1WHCA

Solution structure of rsgi ruh-027, a uba domain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
GSSGSSGAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-027, a UBA domain from Mus musculus cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords UBA/UBX 33.3 kDa protein
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1whcA01
1ZMVA 2DAIA 2QSFX 2EKKA 2K9DA 2HAKA 1C7YA 1HT2E 2ZTDA 1G3IA 1G4AE 2LVQD 1QZEA 1NV9A 1WGLA 4HEOA 3FRIA 2CWBA 1P3QQ 2HWJA 2DNAA 2JUJA 2JY6B 2OO9A 2KNZA 2DHYA 2JNHA 1TTEA 2MROB 5DFLA 1WR1B 2LVAA 2O25A 2H5XA 1XXHE 3IHPA 1VEGA 1PGYA 2WZJA 2QNJA 4WP2A 1DO2A 2DAEA 3GLGE 4UN2B 1A5TA 1OKSA 3E46A 1DO0A 2DAKA 3GLIE 1WIVA 2JY8A 2JZ0A 1WHCA 2EKFA 1Q02A 2DZLA 1VQ1A 2LVNC 2LVPC 3FE3A 1ZMWA 2MJ5B 1E94E 2DAMA 1WGNA 2DENA 1BVSA 1VG5A 1DV0A 1XB2B 2R0IA 1ZV1A 3LCUA 2OOBA 1V92A 2BWBA 1GO5A 2MR9A 1Y8GA 2LTUA 3B89A 4F2LA 1EFUB 1KYIA 3BBZA 2JY5A 1HJPA 3E21A 1ZMUA 1TR8A 1G41A 3F92A 2LVOC 1HT1E 2JP7A 2DKLA 5JI2E 2BWEA 2DI0A 1SG9A 2K0BX 2JZ1A 3GLHE 1IM2A 1IFYA 1OTRA 1CUKA 1VDLA 2RRUA 1VEKA 1JR3E 2G3QA 1T6OA 2B3TA 4F1IA 2L4EA 2KNVA 2MGWA 3GLFE 2L2DA 1AIPC 1OAIA 3FRHA 1MN3A 2KNAA 1WJ7A 1R4GA 4R71A 2OOAA 2EJSA 3H4JA 2QHOB 2CP8A 1HQYE 3IECA 1YLAA 3MMPA 2DAGA 3K9OA 3K9PA 2L4FA 1VEJA 1NV8A 1UFZA 1OQYA 4GEWA 1F4IA 3T6PA 4DBGB 3LCVB 2ZTCA 4Q7JA 2LBCA 4G3OA 2KHHA 2JY7A 1IXSA 1T43A
chains in the Genus database with same CATH superfamily
1D0KA 3UJNA 2DAIA 5ITTA 1N36M 4JI8M 4FWGA 4DR5M 3LVWA 3R8FA 2HAKA 3GLHB 4DR1M 5L8RF 1C1KA 4GC9A 4DUZM 4LG2A 4L4UA 4GH9A 3KS8A 1WGLA 4JI4M 5EXPA 4JI2M 4AQYM 3W0LB 4HEOA 1R2YA 1P3QQ 2DWLA 2UXBM 2JUJA 1TF0B 3EIHA 3KVWA 4A3VB 2L7HA 4K0KM 3FUVA 4QOSA 5FTNA 2JNHA 4CHTB 2LVAA 2J7NA 3D8LA 1XNRM 5FTKA 3HKPA 1VEGA 2WZJA 4LJ6A 1GL6A 2DAEA 3SYLA 3J27B 3PNYA 5FTLA 3GPPA 4P16A 3GPYA 4M9ZA 3BOSA 2KRUA 2O5RA 3KP0E 4DR3M 4GHAA 1A5TA 2DZNB 4Z8XA 3E46A 1DO0A 2DAKA 3GLIE 3THGA 1MJGM 1IXRC 1OIZA 4G4RA 2QP9X 1WHCA 2EKFA 1V33A 2LVNC 3HHXA 1VQ1A 4X65M 3FE3A 4RF0A 2CFOA 1ZMWA 2MJ5B 2DAMA 2YFQA 1JB0F 3A98B 3KOWE 2DENA 1HQCA 4CIZA 5KO3A 3K2LA 4GC5A 4NXNM 3MK6A 3M7GA 3CF2A 1DV0A 4BLCA 3GQ3A 2JXNA 5JI3E 3HWSA 1TDHA 4B7HA 3SAVA 4JN6A 2I7PA 4X64M 2MR9A 3GLGA 4AKGA 4G4NA 3LVVA 3B89A 4B08A 4F2LA 2Q2EB 3MJ5A 5EJCA 3BBZA 3FTEA 3AOEC 4DV2M 3HJQA 1HJPA 4PDGA 2DZOB 1TDZA 4TUWA 4IBKA 4LJ7A 1N34M 3M0EA 1L8QA 3F92A 4IBIA 4DR4M 3ZH9B 2JP7A 1Z5AA 2DKLA 4JI5M 2H1RA 2WSFF 4DV4M 3FUUA 1OFIA 1QANA 4MM3B 5JI2E 3KFUG 4DR6M 4FCWA 2J5YA 4AKIA 2CRUA 3T1HM 1OTRA 3DFZA 4P17A 3JR5A 5ITYA 1TGUA 3BXWA 4IBGA 2UUCM 3R9XB 3D8BA 2Y20A 3FTCA 4LJ8A 5EP1A 1L2DA 2GQFA 3ZCBB 2D7GA 5DYIA 2L4EA 3I04M 1N75A 2XSZA 4OVZA 5IZ7D 3GLFE 4LJ5A 2L2DA 2D7EA 4L16A 3U6CA 2KNAA 3U60A 1QAMA 1WJ7A 3U6LA 3W0FA 3DA1A 3L27A 2XSZD 1VDDA 5ITXE 3QAUA 5C18A 1R7RA 2OOAA 1Z59A 2EJSA 2R6FA 2Z7JA 4Y28F 2HCBA 2DVWB 3W68A 5FSWA 2DAGA 3K9PA 1QUSA 1IY0A 4IJEA 1OQYA 1Z6TA 4FWHA 3KOYE 4DR2M 2J7OA 4WW0A 4OU7A 3T6PA 5IWAM 3HU2A 5A2QS 3SATA 3HJ8A 2ZTCA 4FWDA 1EIJA 3GLGB 2LBCA 1N77A 3TWKA 1HNZM 1TH3A 1FJGM 2FE8A 1NVMA 3VDUA 3A42A 3HHZA 2L6OA 5KQDA 3J7AS 1G59A 3GRUA 2C96A 5EXSA 2K9DA 5EP4A 4XK8F 3LMMA 1HT2E 2ZTDA 2VIIA 1G3IA 2ZBKB 1G4AE 1K3WA 2LVQD 2XZUA 5ITUA 3UK6A 4R7GA 3U61B 1NHGC 4KO8A 3FRIA 2CWBA 4AZFA 3L2AA 4G6ZA 4IBCA 4QOZC 1DGGA 3QWLA 3GRRA 2R62A 4R3DA 4JI6M 1TTEA 2C9OA 1WR1B 3J80S 2H5XA 1D0MA 3CF0A 1XXHE 4JYAM 1K3XA 1QYRA 3I4VA 3FTFA 4YHHM 1PGYA 2QNJA 4WP2A 1DO2A 4GKKM 3RFWA 1XNQM 1J7KA 3IG8A 3JAMS 3J7BA 1LTMA 2Z4SA 4JI0M 3KOZE 1OKSA 3U6OA 2WSEF 8CATA 1WIVA 3AOGA 4NSRA 3GPXA 4DV7M 4B3RM 1ORYB 2XEPA 1HNWM 2LVPC 2R4JA 2GNOA 3SAUA 1IBLM 1OJLA 1E94E 2R46A 5ITQA 1MU5A 3QYEA 1DGHA 3H4MA 4LJAA 3FYDA 1I94M 1IXZA 1XXHB 1XB2B 2FNAA 5C1BA 5BR8M 2OOBA 4KLNA 4BB9A 1V92A 2UXCM 2QZ4A 2XH9A 1Y8GA 2XLJA 2LTUA 1NHWC 2M60A 2MH8A 1Q3CA 2JY5A 3GQ4A 1IQPA 4LRTA 3RGPA 1TR8A 1G41A 3LW5F 2LVOC 4OW0A 3AOEA 1DGHB 2BWEA 1GABA 2JZ1A 4XBOA 1IN7A 2BJWA 1KSFX 1E32A 4D81A 4DUYM 3TWMA 2P5TA 1JR3D 1IBMM 1VEKA 2FS1A 1TH4A 3GLFB 1X37A 1LV7A 1DGBA 3FKEA 4BBAA 4G4QA 4L8RC 4MGKE 1XC8A 5E26A 2C99A 4DV1M 2UU9M 1XHBA 1N33M 1L2CA 1AIPC 1OAIA 4M9XA 3FRHA 2ZAMA 4AG6A 4MGZE 1E9RA 1QQWA 5EQTA 5GKNA 1IN6A 4LGYA 4IBBA 3DZDA 4FVMA 3SC3A 4R71A 3H4JA 1NO1A 3FYCA 3RGSA 3U6SA 4JI3M 4NRWA 3VK7A 1H6UA 2EUCA 5EP2A 4X62M 1UFZA 2Y21A 3TWLA 3SASA 4GEWA 4B3MM 4OX9M 2F5NA 4G4OA 1JR3A 4DV0M 3U6MA 2BNKA 1R2ZA 5E6JA 4LJ9A 1HR0M 3PVSA 3HHYA 2KHHA 4LF8M 4PD2A 3KSXA 2WSCF 3C58A 3LQQA 1T43A 3AV0A 4LZZA 4FW9A 2X8AA 1PJIA 3HX3A 1QVRA 2G5GX 3KS4A 2R65A 4I8OA 2QBYA 1QZMA 3GPUA 4NXMM 1L1ZA 1SXJE 4QNRA 4CISA 1NV9A 4REZA 4M0WA 5KPTA 2N35A 4DV3M 1IN4A 1G71A 1SXJB 3L28A 2R18A 2QPAA 4NSOB 3ZC7B 3U6QA 2CUZA 3SHFA 1QAQA 3SYKA 2KDLA 1YUBA 1Q3BA 2YQZA 4HL4A 4L78A 1J09A 1DGFA 2DHYA 3TE6A 2V1CA 3GQ5A 4B7GA 2MROB 3K92A 3HGIA 3GLIA 3I4YA 3A45A 2O25A 1TH2A 4GMQA 1HNXM 2A5YB 3OTOM 3IHPA 4NC6A 4IBEA 2FOIC 4LF6M 2CHQA 3L29A 2HHHM 3SARA 2VF7A 4UN2B 3M6AA 4D82A 4MGYE 2G8LA 3HZJA 2AHMA 2JY8A 3K1JA 4MGHA 1FNNA 2QQ8A 2R45A 3GRVA 1Q02A 1GVNA 2DZLA 1PJTA 4LFAM 1IN5A 2LXEA 3SMPA 3VK8A 4AI6A 3NWLA 1XMQM 3LQRA 3Q8GA 3A46A 1VG5A 1NY5A 2C98A 2RGOA 4IBJA 3TL4X 3TQSA 1Z5CA 4LF9M 3AL0C 4QHSA 3DOAA 4PCZA 4ITQA 1QDRA 2BWBA 2O01F 3K8ZA 4ZPXA 4RNAA 5BPVA 5ITRA 3PNVA 1PJQA 4CJ6A 3U61A 4LJ4A 1NSFA 1EFUB 1GJTA 1KYIA 3L25A 2RKOA 2ZM6M 3KOXE 2W82A 1ZMUA 1OIPA 3U6EA 4DR7M 5KPRA 1KFVA 3PXGA 4LF4M 2UXDM 4IJFA 1EE8A 4IIWA 2DI0A 2EO2A 1T3TA 1JQJC 1SG9A 1YE9A 3B7QA 4LCBA 1SXJD 3GLIB 3GLHE 1IM2A 4FCVA 1D2NA 3I51A 1L1TA 3UZUA 1CUKA 5FTJA 4GKJM 2YNMD 4GITA 4LRSA 1IN8A 3VDPA 2OPFA 2VF8A 2JWSA 1PRBA 3C9PA 1D0LA 2EA0A 2UUBM 1T6OA 3FD9A 3KP1E 4AW4A 3AKZA 2MGWA 2KNVA 5DYGA 2NQ8C 5EP3A 1IXSB 3J81S 2DWNA 2QBYB 2Z8YM 3FTDA 2K47A 4WURA 5ITXA 4LF5M 2CV2A 2E5LM 2KZUA 3Q8XA 4W5WA 1R4GA 3VKHA 3B74A 4L15A 3KDSE 1V34A 2VQEM 1UM8A 2QHOB 3MHVC 3GLFA 3U60B 2XZFA 3SAWA 3FUTA 3ZQJA 2HKJA 1YLAA 2F4VM 2ERCA 3KW6A 2ZAOA 3K9OA 2DHRA 1IBKM 2L4FA 1VEJA 1NV8A 3HU3A 1R5LA 2R44A 3GP1A 3WHKA 3CF6E 3HHWA 4Q7JA 2YR0A 4G3OA 4EIWA 3GLHA 3HU1A 1IXSA 1Z5BA 4MH0E 4M0DA 3UMMA 4JI1M 4JI7M 1ZMVA 2Z3XA 2FFJA 2QSFX 2EKKA 4KODA 4PT5A 2F5OA 2CHVA 3NBIA 2HL7A 1C7YA 2RGHA 1QAOA 2I7NA 2DWMA 1NY6A 2XF3A 2F5PA 3C3DA 1XXHA 4QNMA 1QZEA 1K82A 2XGNA 1GKIA 1XWIA 4YY3M 3I01M 3T1YM 3IG5A 1QUTA 2HWJA 2C5RA 2DNAA 2JY6B 2OO9A 2KNZA 2QENA 3NBXX 1IY1A 4B7FA 2F5SA 4KHPM 5DFLA 2VQFM 2LWXA 4LF7M 4KT0F 1OAOC 5LMNM 3HY5A 1PM5A 2Y0QA 3VKGA 4RKUF 2OQ4A 5IREB 4IBFA 2QCUA 2APLA 4MGIE 3GLGE 1ZAEA 2JA2A 3QYBA 1PJJA 4S12A 3L26A 3KSJA 1SXJA 1WXQA 2M5ZA 1OFHA 2FH0A 3T15A 4QHTA 4GHLA 3U5ZB 1E9SA 3CGWA 3WHLA 1W5TA 2JZ0A 2R4EA 5KQ8A 2XFTA 3UGJA 1RU3A 2LHGA 1XMOM 1GL7A 4L6V6 1GJSA 1ZQ9A 2CE7A 2X4AA 4Z6YA 2VDBB 1QDTA 1WGNA 1NNJA 5IT9S 4ANRA 1BVSA 3SFZA 1NJGA 1I4WA 1MX0A 3HJSA 4HLQA 3B7NA 5EXTA 5F3WA 3B9PA 2R0IA 1R6BX 1ZV1A 2BJVA 2L09A 2K6BA 3E4RA 3LCUA 4PDIA 5LMUM 1GO5A 1J5EM 2D7HA 1PJSA 3AJIB 4NRVA 2Y0TA 1L2BA 3VFDA 4NL4H 4JV5M 2CHGA 2X49A 2UUAM 1NJFA 1AUAA 4LY6A 3E21A 4DV5M 2KXEA 4II7A 1HT1E 1IY2A 2CV1A 3VLFB 4JXJA 4I81A 3KXEC 2K0BX 4LGMA 4DV6M 5EXXA 4XGIA 1NNUC 1IFYA 3U6DA 1W5SA 1VDLA 7CATA 2RRUA 2KRKA 1JR3E 2G3QA 3U5ZA 1S3SA 3V76A 3ILKA 4CGYB 4GIPA 5H37D 2LH0A 4FD2A 2B3TA 4F1IA 2V6ZM 3SHGB 5FTMA 4B3SM 2Z4RA 4MB7A 4I5SA 5DNYA 1SXJC 3J2PB 3GRYA 5KPZA 1N78A 4GRIA 1MN3A 2KEBA 1YSYA 3T38A 2LNHC 3EIEA 3SBJA 2F5QA 3TPZA 4OVZB 4I4LA 2L7IA 3RE8A 4FCTA 2KZSA 2DXIA 2CV0A 4LZJA 3U6PA 3AFHA 4B3TM 1G8PA 3CTWB 4NOOB 2CP8A 1HQYE 3IECA 3MMPA 4AKHA 4IBDA 3FUWA 3W67A 2KW0A 1Q39A 2ZANA 2KA6B 2V1UA 1F4IA 1GLNA 3E9SA 3C3EA 4RF1A 4DBGB 2C9CA 4M9SA 4AG5A 3LCVB 2LHCA 2DWZB 3FUXA 3JR4A 5FLXS 1N32M 2CEAA 2JY7A 3PFIA 3GO8A 4LFCM 3SMSA 2XFSA 4LFBM 4D80A 3B7ZA 4X66M
chains in the Genus database with same CATH topology
1ZMVA 2DAIA 2QSFX 2EKKA 2K9DA 2HAKA 1C7YA 1HT2E 2ZTDA 1G3IA 1G4AE 2LVQD 1QZEA 1NV9A 1WGLA 4HEOA 3FRIA 2CWBA 1P3QQ 2HWJA 2DNAA 2JUJA 2JY6B 2OO9A 2KNZA 2DHYA 2JNHA 1TTEA 2MROB 5DFLA 1WR1B 2LVAA 2O25A 2H5XA 1XXHE 3IHPA 1VEGA 1PGYA 2WZJA 2QNJA 4WP2A 1DO2A 2DAEA 3GLGE 4UN2B 1A5TA 1OKSA 3E46A 1DO0A 2DAKA 3GLIE 1WIVA 2JY8A 2JZ0A 1WHCA 2EKFA 1Q02A 2DZLA 1VQ1A 2LVNC 2LVPC 3FE3A 1ZMWA 2MJ5B 1E94E 2DAMA 1WGNA 2DENA 1BVSA 1VG5A 1DV0A 1XB2B 2R0IA 1ZV1A 3LCUA 2OOBA 1V92A 2BWBA 1GO5A 2MR9A 1Y8GA 2LTUA 3B89A 4F2LA 1EFUB 1KYIA 3BBZA 2JY5A 1HJPA 3E21A 1ZMUA 1TR8A 1G41A 3F92A 2LVOC 1HT1E 2JP7A 2DKLA 5JI2E 2BWEA 2DI0A 1SG9A 2K0BX 2JZ1A 3GLHE 1IM2A 1IFYA 1OTRA 1CUKA 1VDLA 2RRUA 1VEKA 1JR3E 2G3QA 1T6OA 2B3TA 4F1IA 2L4EA 2KNVA 2MGWA 3GLFE 2L2DA 1AIPC 1OAIA 3FRHA 1MN3A 2KNAA 1WJ7A 1R4GA 4R71A 2OOAA 2EJSA 3H4JA 2QHOB 2CP8A 1HQYE 3IECA 1YLAA 3MMPA 2DAGA 3K9OA 3K9PA 2L4FA 1VEJA 1NV8A 1UFZA 1OQYA 4GEWA 1F4IA 3T6PA 4DBGB 3LCVB 2ZTCA 4Q7JA 2LBCA 4G3OA 2KHHA 2JY7A 1IXSA 1T43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMV A;  2DAI A;  2QSF X;  2EKK A;  2K9D A;  2HAK A;  1C7Y A;  1HT2 E;  2ZTD A;  1G3I A;  1G4A E;  2LVQ D;  1QZE A;  1NV9 A;  1WGL A;  4HEO A;  3FRI A;  2CWB A;  1P3Q Q;  2HWJ A;  2DNA A;  2JUJ A;  2JY6 B;  2OO9 A;  2KNZ A;  2DHY A;  2JNH A;  1TTE A;  2MRO B;  5DFL A;  1WR1 B;  2LVA A;  2O25 A;  2H5X A;  1XXH E;  3IHP A;  1VEG A;  1PGY A;  2WZJ A;  2QNJ A;  4WP2 A;  1DO2 A;  2DAE A;  3GLG E;  4UN2 B;  1A5T A;  1OKS A;  3E46 A;  1DO0 A;  2DAK A;  3GLI E;  1WIV A;  2JY8 A;  2JZ0 A;  1WHC A;  2EKF A;  1Q02 A;  2DZL A;  1VQ1 A;  2LVN C;  2LVP C;  3FE3 A;  1ZMW A;  2MJ5 B;  1E94 E;  2DAM A;  1WGN A;  2DEN A;  1BVS A;  1VG5 A;  1DV0 A;  1XB2 B;  2R0I A;  1ZV1 A;  3LCU A;  2OOB A;  1V92 A;  2BWB A;  1GO5 A;  2MR9 A;  1Y8G A;  2LTU A;  3B89 A;  4F2L A;  1EFU B;  1KYI A;  3BBZ A;  2JY5 A;  1HJP A;  3E21 A;  1ZMU A;  1TR8 A;  1G41 A;  3F92 A;  2LVO C;  1HT1 E;  2JP7 A;  2DKL A;  5JI2 E;  2BWE A;  2DI0 A;  1SG9 A;  2K0B X;  2JZ1 A;  3GLH E;  1IM2 A;  1IFY A;  1OTR A;  1CUK A;  1VDL A;  2RRU A;  1VEK A;  1JR3 E;  2G3Q A;  1T6O A;  2B3T A;  4F1I A;  2L4E A;  2KNV A;  2MGW A;  3GLF E;  2L2D A;  1AIP C;  1OAI A;  3FRH A;  1MN3 A;  2KNA A;  1WJ7 A;  1R4G A;  4R71 A;  2OOA A;  2EJS A;  3H4J A;  2QHO B;  2CP8 A;  1HQY E;  3IEC A;  1YLA A;  3MMP A;  2DAG A;  3K9O A;  3K9P A;  2L4F A;  1VEJ A;  1NV8 A;  1UFZ A;  1OQY A;  4GEW A;  1F4I A;  3T6P A;  4DBG B;  3LCV B;  2ZTC A;  4Q7J A;  2LBC A;  4G3O A;  2KHH A;  2JY7 A;  1IXS A;  1T43 A; 
#chains in the Genus database with same CATH topology
 1D0K A;  3UJN A;  2DAI A;  5ITT A;  1N36 M;  4JI8 M;  4FWG A;  4DR5 M;  3LVW A;  3R8F A;  2HAK A;  3GLH B;  4DR1 M;  5L8R F;  1C1K A;  4GC9 A;  4DUZ M;  4LG2 A;  4L4U A;  4GH9 A;  3KS8 A;  1WGL A;  4JI4 M;  5EXP A;  4JI2 M;  4AQY M;  3W0L B;  4HEO A;  1R2Y A;  1P3Q Q;  2DWL A;  2UXB M;  2JUJ A;  1TF0 B;  3EIH A;  3KVW A;  4A3V B;  2L7H A;  4K0K M;  3FUV A;  4QOS A;  5FTN A;  2JNH A;  4CHT B;  2LVA A;  2J7N A;  3D8L A;  1XNR M;  5FTK A;  3HKP A;  1VEG A;  2WZJ A;  4LJ6 A;  1GL6 A;  2DAE A;  3SYL A;  3J27 B;  3PNY A;  5FTL A;  3GPP A;  4P16 A;  3GPY A;  4M9Z A;  3BOS A;  2KRU A;  2O5R A;  3KP0 E;  4DR3 M;  4GHA A;  1A5T A;  2DZN B;  4Z8X A;  3E46 A;  1DO0 A;  2DAK A;  3GLI E;  3THG A;  1MJG M;  1IXR C;  1OIZ A;  4G4R A;  2QP9 X;  1WHC A;  2EKF A;  1V33 A;  2LVN C;  3HHX A;  1VQ1 A;  4X65 M;  3FE3 A;  4RF0 A;  2CFO A;  1ZMW A;  2MJ5 B;  2DAM A;  2YFQ A;  1JB0 F;  3A98 B;  3KOW E;  2DEN A;  1HQC A;  4CIZ A;  5KO3 A;  3K2L A;  4GC5 A;  4NXN M;  3MK6 A;  3M7G A;  3CF2 A;  1DV0 A;  4BLC A;  3GQ3 A;  2JXN A;  5JI3 E;  3HWS A;  1TDH A;  4B7H A;  3SAV A;  4JN6 A;  2I7P A;  4X64 M;  2MR9 A;  3GLG A;  4AKG A;  4G4N A;  3LVV A;  3B89 A;  4B08 A;  4F2L A;  2Q2E B;  3MJ5 A;  5EJC A;  3BBZ A;  3FTE A;  3AOE C;  4DV2 M;  3HJQ A;  1HJP A;  4PDG A;  2DZO B;  1TDZ A;  4TUW A;  4IBK A;  4LJ7 A;  1N34 M;  3M0E A;  1L8Q A;  3F92 A;  4IBI A;  4DR4 M;  3ZH9 B;  2JP7 A;  1Z5A A;  2DKL A;  4JI5 M;  2H1R A;  2WSF F;  4DV4 M;  3FUU A;  1OFI A;  1QAN A;  4MM3 B;  5JI2 E;  3KFU G;  4DR6 M;  4FCW A;  2J5Y A;  4AKI A;  2CRU A;  3T1H M;  1OTR A;  3DFZ A;  4P17 A;  3JR5 A;  5ITY A;  1TGU A;  3BXW A;  4IBG A;  2UUC M;  3R9X B;  3D8B A;  2Y20 A;  3FTC A;  4LJ8 A;  5EP1 A;  1L2D A;  2GQF A;  3ZCB B;  2D7G A;  5DYI A;  2L4E A;  3I04 M;  1N75 A;  2XSZ A;  4OVZ A;  5IZ7 D;  3GLF E;  4LJ5 A;  2L2D A;  2D7E A;  4L16 A;  3U6C A;  2KNA A;  3U60 A;  1QAM A;  1WJ7 A;  3U6L A;  3W0F A;  3DA1 A;  3L27 A;  2XSZ D;  1VDD A;  5ITX E;  3QAU A;  5C18 A;  1R7R A;  2OOA A;  1Z59 A;  2EJS A;  2R6F A;  2Z7J A;  4Y28 F;  2HCB A;  2DVW B;  3W68 A;  5FSW A;  2DAG A;  3K9P A;  1QUS A;  1IY0 A;  4IJE A;  1OQY A;  1Z6T A;  4FWH A;  3KOY E;  4DR2 M;  2J7O A;  4WW0 A;  4OU7 A;  3T6P A;  5IWA M;  3HU2 A;  5A2Q S;  3SAT A;  3HJ8 A;  2ZTC A;  4FWD A;  1EIJ A;  3GLG B;  2LBC A;  1N77 A;  3TWK A;  1HNZ M;  1TH3 A;  1FJG M;  2FE8 A;  1NVM A;  3VDU A;  3A42 A;  3HHZ A;  2L6O A;  5KQD A;  3J7A S;  1G59 A;  3GRU A;  2C96 A;  5EXS A;  2K9D A;  5EP4 A;  4XK8 F;  3LMM A;  1HT2 E;  2ZTD A;  2VII A;  1G3I A;  2ZBK B;  1G4A E;  1K3W A;  2LVQ D;  2XZU A;  5ITU A;  3UK6 A;  4R7G A;  3U61 B;  1NHG C;  4KO8 A;  3FRI A;  2CWB A;  4AZF A;  3L2A A;  4G6Z A;  4IBC A;  4QOZ C;  1DGG A;  3QWL A;  3GRR A;  2R62 A;  4R3D A;  4JI6 M;  1TTE A;  2C9O A;  1WR1 B;  3J80 S;  2H5X A;  1D0M A;  3CF0 A;  1XXH E;  4JYA M;  1K3X A;  1QYR A;  3I4V A;  3FTF A;  4YHH M;  1PGY A;  2QNJ A;  4WP2 A;  1DO2 A;  4GKK M;  3RFW A;  1XNQ M;  1J7K A;  3IG8 A;  3JAM S;  3J7B A;  1LTM A;  2Z4S A;  4JI0 M;  3KOZ E;  1OKS A;  3U6O A;  2WSE F;  8CAT A;  1WIV A;  3AOG A;  4NSR A;  3GPX A;  4DV7 M;  4B3R M;  1ORY B;  2XEP A;  1HNW M;  2LVP C;  2R4J A;  2GNO A;  3SAU A;  1IBL M;  1OJL A;  1E94 E;  2R46 A;  5ITQ A;  1MU5 A;  3QYE A;  1DGH A;  3H4M A;  4LJA A;  3FYD A;  1I94 M;  1IXZ A;  1XXH B;  1XB2 B;  2FNA A;  5C1B A;  5BR8 M;  2OOB A;  4KLN A;  4BB9 A;  1V92 A;  2UXC M;  2QZ4 A;  2XH9 A;  1Y8G A;  2XLJ A;  2LTU A;  1NHW C;  2M60 A;  2MH8 A;  1Q3C A;  2JY5 A;  3GQ4 A;  1IQP A;  4LRT A;  3RGP A;  1TR8 A;  1G41 A;  3LW5 F;  2LVO C;  4OW0 A;  3AOE A;  1DGH B;  2BWE A;  1GAB A;  2JZ1 A;  4XBO A;  1IN7 A;  2BJW A;  1KSF X;  1E32 A;  4D81 A;  4DUY M;  3TWM A;  2P5T A;  1JR3 D;  1IBM M;  1VEK A;  2FS1 A;  1TH4 A;  3GLF B;  1X37 A;  1LV7 A;  1DGB A;  3FKE A;  4BBA A;  4G4Q A;  4L8R C;  4MGK E;  1XC8 A;  5E26 A;  2C99 A;  4DV1 M;  2UU9 M;  1XHB A;  1N33 M;  1L2C A;  1AIP C;  1OAI A;  4M9X A;  3FRH A;  2ZAM A;  4AG6 A;  4MGZ E;  1E9R A;  1QQW A;  5EQT A;  5GKN A;  1IN6 A;  4LGY A;  4IBB A;  3DZD A;  4FVM A;  3SC3 A;  4R71 A;  3H4J A;  1NO1 A;  3FYC A;  3RGS A;  3U6S A;  4JI3 M;  4NRW A;  3VK7 A;  1H6U A;  2EUC A;  5EP2 A;  4X62 M;  1UFZ A;  2Y21 A;  3TWL A;  3SAS A;  4GEW A;  4B3M M;  4OX9 M;  2F5N A;  4G4O A;  1JR3 A;  4DV0 M;  3U6M A;  2BNK A;  1R2Z A;  5E6J A;  4LJ9 A;  1HR0 M;  3PVS A;  3HHY A;  2KHH A;  4LF8 M;  4PD2 A;  3KSX A;  2WSC F;  3C58 A;  3LQQ A;  1T43 A;  3AV0 A;  4LZZ A;  4FW9 A;  2X8A A;  1PJI A;  3HX3 A;  1QVR A;  2G5G X;  3KS4 A;  2R65 A;  4I8O A;  2QBY A;  1QZM A;  3GPU A;  4NXM M;  1L1Z A;  1SXJ E;  4QNR A;  4CIS A;  1NV9 A;  4REZ A;  4M0W A;  5KPT A;  2N35 A;  4DV3 M;  1IN4 A;  1G71 A;  1SXJ B;  3L28 A;  2R18 A;  2QPA A;  4NSO B;  3ZC7 B;  3U6Q A;  2CUZ A;  3SHF A;  1QAQ A;  3SYK A;  2KDL A;  1YUB A;  1Q3B A;  2YQZ A;  4HL4 A;  4L78 A;  1J09 A;  1DGF A;  2DHY A;  3TE6 A;  2V1C A;  3GQ5 A;  4B7G A;  2MRO B;  3K92 A;  3HGI A;  3GLI A;  3I4Y A;  3A45 A;  2O25 A;  1TH2 A;  4GMQ A;  1HNX M;  2A5Y B;  3OTO M;  3IHP A;  4NC6 A;  4IBE A;  2FOI C;  4LF6 M;  2CHQ A;  3L29 A;  2HHH M;  3SAR A;  2VF7 A;  4UN2 B;  3M6A A;  4D82 A;  4MGY E;  2G8L A;  3HZJ A;  2AHM A;  2JY8 A;  3K1J A;  4MGH A;  1FNN A;  2QQ8 A;  2R45 A;  3GRV A;  1Q02 A;  1GVN A;  2DZL A;  1PJT A;  4LFA M;  1IN5 A;  2LXE A;  3SMP A;  3VK8 A;  4AI6 A;  3NWL A;  1XMQ M;  3LQR A;  3Q8G A;  3A46 A;  1VG5 A;  1NY5 A;  2C98 A;  2RGO A;  4IBJ A;  3TL4 X;  3TQS A;  1Z5C A;  4LF9 M;  3AL0 C;  4QHS A;  3DOA A;  4PCZ A;  4ITQ A;  1QDR A;  2BWB A;  2O01 F;  3K8Z A;  4ZPX A;  4RNA A;  5BPV A;  5ITR A;  3PNV A;  1PJQ A;  4CJ6 A;  3U61 A;  4LJ4 A;  1NSF A;  1EFU B;  1GJT A;  1KYI A;  3L25 A;  2RKO A;  2ZM6 M;  3KOX E;  2W82 A;  1ZMU A;  1OIP A;  3U6E A;  4DR7 M;  5KPR A;  1KFV A;  3PXG A;  4LF4 M;  2UXD M;  4IJF A;  1EE8 A;  4IIW A;  2DI0 A;  2EO2 A;  1T3T A;  1JQJ C;  1SG9 A;  1YE9 A;  3B7Q A;  4LCB A;  1SXJ D;  3GLI B;  3GLH E;  1IM2 A;  4FCV A;  1D2N A;  3I51 A;  1L1T A;  3UZU A;  1CUK A;  5FTJ A;  4GKJ M;  2YNM D;  4GIT A;  4LRS A;  1IN8 A;  3VDP A;  2OPF A;  2VF8 A;  2JWS A;  1PRB A;  3C9P A;  1D0L A;  2EA0 A;  2UUB M;  1T6O A;  3FD9 A;  3KP1 E;  4AW4 A;  3AKZ A;  2MGW A;  2KNV A;  5DYG A;  2NQ8 C;  5EP3 A;  1IXS B;  3J81 S;  2DWN A;  2QBY B;  2Z8Y M;  3FTD A;  2K47 A;  4WUR A;  5ITX A;  4LF5 M;  2CV2 A;  2E5L M;  2KZU A;  3Q8X A;  4W5W A;  1R4G A;  3VKH A;  3B74 A;  4L15 A;  3KDS E;  1V34 A;  2VQE M;  1UM8 A;  2QHO B;  3MHV C;  3GLF A;  3U60 B;  2XZF A;  3SAW A;  3FUT A;  3ZQJ A;  2HKJ A;  1YLA A;  2F4V M;  2ERC A;  3KW6 A;  2ZAO A;  3K9O A;  2DHR A;  1IBK M;  2L4F A;  1VEJ A;  1NV8 A;  3HU3 A;  1R5L A;  2R44 A;  3GP1 A;  3WHK A;  3CF6 E;  3HHW A;  4Q7J A;  2YR0 A;  4G3O A;  4EIW A;  3GLH A;  3HU1 A;  1IXS A;  1Z5B A;  4MH0 E;  4M0D A;  3UMM A;  4JI1 M;  4JI7 M;  1ZMV A;  2Z3X A;  2FFJ A;  2QSF X;  2EKK A;  4KOD A;  4PT5 A;  2F5O A;  2CHV A;  3NBI A;  2HL7 A;  1C7Y A;  2RGH A;  1QAO A;  2I7N A;  2DWM A;  1NY6 A;  2XF3 A;  2F5P A;  3C3D A;  1XXH A;  4QNM A;  1QZE A;  1K82 A;  2XGN A;  1GKI A;  1XWI A;  4YY3 M;  3I01 M;  3T1Y M;  3IG5 A;  1QUT A;  2HWJ A;  2C5R A;  2DNA A;  2JY6 B;  2OO9 A;  2KNZ A;  2QEN A;  3NBX X;  1IY1 A;  4B7F A;  2F5S A;  4KHP M;  5DFL A;  2VQF M;  2LWX A;  4LF7 M;  4KT0 F;  1OAO C;  5LMN M;  3HY5 A;  1PM5 A;  2Y0Q A;  3VKG A;  4RKU F;  2OQ4 A;  5IRE B;  4IBF A;  2QCU A;  2APL A;  4MGI E;  3GLG E;  1ZAE A;  2JA2 A;  3QYB A;  1PJJ A;  4S12 A;  3L26 A;  3KSJ A;  1SXJ A;  1WXQ A;  2M5Z A;  1OFH A;  2FH0 A;  3T15 A;  4QHT A;  4GHL A;  3U5Z B;  1E9S A;  3CGW A;  3WHL A;  1W5T A;  2JZ0 A;  2R4E A;  5KQ8 A;  2XFT A;  3UGJ A;  1RU3 A;  2LHG A;  1XMO M;  1GL7 A;  4L6V 6;  1GJS A;  1ZQ9 A;  2CE7 A;  2X4A A;  4Z6Y A;  2VDB B;  1QDT A;  1WGN A;  1NNJ A;  5IT9 S;  4ANR A;  1BVS A;  3SFZ A;  1NJG A;  1I4W A;  1MX0 A;  3HJS A;  4HLQ A;  3B7N A;  5EXT A;  5F3W A;  3B9P A;  2R0I A;  1R6B X;  1ZV1 A;  2BJV A;  2L09 A;  2K6B A;  3E4R A;  3LCU A;  4PDI A;  5LMU M;  1GO5 A;  1J5E M;  2D7H A;  1PJS A;  3AJI B;  4NRV A;  2Y0T A;  1L2B A;  3VFD A;  4NL4 H;  4JV5 M;  2CHG A;  2X49 A;  2UUA M;  1NJF A;  1AUA A;  4LY6 A;  3E21 A;  4DV5 M;  2KXE A;  4II7 A;  1HT1 E;  1IY2 A;  2CV1 A;  3VLF B;  4JXJ A;  4I81 A;  3KXE C;  2K0B X;  4LGM A;  4DV6 M;  5EXX A;  4XGI A;  1NNU C;  1IFY A;  3U6D A;  1W5S A;  1VDL A;  7CAT A;  2RRU A;  2KRK A;  1JR3 E;  2G3Q A;  3U5Z A;  1S3S A;  3V76 A;  3ILK A;  4CGY B;  4GIP A;  5H37 D;  2LH0 A;  4FD2 A;  2B3T A;  4F1I A;  2V6Z M;  3SHG B;  5FTM A;  4B3S M;  2Z4R A;  4MB7 A;  4I5S A;  5DNY A;  1SXJ C;  3J2P B;  3GRY A;  5KPZ A;  1N78 A;  4GRI A;  1MN3 A;  2KEB A;  1YSY A;  3T38 A;  2LNH C;  3EIE A;  3SBJ A;  2F5Q A;  3TPZ A;  4OVZ B;  4I4L A;  2L7I A;  3RE8 A;  4FCT A;  2KZS A;  2DXI A;  2CV0 A;  4LZJ A;  3U6P A;  3AFH A;  4B3T M;  1G8P A;  3CTW B;  4NOO B;  2CP8 A;  1HQY E;  3IEC A;  3MMP A;  4AKH A;  4IBD A;  3FUW A;  3W67 A;  2KW0 A;  1Q39 A;  2ZAN A;  2KA6 B;  2V1U A;  1F4I A;  1GLN A;  3E9S A;  3C3E A;  4RF1 A;  4DBG B;  2C9C A;  4M9S A;  4AG5 A;  3LCV B;  2LHC A;  2DWZ B;  3FUX A;  3JR4 A;  5FLX S;  1N32 M;  2CEA A;  2JY7 A;  3PFI A;  3GO8 A;  4LFC M;  3SMS A;  2XFS A;  4LFB M;  4D80 A;  3B7Z A;  4X66 M; 
#chains in the Genus database with same CATH homology
 1ZMV A;  2DAI A;  2QSF X;  2EKK A;  2K9D A;  2HAK A;  1C7Y A;  1HT2 E;  2ZTD A;  1G3I A;  1G4A E;  2LVQ D;  1QZE A;  1NV9 A;  1WGL A;  4HEO A;  3FRI A;  2CWB A;  1P3Q Q;  2HWJ A;  2DNA A;  2JUJ A;  2JY6 B;  2OO9 A;  2KNZ A;  2DHY A;  2JNH A;  1TTE A;  2MRO B;  5DFL A;  1WR1 B;  2LVA A;  2O25 A;  2H5X A;  1XXH E;  3IHP A;  1VEG A;  1PGY A;  2WZJ A;  2QNJ A;  4WP2 A;  1DO2 A;  2DAE A;  3GLG E;  4UN2 B;  1A5T A;  1OKS A;  3E46 A;  1DO0 A;  2DAK A;  3GLI E;  1WIV A;  2JY8 A;  2JZ0 A;  1WHC A;  2EKF A;  1Q02 A;  2DZL A;  1VQ1 A;  2LVN C;  2LVP C;  3FE3 A;  1ZMW A;  2MJ5 B;  1E94 E;  2DAM A;  1WGN A;  2DEN A;  1BVS A;  1VG5 A;  1DV0 A;  1XB2 B;  2R0I A;  1ZV1 A;  3LCU A;  2OOB A;  1V92 A;  2BWB A;  1GO5 A;  2MR9 A;  1Y8G A;  2LTU A;  3B89 A;  4F2L A;  1EFU B;  1KYI A;  3BBZ A;  2JY5 A;  1HJP A;  3E21 A;  1ZMU A;  1TR8 A;  1G41 A;  3F92 A;  2LVO C;  1HT1 E;  2JP7 A;  2DKL A;  5JI2 E;  2BWE A;  2DI0 A;  1SG9 A;  2K0B X;  2JZ1 A;  3GLH E;  1IM2 A;  1IFY A;  1OTR A;  1CUK A;  1VDL A;  2RRU A;  1VEK A;  1JR3 E;  2G3Q A;  1T6O A;  2B3T A;  4F1I A;  2L4E A;  2KNV A;  2MGW A;  3GLF E;  2L2D A;  1AIP C;  1OAI A;  3FRH A;  1MN3 A;  2KNA A;  1WJ7 A;  1R4G A;  4R71 A;  2OOA A;  2EJS A;  3H4J A;  2QHO B;  2CP8 A;  1HQY E;  3IEC A;  1YLA A;  3MMP A;  2DAG A;  3K9O A;  3K9P A;  2L4F A;  1VEJ A;  1NV8 A;  1UFZ A;  1OQY A;  4GEW A;  1F4I A;  3T6P A;  4DBG B;  3LCV B;  2ZTC A;  4Q7J A;  2LBC A;  4G3O A;  2KHH A;  2JY7 A;  1IXS A;  1T43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...