1WHCA

Solution structure of rsgi ruh-027, a uba domain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
GSSGSSGAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBA/UBX 33.3 kDa protein
publication title Solution Structure of RSGI RUH-027, a UBA domain from Mus musculus cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1whcA01
2DNAA 1E94E 1DO2A 2QHOB 3FE3A 1Q02A 1G41A 2DKLA 1HJPA 2JY6B 1T6OA 1C7YA 2JY5A 2BWEA 2DAKA 1OAIA 1DO0A 5JI2E 3E21A 2JY8A 1ZMVA 2O25A 2QSFX 1OTRA 2KNVA 2OOAA 3GLHE 1IM2A 1YLAA 1KYIA 2DZLA 1AIPC 1Y8GA 1IFYA 2DAEA 1EFUB 4GEWA 2LBCA 1JR3E 1NV8A 2L2DA 1WIVA 2MJ5B 1HT2E 2K9DA 1QZEA 1TR8A 2H5XA 2JNHA 2LTUA 2OOBA 1WGNA 2CWBA 2LVOC 2ZTCA 2EKKA 3B89A 2R0IA 1VEJA 3MMPA 3IHPA 3K9OA 2HAKA 3FRHA 2JUJA 4UN2B 1WR1B 2L4EA 3LCVB 3E46A 2QNJA 4G3OA 1WGLA 1V92A 1VG5A 2LVAA 1P3QQ 2BWBA 1A5TA 2K0BX 1UFZA 2MGWA 1HQYE 1MN3A 3K9PA 1ZMUA 2KNZA 3H4JA 2JY7A 3GLIE 2B3TA 1VDLA 1CUKA 2LVNC 2EKFA 3BBZA 2HWJA 1G4AE 4DBGB 2MROB 1WJ7A 1XXHE 2KHHA 3IECA 3GLGE 2DHYA 3F92A 1SG9A 1F4IA 1WHCA 1HT1E 3FRIA 2RRUA 1R4GA 1VEKA 4R71A 1NV9A 2KNAA 2OO9A 2JZ1A 1T43A 2LVPC 3LCUA 1VQ1A 2EJSA 4Q7JA 2DAMA 1DV0A 2DI0A 2DAGA 2DENA 1BVSA 1GO5A 2WZJA 1PGYA 5DFLA 2CP8A 4F1IA 2LVQD 3T6PA 2JP7A 1XB2B 2DAIA 4HEOA 1ZMWA 2ZTDA 2MR9A 1OKSA 1ZV1A 3GLFE 4WP2A 1G3IA 1TTEA 4F2LA 2JZ0A 2G3QA 1VEGA 1OQYA 1IXSA 2L4FA
chains in the Genus database with same CATH superfamily
2Z4SA 5C18A 1E94E 1XHBA 3KOWE 3SARA 4DV1M 3U5ZB 2ERCA 3FE3A 4DUYM 1Q02A 4X66M 4G4NA 1YUBA 4LF6M 2QCUA 1HJPA 3GQ5A 1SXJB 4W5WA 4GC5A 2CHGA 4WW0A 2JA2A 1NJGA 4WURA 4JXJA 3QAUA 2DAKA 4OVZB 2BJWA 1DO0A 2XH9A 5KPZA 2JY8A 5FSWA 1XXHB 2CV1A 5DYIA 1ZMVA 1SXJD 2G5GX 2O25A 4DV2M 1D0LA 3VKHA 4G4QA 4OW0A 1TGUA 2FH0A 4CJ6A 1HQCA 3GLHE 1IM2A 1KYIA 2O01F 3NWLA 5ITXA 3KS4A 3U6LA 4FWGA 2Q2EB 4DR7M 2QP9X 5FLXS 4DV3M 2L2DA 3HJSA 4II7A 2CV2A 1HT2E 4AI6A 4Z8XA 1HNXM 3PVSA 1N32M 4IBJA 4MB7A 4FVMA 4NC6A 3IG8A 2J5YA 4B08A 4GKKM 2Z7JA 4L15A 2EA0A 4LJ9A 2I7PA 2CWBA 2LVOC 2FE8A 2ZTCA 4FCTA 3B89A 4M0WA 3HJQA 1VEJA 2XZUA 3JR5A 4KHPM 2QQ8A 3K2LA 4M0DA 3TL4X 3IHPA 3K9OA 3J80S 7CATA 1IBKM 3AOEC 4IBBA 3KSJA 2OQ4A 4P17A 3GLGB 2E5LM 4AZFA 1N75A 1ZQ9A 1W5TA 3AOEA 4R3DA 3ZCBB 3E9SA 3I51A 2GNOA 2X4AA 3AOGA 4L6V6 2VQFM 4JI4M 2LHCA 1WGLA 2K47A 2J7OA 5FTNA 4JI0M 2LVAA 2UXCM 1P3QQ 2F5NA 5IREB 3FTEA 2XF3A 3C9PA 3B7ZA 1GVNA 2F5SA 2R45A 3HU3A 1G59A 2ZBKB 3KSXA 3K8ZA 5EXXA 3PXGA 4HL4A 4IBEA 2L6OA 3FTCA 4KO8A 2UXDM 3GO8A 4LFAM 1IBLM 4LJ6A 5EQTA 2LVNC 2EKFA 2HWJA 3I04M 3KXEC 2MROB 1SXJC 2KHHA 1XWIA 4RF1A 3GRRA 1TDHA 3U6MA 2KA6B 1SXJA 2XEPA 3ZH9B 3F92A 1SG9A 2F5OA 1WHCA 1QUSA 2GQFA 3DOAA 1DGFA 4GH9A 5ITUA 3FRIA 1L2BA 4S12A 1VEKA 3VKGA 3GLHB 4PDGA 2JZ1A 1MU5A 1QYRA 1T43A 3AFHA 1QUTA 1T3TA 1K82A 3LCUA 3DA1A 4DV5M 3NBIA 2WSEF 4HLQA 2KRKA 3LMMA 4D82A 4LZZA 4DR3M 1IBMM 4GRIA 1QAOA 1IY2A 2DAGA 3Q8XA 3J7BA 3L26A 2CRUA 1IN4A 4L16A 3MK6A 2R18A 2QZ4A 2LXEA 1C1KA 3HX3A 4LY6A 1NNJA 1N34M 4BLCA 4B3MM 4DUZM 1WXQA 4HEOA 3FYDA 4LCBA 2Y21A 4FWDA 3L2AA 2DXIA 1ZV1A 3GLFE 4TUWA 3VLFB 1PJTA 5A2QS 3L25A 1OIPA 2R44A 1DGHB 2JZ0A 3CGWA 2XFSA 4GMQA 1PM5A 4CISA 3UMMA 1OQYA 3HHYA 3SAUA 2LH0A 3GPXA 1L2CA 1L1TA 4QOSA 2DNAA 4AG6A 2EUCA 1DO2A 1PRBA 2V6ZM 2VF7A 3GRUA 1QAQA 3KP1E 3GLGA 1IXZA 2KEBA 2DKLA 1YE9A 1XNRM 2C99A 5IZ7D 1DGBA 3THGA 3WHKA 2Y0QA 3TQSA 1GJSA 3B7QA 4LFBM 1IXSB 1JQJC 4Y28F 3U6CA 3E21A 2RGHA 1FJGM 3B9PA 1N77A 2CFOA 2UUAM 2CEAA 5DNYA 3HHWA 1TDZA 5JI3E 1XNQM 2CV0A 1NY5A 2KXEA 3KS8A 1XMOM 1OTRA 2QBYB 2OOAA 4LJAA 1OJLA 1Z5CA 1YLAA 2XLJA 2R46A 5EXSA 1TH4A 2DWLA 1Y8GA 3CTWB 1E9RA 1IFYA 3JAMS 3U6QA 1JR3E 1D0KA 3CF0A 2MJ5B 3D8LA 4ANRA 3R8FA 3U60B 3GPPA 2VDBB 3OTOM 2JNHA 2LTUA 1WGNA 4B7HA 4EIWA 2VQEM 2EKKA 1R2YA 3GLIB 1MJGM 1J7KA 4ZPXA 3R9XB 5ITRA 3KVWA 3FUTA 1HNWM 4IBIA 3L28A 1X37A 3SBJA 3FRHA 4NRVA 4QHSA 4UN2B 4IJEA 1OIZA 3SYKA 2RGOA 2Z4RA 1FNNA 3KOXE 4KLNA 5IT9S 3A98B 1J5EM 2VIIA 4R7GA 2WSCF 3MJ5A 2W82A 1UFZA 2MGWA 1IY1A 3AL0C 4B3RM 1GJTA 1OAOC 4NOOB 3KFUG 4JI7M 1DGHA 2AHMA 2J7NA 3LVVA 4L4UA 2DZOB 1NY6A 4FW9A 3ZC7B 2R62A 3HHXA 4I4LA 4IBDA 4LJ7A 3M7GA 3KOYE 5FTJA 3K92A 1GKIA 2N35A 3E4RA 3U6EA 3SATA 4L8RC 1J09A 4JI5M 3IECA 4LF9M 1LTMA 4D81A 3T38A 1F4IA 2A5YB 3GRYA 4RKUF 2DZNB 1L2DA 4DR6M 4JI1M 3B74A 1XC8A 3HU1A 1NSFA 3BXWA 5KPTA 4I8OA 1Z5BA 5FTMA 4M9ZA 1NV9A 2FOIC 4NXNM 2OO9A 4DR2M 3J2PB 1DGGA 3GRVA 3U61A 2LVPC 4IBFA 2P5TA 4IJFA 4LZJA 1ORYB 2DAMA 5KQDA 2ZAMA 1Q39A 2LHGA 3T15A 4FCVA 2DENA 1N36M 5ITXE 2WZJA 1PGYA 2L09A 4X65M 2CP8A 4OX9M 3U5ZA 4XGIA 3TWLA 2ZAOA 5EP2A 3SAWA 2CUZA 3U60A 2YQZA 4REZA 2D7GA 1JR3D 4LJ5A 3SHGB 1OKSA 3M0EA 2QENA 4WP2A 5H37D 1N33M 2HL7A 5EXPA 3W0FA 1OFIA 4LJ4A 2G3QA 4IBGA 5EP1A 1G8PA 4PD2A 2C9OA 4OVZA 3SMSA 2L4FA 2F5QA 3AJIB 5E26A 2R65A 4DR5M 3SFZA 2QHOB 1XXHA 2R4JA 1G41A 3PNYA 3C3DA 1IXRC 4A3VB 4CHTB 4CIZA 1L8QA 5L8RF 2CHQA 4CGYB 4IBKA 2JY6B 3CF2A 3SC3A 1T6OA 1C7YA 4X64M 4QNMA 2JY5A 4JI2M 2BWEA 3I01M 2QPAA 4LFCM 2F4VM 1IN7A 1PJSA 3U6DA 2ZM6M 5KQ8A 1R2ZA 1N78A 4MGYE 3KW6A 3KOZE 4MGKE 2MH8A 2G8LA 2UXBM 1QANA 3QYBA 3KDSE 5EP4A 2M60A 3FYCA 2JXNA 4DV7M 3LW5F 3V76A 2KNVA 3GPUA 3B7NA 2DVWB 4GKJM 1Z59A 4M9SA 1IN5A 1V33A 2KZSA 1YSYA 4IBCA 4IIWA 1SXJE 5IWAM 1WIVA 3HKPA 4XBOA 4LF4M 3W0LB 3KP0E 4JN6A 2L7HA 4B7GA 1QZEA 1TR8A 4G4RA 1I4WA 3T1HM 5F3WA 2R6FA 3QYEA 4LRTA 5ITQA 2KW0A 4DV4M 1K3XA 2R0IA 1E9SA 5EJCA 3MMPA 3MHVC 3LQQA 4FD2A 3RFWA 1W5SA 2XFTA 2LWXA 1WR1B 2L4EA 2LNHC 3LCVB 3E46A 4I81A 1ZAEA 4LGYA 2FFJA 4LRSA 3JR4A 3UJNA 2XSZD 4B7FA 5LMUM 2DWMA 4D80A 3BOSA 2BWBA 1A5TA 3U6SA 2XZFA 1R5LA 1LV7A 4ITQA 1MN3A 2KNZA 4MGZE 3TWKA 2B3TA 3H4MA 3LQRA 1VDLA 3I4VA 1NNUC 4KODA 3C58A 4DR1M 3GLHA 1CUKA 5GKNA 3BBZA 1QZMA 4DBGB 4XK8F 4QOZC 1NHGC 1OFHA 1HNZM 2I7NA 3GLGE 3J7AS 2D7EA 4GC9A 1IN8A 2FNAA 5BPVA 1TF0B 2C98A 4LGMA 4AKGA 3GLFB 2RRUA 1R4GA 2YFQA 4QHTA 2D7HA 5FTKA 3RGSA 4R71A 4PCZA 3FTFA 4BBAA 1GABA 3UZUA 2X8AA 2Y0TA 3DZDA 1VQ1A 1MX0A 3VK8A 3HWSA 2EJSA 1QQWA 4AKHA 4YY3M 4G4OA 1H6UA 1L1ZA 1DV0A 4B3TM 1QVRA 2HCBA 4GIPA 3ZQJA 4Z6YA 4GHAA 3L29A 5ITTA 1QDRA 3L27A 3RE8A 3SYLA 3VFDA 2O5RA 3M6AA 1K3WA 1AUAA 3RGPA 3EIEA 3TPZA 4F1IA 1KSFX 2Z3XA 3C3EA 2LVQD 2JP7A 2DAIA 2NQ8C 1VDDA 2EO2A 2ZANA 4GITA 3SAVA 2MR9A 4YHHM 3EIHA 4MH0E 3WHLA 2FS1A 4JI6M 4KT0F 2KDLA 2XSZA 4GHLA 3QWLA 1IXSA 4PDIA 3PNVA 4MGHA 5ITYA 3W68A 3AV0A 4LG2A 1GLNA 1NJFA 4JI3M 1PJJA 4B3SM 3SMPA 3UGJA 1XMQM 1G71A 1UM8A 2QBYA 1TH3A 1D2NA 3W67A 1KFVA 3GP1A 2V1UA 3J27B 1OAIA 1QAMA 2R4EA 3ILKA 3Q8GA 5KPRA 4NSOB 4DV6M 5JI2E 2M5ZA 4DV0M 4I5SA 4JYAM 2RKOA 2UUBM 1EIJA 2F5PA 3AKZA 4FWHA 5C1BA 5FTLA 2UU9M 2QSFX 3HZJA 3FD9A 3A45A 3CF6E 3GLIA 2DHRA 3IG5A 5LMNM 2DZLA 3K1JA 1AIPC 5E6JA 3UK6A 4NXMM 4X62M 2DAEA 1EFUB 4GEWA 3GQ4A 2LBCA 3TE6A 1NV8A 1TH2A 2HHHM 2DWNA 1HR0M 2K9DA 3PFIA 1NO1A 4L78A 1D0MA 3GLFA 2H5XA 4AQYM 3HU2A 2OOBA 5BR8M 1S3SA 3FUXA 5DYGA 4PT5A 3GQ3A 3SHFA 2Y20A 4M9XA 4LJ8A 2X49A 4AW4A 3DFZA 4OU7A 1E32A 2DWZB 5EP3A 3TWMA 2HAKA 2JUJA 3A42A 4MGIE 3VK7A 2K6BA 2YNMD 1NHWC 1Z6TA 1Q3CA 3FUUA 1Z5AA 2QNJA 4G3OA 1V92A 1VG5A 1PJQA 2VF8A 2K0BX 3VDUA 4DR4M 1HQYE 2C96A 2APLA 3HGIA 1R7RA 4G6ZA 2V1CA 3K9PA 2YR0A 1ZMUA 2XGNA 3LVWA 3H4JA 2JY7A 3GLIE 1EE8A 4JI8M 1R6BX 3VDPA 4AKIA 3GPYA 3T1YM 1G4AE 1I94M 1WJ7A 4JV5M 1XXHE 2BNKA 4AG5A 4NRWA 4LF5M 1JR3A 2DHYA 1GL6A 2CE7A 2L7IA 4LF8M 1Q3BA 4RF0A 4RNAA 3SASA 1HT1E 1JB0F 3HJ8A 4LF7M 3FUVA 2H1RA 1PJIA 2KNAA 3A46A 3FKEA 2CHVA 4FCWA 4Q7JA 4K0KM 4BB9A 3FUWA 3HHZA 4NL4H 3HY5A 2DI0A 4NSRA 5EXTA 3NBXX 2BJVA 2KRUA 1BVSA 1GO5A 1RU3A 2HKJA 3U6OA 5DFLA 2C9CA 2UUCM 1IY0A 2WSFF 5KO3A 3T6PA 4MM3B 1IQPA 1XB2B 3J81S 3U61B 1ZMWA 2ZTDA 2Z8YM 3U6PA 1NVMA 2OPFA 4P16A 1G3IA 1GL7A 1QDTA 1TTEA 1IN6A 3FTDA 4F2LA 4QNRA 2JWSA 3I4YA 1V34A 1VEGA 8CATA 2C5RA 2KZUA 3D8BA
chains in the Genus database with same CATH topology
2DNAA 1E94E 1DO2A 2QHOB 3FE3A 1Q02A 1G41A 2DKLA 1HJPA 2JY6B 1T6OA 1C7YA 2JY5A 2BWEA 2DAKA 1OAIA 1DO0A 5JI2E 3E21A 2JY8A 1ZMVA 2O25A 2QSFX 1OTRA 2KNVA 2OOAA 3GLHE 1IM2A 1YLAA 1KYIA 2DZLA 1AIPC 1Y8GA 1IFYA 2DAEA 1EFUB 4GEWA 2LBCA 1JR3E 1NV8A 2L2DA 1WIVA 2MJ5B 1HT2E 2K9DA 1QZEA 1TR8A 2H5XA 2JNHA 2LTUA 2OOBA 1WGNA 2CWBA 2LVOC 2ZTCA 2EKKA 3B89A 2R0IA 1VEJA 3MMPA 3IHPA 3K9OA 2HAKA 3FRHA 2JUJA 4UN2B 1WR1B 2L4EA 3LCVB 3E46A 2QNJA 4G3OA 1WGLA 1V92A 1VG5A 2LVAA 1P3QQ 2BWBA 1A5TA 2K0BX 1UFZA 2MGWA 1HQYE 1MN3A 3K9PA 1ZMUA 2KNZA 3H4JA 2JY7A 3GLIE 2B3TA 1VDLA 1CUKA 2LVNC 2EKFA 3BBZA 2HWJA 1G4AE 4DBGB 2MROB 1WJ7A 1XXHE 2KHHA 3IECA 3GLGE 2DHYA 3F92A 1SG9A 1F4IA 1WHCA 1HT1E 3FRIA 2RRUA 1R4GA 1VEKA 4R71A 1NV9A 2KNAA 2OO9A 2JZ1A 1T43A 2LVPC 3LCUA 1VQ1A 2EJSA 4Q7JA 2DAMA 1DV0A 2DI0A 2DAGA 2DENA 1BVSA 1GO5A 2WZJA 1PGYA 5DFLA 2CP8A 4F1IA 2LVQD 3T6PA 2JP7A 1XB2B 2DAIA 4HEOA 1ZMWA 2ZTDA 2MR9A 1OKSA 1ZV1A 3GLFE 4WP2A 1G3IA 1TTEA 4F2LA 2JZ0A 2G3QA 1VEGA 1OQYA 1IXSA 2L4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNA A;  1E94 E;  1DO2 A;  2QHO B;  3FE3 A;  1Q02 A;  1G41 A;  2DKL A;  1HJP A;  2JY6 B;  1T6O A;  1C7Y A;  2JY5 A;  2BWE A;  2DAK A;  1OAI A;  1DO0 A;  5JI2 E;  3E21 A;  2JY8 A;  1ZMV A;  2O25 A;  2QSF X;  1OTR A;  2KNV A;  2OOA A;  3GLH E;  1IM2 A;  1YLA A;  1KYI A;  2DZL A;  1AIP C;  1Y8G A;  1IFY A;  2DAE A;  1EFU B;  4GEW A;  2LBC A;  1JR3 E;  1NV8 A;  2L2D A;  1WIV A;  2MJ5 B;  1HT2 E;  2K9D A;  1QZE A;  1TR8 A;  2H5X A;  2JNH A;  2LTU A;  2OOB A;  1WGN A;  2CWB A;  2LVO C;  2ZTC A;  2EKK A;  3B89 A;  2R0I A;  1VEJ A;  3MMP A;  3IHP A;  3K9O A;  2HAK A;  3FRH A;  2JUJ A;  4UN2 B;  1WR1 B;  2L4E A;  3LCV B;  3E46 A;  2QNJ A;  4G3O A;  1WGL A;  1V92 A;  1VG5 A;  2LVA A;  1P3Q Q;  2BWB A;  1A5T A;  2K0B X;  1UFZ A;  2MGW A;  1HQY E;  1MN3 A;  3K9P A;  1ZMU A;  2KNZ A;  3H4J A;  2JY7 A;  3GLI E;  2B3T A;  1VDL A;  1CUK A;  2LVN C;  2EKF A;  3BBZ A;  2HWJ A;  1G4A E;  4DBG B;  2MRO B;  1WJ7 A;  1XXH E;  2KHH A;  3IEC A;  3GLG E;  2DHY A;  3F92 A;  1SG9 A;  1F4I A;  1WHC A;  1HT1 E;  3FRI A;  2RRU A;  1R4G A;  1VEK A;  4R71 A;  1NV9 A;  2KNA A;  2OO9 A;  2JZ1 A;  1T43 A;  2LVP C;  3LCU A;  1VQ1 A;  2EJS A;  4Q7J A;  2DAM A;  1DV0 A;  2DI0 A;  2DAG A;  2DEN A;  1BVS A;  1GO5 A;  2WZJ A;  1PGY A;  5DFL A;  2CP8 A;  4F1I A;  2LVQ D;  3T6P A;  2JP7 A;  1XB2 B;  2DAI A;  4HEO A;  1ZMW A;  2ZTD A;  2MR9 A;  1OKS A;  1ZV1 A;  3GLF E;  4WP2 A;  1G3I A;  1TTE A;  4F2L A;  2JZ0 A;  2G3Q A;  1VEG A;  1OQY A;  1IXS A;  2L4F A; 
#chains in the Genus database with same CATH topology
 2Z4S A;  5C18 A;  1E94 E;  1XHB A;  3KOW E;  3SAR A;  4DV1 M;  3U5Z B;  2ERC A;  3FE3 A;  4DUY M;  1Q02 A;  4X66 M;  4G4N A;  1YUB A;  4LF6 M;  2QCU A;  1HJP A;  3GQ5 A;  1SXJ B;  4W5W A;  4GC5 A;  2CHG A;  4WW0 A;  2JA2 A;  1NJG A;  4WUR A;  4JXJ A;  3QAU A;  2DAK A;  4OVZ B;  2BJW A;  1DO0 A;  2XH9 A;  5KPZ A;  2JY8 A;  5FSW A;  1XXH B;  2CV1 A;  5DYI A;  1ZMV A;  1SXJ D;  2G5G X;  2O25 A;  4DV2 M;  1D0L A;  3VKH A;  4G4Q A;  4OW0 A;  1TGU A;  2FH0 A;  4CJ6 A;  1HQC A;  3GLH E;  1IM2 A;  1KYI A;  2O01 F;  3NWL A;  5ITX A;  3KS4 A;  3U6L A;  4FWG A;  2Q2E B;  4DR7 M;  2QP9 X;  5FLX S;  4DV3 M;  2L2D A;  3HJS A;  4II7 A;  2CV2 A;  1HT2 E;  4AI6 A;  4Z8X A;  1HNX M;  3PVS A;  1N32 M;  4IBJ A;  4MB7 A;  4FVM A;  4NC6 A;  3IG8 A;  2J5Y A;  4B08 A;  4GKK M;  2Z7J A;  4L15 A;  2EA0 A;  4LJ9 A;  2I7P A;  2CWB A;  2LVO C;  2FE8 A;  2ZTC A;  4FCT A;  3B89 A;  4M0W A;  3HJQ A;  1VEJ A;  2XZU A;  3JR5 A;  4KHP M;  2QQ8 A;  3K2L A;  4M0D A;  3TL4 X;  3IHP A;  3K9O A;  3J80 S;  7CAT A;  1IBK M;  3AOE C;  4IBB A;  3KSJ A;  2OQ4 A;  4P17 A;  3GLG B;  2E5L M;  4AZF A;  1N75 A;  1ZQ9 A;  1W5T A;  3AOE A;  4R3D A;  3ZCB B;  3E9S A;  3I51 A;  2GNO A;  2X4A A;  3AOG A;  4L6V 6;  2VQF M;  4JI4 M;  2LHC A;  1WGL A;  2K47 A;  2J7O A;  5FTN A;  4JI0 M;  2LVA A;  2UXC M;  1P3Q Q;  2F5N A;  5IRE B;  3FTE A;  2XF3 A;  3C9P A;  3B7Z A;  1GVN A;  2F5S A;  2R45 A;  3HU3 A;  1G59 A;  2ZBK B;  3KSX A;  3K8Z A;  5EXX A;  3PXG A;  4HL4 A;  4IBE A;  2L6O A;  3FTC A;  4KO8 A;  2UXD M;  3GO8 A;  4LFA M;  1IBL M;  4LJ6 A;  5EQT A;  2LVN C;  2EKF A;  2HWJ A;  3I04 M;  3KXE C;  2MRO B;  1SXJ C;  2KHH A;  1XWI A;  4RF1 A;  3GRR A;  1TDH A;  3U6M A;  2KA6 B;  1SXJ A;  2XEP A;  3ZH9 B;  3F92 A;  1SG9 A;  2F5O A;  1WHC A;  1QUS A;  2GQF A;  3DOA A;  1DGF A;  4GH9 A;  5ITU A;  3FRI A;  1L2B A;  4S12 A;  1VEK A;  3VKG A;  3GLH B;  4PDG A;  2JZ1 A;  1MU5 A;  1QYR A;  1T43 A;  3AFH A;  1QUT A;  1T3T A;  1K82 A;  3LCU A;  3DA1 A;  4DV5 M;  3NBI A;  2WSE F;  4HLQ A;  2KRK A;  3LMM A;  4D82 A;  4LZZ A;  4DR3 M;  1IBM M;  4GRI A;  1QAO A;  1IY2 A;  2DAG A;  3Q8X A;  3J7B A;  3L26 A;  2CRU A;  1IN4 A;  4L16 A;  3MK6 A;  2R18 A;  2QZ4 A;  2LXE A;  1C1K A;  3HX3 A;  4LY6 A;  1NNJ A;  1N34 M;  4BLC A;  4B3M M;  4DUZ M;  1WXQ A;  4HEO A;  3FYD A;  4LCB A;  2Y21 A;  4FWD A;  3L2A A;  2DXI A;  1ZV1 A;  3GLF E;  4TUW A;  3VLF B;  1PJT A;  5A2Q S;  3L25 A;  1OIP A;  2R44 A;  1DGH B;  2JZ0 A;  3CGW A;  2XFS A;  4GMQ A;  1PM5 A;  4CIS A;  3UMM A;  1OQY A;  3HHY A;  3SAU A;  2LH0 A;  3GPX A;  1L2C A;  1L1T A;  4QOS A;  2DNA A;  4AG6 A;  2EUC A;  1DO2 A;  1PRB A;  2V6Z M;  2VF7 A;  3GRU A;  1QAQ A;  3KP1 E;  3GLG A;  1IXZ A;  2KEB A;  2DKL A;  1YE9 A;  1XNR M;  2C99 A;  5IZ7 D;  1DGB A;  3THG A;  3WHK A;  2Y0Q A;  3TQS A;  1GJS A;  3B7Q A;  4LFB M;  1IXS B;  1JQJ C;  4Y28 F;  3U6C A;  3E21 A;  2RGH A;  1FJG M;  3B9P A;  1N77 A;  2CFO A;  2UUA M;  2CEA A;  5DNY A;  3HHW A;  1TDZ A;  5JI3 E;  1XNQ M;  2CV0 A;  1NY5 A;  2KXE A;  3KS8 A;  1XMO M;  1OTR A;  2QBY B;  2OOA A;  4LJA A;  1OJL A;  1Z5C A;  1YLA A;  2XLJ A;  2R46 A;  5EXS A;  1TH4 A;  2DWL A;  1Y8G A;  3CTW B;  1E9R A;  1IFY A;  3JAM S;  3U6Q A;  1JR3 E;  1D0K A;  3CF0 A;  2MJ5 B;  3D8L A;  4ANR A;  3R8F A;  3U60 B;  3GPP A;  2VDB B;  3OTO M;  2JNH A;  2LTU A;  1WGN A;  4B7H A;  4EIW A;  2VQE M;  2EKK A;  1R2Y A;  3GLI B;  1MJG M;  1J7K A;  4ZPX A;  3R9X B;  5ITR A;  3KVW A;  3FUT A;  1HNW M;  4IBI A;  3L28 A;  1X37 A;  3SBJ A;  3FRH A;  4NRV A;  4QHS A;  4UN2 B;  4IJE A;  1OIZ A;  3SYK A;  2RGO A;  2Z4R A;  1FNN A;  3KOX E;  4KLN A;  5IT9 S;  3A98 B;  1J5E M;  2VII A;  4R7G A;  2WSC F;  3MJ5 A;  2W82 A;  1UFZ A;  2MGW A;  1IY1 A;  3AL0 C;  4B3R M;  1GJT A;  1OAO C;  4NOO B;  3KFU G;  4JI7 M;  1DGH A;  2AHM A;  2J7N A;  3LVV A;  4L4U A;  2DZO B;  1NY6 A;  4FW9 A;  3ZC7 B;  2R62 A;  3HHX A;  4I4L A;  4IBD A;  4LJ7 A;  3M7G A;  3KOY E;  5FTJ A;  3K92 A;  1GKI A;  2N35 A;  3E4R A;  3U6E A;  3SAT A;  4L8R C;  1J09 A;  4JI5 M;  3IEC A;  4LF9 M;  1LTM A;  4D81 A;  3T38 A;  1F4I A;  2A5Y B;  3GRY A;  4RKU F;  2DZN B;  1L2D A;  4DR6 M;  4JI1 M;  3B74 A;  1XC8 A;  3HU1 A;  1NSF A;  3BXW A;  5KPT A;  4I8O A;  1Z5B A;  5FTM A;  4M9Z A;  1NV9 A;  2FOI C;  4NXN M;  2OO9 A;  4DR2 M;  3J2P B;  1DGG A;  3GRV A;  3U61 A;  2LVP C;  4IBF A;  2P5T A;  4IJF A;  4LZJ A;  1ORY B;  2DAM A;  5KQD A;  2ZAM A;  1Q39 A;  2LHG A;  3T15 A;  4FCV A;  2DEN A;  1N36 M;  5ITX E;  2WZJ A;  1PGY A;  2L09 A;  4X65 M;  2CP8 A;  4OX9 M;  3U5Z A;  4XGI A;  3TWL A;  2ZAO A;  5EP2 A;  3SAW A;  2CUZ A;  3U60 A;  2YQZ A;  4REZ A;  2D7G A;  1JR3 D;  4LJ5 A;  3SHG B;  1OKS A;  3M0E A;  2QEN A;  4WP2 A;  5H37 D;  1N33 M;  2HL7 A;  5EXP A;  3W0F A;  1OFI A;  4LJ4 A;  2G3Q A;  4IBG A;  5EP1 A;  1G8P A;  4PD2 A;  2C9O A;  4OVZ A;  3SMS A;  2L4F A;  2F5Q A;  3AJI B;  5E26 A;  2R65 A;  4DR5 M;  3SFZ A;  2QHO B;  1XXH A;  2R4J A;  1G41 A;  3PNY A;  3C3D A;  1IXR C;  4A3V B;  4CHT B;  4CIZ A;  1L8Q A;  5L8R F;  2CHQ A;  4CGY B;  4IBK A;  2JY6 B;  3CF2 A;  3SC3 A;  1T6O A;  1C7Y A;  4X64 M;  4QNM A;  2JY5 A;  4JI2 M;  2BWE A;  3I01 M;  2QPA A;  4LFC M;  2F4V M;  1IN7 A;  1PJS A;  3U6D A;  2ZM6 M;  5KQ8 A;  1R2Z A;  1N78 A;  4MGY E;  3KW6 A;  3KOZ E;  4MGK E;  2MH8 A;  2G8L A;  2UXB M;  1QAN A;  3QYB A;  3KDS E;  5EP4 A;  2M60 A;  3FYC A;  2JXN A;  4DV7 M;  3LW5 F;  3V76 A;  2KNV A;  3GPU A;  3B7N A;  2DVW B;  4GKJ M;  1Z59 A;  4M9S A;  1IN5 A;  1V33 A;  2KZS A;  1YSY A;  4IBC A;  4IIW A;  1SXJ E;  5IWA M;  1WIV A;  3HKP A;  4XBO A;  4LF4 M;  3W0L B;  3KP0 E;  4JN6 A;  2L7H A;  4B7G A;  1QZE A;  1TR8 A;  4G4R A;  1I4W A;  3T1H M;  5F3W A;  2R6F A;  3QYE A;  4LRT A;  5ITQ A;  2KW0 A;  4DV4 M;  1K3X A;  2R0I A;  1E9S A;  5EJC A;  3MMP A;  3MHV C;  3LQQ A;  4FD2 A;  3RFW A;  1W5S A;  2XFT A;  2LWX A;  1WR1 B;  2L4E A;  2LNH C;  3LCV B;  3E46 A;  4I81 A;  1ZAE A;  4LGY A;  2FFJ A;  4LRS A;  3JR4 A;  3UJN A;  2XSZ D;  4B7F A;  5LMU M;  2DWM A;  4D80 A;  3BOS A;  2BWB A;  1A5T A;  3U6S A;  2XZF A;  1R5L A;  1LV7 A;  4ITQ A;  1MN3 A;  2KNZ A;  4MGZ E;  3TWK A;  2B3T A;  3H4M A;  3LQR A;  1VDL A;  3I4V A;  1NNU C;  4KOD A;  3C58 A;  4DR1 M;  3GLH A;  1CUK A;  5GKN A;  3BBZ A;  1QZM A;  4DBG B;  4XK8 F;  4QOZ C;  1NHG C;  1OFH A;  1HNZ M;  2I7N A;  3GLG E;  3J7A S;  2D7E A;  4GC9 A;  1IN8 A;  2FNA A;  5BPV A;  1TF0 B;  2C98 A;  4LGM A;  4AKG A;  3GLF B;  2RRU A;  1R4G A;  2YFQ A;  4QHT A;  2D7H A;  5FTK A;  3RGS A;  4R71 A;  4PCZ A;  3FTF A;  4BBA A;  1GAB A;  3UZU A;  2X8A A;  2Y0T A;  3DZD A;  1VQ1 A;  1MX0 A;  3VK8 A;  3HWS A;  2EJS A;  1QQW A;  4AKH A;  4YY3 M;  4G4O A;  1H6U A;  1L1Z A;  1DV0 A;  4B3T M;  1QVR A;  2HCB A;  4GIP A;  3ZQJ A;  4Z6Y A;  4GHA A;  3L29 A;  5ITT A;  1QDR A;  3L27 A;  3RE8 A;  3SYL A;  3VFD A;  2O5R A;  3M6A A;  1K3W A;  1AUA A;  3RGP A;  3EIE A;  3TPZ A;  4F1I A;  1KSF X;  2Z3X A;  3C3E A;  2LVQ D;  2JP7 A;  2DAI A;  2NQ8 C;  1VDD A;  2EO2 A;  2ZAN A;  4GIT A;  3SAV A;  2MR9 A;  4YHH M;  3EIH A;  4MH0 E;  3WHL A;  2FS1 A;  4JI6 M;  4KT0 F;  2KDL A;  2XSZ A;  4GHL A;  3QWL A;  1IXS A;  4PDI A;  3PNV A;  4MGH A;  5ITY A;  3W68 A;  3AV0 A;  4LG2 A;  1GLN A;  1NJF A;  4JI3 M;  1PJJ A;  4B3S M;  3SMP A;  3UGJ A;  1XMQ M;  1G71 A;  1UM8 A;  2QBY A;  1TH3 A;  1D2N A;  3W67 A;  1KFV A;  3GP1 A;  2V1U A;  3J27 B;  1OAI A;  1QAM A;  2R4E A;  3ILK A;  3Q8G A;  5KPR A;  4NSO B;  4DV6 M;  5JI2 E;  2M5Z A;  4DV0 M;  4I5S A;  4JYA M;  2RKO A;  2UUB M;  1EIJ A;  2F5P A;  3AKZ A;  4FWH A;  5C1B A;  5FTL A;  2UU9 M;  2QSF X;  3HZJ A;  3FD9 A;  3A45 A;  3CF6 E;  3GLI A;  2DHR A;  3IG5 A;  5LMN M;  2DZL A;  3K1J A;  1AIP C;  5E6J A;  3UK6 A;  4NXM M;  4X62 M;  2DAE A;  1EFU B;  4GEW A;  3GQ4 A;  2LBC A;  3TE6 A;  1NV8 A;  1TH2 A;  2HHH M;  2DWN A;  1HR0 M;  2K9D A;  3PFI A;  1NO1 A;  4L78 A;  1D0M A;  3GLF A;  2H5X A;  4AQY M;  3HU2 A;  2OOB A;  5BR8 M;  1S3S A;  3FUX A;  5DYG A;  4PT5 A;  3GQ3 A;  3SHF A;  2Y20 A;  4M9X A;  4LJ8 A;  2X49 A;  4AW4 A;  3DFZ A;  4OU7 A;  1E32 A;  2DWZ B;  5EP3 A;  3TWM A;  2HAK A;  2JUJ A;  3A42 A;  4MGI E;  3VK7 A;  2K6B A;  2YNM D;  1NHW C;  1Z6T A;  1Q3C A;  3FUU A;  1Z5A A;  2QNJ A;  4G3O A;  1V92 A;  1VG5 A;  1PJQ A;  2VF8 A;  2K0B X;  3VDU A;  4DR4 M;  1HQY E;  2C96 A;  2APL A;  3HGI A;  1R7R A;  4G6Z A;  2V1C A;  3K9P A;  2YR0 A;  1ZMU A;  2XGN A;  3LVW A;  3H4J A;  2JY7 A;  3GLI E;  1EE8 A;  4JI8 M;  1R6B X;  3VDP A;  4AKI A;  3GPY A;  3T1Y M;  1G4A E;  1I94 M;  1WJ7 A;  4JV5 M;  1XXH E;  2BNK A;  4AG5 A;  4NRW A;  4LF5 M;  1JR3 A;  2DHY A;  1GL6 A;  2CE7 A;  2L7I A;  4LF8 M;  1Q3B A;  4RF0 A;  4RNA A;  3SAS A;  1HT1 E;  1JB0 F;  3HJ8 A;  4LF7 M;  3FUV A;  2H1R A;  1PJI A;  2KNA A;  3A46 A;  3FKE A;  2CHV A;  4FCW A;  4Q7J A;  4K0K M;  4BB9 A;  3FUW A;  3HHZ A;  4NL4 H;  3HY5 A;  2DI0 A;  4NSR A;  5EXT A;  3NBX X;  2BJV A;  2KRU A;  1BVS A;  1GO5 A;  1RU3 A;  2HKJ A;  3U6O A;  5DFL A;  2C9C A;  2UUC M;  1IY0 A;  2WSF F;  5KO3 A;  3T6P A;  4MM3 B;  1IQP A;  1XB2 B;  3J81 S;  3U61 B;  1ZMW A;  2ZTD A;  2Z8Y M;  3U6P A;  1NVM A;  2OPF A;  4P16 A;  1G3I A;  1GL7 A;  1QDT A;  1TTE A;  1IN6 A;  3FTD A;  4F2L A;  4QNR A;  2JWS A;  3I4Y A;  1V34 A;  1VEG A;  8CAT A;  2C5R A;  2KZU A;  3D8B A; 
#chains in the Genus database with same CATH homology
 2DNA A;  1E94 E;  1DO2 A;  2QHO B;  3FE3 A;  1Q02 A;  1G41 A;  2DKL A;  1HJP A;  2JY6 B;  1T6O A;  1C7Y A;  2JY5 A;  2BWE A;  2DAK A;  1OAI A;  1DO0 A;  5JI2 E;  3E21 A;  2JY8 A;  1ZMV A;  2O25 A;  2QSF X;  1OTR A;  2KNV A;  2OOA A;  3GLH E;  1IM2 A;  1YLA A;  1KYI A;  2DZL A;  1AIP C;  1Y8G A;  1IFY A;  2DAE A;  1EFU B;  4GEW A;  2LBC A;  1JR3 E;  1NV8 A;  2L2D A;  1WIV A;  2MJ5 B;  1HT2 E;  2K9D A;  1QZE A;  1TR8 A;  2H5X A;  2JNH A;  2LTU A;  2OOB A;  1WGN A;  2CWB A;  2LVO C;  2ZTC A;  2EKK A;  3B89 A;  2R0I A;  1VEJ A;  3MMP A;  3IHP A;  3K9O A;  2HAK A;  3FRH A;  2JUJ A;  4UN2 B;  1WR1 B;  2L4E A;  3LCV B;  3E46 A;  2QNJ A;  4G3O A;  1WGL A;  1V92 A;  1VG5 A;  2LVA A;  1P3Q Q;  2BWB A;  1A5T A;  2K0B X;  1UFZ A;  2MGW A;  1HQY E;  1MN3 A;  3K9P A;  1ZMU A;  2KNZ A;  3H4J A;  2JY7 A;  3GLI E;  2B3T A;  1VDL A;  1CUK A;  2LVN C;  2EKF A;  3BBZ A;  2HWJ A;  1G4A E;  4DBG B;  2MRO B;  1WJ7 A;  1XXH E;  2KHH A;  3IEC A;  3GLG E;  2DHY A;  3F92 A;  1SG9 A;  1F4I A;  1WHC A;  1HT1 E;  3FRI A;  2RRU A;  1R4G A;  1VEK A;  4R71 A;  1NV9 A;  2KNA A;  2OO9 A;  2JZ1 A;  1T43 A;  2LVP C;  3LCU A;  1VQ1 A;  2EJS A;  4Q7J A;  2DAM A;  1DV0 A;  2DI0 A;  2DAG A;  2DEN A;  1BVS A;  1GO5 A;  2WZJ A;  1PGY A;  5DFL A;  2CP8 A;  4F1I A;  2LVQ D;  3T6P A;  2JP7 A;  1XB2 B;  2DAI A;  4HEO A;  1ZMW A;  2ZTD A;  2MR9 A;  1OKS A;  1ZV1 A;  3GLF E;  4WP2 A;  1G3I A;  1TTE A;  4F2L A;  2JZ0 A;  2G3Q A;  1VEG A;  1OQY A;  1IXS A;  2L4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...