2D7GA

Crystal structure of the aa complex of the n-terminal domain of pria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
PVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7gA01
4NL4H 2D7HA 2D7GA 2DWNA 2D7EA 2DWMA 2DWLA
chains in the Genus database with same CATH superfamily
2R0IA 1VEGA 3HJSA 3QYEA 4F2LA 2JNHA 4M9SA 1VDLA 3IHPA 5ITXE 2V1UA 3I51A 4X66M 1XNRM 4G4OA 1ZMUA 2CHQA 3JR5A 1I94M 4AG6A 1X37A 4G6ZA 2W82A 2CRUA 3KOXE 2R65A 1NHGC 1V92A 1E32A 2JWSA 5ITQA 3IG8A 1R2YA 2EKFA 3GQ3A 4B3RM 3FTDA 3FUWA 4B7HA 1IXSA 1D0LA 3GLFE 3VKHA 4GKJM 3TE6A 4X65M 4IBGA 1JR3E 1VEJA 2LNHC 4LZZA 3K92A 2P5TA 3L27A 4IBBA 4LJ4A 1N36M 2UXDM 2JA2A 3NBIA 1GVNA 4L78A 4TUWA 4II7A 3JAMS 1NO1A 2HAKA 3ZQJA 1DV0A 8CATA 4G4QA 3LCUA 2XZFA 3K9PA 2G5GX 5JI3E 3E21A 1N77A 4L16A 4LF8M 5EP3A 1W5SA 3DZDA 3FE3A 1Q02A 2C9OA 2DAKA 1WGNA 2JUJA 2JXNA 3GLHA 2NQ8C 3U6DA 4LG2A 2R4EA 3HU1A 3B89A 1OIZA 4KO8A 3L28A 4JI2M 3A45A 3MK6A 3LQRA 3GLHB 4DR4M 2DHRA 4DR5M 1OIPA 2BWEA 4X62M 1GL7A 1MJGM 1R5LA 3LW5F 3SASA 5EXPA 3OTOM 1TGUA 1OQYA 2K6BA 2KZSA 3HJ8A 4ITQA 4GHAA 4JV5M 4IIWA 2QPAA 1ZMVA 3RFWA 3K9OA 4IJFA 1KYIA 5ITRA 4REZA 3BXWA 4FWGA 1L8QA 2QCUA 1E94E 2ZAMA 4MB7A 2DZOB 5EXSA 1XB2B 2L2DA 4KLNA 4AKIA 3LVWA 5GKNA 3A46A 4JYAM 4DV4M 1L2DA 5BPVA 2XH9A 3KOWE 3PVSA 2LVQD 3ZH9B 3K1JA 1XHBA 1ZAEA 4G3OA 5FTJA 3UJNA 1J5EM 2V6ZM 1IY0A 3HU2A 3M7GA 4ANRA 4PDIA 4LY6A 3W67A 1IM2A 3E4RA 1TTEA 3NWLA 5ITXA 2O5RA 3U6EA 3R9XB 1YE9A 3GLIE 3SHFA 2F4VM 2ZAOA 4Y28F 1MN3A 4L6V6 1T6OA 3UMMA 3U61B 3KVWA 3B74A 1GJTA 3LCVB 4HL4A 3U6LA 2VIIA 2DAGA 2O25A 5C1BA 3FUVA 1D0MA 2CHVA 2LXEA 2G8LA 5EXXA 4BBAA 3SATA 3U6PA 4DV2M 2QHOB 3FUUA 3HU3A 1WR1B 4DV7M 2Z3XA 2CV2A 1R4GA 4BLCA 3GPXA 2I7NA 3BOSA 3THGA 1DO0A 3FUXA 1NSFA 1K82A 3HX3A 1CUKA 1QUTA 2MGWA 2LWXA 2UXCM 2QBYA 2HKJA 2QENA 3GRRA 1SXJE 2QZ4A 2LVPC 3SAUA 2XZUA 2CFOA 2FH0A 2JP7A 2F5SA 4K0KM 4DUYM 2QBYB 5ITUA 2X49A 2OO9A 4GMQA 1PJQA 4PDGA 1R7RA 4OVZB 4WW0A 1XXHE 2KNAA 3SAVA 4JI1M 3QYBA 1YSYA 3T15A 4QOZC 1QZMA 3QWLA 4DR6M 3U6OA 3FTFA 4RF0A 2F5PA 4BB9A 2EUCA 1E9RA 5KO3A 4KHPM 1YLAA 3SYKA 4DR7M 5EQTA 2L09A 4AI6A 2D7EA 2UUBM 2HHHM 3KFUG 1EE8A 3FTCA 4LF5M 2Q2EB 2JY6B 1NNJA 3L25A 3I4YA 3FUTA 5KPRA 2C96A 1Q39A 2DWZB 4M0DA 2MROB 2XEPA 1IN7A 3FKEA 1PJTA 4IBEA 3T6PA 3CF6E 2Y20A 2DHYA 2KZUA 3VDPA 1ORYB 3I01M 3AOEA 1R6BX 3LQQA 4CISA 4S12A 1Z59A 3FRHA 4ZPXA 2QQ8A 4JI8M 3KS8A 3AOEC 3HHYA 2F5NA 1QVRA 2YNMD 4LJ5A 3VDUA 5C18A 4Q7JA 2V1CA 1NV8A 1NVMA 2GQFA 4R7GA 3GLGE 2UUCM 3J81S 2BNKA 3PNYA 1QAQA 2G3QA 4PD2A 3AKZA 2CE7A 2DENA 2XFTA 1IXSB 3EIEA 4LFCM 1D0KA 5E26A 1IBMM 2EO2A 1FNNA 5DYIA 2RGHA 1JQJC 3SMPA 1Z6TA 1K3XA 4HLQA 4DV3M 4JI4M 4LJ6A 1WHCA 3AFHA 1Z5BA 1K3WA 3D8BA 4OU7A 3LMMA 5DNYA 4P17A 1C1KA 3HJQA 5F3WA 1QYRA 2CWBA 2YR0A 1V33A 1ZQ9A 4CHTB 2OOAA 1IBLM 1VEKA 4B7GA 1TH3A 4PCZA 1VQ1A 4MM3B 4NSRA 4IBDA 1HNWM 3SBJA 3FTEA 4LZJA 1LV7A 3B9PA 4W5WA 4AKHA 2KW0A 3WHLA 2Y21A 4MGZE 1QDRA 2DXIA 2VQEM 3KS4A 2VQFM 1PGYA 2KNZA 2D7HA 1VDDA 2BWBA 3T38A 3M0EA 4XBOA 4DV0M 1MX0A 4R71A 2LVNC 3HHXA 1G71A 1Q3CA 4LRSA 1L1TA 1OTRA 4FCVA 3AOGA 1XXHA 1NHWC 3I4VA 1HR0M 1HNXM 3L29A 4RKUF 2BJVA 1ZMWA 2XF3A 2DKLA 1IXRC 4L15A 2R45A 2JY7A 1DGFA 3KSXA 2DVWB 3TWKA 4IBCA 3GQ4A 3GPPA 4RNAA 2GNOA 3PNVA 1QUSA 3J80S 3HGIA 3T1YM 1NJGA 1Z5CA 1AIPC 2FE8A 3DA1A 3FRIA 3KXEC 1IN5A 2ERCA 4FCWA 1QANA 4I8OA 4MGYE 4JI0M 3U5ZA 4I4LA 5FTNA 5FSWA 1IQPA 5BR8M 3KW6A 4MGIE 1GLNA 4LJAA 2CV1A 4CJ6A 1EIJA 3TPZA 1N75A 3ZCBB 3CTWB 4NL4H 1R2ZA 4DBGB 2F5QA 1JB0F 2JZ1A 2KDLA 3A98B 4WP2A 2CHGA 3HWSA 3L26A 4MH0E 4FW9A 1OFIA 5KQDA 1WXQA 3F92A 3J27B 1XC8A 2X8AA 2I7PA 3GLFA 1QAOA 1TR8A 3CF2A 1Q3BA 3T1HM 2R6FA 1NV9A 2BJWA 1JR3A 2Z4RA 3C3DA 3Q8XA 4QHSA 2YQZA 3PXGA 2EA0A 3BBZA 2JY5A 4DV1M 1GL6A 4LF9M 2R4JA 1EFUB 3GLFB 2DWMA 5IZ7D 2RGOA 1L2CA 1NY6A 2KEBA 3SHGB 4JI3M 5KPTA 1XNQM 2D7GA 1PRBA 4FWDA 3E46A 3PFIA 3GLHE 1NY5A 2LHCA 3AJIB 2WSEF 5IREB 3GP1A 3GRYA 3AV0A 4NOOB 2DI0A 3J2PB 2XSZA 1KSFX 5LMUM 1NJFA 2EKKA 3GRUA 1FJGM 1IN8A 2N35A 4DV5M 2CV0A 2UUAM 2Y0QA 2FNAA 2RRUA 4LFBM 4NSOB 5IT9S 2APLA 4LGYA 3D8LA 3HKPA 3NBXX 4GC5A 5EP4A 3KSJA 3VK8A 4LF7M 3FYCA 1GKIA 1WIVA 2R46A 4M0WA 3B7NA 4XGIA 3U60A 2EJSA 1OJLA 3QAUA 1KFVA 3E9SA 4JI6M 4IBIA 5JI2E 4LJ7A 7CATA 1QAMA 3ILKA 1W5TA 4R3DA 4IBJA 2ZM6M 3GPYA 3CGWA 4WURA 2L7IA 3U60B 2MR9A 4QOSA 2MH8A 3KDSE 4XK8F 1AUAA 3GRVA 4B7FA 1HNZM 1IN6A 1LTMA 4I81A 2CP8A 3IECA 3HHZA 3W0LB 3IG5A 1S3SA 3C3EA 4RF1A 3B7QA 3DFZA 4GRIA 3RE8A 4AZFA 2VF7A 4DUZM 4DV6M 5DYGA 3TWMA 3VKGA 2RKOA 4LRTA 4D81A 4LGMA 4F1IA 4LF6M 2C5RA 1MU5A 2LBCA 4LJ8A 3I04M 3J7BA 2VF8A 4JN6A 3VFDA 1IXZA 4QNMA 3U6CA 2HL7A 3GQ5A 2ZBKB 2Y0TA 1YUBA 1HT2E 3RGPA 4QHTA 3CF0A 3GLIA 2F5OA 1PJSA 4FD2A 3UGJA 2DZNB 4YHHM 1OFHA 2AHMA 1QZEA 2ZTCA 1N33M 2ZTDA 4DR2M 3DOAA 2MJ5B 1TH4A 2WZJA 4NXMM 3GLIB 5EP2A 4B08A 3SAWA 2DAMA 1T43A 1SG9A 1Z5AA 3TQSA 2YFQA 4MGHA 3ZC7B 2KXEA 5EXTA 2WSFF 1QDTA 2J5YA 2Z7JA 2K0BX 2O01F 3B7ZA 4GEWA 1PM5A 4LFAM 1C7YA 1VG5A 2J7OA 3HZJA 3EIHA 3KOZE 4G4RA 4LF4M 2C98A 2JZ0A 4D82A 3KP0E 3WHKA 1XWIA 4L4UA 1H6UA 3KP1E 2H1RA 2M60A 3HHWA 2DZLA 4GH9A 1SXJA 1WJ7A 1TDHA 3A42A 3V76A 1JR3D 1A5TA 2KHHA 1T3TA 3KOYE 1NNUC 4B3SM 2LTUA 1N34M 4GHLA 4D80A 5E6JA 2XLJA 2J7NA 1J09A 2FOIC 1SXJC 4M9ZA 1SXJB 2L6OA 3LVVA 1HQCA 5FTLA 2FFJA 3AL0C 4JI7M 2LHGA 1D2NA 4OW0A 4FVMA 2DWNA 2DAIA 2KRUA 5ITYA 1IN4A 1G3IA 3W68A 5L8RF 2XSZD 4IBKA 1XXHB 2R44A 4PT5A 1IFYA 2L7HA 1UM8A 1V34A 3L2AA 5FTMA 1DGBA 2B3TA 3U6SA 2UU9M 2OQ4A 2QP9X 3TWLA 2ZANA 2HCBA 1IBKM 3SFZA 3K2LA 4JXJA 4B3MM 3H4MA 1IY2A 3SARA 4QNRA 1N78A 3U6QA 2XGNA 4M9XA 4Z6YA 3U5ZB 4MGKE 4NXNM 3RGSA 2KRKA 4GITA 1J7KA 2FS1A 1HT1E 5A2QS 1L2BA 4DR1M 2KNVA 4NRWA 1OAOC 2VDBB 4AG5A 4OX9M 3UK6A 2HWJA 3SYLA 3U61A 1OKSA 2CEAA 2DNAA 2WSCF 1GO5A 3JR4A 5EP1A 4FCTA 4YY3M 1PJIA 3GLGA 1G41A 1OAIA 3M6AA 5IWAM 4L8RC 1RU3A 3R8FA 3C9PA 2QNJA 1TF0B 4G4NA 3VK7A 2M5ZA 1DO2A 1UFZA 2E5LM 4CIZA 4IJEA 4I5SA 1TH2A 3SC3A 2Z8YM 2XFSA 2DAEA 3HY5A 3GLGB 3MJ5A 3SMSA 2OPFA 4LJ9A 3U6MA 1P3QQ 1G8PA 3MMPA 4X64M 4GKKM 4LCBA 1TDZA 4DR3M 3W0FA 4KODA 2LH0A 2Z4SA 5FTKA 1I4WA 2H5XA 3MHVC 3TL4X 4B3TM 4GC9A 1BVSA 5ITTA 4CGYB 1G59A 3C58A 1XMOM 5KPZA 4A3VB 1HQYE 2K47A 2C99A 5H37D 1WGLA 1L1ZA 1E9SA 4OVZA 1N32M 3VLFB 3J7AS 5EJCA 3FYDA 1PJJA 1QQWA 2X4AA 4FWHA 2CUZA 1Y8GA 1SXJD 1DGGA 5DFLA 1XMQM 4NC6A 2DWLA 2L4FA 4EIWA 3K8ZA 1IY1A 3Q8GA 4KT0F 5LMNM 5FLXS 2LVAA 4IBFA 1G4AE 4AQYM 2UXBM 1GJSA 2LVOC 4UN2B 4JI5M 3FD9A 4P16A 1DGHA 4NRVA 2JY8A 2OOBA 3GO8A 4Z8XA 2L4EA 3H4JA 5KQ8A 1HJPA 1GABA 1ZV1A 4AW4A 1F4IA 4AKGA 2A5YB 2QSFX 2R18A 2K9DA 4HEOA 1DGHB 2KA6B 3UZUA 2R62A 3GPUA 2C9CA 4GIPA
chains in the Genus database with same CATH topology
3HJSA 5ITXE 4M9SA 2V1UA 3I51A 4X66M 1XNRM 4G4OA 2CHQA 1I94M 3JR5A 4AG6A 1X37A 4G6ZA 2W82A 3KOXE 2R65A 1NHGC 1E32A 5ITQA 3IG8A 1R2YA 3GQ3A 4B3RM 3FTDA 3FUWA 4B7HA 3VKHA 4GKJM 3TE6A 4X65M 4IBGA 2LNHC 4LZZA 3K92A 2P5TA 3L27A 4IBBA 4LJ4A 1N36M 2UXDM 2JA2A 3NBIA 1GVNA 4L78A 4TUWA 4II7A 3JAMS 8CATA 4G4QA 2XZFA 2G5GX 5JI3E 1N77A 4L16A 4LF8M 5EP3A 1W5SA 3DZDA 2C9OA 3GLHA 4LG2A 2NQ8C 3U6DA 2R4EA 3HU1A 4KO8A 3L28A 4JI2M 3A45A 3MK6A 3LQRA 3GLHB 4DR4M 2DHRA 4DR5M 4X62M 1GL7A 3SASA 5EXPA 3OTOM 1TGUA 4GHAA 2KZSA 3HJ8A 4ITQA 4JV5M 4IIWA 2QPAA 3RFWA 4IJFA 1KYIA 5ITRA 4REZA 4FWGA 1L8QA 2QCUA 1E94E 2ZAMA 4MB7A 2DZOB 5EXSA 4AKIA 4KLNA 3LVWA 5GKNA 3A46A 4JYAM 4DV4M 1L2DA 5BPVA 2XH9A 3KOWE 3PVSA 3ZH9B 3K1JA 1XHBA 1ZAEA 5FTJA 3UJNA 1J5EM 2V6ZM 1IY0A 3HU2A 3M7GA 4PDIA 4LY6A 1IM2A 3E4RA 3NWLA 5ITXA 2O5RA 3U6EA 3R9XB 1YE9A 3SHFA 2F4VM 2ZAOA 3U61B 3UMMA 3KVWA 4HL4A 3U6LA 2VIIA 5C1BA 3FUVA 2CHVA 2LXEA 2G8LA 5EXXA 4BBAA 3SATA 3U6PA 4DV2M 3FUUA 3HU3A 4DV7M 2Z3XA 2CV2A 4BLCA 3GPXA 2I7NA 3BOSA 3THGA 1DO0A 3FUXA 1NSFA 1K82A 2LWXA 2UXCM 2QBYA 2HKJA 2QENA 3GRRA 1SXJE 2QZ4A 2XZUA 3SAUA 2CFOA 2F5SA 4DUYM 2QBYB 5ITUA 2X49A 4GMQA 4PDGA 1R7RA 4OVZB 4WW0A 3SAVA 4JI1M 1YSYA 3T15A 4QOZC 1QZMA 3QWLA 4DR6M 3U6OA 3FTFA 4RF0A 2F5PA 4BB9A 2EUCA 1E9RA 5KO3A 4KHPM 3SYKA 4DR7M 5EQTA 2L09A 4AI6A 2D7EA 2UUBM 2HHHM 3KFUG 1EE8A 3FTCA 4LF5M 2Q2EB 1NNJA 3L25A 3I4YA 3FUTA 5KPRA 2C96A 1Q39A 2DWZB 4M0DA 2XEPA 1IN7A 3FKEA 4IBEA 3CF6E 2Y20A 2KZUA 3VDPA 1ORYB 3AOEA 1R6BX 3LQQA 4CISA 4S12A 1Z59A 4ZPXA 4JI8M 3KS8A 3AOEC 3HHYA 2F5NA 1QVRA 2YNMD 4LJ5A 3VDUA 5C18A 2V1CA 1NVMA 4R7GA 2UUCM 3J81S 2BNKA 3PNYA 1QAQA 4PD2A 3AKZA 2CE7A 2XFTA 1IXSB 3EIEA 4LFCM 5E26A 1IBMM 2EO2A 1FNNA 5DYIA 2RGHA 1JQJC 3SMPA 1Z6TA 1K3XA 4HLQA 4DV3M 4JI4M 4LJ6A 3AFHA 1Z5BA 1K3WA 3D8BA 4OU7A 3LMMA 5DNYA 1C1KA 3HJQA 5F3WA 1QYRA 2YR0A 1ZQ9A 4CHTB 1IBLM 4B7GA 1TH3A 4PCZA 4MM3B 4NSRA 4IBDA 1HNWM 3SBJA 3FTEA 4LZJA 1LV7A 3B9PA 4W5WA 4AKHA 2KW0A 3WHLA 2Y21A 4MGZE 2DXIA 2VQEM 3KS4A 2VQFM 2D7HA 1VDDA 3T38A 3M0EA 4XBOA 4DV0M 1MX0A 3HHXA 1Q3CA 1L1TA 4LRSA 4FCVA 3AOGA 1XXHA 1NHWC 3I4VA 1HR0M 1HNXM 3L29A 2BJVA 2XF3A 1IXRC 4L15A 2R45A 1DGFA 3KSXA 2DVWB 3TWKA 4IBCA 3GQ4A 3GPPA 4RNAA 3PNVA 3J80S 3HGIA 3T1YM 1NJGA 1Z5CA 2FE8A 3DA1A 3KXEC 4FCWA 4MGYE 1IN5A 2ERCA 4I8OA 1QANA 5ITTA 3U5ZA 4JI0M 4I4LA 5FTNA 5FSWA 1IQPA 5BR8M 3KW6A 4MGIE 1GLNA 4LJAA 2CV1A 3TPZA 1N75A 3ZCBB 3CTWB 4NL4H 1R2ZA 2F5QA 3A98B 2CHGA 3HWSA 3L26A 4MH0E 4FW9A 1OFIA 5KQDA 1WXQA 3J27B 1XC8A 2X8AA 2I7PA 3GLFA 1QAOA 3CF2A 1Q3BA 3T1HM 3Q8XA 2BJWA 1JR3A 2Z4RA 3PXGA 4QHSA 2EA0A 2YQZA 4DV1M 4K0KM 4LF9M 1GL6A 2R4JA 3GLFB 2DWMA 5IZ7D 2RGOA 1L2CA 1NY6A 2KEBA 3SHGB 4JI3M 5KPTA 1XNQM 2D7GA 4FWDA 3PFIA 1NY5A 3AJIB 5IREB 3GP1A 3GRYA 3AV0A 4NOOB 3J2PB 2XSZA 1KSFX 5LMUM 1NJFA 3GRUA 1FJGM 1IN8A 4DV5M 2CV0A 2UUAM 2Y0QA 2FNAA 4LFBM 4NSOB 5IT9S 4LGYA 3D8LA 3HKPA 4GC5A 5EP4A 3VK8A 3KSJA 4LF7M 3FYCA 1GKIA 2R46A 4M0WA 3U60A 4XGIA 1OJLA 3QAUA 1KFVA 3E9SA 4JI6M 4IBIA 5JI2E 4LJ7A 7CATA 1QAMA 3ILKA 1W5TA 4R3DA 4IBJA 2ZM6M 3GPYA 4WURA 2L7IA 3U60B 4QOSA 1HNZM 3KDSE 3GRVA 4B7FA 1IN6A 4I81A 3HHZA 3W0LB 3IG5A 1S3SA 4DUZM 4RF1A 3DFZA 4GRIA 3RE8A 4AZFA 4DV6M 3VKGA 3TWMA 5DYGA 2RKOA 4LRTA 4D81A 4LGMA 4LF6M 2C5RA 1MU5A 4LJ8A 3VFDA 3J7BA 4JN6A 1IXZA 4QNMA 3U6CA 2HL7A 3GQ5A 2ZBKB 2Y0TA 1YUBA 1HT2E 3RGPA 4QHTA 3CF0A 3GLIA 2F5OA 4FD2A 3UGJA 2DZNB 4YHHM 1OFHA 2AHMA 1N33M 4DR2M 3DOAA 4NXMM 1TH4A 3GLIB 5EP2A 4B08A 3SAWA 1Z5AA 3TQSA 2YFQA 4MGHA 3ZC7B 2KXEA 5EXTA 2Z7JA 1PM5A 4LFAM 2J7OA 4G4RA 3EIHA 3KOZE 4LF4M 2C98A 4D82A 3KP0E 3WHKA 1XWIA 4L4UA 1H6UA 3KP1E 2H1RA 2M60A 3HHWA 4GH9A 1SXJA 1TDHA 3A42A 1JR3D 1T3TA 3KOYE 1NNUC 4B3SM 1N34M 4GHLA 4D80A 5E6JA 2XLJA 2J7NA 1J09A 2FOIC 1SXJC 4M9ZA 1SXJB 2L6OA 3LVVA 1HQCA 5FTLA 2FFJA 3AL0C 4JI7M 1D2NA 4OW0A 4FVMA 2DWNA 2KRUA 5ITYA 1IN4A 1G3IA 2XSZD 4IBKA 1XXHB 4PT5A 2L7HA 1UM8A 3L2AA 5FTMA 1DGBA 3U6SA 2UU9M 2OQ4A 2QP9X 3TWLA 2ZANA 2HCBA 1IBKM 3SFZA 3K2LA 4JXJA 4B3MM 3H4MA 1IY2A 3SARA 4QNRA 1N78A 3U6QA 2XGNA 4M9XA 4Z6YA 3U5ZB 4MGKE 4NXNM 3RGSA 2KRKA 4GITA 1J7KA 1HT1E 5A2QS 1L2BA 4DR1M 4NRWA 4AG5A 4OX9M 3UK6A 3SYLA 3U61A 2CEAA 3JR4A 5EP1A 4FCTA 4YY3M 1PJIA 3GLGA 1G41A 3M6AA 5IWAM 4L8RC 3R8FA 4G4NA 3VK7A 2M5ZA 1DO2A 2E5LM 4IJEA 4I5SA 1TH2A 3SC3A 2XFSA 3GLGB 3MJ5A 3SMSA 2OPFA 4LJ9A 3U6MA 1G8PA 4X64M 4GKKM 4LCBA 1TDZA 4DR3M 3W0FA 4KODA 2LH0A 2Z4SA 5FTKA 1I4WA 3MHVC 3TL4X 4B3TM 4GC9A 4CGYB 1G59A 3C58A 1XMOM 5KPZA 4A3VB 1HQYE 2K47A 2C99A 5H37D 1L1ZA 1E9SA 4OVZA 1N32M 3VLFB 3J7AS 5EJCA 3FYDA 1PJJA 1QQWA 2X4AA 4FWHA 2CUZA 1SXJD 1DGGA 1XMQM 2DWLA 4EIWA 3K8ZA 1IY1A 5LMNM 5FLXS 2UXBM 4IBFA 1G4AE 4AQYM 4JI5M 3FD9A 4P16A 1DGHA 4NRVA 3GO8A 4Z8XA 5KQ8A 4AW4A 4AKGA 2A5YB 2R18A 3UZUA 1DGHB 2KA6B 3GPUA 2R62A 2C9CA 4GIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL4 H;  2D7H A;  2D7G A;  2DWN A;  2D7E A;  2DWM A;  2DWL A; 
#chains in the Genus database with same CATH topology
 2R0I A;  1VEG A;  3HJS A;  3QYE A;  4F2L A;  2JNH A;  4M9S A;  1VDL A;  3IHP A;  5ITX E;  2V1U A;  3I51 A;  4X66 M;  1XNR M;  4G4O A;  1ZMU A;  2CHQ A;  3JR5 A;  1I94 M;  4AG6 A;  1X37 A;  4G6Z A;  2W82 A;  2CRU A;  3KOX E;  2R65 A;  1NHG C;  1V92 A;  1E32 A;  2JWS A;  5ITQ A;  3IG8 A;  1R2Y A;  2EKF A;  3GQ3 A;  4B3R M;  3FTD A;  3FUW A;  4B7H A;  1IXS A;  1D0L A;  3GLF E;  3VKH A;  4GKJ M;  3TE6 A;  4X65 M;  4IBG A;  1JR3 E;  1VEJ A;  2LNH C;  4LZZ A;  3K92 A;  2P5T A;  3L27 A;  4IBB A;  4LJ4 A;  1N36 M;  2UXD M;  2JA2 A;  3NBI A;  1GVN A;  4L78 A;  4TUW A;  4II7 A;  3JAM S;  1NO1 A;  2HAK A;  3ZQJ A;  1DV0 A;  8CAT A;  4G4Q A;  3LCU A;  2XZF A;  3K9P A;  2G5G X;  5JI3 E;  3E21 A;  1N77 A;  4L16 A;  4LF8 M;  5EP3 A;  1W5S A;  3DZD A;  3FE3 A;  1Q02 A;  2C9O A;  2DAK A;  1WGN A;  2JUJ A;  2JXN A;  3GLH A;  2NQ8 C;  3U6D A;  4LG2 A;  2R4E A;  3HU1 A;  3B89 A;  1OIZ A;  4KO8 A;  3L28 A;  4JI2 M;  3A45 A;  3MK6 A;  3LQR A;  3GLH B;  4DR4 M;  2DHR A;  4DR5 M;  1OIP A;  2BWE A;  4X62 M;  1GL7 A;  1MJG M;  1R5L A;  3LW5 F;  3SAS A;  5EXP A;  3OTO M;  1TGU A;  1OQY A;  2K6B A;  2KZS A;  3HJ8 A;  4ITQ A;  4GHA A;  4JV5 M;  4IIW A;  2QPA A;  1ZMV A;  3RFW A;  3K9O A;  4IJF A;  1KYI A;  5ITR A;  4REZ A;  3BXW A;  4FWG A;  1L8Q A;  2QCU A;  1E94 E;  2ZAM A;  4MB7 A;  2DZO B;  5EXS A;  1XB2 B;  2L2D A;  4KLN A;  4AKI A;  3LVW A;  5GKN A;  3A46 A;  4JYA M;  4DV4 M;  1L2D A;  5BPV A;  2XH9 A;  3KOW E;  3PVS A;  2LVQ D;  3ZH9 B;  3K1J A;  1XHB A;  1ZAE A;  4G3O A;  5FTJ A;  3UJN A;  1J5E M;  2V6Z M;  1IY0 A;  3HU2 A;  3M7G A;  4ANR A;  4PDI A;  4LY6 A;  3W67 A;  1IM2 A;  3E4R A;  1TTE A;  3NWL A;  5ITX A;  2O5R A;  3U6E A;  3R9X B;  1YE9 A;  3GLI E;  3SHF A;  2F4V M;  2ZAO A;  4Y28 F;  1MN3 A;  4L6V 6;  1T6O A;  3UMM A;  3U61 B;  3KVW A;  3B74 A;  1GJT A;  3LCV B;  4HL4 A;  3U6L A;  2VII A;  2DAG A;  2O25 A;  5C1B A;  3FUV A;  1D0M A;  2CHV A;  2LXE A;  2G8L A;  5EXX A;  4BBA A;  3SAT A;  3U6P A;  4DV2 M;  2QHO B;  3FUU A;  3HU3 A;  1WR1 B;  4DV7 M;  2Z3X A;  2CV2 A;  1R4G A;  4BLC A;  3GPX A;  2I7N A;  3BOS A;  3THG A;  1DO0 A;  3FUX A;  1NSF A;  1K82 A;  3HX3 A;  1CUK A;  1QUT A;  2MGW A;  2LWX A;  2UXC M;  2QBY A;  2HKJ A;  2QEN A;  3GRR A;  1SXJ E;  2QZ4 A;  2LVP C;  3SAU A;  2XZU A;  2CFO A;  2FH0 A;  2JP7 A;  2F5S A;  4K0K M;  4DUY M;  2QBY B;  5ITU A;  2X49 A;  2OO9 A;  4GMQ A;  1PJQ A;  4PDG A;  1R7R A;  4OVZ B;  4WW0 A;  1XXH E;  2KNA A;  3SAV A;  4JI1 M;  3QYB A;  1YSY A;  3T15 A;  4QOZ C;  1QZM A;  3QWL A;  4DR6 M;  3U6O A;  3FTF A;  4RF0 A;  2F5P A;  4BB9 A;  2EUC A;  1E9R A;  5KO3 A;  4KHP M;  1YLA A;  3SYK A;  4DR7 M;  5EQT A;  2L09 A;  4AI6 A;  2D7E A;  2UUB M;  2HHH M;  3KFU G;  1EE8 A;  3FTC A;  4LF5 M;  2Q2E B;  2JY6 B;  1NNJ A;  3L25 A;  3I4Y A;  3FUT A;  5KPR A;  2C96 A;  1Q39 A;  2DWZ B;  4M0D A;  2MRO B;  2XEP A;  1IN7 A;  3FKE A;  1PJT A;  4IBE A;  3T6P A;  3CF6 E;  2Y20 A;  2DHY A;  2KZU A;  3VDP A;  1ORY B;  3I01 M;  3AOE A;  1R6B X;  3LQQ A;  4CIS A;  4S12 A;  1Z59 A;  3FRH A;  4ZPX A;  2QQ8 A;  4JI8 M;  3KS8 A;  3AOE C;  3HHY A;  2F5N A;  1QVR A;  2YNM D;  4LJ5 A;  3VDU A;  5C18 A;  4Q7J A;  2V1C A;  1NV8 A;  1NVM A;  2GQF A;  4R7G A;  3GLG E;  2UUC M;  3J81 S;  2BNK A;  3PNY A;  1QAQ A;  2G3Q A;  4PD2 A;  3AKZ A;  2CE7 A;  2DEN A;  2XFT A;  1IXS B;  3EIE A;  4LFC M;  1D0K A;  5E26 A;  1IBM M;  2EO2 A;  1FNN A;  5DYI A;  2RGH A;  1JQJ C;  3SMP A;  1Z6T A;  1K3X A;  4HLQ A;  4DV3 M;  4JI4 M;  4LJ6 A;  1WHC A;  3AFH A;  1Z5B A;  1K3W A;  3D8B A;  4OU7 A;  3LMM A;  5DNY A;  4P17 A;  1C1K A;  3HJQ A;  5F3W A;  1QYR A;  2CWB A;  2YR0 A;  1V33 A;  1ZQ9 A;  4CHT B;  2OOA A;  1IBL M;  1VEK A;  4B7G A;  1TH3 A;  4PCZ A;  1VQ1 A;  4MM3 B;  4NSR A;  4IBD A;  1HNW M;  3SBJ A;  3FTE A;  4LZJ A;  1LV7 A;  3B9P A;  4W5W A;  4AKH A;  2KW0 A;  3WHL A;  2Y21 A;  4MGZ E;  1QDR A;  2DXI A;  2VQE M;  3KS4 A;  2VQF M;  1PGY A;  2KNZ A;  2D7H A;  1VDD A;  2BWB A;  3T38 A;  3M0E A;  4XBO A;  4DV0 M;  1MX0 A;  4R71 A;  2LVN C;  3HHX A;  1G71 A;  1Q3C A;  4LRS A;  1L1T A;  1OTR A;  4FCV A;  3AOG A;  1XXH A;  1NHW C;  3I4V A;  1HR0 M;  1HNX M;  3L29 A;  4RKU F;  2BJV A;  1ZMW A;  2XF3 A;  2DKL A;  1IXR C;  4L15 A;  2R45 A;  2JY7 A;  1DGF A;  3KSX A;  2DVW B;  3TWK A;  4IBC A;  3GQ4 A;  3GPP A;  4RNA A;  2GNO A;  3PNV A;  1QUS A;  3J80 S;  3HGI A;  3T1Y M;  1NJG A;  1Z5C A;  1AIP C;  2FE8 A;  3DA1 A;  3FRI A;  3KXE C;  1IN5 A;  2ERC A;  4FCW A;  1QAN A;  4I8O A;  4MGY E;  4JI0 M;  3U5Z A;  4I4L A;  5FTN A;  5FSW A;  1IQP A;  5BR8 M;  3KW6 A;  4MGI E;  1GLN A;  4LJA A;  2CV1 A;  4CJ6 A;  1EIJ A;  3TPZ A;  1N75 A;  3ZCB B;  3CTW B;  4NL4 H;  1R2Z A;  4DBG B;  2F5Q A;  1JB0 F;  2JZ1 A;  2KDL A;  3A98 B;  4WP2 A;  2CHG A;  3HWS A;  3L26 A;  4MH0 E;  4FW9 A;  1OFI A;  5KQD A;  1WXQ A;  3F92 A;  3J27 B;  1XC8 A;  2X8A A;  2I7P A;  3GLF A;  1QAO A;  1TR8 A;  3CF2 A;  1Q3B A;  3T1H M;  2R6F A;  1NV9 A;  2BJW A;  1JR3 A;  2Z4R A;  3C3D A;  3Q8X A;  4QHS A;  2YQZ A;  3PXG A;  2EA0 A;  3BBZ A;  2JY5 A;  4DV1 M;  1GL6 A;  4LF9 M;  2R4J A;  1EFU B;  3GLF B;  2DWM A;  5IZ7 D;  2RGO A;  1L2C A;  1NY6 A;  2KEB A;  3SHG B;  4JI3 M;  5KPT A;  1XNQ M;  2D7G A;  1PRB A;  4FWD A;  3E46 A;  3PFI A;  3GLH E;  1NY5 A;  2LHC A;  3AJI B;  2WSE F;  5IRE B;  3GP1 A;  3GRY A;  3AV0 A;  4NOO B;  2DI0 A;  3J2P B;  2XSZ A;  1KSF X;  5LMU M;  1NJF A;  2EKK A;  3GRU A;  1FJG M;  1IN8 A;  2N35 A;  4DV5 M;  2CV0 A;  2UUA M;  2Y0Q A;  2FNA A;  2RRU A;  4LFB M;  4NSO B;  5IT9 S;  2APL A;  4LGY A;  3D8L A;  3HKP A;  3NBX X;  4GC5 A;  5EP4 A;  3KSJ A;  3VK8 A;  4LF7 M;  3FYC A;  1GKI A;  1WIV A;  2R46 A;  4M0W A;  3B7N A;  4XGI A;  3U60 A;  2EJS A;  1OJL A;  3QAU A;  1KFV A;  3E9S A;  4JI6 M;  4IBI A;  5JI2 E;  4LJ7 A;  7CAT A;  1QAM A;  3ILK A;  1W5T A;  4R3D A;  4IBJ A;  2ZM6 M;  3GPY A;  3CGW A;  4WUR A;  2L7I A;  3U60 B;  2MR9 A;  4QOS A;  2MH8 A;  3KDS E;  4XK8 F;  1AUA A;  3GRV A;  4B7F A;  1HNZ M;  1IN6 A;  1LTM A;  4I81 A;  2CP8 A;  3IEC A;  3HHZ A;  3W0L B;  3IG5 A;  1S3S A;  3C3E A;  4RF1 A;  3B7Q A;  3DFZ A;  4GRI A;  3RE8 A;  4AZF A;  2VF7 A;  4DUZ M;  4DV6 M;  5DYG A;  3TWM A;  3VKG A;  2RKO A;  4LRT A;  4D81 A;  4LGM A;  4F1I A;  4LF6 M;  2C5R A;  1MU5 A;  2LBC A;  4LJ8 A;  3I04 M;  3J7B A;  2VF8 A;  4JN6 A;  3VFD A;  1IXZ A;  4QNM A;  3U6C A;  2HL7 A;  3GQ5 A;  2ZBK B;  2Y0T A;  1YUB A;  1HT2 E;  3RGP A;  4QHT A;  3CF0 A;  3GLI A;  2F5O A;  1PJS A;  4FD2 A;  3UGJ A;  2DZN B;  4YHH M;  1OFH A;  2AHM A;  1QZE A;  2ZTC A;  1N33 M;  2ZTD A;  4DR2 M;  3DOA A;  2MJ5 B;  1TH4 A;  2WZJ A;  4NXM M;  3GLI B;  5EP2 A;  4B08 A;  3SAW A;  2DAM A;  1T43 A;  1SG9 A;  1Z5A A;  3TQS A;  2YFQ A;  4MGH A;  3ZC7 B;  2KXE A;  5EXT A;  2WSF F;  1QDT A;  2J5Y A;  2Z7J A;  2K0B X;  2O01 F;  3B7Z A;  4GEW A;  1PM5 A;  4LFA M;  1C7Y A;  1VG5 A;  2J7O A;  3HZJ A;  3EIH A;  3KOZ E;  4G4R A;  4LF4 M;  2C98 A;  2JZ0 A;  4D82 A;  3KP0 E;  3WHK A;  1XWI A;  4L4U A;  1H6U A;  3KP1 E;  2H1R A;  2M60 A;  3HHW A;  2DZL A;  4GH9 A;  1SXJ A;  1WJ7 A;  1TDH A;  3A42 A;  3V76 A;  1JR3 D;  1A5T A;  2KHH A;  1T3T A;  3KOY E;  1NNU C;  4B3S M;  2LTU A;  1N34 M;  4GHL A;  4D80 A;  5E6J A;  2XLJ A;  2J7N A;  1J09 A;  2FOI C;  1SXJ C;  4M9Z A;  1SXJ B;  2L6O A;  3LVV A;  1HQC A;  5FTL A;  2FFJ A;  3AL0 C;  4JI7 M;  2LHG A;  1D2N A;  4OW0 A;  4FVM A;  2DWN A;  2DAI A;  2KRU A;  5ITY A;  1IN4 A;  1G3I A;  3W68 A;  5L8R F;  2XSZ D;  4IBK A;  1XXH B;  2R44 A;  4PT5 A;  1IFY A;  2L7H A;  1UM8 A;  1V34 A;  3L2A A;  5FTM A;  1DGB A;  2B3T A;  3U6S A;  2UU9 M;  2OQ4 A;  2QP9 X;  3TWL A;  2ZAN A;  2HCB A;  1IBK M;  3SFZ A;  3K2L A;  4JXJ A;  4B3M M;  3H4M A;  1IY2 A;  3SAR A;  4QNR A;  1N78 A;  3U6Q A;  2XGN A;  4M9X A;  4Z6Y A;  3U5Z B;  4MGK E;  4NXN M;  3RGS A;  2KRK A;  4GIT A;  1J7K A;  2FS1 A;  1HT1 E;  5A2Q S;  1L2B A;  4DR1 M;  2KNV A;  4NRW A;  1OAO C;  2VDB B;  4AG5 A;  4OX9 M;  3UK6 A;  2HWJ A;  3SYL A;  3U61 A;  1OKS A;  2CEA A;  2DNA A;  2WSC F;  1GO5 A;  3JR4 A;  5EP1 A;  4FCT A;  4YY3 M;  1PJI A;  3GLG A;  1G41 A;  1OAI A;  3M6A A;  5IWA M;  4L8R C;  1RU3 A;  3R8F A;  3C9P A;  2QNJ A;  1TF0 B;  4G4N A;  3VK7 A;  2M5Z A;  1DO2 A;  1UFZ A;  2E5L M;  4CIZ A;  4IJE A;  4I5S A;  1TH2 A;  3SC3 A;  2Z8Y M;  2XFS A;  2DAE A;  3HY5 A;  3GLG B;  3MJ5 A;  3SMS A;  2OPF A;  4LJ9 A;  3U6M A;  1P3Q Q;  1G8P A;  3MMP A;  4X64 M;  4GKK M;  4LCB A;  1TDZ A;  4DR3 M;  3W0F A;  4KOD A;  2LH0 A;  2Z4S A;  5FTK A;  1I4W A;  2H5X A;  3MHV C;  3TL4 X;  4B3T M;  4GC9 A;  1BVS A;  5ITT A;  4CGY B;  1G59 A;  3C58 A;  1XMO M;  5KPZ A;  4A3V B;  1HQY E;  2K47 A;  2C99 A;  5H37 D;  1WGL A;  1L1Z A;  1E9S A;  4OVZ A;  1N32 M;  3VLF B;  3J7A S;  5EJC A;  3FYD A;  1PJJ A;  1QQW A;  2X4A A;  4FWH A;  2CUZ A;  1Y8G A;  1SXJ D;  1DGG A;  5DFL A;  1XMQ M;  4NC6 A;  2DWL A;  2L4F A;  4EIW A;  3K8Z A;  1IY1 A;  3Q8G A;  4KT0 F;  5LMN M;  5FLX S;  2LVA A;  4IBF A;  1G4A E;  4AQY M;  2UXB M;  1GJS A;  2LVO C;  4UN2 B;  4JI5 M;  3FD9 A;  4P16 A;  1DGH A;  4NRV A;  2JY8 A;  2OOB A;  3GO8 A;  4Z8X A;  2L4E A;  3H4J A;  5KQ8 A;  1HJP A;  1GAB A;  1ZV1 A;  4AW4 A;  1F4I A;  4AKG A;  2A5Y B;  2QSF X;  2R18 A;  2K9D A;  4HEO A;  1DGH B;  2KA6 B;  3UZU A;  2R62 A;  3GPU A;  2C9C A;  4GIP A; 
#chains in the Genus database with same CATH homology
 3HJS A;  5ITX E;  4M9S A;  2V1U A;  3I51 A;  4X66 M;  1XNR M;  4G4O A;  2CHQ A;  1I94 M;  3JR5 A;  4AG6 A;  1X37 A;  4G6Z A;  2W82 A;  3KOX E;  2R65 A;  1NHG C;  1E32 A;  5ITQ A;  3IG8 A;  1R2Y A;  3GQ3 A;  4B3R M;  3FTD A;  3FUW A;  4B7H A;  3VKH A;  4GKJ M;  3TE6 A;  4X65 M;  4IBG A;  2LNH C;  4LZZ A;  3K92 A;  2P5T A;  3L27 A;  4IBB A;  4LJ4 A;  1N36 M;  2UXD M;  2JA2 A;  3NBI A;  1GVN A;  4L78 A;  4TUW A;  4II7 A;  3JAM S;  8CAT A;  4G4Q A;  2XZF A;  2G5G X;  5JI3 E;  1N77 A;  4L16 A;  4LF8 M;  5EP3 A;  1W5S A;  3DZD A;  2C9O A;  3GLH A;  4LG2 A;  2NQ8 C;  3U6D A;  2R4E A;  3HU1 A;  4KO8 A;  3L28 A;  4JI2 M;  3A45 A;  3MK6 A;  3LQR A;  3GLH B;  4DR4 M;  2DHR A;  4DR5 M;  4X62 M;  1GL7 A;  3SAS A;  5EXP A;  3OTO M;  1TGU A;  4GHA A;  2KZS A;  3HJ8 A;  4ITQ A;  4JV5 M;  4IIW A;  2QPA A;  3RFW A;  4IJF A;  1KYI A;  5ITR A;  4REZ A;  4FWG A;  1L8Q A;  2QCU A;  1E94 E;  2ZAM A;  4MB7 A;  2DZO B;  5EXS A;  4AKI A;  4KLN A;  3LVW A;  5GKN A;  3A46 A;  4JYA M;  4DV4 M;  1L2D A;  5BPV A;  2XH9 A;  3KOW E;  3PVS A;  3ZH9 B;  3K1J A;  1XHB A;  1ZAE A;  5FTJ A;  3UJN A;  1J5E M;  2V6Z M;  1IY0 A;  3HU2 A;  3M7G A;  4PDI A;  4LY6 A;  1IM2 A;  3E4R A;  3NWL A;  5ITX A;  2O5R A;  3U6E A;  3R9X B;  1YE9 A;  3SHF A;  2F4V M;  2ZAO A;  3U61 B;  3UMM A;  3KVW A;  4HL4 A;  3U6L A;  2VII A;  5C1B A;  3FUV A;  2CHV A;  2LXE A;  2G8L A;  5EXX A;  4BBA A;  3SAT A;  3U6P A;  4DV2 M;  3FUU A;  3HU3 A;  4DV7 M;  2Z3X A;  2CV2 A;  4BLC A;  3GPX A;  2I7N A;  3BOS A;  3THG A;  1DO0 A;  3FUX A;  1NSF A;  1K82 A;  2LWX A;  2UXC M;  2QBY A;  2HKJ A;  2QEN A;  3GRR A;  1SXJ E;  2QZ4 A;  2XZU A;  3SAU A;  2CFO A;  2F5S A;  4DUY M;  2QBY B;  5ITU A;  2X49 A;  4GMQ A;  4PDG A;  1R7R A;  4OVZ B;  4WW0 A;  3SAV A;  4JI1 M;  1YSY A;  3T15 A;  4QOZ C;  1QZM A;  3QWL A;  4DR6 M;  3U6O A;  3FTF A;  4RF0 A;  2F5P A;  4BB9 A;  2EUC A;  1E9R A;  5KO3 A;  4KHP M;  3SYK A;  4DR7 M;  5EQT A;  2L09 A;  4AI6 A;  2D7E A;  2UUB M;  2HHH M;  3KFU G;  1EE8 A;  3FTC A;  4LF5 M;  2Q2E B;  1NNJ A;  3L25 A;  3I4Y A;  3FUT A;  5KPR A;  2C96 A;  1Q39 A;  2DWZ B;  4M0D A;  2XEP A;  1IN7 A;  3FKE A;  4IBE A;  3CF6 E;  2Y20 A;  2KZU A;  3VDP A;  1ORY B;  3AOE A;  1R6B X;  3LQQ A;  4CIS A;  4S12 A;  1Z59 A;  4ZPX A;  4JI8 M;  3KS8 A;  3AOE C;  3HHY A;  2F5N A;  1QVR A;  2YNM D;  4LJ5 A;  3VDU A;  5C18 A;  2V1C A;  1NVM A;  4R7G A;  2UUC M;  3J81 S;  2BNK A;  3PNY A;  1QAQ A;  4PD2 A;  3AKZ A;  2CE7 A;  2XFT A;  1IXS B;  3EIE A;  4LFC M;  5E26 A;  1IBM M;  2EO2 A;  1FNN A;  5DYI A;  2RGH A;  1JQJ C;  3SMP A;  1Z6T A;  1K3X A;  4HLQ A;  4DV3 M;  4JI4 M;  4LJ6 A;  3AFH A;  1Z5B A;  1K3W A;  3D8B A;  4OU7 A;  3LMM A;  5DNY A;  1C1K A;  3HJQ A;  5F3W A;  1QYR A;  2YR0 A;  1ZQ9 A;  4CHT B;  1IBL M;  4B7G A;  1TH3 A;  4PCZ A;  4MM3 B;  4NSR A;  4IBD A;  1HNW M;  3SBJ A;  3FTE A;  4LZJ A;  1LV7 A;  3B9P A;  4W5W A;  4AKH A;  2KW0 A;  3WHL A;  2Y21 A;  4MGZ E;  2DXI A;  2VQE M;  3KS4 A;  2VQF M;  2D7H A;  1VDD A;  3T38 A;  3M0E A;  4XBO A;  4DV0 M;  1MX0 A;  3HHX A;  1Q3C A;  1L1T A;  4LRS A;  4FCV A;  3AOG A;  1XXH A;  1NHW C;  3I4V A;  1HR0 M;  1HNX M;  3L29 A;  2BJV A;  2XF3 A;  1IXR C;  4L15 A;  2R45 A;  1DGF A;  3KSX A;  2DVW B;  3TWK A;  4IBC A;  3GQ4 A;  3GPP A;  4RNA A;  3PNV A;  3J80 S;  3HGI A;  3T1Y M;  1NJG A;  1Z5C A;  2FE8 A;  3DA1 A;  3KXE C;  4FCW A;  4MGY E;  1IN5 A;  2ERC A;  4I8O A;  1QAN A;  5ITT A;  3U5Z A;  4JI0 M;  4I4L A;  5FTN A;  5FSW A;  1IQP A;  5BR8 M;  3KW6 A;  4MGI E;  1GLN A;  4LJA A;  2CV1 A;  3TPZ A;  1N75 A;  3ZCB B;  3CTW B;  4NL4 H;  1R2Z A;  2F5Q A;  3A98 B;  2CHG A;  3HWS A;  3L26 A;  4MH0 E;  4FW9 A;  1OFI A;  5KQD A;  1WXQ A;  3J27 B;  1XC8 A;  2X8A A;  2I7P A;  3GLF A;  1QAO A;  3CF2 A;  1Q3B A;  3T1H M;  3Q8X A;  2BJW A;  1JR3 A;  2Z4R A;  3PXG A;  4QHS A;  2EA0 A;  2YQZ A;  4DV1 M;  4K0K M;  4LF9 M;  1GL6 A;  2R4J A;  3GLF B;  2DWM A;  5IZ7 D;  2RGO A;  1L2C A;  1NY6 A;  2KEB A;  3SHG B;  4JI3 M;  5KPT A;  1XNQ M;  2D7G A;  4FWD A;  3PFI A;  1NY5 A;  3AJI B;  5IRE B;  3GP1 A;  3GRY A;  3AV0 A;  4NOO B;  3J2P B;  2XSZ A;  1KSF X;  5LMU M;  1NJF A;  3GRU A;  1FJG M;  1IN8 A;  4DV5 M;  2CV0 A;  2UUA M;  2Y0Q A;  2FNA A;  4LFB M;  4NSO B;  5IT9 S;  4LGY A;  3D8L A;  3HKP A;  4GC5 A;  5EP4 A;  3VK8 A;  3KSJ A;  4LF7 M;  3FYC A;  1GKI A;  2R46 A;  4M0W A;  3U60 A;  4XGI A;  1OJL A;  3QAU A;  1KFV A;  3E9S A;  4JI6 M;  4IBI A;  5JI2 E;  4LJ7 A;  7CAT A;  1QAM A;  3ILK A;  1W5T A;  4R3D A;  4IBJ A;  2ZM6 M;  3GPY A;  4WUR A;  2L7I A;  3U60 B;  4QOS A;  1HNZ M;  3KDS E;  3GRV A;  4B7F A;  1IN6 A;  4I81 A;  3HHZ A;  3W0L B;  3IG5 A;  1S3S A;  4DUZ M;  4RF1 A;  3DFZ A;  4GRI A;  3RE8 A;  4AZF A;  4DV6 M;  3VKG A;  3TWM A;  5DYG A;  2RKO A;  4LRT A;  4D81 A;  4LGM A;  4LF6 M;  2C5R A;  1MU5 A;  4LJ8 A;  3VFD A;  3J7B A;  4JN6 A;  1IXZ A;  4QNM A;  3U6C A;  2HL7 A;  3GQ5 A;  2ZBK B;  2Y0T A;  1YUB A;  1HT2 E;  3RGP A;  4QHT A;  3CF0 A;  3GLI A;  2F5O A;  4FD2 A;  3UGJ A;  2DZN B;  4YHH M;  1OFH A;  2AHM A;  1N33 M;  4DR2 M;  3DOA A;  4NXM M;  1TH4 A;  3GLI B;  5EP2 A;  4B08 A;  3SAW A;  1Z5A A;  3TQS A;  2YFQ A;  4MGH A;  3ZC7 B;  2KXE A;  5EXT A;  2Z7J A;  1PM5 A;  4LFA M;  2J7O A;  4G4R A;  3EIH A;  3KOZ E;  4LF4 M;  2C98 A;  4D82 A;  3KP0 E;  3WHK A;  1XWI A;  4L4U A;  1H6U A;  3KP1 E;  2H1R A;  2M60 A;  3HHW A;  4GH9 A;  1SXJ A;  1TDH A;  3A42 A;  1JR3 D;  1T3T A;  3KOY E;  1NNU C;  4B3S M;  1N34 M;  4GHL A;  4D80 A;  5E6J A;  2XLJ A;  2J7N A;  1J09 A;  2FOI C;  1SXJ C;  4M9Z A;  1SXJ B;  2L6O A;  3LVV A;  1HQC A;  5FTL A;  2FFJ A;  3AL0 C;  4JI7 M;  1D2N A;  4OW0 A;  4FVM A;  2DWN A;  2KRU A;  5ITY A;  1IN4 A;  1G3I A;  2XSZ D;  4IBK A;  1XXH B;  4PT5 A;  2L7H A;  1UM8 A;  3L2A A;  5FTM A;  1DGB A;  3U6S A;  2UU9 M;  2OQ4 A;  2QP9 X;  3TWL A;  2ZAN A;  2HCB A;  1IBK M;  3SFZ A;  3K2L A;  4JXJ A;  4B3M M;  3H4M A;  1IY2 A;  3SAR A;  4QNR A;  1N78 A;  3U6Q A;  2XGN A;  4M9X A;  4Z6Y A;  3U5Z B;  4MGK E;  4NXN M;  3RGS A;  2KRK A;  4GIT A;  1J7K A;  1HT1 E;  5A2Q S;  1L2B A;  4DR1 M;  4NRW A;  4AG5 A;  4OX9 M;  3UK6 A;  3SYL A;  3U61 A;  2CEA A;  3JR4 A;  5EP1 A;  4FCT A;  4YY3 M;  1PJI A;  3GLG A;  1G41 A;  3M6A A;  5IWA M;  4L8R C;  3R8F A;  4G4N A;  3VK7 A;  2M5Z A;  1DO2 A;  2E5L M;  4IJE A;  4I5S A;  1TH2 A;  3SC3 A;  2XFS A;  3GLG B;  3MJ5 A;  3SMS A;  2OPF A;  4LJ9 A;  3U6M A;  1G8P A;  4X64 M;  4GKK M;  4LCB A;  1TDZ A;  4DR3 M;  3W0F A;  4KOD A;  2LH0 A;  2Z4S A;  5FTK A;  1I4W A;  3MHV C;  3TL4 X;  4B3T M;  4GC9 A;  4CGY B;  1G59 A;  3C58 A;  1XMO M;  5KPZ A;  4A3V B;  1HQY E;  2K47 A;  2C99 A;  5H37 D;  1L1Z A;  1E9S A;  4OVZ A;  1N32 M;  3VLF B;  3J7A S;  5EJC A;  3FYD A;  1PJJ A;  1QQW A;  2X4A A;  4FWH A;  2CUZ A;  1SXJ D;  1DGG A;  1XMQ M;  2DWL A;  4EIW A;  3K8Z A;  1IY1 A;  5LMN M;  5FLX S;  2UXB M;  4IBF A;  1G4A E;  4AQY M;  4JI5 M;  3FD9 A;  4P16 A;  1DGH A;  4NRV A;  3GO8 A;  4Z8X A;  5KQ8 A;  4AW4 A;  4AKG A;  2A5Y B;  2R18 A;  3UZU A;  1DGH B;  2KA6 B;  3GPU A;  2R62 A;  2C9C A;  4GIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...