2D7GA

Crystal structure of the aa complex of the n-terminal domain of pria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
PVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Primosomal protein N'
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7gA01
2D7GA 2DWMA 2DWNA 4NL4H 2D7HA 2DWLA 2D7EA
chains in the Genus database with same CATH superfamily
1D2NA 2Z3XA 1GABA 1ZQ9A 4PCZA 3CGWA 1OFIA 3AV0A 3ZC7B 4F1IA 4DR6M 2XSZD 2Y0QA 2R18A 4LJ5A 4JI3M 2XZFA 1D0LA 1FNNA 3A42A 1C1KA 3ZH9B 3U6PA 3GRUA 3DZDA 1PGYA 2DENA 2Y21A 2RKOA 3EIHA 3GLFB 4FCVA 1IQPA 2L6OA 4GHLA 4R3DA 3H4JA 5C1BA 1GJSA 3K1JA 4JN6A 1AUAA 1R4GA 4P16A 4OU7A 4DV3M 2JP7A 2QCUA 4AG6A 4GC9A 5E26A 2DAIA 1QUSA 4RNAA 1I4WA 3FKEA 3FUTA 5BPVA 4RF1A 1TGUA 2KA6B 2XSZA 3PNYA 3B9PA 1L2CA 1D0MA 4WP2A 4XK8F 3U60A 3U6LA 1SXJC 1UFZA 1VG5A 3HU1A 3KSXA 5FSWA 3R8FA 3CF6E 2QP9X 4AW4A 1N33M 2I7PA 2JZ0A 1ZMUA 4DV5M 2O01F 1Z5AA 4LF6M 1GJTA 4AQYM 3V76A 1IY2A 2UXBM 2VQEM 4NRWA 1TF0B 2P5TA 2M5ZA 3GLGE 2QBYB 3HJSA 3A46A 3SASA 4R7GA 1HQCA 1PJTA 2R6FA 2DHYA 3KOWE 4M9XA 1G8PA 1YE9A 4MGZE 4B08A 4Q7JA 1UM8A 1WJ7A 4LJ6A 1IY1A 4M0DA 3GLIA 2X8AA 2KEBA 1YLAA 2V6ZM 2C9CA 2EKKA 3RE8A 8CATA 2I7NA 1K82A 4XBOA 1IFYA 1NHGC 2OQ4A 3BXWA 2L7IA 3U6QA 3FTDA 1CUKA 4MGIE 4M9SA 4LGYA 2DZNB 2CV1A 3C9PA 3QWLA 5KO3A 3C58A 4LF8M 2VF8A 2CUZA 1DGHA 1WIVA 2QPAA 4GMQA 3GLGA 5KPTA 4LG2A 3GLFE 4CHTB 3SARA 1Q3BA 2CV0A 3CF0A 2BWEA 4R71A 4JXJA 3MHVC 3IECA 1NY5A 4P17A 2NQ8C 3KSJA 3U6MA 2Z4SA 3ZCBB 4AG5A 1QZMA 3C3DA 5FTNA 1DO0A 3LVVA 4MGHA 2EA0A 2LNHC 3GLHA 5ITXA 2KXEA 1G71A 3BBZA 1PJQA 3AOEA 3BOSA 3KS8A 4QNMA 1HNZM 3RFWA 4FD2A 3DFZA 1OIZA 3FTCA 2FS1A 4REZA 1SG9A 3FUVA 1NNUC 1YUBA 1IN7A 2QQ8A 3VK7A 3A45A 3J2PB 1EIJA 1OQYA 5LMNM 2F5SA 4LF4M 2KRUA 1OTRA 2KRKA 3D8LA 3GLGB 3K9OA 1ZMVA 3C3EA 4DBGB 1TR8A 3GRVA 2OOBA 4FCTA 4GIPA 3UMMA 3U5ZB 4B3MM 3I04M 4CIZA 4I81A 4RKUF 4KLNA 3SBJA 4DV7M 2DAKA 1JR3D 1W5SA 3E4RA 4WURA 4LCBA 5DFLA 5ITUA 3FUUA 1NV8A 4I8OA 4S12A 3FRIA 2UUAM 2CRUA 1QDRA 1G3IA 2F5QA 2KZUA 4L4UA 2KHHA 5E6JA 1K3XA 1FJGM 1IN8A 1NJGA 1Q02A 2JZ1A 1NV9A 1QZEA 2LXEA 2MR9A 3HKPA 4NRVA 3VDUA 1L8QA 2LTUA 1GLNA 3GLIB 1L1TA 3U61B 1J7KA 4DV4M 1TDZA 4KODA 5F3WA 4TUWA 2WZJA 4PT5A 1XNRM 5JI2E 3GRRA 4G4OA 3QYBA 5BR8M 3LW5F 4LJ9A 4BB9A 5EXPA 4HL4A 2LVQD 1QANA 4OX9M 3I4VA 5ITRA 3TWKA 1DGBA 2G5GX 5C18A 4IBCA 1OJLA 2J5YA 4MGKE 1MN3A 5KQDA 1XXHB 2JUJA 1KFVA 2XZUA 1JR3A 1Y8GA 4LFCM 4D82A 5DNYA 4K0KM 4F2LA 1LTMA 1Z6TA 2X4AA 3GQ4A 5LMUM 4IBKA 2BJWA 3SATA 4FW9A 1R5LA 2Z4RA 3MJ5A 4ZPXA 3UZUA 1N32M 2C5RA 1T6OA 2K9DA 2ZTCA 1VDDA 3QAUA 1JR3E 3KFUG 2FFJA 3WHKA 7CATA 2KZSA 2H5XA 1Z5BA 1J5EM 2QSFX 4LJ7A 1IM2A 1NY6A 3CTWB 4L78A 1E9SA 4LZZA 4PDGA 2X49A 4DV0M 2Z7JA 2LH0A 2WSEF 4DV1M 1L2DA 4AZFA 4LF5M 1XHBA 4GHAA 3Q8XA 3RGSA 3L29A 4PD2A 1DGHB 4QHSA 4AI6A 1DGGA 1Z5CA 2ERCA 4LRSA 3MMPA 2C9OA 1WR1B 3SMSA 3GP1A 1IN5A 2L7HA 3HU3A 4A3VB 3TWLA 1R6BX 2ZAMA 5ITXE 3T1HM 4LZJA 3KXEC 1PJIA 2UXCM 5GKNA 2JXNA 2R0IA 1HNXM 1IXRC 5EXXA 2O5RA 1T43A 3B74A 3VDPA 2FOIC 2JA2A 2UXDM 4FWHA 4IJFA 1HT2E 1IN4A 4NXNM 1G41A 5FTLA 3J81S 3HY5A 3SYLA 3KP0E 3GRYA 2K6BA 3LVWA 4JI1M 1NJFA 2XLJA 2DWZB 4B3SM 2CE7A 1WHCA 2KNAA 4QOSA 3PXGA 1QVRA 2DVWB 4G3OA 1P3QQ 3L25A 2R45A 4JI7M 3U5ZA 5IT9S 3FTEA 1ORYB 4GKKM 3LQRA 1NHWC 2DAEA 4QHTA 1WXQA 1XXHA 3FUWA 3HHYA 5ITYA 3FYCA 1L2BA 2XGNA 4AKGA 2HCBA 5FLXS 5IREB 3KS4A 2WSFF 2K47A 2JWSA 3GQ3A 4LFAM 2RRUA 1XC8A 3M7GA 3SHFA 1ZAEA 1QUTA 2G3QA 2BJVA 1NNJA 2MROB 3K8ZA 2CFOA 2H1RA 2L4EA 4NC6A 5EQTA 1PJJA 2QZ4A 4IBJA 5DYGA 3PNVA 3SMPA 3HX3A 4LJ8A 2KW0A 3UGJA 2F4VM 3HU2A 1E32A 4MM3B 2UU9M 1HQYE 1VEKA 3T1YM 4OVZA 2O25A 5H37D 4FVMA 4LRTA 3SAWA 4X62M 2FE8A 4PDIA 3HJQA 1HR0M 2CP8A 4DUYM 2VDBB 3TL4X 2QHOB 3KOZE 2M60A 1MJGM 1QYRA 4KHPM 4DV6M 3B7QA 1WGLA 4B7FA 3W0LB 4G6ZA 1EE8A 2EO2A 2GNOA 4DR5M 3VK8A 2YQZA 3J27B 2R4EA 3JR5A 1I94M 4B3RM 3CF2A 3L28A 3K2LA 3SYKA 4BBAA 2RGHA 2HWJA 4II7A 2XFTA 5L8RF 4IBFA 1IXSB 3RGPA 3H4MA 4DR4M 4JI0M 3J7AS 2LBCA 3GO8A 3SHGB 2BNKA 3KOXE 4CGYB 3OTOM 1JQJC 1RU3A 3GLHB 2QNJA 4M0WA 4IIWA 2DXIA 2ZBKB 5EP4A 1T3TA 4LFBM 2Y20A 2JNHA 2R46A 5IWAM 3LQQA 5EXTA 3B89A 1OAOC 2R4JA 5EP2A 3M0EA 2EJSA 3W0FA 1OKSA 1NVMA 1XWIA 1F4IA 3KVWA 4D81A 1SXJA 3U6EA 1G59A 4IBIA 3VFDA 2R65A 4LJAA 4UN2B 4LY6A 4I4LA 2G8LA 3VKGA 2YNMD 5EP1A 4FWGA 2R62A 4RF0A 4G4NA 1HJPA 4IBDA 4MGYE 1GO5A 2LVOC 2DWLA 3U6OA 5IZ7D 1E94E 3L2AA 2W82A 2FH0A 2F5NA 3KDSE 2J7NA 2OO9A 3NBXX 4EIWA 2B3TA 4BLCA 3T6PA 3U61A 3PVSA 3A98B 2MH8A 4JI6M 3HWSA 3SC3A 4YY3M 1JB0F 2CHGA 1GL7A 1KYIA 2R44A 1QDTA 4Z6YA 4GKJM 1SXJB 2XFSA 3D8BA 4L15A 2ZTDA 3HJ8A 1OFHA 1BVSA 1G4AE 2OOAA 2Y0TA 3IG8A 3GPYA 2QENA 3QYEA 4L6V6 4NSRA 1K3WA 4CISA 4JI2M 3M6AA 2RGOA 1IXZA 2DHRA 5A2QS 1ZV1A 2QBYA 4JV5M 2LHCA 3HHXA 4YHHM 3U60B 1D0KA 4LJ4A 3FUXA 2ZANA 4Y28F 1QAMA 2KNVA 3KW6A 2LVAA 3NWLA 3AFHA 2DWNA 2LVPC 1DV0A 4GRIA 3GPPA 3AOEC 2F5PA 1Q3CA 3AKZA 3NBIA 2DWMA 4QNRA 2C96A 4NSOB 2CEAA 3DOAA 2K0BX 1N77A 3TE6A 4DR7M 4FWDA 3W68A 4GITA 1ZMWA 4JI5M 1XNQM 2Z8YM 3E9SA 3FRHA 5EP3A 3J80S 3WHLA 1LV7A 4NOOB 2UUBM 4L8RC 1AIPC 2L09A 2MGWA 3HGIA 1N75A 4ANRA 3GLIE 3I4YA 2JY8A 1TH3A 4IBBA 4IBGA 4XGIA 4Z8XA 2V1UA 3JAMS 1IY0A 1SXJD 2LHGA 4DR2M 4DV2M 3FTFA 2JY5A 2MJ5B 4KT0F 2CHQA 4X65M 4JI8M 3AL0C 1V92A 4AKHA 3THGA 3AJIB 1GVNA 1C7YA 3AOGA 2VIIA 1IBMM 3GLFA 3TWMA 2AHMA 2XF3A 4KO8A 2EKFA 2LVNC 4NXMM 2JY7A 3VKHA 2C99A 2ZM6M 1N36M 4B7GA 3JR4A 1PRBA 3K9PA 4HEOA 2D7HA 1J09A 2JY6B 4I5SA 5ITQA 5ITTA 2CV2A 2DZOB 1XXHE 1QAQA 3GPXA 4X66M 3E46A 1SXJE 1OIPA 2OPFA 1IN6A 4B7HA 2F5OA 1PM5A 3ZQJA 3FE3A 1HNWM 4MB7A 1L1ZA 2DNAA 5DYIA 2HAKA 1S3SA 4G4QA 3E21A 2EUCA 1IBLM 2XEPA 1MU5A 2L4FA 1WGNA 2GQFA 2LWXA 2HL7A 2WSCF 3GLHE 3L27A 3I51A 4FCWA 5EJCA 3HHWA 1PJSA 1VEGA 2DI0A 2VF7A 1DO2A 3MK6A 1N34M 2HHHM 1IBKM 2D7EA 4CJ6A 3ILKA 3EIEA 4X64M 3LCUA 3T15A 2ZAOA 3U6SA 4HLQA 4ITQA 1EFUB 5KPRA 4GC5A 4G4RA 4DUZM 1DGFA 1X37A 2J7OA 1GL6A 1OAIA 1R7RA 3IHPA 4AKIA 1YSYA 1NO1A 2HKJA 5EXSA 4LF7M 2VQFM 2CWBA 1V34A 2CHVA 3T38A 2N35A 3K92A 1QQWA 3VLFB 3W67A 3TPZA 1XMOM 3B7ZA 2C98A 4GH9A 4MH0E 1W5TA 1R2YA 2DAGA 1Z59A 1VQ1A 2XH9A 4D80A 1NSFA 3GPUA 2YR0A 3Q8GA 2L2DA 3R9XB 2KNZA 2KDLA 2BWBA 1TDHA 2DZLA 4OVZB 4M9ZA 1XMQM 3B7NA 1KSFX 2YFQA 4NL4H 1QAOA 1MX0A 2DAMA 3HZJA 4JI4M 3I01M 4IJEA 3U6CA 4WW0A 1V33A 4QOZC 5KQ8A 1GKIA 5FTKA 1R2ZA 4LF9M 4LGMA 3HHZA 2FNAA 1HT1E 2A5YB 3FD9A 2UUCM 3IG5A 4DR1M 3UJNA 1TTEA 1E9RA 3LMMA 1N78A 1VEJA 2APLA 2DKLA 3KP1E 3PFIA 3U6DA 5JI3E 2E5LM 1TH2A 5FTMA 5FTJA 4JYAM 1IXSA 1XB2B 2V1CA 4B3TM 4IBEA 3GQ5A 1Q39A 3DA1A 3LCVB 1A5TA 3TQSA 3UK6A 5KPZA 3J7BA 3SAVA 2D7GA 4L16A 3SFZA 1H6UA 1VDLA 3L26A 3FYDA 4DR3M 3SAUA 2Q2EB 4W5WA 4GEWA 4OW0A 3F92A 3KOYE 1TH4A
chains in the Genus database with same CATH topology
1D2NA 2Z3XA 1ZQ9A 4PCZA 1OFIA 3AV0A 3ZC7B 4DR6M 2XSZD 2Y0QA 2R18A 4LJ5A 4JI3M 2XZFA 3U6PA 1FNNA 3A42A 1C1KA 3ZH9B 3GRUA 3DZDA 2Y21A 2RKOA 3EIHA 3GLFB 4FCVA 1IQPA 2L6OA 4GHLA 4R3DA 5C1BA 3K1JA 4JN6A 4P16A 4DV3M 4OU7A 2QCUA 4AG6A 4GC9A 5E26A 4RNAA 1I4WA 3FKEA 3FUTA 5BPVA 4RF1A 1TGUA 2KA6B 2XSZA 3PNYA 3B9PA 1L2CA 3U60A 3U6LA 1SXJC 3HU1A 3KSXA 5FSWA 3R8FA 3CF6E 2QP9X 4AW4A 1N33M 2I7PA 4DV5M 4LF6M 1Z5AA 4AQYM 1IY2A 2UXBM 2VQEM 4NRWA 2P5TA 2M5ZA 2QBYB 3HJSA 3A46A 3SASA 4R7GA 1HQCA 3KOWE 4M9XA 4MGZE 1G8PA 1YE9A 4B08A 1UM8A 4LJ6A 4M0DA 1IY1A 3GLIA 2X8AA 2KEBA 2V6ZM 8CATA 2C9CA 3RE8A 2I7NA 1K82A 4XBOA 1NHGC 2OQ4A 2L7IA 3U6QA 3FTDA 4MGIE 4M9SA 4LGYA 2DZNB 2CV1A 5KO3A 3QWLA 3C58A 4LF8M 2CUZA 1DGHA 2QPAA 4GMQA 3GLGA 5KPTA 4LG2A 4CHTB 3SARA 1Q3BA 2CV0A 3CF0A 4JXJA 3MHVC 1NY5A 2NQ8C 3KSJA 3U6MA 2Z4SA 3ZCBB 4AG5A 1QZMA 5FTNA 1DO0A 3LVVA 4MGHA 2EA0A 2LNHC 3GLHA 5ITXA 2KXEA 3AOEA 3BOSA 3KS8A 4QNMA 1HNZM 3RFWA 4FD2A 3DFZA 3FTCA 4REZA 3FUVA 1NNUC 1YUBA 1IN7A 3VK7A 3A45A 3J2PB 5LMNM 2F5SA 4LF4M 2KRUA 2KRKA 3D8LA 3GLGB 1IBKM 3GRVA 4FCTA 4GIPA 3U5ZB 3UMMA 4B3MM 4I81A 4KLNA 3SBJA 4DV7M 3E4RA 1JR3D 1W5SA 4WURA 5ITUA 4LCBA 3FUUA 4I8OA 4S12A 2UUAM 1G3IA 2F5QA 2KZUA 4L4UA 5E6JA 1K3XA 1FJGM 1IN8A 1NJGA 4NRVA 3VDUA 3HKPA 2LXEA 3GLIB 1L8QA 1L1TA 1GLNA 3U61B 1J7KA 4DV4M 4KODA 5F3WA 4TUWA 4PT5A 1XNRM 5JI2E 3GRRA 4G4OA 5BR8M 4LJ9A 4BB9A 5EXPA 4HL4A 1QANA 4OX9M 3I4VA 5ITRA 3TWKA 1DGBA 2G5GX 5C18A 4IBCA 1OJLA 4MGKE 5KQDA 1XXHB 1KFVA 2XZUA 1JR3A 4LFCM 4D82A 5DNYA 4K0KM 1Z6TA 2X4AA 5LMUM 3GQ4A 3SATA 4IBKA 2BJWA 4FW9A 2Z4RA 3MJ5A 4ZPXA 3UZUA 1N32M 2C5RA 3QAUA 1VDDA 3KFUG 2FFJA 3WHKA 7CATA 2KZSA 1Z5BA 1J5EM 4LJ7A 1IM2A 1NY6A 3CTWB 4L78A 1E9SA 4LZZA 4PDGA 2X49A 4DV0M 2Z7JA 2LH0A 4DV1M 1L2DA 4AZFA 4LF5M 1XHBA 4GHAA 3Q8XA 3RGSA 3L29A 4PD2A 1DGHB 4QHSA 4AI6A 1DGGA 1Z5CA 2ERCA 4LRSA 2C9OA 3SMSA 3GP1A 1IN5A 2L7HA 3HU3A 4A3VB 3TWLA 1R6BX 2ZAMA 3T1HM 2UXCM 4LZJA 3KXEC 1PJIA 5GKNA 1HNXM 1IXRC 5EXXA 2O5RA 3VDPA 2FOIC 2JA2A 2UXDM 4FWHA 4IJFA 1HT2E 1IN4A 4NXNM 1G41A 5FTLA 3J81S 3SYLA 3KP0E 3GRYA 3LVWA 4JI1M 1NJFA 2XLJA 2DWZB 4B3SM 2CE7A 4QOSA 3PXGA 1QVRA 2DVWB 3L25A 2R45A 4JI7M 3U5ZA 5IT9S 3FTEA 1ORYB 4GKKM 3LQRA 1NHWC 4QHTA 1WXQA 1XXHA 3FUWA 3HHYA 5ITYA 3FYCA 1L2BA 2XGNA 4AKGA 2HCBA 5FLXS 5IREB 3KS4A 2K47A 3GQ3A 4LFAM 1XC8A 3M7GA 3SHFA 1ZAEA 2BJVA 1NNJA 3K8ZA 2CFOA 2H1RA 5EQTA 1PJJA 2QZ4A 4IBJA 5DYGA 3PNVA 3SMPA 4LJ8A 2KW0A 3UGJA 2F4VM 3HU2A 1E32A 4MM3B 2UU9M 1HQYE 3T1YM 4OVZA 5H37D 4FVMA 4LRTA 3SAWA 4X62M 2FE8A 4PDIA 3HJQA 1HR0M 4DUYM 3TL4X 3KOZE 2M60A 1QYRA 4KHPM 4DV6M 4B7FA 3W0LB 4G6ZA 1EE8A 2EO2A 4DR5M 3VK8A 2YQZA 3J27B 2R4EA 3JR5A 4B3RM 3CF2A 3L28A 3K2LA 3SYKA 4BBAA 2RGHA 4II7A 2XFTA 4IBFA 1IXSB 3RGPA 3H4MA 4DR4M 4JI0M 3J7AS 3GO8A 3SHGB 2BNKA 3KOXE 4CGYB 3OTOM 1JQJC 3GLHB 4M0WA 4IIWA 2DXIA 2ZBKB 5EP4A 1T3TA 4LFBM 2Y20A 2R46A 5IWAM 3LQQA 5EXTA 2R4JA 5EP2A 3M0EA 3W0FA 1NVMA 1XWIA 3KVWA 4D81A 1SXJA 3U6EA 1G59A 4IBIA 3VFDA 2R65A 4LJAA 4LY6A 4I4LA 2G8LA 3VKGA 2YNMD 5EP1A 4FWGA 2R62A 4RF0A 4G4NA 4IBDA 4MGYE 2DWLA 3U6OA 5IZ7D 3L2AA 1E94E 2W82A 2F5NA 3KDSE 2J7NA 4EIWA 4BLCA 3U61A 3PVSA 3A98B 4JI6M 3HWSA 3SC3A 4YY3M 2CHGA 1GL7A 1KYIA 4Z6YA 4GKJM 1SXJB 2XFSA 3D8BA 4L15A 3HJ8A 1OFHA 1G4AE 2Y0TA 3IG8A 3GPYA 2QENA 1K3WA 4NSRA 4JI2M 4CISA 3M6AA 2RGOA 1IXZA 2DHRA 5A2QS 2QBYA 4JV5M 3HHXA 4YHHM 3U60B 4LJ4A 3FUXA 2ZANA 1QAMA 3KW6A 3NWLA 3AFHA 2DWNA 4GRIA 3GPPA 3AOEC 2F5PA 1Q3CA 3AKZA 3NBIA 2DWMA 4QNRA 2C96A 4NSOB 2CEAA 3DOAA 1N77A 3TE6A 4DR7M 4FWDA 1XNQM 4GITA 3E9SA 5EP3A 3J80S 3WHLA 1LV7A 4NOOB 2UUBM 4L8RC 2L09A 3HGIA 1N75A 3I4YA 4XGIA 1TH3A 4IBBA 4IBGA 4Z8XA 2V1UA 3JAMS 1IY0A 1SXJD 4DR2M 3FTFA 4DV2M 4AKHA 2CHQA 4X65M 4JI8M 3AL0C 3THGA 3AJIB 1GVNA 3AOGA 2VIIA 1IBMM 3GLFA 3TWMA 2AHMA 2XF3A 4KO8A 4NXMM 3VKHA 2C99A 2ZM6M 1N36M 4B7GA 3JR4A 2D7HA 1J09A 4I5SA 5ITQA 5ITTA 2CV2A 2DZOB 1QAQA 3GPXA 4X66M 1SXJE 2OPFA 1IN6A 4B7HA 2F5OA 1HNWM 4MB7A 1L1ZA 5DYIA 1S3SA 4G4QA 1IBLM 2EUCA 2XEPA 1MU5A 2LWXA 1PM5A 2HL7A 3L27A 4FCWA 5EJCA 3I51A 5ITXE 1TDZA 3HHWA 1N34M 1I94M 4JI5M 1DO2A 3MK6A 2HHHM 2D7EA 3ILKA 3EIEA 4X64M 3T15A 2ZAOA 3U6SA 4HLQA 4ITQA 5KPRA 4GC5A 4G4RA 4DUZM 1DGFA 1X37A 2J7OA 1GL6A 1R7RA 4AKIA 1YSYA 2HKJA 5EXSA 4LF7M 2VQFM 2CHVA 3T38A 3K92A 1QQWA 3VLFB 3TPZA 1XMOM 2C98A 4GH9A 4MH0E 1W5TA 1R2YA 1Z59A 2XH9A 4D80A 1NSFA 3GPUA 2YR0A 3R9XB 1TDHA 4OVZB 4M9ZA 1XMQM 1KSFX 2YFQA 4NL4H 1QAOA 1MX0A 4JI4M 4QOZC 4IJEA 3U6CA 4WW0A 5KQ8A 1GKIA 5FTKA 1R2ZA 4LF9M 4LGMA 3HHZA 2FNAA 1HT1E 2A5YB 3FD9A 2UUCM 3IG5A 4DR1M 3UJNA 3LMMA 1E9RA 1N78A 3KP1E 3PFIA 3U6DA 5JI3E 2E5LM 1TH2A 5FTMA 5FTJA 4JYAM 2V1CA 4B3TM 4IBEA 3GQ5A 1Q39A 3DA1A 3UK6A 3TQSA 5KPZA 3J7BA 3SAVA 2D7GA 4L16A 3SFZA 1H6UA 3L26A 4DR3M 3FYDA 3SAUA 2Q2EB 4W5WA 4OW0A 3KOYE 1TH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7G A;  2DWM A;  2DWN A;  4NL4 H;  2D7H A;  2DWL A;  2D7E A; 
#chains in the Genus database with same CATH topology
 1D2N A;  2Z3X A;  1GAB A;  1ZQ9 A;  4PCZ A;  3CGW A;  1OFI A;  3AV0 A;  3ZC7 B;  4F1I A;  4DR6 M;  2XSZ D;  2Y0Q A;  2R18 A;  4LJ5 A;  4JI3 M;  2XZF A;  1D0L A;  1FNN A;  3A42 A;  1C1K A;  3ZH9 B;  3U6P A;  3GRU A;  3DZD A;  1PGY A;  2DEN A;  2Y21 A;  2RKO A;  3EIH A;  3GLF B;  4FCV A;  1IQP A;  2L6O A;  4GHL A;  4R3D A;  3H4J A;  5C1B A;  1GJS A;  3K1J A;  4JN6 A;  1AUA A;  1R4G A;  4P16 A;  4OU7 A;  4DV3 M;  2JP7 A;  2QCU A;  4AG6 A;  4GC9 A;  5E26 A;  2DAI A;  1QUS A;  4RNA A;  1I4W A;  3FKE A;  3FUT A;  5BPV A;  4RF1 A;  1TGU A;  2KA6 B;  2XSZ A;  3PNY A;  3B9P A;  1L2C A;  1D0M A;  4WP2 A;  4XK8 F;  3U60 A;  3U6L A;  1SXJ C;  1UFZ A;  1VG5 A;  3HU1 A;  3KSX A;  5FSW A;  3R8F A;  3CF6 E;  2QP9 X;  4AW4 A;  1N33 M;  2I7P A;  2JZ0 A;  1ZMU A;  4DV5 M;  2O01 F;  1Z5A A;  4LF6 M;  1GJT A;  4AQY M;  3V76 A;  1IY2 A;  2UXB M;  2VQE M;  4NRW A;  1TF0 B;  2P5T A;  2M5Z A;  3GLG E;  2QBY B;  3HJS A;  3A46 A;  3SAS A;  4R7G A;  1HQC A;  1PJT A;  2R6F A;  2DHY A;  3KOW E;  4M9X A;  1G8P A;  1YE9 A;  4MGZ E;  4B08 A;  4Q7J A;  1UM8 A;  1WJ7 A;  4LJ6 A;  1IY1 A;  4M0D A;  3GLI A;  2X8A A;  2KEB A;  1YLA A;  2V6Z M;  2C9C A;  2EKK A;  3RE8 A;  8CAT A;  2I7N A;  1K82 A;  4XBO A;  1IFY A;  1NHG C;  2OQ4 A;  3BXW A;  2L7I A;  3U6Q A;  3FTD A;  1CUK A;  4MGI E;  4M9S A;  4LGY A;  2DZN B;  2CV1 A;  3C9P A;  3QWL A;  5KO3 A;  3C58 A;  4LF8 M;  2VF8 A;  2CUZ A;  1DGH A;  1WIV A;  2QPA A;  4GMQ A;  3GLG A;  5KPT A;  4LG2 A;  3GLF E;  4CHT B;  3SAR A;  1Q3B A;  2CV0 A;  3CF0 A;  2BWE A;  4R71 A;  4JXJ A;  3MHV C;  3IEC A;  1NY5 A;  4P17 A;  2NQ8 C;  3KSJ A;  3U6M A;  2Z4S A;  3ZCB B;  4AG5 A;  1QZM A;  3C3D A;  5FTN A;  1DO0 A;  3LVV A;  4MGH A;  2EA0 A;  2LNH C;  3GLH A;  5ITX A;  2KXE A;  1G71 A;  3BBZ A;  1PJQ A;  3AOE A;  3BOS A;  3KS8 A;  4QNM A;  1HNZ M;  3RFW A;  4FD2 A;  3DFZ A;  1OIZ A;  3FTC A;  2FS1 A;  4REZ A;  1SG9 A;  3FUV A;  1NNU C;  1YUB A;  1IN7 A;  2QQ8 A;  3VK7 A;  3A45 A;  3J2P B;  1EIJ A;  1OQY A;  5LMN M;  2F5S A;  4LF4 M;  2KRU A;  1OTR A;  2KRK A;  3D8L A;  3GLG B;  3K9O A;  1ZMV A;  3C3E A;  4DBG B;  1TR8 A;  3GRV A;  2OOB A;  4FCT A;  4GIP A;  3UMM A;  3U5Z B;  4B3M M;  3I04 M;  4CIZ A;  4I81 A;  4RKU F;  4KLN A;  3SBJ A;  4DV7 M;  2DAK A;  1JR3 D;  1W5S A;  3E4R A;  4WUR A;  4LCB A;  5DFL A;  5ITU A;  3FUU A;  1NV8 A;  4I8O A;  4S12 A;  3FRI A;  2UUA M;  2CRU A;  1QDR A;  1G3I A;  2F5Q A;  2KZU A;  4L4U A;  2KHH A;  5E6J A;  1K3X A;  1FJG M;  1IN8 A;  1NJG A;  1Q02 A;  2JZ1 A;  1NV9 A;  1QZE A;  2LXE A;  2MR9 A;  3HKP A;  4NRV A;  3VDU A;  1L8Q A;  2LTU A;  1GLN A;  3GLI B;  1L1T A;  3U61 B;  1J7K A;  4DV4 M;  1TDZ A;  4KOD A;  5F3W A;  4TUW A;  2WZJ A;  4PT5 A;  1XNR M;  5JI2 E;  3GRR A;  4G4O A;  3QYB A;  5BR8 M;  3LW5 F;  4LJ9 A;  4BB9 A;  5EXP A;  4HL4 A;  2LVQ D;  1QAN A;  4OX9 M;  3I4V A;  5ITR A;  3TWK A;  1DGB A;  2G5G X;  5C18 A;  4IBC A;  1OJL A;  2J5Y A;  4MGK E;  1MN3 A;  5KQD A;  1XXH B;  2JUJ A;  1KFV A;  2XZU A;  1JR3 A;  1Y8G A;  4LFC M;  4D82 A;  5DNY A;  4K0K M;  4F2L A;  1LTM A;  1Z6T A;  2X4A A;  3GQ4 A;  5LMU M;  4IBK A;  2BJW A;  3SAT A;  4FW9 A;  1R5L A;  2Z4R A;  3MJ5 A;  4ZPX A;  3UZU A;  1N32 M;  2C5R A;  1T6O A;  2K9D A;  2ZTC A;  1VDD A;  3QAU A;  1JR3 E;  3KFU G;  2FFJ A;  3WHK A;  7CAT A;  2KZS A;  2H5X A;  1Z5B A;  1J5E M;  2QSF X;  4LJ7 A;  1IM2 A;  1NY6 A;  3CTW B;  4L78 A;  1E9S A;  4LZZ A;  4PDG A;  2X49 A;  4DV0 M;  2Z7J A;  2LH0 A;  2WSE F;  4DV1 M;  1L2D A;  4AZF A;  4LF5 M;  1XHB A;  4GHA A;  3Q8X A;  3RGS A;  3L29 A;  4PD2 A;  1DGH B;  4QHS A;  4AI6 A;  1DGG A;  1Z5C A;  2ERC A;  4LRS A;  3MMP A;  2C9O A;  1WR1 B;  3SMS A;  3GP1 A;  1IN5 A;  2L7H A;  3HU3 A;  4A3V B;  3TWL A;  1R6B X;  2ZAM A;  5ITX E;  3T1H M;  4LZJ A;  3KXE C;  1PJI A;  2UXC M;  5GKN A;  2JXN A;  2R0I A;  1HNX M;  1IXR C;  5EXX A;  2O5R A;  1T43 A;  3B74 A;  3VDP A;  2FOI C;  2JA2 A;  2UXD M;  4FWH A;  4IJF A;  1HT2 E;  1IN4 A;  4NXN M;  1G41 A;  5FTL A;  3J81 S;  3HY5 A;  3SYL A;  3KP0 E;  3GRY A;  2K6B A;  3LVW A;  4JI1 M;  1NJF A;  2XLJ A;  2DWZ B;  4B3S M;  2CE7 A;  1WHC A;  2KNA A;  4QOS A;  3PXG A;  1QVR A;  2DVW B;  4G3O A;  1P3Q Q;  3L25 A;  2R45 A;  4JI7 M;  3U5Z A;  5IT9 S;  3FTE A;  1ORY B;  4GKK M;  3LQR A;  1NHW C;  2DAE A;  4QHT A;  1WXQ A;  1XXH A;  3FUW A;  3HHY A;  5ITY A;  3FYC A;  1L2B A;  2XGN A;  4AKG A;  2HCB A;  5FLX S;  5IRE B;  3KS4 A;  2WSF F;  2K47 A;  2JWS A;  3GQ3 A;  4LFA M;  2RRU A;  1XC8 A;  3M7G A;  3SHF A;  1ZAE A;  1QUT A;  2G3Q A;  2BJV A;  1NNJ A;  2MRO B;  3K8Z A;  2CFO A;  2H1R A;  2L4E A;  4NC6 A;  5EQT A;  1PJJ A;  2QZ4 A;  4IBJ A;  5DYG A;  3PNV A;  3SMP A;  3HX3 A;  4LJ8 A;  2KW0 A;  3UGJ A;  2F4V M;  3HU2 A;  1E32 A;  4MM3 B;  2UU9 M;  1HQY E;  1VEK A;  3T1Y M;  4OVZ A;  2O25 A;  5H37 D;  4FVM A;  4LRT A;  3SAW A;  4X62 M;  2FE8 A;  4PDI A;  3HJQ A;  1HR0 M;  2CP8 A;  4DUY M;  2VDB B;  3TL4 X;  2QHO B;  3KOZ E;  2M60 A;  1MJG M;  1QYR A;  4KHP M;  4DV6 M;  3B7Q A;  1WGL A;  4B7F A;  3W0L B;  4G6Z A;  1EE8 A;  2EO2 A;  2GNO A;  4DR5 M;  3VK8 A;  2YQZ A;  3J27 B;  2R4E A;  3JR5 A;  1I94 M;  4B3R M;  3CF2 A;  3L28 A;  3K2L A;  3SYK A;  4BBA A;  2RGH A;  2HWJ A;  4II7 A;  2XFT A;  5L8R F;  4IBF A;  1IXS B;  3RGP A;  3H4M A;  4DR4 M;  4JI0 M;  3J7A S;  2LBC A;  3GO8 A;  3SHG B;  2BNK A;  3KOX E;  4CGY B;  3OTO M;  1JQJ C;  1RU3 A;  3GLH B;  2QNJ A;  4M0W A;  4IIW A;  2DXI A;  2ZBK B;  5EP4 A;  1T3T A;  4LFB M;  2Y20 A;  2JNH A;  2R46 A;  5IWA M;  3LQQ A;  5EXT A;  3B89 A;  1OAO C;  2R4J A;  5EP2 A;  3M0E A;  2EJS A;  3W0F A;  1OKS A;  1NVM A;  1XWI A;  1F4I A;  3KVW A;  4D81 A;  1SXJ A;  3U6E A;  1G59 A;  4IBI A;  3VFD A;  2R65 A;  4LJA A;  4UN2 B;  4LY6 A;  4I4L A;  2G8L A;  3VKG A;  2YNM D;  5EP1 A;  4FWG A;  2R62 A;  4RF0 A;  4G4N A;  1HJP A;  4IBD A;  4MGY E;  1GO5 A;  2LVO C;  2DWL A;  3U6O A;  5IZ7 D;  1E94 E;  3L2A A;  2W82 A;  2FH0 A;  2F5N A;  3KDS E;  2J7N A;  2OO9 A;  3NBX X;  4EIW A;  2B3T A;  4BLC A;  3T6P A;  3U61 A;  3PVS A;  3A98 B;  2MH8 A;  4JI6 M;  3HWS A;  3SC3 A;  4YY3 M;  1JB0 F;  2CHG A;  1GL7 A;  1KYI A;  2R44 A;  1QDT A;  4Z6Y A;  4GKJ M;  1SXJ B;  2XFS A;  3D8B A;  4L15 A;  2ZTD A;  3HJ8 A;  1OFH A;  1BVS A;  1G4A E;  2OOA A;  2Y0T A;  3IG8 A;  3GPY A;  2QEN A;  3QYE A;  4L6V 6;  4NSR A;  1K3W A;  4CIS A;  4JI2 M;  3M6A A;  2RGO A;  1IXZ A;  2DHR A;  5A2Q S;  1ZV1 A;  2QBY A;  4JV5 M;  2LHC A;  3HHX A;  4YHH M;  3U60 B;  1D0K A;  4LJ4 A;  3FUX A;  2ZAN A;  4Y28 F;  1QAM A;  2KNV A;  3KW6 A;  2LVA A;  3NWL A;  3AFH A;  2DWN A;  2LVP C;  1DV0 A;  4GRI A;  3GPP A;  3AOE C;  2F5P A;  1Q3C A;  3AKZ A;  3NBI A;  2DWM A;  4QNR A;  2C96 A;  4NSO B;  2CEA A;  3DOA A;  2K0B X;  1N77 A;  3TE6 A;  4DR7 M;  4FWD A;  3W68 A;  4GIT A;  1ZMW A;  4JI5 M;  1XNQ M;  2Z8Y M;  3E9S A;  3FRH A;  5EP3 A;  3J80 S;  3WHL A;  1LV7 A;  4NOO B;  2UUB M;  4L8R C;  1AIP C;  2L09 A;  2MGW A;  3HGI A;  1N75 A;  4ANR A;  3GLI E;  3I4Y A;  2JY8 A;  1TH3 A;  4IBB A;  4IBG A;  4XGI A;  4Z8X A;  2V1U A;  3JAM S;  1IY0 A;  1SXJ D;  2LHG A;  4DR2 M;  4DV2 M;  3FTF A;  2JY5 A;  2MJ5 B;  4KT0 F;  2CHQ A;  4X65 M;  4JI8 M;  3AL0 C;  1V92 A;  4AKH A;  3THG A;  3AJI B;  1GVN A;  1C7Y A;  3AOG A;  2VII A;  1IBM M;  3GLF A;  3TWM A;  2AHM A;  2XF3 A;  4KO8 A;  2EKF A;  2LVN C;  4NXM M;  2JY7 A;  3VKH A;  2C99 A;  2ZM6 M;  1N36 M;  4B7G A;  3JR4 A;  1PRB A;  3K9P A;  4HEO A;  2D7H A;  1J09 A;  2JY6 B;  4I5S A;  5ITQ A;  5ITT A;  2CV2 A;  2DZO B;  1XXH E;  1QAQ A;  3GPX A;  4X66 M;  3E46 A;  1SXJ E;  1OIP A;  2OPF A;  1IN6 A;  4B7H A;  2F5O A;  1PM5 A;  3ZQJ A;  3FE3 A;  1HNW M;  4MB7 A;  1L1Z A;  2DNA A;  5DYI A;  2HAK A;  1S3S A;  4G4Q A;  3E21 A;  2EUC A;  1IBL M;  2XEP A;  1MU5 A;  2L4F A;  1WGN A;  2GQF A;  2LWX A;  2HL7 A;  2WSC F;  3GLH E;  3L27 A;  3I51 A;  4FCW A;  5EJC A;  3HHW A;  1PJS A;  1VEG A;  2DI0 A;  2VF7 A;  1DO2 A;  3MK6 A;  1N34 M;  2HHH M;  1IBK M;  2D7E A;  4CJ6 A;  3ILK A;  3EIE A;  4X64 M;  3LCU A;  3T15 A;  2ZAO A;  3U6S A;  4HLQ A;  4ITQ A;  1EFU B;  5KPR A;  4GC5 A;  4G4R A;  4DUZ M;  1DGF A;  1X37 A;  2J7O A;  1GL6 A;  1OAI A;  1R7R A;  3IHP A;  4AKI A;  1YSY A;  1NO1 A;  2HKJ A;  5EXS A;  4LF7 M;  2VQF M;  2CWB A;  1V34 A;  2CHV A;  3T38 A;  2N35 A;  3K92 A;  1QQW A;  3VLF B;  3W67 A;  3TPZ A;  1XMO M;  3B7Z A;  2C98 A;  4GH9 A;  4MH0 E;  1W5T A;  1R2Y A;  2DAG A;  1Z59 A;  1VQ1 A;  2XH9 A;  4D80 A;  1NSF A;  3GPU A;  2YR0 A;  3Q8G A;  2L2D A;  3R9X B;  2KNZ A;  2KDL A;  2BWB A;  1TDH A;  2DZL A;  4OVZ B;  4M9Z A;  1XMQ M;  3B7N A;  1KSF X;  2YFQ A;  4NL4 H;  1QAO A;  1MX0 A;  2DAM A;  3HZJ A;  4JI4 M;  3I01 M;  4IJE A;  3U6C A;  4WW0 A;  1V33 A;  4QOZ C;  5KQ8 A;  1GKI A;  5FTK A;  1R2Z A;  4LF9 M;  4LGM A;  3HHZ A;  2FNA A;  1HT1 E;  2A5Y B;  3FD9 A;  2UUC M;  3IG5 A;  4DR1 M;  3UJN A;  1TTE A;  1E9R A;  3LMM A;  1N78 A;  1VEJ A;  2APL A;  2DKL A;  3KP1 E;  3PFI A;  3U6D A;  5JI3 E;  2E5L M;  1TH2 A;  5FTM A;  5FTJ A;  4JYA M;  1IXS A;  1XB2 B;  2V1C A;  4B3T M;  4IBE A;  3GQ5 A;  1Q39 A;  3DA1 A;  3LCV B;  1A5T A;  3TQS A;  3UK6 A;  5KPZ A;  3J7B A;  3SAV A;  2D7G A;  4L16 A;  3SFZ A;  1H6U A;  1VDL A;  3L26 A;  3FYD A;  4DR3 M;  3SAU A;  2Q2E B;  4W5W A;  4GEW A;  4OW0 A;  3F92 A;  3KOY E;  1TH4 A; 
#chains in the Genus database with same CATH homology
 1D2N A;  2Z3X A;  1ZQ9 A;  4PCZ A;  1OFI A;  3AV0 A;  3ZC7 B;  4DR6 M;  2XSZ D;  2Y0Q A;  2R18 A;  4LJ5 A;  4JI3 M;  2XZF A;  3U6P A;  1FNN A;  3A42 A;  1C1K A;  3ZH9 B;  3GRU A;  3DZD A;  2Y21 A;  2RKO A;  3EIH A;  3GLF B;  4FCV A;  1IQP A;  2L6O A;  4GHL A;  4R3D A;  5C1B A;  3K1J A;  4JN6 A;  4P16 A;  4DV3 M;  4OU7 A;  2QCU A;  4AG6 A;  4GC9 A;  5E26 A;  4RNA A;  1I4W A;  3FKE A;  3FUT A;  5BPV A;  4RF1 A;  1TGU A;  2KA6 B;  2XSZ A;  3PNY A;  3B9P A;  1L2C A;  3U60 A;  3U6L A;  1SXJ C;  3HU1 A;  3KSX A;  5FSW A;  3R8F A;  3CF6 E;  2QP9 X;  4AW4 A;  1N33 M;  2I7P A;  4DV5 M;  4LF6 M;  1Z5A A;  4AQY M;  1IY2 A;  2UXB M;  2VQE M;  4NRW A;  2P5T A;  2M5Z A;  2QBY B;  3HJS A;  3A46 A;  3SAS A;  4R7G A;  1HQC A;  3KOW E;  4M9X A;  4MGZ E;  1G8P A;  1YE9 A;  4B08 A;  1UM8 A;  4LJ6 A;  4M0D A;  1IY1 A;  3GLI A;  2X8A A;  2KEB A;  2V6Z M;  8CAT A;  2C9C A;  3RE8 A;  2I7N A;  1K82 A;  4XBO A;  1NHG C;  2OQ4 A;  2L7I A;  3U6Q A;  3FTD A;  4MGI E;  4M9S A;  4LGY A;  2DZN B;  2CV1 A;  5KO3 A;  3QWL A;  3C58 A;  4LF8 M;  2CUZ A;  1DGH A;  2QPA A;  4GMQ A;  3GLG A;  5KPT A;  4LG2 A;  4CHT B;  3SAR A;  1Q3B A;  2CV0 A;  3CF0 A;  4JXJ A;  3MHV C;  1NY5 A;  2NQ8 C;  3KSJ A;  3U6M A;  2Z4S A;  3ZCB B;  4AG5 A;  1QZM A;  5FTN A;  1DO0 A;  3LVV A;  4MGH A;  2EA0 A;  2LNH C;  3GLH A;  5ITX A;  2KXE A;  3AOE A;  3BOS A;  3KS8 A;  4QNM A;  1HNZ M;  3RFW A;  4FD2 A;  3DFZ A;  3FTC A;  4REZ A;  3FUV A;  1NNU C;  1YUB A;  1IN7 A;  3VK7 A;  3A45 A;  3J2P B;  5LMN M;  2F5S A;  4LF4 M;  2KRU A;  2KRK A;  3D8L A;  3GLG B;  1IBK M;  3GRV A;  4FCT A;  4GIP A;  3U5Z B;  3UMM A;  4B3M M;  4I81 A;  4KLN A;  3SBJ A;  4DV7 M;  3E4R A;  1JR3 D;  1W5S A;  4WUR A;  5ITU A;  4LCB A;  3FUU A;  4I8O A;  4S12 A;  2UUA M;  1G3I A;  2F5Q A;  2KZU A;  4L4U A;  5E6J A;  1K3X A;  1FJG M;  1IN8 A;  1NJG A;  4NRV A;  3VDU A;  3HKP A;  2LXE A;  3GLI B;  1L8Q A;  1L1T A;  1GLN A;  3U61 B;  1J7K A;  4DV4 M;  4KOD A;  5F3W A;  4TUW A;  4PT5 A;  1XNR M;  5JI2 E;  3GRR A;  4G4O A;  5BR8 M;  4LJ9 A;  4BB9 A;  5EXP A;  4HL4 A;  1QAN A;  4OX9 M;  3I4V A;  5ITR A;  3TWK A;  1DGB A;  2G5G X;  5C18 A;  4IBC A;  1OJL A;  4MGK E;  5KQD A;  1XXH B;  1KFV A;  2XZU A;  1JR3 A;  4LFC M;  4D82 A;  5DNY A;  4K0K M;  1Z6T A;  2X4A A;  5LMU M;  3GQ4 A;  3SAT A;  4IBK A;  2BJW A;  4FW9 A;  2Z4R A;  3MJ5 A;  4ZPX A;  3UZU A;  1N32 M;  2C5R A;  3QAU A;  1VDD A;  3KFU G;  2FFJ A;  3WHK A;  7CAT A;  2KZS A;  1Z5B A;  1J5E M;  4LJ7 A;  1IM2 A;  1NY6 A;  3CTW B;  4L78 A;  1E9S A;  4LZZ A;  4PDG A;  2X49 A;  4DV0 M;  2Z7J A;  2LH0 A;  4DV1 M;  1L2D A;  4AZF A;  4LF5 M;  1XHB A;  4GHA A;  3Q8X A;  3RGS A;  3L29 A;  4PD2 A;  1DGH B;  4QHS A;  4AI6 A;  1DGG A;  1Z5C A;  2ERC A;  4LRS A;  2C9O A;  3SMS A;  3GP1 A;  1IN5 A;  2L7H A;  3HU3 A;  4A3V B;  3TWL A;  1R6B X;  2ZAM A;  3T1H M;  2UXC M;  4LZJ A;  3KXE C;  1PJI A;  5GKN A;  1HNX M;  1IXR C;  5EXX A;  2O5R A;  3VDP A;  2FOI C;  2JA2 A;  2UXD M;  4FWH A;  4IJF A;  1HT2 E;  1IN4 A;  4NXN M;  1G41 A;  5FTL A;  3J81 S;  3SYL A;  3KP0 E;  3GRY A;  3LVW A;  4JI1 M;  1NJF A;  2XLJ A;  2DWZ B;  4B3S M;  2CE7 A;  4QOS A;  3PXG A;  1QVR A;  2DVW B;  3L25 A;  2R45 A;  4JI7 M;  3U5Z A;  5IT9 S;  3FTE A;  1ORY B;  4GKK M;  3LQR A;  1NHW C;  4QHT A;  1WXQ A;  1XXH A;  3FUW A;  3HHY A;  5ITY A;  3FYC A;  1L2B A;  2XGN A;  4AKG A;  2HCB A;  5FLX S;  5IRE B;  3KS4 A;  2K47 A;  3GQ3 A;  4LFA M;  1XC8 A;  3M7G A;  3SHF A;  1ZAE A;  2BJV A;  1NNJ A;  3K8Z A;  2CFO A;  2H1R A;  5EQT A;  1PJJ A;  2QZ4 A;  4IBJ A;  5DYG A;  3PNV A;  3SMP A;  4LJ8 A;  2KW0 A;  3UGJ A;  2F4V M;  3HU2 A;  1E32 A;  4MM3 B;  2UU9 M;  1HQY E;  3T1Y M;  4OVZ A;  5H37 D;  4FVM A;  4LRT A;  3SAW A;  4X62 M;  2FE8 A;  4PDI A;  3HJQ A;  1HR0 M;  4DUY M;  3TL4 X;  3KOZ E;  2M60 A;  1QYR A;  4KHP M;  4DV6 M;  4B7F A;  3W0L B;  4G6Z A;  1EE8 A;  2EO2 A;  4DR5 M;  3VK8 A;  2YQZ A;  3J27 B;  2R4E A;  3JR5 A;  4B3R M;  3CF2 A;  3L28 A;  3K2L A;  3SYK A;  4BBA A;  2RGH A;  4II7 A;  2XFT A;  4IBF A;  1IXS B;  3RGP A;  3H4M A;  4DR4 M;  4JI0 M;  3J7A S;  3GO8 A;  3SHG B;  2BNK A;  3KOX E;  4CGY B;  3OTO M;  1JQJ C;  3GLH B;  4M0W A;  4IIW A;  2DXI A;  2ZBK B;  5EP4 A;  1T3T A;  4LFB M;  2Y20 A;  2R46 A;  5IWA M;  3LQQ A;  5EXT A;  2R4J A;  5EP2 A;  3M0E A;  3W0F A;  1NVM A;  1XWI A;  3KVW A;  4D81 A;  1SXJ A;  3U6E A;  1G59 A;  4IBI A;  3VFD A;  2R65 A;  4LJA A;  4LY6 A;  4I4L A;  2G8L A;  3VKG A;  2YNM D;  5EP1 A;  4FWG A;  2R62 A;  4RF0 A;  4G4N A;  4IBD A;  4MGY E;  2DWL A;  3U6O A;  5IZ7 D;  3L2A A;  1E94 E;  2W82 A;  2F5N A;  3KDS E;  2J7N A;  4EIW A;  4BLC A;  3U61 A;  3PVS A;  3A98 B;  4JI6 M;  3HWS A;  3SC3 A;  4YY3 M;  2CHG A;  1GL7 A;  1KYI A;  4Z6Y A;  4GKJ M;  1SXJ B;  2XFS A;  3D8B A;  4L15 A;  3HJ8 A;  1OFH A;  1G4A E;  2Y0T A;  3IG8 A;  3GPY A;  2QEN A;  1K3W A;  4NSR A;  4JI2 M;  4CIS A;  3M6A A;  2RGO A;  1IXZ A;  2DHR A;  5A2Q S;  2QBY A;  4JV5 M;  3HHX A;  4YHH M;  3U60 B;  4LJ4 A;  3FUX A;  2ZAN A;  1QAM A;  3KW6 A;  3NWL A;  3AFH A;  2DWN A;  4GRI A;  3GPP A;  3AOE C;  2F5P A;  1Q3C A;  3AKZ A;  3NBI A;  2DWM A;  4QNR A;  2C96 A;  4NSO B;  2CEA A;  3DOA A;  1N77 A;  3TE6 A;  4DR7 M;  4FWD A;  1XNQ M;  4GIT A;  3E9S A;  5EP3 A;  3J80 S;  3WHL A;  1LV7 A;  4NOO B;  2UUB M;  4L8R C;  2L09 A;  3HGI A;  1N75 A;  3I4Y A;  4XGI A;  1TH3 A;  4IBB A;  4IBG A;  4Z8X A;  2V1U A;  3JAM S;  1IY0 A;  1SXJ D;  4DR2 M;  3FTF A;  4DV2 M;  4AKH A;  2CHQ A;  4X65 M;  4JI8 M;  3AL0 C;  3THG A;  3AJI B;  1GVN A;  3AOG A;  2VII A;  1IBM M;  3GLF A;  3TWM A;  2AHM A;  2XF3 A;  4KO8 A;  4NXM M;  3VKH A;  2C99 A;  2ZM6 M;  1N36 M;  4B7G A;  3JR4 A;  2D7H A;  1J09 A;  4I5S A;  5ITQ A;  5ITT A;  2CV2 A;  2DZO B;  1QAQ A;  3GPX A;  4X66 M;  1SXJ E;  2OPF A;  1IN6 A;  4B7H A;  2F5O A;  1HNW M;  4MB7 A;  1L1Z A;  5DYI A;  1S3S A;  4G4Q A;  1IBL M;  2EUC A;  2XEP A;  1MU5 A;  2LWX A;  1PM5 A;  2HL7 A;  3L27 A;  4FCW A;  5EJC A;  3I51 A;  5ITX E;  1TDZ A;  3HHW A;  1N34 M;  1I94 M;  4JI5 M;  1DO2 A;  3MK6 A;  2HHH M;  2D7E A;  3ILK A;  3EIE A;  4X64 M;  3T15 A;  2ZAO A;  3U6S A;  4HLQ A;  4ITQ A;  5KPR A;  4GC5 A;  4G4R A;  4DUZ M;  1DGF A;  1X37 A;  2J7O A;  1GL6 A;  1R7R A;  4AKI A;  1YSY A;  2HKJ A;  5EXS A;  4LF7 M;  2VQF M;  2CHV A;  3T38 A;  3K92 A;  1QQW A;  3VLF B;  3TPZ A;  1XMO M;  2C98 A;  4GH9 A;  4MH0 E;  1W5T A;  1R2Y A;  1Z59 A;  2XH9 A;  4D80 A;  1NSF A;  3GPU A;  2YR0 A;  3R9X B;  1TDH A;  4OVZ B;  4M9Z A;  1XMQ M;  1KSF X;  2YFQ A;  4NL4 H;  1QAO A;  1MX0 A;  4JI4 M;  4QOZ C;  4IJE A;  3U6C A;  4WW0 A;  5KQ8 A;  1GKI A;  5FTK A;  1R2Z A;  4LF9 M;  4LGM A;  3HHZ A;  2FNA A;  1HT1 E;  2A5Y B;  3FD9 A;  2UUC M;  3IG5 A;  4DR1 M;  3UJN A;  3LMM A;  1E9R A;  1N78 A;  3KP1 E;  3PFI A;  3U6D A;  5JI3 E;  2E5L M;  1TH2 A;  5FTM A;  5FTJ A;  4JYA M;  2V1C A;  4B3T M;  4IBE A;  3GQ5 A;  1Q39 A;  3DA1 A;  3UK6 A;  3TQS A;  5KPZ A;  3J7B A;  3SAV A;  2D7G A;  4L16 A;  3SFZ A;  1H6U A;  3L26 A;  4DR3 M;  3FYD A;  3SAU A;  2Q2E B;  4W5W A;  4OW0 A;  3KOY E;  1TH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...