1WHCA

Solution structure of rsgi ruh-027, a uba domain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
b'GSSGSSGAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBA/UBX 33.3 kDa protein
publication title Solution Structure of RSGI RUH-027, a UBA domain from Mus musculus cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1whcA01
2JUJA 1IM2A 2JNHA 2KHHA 1Q02A 2LVNC 1NV9A 2OOBA 2CP8A 2MROB 2DI0A 3B89A 2DAKA 4WP2A 2EKKA 3K9PA 1HQYE 1OQYA 2ZTDA 3E46A 2WZJA 2DENA 1TR8A 2R0IA 2EKFA 3GLFE 2LTUA 2LVPC 1VQ1A 1XXHE 3H4JA 1R4GA 1VEKA 1VEJA 1OTRA 2DAMA 2JY5A 4UN2B 2RRUA 1WIVA 3E21A 2L4EA 3IHPA 4F2LA 1CUKA 2MGWA 2MR9A 2QHOB 2DZLA 2BWEA 1IFYA 1E94E 2HWJA 3GLIE 1TTEA 2B3TA 1NV8A 4GEWA 2DAEA 1VEGA 3FRHA 1PGYA 2OO9A 3K9OA 3BBZA 3LCUA 1P3QQ 3IECA 1VDLA 2KNZA 4DBGB 1JR3E 2LVOC 2O25A 2LBCA 1MN3A 2L4FA 3FRIA 1G41A 2DNAA 2KNAA 1ZMUA 4F1IA 1EFUB 4R71A 1QZEA 1OKSA 2JY6B 1G4AE 1G3IA 2K0BX 1WR1B 1ZV1A 2QSFX 1DO2A 2MJ5B 2BWBA 4Q7JA 1Y8GA 1WJ7A 2JZ0A 1C7YA 2LVAA 4G3OA 3LCVB 2LVQD 3MMPA 2K9DA 1DO0A 2JY7A 2DAGA 2DAIA 1UFZA 3GLHE 4HEOA 1DV0A 1WHCA 1WGNA 1T43A 1OAIA 1YLAA 1WGLA 1T6OA 2L2DA 2DHYA 3F92A 3GLGE 2G3QA 2ZTCA 1HJPA 2CWBA 2DKLA 2JP7A 1F4IA 1XB2B 3FE3A 1SG9A 5JI2E 2QNJA 1VG5A 1AIPC 1ZMWA 2JZ1A 1GO5A 1KYIA 1HT1E 1ZMVA 2H5XA 2JY8A 1BVSA 1V92A 2OOAA 5DFLA 1A5TA 3T6PA 1IXSA 2HAKA 2KNVA 1HT2E 2EJSA
chains in the Genus database with same CATH superfamily
2BJVA 4LFBM 2JNHA 2VQFM 3E4RA 2KEBA 3AL0C 2UUAM 4ZPXA 5EQTA 2WSEF 1NV9A 4G4OA 3GPYA 5E26A 4G4RA 1HQCA 1XXHB 3AOEA 1K3XA 1SXJD 2DAKA 3W68A 3SYKA 3SBJA 4GH9A 1R2ZA 3TWLA 1QZMA 2EKKA 4AKIA 1HQYE 3CF0A 3E46A 5E6JA 3HY5A 5C1BA 3VDPA 1D0KA 2XFTA 3FD9A 4A3VB 5KPRA 3IG5A 2LVPC 3FTEA 3EIEA 4LCBA 3K2LA 3GLIB 1XXHE 2UXDM 4LFAM 1VEJA 1K3WA 4GITA 3GPUA 2JY5A 2CRUA 3A98B 4UN2B 2RRUA 1WIVA 3V76A 4QOSA 4DR7M 1PJIA 3I4YA 3WHLA 4II7A 5FLXS 4GKJM 1GKIA 1CUKA 2Y21A 4GC5A 4REZA 1IFYA 3RGPA 3GLIE 2RGOA 3VFDA 3OTOM 1XC8A 3KOZE 1XMQM 1QAOA 3HWSA 3B9PA 4G4QA 1DGHA 3FUTA 4LZJA 1PJJA 2F5OA 3LCUA 2F5QA 2D7EA 3T1YM 2Z4RA 3IECA 3RGSA 3J7AS 1DGGA 1JR3E 5FTKA 4GC9A 4DV5M 1N75A 3GLHA 3GQ5A 4BB9A 2LBCA 4DR5M 4B3TM 4M9XA 5ITRA 5KO3A 2QZ4A 3GP1A 3KOWE 3ZCBB 3R8FA 4OX9M 3U60B 1IXRC 2KNAA 4Z8XA 1X37A 4LF5M 4OVZA 4JI6M 5KPTA 4GHLA 5ITUA 1NSFA 1R7RA 1NNUC 1N36M 1GJTA 4Q7JA 1NY6A 4W5WA 1DGFA 2XSZA 2CV0A 1JB0F 1IN8A 4FVMA 2LWXA 3GO8A 2LVQD 3HU3A 4NXMM 2K9DA 2UXBM 1LV7A 2ZBKB 3M6AA 1XWIA 4IJEA 4HEOA 1Z5CA 4IBKA 1Q3BA 2LNHC 2DVWB 2FNAA 1WHCA 3Q8XA 4EIWA 2QP9X 4D80A 1VDDA 1SXJA 2D7GA 2Y0QA 2YNMD 3SHGB 2DHYA 4AG6A 5H37D 3F92A 1IY0A 2HL7A 2ZTCA 4B7GA 4IBIA 3J80S 3M7GA 1Z5BA 3AJIB 3B7ZA 3FTDA 4JI4M 4PCZA 4NRVA 4IBCA 3AOEC 4CIZA 4OU7A 2F5SA 2QNJA 2JZ1A 1GL7A 4MM3B 2EUCA 1KYIA 2JY8A 2J7OA 1E9RA 2VF8A 3E9SA 3SAUA 2Y0TA 1V92A 3PFIA 4FW9A 2OOAA 2KRUA 3GLFA 4MGKE 2DWLA 3SAVA 2DWMA 2XEPA 4AQYM 3VDUA 4X64M 2K47A 2EJSA 2DAMA 3D8BA 2YQZA 3L27A 3FUVA 5IWAM 3C9PA 3U5ZA 4B3SM 2G8LA 1Q02A 2R46A 3UJNA 3U6DA 4JI1M 3FUXA 3UGJA 2XLJA 2FFJA 1IN6A 4LJ6A 4NC6A 2R4EA 3SYLA 4DV7M 4HL4A 3B89A 4HLQA 3GPXA 4JI5M 3KP0E 5EXTA 3U6LA 1JQJC 3U6QA 4NSOB 3K9PA 4KHPM 1Z59A 2ZTDA 3FUUA 3K92A 4LRTA 3A46A 2JXNA 3GRYA 3UK6A 1TR8A 2R0IA 3IG8A 4X62M 2XH9A 4IBFA 2LTUA 5IREB 1NY5A 4PDIA 3KSXA 5A2QS 3H4JA 5KQ8A 3CF2A 3FYCA 1OTRA 2L7IA 1Z5AA 1L8QA 3FYDA 4GIPA 4DR1M 4AKHA 1R2YA 4DUYM 1L1ZA 1I4WA 4F2LA 4K0KM 2R6FA 2DZLA 1T3TA 4Y28F 4JYAM 4LF4M 2HWJA 2P5TA 4LGYA 4CISA 3C58A 2B3TA 1GL6A 2QENA 3TWKA 1NV8A 2F5NA 1PM5A 3W0LB 2DAEA 4QHSA 4DR3M 4LGMA 1PJTA 3T1HM 3KXEC 4DR2M 3K9OA 2JA2A 2LXEA 3KVWA 4MGYE 3GLIA 3VK7A 1NJGA 3H4MA 3U6PA 1VDLA 1GJSA 3I4VA 3ZC7B 4MB7A 1J09A 3HKPA 1MN3A 3KW6A 2L4FA 4GMQA 4ANRA 4DV0M 3C3EA 3KOXE 1XNQM 2DNAA 1DGHB 1ZMUA 3BXWA 3DA1A 1D0LA 3U6CA 4JI2M 5FSWA 2ZANA 4R71A 2C5RA 3DZDA 5FTNA 4CJ6A 1HNZM 4ITQA 3TE6A 1GVNA 1GABA 3FKEA 4RF0A 4R3DA 3GLHB 1WR1B 3I01M 3EIHA 3W0FA 3KP1E 1YE9A 2JWSA 2X49A 1Y8GA 2VIIA 3PVSA 1IN4A 3C3DA 2LVAA 4OVZB 3LCVB 4LG2A 3MMPA 1Q3CA 3JR5A 5FTJA 2DAGA 4Z6YA 2CHQA 2QPAA 1IY2A 3GLHE 5ITXA 2DWNA 4PD2A 1GLNA 1I94M 2UUBM 1DV0A 1G8PA 2HHHM 1MU5A 2CUZA 4KLNA 1HR0M 3WHKA 2GNOA 2L2DA 1OAIA 1QQWA 2KA6B 3RFWA 1IQPA 4JI8M 3B74A 1FNNA 1L2DA 2CWBA 2LHGA 2J5YA 3UZUA 2X4AA 1XB2B 2ZM6M 4AI6A 4DV1M 5JI2E 2FH0A 5BR8M 1YUBA 1OIPA 1SXJB 1VG5A 2L7HA 1ZMVA 1BVSA 5EXSA 1IBMM 2QBYA 2V1UA 4IJFA 2BNKA 2O5RA 1IXSA 3KS8A 2Z7JA 3Q8GA 2KNVA 5EXXA 4M0DA 3KOYE 3GQ3A 3L28A 2C98A 3MJ5A 1NO1A 4WW0A 3TQSA 4L78A 2JUJA 3LQQA 1IM2A 1SXJE 2KHHA 2Z8YM 4IBJA 1QVRA 3GRVA 4NSRA 1EIJA 4QHTA 3GLFB 1TH2A 3SMSA 4X66M 5KPZA 2CP8A 4XGIA 2MROB 2DI0A 4IBBA 1OFIA 3LQRA 3L26A 7CATA 3ILKA 5JI3E 1HNWM 4GKKM 2XF3A 4JI7M 1N77A 1N33M 1EE8A 4IBEA 3U5ZB 2Z4SA 2E5LM 3VKGA 4DV6M 4QOZC 2XZFA 1R5LA 1NHWC 1NJFA 2HCBA 5DNYA 3SFZA 2L09A 1NVMA 3GLFE 1E32A 4GRIA 4CGYB 4GHAA 3JR4A 2H1RA 3UMMA 1VEKA 2M60A 2ZAOA 2AHMA 4X65M 4L16A 4R7GA 1OJLA 5DYIA 1L2BA 3B7QA 3HHXA 4FWGA 1OIZA 4WURA 5F3WA 1IBLM 4B3MM 1TDZA 3IHPA 3FTFA 2MGWA 2A5YB 1KSFX 3U6SA 2QHOB 3SHFA 4G4NA 3HJQA 1TTEA 3U61A 2EA0A 3L2AA 3R9XB 4GEWA 3I04M 4I8OA 1PGYA 2CFOA 4DV2M 1QYRA 3PNVA 3SASA 2L6OA 3ZQJA 1G71A 3A42A 4DBGB 3HU2A 4LY6A 1HNXM 2O25A 4PT5A 4JI3M 1IN7A 3U6MA 3L25A 1G41A 2VDBB 3HHZA 4LF6M 1JR3D 3PXGA 1KFVA 5EJCA 4F1IA 1EFUB 3CTWB 1QZEA 3GLGA 4S12A 1MX0A 1PJSA 2UXCM 4RKUF 3VKHA 1G4AE 1YSYA 2FS1A 3HGIA 4RF1A 1G3IA 1IN5A 3TWMA 2K0BX 1ZV1A 2ZAMA 1XHBA 4MGZE 4B7FA 4NRWA 1IXZA 2R44A 2MJ5B 5LMNM 3HHYA 4I5SA 3HHWA 4M9ZA 2JZ0A 2APLA 1C7YA 3ZH9B 4LJ8A 3KFUG 2R45A 3J27B 2KRKA 1E9SA 3THGA 3VLFB 3BOSA 3D8LA 4IBGA 1PRBA 3HJ8A 2XSZD 5ITYA 2R4JA 5EP4A 2X8AA 2KXEA 4NL4H 1UM8A 2F4VM 1Z6TA 2XGNA 3L29A 3QAUA 2N35A 3CF6E 2K6BA 1T6OA 4M9SA 4LJAA 4P17A 3T15A 3HZJA 1SXJC 1QANA 2G5GX 1HJPA 2JP7A 1NHGC 2VF7A 4QNRA 4MGHA 1R6BX 3J2PB 5BPVA 4PDGA 1F4IA 4LFCM 1Q39A 1WXQA 2O01F 4L6V6 5KQDA 2XFSA 3AOGA 2I7NA 1AIPC 5EXPA 4LJ9A 2VQEM 2FOIC 1N32M 2V1CA 2Y20A 2LHCA 4NOOB 4LF9M 3AV0A 2HAKA 1XXHA 3LVWA 4LF7M 5ITXE 2DXIA 1K82A 4QNMA 2I7PA 1OAOC 3QWLA 2QBYB 3A45A 3T38A 1MJGM 1J7KA 2LVNC 4FD2A 2OOBA 3QYEA 1IXSB 1QAQA 2CEAA 1W5TA 3I51A 4WP2A 4L8RC 3HU1A 2J7NA 3QYBA 4XK8F 2ERCA 3NWLA 3AKZA 4D81A 1D0MA 2C9CA 3SC3A 1ZAEA 1OQYA 5EP1A 1ZQ9A 4LJ4A 3W67A 4DR4M 3M0EA 4OW0A 2WZJA 4MGIE 2EO2A 1FJGM 2DENA 5C18A 2EKFA 4YY3M 1JR3A 1VQ1A 1C1KA 1ORYB 2CHGA 4LJ7A 4IIWA 4JXJA 3LW5F 4AG5A 1R4GA 3DOAA 1J5EM 2R18A 4B7HA 4DR6M 3B7NA 4M0WA 3J81S 2WSFF 4XBOA 4I4LA 3E21A 2BJWA 2L4EA 2F5PA 2Q2EB 3NBIA 2KW0A 2MR9A 4MH0E 4JI0M 1D2NA 2WSCF 2BWEA 1QDTA 1E94E 3FUWA 4L15A 1NNJA 1TDHA 4FWDA 2D7HA 1QUTA 3U60A 3GQ4A 1VEGA 3FRHA 4FCTA 2OO9A 4FWHA 4KT0F 1N78A 1OFHA 5ITQA 3GPPA 3BBZA 2Z3XA 4B08A 4B3RM 1P3QQ 3TPZA 1G59A 4DUZM 4I81A 4D82A 2DZOB 2KNZA 2M5ZA 4LZZA 1IBKM 2CV2A 2CV1A 3NBXX 1V34A 2LVOC 3U61B 5IT9S 3SAWA 2DHRA 1QAMA 3FRIA 3FTCA 2HKJA 3K8ZA 4DV3M 2DWZB 2C99A 4DV4M 1OKSA 2OQ4A 2KDLA 4FCVA 2JY6B 1IY1A 1QDRA 3HX3A 2C9OA 4JN6A 2UU9M 1QUSA 1LTMA 3U6OA 3TL4X 2QSFX 2MH8A 1DO2A 3KSJA 2XZUA 4LJ5A 2BWBA 1TF0B 2V6ZM 2OPFA 4JV5M 3GRRA 4TUWA 3J7BA 1WJ7A 5EP2A 1L1TA 3GLGB 1TH3A 4G3OA 3MK6A 4KODA 1H6UA 2KZUA 2QQ8A 5FTMA 1XMOM 3MHVC 4G6ZA 3RE8A 3DFZA 1L2CA 2CE7A 1DO0A 1XNRM 2JY7A 2DAIA 1UFZA 4BBAA 2NQ8C 5DYGA 3AFHA 4BLCA 4NXNM 1WGNA 2CHVA 3JAMS 1T43A 3KS4A 3VK8A 2LH0A 1YLAA 1WGLA 4KO8A 4P16A 4L4UA 5ITTA 1S3SA 4AKGA 8CATA 5L8RF 3GLGE 3HJSA 3CGWA 2G3QA 4LRSA 2UUCM 3SATA 2YFQA 4LF8M 2DKLA 3K1JA 4FCWA 2GQFA 3SARA 2KZSA 2RGHA 3FE3A 5IZ7D 1SG9A 1V33A 4AZFA 4CHTB 3U6EA 4IBDA 2FE8A 5FTLA 2RKOA 1N34M 2YR0A 1GO5A 1W5SA 1ZMWA 3PNYA 1HT1E 1PJQA 2H5XA 1AUAA 1TGUA 3GRUA 2R65A 1TH4A 3KDSE 5DFLA 3SMPA 1A5TA 3T6PA 2C96A 4RNAA 2R62A 5LMUM 2QCUA 3LMMA 4AW4A 4YHHM 1RU3A 2DZNB 5EP3A 1HT2E 3LVVA 5GKNA 1DGBA 2W82A
chains in the Genus database with same CATH topology
2JUJA 1IM2A 2JNHA 2KHHA 1Q02A 2LVNC 1NV9A 2OOBA 2CP8A 2MROB 2DI0A 3B89A 2DAKA 4WP2A 2EKKA 3K9PA 1HQYE 1OQYA 2ZTDA 3E46A 2WZJA 2DENA 1TR8A 2R0IA 2EKFA 3GLFE 2LTUA 2LVPC 1VQ1A 1XXHE 3H4JA 1R4GA 1VEKA 1VEJA 1OTRA 2DAMA 2JY5A 4UN2B 2RRUA 1WIVA 3E21A 2L4EA 3IHPA 4F2LA 1CUKA 2MGWA 2MR9A 2QHOB 2DZLA 2BWEA 1IFYA 1E94E 2HWJA 3GLIE 1TTEA 2B3TA 1NV8A 4GEWA 2DAEA 1VEGA 3FRHA 1PGYA 2OO9A 3K9OA 3BBZA 3LCUA 1P3QQ 3IECA 1VDLA 2KNZA 4DBGB 1JR3E 2LVOC 2O25A 2LBCA 1MN3A 2L4FA 3FRIA 1G41A 2DNAA 2KNAA 1ZMUA 4F1IA 1EFUB 4R71A 1QZEA 1OKSA 2JY6B 1G4AE 1G3IA 2K0BX 1WR1B 1ZV1A 2QSFX 1DO2A 2MJ5B 2BWBA 4Q7JA 1Y8GA 1WJ7A 2JZ0A 1C7YA 2LVAA 4G3OA 3LCVB 2LVQD 3MMPA 2K9DA 1DO0A 2JY7A 2DAGA 2DAIA 1UFZA 3GLHE 4HEOA 1DV0A 1WHCA 1WGNA 1T43A 1OAIA 1YLAA 1WGLA 1T6OA 2L2DA 2DHYA 3F92A 3GLGE 2G3QA 2ZTCA 1HJPA 2CWBA 2DKLA 2JP7A 1F4IA 1XB2B 3FE3A 1SG9A 5JI2E 2QNJA 1VG5A 1AIPC 1ZMWA 2JZ1A 1GO5A 1KYIA 1HT1E 1ZMVA 2H5XA 2JY8A 1BVSA 1V92A 2OOAA 5DFLA 1A5TA 3T6PA 1IXSA 2HAKA 2KNVA 1HT2E 2EJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUJ A;  1IM2 A;  2JNH A;  2KHH A;  1Q02 A;  2LVN C;  1NV9 A;  2OOB A;  2CP8 A;  2MRO B;  2DI0 A;  3B89 A;  2DAK A;  4WP2 A;  2EKK A;  3K9P A;  1HQY E;  1OQY A;  2ZTD A;  3E46 A;  2WZJ A;  2DEN A;  1TR8 A;  2R0I A;  2EKF A;  3GLF E;  2LTU A;  2LVP C;  1VQ1 A;  1XXH E;  3H4J A;  1R4G A;  1VEK A;  1VEJ A;  1OTR A;  2DAM A;  2JY5 A;  4UN2 B;  2RRU A;  1WIV A;  3E21 A;  2L4E A;  3IHP A;  4F2L A;  1CUK A;  2MGW A;  2MR9 A;  2QHO B;  2DZL A;  2BWE A;  1IFY A;  1E94 E;  2HWJ A;  3GLI E;  1TTE A;  2B3T A;  1NV8 A;  4GEW A;  2DAE A;  1VEG A;  3FRH A;  1PGY A;  2OO9 A;  3K9O A;  3BBZ A;  3LCU A;  1P3Q Q;  3IEC A;  1VDL A;  2KNZ A;  4DBG B;  1JR3 E;  2LVO C;  2O25 A;  2LBC A;  1MN3 A;  2L4F A;  3FRI A;  1G41 A;  2DNA A;  2KNA A;  1ZMU A;  4F1I A;  1EFU B;  4R71 A;  1QZE A;  1OKS A;  2JY6 B;  1G4A E;  1G3I A;  2K0B X;  1WR1 B;  1ZV1 A;  2QSF X;  1DO2 A;  2MJ5 B;  2BWB A;  4Q7J A;  1Y8G A;  1WJ7 A;  2JZ0 A;  1C7Y A;  2LVA A;  4G3O A;  3LCV B;  2LVQ D;  3MMP A;  2K9D A;  1DO0 A;  2JY7 A;  2DAG A;  2DAI A;  1UFZ A;  3GLH E;  4HEO A;  1DV0 A;  1WHC A;  1WGN A;  1T43 A;  1OAI A;  1YLA A;  1WGL A;  1T6O A;  2L2D A;  2DHY A;  3F92 A;  3GLG E;  2G3Q A;  2ZTC A;  1HJP A;  2CWB A;  2DKL A;  2JP7 A;  1F4I A;  1XB2 B;  3FE3 A;  1SG9 A;  5JI2 E;  2QNJ A;  1VG5 A;  1AIP C;  1ZMW A;  2JZ1 A;  1GO5 A;  1KYI A;  1HT1 E;  1ZMV A;  2H5X A;  2JY8 A;  1BVS A;  1V92 A;  2OOA A;  5DFL A;  1A5T A;  3T6P A;  1IXS A;  2HAK A;  2KNV A;  1HT2 E;  2EJS A; 
#chains in the Genus database with same CATH topology
 2BJV A;  4LFB M;  2JNH A;  2VQF M;  3E4R A;  2KEB A;  3AL0 C;  2UUA M;  4ZPX A;  5EQT A;  2WSE F;  1NV9 A;  4G4O A;  3GPY A;  5E26 A;  4G4R A;  1HQC A;  1XXH B;  3AOE A;  1K3X A;  1SXJ D;  2DAK A;  3W68 A;  3SYK A;  3SBJ A;  4GH9 A;  1R2Z A;  3TWL A;  1QZM A;  2EKK A;  4AKI A;  1HQY E;  3CF0 A;  3E46 A;  5E6J A;  3HY5 A;  5C1B A;  3VDP A;  1D0K A;  2XFT A;  3FD9 A;  4A3V B;  5KPR A;  3IG5 A;  2LVP C;  3FTE A;  3EIE A;  4LCB A;  3K2L A;  3GLI B;  1XXH E;  2UXD M;  4LFA M;  1VEJ A;  1K3W A;  4GIT A;  3GPU A;  2JY5 A;  2CRU A;  3A98 B;  4UN2 B;  2RRU A;  1WIV A;  3V76 A;  4QOS A;  4DR7 M;  1PJI A;  3I4Y A;  3WHL A;  4II7 A;  5FLX S;  4GKJ M;  1GKI A;  1CUK A;  2Y21 A;  4GC5 A;  4REZ A;  1IFY A;  3RGP A;  3GLI E;  2RGO A;  3VFD A;  3OTO M;  1XC8 A;  3KOZ E;  1XMQ M;  1QAO A;  3HWS A;  3B9P A;  4G4Q A;  1DGH A;  3FUT A;  4LZJ A;  1PJJ A;  2F5O A;  3LCU A;  2F5Q A;  2D7E A;  3T1Y M;  2Z4R A;  3IEC A;  3RGS A;  3J7A S;  1DGG A;  1JR3 E;  5FTK A;  4GC9 A;  4DV5 M;  1N75 A;  3GLH A;  3GQ5 A;  4BB9 A;  2LBC A;  4DR5 M;  4B3T M;  4M9X A;  5ITR A;  5KO3 A;  2QZ4 A;  3GP1 A;  3KOW E;  3ZCB B;  3R8F A;  4OX9 M;  3U60 B;  1IXR C;  2KNA A;  4Z8X A;  1X37 A;  4LF5 M;  4OVZ A;  4JI6 M;  5KPT A;  4GHL A;  5ITU A;  1NSF A;  1R7R A;  1NNU C;  1N36 M;  1GJT A;  4Q7J A;  1NY6 A;  4W5W A;  1DGF A;  2XSZ A;  2CV0 A;  1JB0 F;  1IN8 A;  4FVM A;  2LWX A;  3GO8 A;  2LVQ D;  3HU3 A;  4NXM M;  2K9D A;  2UXB M;  1LV7 A;  2ZBK B;  3M6A A;  1XWI A;  4IJE A;  4HEO A;  1Z5C A;  4IBK A;  1Q3B A;  2LNH C;  2DVW B;  2FNA A;  1WHC A;  3Q8X A;  4EIW A;  2QP9 X;  4D80 A;  1VDD A;  1SXJ A;  2D7G A;  2Y0Q A;  2YNM D;  3SHG B;  2DHY A;  4AG6 A;  5H37 D;  3F92 A;  1IY0 A;  2HL7 A;  2ZTC A;  4B7G A;  4IBI A;  3J80 S;  3M7G A;  1Z5B A;  3AJI B;  3B7Z A;  3FTD A;  4JI4 M;  4PCZ A;  4NRV A;  4IBC A;  3AOE C;  4CIZ A;  4OU7 A;  2F5S A;  2QNJ A;  2JZ1 A;  1GL7 A;  4MM3 B;  2EUC A;  1KYI A;  2JY8 A;  2J7O A;  1E9R A;  2VF8 A;  3E9S A;  3SAU A;  2Y0T A;  1V92 A;  3PFI A;  4FW9 A;  2OOA A;  2KRU A;  3GLF A;  4MGK E;  2DWL A;  3SAV A;  2DWM A;  2XEP A;  4AQY M;  3VDU A;  4X64 M;  2K47 A;  2EJS A;  2DAM A;  3D8B A;  2YQZ A;  3L27 A;  3FUV A;  5IWA M;  3C9P A;  3U5Z A;  4B3S M;  2G8L A;  1Q02 A;  2R46 A;  3UJN A;  3U6D A;  4JI1 M;  3FUX A;  3UGJ A;  2XLJ A;  2FFJ A;  1IN6 A;  4LJ6 A;  4NC6 A;  2R4E A;  3SYL A;  4DV7 M;  4HL4 A;  3B89 A;  4HLQ A;  3GPX A;  4JI5 M;  3KP0 E;  5EXT A;  3U6L A;  1JQJ C;  3U6Q A;  4NSO B;  3K9P A;  4KHP M;  1Z59 A;  2ZTD A;  3FUU A;  3K92 A;  4LRT A;  3A46 A;  2JXN A;  3GRY A;  3UK6 A;  1TR8 A;  2R0I A;  3IG8 A;  4X62 M;  2XH9 A;  4IBF A;  2LTU A;  5IRE B;  1NY5 A;  4PDI A;  3KSX A;  5A2Q S;  3H4J A;  5KQ8 A;  3CF2 A;  3FYC A;  1OTR A;  2L7I A;  1Z5A A;  1L8Q A;  3FYD A;  4GIP A;  4DR1 M;  4AKH A;  1R2Y A;  4DUY M;  1L1Z A;  1I4W A;  4F2L A;  4K0K M;  2R6F A;  2DZL A;  1T3T A;  4Y28 F;  4JYA M;  4LF4 M;  2HWJ A;  2P5T A;  4LGY A;  4CIS A;  3C58 A;  2B3T A;  1GL6 A;  2QEN A;  3TWK A;  1NV8 A;  2F5N A;  1PM5 A;  3W0L B;  2DAE A;  4QHS A;  4DR3 M;  4LGM A;  1PJT A;  3T1H M;  3KXE C;  4DR2 M;  3K9O A;  2JA2 A;  2LXE A;  3KVW A;  4MGY E;  3GLI A;  3VK7 A;  1NJG A;  3H4M A;  3U6P A;  1VDL A;  1GJS A;  3I4V A;  3ZC7 B;  4MB7 A;  1J09 A;  3HKP A;  1MN3 A;  3KW6 A;  2L4F A;  4GMQ A;  4ANR A;  4DV0 M;  3C3E A;  3KOX E;  1XNQ M;  2DNA A;  1DGH B;  1ZMU A;  3BXW A;  3DA1 A;  1D0L A;  3U6C A;  4JI2 M;  5FSW A;  2ZAN A;  4R71 A;  2C5R A;  3DZD A;  5FTN A;  4CJ6 A;  1HNZ M;  4ITQ A;  3TE6 A;  1GVN A;  1GAB A;  3FKE A;  4RF0 A;  4R3D A;  3GLH B;  1WR1 B;  3I01 M;  3EIH A;  3W0F A;  3KP1 E;  1YE9 A;  2JWS A;  2X49 A;  1Y8G A;  2VII A;  3PVS A;  1IN4 A;  3C3D A;  2LVA A;  4OVZ B;  3LCV B;  4LG2 A;  3MMP A;  1Q3C A;  3JR5 A;  5FTJ A;  2DAG A;  4Z6Y A;  2CHQ A;  2QPA A;  1IY2 A;  3GLH E;  5ITX A;  2DWN A;  4PD2 A;  1GLN A;  1I94 M;  2UUB M;  1DV0 A;  1G8P A;  2HHH M;  1MU5 A;  2CUZ A;  4KLN A;  1HR0 M;  3WHK A;  2GNO A;  2L2D A;  1OAI A;  1QQW A;  2KA6 B;  3RFW A;  1IQP A;  4JI8 M;  3B74 A;  1FNN A;  1L2D A;  2CWB A;  2LHG A;  2J5Y A;  3UZU A;  2X4A A;  1XB2 B;  2ZM6 M;  4AI6 A;  4DV1 M;  5JI2 E;  2FH0 A;  5BR8 M;  1YUB A;  1OIP A;  1SXJ B;  1VG5 A;  2L7H A;  1ZMV A;  1BVS A;  5EXS A;  1IBM M;  2QBY A;  2V1U A;  4IJF A;  2BNK A;  2O5R A;  1IXS A;  3KS8 A;  2Z7J A;  3Q8G A;  2KNV A;  5EXX A;  4M0D A;  3KOY E;  3GQ3 A;  3L28 A;  2C98 A;  3MJ5 A;  1NO1 A;  4WW0 A;  3TQS A;  4L78 A;  2JUJ A;  3LQQ A;  1IM2 A;  1SXJ E;  2KHH A;  2Z8Y M;  4IBJ A;  1QVR A;  3GRV A;  4NSR A;  1EIJ A;  4QHT A;  3GLF B;  1TH2 A;  3SMS A;  4X66 M;  5KPZ A;  2CP8 A;  4XGI A;  2MRO B;  2DI0 A;  4IBB A;  1OFI A;  3LQR A;  3L26 A;  7CAT A;  3ILK A;  5JI3 E;  1HNW M;  4GKK M;  2XF3 A;  4JI7 M;  1N77 A;  1N33 M;  1EE8 A;  4IBE A;  3U5Z B;  2Z4S A;  2E5L M;  3VKG A;  4DV6 M;  4QOZ C;  2XZF A;  1R5L A;  1NHW C;  1NJF A;  2HCB A;  5DNY A;  3SFZ A;  2L09 A;  1NVM A;  3GLF E;  1E32 A;  4GRI A;  4CGY B;  4GHA A;  3JR4 A;  2H1R A;  3UMM A;  1VEK A;  2M60 A;  2ZAO A;  2AHM A;  4X65 M;  4L16 A;  4R7G A;  1OJL A;  5DYI A;  1L2B A;  3B7Q A;  3HHX A;  4FWG A;  1OIZ A;  4WUR A;  5F3W A;  1IBL M;  4B3M M;  1TDZ A;  3IHP A;  3FTF A;  2MGW A;  2A5Y B;  1KSF X;  3U6S A;  2QHO B;  3SHF A;  4G4N A;  3HJQ A;  1TTE A;  3U61 A;  2EA0 A;  3L2A A;  3R9X B;  4GEW A;  3I04 M;  4I8O A;  1PGY A;  2CFO A;  4DV2 M;  1QYR A;  3PNV A;  3SAS A;  2L6O A;  3ZQJ A;  1G71 A;  3A42 A;  4DBG B;  3HU2 A;  4LY6 A;  1HNX M;  2O25 A;  4PT5 A;  4JI3 M;  1IN7 A;  3U6M A;  3L25 A;  1G41 A;  2VDB B;  3HHZ A;  4LF6 M;  1JR3 D;  3PXG A;  1KFV A;  5EJC A;  4F1I A;  1EFU B;  3CTW B;  1QZE A;  3GLG A;  4S12 A;  1MX0 A;  1PJS A;  2UXC M;  4RKU F;  3VKH A;  1G4A E;  1YSY A;  2FS1 A;  3HGI A;  4RF1 A;  1G3I A;  1IN5 A;  3TWM A;  2K0B X;  1ZV1 A;  2ZAM A;  1XHB A;  4MGZ E;  4B7F A;  4NRW A;  1IXZ A;  2R44 A;  2MJ5 B;  5LMN M;  3HHY A;  4I5S A;  3HHW A;  4M9Z A;  2JZ0 A;  2APL A;  1C7Y A;  3ZH9 B;  4LJ8 A;  3KFU G;  2R45 A;  3J27 B;  2KRK A;  1E9S A;  3THG A;  3VLF B;  3BOS A;  3D8L A;  4IBG A;  1PRB A;  3HJ8 A;  2XSZ D;  5ITY A;  2R4J A;  5EP4 A;  2X8A A;  2KXE A;  4NL4 H;  1UM8 A;  2F4V M;  1Z6T A;  2XGN A;  3L29 A;  3QAU A;  2N35 A;  3CF6 E;  2K6B A;  1T6O A;  4M9S A;  4LJA A;  4P17 A;  3T15 A;  3HZJ A;  1SXJ C;  1QAN A;  2G5G X;  1HJP A;  2JP7 A;  1NHG C;  2VF7 A;  4QNR A;  4MGH A;  1R6B X;  3J2P B;  5BPV A;  4PDG A;  1F4I A;  4LFC M;  1Q39 A;  1WXQ A;  2O01 F;  4L6V 6;  5KQD A;  2XFS A;  3AOG A;  2I7N A;  1AIP C;  5EXP A;  4LJ9 A;  2VQE M;  2FOI C;  1N32 M;  2V1C A;  2Y20 A;  2LHC A;  4NOO B;  4LF9 M;  3AV0 A;  2HAK A;  1XXH A;  3LVW A;  4LF7 M;  5ITX E;  2DXI A;  1K82 A;  4QNM A;  2I7P A;  1OAO C;  3QWL A;  2QBY B;  3A45 A;  3T38 A;  1MJG M;  1J7K A;  2LVN C;  4FD2 A;  2OOB A;  3QYE A;  1IXS B;  1QAQ A;  2CEA A;  1W5T A;  3I51 A;  4WP2 A;  4L8R C;  3HU1 A;  2J7N A;  3QYB A;  4XK8 F;  2ERC A;  3NWL A;  3AKZ A;  4D81 A;  1D0M A;  2C9C A;  3SC3 A;  1ZAE A;  1OQY A;  5EP1 A;  1ZQ9 A;  4LJ4 A;  3W67 A;  4DR4 M;  3M0E A;  4OW0 A;  2WZJ A;  4MGI E;  2EO2 A;  1FJG M;  2DEN A;  5C18 A;  2EKF A;  4YY3 M;  1JR3 A;  1VQ1 A;  1C1K A;  1ORY B;  2CHG A;  4LJ7 A;  4IIW A;  4JXJ A;  3LW5 F;  4AG5 A;  1R4G A;  3DOA A;  1J5E M;  2R18 A;  4B7H A;  4DR6 M;  3B7N A;  4M0W A;  3J81 S;  2WSF F;  4XBO A;  4I4L A;  3E21 A;  2BJW A;  2L4E A;  2F5P A;  2Q2E B;  3NBI A;  2KW0 A;  2MR9 A;  4MH0 E;  4JI0 M;  1D2N A;  2WSC F;  2BWE A;  1QDT A;  1E94 E;  3FUW A;  4L15 A;  1NNJ A;  1TDH A;  4FWD A;  2D7H A;  1QUT A;  3U60 A;  3GQ4 A;  1VEG A;  3FRH A;  4FCT A;  2OO9 A;  4FWH A;  4KT0 F;  1N78 A;  1OFH A;  5ITQ A;  3GPP A;  3BBZ A;  2Z3X A;  4B08 A;  4B3R M;  1P3Q Q;  3TPZ A;  1G59 A;  4DUZ M;  4I81 A;  4D82 A;  2DZO B;  2KNZ A;  2M5Z A;  4LZZ A;  1IBK M;  2CV2 A;  2CV1 A;  3NBX X;  1V34 A;  2LVO C;  3U61 B;  5IT9 S;  3SAW A;  2DHR A;  1QAM A;  3FRI A;  3FTC A;  2HKJ A;  3K8Z A;  4DV3 M;  2DWZ B;  2C99 A;  4DV4 M;  1OKS A;  2OQ4 A;  2KDL A;  4FCV A;  2JY6 B;  1IY1 A;  1QDR A;  3HX3 A;  2C9O A;  4JN6 A;  2UU9 M;  1QUS A;  1LTM A;  3U6O A;  3TL4 X;  2QSF X;  2MH8 A;  1DO2 A;  3KSJ A;  2XZU A;  4LJ5 A;  2BWB A;  1TF0 B;  2V6Z M;  2OPF A;  4JV5 M;  3GRR A;  4TUW A;  3J7B A;  1WJ7 A;  5EP2 A;  1L1T A;  3GLG B;  1TH3 A;  4G3O A;  3MK6 A;  4KOD A;  1H6U A;  2KZU A;  2QQ8 A;  5FTM A;  1XMO M;  3MHV C;  4G6Z A;  3RE8 A;  3DFZ A;  1L2C A;  2CE7 A;  1DO0 A;  1XNR M;  2JY7 A;  2DAI A;  1UFZ A;  4BBA A;  2NQ8 C;  5DYG A;  3AFH A;  4BLC A;  4NXN M;  1WGN A;  2CHV A;  3JAM S;  1T43 A;  3KS4 A;  3VK8 A;  2LH0 A;  1YLA A;  1WGL A;  4KO8 A;  4P16 A;  4L4U A;  5ITT A;  1S3S A;  4AKG A;  8CAT A;  5L8R F;  3GLG E;  3HJS A;  3CGW A;  2G3Q A;  4LRS A;  2UUC M;  3SAT A;  2YFQ A;  4LF8 M;  2DKL A;  3K1J A;  4FCW A;  2GQF A;  3SAR A;  2KZS A;  2RGH A;  3FE3 A;  5IZ7 D;  1SG9 A;  1V33 A;  4AZF A;  4CHT B;  3U6E A;  4IBD A;  2FE8 A;  5FTL A;  2RKO A;  1N34 M;  2YR0 A;  1GO5 A;  1W5S A;  1ZMW A;  3PNY A;  1HT1 E;  1PJQ A;  2H5X A;  1AUA A;  1TGU A;  3GRU A;  2R65 A;  1TH4 A;  3KDS E;  5DFL A;  3SMP A;  1A5T A;  3T6P A;  2C96 A;  4RNA A;  2R62 A;  5LMU M;  2QCU A;  3LMM A;  4AW4 A;  4YHH M;  1RU3 A;  2DZN B;  5EP3 A;  1HT2 E;  3LVV A;  5GKN A;  1DGB A;  2W82 A; 
#chains in the Genus database with same CATH homology
 2JUJ A;  1IM2 A;  2JNH A;  2KHH A;  1Q02 A;  2LVN C;  1NV9 A;  2OOB A;  2CP8 A;  2MRO B;  2DI0 A;  3B89 A;  2DAK A;  4WP2 A;  2EKK A;  3K9P A;  1HQY E;  1OQY A;  2ZTD A;  3E46 A;  2WZJ A;  2DEN A;  1TR8 A;  2R0I A;  2EKF A;  3GLF E;  2LTU A;  2LVP C;  1VQ1 A;  1XXH E;  3H4J A;  1R4G A;  1VEK A;  1VEJ A;  1OTR A;  2DAM A;  2JY5 A;  4UN2 B;  2RRU A;  1WIV A;  3E21 A;  2L4E A;  3IHP A;  4F2L A;  1CUK A;  2MGW A;  2MR9 A;  2QHO B;  2DZL A;  2BWE A;  1IFY A;  1E94 E;  2HWJ A;  3GLI E;  1TTE A;  2B3T A;  1NV8 A;  4GEW A;  2DAE A;  1VEG A;  3FRH A;  1PGY A;  2OO9 A;  3K9O A;  3BBZ A;  3LCU A;  1P3Q Q;  3IEC A;  1VDL A;  2KNZ A;  4DBG B;  1JR3 E;  2LVO C;  2O25 A;  2LBC A;  1MN3 A;  2L4F A;  3FRI A;  1G41 A;  2DNA A;  2KNA A;  1ZMU A;  4F1I A;  1EFU B;  4R71 A;  1QZE A;  1OKS A;  2JY6 B;  1G4A E;  1G3I A;  2K0B X;  1WR1 B;  1ZV1 A;  2QSF X;  1DO2 A;  2MJ5 B;  2BWB A;  4Q7J A;  1Y8G A;  1WJ7 A;  2JZ0 A;  1C7Y A;  2LVA A;  4G3O A;  3LCV B;  2LVQ D;  3MMP A;  2K9D A;  1DO0 A;  2JY7 A;  2DAG A;  2DAI A;  1UFZ A;  3GLH E;  4HEO A;  1DV0 A;  1WHC A;  1WGN A;  1T43 A;  1OAI A;  1YLA A;  1WGL A;  1T6O A;  2L2D A;  2DHY A;  3F92 A;  3GLG E;  2G3Q A;  2ZTC A;  1HJP A;  2CWB A;  2DKL A;  2JP7 A;  1F4I A;  1XB2 B;  3FE3 A;  1SG9 A;  5JI2 E;  2QNJ A;  1VG5 A;  1AIP C;  1ZMW A;  2JZ1 A;  1GO5 A;  1KYI A;  1HT1 E;  1ZMV A;  2H5X A;  2JY8 A;  1BVS A;  1V92 A;  2OOA A;  5DFL A;  1A5T A;  3T6P A;  1IXS A;  2HAK A;  2KNV A;  1HT2 E;  2EJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...