 1Q39A 3KSJA 5ITXA 3L26A 5FTKA 4JI1M 1I4WA 2F5SA 1PJJA 1Z59A 4DUYM 2YFQA 1MX0A 3EIHA 3L25A 1DGGA 2UXDM 2KRUA 4RF0A 5DYIA 3IG5A 3J7AS 2QPAA 2R4JA 3U6EA 2I7NA 4G6ZA 4NXMM 3A98B 3U6MA 2FNAA 4I81A 1Z5AA 4LFBM 5KQDA 3CTWB 3LVVA 1HNWM 4DV1M 1IBLM 4IBJA 5DYGA 1N75A 3K1JA 3L28A 5JI3E 1JR3D 3UMMA 4L15A 1IN6A 1DGHA 3TPZA 4GRIA 3AFHA 4IJFA 3U6PA 4GKKM 2ZAMA 3PVSA 2FE8A 1L8QA 3U6SA 2J7NA 3HHXA 2DXIA 2KA6B 4DR7M 2XLJA 3THGA 3AOEA 4LF4M 1TH3A 4LJ8A 2R65A 3AOGA 4DR5M 2QBYB 2YR0A 5LMUM 1EE8A 4DV0M 3KDSE 3U6CA 2XSZD 3KSXA 2XGNA 2BNKA 2CUZA 3HGIA 4LCBA 4GIPA 4JI2M 3QWLA 3K8ZA 3JR4A 4DR6M 3L29A 3GQ3A 1YSYA 2L7HA 2Z7JA 3C58A 2F5OA 3SMSA 4AKHA 2HCBA 5EXSA 2I7PA 1QQWA 3HU1A 3K2LA 4K0KM 1IXSB 4HL4A 3T15A 2Z3XA 3W0FA 4QNMA 4BBAA 1UM8A 5FTMA 3U6OA 1GL6A 3GRVA 4KLNA 2RGOA 1XWIA 3L2AA 2DVWB 4JXJA 3FUVA 4L16A 1K82A 2CV1A 4AKIA 4MGYE 4X64M 4LRTA 1GLNA 1IY0A 5EP1A 1DO2A 1DGHB 2KEBA 3LVWA 2W82A 5C1BA 3LQRA 2UXBM 4GHLA 3U60A 4MB7A 4MGZE 1K3XA 1HQCA 3UZUA 3WHKA 3HWSA 2C9OA 5ITXE 4IBGA 4MH0E 4BB9A 3EIEA 5BR8M 3FTFA 3JAMS 3T1HM 2JA2A 3QAUA 2LNHC 3RE8A 1GKIA 1J09A 1HT1E 2HKJA 3SBJA 4FCTA 2L09A 2UXCM 1HT2E 3BOSA 1L2CA 1FJGM 3KVWA 3LQQA 1QVRA 3FTDA 1DGBA 4LJ6A 4NRVA 5EXXA 3DFZA 3FD9A 2CHGA 5LMNM 3U5ZA 1L1ZA 1XMOM 3A45A 3HJQA 2HHHM 1R7RA 3WHLA 4P16A 3GLGA 4JN6A 5EXTA 3VDPA 5FTJA 4B08A 1L2DA 5EXPA 2C5RA 1E9SA 3KOZE 2DWLA 1NJGA 2CE7A 2XFSA 3FUUA 4S12A 5H37D 2YNMD 1GVNA 1N78A 4FVMA 4HLQA 4R7GA 5KQ8A 2Y20A 2KW0A 3LMMA 2Q2EB 2J7OA 4X62M 1W5TA 3GLFA 5DNYA 3J2PB 5ITRA 3SARA 2ERCA 3KOYE 3U60B 3E4RA 4FWGA 4AI6A 3VK7A 3W0LB 3I4YA 4DR3M 1W5SA 2FOIC 3IG8A 3GRUA 5F3WA 1KYIA 3SHGB 1E9RA 2HL7A 5EP3A 3DZDA 1K3WA 3H4MA 1JQJC 2C98A 3A42A 3VDUA 3HHYA 1XXHB 4MGKE 1SXJA 2BJVA 1ZAEA 3AKZA 3GO8A 1NHGC 1XHBA 3HHWA 2VIIA 5FTNA 3KOXE 3M0EA 5GKNA 1HNXM 3U6DA 2G5GX 2M5ZA 5IZ7D 4CISA 1XNQM 5IREB 1QYRA 1NHWC 5IT9S 3SC3A 2QZ4A 3U5ZB 4AG6A 4PCZA 2D7GA 1H6UA 1XMQM 2F5QA 3HHZA 3ZH9B 1OJLA 4NSOB 4D82A 2DWZB 1N36M 3GLGB 4LF9M 3L27A 2C9CA 3UK6A 4LJ9A 3TL4X 3U61A 3T1YM 4I4LA 3GPPA 2XEPA 1NNUC 4PT5A 3GPXA 5EJCA 4X65M 4IJEA 1N33M 3SFZA 3PNVA 2RKOA 4D80A 3M7GA 1VDDA 5FTLA 1G4AE 4L78A 1PJIA 4AKGA 2V6ZM 2CFOA 2Y0QA 3D8BA 3GLFB 4PD2A 4LFCM 4W5WA 4IBIA 4FD2A 5C18A 4QOZC 4AZFA 4LJ7A 3NBIA 4KO8A 3GQ4A 4DV7M 3KP0E 4R3DA 2CV0A 2CEAA 1Z5BA 4IBCA 3TQSA 1XC8A 4OU7A 3PFIA 2XF3A 4IIWA 3ZCBB 4QNRA 4FW9A 3RFWA 5IWAM 3ILKA 2DWMA 1SXJB 3RGSA 2XFTA 4M0DA 2F5NA 1IQPA 3VFDA 5ITQA 4OX9M 1HNZM 3SAVA 3FUWA 3UJNA 2XZFA 2QP9X 3JR5A 2V1CA 2DWNA 4JV5M 4DV3M 4KHPM 3SYKA 4L4UA 2KZUA 1X37A 2KZSA 1TDHA 5FSWA 1C1KA 4G4OA 3HU2A 4MGHA 2UUAM 5KPTA 4GC9A 3U61B 4II7A 4LJ4A 2R4EA 2R62A 3HKPA 3M6AA 4B3MM 1MU5A 3AOEC 2ZM6M 1N77A 4Z6YA 1Q3BA 1L1TA 3SMPA 3HU3A 3KW6A 4JI8M 3R9XB 3K92A 4LGMA 2M60A 4JI7M 1G8PA 1LV7A 1Q3CA 4Z8XA 1YE9A 5KPRA 3AL0C 1SXJE 4FCVA 3J7BA 4IBDA 1IN8A 3U6QA 5ITTA 1E32A 4MM3B 3GQ5A 2Y0TA 4JI0M 4IBKA 2XSZA 3FTCA 4CHTB 2UUBM 4G4QA 1HR0M 3KOWE 2D7EA 4LGYA 4YHHM 1L2BA 2UUCM 2LXEA 3I4VA 8CATA 4KODA 3ZC7B 2X49A 4DV2M 2F5PA 1IN7A 4QOSA 4X66M 1E94E 1KFVA 4OVZA 4CGYB 2R45A 4EIWA 4M9SA 4IBBA 2RGHA 1IN5A 1I94M 2ZAOA 4LRSA 3TWMA 4IBEA 1KSFX 3KFUG 1Z5CA 1ZQ9A 3J27B 4FCWA 4RF1A 5E6JA 4NL4H 4QHSA 4TUWA 3HJSA 4LJAA 3UGJA 3KXEC 1NJFA 2F4VM 4NXNM 2XZUA 3A46A 5EP2A 1TH4A 2L6OA 1T3TA 3KS4A 3MHVC 1IM2A 2XH9A 1J5EM 4B3SM 1N32M 1QANA 2AHMA 2LWXA 4B3RM 4NRWA 4DR1M 2X4AA 2C99A 5BPVA 1IN4A 1Z6TA 3KS8A 4GC5A 2R46A 4B7FA 4GKJM 4XGIA 1FNNA 2DZOB 1IBMM 1YUBA 3AJIB 1ORYB 4IBFA 4LF6M 4WW0A 3SATA 7CATA 4DV6M 1QAMA 4PDIA 1IBKM 4ZPXA 3T38A 3J80S 4DUZM 5ITYA 3VKGA 4LY6A 3SYLA 4LZJA 2V1UA 1IXZA 1N34M 3SAUA 1WXQA 1R2YA 1DO0A 3GRRA 2CV2A 4B7GA 1IXRC 3FUTA 2VQEM 3FUXA 1TH2A 3VKHA 1PM5A 1TGUA 4AQYM 4ITQA 4JYAM 3R8FA 4B3TM 5JI2E 3FTEA 4OVZB 3DOAA 4GH9A 3PXGA 2UU9M 2R18A 1NY6A 4YY3M 5ITUA 2KRKA 4MGIE 2BJWA 2O5RA 2L7IA 5E26A 4D81A 4GMQA 3AV0A 4GHAA 1NY5A 3CF0A 3KP1E 3SHFA 2EUCA 4I8OA 2DHRA 4LG2A 4DV5M 5KPZA 1QAQA 3FKEA 5EP4A 4AG5A 4LF8M 3MJ5A 2LH0A 1QAOA 5FLXS 1S3SA 2DZNB 3GLIA 4WURA 3J81S 4DR2M 4LJ5A 5EQTA 1GL7A 2FFJA 4XBOA 4RNAA 4A3VB 3GLHA 1NVMA 3B9PA 1D2NA 2VQFM 1SXJC 3VK8A 4GITA 1G59A 3RGPA 3GP1A 2Z4RA 4JI3M 4BLCA 2QENA 4M9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7E A;  2DWM A;  2DWL A;  2DWN A;  2D7G A;  2D7H A;  4NL4 H; 
#chains in the Genus database with same CATH topology
 4PDG A;  2C96 A;  2Y21 A;  1Q02 A;  3TWK A;  1QZM A;  1SXJ D;  2DHY A;  3SAS A;  4JI5 M;  1XNR M;  1JR3 A;  2H1R A;  3GRY A;  2D7H A;  2X8A A;  3Q8X A;  1D0L A;  2HAK A;  1WR1 B;  4NSR A;  3PNY A;  3E9S A;  2YQZ A;  3D8L A;  3F92 A;  3CF6 E;  2CHV A;  3CF2 A;  3QYE A;  1AUA A;  1R5L A;  2NQ8 C;  4G4R A;  4QHT A;  4DV4 M;  1OFI A;  1R6B X;  2LHG A;  3HZJ A;  4M9X A;  2LVO C;  1G3I A;  2EA0 A;  2Z4S A;  4LFA M;  1EIJ A;  1GJT A;  1XXH A;  2QQ8 A;  4DR4 M;  2CHQ A;  1QDT A;  4LZZ A;  2DAI A;  3SAW A;  3TWL A;  1TDZ A;  2BWE A;  2KXE A;  4B7H A;  3GPU A;  3GPY A;  1IY1 A;  2LVN C;  4FWH A;  3FYD A;  4FWD A;  4OW0 A;  2ZAN A;  1GJS A;  4G4N A;  2OQ4 A;  2ZTC A;  3IEC A;  1OFH A;  3HJ8 A;  1VEK A;  3OTO M;  3GLI B;  1V34 A;  2EO2 A;  4AW4 A;  4JI6 M;  4LF7 M;  4REZ A;  1J7K A;  2APL A;  2QBY A;  2K47 A;  1DGF A;  1IY2 A;  2G8L A;  3FYC A;  1G41 A;  2KNZ A;  5A2Q S;  2OPF A;  3I51 A;  3MK6 A;  4M0W A;  3GLH B;  1HQY E;  4I5S A;  3DA1 A;  2WZJ A;  3VLF B;  3TE6 A;  1NNJ A;  2E5L M;  1NSF A;  2P5T A;  4L8R C;  4NOO B;  3U6L A;  2QCU A;  4JI4 M;  4L6V 6;  2A5Y B;  2ZBK B;  4LF5 M;  5KO3 A;  3NWL A;  2L4E A;  1R2Z A;  1Q39 A;  3KSJ A;  5ITX A;  1ZV1 A;  3L26 A;  5FTK A;  1QUS A;  4JI1 M;  1I4W A;  2F5S A;  1PJJ A;  1Z59 A;  4DUY M;  2YFQ A;  2WSE F;  3FRI A;  1IXS A;  1MX0 A;  2QSF X;  3EIH A;  1DGG A;  4P17 A;  3L25 A;  2KRU A;  4RF0 A;  5DYI A;  3IG5 A;  3J7A S;  2UXD M;  2QPA A;  2R4J A;  3U6E A;  2I7N A;  4G6Z A;  4NXM M;  1IFY A;  3A98 B;  3U6M A;  2FNA A;  2JY6 B;  4I81 A;  1V33 A;  1Z5A A;  4LFB M;  5KQD A;  3GLI E;  3CTW B;  3LVV A;  1HNW M;  1TTE A;  3LW5 F;  4DV1 M;  1ZMV A;  1IBL M;  4IBJ A;  5DYG A;  4Y28 F;  2DAG A;  1N75 A;  3K1J A;  3L28 A;  1OIZ A;  1JR3 D;  5JI3 E;  3UMM A;  3GLH E;  3B7N A;  4L15 A;  1IN6 A;  1DGH A;  3TPZ A;  4GRI A;  3AFH A;  2DEN A;  4IJF A;  3HX3 A;  3U6P A;  4GKK M;  2ZAM A;  3PVS A;  2FE8 A;  1L8Q A;  3K9O A;  3V76 A;  3U6S A;  2J7N A;  3HHX A;  2DAK A;  2DXI A;  2KA6 B;  3FE3 A;  3HY5 A;  4F2L A;  4DR7 M;  1NO1 A;  2MRO B;  2XLJ A;  3THG A;  1JR3 E;  3AOE A;  4LF4 M;  1PRB A;  1TH3 A;  2K0B X;  4LJ8 A;  2R65 A;  3AOG A;  2L4F A;  4DR5 M;  2QBY B;  2YR0 A;  5LMU M;  1EE8 A;  4RKU F;  4DV0 M;  1BVS A;  3KDS E;  3LCU A;  3U6C A;  2XSZ D;  2K9D A;  3KSX A;  2BNK A;  2XGN A;  1LTM A;  2CUZ A;  3HGI A;  4LCB A;  4GIP A;  4JI2 M;  3QWL A;  2FH0 A;  3K8Z A;  3ZQJ A;  3JR4 A;  1UFZ A;  4DR6 M;  3L29 A;  3GQ3 A;  1YSY A;  2L7H A;  2Z7J A;  4XK8 F;  3C58 A;  2F5O A;  2JP7 A;  3SMS A;  1OIP A;  4AKH A;  1VEJ A;  2HCB A;  5EXS A;  2I7P A;  1QQW A;  3HU1 A;  3K2L A;  2DZL A;  1IXS B;  1CUK A;  4HL4 A;  3T15 A;  2Z3X A;  3W0F A;  4K0K M;  4QNM A;  4BBA A;  1UM8 A;  5FTM A;  3U6O A;  1GL6 A;  3GRV A;  2VF8 A;  4KLN A;  2RGO A;  1XWI A;  4NC6 A;  3L2A A;  2DVW B;  4JXJ A;  3FUV A;  4L16 A;  1K3W A;  1K82 A;  2OOA A;  2CV1 A;  1QDR A;  4AKI A;  3BXW A;  1VEG A;  4MGY E;  4X64 M;  4LRT A;  1GLN A;  1IY0 A;  2RRU A;  5EP1 A;  1DO2 A;  1DGH B;  2KEB A;  2CWB A;  1G71 A;  2JWS A;  3LVW A;  2W82 A;  5C1B A;  3LQR A;  2UXB M;  1DV0 A;  4GHL A;  3U60 A;  4MB7 A;  4MGZ E;  1K3X A;  2FS1 A;  1HQC A;  3UZU A;  3WHK A;  1P3Q Q;  3HWS A;  2C9O A;  5ITX E;  1MJG M;  3Q8G A;  4IBG A;  4MH0 E;  3EIE A;  4BB9 A;  5BR8 M;  3FTF A;  3JAM S;  3T1H M;  1TR8 A;  2KNV A;  3B7Q A;  1VG5 A;  1MN3 A;  2JA2 A;  3QAU A;  2LNH C;  3RE8 A;  1GKI A;  3IHP A;  2LVQ D;  1J09 A;  1HT1 E;  2HKJ A;  3C3D A;  3SBJ A;  3H4J A;  1HJP A;  4FCT A;  2BWB A;  2L09 A;  2UXC M;  1HT2 E;  1VDL A;  3BOS A;  1Y8G A;  1L2C A;  1FJG M;  1GAB A;  3KVW A;  1D0M A;  3LQQ A;  1QVR A;  3FTD A;  1DGB A;  4ANR A;  4LJ6 A;  4NRV A;  5EXX A;  3DFZ A;  3FD9 A;  2CHG A;  5LMN M;  3U5Z A;  1L1Z A;  1V92 A;  1XMO M;  3A45 A;  3HJQ A;  3T6P A;  2HHH M;  1R7R A;  3WHL A;  4P16 A;  3GLG A;  4JN6 A;  1NV8 A;  5EXT A;  3VDP A;  5FTJ A;  4B08 A;  1RU3 A;  2KDL A;  5EXP A;  2C5R A;  1L2D A;  1E9S A;  2JNH A;  3KOZ E;  2DWL A;  1NJG A;  2CE7 A;  2XFS A;  3FUU A;  4S12 A;  5H37 D;  2YNM D;  3FRH A;  1GVN A;  1N78 A;  4FVM A;  4HLQ A;  4R7G A;  1WGL A;  5KQ8 A;  2Y20 A;  2KW0 A;  2JZ1 A;  3LMM A;  2Q2E B;  2J7O A;  3W67 A;  4X62 M;  1W5T A;  3GLF A;  1ZMU A;  5DNY A;  3J2P B;  2MR9 A;  5ITR A;  3SAR A;  2ERC A;  3KOY E;  3U60 B;  3E4R A;  4FWG A;  4AI6 A;  3VK7 A;  3W0L B;  3I4Y A;  1OKS A;  1PJQ A;  4DR3 M;  1W5S A;  2FOI C;  3IG8 A;  2LTU A;  3GRU A;  4HEO A;  5F3W A;  1KYI A;  1OAI A;  1E9R A;  2HL7 A;  5EP3 A;  3DZD A;  3SHG B;  3H4M A;  1JQJ C;  1QUT A;  2C98 A;  1R4G A;  3A42 A;  3HHY A;  3VDU A;  1XXH B;  4MGK E;  1SXJ A;  2R44 A;  2BJV A;  1ZAE A;  3AKZ A;  3GO8 A;  1NHG C;  1XHB A;  2OO9 A;  3HHW A;  2VII A;  5FTN A;  3KOX E;  3M0E A;  5GKN A;  1HNX M;  3U6D A;  2G5G X;  2M5Z A;  5IZ7 D;  4CIS A;  1XNQ M;  5IRE B;  3W68 A;  1QYR A;  4F1I A;  1NHW C;  5IT9 S;  3SC3 A;  2QZ4 A;  2QNJ A;  4AG6 A;  3MMP A;  3U5Z B;  2DI0 A;  2KNA A;  4PCZ A;  2D7G A;  1H6U A;  1XMQ M;  2F5Q A;  3HHZ A;  2DKL A;  3ZH9 B;  1OJL A;  4NSO B;  4D82 A;  2DWZ B;  1N36 M;  3GLG B;  4LF9 M;  3L27 A;  2C9C A;  3UK6 A;  4LJ9 A;  3TL4 X;  3U61 A;  3T1Y M;  2LBC A;  2WSC F;  4I4L A;  3GPP A;  1OTR A;  1SG9 A;  2XEP A;  1NNU C;  4PT5 A;  3GPX A;  5EJC A;  4X65 M;  4IJE A;  1N33 M;  3SFZ A;  3PNV A;  2RKO A;  4D80 A;  2J5Y A;  2K6B A;  3M7G A;  1VDD A;  5FTL A;  1XXH E;  1G4A E;  4L78 A;  1PJI A;  4AKG A;  2V6Z M;  1AIP C;  2CFO A;  2Y0Q A;  2WSF F;  1PGY A;  3D8B A;  4PD2 A;  3GLF B;  1OQY A;  4W5W A;  4WP2 A;  4LFC M;  1F4I A;  4IBI A;  4FD2 A;  2DNA A;  5C18 A;  4CIZ A;  4QOZ C;  4AZF A;  4LJ7 A;  3NBI A;  4KO8 A;  3GQ4 A;  4DV7 M;  2CP8 A;  3KP0 E;  4R3D A;  2CV0 A;  2CEA A;  1Z5B A;  4IBC A;  3TQS A;  1XC8 A;  4OU7 A;  3PFI A;  2XF3 A;  4IIW A;  3ZCB B;  4QNR A;  3GLG E;  4FW9 A;  3RFW A;  5IWA M;  3ILK A;  2DWM A;  1SXJ B;  3RGS A;  1GO5 A;  2XFT A;  4M0D A;  2F5N A;  1IQP A;  3VFD A;  5ITQ A;  4OX9 M;  3I04 M;  1HNZ M;  2L2D A;  3SAV A;  3FUW A;  3UJN A;  2XZF A;  2QP9 X;  2JZ0 A;  2QHO B;  2V1C A;  3JR5 A;  2DWN A;  4JV5 M;  4DV3 M;  4KHP M;  3SYK A;  4L4U A;  2KZU A;  1X37 A;  2KZS A;  3GLF E;  4GEW A;  1TDH A;  4UN2 B;  5FSW A;  1C1K A;  4G4O A;  3HU2 A;  4MGH A;  2UUA M;  5KPT A;  4GC9 A;  3U61 B;  4II7 A;  4LJ4 A;  2R4E A;  2R62 A;  3HKP A;  3M6A A;  4Q7J A;  4B3M M;  1MU5 A;  3AOE C;  2ZM6 M;  1N77 A;  4Z6Y A;  2LVA A;  1Q3B A;  2ZTD A;  1L1T A;  3SMP A;  3HU3 A;  3KW6 A;  4JI8 M;  3R9X B;  3K92 A;  4LGM A;  2JUJ A;  2M60 A;  1WJ7 A;  4JI7 M;  1G8P A;  1LV7 A;  1Q3C A;  4Z8X A;  1ZMW A;  1YE9 A;  5KPR A;  3AL0 C;  1SXJ E;  3B74 A;  4FCV A;  3J7B A;  4IBD A;  1IN8 A;  3U6Q A;  5ITT A;  1E32 A;  2LVP C;  4CJ6 A;  4MM3 B;  2MH8 A;  3GQ5 A;  2Y0T A;  4JI0 M;  4IBK A;  2XSZ A;  3FTC A;  4CHT B;  2UUB M;  4G4Q A;  1HR0 M;  3KOW E;  2D7E A;  4LGY A;  4YHH M;  2JY8 A;  1D0K A;  1C7Y A;  1L2B A;  2UUC M;  2LXE A;  2R0I A;  3I4V A;  8CAT A;  4KOD A;  1A5T A;  3ZC7 B;  2X49 A;  4DV2 M;  2F5P A;  5DFL A;  1IN7 A;  3BBZ A;  4QOS A;  4X66 M;  1E94 E;  1KFV A;  4OVZ A;  4CGY B;  3CGW A;  2R45 A;  4EIW A;  4M9S A;  4IBB A;  2RGH A;  1IN5 A;  5L8R F;  1I94 M;  2ZAO A;  4LRS A;  3K9P A;  2GQF A;  3LCV B;  3TWM A;  4IBE A;  1KSF X;  2G3Q A;  2N35 A;  3KFU G;  1Z5C A;  1ZQ9 A;  3J27 B;  4FCW A;  4RF1 A;  2VF7 A;  4NL4 H;  5E6J A;  4QHS A;  4TUW A;  3HJS A;  4LJA A;  2MJ5 B;  3UGJ A;  3KXE C;  1NJF A;  2CRU A;  2F4V M;  2OOB A;  4NXN M;  2XZU A;  3A46 A;  5EP2 A;  1TH4 A;  2B3T A;  2L6O A;  1T3T A;  3KS4 A;  3MHV C;  1IM2 A;  2XH9 A;  1J5E M;  4B3S M;  2DAM A;  1QAN A;  1N32 M;  2AHM A;  2LWX A;  4B3R M;  4NRW A;  3B89 A;  4DR1 M;  2X4A A;  2C99 A;  5BPV A;  1IN4 A;  1Z6T A;  1WIV A;  3KS8 A;  2EJS A;  4GC5 A;  2R46 A;  2H5X A;  4B7F A;  4GKJ M;  4XGI A;  1FNN A;  2DZO B;  3B7Z A;  2R6F A;  1IBM M;  1YUB A;  3AJI B;  1ORY B;  4IBF A;  4LF6 M;  4WW0 A;  2JY7 A;  3SAT A;  7CAT A;  4DV6 M;  1QAM A;  4PDI A;  1IBK M;  4ZPX A;  3T38 A;  3J80 S;  4DUZ M;  1EFU B;  1JB0 F;  5ITY A;  3VKG A;  4LY6 A;  3SYL A;  4LZJ A;  2V1U A;  1IXZ A;  1N34 M;  1OAO C;  3C3E A;  3SAU A;  1WXQ A;  1R2Y A;  1DO0 A;  3GRR A;  2CV2 A;  4B7G A;  1IXR C;  1NV9 A;  2MGW A;  3FUT A;  2VQE M;  3FUX A;  1TH2 A;  3VKH A;  1PJS A;  1PM5 A;  1TGU A;  4AQY M;  4ITQ A;  4JYA M;  3R8F A;  4B3T M;  5JI2 E;  2Z8Y M;  3FTE A;  4OVZ B;  3DOA A;  2O25 A;  4GH9 A;  3PXG A;  3I01 M;  2UU9 M;  2R18 A;  1NY6 A;  4DBG B;  1WGN A;  3E46 A;  2EKK A;  4YY3 M;  5ITU A;  2KRK A;  4MGI E;  2BJW A;  2O5R A;  2L7I A;  5E26 A;  4D81 A;  2EKF A;  4GMQ A;  3AV0 A;  4GHA A;  2GNO A;  1NY5 A;  3CF0 A;  3KP1 E;  2DAE A;  2JXN A;  1XB2 B;  2EUC A;  3SHF A;  4I8O A;  2DHR A;  4LG2 A;  4DV5 M;  5KPZ A;  1QAQ A;  3FKE A;  5EP4 A;  4AG5 A;  4LF8 M;  3MJ5 A;  2LH0 A;  3NBX X;  1QAO A;  3E21 A;  1VQ1 A;  5FLX S;  1S3S A;  1YLA A;  2DZN B;  4G3O A;  3GLI A;  4WUR A;  1QZE A;  3J81 S;  4DR2 M;  1WHC A;  2LHC A;  2VDB B;  4LJ5 A;  5EQT A;  1GL7 A;  2FFJ A;  2JY5 A;  2KHH A;  4XBO A;  2O01 F;  3C9P A;  4KT0 F;  1T43 A;  1TF0 B;  4RNA A;  4A3V B;  3GLH A;  1NVM A;  1T6O A;  3B9P A;  1D2N A;  4R71 A;  2VQF M;  3QYB A;  1SXJ C;  2HWJ A;  3VK8 A;  1PJT A;  4GIT A;  1G59 A;  3RGP A;  3GP1 A;  2Z4R A;  4JI3 M;  4BLC A;  2QEN A;  4M9Z A; 
#chains in the Genus database with same CATH homology
 4PDG A;  2C96 A;  2Y21 A;  3TWK A;  1QZM A;  1SXJ D;  3SAS A;  4JI5 M;  1XNR M;  1JR3 A;  2H1R A;  3GRY A;  2D7H A;  2X8A A;  3Q8X A;  4NSR A;  3PNY A;  3E9S A;  2YQZ A;  3D8L A;  3CF6 E;  2CHV A;  3CF2 A;  2NQ8 C;  4G4R A;  4QHT A;  4DV4 M;  1OFI A;  1R6B X;  4M9X A;  1G3I A;  2EA0 A;  2Z4S A;  4LFA M;  1XXH A;  4DR4 M;  2CHQ A;  4LZZ A;  3SAW A;  3TWL A;  1TDZ A;  2KXE A;  4B7H A;  3GPU A;  3GPY A;  1IY1 A;  4FWD A;  4FWH A;  3FYD A;  4OW0 A;  2ZAN A;  4G4N A;  2OQ4 A;  1OFH A;  3HJ8 A;  3GLI B;  3OTO M;  4LF7 M;  2EO2 A;  4AW4 A;  4JI6 M;  4REZ A;  1J7K A;  2QBY A;  2K47 A;  1DGF A;  1IY2 A;  2G8L A;  3FYC A;  1G41 A;  5A2Q S;  2OPF A;  3I51 A;  3MK6 A;  4M0W A;  3GLH B;  1HQY E;  4I5S A;  3DA1 A;  3VLF B;  3TE6 A;  1NNJ A;  2E5L M;  1NSF A;  2P5T A;  4L8R C;  4NOO B;  3U6L A;  2QCU A;  4JI4 M;  2A5Y B;  2ZBK B;  4LF5 M;  5KO3 A;  3NWL A;  1R2Z A;  1Q39 A;  3KSJ A;  5ITX A;  3L26 A;  5FTK A;  4JI1 M;  1I4W A;  2F5S A;  1PJJ A;  1Z59 A;  4DUY M;  2YFQ A;  1MX0 A;  3EIH A;  3L25 A;  1DGG A;  2UXD M;  2KRU A;  4RF0 A;  5DYI A;  3IG5 A;  3J7A S;  2QPA A;  2R4J A;  3U6E A;  2I7N A;  4G6Z A;  4NXM M;  3A98 B;  3U6M A;  2FNA A;  4I81 A;  1Z5A A;  4LFB M;  5KQD A;  3CTW B;  3LVV A;  1HNW M;  4DV1 M;  1IBL M;  4IBJ A;  5DYG A;  1N75 A;  3K1J A;  3L28 A;  5JI3 E;  1JR3 D;  3UMM A;  4L15 A;  1IN6 A;  1DGH A;  3TPZ A;  4GRI A;  3AFH A;  4IJF A;  3U6P A;  4GKK M;  2ZAM A;  3PVS A;  2FE8 A;  1L8Q A;  3U6S A;  2J7N A;  3HHX A;  2DXI A;  2KA6 B;  4DR7 M;  2XLJ A;  3THG A;  3AOE A;  4LF4 M;  1TH3 A;  4LJ8 A;  2R65 A;  3AOG A;  4DR5 M;  2QBY B;  2YR0 A;  5LMU M;  1EE8 A;  4DV0 M;  3KDS E;  3U6C A;  2XSZ D;  3KSX A;  2XGN A;  2BNK A;  2CUZ A;  3HGI A;  4LCB A;  4GIP A;  4JI2 M;  3QWL A;  3K8Z A;  3JR4 A;  4DR6 M;  3L29 A;  3GQ3 A;  1YSY A;  2L7H A;  2Z7J A;  3C58 A;  2F5O A;  3SMS A;  4AKH A;  2HCB A;  5EXS A;  2I7P A;  1QQW A;  3HU1 A;  3K2L A;  4K0K M;  1IXS B;  4HL4 A;  3T15 A;  2Z3X A;  3W0F A;  4QNM A;  4BBA A;  1UM8 A;  5FTM A;  3U6O A;  1GL6 A;  3GRV A;  4KLN A;  2RGO A;  1XWI A;  3L2A A;  2DVW B;  4JXJ A;  3FUV A;  4L16 A;  1K82 A;  2CV1 A;  4AKI A;  4MGY E;  4X64 M;  4LRT A;  1GLN A;  1IY0 A;  5EP1 A;  1DO2 A;  1DGH B;  2KEB A;  3LVW A;  2W82 A;  5C1B A;  3LQR A;  2UXB M;  4GHL A;  3U60 A;  4MB7 A;  4MGZ E;  1K3X A;  1HQC A;  3UZU A;  3WHK A;  3HWS A;  2C9O A;  5ITX E;  4IBG A;  4MH0 E;  4BB9 A;  3EIE A;  5BR8 M;  3FTF A;  3JAM S;  3T1H M;  2JA2 A;  3QAU A;  2LNH C;  3RE8 A;  1GKI A;  1J09 A;  1HT1 E;  2HKJ A;  3SBJ A;  4FCT A;  2L09 A;  2UXC M;  1HT2 E;  3BOS A;  1L2C A;  1FJG M;  3KVW A;  3LQQ A;  1QVR A;  3FTD A;  1DGB A;  4LJ6 A;  4NRV A;  5EXX A;  3DFZ A;  3FD9 A;  2CHG A;  5LMN M;  3U5Z A;  1L1Z A;  1XMO M;  3A45 A;  3HJQ A;  2HHH M;  1R7R A;  3WHL A;  4P16 A;  3GLG A;  4JN6 A;  5EXT A;  3VDP A;  5FTJ A;  4B08 A;  1L2D A;  5EXP A;  2C5R A;  1E9S A;  3KOZ E;  2DWL A;  1NJG A;  2CE7 A;  2XFS A;  3FUU A;  4S12 A;  5H37 D;  2YNM D;  1GVN A;  1N78 A;  4FVM A;  4HLQ A;  4R7G A;  5KQ8 A;  2Y20 A;  2KW0 A;  3LMM A;  2Q2E B;  2J7O A;  4X62 M;  1W5T A;  3GLF A;  5DNY A;  3J2P B;  5ITR A;  3SAR A;  2ERC A;  3KOY E;  3U60 B;  3E4R A;  4FWG A;  4AI6 A;  3VK7 A;  3W0L B;  3I4Y A;  4DR3 M;  1W5S A;  2FOI C;  3IG8 A;  3GRU A;  5F3W A;  1KYI A;  3SHG B;  1E9R A;  2HL7 A;  5EP3 A;  3DZD A;  1K3W A;  3H4M A;  1JQJ C;  2C98 A;  3A42 A;  3VDU A;  3HHY A;  1XXH B;  4MGK E;  1SXJ A;  2BJV A;  1ZAE A;  3AKZ A;  3GO8 A;  1NHG C;  1XHB A;  3HHW A;  2VII A;  5FTN A;  3KOX E;  3M0E A;  5GKN A;  1HNX M;  3U6D A;  2G5G X;  2M5Z A;  5IZ7 D;  4CIS A;  1XNQ M;  5IRE B;  1QYR A;  1NHW C;  5IT9 S;  3SC3 A;  2QZ4 A;  3U5Z B;  4AG6 A;  4PCZ A;  2D7G A;  1H6U A;  1XMQ M;  2F5Q A;  3HHZ A;  3ZH9 B;  1OJL A;  4NSO B;  4D82 A;  2DWZ B;  1N36 M;  3GLG B;  4LF9 M;  3L27 A;  2C9C A;  3UK6 A;  4LJ9 A;  3TL4 X;  3U61 A;  3T1Y M;  4I4L A;  3GPP A;  2XEP A;  1NNU C;  4PT5 A;  3GPX A;  5EJC A;  4X65 M;  4IJE A;  1N33 M;  3SFZ A;  3PNV A;  2RKO A;  4D80 A;  3M7G A;  1VDD A;  5FTL A;  1G4A E;  4L78 A;  1PJI A;  4AKG A;  2V6Z M;  2CFO A;  2Y0Q A;  3D8B A;  3GLF B;  4PD2 A;  4LFC M;  4W5W A;  4IBI A;  4FD2 A;  5C18 A;  4QOZ C;  4AZF A;  4LJ7 A;  3NBI A;  4KO8 A;  3GQ4 A;  4DV7 M;  3KP0 E;  4R3D A;  2CV0 A;  2CEA A;  1Z5B A;  4IBC A;  3TQS A;  1XC8 A;  4OU7 A;  3PFI A;  2XF3 A;  4IIW A;  3ZCB B;  4QNR A;  4FW9 A;  3RFW A;  5IWA M;  3ILK A;  2DWM A;  1SXJ B;  3RGS A;  2XFT A;  4M0D A;  2F5N A;  1IQP A;  3VFD A;  5ITQ A;  4OX9 M;  1HNZ M;  3SAV A;  3FUW A;  3UJN A;  2XZF A;  2QP9 X;  3JR5 A;  2V1C A;  2DWN A;  4JV5 M;  4DV3 M;  4KHP M;  3SYK A;  4L4U A;  2KZU A;  1X37 A;  2KZS A;  1TDH A;  5FSW A;  1C1K A;  4G4O A;  3HU2 A;  4MGH A;  2UUA M;  5KPT A;  4GC9 A;  3U61 B;  4II7 A;  4LJ4 A;  2R4E A;  2R62 A;  3HKP A;  3M6A A;  4B3M M;  1MU5 A;  3AOE C;  2ZM6 M;  1N77 A;  4Z6Y A;  1Q3B A;  1L1T A;  3SMP A;  3HU3 A;  3KW6 A;  4JI8 M;  3R9X B;  3K92 A;  4LGM A;  2M60 A;  4JI7 M;  1G8P A;  1LV7 A;  1Q3C A;  4Z8X A;  1YE9 A;  5KPR A;  3AL0 C;  1SXJ E;  4FCV A;  3J7B A;  4IBD A;  1IN8 A;  3U6Q A;  5ITT A;  1E32 A;  4MM3 B;  3GQ5 A;  2Y0T A;  4JI0 M;  4IBK A;  2XSZ A;  3FTC A;  4CHT B;  2UUB M;  4G4Q A;  1HR0 M;  3KOW E;  2D7E A;  4LGY A;  4YHH M;  1L2B A;  2UUC M;  2LXE A;  3I4V A;  8CAT A;  4KOD A;  3ZC7 B;  2X49 A;  4DV2 M;  2F5P A;  1IN7 A;  4QOS A;  4X66 M;  1E94 E;  1KFV A;  4OVZ A;  4CGY B;  2R45 A;  4EIW A;  4M9S A;  4IBB A;  2RGH A;  1IN5 A;  1I94 M;  2ZAO A;  4LRS A;  3TWM A;  4IBE A;  1KSF X;  3KFU G;  1Z5C A;  1ZQ9 A;  3J27 B;  4FCW A;  4RF1 A;  5E6J A;  4NL4 H;  4QHS A;  4TUW A;  3HJS A;  4LJA A;  3UGJ A;  3KXE C;  1NJF A;  2F4V M;  4NXN M;  2XZU A;  3A46 A;  5EP2 A;  1TH4 A;  2L6O A;  1T3T A;  3KS4 A;  3MHV C;  1IM2 A;  2XH9 A;  1J5E M;  4B3S M;  1N32 M;  1QAN A;  2AHM A;  2LWX A;  4B3R M;  4NRW A;  4DR1 M;  2X4A A;  2C99 A;  5BPV A;  1IN4 A;  1Z6T A;  3KS8 A;  4GC5 A;  2R46 A;  4B7F A;  4GKJ M;  4XGI A;  1FNN A;  2DZO B;  1IBM M;  1YUB A;  3AJI B;  1ORY B;  4IBF A;  4LF6 M;  4WW0 A;  3SAT A;  7CAT A;  4DV6 M;  1QAM A;  4PDI A;  1IBK M;  4ZPX A;  3T38 A;  3J80 S;  4DUZ M;  5ITY A;  3VKG A;  4LY6 A;  3SYL A;  4LZJ A;  2V1U A;  1IXZ A;  1N34 M;  3SAU A;  1WXQ A;  1R2Y A;  1DO0 A;  3GRR A;  2CV2 A;  4B7G A;  1IXR C;  3FUT A;  2VQE M;  3FUX A;  1TH2 A;  3VKH A;  1PM5 A;  1TGU A;  4AQY M;  4ITQ A;  4JYA M;  3R8F A;  4B3T M;  5JI2 E;  3FTE A;  4OVZ B;  3DOA A;  4GH9 A;  3PXG A;  2UU9 M;  2R18 A;  1NY6 A;  4YY3 M;  5ITU A;  2KRK A;  4MGI E;  2BJW A;  2O5R A;  2L7I A;  5E26 A;  4D81 A;  4GMQ A;  3AV0 A;  4GHA A;  1NY5 A;  3CF0 A;  3KP1 E;  3SHF A;  2EUC A;  4I8O A;  2DHR A;  4LG2 A;  4DV5 M;  5KPZ A;  1QAQ A;  3FKE A;  5EP4 A;  4AG5 A;  4LF8 M;  3MJ5 A;  2LH0 A;  1QAO A;  5FLX S;  1S3S A;  2DZN B;  3GLI A;  4WUR A;  3J81 S;  4DR2 M;  4LJ5 A;  5EQT A;  1GL7 A;  2FFJ A;  4XBO A;  4RNA A;  4A3V B;  3GLH A;  1NVM A;  3B9P A;  1D2N A;  2VQF M;  1SXJ C;  3VK8 A;  4GIT A;  1G59 A;  3RGP A;  3GP1 A;  2Z4R A;  4JI3 M;  4BLC A;  2QEN A;  4M9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...