2D7GA

Crystal structure of the aa complex of the n-terminal domain of pria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
PVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Primosomal protein N'
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7gA01
2DWLA 4NL4H 2D7EA 2DWNA 2D7GA 2DWMA 2D7HA
chains in the Genus database with same CATH superfamily
1V33A 3IECA 3ILKA 2RGOA 3KDSE 1K3WA 1W5SA 2VF7A 1WR1B 1NVMA 3U6QA 1N34M 1HNWM 2FH0A 4X64M 4II7A 3HKPA 4NC6A 1MU5A 3FTCA 2JP7A 4MGIE 3GLFA 3SMSA 3L26A 3EIEA 1KFVA 3A45A 3TQSA 2DVWB 3SYKA 3TWLA 2X8AA 1IXSB 5IT9S 5FTNA 2X4AA 2CV1A 2DXIA 1R2ZA 1D0KA 2CWBA 4QHSA 2CV0A 1DGHB 3IG8A 1OAIA 2MR9A 3HU3A 4LCBA 2DWMA 1GABA 4LJ5A 4R7GA 2QENA 2LXEA 1G71A 3DA1A 2KNVA 5IREB 1YLAA 1E9RA 1G3IA 4IBBA 1N33M 2HKJA 3GLGB 1IY0A 1GL7A 1PJQA 4GRIA 4M9XA 2HAKA 2XZUA 1NY5A 2YFQA 4IBCA 4LRTA 5EXTA 3UZUA 1T43A 3SC3A 3LVVA 2LVPC 4X62M 2LH0A 3U6EA 3V76A 4HEOA 2F5PA 3RGPA 3LCVB 4KO8A 5ITQA 3LMMA 3GQ3A 3U6DA 2XSZA 3VK7A 2FE8A 4RKUF 3E21A 3HY5A 2H5XA 3PNYA 3K92A 4I81A 1BVSA 4OVZA 2RRUA 2N35A 5IWAM 3SBJA 3I01M 4JYAM 3KFUG 2ZTDA 4GKKM 4Q7JA 3AOGA 3VLFB 1R2YA 3W67A 4NL4H 2DZOB 2O01F 3SHFA 3FYCA 1D0LA 4DR7M 1L2BA 2KZUA 1ZMUA 2HCBA 3NWLA 5EXXA 4LF7M 1ZMWA 1NNJA 2OQ4A 3GRVA 1L1ZA 3LQQA 1MJGM 4X66M 2Q2EB 2R62A 1IXSA 2I7NA 4R3DA 1QYRA 2DAEA 3GLIB 1IQPA 5IZ7D 2JA2A 2QPAA 4LFCM 4QHTA 1QQWA 2L4FA 2DHYA 2W82A 4GIPA 4JI7M 4K0KM 1OIPA 2OO9A 4IBIA 5FLXS 1GL6A 2F4VM 5FTKA 4IBGA 4R71A 3CTWB 4B3SM 4M9SA 2DAKA 1XB2B 1FJGM 2UXCM 2WSCF 3Q8GA 4IBDA 3MK6A 3L28A 1OTRA 2FS1A 3VK8A 2FFJA 1GJTA 1TDZA 3J2PB 4DR1M 2JXNA 1Q3BA 4NXNM 4EIWA 2J7NA 5JI2E 2GQFA 5KO3A 4PDGA 1AUAA 1SG9A 3SASA 1VDLA 2XEPA 5FTLA 1NHGC 1ZQ9A 4AKIA 1OIZA 1NJGA 4I4LA 3KVWA 4I5SA 2CV2A 4KHPM 1QAMA 3W0LB 2QSFX 4QOZC 2F5SA 3KP0E 3TE6A 2QBYB 1XC8A 1UM8A 3AOEA 5C1BA 3GPYA 3SAVA 3GLGE 4Y28F 3LVWA 4BLCA 2DZLA 2VIIA 3C58A 3PNVA 1T3TA 5KPZA 3B7QA 3KOZE 4DR2M 2KHHA 3AOEC 3AL0C 4GC5A 3DFZA 1HQCA 3C9PA 2B3TA 4IJFA 2XH9A 4I8OA 3UMMA 4B3TM 3K1JA 4IJEA 5EXSA 1IBKM 3GP1A 3HWSA 4FCWA 2UXDM 1XXHB 4LFBM 3F92A 3T38A 4M0DA 4FWDA 3HHZA 1TH3A 1J09A 4QOSA 1G59A 2R18A 1IBLM 3W0FA 4G6ZA 1OAOC 1KSFX 2R44A 3CF0A 1VQ1A 2L6OA 5E26A 1VG5A 5KPRA 4LG2A 4AKHA 3HHYA 2Z4RA 3L27A 4M0WA 1TH2A 2YNMD 4L8RC 4DUYM 3FTFA 3MHVC 2KRUA 4Z8XA 3I4VA 3U60A 4LRSA 2BJWA 2EKFA 2R6FA 2Y0TA 2D7HA 2MROB 1P3QQ 3AJIB 3FD9A 3H4MA 5KQDA 4DV6M 1A5TA 2APLA 3DOAA 3T1HM 2QNJA 3ZCBB 1WJ7A 4L6V6 1ORYB 1IN6A 2C96A 4IBFA 3ZC7B 4B7FA 5C18A 2F5OA 4F2LA 4G3OA 4DR3M 4FWHA 2DI0A 4B7GA 1GJSA 3W68A 1GKIA 2BJVA 4G4QA 2J5YA 2DWZB 1NV8A 4GEWA 3J80S 3ZQJA 4B3MM 1QAQA 4OX9M 1XMOM 3T1YM 1E32A 1EE8A 5DFLA 1OQYA 4LF9M 1KYIA 3TWKA 1NSFA 3AFHA 4FVMA 3TPZA 4WW0A 1F4IA 3GPPA 4MGYE 2AHMA 4P17A 2K6BA 2VQEM 3RFWA 4AI6A 3FUUA 5KPTA 4CGYB 3E4RA 3SARA 3E46A 1J5EM 2UUAM 3J27B 1WGNA 1V34A 1C1KA 1IXRC 1NY6A 2Z7JA 1N36M 4NOOB 2JY5A 1XXHA 3VKGA 2G5GX 3FYDA 3QAUA 2ZAOA 2EJSA 2JY7A 1SXJC 3HU1A 2QHOB 3KS4A 3PXGA 2DAMA 1WGLA 1Y8GA 3SATA 3GRRA 1HNZM 3R8FA 4LZJA 3GLHA 4TUWA 2XLJA 2X49A 1K82A 4LF8M 4IBEA 4LGYA 4LJ8A 3FUXA 1QAOA 3HZJA 1SXJA 4LF4M 2KNAA 3UK6A 3SAWA 4L78A 1QDRA 3A98B 3D8LA 4G4RA 3U6MA 1XMQM 4WP2A 1DGFA 5EQTA 1Z5AA 2ZANA 1JR3D 4HL4A 4GMQA 1IXZA 2GNOA 4JXJA 5GKNA 1Q02A 1NJFA 3PVSA 1E9SA 3K2LA 4D80A 2P5TA 2XZFA 4PCZA 5ITRA 2R46A 4JI1M 1N32M 3GQ4A 5ITXA 3OTOM 5H37D 3GLFE 4P16A 5KQ8A 3THGA 3GPXA 1NV9A 1SXJD 2BWBA 4XK8F 2ZM6M 3FE3A 4XGIA 2CEAA 4YY3M 3M6AA 3RE8A 1X37A 4MB7A 4W5WA 1R6BX 1WIVA 2CUZA 2L2DA 3JAMS 4JN6A 4B7HA 3NBXX 8CATA 1IY2A 2KDLA 4IBKA 1PJSA 3UJNA 3SMPA 1DGBA 1TGUA 2FOIC 2DNAA 4REZA 3KOXE 3GLIA 1VEKA 1VEGA 1Z6TA 5E6JA 1H6UA 4D82A 2G8LA 1PJTA 5JI3E 3U5ZB 3Q8XA 1E94E 2MH8A 2Y0QA 3HGIA 3HU2A 2JZ0A 4OU7A 1XNQM 4DV5M 3U60B 4GKJM 2O25A 3J7AS 4JI3M 1TTEA 3HJSA 5EP4A 3I51A 3FTEA 1DGGA 1SXJB 2WZJA 3K9PA 4FWGA 1G4AE 4DV4M 4UN2B 3M0EA 2MGWA 2JY6B 5FTMA 3GLHB 1GO5A 2R0IA 2V1UA 3FRHA 1DO0A 4D81A 3AV0A 4BBAA 2I7PA 2QZ4A 2H1RA 4LJ6A 4ZPXA 2QBYA 5DYIA 3L2AA 2LVQD 1L2CA 1NO1A 4CISA 4F1IA 5FSWA 2Z3XA 3BXWA 1IY1A 1WXQA 2ZAMA 4AG5A 1YSYA 3IHPA 1AIPC 3C3DA 2DAGA 2JY8A 3HX3A 1ZMVA 2QP9X 3A42A 3QYEA 2CE7A 2LHCA 4NSRA 2A5YB 2EA0A 2K47A 1QANA 1RU3A 4GITA 4FW9A 5L8RF 4ANRA 2DHRA 4YHHM 3JR4A 2DAIA 2EO2A 4JI4M 2M60A 3M7GA 2LHGA 4L15A 4KLNA 4CHTB 2JUJA 4MGKE 1Q3CA 1QDTA 3GRYA 4GHAA 1DV0A 1YUBA 4WURA 2EUCA 1VEJA 1TDHA 2YQZA 3FUVA 1Z5BA 4RF0A 1HR0M 4JI6M 2JZ1A 4PD2A 2Z8YM 3FUWA 1G41A 1W5TA 4OW0A 3SAUA 3HHWA 2EKKA 2R4EA 5ITTA 3A46A 4NRVA 2UXBM 1OFIA 4MH0E 4XBOA 2LNHC 4LFAM 4DBGB 2HHHM 4RNAA 1HT1E 5EJCA 2DWLA 3WHLA 4GHLA 4IBJA 4DR6M 1R7RA 1Q39A 5BR8M 2F5NA 1PJIA 2C9OA 2M5ZA 1QUSA 2KA6B 3FUTA 3HHXA 3FTDA 3I4YA 4GC9A 1D2NA 1XHBA 1EFUB 4FD2A 3SHGB 1EIJA 3NBIA 3QWLA 3K8ZA 1IN7A 4NSOB 2UUCM 2Y21A 1IN8A 2WSEF 5BPVA 3MMPA 4JI0M 1J7KA 2C99A 2ZTCA 1PM5A 2L7HA 3B89A 5LMNM 5ITXE 3LW5F 2YR0A 4CIZA 3FRIA 2LWXA 1DO2A 5LMUM 3GO8A 4LGMA 2KEBA 1HNXM 3JR5A 3QYBA 4NXMM 2CRUA 5DNYA 4DV3M 4LZZA 1PRBA 4JI2M 2E5LM 4AW4A 1IN5A 1IFYA 2K9DA 1FNNA 2KRKA 2J7OA 1MX0A 3GLHE 1N77A 1IN4A 1PJJA 3GQ5A 3B7ZA 4AG6A 7CATA 1SXJE 3VDPA 2CHGA 4DV7M 3U6PA 3L25A 3J81S 3HJQA 2LVAA 1CUKA 4OVZB 1N78A 1C7YA 2MJ5B 4FCTA 3J7BA 3VFDA 3KOYE 1JB0F 2CHQA 3BBZA 4X65M 4JI8M 4DR4M 2DZNB 3I04M 3U6SA 4L4UA 3UGJA 4S12A 2OOAA 2V1CA 1XXHE 3TL4X 2OOBA 2O5RA 2DWNA 4BB9A 1YE9A 3KXEC 4DV2M 4DUZM 1S3SA 1HT2E 2L09A 3U61B 4DR5M 2HWJA 4GH9A 4NRWA 4Z6YA 1HQYE 2G3QA 1G8PA 5EP2A 3GLGA 3R9XB 1OJLA 2R45A 3DZDA 2KNZA 4IIWA 3CF6E 4KT0F 2XF3A 3U6LA 3T6PA 2LVNC 2F5QA 2LBCA 3T15A 4HLQA 2VDBB 4LJAA 2FNAA 2KZSA 2BWEA 2QCUA 4LJ4A 1WHCA 3VKHA 2CHVA 3HJ8A 2OPFA 4MGHA 5F3WA 3WHKA 4PDIA 1I94M 3K9OA 2CFOA 2QQ8A 3PFIA 4CJ6A 3GLFB 2Y20A 2LVOC 2NQ8C 2JNHA 1V92A 3LCUA 2K0BX 1L2DA 3B7NA 2C5RA 1MN3A 1Z59A 2Z4SA 3CGWA 4A3VB 1OFHA 4FCVA 3H4JA 2RKOA 5EXPA 3SFZA 1JR3A 1HJPA 2KW0A 2V6ZM 1JR3E 1L8QA 3B74A 3EIHA 2D7GA 5EP1A 1TR8A 1VDDA 3C3EA 1IM2A 4LJ9A 3GRUA 1XWIA 4AQYM 4MM3B 1NNUC 1GLNA 1D0MA 1Z5CA 4LF6M 2DENA 3U61A 2BNKA 3IG5A 4JV5M 1UFZA 3U6OA 2D7EA 3KW6A 4AKGA 5FTJA 2HL7A 1TH4A 1GVNA 3GLIE 2KXEA 3KSJA 3LQRA 5ITUA 1QZMA 3FKEA 5A2QS 1L1TA 3U6CA 1QVRA 2WSFF 2XFSA 5ITYA 1I4WA 3E9SA 3KSXA 2LTUA 1ZAEA 3L29A 5DYGA 1QZEA 1ZV1A 2CP8A 4RF1A 4DV1M 4ITQA 4LF5M 1DGHA 4MGZE 4DV0M 4G4NA 1IBMM 3B9PA 1T6OA 3KP1E 4PT5A 4G4OA 3TWMA 2UU9M 1R5LA 1QUTA 1K3XA 3AKZA 2UUBM 3VDUA 4QNMA 2L4EA 2C98A 1OKSA 4LJ7A 4L16A 4JI5M 2XSZD 1PGYA 3ZH9B 3U5ZA 2ERCA 1N75A 3KS8A 2C9CA 4QNRA 1NHWC 1JQJC 2JWSA 4AZFA 3CF2A 2VQFM 4LY6A 1XNRM 1TF0B 2R4JA 1R4GA 4KODA 3KOWE 5EP3A 3GPUA 3D8BA 4M9ZA 2DKLA 1LTMA 1LV7A 3MJ5A 4B3RM 2VF8A 3RGSA 2L7IA 4B08A 2XFTA 3SYLA 2XGNA 2R65A 2RGHA 2ZBKB 3BOSA
chains in the Genus database with same CATH topology
3ILKA 2RGOA 3KDSE 1K3WA 1W5SA 1N34M 3U6QA 1NVMA 1HNWM 4X64M 4II7A 3HKPA 1MU5A 3FTCA 4MGIE 3GLFA 3SMSA 3L26A 3EIEA 1KFVA 3A45A 3TQSA 2DVWB 3SYKA 3TWLA 2X8AA 1IXSB 5IT9S 5FTNA 2X4AA 2CV1A 2DXIA 1R2ZA 4QHSA 2CV0A 1DGHB 3IG8A 3HU3A 4LCBA 2DWMA 4LJ5A 4R7GA 2QENA 2LXEA 3DA1A 5IREB 1E9RA 1G3IA 4IBBA 1N33M 2HKJA 3GLGB 1IY0A 1GL7A 4GRIA 4M9XA 2XZUA 1NY5A 2YFQA 4IBCA 4LRTA 5EXTA 3UZUA 3SC3A 3LVVA 4X62M 2LH0A 3U6EA 2F5PA 3RGPA 4KO8A 3GQ3A 5ITQA 3LMMA 3U6DA 3VK7A 2XSZA 2FE8A 3PNYA 3K92A 4I81A 4OVZA 5IWAM 3SBJA 4JYAM 3KFUG 4GKKM 3AOGA 3VLFB 1R2YA 4NL4H 2DZOB 3SHFA 3FYCA 4DR7M 1L2BA 2KZUA 2HCBA 3NWLA 5EXXA 4LF7M 1NNJA 2OQ4A 3GRVA 1L1ZA 3LQQA 4X66M 2Q2EB 2R62A 2I7NA 4R3DA 1QYRA 3GLIB 1IQPA 5IZ7D 2JA2A 2QPAA 4LFCM 4QHTA 1QQWA 2W82A 4GIPA 4JI7M 4K0KM 4IBIA 5FLXS 1GL6A 2F4VM 5FTKA 4IBGA 3CTWB 4B3SM 4M9SA 1FJGM 2UXCM 4IBDA 3MK6A 3L28A 3VK8A 1TDZA 2FFJA 3J2PB 4DR1M 1Q3BA 4NXNM 4EIWA 2J7NA 5JI2E 5KO3A 4PDGA 3SASA 5FTLA 2XEPA 4AKIA 1NHGC 1ZQ9A 1NJGA 4I4LA 3KVWA 4I5SA 2CV2A 4KHPM 1QAMA 3W0LB 4QOZC 2F5SA 3KP0E 3TE6A 2QBYB 1XC8A 1UM8A 3AOEA 5C1BA 3GPYA 3SAVA 3LVWA 4BLCA 2VIIA 3C58A 3PNVA 1T3TA 5KPZA 3KOZE 4DR2M 3AOEC 3AL0C 4GC5A 3DFZA 1HQCA 4IJFA 2XH9A 4I8OA 3UMMA 4B3TM 3K1JA 4IJEA 5EXSA 1IBKM 3GP1A 3HWSA 4FCWA 2UXDM 1XXHB 4LFBM 3T38A 4M0DA 4FWDA 3HHZA 1TH3A 1J09A 4QOSA 1G59A 2R18A 1IBLM 3W0FA 4G6ZA 3CF0A 1KSFX 5E26A 2L6OA 5KPRA 4LG2A 4AKHA 3HHYA 2Z4RA 3L27A 4M0WA 1TH2A 2YNMD 4L8RC 4DUYM 3FTFA 3MHVC 2KRUA 4Z8XA 3I4VA 3U60A 4LRSA 2BJWA 3AJIB 2Y0TA 2D7HA 3H4MA 5KQDA 3FD9A 4DV6M 3DOAA 3T1HM 3ZCBB 1ORYB 1IN6A 2C96A 4IBFA 3ZC7B 4B7FA 5C18A 2F5OA 4DR3M 4FWHA 4B7GA 1GKIA 2BJVA 4G4QA 2DWZB 3J80S 4B3MM 4OX9M 1QAQA 1XMOM 3T1YM 1E32A 1EE8A 4LF9M 1KYIA 3TWKA 1NSFA 3AFHA 4FVMA 3TPZA 4WW0A 3GPPA 4MGYE 2AHMA 2VQEM 3RFWA 4AI6A 3FUUA 5KPTA 4CGYB 3E4RA 3SARA 2UUAM 1J5EM 3J27B 2Z7JA 1C1KA 1IXRC 1NY6A 1N36M 4NOOB 1XXHA 3VKGA 3QAUA 2G5GX 3FYDA 2ZAOA 1SXJC 3HU1A 3KS4A 3PXGA 3SATA 3GRRA 1HNZM 3R8FA 4LZJA 3GLHA 4TUWA 2XLJA 2X49A 1K82A 4LF8M 4IBEA 4LGYA 4LJ8A 3FUXA 1QAOA 4LF4M 1SXJA 3UK6A 3SAWA 4L78A 3D8LA 3A98B 4G4RA 3U6MA 1XMQM 1DGFA 5EQTA 1Z5AA 2ZANA 1JR3D 4HL4A 4GMQA 1IXZA 4JXJA 5GKNA 2XZFA 1NJFA 3PVSA 1E9SA 3K2LA 4D80A 2P5TA 4JI1M 4PCZA 5ITRA 2R46A 1N32M 3GQ4A 5ITXA 3OTOM 5H37D 4P16A 5KQ8A 3THGA 3GPXA 1SXJD 2ZM6M 4XGIA 2CEAA 4YY3M 3M6AA 3RE8A 1X37A 4MB7A 4W5WA 1R6BX 2CUZA 3JAMS 4JN6A 4B7HA 8CATA 1IY2A 4IBKA 3UJNA 3SMPA 1DGBA 1TGUA 2FOIC 4REZA 3KOXE 3GLIA 1Z6TA 3U5ZB 5E6JA 1H6UA 4D82A 2G8LA 5JI3E 3Q8XA 1E94E 3HGIA 2Y0QA 4OU7A 3HU2A 1XNQM 4DV5M 3U60B 4GKJM 3J7AS 4JI3M 3HJSA 5EP4A 3I51A 3FTEA 1DGGA 1SXJB 4FWGA 1G4AE 4DV4M 3M0EA 5FTMA 3GLHB 2V1UA 1DO0A 4D81A 3AV0A 4BBAA 2I7PA 2QZ4A 2H1RA 4LJ6A 4ZPXA 2QBYA 5DYIA 3L2AA 1L2CA 4CISA 5FSWA 2Z3XA 1IY1A 1WXQA 2ZAMA 4AG5A 1YSYA 1HR0M 2QP9X 3A42A 2CE7A 4NSRA 2A5YB 2EA0A 2K47A 1QANA 4GITA 4FW9A 2DHRA 4YHHM 3JR4A 2EO2A 4JI4M 2M60A 3M7GA 4L15A 4CHTB 4KLNA 4MGKE 1Q3CA 3GRYA 4GHAA 1YUBA 4WURA 2EUCA 1TDHA 2YQZA 3FUVA 1Z5BA 4RF0A 4JI6M 4PD2A 3FUWA 1G41A 1W5TA 4OW0A 3SAUA 3HHWA 2R4EA 5ITTA 3A46A 4NRVA 2UXBM 1OFIA 4MH0E 4XBOA 2LNHC 4LFAM 2HHHM 4RNAA 1HT1E 5EJCA 2DWLA 3WHLA 4GHLA 4IBJA 4DR6M 1R7RA 1Q39A 5BR8M 2F5NA 1PJIA 2C9OA 2M5ZA 2KA6B 3FUTA 3HHXA 3FTDA 3I4YA 4GC9A 1D2NA 1XHBA 3SHGB 4FD2A 3NBIA 3QWLA 3K8ZA 1IN7A 4NSOB 2UUCM 2Y21A 1IN8A 5BPVA 4JI0M 1J7KA 2C99A 1PM5A 2L7HA 5LMNM 5ITXE 2YR0A 2LWXA 1DO2A 5LMUM 3GO8A 4LGMA 2KEBA 1HNXM 3JR5A 4NXMM 5DNYA 4DV3M 4LZZA 4JI2M 2E5LM 4AW4A 1IN5A 1FNNA 2KRKA 2J7OA 1MX0A 1N77A 1IN4A 1PJJA 3GQ5A 4AG6A 7CATA 1SXJE 3VDPA 2CHGA 4DV7M 3U6PA 3L25A 3J81S 3HJQA 4OVZB 1N78A 3VFDA 4FCTA 3J7BA 3KOYE 2CHQA 4X65M 4DR4M 4JI8M 2DZNB 3U6SA 4L4UA 3UGJA 4S12A 2V1CA 3TL4X 2DWNA 2O5RA 4BB9A 1YE9A 3KXEC 4DV2M 4DUZM 1S3SA 1HT2E 2L09A 3U61B 4DR5M 4GH9A 4NRWA 4Z6YA 1HQYE 1G8PA 5EP2A 3GLGA 3R9XB 1OJLA 2R45A 3DZDA 4IIWA 3U6LA 3CF6E 2XF3A 2F5QA 3T15A 4HLQA 4LJAA 2FNAA 2KZSA 2QCUA 4LJ4A 3VKHA 2CHVA 3HJ8A 2OPFA 4MGHA 5F3WA 3WHKA 4PDIA 1I94M 2CFOA 3PFIA 3GLFB 2Y20A 2NQ8C 1L2DA 2C5RA 2Z4SA 1Z59A 4A3VB 1OFHA 4FCVA 5EXPA 2RKOA 3SFZA 1JR3A 2KW0A 2V6ZM 1L8QA 3EIHA 2D7GA 5EP1A 1VDDA 1IM2A 4LJ9A 3GRUA 1XWIA 4AQYM 4MM3B 1NNUC 1GLNA 1Z5CA 4LF6M 3U61A 2BNKA 3IG5A 4JV5M 3U6OA 2D7EA 3KW6A 4AKGA 5FTJA 2HL7A 1TH4A 1GVNA 2KXEA 3KSJA 3LQRA 5ITUA 1QZMA 3FKEA 5A2QS 1L1TA 3U6CA 1QVRA 2XFSA 5ITYA 1I4WA 3E9SA 3KSXA 1ZAEA 3L29A 5DYGA 4RF1A 4DV1M 4ITQA 4LF5M 1DGHA 4MGZE 4DV0M 4G4NA 1IBMM 3B9PA 3KP1E 4G4OA 4PT5A 3TWMA 2UU9M 1K3XA 2UUBM 3AKZA 3VDUA 4QNMA 2C98A 4LJ7A 4L16A 4JI5M 2XSZD 3ZH9B 3U5ZA 2ERCA 1N75A 3KS8A 2C9CA 4QNRA 1NHWC 1JQJC 4AZFA 3CF2A 2VQFM 4LY6A 1XNRM 2R4JA 4KODA 3KOWE 5EP3A 3GPUA 3D8BA 4M9ZA 1LV7A 3MJ5A 4B3RM 3RGSA 2L7IA 4B08A 2XFTA 3SYLA 2XGNA 2R65A 2RGHA 2ZBKB 3BOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWL A;  4NL4 H;  2D7E A;  2DWN A;  2D7G A;  2DWM A;  2D7H A; 
#chains in the Genus database with same CATH topology
 1V33 A;  3IEC A;  3ILK A;  2RGO A;  3KDS E;  1K3W A;  1W5S A;  2VF7 A;  1WR1 B;  1NVM A;  3U6Q A;  1N34 M;  1HNW M;  2FH0 A;  4X64 M;  4II7 A;  3HKP A;  4NC6 A;  1MU5 A;  3FTC A;  2JP7 A;  4MGI E;  3GLF A;  3SMS A;  3L26 A;  3EIE A;  1KFV A;  3A45 A;  3TQS A;  2DVW B;  3SYK A;  3TWL A;  2X8A A;  1IXS B;  5IT9 S;  5FTN A;  2X4A A;  2CV1 A;  2DXI A;  1R2Z A;  1D0K A;  2CWB A;  4QHS A;  2CV0 A;  1DGH B;  3IG8 A;  1OAI A;  2MR9 A;  3HU3 A;  4LCB A;  2DWM A;  1GAB A;  4LJ5 A;  4R7G A;  2QEN A;  2LXE A;  1G71 A;  3DA1 A;  2KNV A;  5IRE B;  1YLA A;  1E9R A;  1G3I A;  4IBB A;  1N33 M;  2HKJ A;  3GLG B;  1IY0 A;  1GL7 A;  1PJQ A;  4GRI A;  4M9X A;  2HAK A;  2XZU A;  1NY5 A;  2YFQ A;  4IBC A;  4LRT A;  5EXT A;  3UZU A;  1T43 A;  3SC3 A;  3LVV A;  2LVP C;  4X62 M;  2LH0 A;  3U6E A;  3V76 A;  4HEO A;  2F5P A;  3RGP A;  3LCV B;  4KO8 A;  5ITQ A;  3LMM A;  3GQ3 A;  3U6D A;  2XSZ A;  3VK7 A;  2FE8 A;  4RKU F;  3E21 A;  3HY5 A;  2H5X A;  3PNY A;  3K92 A;  4I81 A;  1BVS A;  4OVZ A;  2RRU A;  2N35 A;  5IWA M;  3SBJ A;  3I01 M;  4JYA M;  3KFU G;  2ZTD A;  4GKK M;  4Q7J A;  3AOG A;  3VLF B;  1R2Y A;  3W67 A;  4NL4 H;  2DZO B;  2O01 F;  3SHF A;  3FYC A;  1D0L A;  4DR7 M;  1L2B A;  2KZU A;  1ZMU A;  2HCB A;  3NWL A;  5EXX A;  4LF7 M;  1ZMW A;  1NNJ A;  2OQ4 A;  3GRV A;  1L1Z A;  3LQQ A;  1MJG M;  4X66 M;  2Q2E B;  2R62 A;  1IXS A;  2I7N A;  4R3D A;  1QYR A;  2DAE A;  3GLI B;  1IQP A;  5IZ7 D;  2JA2 A;  2QPA A;  4LFC M;  4QHT A;  1QQW A;  2L4F A;  2DHY A;  2W82 A;  4GIP A;  4JI7 M;  4K0K M;  1OIP A;  2OO9 A;  4IBI A;  5FLX S;  1GL6 A;  2F4V M;  5FTK A;  4IBG A;  4R71 A;  3CTW B;  4B3S M;  4M9S A;  2DAK A;  1XB2 B;  1FJG M;  2UXC M;  2WSC F;  3Q8G A;  4IBD A;  3MK6 A;  3L28 A;  1OTR A;  2FS1 A;  3VK8 A;  2FFJ A;  1GJT A;  1TDZ A;  3J2P B;  4DR1 M;  2JXN A;  1Q3B A;  4NXN M;  4EIW A;  2J7N A;  5JI2 E;  2GQF A;  5KO3 A;  4PDG A;  1AUA A;  1SG9 A;  3SAS A;  1VDL A;  2XEP A;  5FTL A;  1NHG C;  1ZQ9 A;  4AKI A;  1OIZ A;  1NJG A;  4I4L A;  3KVW A;  4I5S A;  2CV2 A;  4KHP M;  1QAM A;  3W0L B;  2QSF X;  4QOZ C;  2F5S A;  3KP0 E;  3TE6 A;  2QBY B;  1XC8 A;  1UM8 A;  3AOE A;  5C1B A;  3GPY A;  3SAV A;  3GLG E;  4Y28 F;  3LVW A;  4BLC A;  2DZL A;  2VII A;  3C58 A;  3PNV A;  1T3T A;  5KPZ A;  3B7Q A;  3KOZ E;  4DR2 M;  2KHH A;  3AOE C;  3AL0 C;  4GC5 A;  3DFZ A;  1HQC A;  3C9P A;  2B3T A;  4IJF A;  2XH9 A;  4I8O A;  3UMM A;  4B3T M;  3K1J A;  4IJE A;  5EXS A;  1IBK M;  3GP1 A;  3HWS A;  4FCW A;  2UXD M;  1XXH B;  4LFB M;  3F92 A;  3T38 A;  4M0D A;  4FWD A;  3HHZ A;  1TH3 A;  1J09 A;  4QOS A;  1G59 A;  2R18 A;  1IBL M;  3W0F A;  4G6Z A;  1OAO C;  1KSF X;  2R44 A;  3CF0 A;  1VQ1 A;  2L6O A;  5E26 A;  1VG5 A;  5KPR A;  4LG2 A;  4AKH A;  3HHY A;  2Z4R A;  3L27 A;  4M0W A;  1TH2 A;  2YNM D;  4L8R C;  4DUY M;  3FTF A;  3MHV C;  2KRU A;  4Z8X A;  3I4V A;  3U60 A;  4LRS A;  2BJW A;  2EKF A;  2R6F A;  2Y0T A;  2D7H A;  2MRO B;  1P3Q Q;  3AJI B;  3FD9 A;  3H4M A;  5KQD A;  4DV6 M;  1A5T A;  2APL A;  3DOA A;  3T1H M;  2QNJ A;  3ZCB B;  1WJ7 A;  4L6V 6;  1ORY B;  1IN6 A;  2C96 A;  4IBF A;  3ZC7 B;  4B7F A;  5C18 A;  2F5O A;  4F2L A;  4G3O A;  4DR3 M;  4FWH A;  2DI0 A;  4B7G A;  1GJS A;  3W68 A;  1GKI A;  2BJV A;  4G4Q A;  2J5Y A;  2DWZ B;  1NV8 A;  4GEW A;  3J80 S;  3ZQJ A;  4B3M M;  1QAQ A;  4OX9 M;  1XMO M;  3T1Y M;  1E32 A;  1EE8 A;  5DFL A;  1OQY A;  4LF9 M;  1KYI A;  3TWK A;  1NSF A;  3AFH A;  4FVM A;  3TPZ A;  4WW0 A;  1F4I A;  3GPP A;  4MGY E;  2AHM A;  4P17 A;  2K6B A;  2VQE M;  3RFW A;  4AI6 A;  3FUU A;  5KPT A;  4CGY B;  3E4R A;  3SAR A;  3E46 A;  1J5E M;  2UUA M;  3J27 B;  1WGN A;  1V34 A;  1C1K A;  1IXR C;  1NY6 A;  2Z7J A;  1N36 M;  4NOO B;  2JY5 A;  1XXH A;  3VKG A;  2G5G X;  3FYD A;  3QAU A;  2ZAO A;  2EJS A;  2JY7 A;  1SXJ C;  3HU1 A;  2QHO B;  3KS4 A;  3PXG A;  2DAM A;  1WGL A;  1Y8G A;  3SAT A;  3GRR A;  1HNZ M;  3R8F A;  4LZJ A;  3GLH A;  4TUW A;  2XLJ A;  2X49 A;  1K82 A;  4LF8 M;  4IBE A;  4LGY A;  4LJ8 A;  3FUX A;  1QAO A;  3HZJ A;  1SXJ A;  4LF4 M;  2KNA A;  3UK6 A;  3SAW A;  4L78 A;  1QDR A;  3A98 B;  3D8L A;  4G4R A;  3U6M A;  1XMQ M;  4WP2 A;  1DGF A;  5EQT A;  1Z5A A;  2ZAN A;  1JR3 D;  4HL4 A;  4GMQ A;  1IXZ A;  2GNO A;  4JXJ A;  5GKN A;  1Q02 A;  1NJF A;  3PVS A;  1E9S A;  3K2L A;  4D80 A;  2P5T A;  2XZF A;  4PCZ A;  5ITR A;  2R46 A;  4JI1 M;  1N32 M;  3GQ4 A;  5ITX A;  3OTO M;  5H37 D;  3GLF E;  4P16 A;  5KQ8 A;  3THG A;  3GPX A;  1NV9 A;  1SXJ D;  2BWB A;  4XK8 F;  2ZM6 M;  3FE3 A;  4XGI A;  2CEA A;  4YY3 M;  3M6A A;  3RE8 A;  1X37 A;  4MB7 A;  4W5W A;  1R6B X;  1WIV A;  2CUZ A;  2L2D A;  3JAM S;  4JN6 A;  4B7H A;  3NBX X;  8CAT A;  1IY2 A;  2KDL A;  4IBK A;  1PJS A;  3UJN A;  3SMP A;  1DGB A;  1TGU A;  2FOI C;  2DNA A;  4REZ A;  3KOX E;  3GLI A;  1VEK A;  1VEG A;  1Z6T A;  5E6J A;  1H6U A;  4D82 A;  2G8L A;  1PJT A;  5JI3 E;  3U5Z B;  3Q8X A;  1E94 E;  2MH8 A;  2Y0Q A;  3HGI A;  3HU2 A;  2JZ0 A;  4OU7 A;  1XNQ M;  4DV5 M;  3U60 B;  4GKJ M;  2O25 A;  3J7A S;  4JI3 M;  1TTE A;  3HJS A;  5EP4 A;  3I51 A;  3FTE A;  1DGG A;  1SXJ B;  2WZJ A;  3K9P A;  4FWG A;  1G4A E;  4DV4 M;  4UN2 B;  3M0E A;  2MGW A;  2JY6 B;  5FTM A;  3GLH B;  1GO5 A;  2R0I A;  2V1U A;  3FRH A;  1DO0 A;  4D81 A;  3AV0 A;  4BBA A;  2I7P A;  2QZ4 A;  2H1R A;  4LJ6 A;  4ZPX A;  2QBY A;  5DYI A;  3L2A A;  2LVQ D;  1L2C A;  1NO1 A;  4CIS A;  4F1I A;  5FSW A;  2Z3X A;  3BXW A;  1IY1 A;  1WXQ A;  2ZAM A;  4AG5 A;  1YSY A;  3IHP A;  1AIP C;  3C3D A;  2DAG A;  2JY8 A;  3HX3 A;  1ZMV A;  2QP9 X;  3A42 A;  3QYE A;  2CE7 A;  2LHC A;  4NSR A;  2A5Y B;  2EA0 A;  2K47 A;  1QAN A;  1RU3 A;  4GIT A;  4FW9 A;  5L8R F;  4ANR A;  2DHR A;  4YHH M;  3JR4 A;  2DAI A;  2EO2 A;  4JI4 M;  2M60 A;  3M7G A;  2LHG A;  4L15 A;  4KLN A;  4CHT B;  2JUJ A;  4MGK E;  1Q3C A;  1QDT A;  3GRY A;  4GHA A;  1DV0 A;  1YUB A;  4WUR A;  2EUC A;  1VEJ A;  1TDH A;  2YQZ A;  3FUV A;  1Z5B A;  4RF0 A;  1HR0 M;  4JI6 M;  2JZ1 A;  4PD2 A;  2Z8Y M;  3FUW A;  1G41 A;  1W5T A;  4OW0 A;  3SAU A;  3HHW A;  2EKK A;  2R4E A;  5ITT A;  3A46 A;  4NRV A;  2UXB M;  1OFI A;  4MH0 E;  4XBO A;  2LNH C;  4LFA M;  4DBG B;  2HHH M;  4RNA A;  1HT1 E;  5EJC A;  2DWL A;  3WHL A;  4GHL A;  4IBJ A;  4DR6 M;  1R7R A;  1Q39 A;  5BR8 M;  2F5N A;  1PJI A;  2C9O A;  2M5Z A;  1QUS A;  2KA6 B;  3FUT A;  3HHX A;  3FTD A;  3I4Y A;  4GC9 A;  1D2N A;  1XHB A;  1EFU B;  4FD2 A;  3SHG B;  1EIJ A;  3NBI A;  3QWL A;  3K8Z A;  1IN7 A;  4NSO B;  2UUC M;  2Y21 A;  1IN8 A;  2WSE F;  5BPV A;  3MMP A;  4JI0 M;  1J7K A;  2C99 A;  2ZTC A;  1PM5 A;  2L7H A;  3B89 A;  5LMN M;  5ITX E;  3LW5 F;  2YR0 A;  4CIZ A;  3FRI A;  2LWX A;  1DO2 A;  5LMU M;  3GO8 A;  4LGM A;  2KEB A;  1HNX M;  3JR5 A;  3QYB A;  4NXM M;  2CRU A;  5DNY A;  4DV3 M;  4LZZ A;  1PRB A;  4JI2 M;  2E5L M;  4AW4 A;  1IN5 A;  1IFY A;  2K9D A;  1FNN A;  2KRK A;  2J7O A;  1MX0 A;  3GLH E;  1N77 A;  1IN4 A;  1PJJ A;  3GQ5 A;  3B7Z A;  4AG6 A;  7CAT A;  1SXJ E;  3VDP A;  2CHG A;  4DV7 M;  3U6P A;  3L25 A;  3J81 S;  3HJQ A;  2LVA A;  1CUK A;  4OVZ B;  1N78 A;  1C7Y A;  2MJ5 B;  4FCT A;  3J7B A;  3VFD A;  3KOY E;  1JB0 F;  2CHQ A;  3BBZ A;  4X65 M;  4JI8 M;  4DR4 M;  2DZN B;  3I04 M;  3U6S A;  4L4U A;  3UGJ A;  4S12 A;  2OOA A;  2V1C A;  1XXH E;  3TL4 X;  2OOB A;  2O5R A;  2DWN A;  4BB9 A;  1YE9 A;  3KXE C;  4DV2 M;  4DUZ M;  1S3S A;  1HT2 E;  2L09 A;  3U61 B;  4DR5 M;  2HWJ A;  4GH9 A;  4NRW A;  4Z6Y A;  1HQY E;  2G3Q A;  1G8P A;  5EP2 A;  3GLG A;  3R9X B;  1OJL A;  2R45 A;  3DZD A;  2KNZ A;  4IIW A;  3CF6 E;  4KT0 F;  2XF3 A;  3U6L A;  3T6P A;  2LVN C;  2F5Q A;  2LBC A;  3T15 A;  4HLQ A;  2VDB B;  4LJA A;  2FNA A;  2KZS A;  2BWE A;  2QCU A;  4LJ4 A;  1WHC A;  3VKH A;  2CHV A;  3HJ8 A;  2OPF A;  4MGH A;  5F3W A;  3WHK A;  4PDI A;  1I94 M;  3K9O A;  2CFO A;  2QQ8 A;  3PFI A;  4CJ6 A;  3GLF B;  2Y20 A;  2LVO C;  2NQ8 C;  2JNH A;  1V92 A;  3LCU A;  2K0B X;  1L2D A;  3B7N A;  2C5R A;  1MN3 A;  1Z59 A;  2Z4S A;  3CGW A;  4A3V B;  1OFH A;  4FCV A;  3H4J A;  2RKO A;  5EXP A;  3SFZ A;  1JR3 A;  1HJP A;  2KW0 A;  2V6Z M;  1JR3 E;  1L8Q A;  3B74 A;  3EIH A;  2D7G A;  5EP1 A;  1TR8 A;  1VDD A;  3C3E A;  1IM2 A;  4LJ9 A;  3GRU A;  1XWI A;  4AQY M;  4MM3 B;  1NNU C;  1GLN A;  1D0M A;  1Z5C A;  4LF6 M;  2DEN A;  3U61 A;  2BNK A;  3IG5 A;  4JV5 M;  1UFZ A;  3U6O A;  2D7E A;  3KW6 A;  4AKG A;  5FTJ A;  2HL7 A;  1TH4 A;  1GVN A;  3GLI E;  2KXE A;  3KSJ A;  3LQR A;  5ITU A;  1QZM A;  3FKE A;  5A2Q S;  1L1T A;  3U6C A;  1QVR A;  2WSF F;  2XFS A;  5ITY A;  1I4W A;  3E9S A;  3KSX A;  2LTU A;  1ZAE A;  3L29 A;  5DYG A;  1QZE A;  1ZV1 A;  2CP8 A;  4RF1 A;  4DV1 M;  4ITQ A;  4LF5 M;  1DGH A;  4MGZ E;  4DV0 M;  4G4N A;  1IBM M;  3B9P A;  1T6O A;  3KP1 E;  4PT5 A;  4G4O A;  3TWM A;  2UU9 M;  1R5L A;  1QUT A;  1K3X A;  3AKZ A;  2UUB M;  3VDU A;  4QNM A;  2L4E A;  2C98 A;  1OKS A;  4LJ7 A;  4L16 A;  4JI5 M;  2XSZ D;  1PGY A;  3ZH9 B;  3U5Z A;  2ERC A;  1N75 A;  3KS8 A;  2C9C A;  4QNR A;  1NHW C;  1JQJ C;  2JWS A;  4AZF A;  3CF2 A;  2VQF M;  4LY6 A;  1XNR M;  1TF0 B;  2R4J A;  1R4G A;  4KOD A;  3KOW E;  5EP3 A;  3GPU A;  3D8B A;  4M9Z A;  2DKL A;  1LTM A;  1LV7 A;  3MJ5 A;  4B3R M;  2VF8 A;  3RGS A;  2L7I A;  4B08 A;  2XFT A;  3SYL A;  2XGN A;  2R65 A;  2RGH A;  2ZBK B;  3BOS A; 
#chains in the Genus database with same CATH homology
 3ILK A;  2RGO A;  3KDS E;  1K3W A;  1W5S A;  1N34 M;  3U6Q A;  1NVM A;  1HNW M;  4X64 M;  4II7 A;  3HKP A;  1MU5 A;  3FTC A;  4MGI E;  3GLF A;  3SMS A;  3L26 A;  3EIE A;  1KFV A;  3A45 A;  3TQS A;  2DVW B;  3SYK A;  3TWL A;  2X8A A;  1IXS B;  5IT9 S;  5FTN A;  2X4A A;  2CV1 A;  2DXI A;  1R2Z A;  4QHS A;  2CV0 A;  1DGH B;  3IG8 A;  3HU3 A;  4LCB A;  2DWM A;  4LJ5 A;  4R7G A;  2QEN A;  2LXE A;  3DA1 A;  5IRE B;  1E9R A;  1G3I A;  4IBB A;  1N33 M;  2HKJ A;  3GLG B;  1IY0 A;  1GL7 A;  4GRI A;  4M9X A;  2XZU A;  1NY5 A;  2YFQ A;  4IBC A;  4LRT A;  5EXT A;  3UZU A;  3SC3 A;  3LVV A;  4X62 M;  2LH0 A;  3U6E A;  2F5P A;  3RGP A;  4KO8 A;  3GQ3 A;  5ITQ A;  3LMM A;  3U6D A;  3VK7 A;  2XSZ A;  2FE8 A;  3PNY A;  3K92 A;  4I81 A;  4OVZ A;  5IWA M;  3SBJ A;  4JYA M;  3KFU G;  4GKK M;  3AOG A;  3VLF B;  1R2Y A;  4NL4 H;  2DZO B;  3SHF A;  3FYC A;  4DR7 M;  1L2B A;  2KZU A;  2HCB A;  3NWL A;  5EXX A;  4LF7 M;  1NNJ A;  2OQ4 A;  3GRV A;  1L1Z A;  3LQQ A;  4X66 M;  2Q2E B;  2R62 A;  2I7N A;  4R3D A;  1QYR A;  3GLI B;  1IQP A;  5IZ7 D;  2JA2 A;  2QPA A;  4LFC M;  4QHT A;  1QQW A;  2W82 A;  4GIP A;  4JI7 M;  4K0K M;  4IBI A;  5FLX S;  1GL6 A;  2F4V M;  5FTK A;  4IBG A;  3CTW B;  4B3S M;  4M9S A;  1FJG M;  2UXC M;  4IBD A;  3MK6 A;  3L28 A;  3VK8 A;  1TDZ A;  2FFJ A;  3J2P B;  4DR1 M;  1Q3B A;  4NXN M;  4EIW A;  2J7N A;  5JI2 E;  5KO3 A;  4PDG A;  3SAS A;  5FTL A;  2XEP A;  4AKI A;  1NHG C;  1ZQ9 A;  1NJG A;  4I4L A;  3KVW A;  4I5S A;  2CV2 A;  4KHP M;  1QAM A;  3W0L B;  4QOZ C;  2F5S A;  3KP0 E;  3TE6 A;  2QBY B;  1XC8 A;  1UM8 A;  3AOE A;  5C1B A;  3GPY A;  3SAV A;  3LVW A;  4BLC A;  2VII A;  3C58 A;  3PNV A;  1T3T A;  5KPZ A;  3KOZ E;  4DR2 M;  3AOE C;  3AL0 C;  4GC5 A;  3DFZ A;  1HQC A;  4IJF A;  2XH9 A;  4I8O A;  3UMM A;  4B3T M;  3K1J A;  4IJE A;  5EXS A;  1IBK M;  3GP1 A;  3HWS A;  4FCW A;  2UXD M;  1XXH B;  4LFB M;  3T38 A;  4M0D A;  4FWD A;  3HHZ A;  1TH3 A;  1J09 A;  4QOS A;  1G59 A;  2R18 A;  1IBL M;  3W0F A;  4G6Z A;  3CF0 A;  1KSF X;  5E26 A;  2L6O A;  5KPR A;  4LG2 A;  4AKH A;  3HHY A;  2Z4R A;  3L27 A;  4M0W A;  1TH2 A;  2YNM D;  4L8R C;  4DUY M;  3FTF A;  3MHV C;  2KRU A;  4Z8X A;  3I4V A;  3U60 A;  4LRS A;  2BJW A;  3AJI B;  2Y0T A;  2D7H A;  3H4M A;  5KQD A;  3FD9 A;  4DV6 M;  3DOA A;  3T1H M;  3ZCB B;  1ORY B;  1IN6 A;  2C96 A;  4IBF A;  3ZC7 B;  4B7F A;  5C18 A;  2F5O A;  4DR3 M;  4FWH A;  4B7G A;  1GKI A;  2BJV A;  4G4Q A;  2DWZ B;  3J80 S;  4B3M M;  4OX9 M;  1QAQ A;  1XMO M;  3T1Y M;  1E32 A;  1EE8 A;  4LF9 M;  1KYI A;  3TWK A;  1NSF A;  3AFH A;  4FVM A;  3TPZ A;  4WW0 A;  3GPP A;  4MGY E;  2AHM A;  2VQE M;  3RFW A;  4AI6 A;  3FUU A;  5KPT A;  4CGY B;  3E4R A;  3SAR A;  2UUA M;  1J5E M;  3J27 B;  2Z7J A;  1C1K A;  1IXR C;  1NY6 A;  1N36 M;  4NOO B;  1XXH A;  3VKG A;  3QAU A;  2G5G X;  3FYD A;  2ZAO A;  1SXJ C;  3HU1 A;  3KS4 A;  3PXG A;  3SAT A;  3GRR A;  1HNZ M;  3R8F A;  4LZJ A;  3GLH A;  4TUW A;  2XLJ A;  2X49 A;  1K82 A;  4LF8 M;  4IBE A;  4LGY A;  4LJ8 A;  3FUX A;  1QAO A;  4LF4 M;  1SXJ A;  3UK6 A;  3SAW A;  4L78 A;  3D8L A;  3A98 B;  4G4R A;  3U6M A;  1XMQ M;  1DGF A;  5EQT A;  1Z5A A;  2ZAN A;  1JR3 D;  4HL4 A;  4GMQ A;  1IXZ A;  4JXJ A;  5GKN A;  2XZF A;  1NJF A;  3PVS A;  1E9S A;  3K2L A;  4D80 A;  2P5T A;  4JI1 M;  4PCZ A;  5ITR A;  2R46 A;  1N32 M;  3GQ4 A;  5ITX A;  3OTO M;  5H37 D;  4P16 A;  5KQ8 A;  3THG A;  3GPX A;  1SXJ D;  2ZM6 M;  4XGI A;  2CEA A;  4YY3 M;  3M6A A;  3RE8 A;  1X37 A;  4MB7 A;  4W5W A;  1R6B X;  2CUZ A;  3JAM S;  4JN6 A;  4B7H A;  8CAT A;  1IY2 A;  4IBK A;  3UJN A;  3SMP A;  1DGB A;  1TGU A;  2FOI C;  4REZ A;  3KOX E;  3GLI A;  1Z6T A;  3U5Z B;  5E6J A;  1H6U A;  4D82 A;  2G8L A;  5JI3 E;  3Q8X A;  1E94 E;  3HGI A;  2Y0Q A;  4OU7 A;  3HU2 A;  1XNQ M;  4DV5 M;  3U60 B;  4GKJ M;  3J7A S;  4JI3 M;  3HJS A;  5EP4 A;  3I51 A;  3FTE A;  1DGG A;  1SXJ B;  4FWG A;  1G4A E;  4DV4 M;  3M0E A;  5FTM A;  3GLH B;  2V1U A;  1DO0 A;  4D81 A;  3AV0 A;  4BBA A;  2I7P A;  2QZ4 A;  2H1R A;  4LJ6 A;  4ZPX A;  2QBY A;  5DYI A;  3L2A A;  1L2C A;  4CIS A;  5FSW A;  2Z3X A;  1IY1 A;  1WXQ A;  2ZAM A;  4AG5 A;  1YSY A;  1HR0 M;  2QP9 X;  3A42 A;  2CE7 A;  4NSR A;  2A5Y B;  2EA0 A;  2K47 A;  1QAN A;  4GIT A;  4FW9 A;  2DHR A;  4YHH M;  3JR4 A;  2EO2 A;  4JI4 M;  2M60 A;  3M7G A;  4L15 A;  4CHT B;  4KLN A;  4MGK E;  1Q3C A;  3GRY A;  4GHA A;  1YUB A;  4WUR A;  2EUC A;  1TDH A;  2YQZ A;  3FUV A;  1Z5B A;  4RF0 A;  4JI6 M;  4PD2 A;  3FUW A;  1G41 A;  1W5T A;  4OW0 A;  3SAU A;  3HHW A;  2R4E A;  5ITT A;  3A46 A;  4NRV A;  2UXB M;  1OFI A;  4MH0 E;  4XBO A;  2LNH C;  4LFA M;  2HHH M;  4RNA A;  1HT1 E;  5EJC A;  2DWL A;  3WHL A;  4GHL A;  4IBJ A;  4DR6 M;  1R7R A;  1Q39 A;  5BR8 M;  2F5N A;  1PJI A;  2C9O A;  2M5Z A;  2KA6 B;  3FUT A;  3HHX A;  3FTD A;  3I4Y A;  4GC9 A;  1D2N A;  1XHB A;  3SHG B;  4FD2 A;  3NBI A;  3QWL A;  3K8Z A;  1IN7 A;  4NSO B;  2UUC M;  2Y21 A;  1IN8 A;  5BPV A;  4JI0 M;  1J7K A;  2C99 A;  1PM5 A;  2L7H A;  5LMN M;  5ITX E;  2YR0 A;  2LWX A;  1DO2 A;  5LMU M;  3GO8 A;  4LGM A;  2KEB A;  1HNX M;  3JR5 A;  4NXM M;  5DNY A;  4DV3 M;  4LZZ A;  4JI2 M;  2E5L M;  4AW4 A;  1IN5 A;  1FNN A;  2KRK A;  2J7O A;  1MX0 A;  1N77 A;  1IN4 A;  1PJJ A;  3GQ5 A;  4AG6 A;  7CAT A;  1SXJ E;  3VDP A;  2CHG A;  4DV7 M;  3U6P A;  3L25 A;  3J81 S;  3HJQ A;  4OVZ B;  1N78 A;  3VFD A;  4FCT A;  3J7B A;  3KOY E;  2CHQ A;  4X65 M;  4DR4 M;  4JI8 M;  2DZN B;  3U6S A;  4L4U A;  3UGJ A;  4S12 A;  2V1C A;  3TL4 X;  2DWN A;  2O5R A;  4BB9 A;  1YE9 A;  3KXE C;  4DV2 M;  4DUZ M;  1S3S A;  1HT2 E;  2L09 A;  3U61 B;  4DR5 M;  4GH9 A;  4NRW A;  4Z6Y A;  1HQY E;  1G8P A;  5EP2 A;  3GLG A;  3R9X B;  1OJL A;  2R45 A;  3DZD A;  4IIW A;  3U6L A;  3CF6 E;  2XF3 A;  2F5Q A;  3T15 A;  4HLQ A;  4LJA A;  2FNA A;  2KZS A;  2QCU A;  4LJ4 A;  3VKH A;  2CHV A;  3HJ8 A;  2OPF A;  4MGH A;  5F3W A;  3WHK A;  4PDI A;  1I94 M;  2CFO A;  3PFI A;  3GLF B;  2Y20 A;  2NQ8 C;  1L2D A;  2C5R A;  2Z4S A;  1Z59 A;  4A3V B;  1OFH A;  4FCV A;  5EXP A;  2RKO A;  3SFZ A;  1JR3 A;  2KW0 A;  2V6Z M;  1L8Q A;  3EIH A;  2D7G A;  5EP1 A;  1VDD A;  1IM2 A;  4LJ9 A;  3GRU A;  1XWI A;  4AQY M;  4MM3 B;  1NNU C;  1GLN A;  1Z5C A;  4LF6 M;  3U61 A;  2BNK A;  3IG5 A;  4JV5 M;  3U6O A;  2D7E A;  3KW6 A;  4AKG A;  5FTJ A;  2HL7 A;  1TH4 A;  1GVN A;  2KXE A;  3KSJ A;  3LQR A;  5ITU A;  1QZM A;  3FKE A;  5A2Q S;  1L1T A;  3U6C A;  1QVR A;  2XFS A;  5ITY A;  1I4W A;  3E9S A;  3KSX A;  1ZAE A;  3L29 A;  5DYG A;  4RF1 A;  4DV1 M;  4ITQ A;  4LF5 M;  1DGH A;  4MGZ E;  4DV0 M;  4G4N A;  1IBM M;  3B9P A;  3KP1 E;  4G4O A;  4PT5 A;  3TWM A;  2UU9 M;  1K3X A;  2UUB M;  3AKZ A;  3VDU A;  4QNM A;  2C98 A;  4LJ7 A;  4L16 A;  4JI5 M;  2XSZ D;  3ZH9 B;  3U5Z A;  2ERC A;  1N75 A;  3KS8 A;  2C9C A;  4QNR A;  1NHW C;  1JQJ C;  4AZF A;  3CF2 A;  2VQF M;  4LY6 A;  1XNR M;  2R4J A;  4KOD A;  3KOW E;  5EP3 A;  3GPU A;  3D8B A;  4M9Z A;  1LV7 A;  3MJ5 A;  4B3R M;  3RGS A;  2L7I A;  4B08 A;  2XFT A;  3SYL A;  2XGN A;  2R65 A;  2RGH A;  2ZBK B;  3BOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...