2XF3A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
423
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSGEDVAARFIPTFAAAGNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 141
structure length 423
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xf3A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xf3A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xf3A02
3G4PA 2EX2A 5FQQA 4BD0A 1EWZA 2WZXA 2PBYA 4QY5A 3IHAA 2Y2MA 1YLZA 5AQAA 3W4PA 3HUMA 4BENA 1ZG4A 4MBFA 3D4FA 4QHCA 1YM1A 5M18A 1YLYA 1RGYA 1KGFA 2P9VA 4K0WA 5DF7A 1KE3A 3VP1A 3ZCZA 3MKFA 3OZHA 3FV7A 4PM8A 3EQUA 4MLLA 4JLFA 3UDXA 3Q7VA 1Q2QA 3IF6C 3LO7A 4HBUA 4LCMA 4P0MA 3VMAA 4E3NA 2JCHA 5DVAA 1MPLA 4N9KA 4HBTA 2ZM2A 3BECA 2EFXA 2OLUA 3G35A 3N6IA 5FQMA 4KG6A 4IBRA 1PZPA 2EX6A 4E3JA 2XD5A 2Y4AA 3A3EA 1ONGA 3CG5A 4KQRA 3UY6A 1CEFA 1BLPA 4FH2A 1PIOA 1WYCA 2IWDA 2XQZA 5FAPA 4K0XA 2B5RA 5CHMA 3W4QA 2G2WA 3WS0A 2JE5A 1L0EA 1SDEA 3IWOA 1BLCA 4DDSA 3Q81A 4D2OA 1XA7A 2FFYA 3WS5A 1L0DA 2FFFB 3E2KA 1WE4A 4OPZA 1Z6FA 3IXHA 4Z9QA 4UA6A 1CK3A 4PM7A 3ZG8B 4JBFA 3BLMA 1MWSA 1DY6A 1ES4A 4WZ4A 2EX8A 1HZOA 2IWCA 3FZCA 2QZ6A 1SKFA 5F82A 1PWCA 4KZ3A 2DRWA 1ERMA 5EVIA 2DCFA 3SH7A 5E43A 4R4RA 3IT9A 5GHXA 4LV3A 4CJNA 3ZG7B 1CI8A 4U3TA 1N9BA 3GSGA 2E8IA 1KDWA 4DE2A 4P87A 2ZQ9A 2P9VB 4S2OA 1QMFA 3A3FA 1I2SA 3MZDA 1LI0A 3MKEA 5HAIA 4DE0A 2ZM8A 2WADA 5F83A 5FI7A 5FSRA 5KZHA 1LL5A 1PWGA 4DF6A 1K6RA 3CMZA 1IYOA 1PYYA 3BFEA 3FWLA 3SH8A 1JWPA 3BLSA 3OC2A 2Q9MA 1ONHA 5M1AA 4ID4A 5GHZA 1KE0A 3SH9A 5F1FA 2Y59A 5JYPA 5HL1A 1PZOA 3HLCA 4S2IA 1IELA 4OP8A 4ZJ2A 4E3IA 1SCWA 3HLWA 1NYMA 4N9LA 4UAAA 1ERQA 1K25A 3FKVA 1FR1A 5EVID 4BLMA 4X56A 1LLBA 4BD1A 4EBNA 5CECA 3PAGA 4E3OA 2XGNA 1BULA 1RP5A 4QU3A 4ZBEA 3VSKA 4S2KA 4DE3A 4GD6A 4MEZA 4MBKA 3ZVWA 4KZ8A 4E3KA 5HX9A 1ESIA 2A49A 1IYSA 1VM1A 1KVLA 1LHYA 4UA9A 3VFFA 5E2GA 1NZUA 4PM6A 4KZBA 2HDQA 4O7DA 2WZZA 5FQJA 1NZOA 1U60A 3OPPA 2J8YA 4OKPA 3HLEA 1FQGA 4C6YA 1NXYA 4GOGA 3NBLA 2X01A 1KDSA 3VSLA 3V3SA 5EVIC 5KSCA 3IXGA 4OONA 1PW8A 3WRZA 3ZVTA 3HVFA 4MNRA 5FI2A 3WS2A 3ZHHA 3CZDA 2WGIA 4JXWA 3S4XA 1ES3A 3DTMA 3FYZA 1EI5A 1NRFA 4HESA 5FA7A 3VFHA 4EWFA 4OLGA 3TSGA 4HEFA 4P85A 3BM6A 4WELA 4OOMA 5EECA 2P74A 2WGWA 1E3UA 4RVAA 3OCLA 3Q1FA 2ZC7A 3HLBA 1XX2A 1GHPA 1W8QA 4B88A 3C7VA 3SS3A 3P98A 1YLTA 1MWUA 3M2JA 3MZFA 1XGJA 2XK1A 4DE1A 3IF6B 5CRFA 4JPMA 4E6WA 1SHVA 2Y2QA 1HTZA 3UDFA 5EOEA 3ITBA 2JC7A 3ITAA 2ZQ8A 1BT5A 3W4OA 2XD1A 1IEMA 3IWQA 1JWVA 3RXXA 1W8YA 3A3JA 4R1GA 4RX2A 2R9XA 2WKIA 4R3JA 4XUXA 5A90A 3ZNTA 3BFCA 4S2MA 4Y0UA 4OQGA 5GLAA 5A92A 3CJMA 1Q2PA 2Y2LA 1ZG6A 2J9PA 3IH9A 4GD8A 3AGFA 3GR2A 4WZ5A 5FQIA 2XDMA 3PBRA 4DRTA 1ESUA 2HDUA 3O3VA 3Q7ZA 1MBLA 4WBGA 3V3RA 1E3UD 4LCLA 5GLCA 1W79A 4R3BA 1S6RA 3FKWA 5G18A 5DF9A 1IYPA 1N4OA 1TEMA 3UE3A 4Y7PA 2OV5A 2OLVA 1XKZA 2ZC4B 1L2SA 1W7FA 2BG1A 4OOYA 1E25A 1XPBA 2RCXA 3LCEA 4WEJA 1BTLA 3GRJA 5GLBA 4Y0OA 3QHYA 2Y55A 2VGJA 4MBHA 1XGIA 3V50A 3MXRA 4S2NA 3BFGA 3ZFZA 3BYDA 1BLSA 1K38A 3GTCA 3ISGA 2Y91A 1FR6A 4ZJ1A 1FCOA 2WAEA 1DJBA 2C6WB 3VOZA 1K54A 3HLDA 1MKIA 2ZMAA 2X71A 5TGFA 2IWBA 2WGWB 2I72A 4QB8A 5M19A 5CTMA 1HD8A 4GDBA 2G2UA 1K4FA 4KZ5A 5DF8A 1S0WA 3C4OA 3Q7VB 4EUZA 4ZTKA 2ZD8A 2VGKA 3SOIA 4PMAA 2Z2LB 3NDEA 5CTNA 5E2HA 2GDNA 3O87A 4GZBA 1MWTA 1YQSA 2XF3A 2EXBA 2Y2NA 4OPRA 4R4SA 2WUQA 5I94A 1OMEA 3SS4A 2WAFA 1IYQA 4OP5A 3WS4A 3AGDA 1K56A 4X53A 1E4DA 1SDNA 2CC1A 4OOLA 3IF5A 4WZ5C 2ZQAA 1C3BA 1H8ZA 4OQ0A 3UE1A 4WMCA 1ZC2A 1L0GA 2BLSA 5CHUA 4LV1A 4IBXA 5EUAA 1PI4A 3G2ZA 1K4EA 3HREA 4OQHA 3ZG5A 1W5DA 3C4PA 3UDIA 1JWZA 1ES5A 2ZC6B 3PBOA 3LY3A 3UO9A 4ZDXA 3LY4A 1YLWA 3PBQA 3DWZA 1LL9A 2JBFA 5GL9A 4FD8A 2XEPA 3WWXA 5A91A 1O7EA 5EE8A 2PU4A 4OPQA 2ZJ9A 2XR0A 5CEDA 3HLFA 2WK0A 4IVKA 2Z2MB 1YMXA 3G30A 3MFDA 3OPHA 1WYBA 4A5RA 4KG2A 4R0QA 4XXRA 5EVIB 3RJUA 4FH4A 4S2NC 5L2FA 3GV9A 4JXSA 3JYIA 4EBPA 3GQZA 3N8SA 5GLDA 5AQ7A 2WKHA 1K56D 3MXSA 2HP6A 1PI5A 4KZ7A 4EV4A 2PU2A 3O88A 4RX3A 4JKTA 1K54C 5CEBA 3QNCA 1G68A 1ALQA 4WMCD 2XFSA 4BJPA 5CGWA 1BSGA 2ZC3B 5FAOA 3N8RA 2DNSA 5HW3A 4PM5A 4ZJ3A 1FCMA 1IKIA 1PW1A 2ZLYA 4KQOA 3S22A 2R9WA 3PBSA 2EFUA 3IXBA 3O86A 1K57A 3TOIA 1H8YA 3N8LA 4C3QA 1AXBA 5U47A 3UE0A 3B3XA 3C7UA 1VQQA 4OQIA 3NI9A 3NDGA 5FAQA 3DW0A 1Y54A 3DWKA 1KGGA 1YLJA 5CHJA 1ZKJA 4BL3A 2RL3A 3I7JA 4WEKA 1L0FA 3VP0A 4IEDA 3V39A 4E3LA 1MY8A 4PPRA 1ES2A 4F94A 1BLHA 5D3OA 1BZAA 3M6BA 4NETA 3HUNA 5GHYA 1H5XA 4GKUA 3M2KA 2ZC5B 5CERA 2WYXA 1JVJA 3OCNA 1M6KA 5A93A 4KZ4A 5DTKA 2Y2IA 4OVDA 4OLDA 1I5QA 2HP9A 3E2LA 4RYEA 1DJCA 4M3KA 4E6XA 5HFOA 4U0TA 3HL9A 4KZ9A 3P09A 3A3DA 2XFTA 2H0TA 3ZG9B 1RCJA 3HBRA 3Q07A 2V1ZA 4UHUA 4WYYA 3IH8A 3V5MA 1TDLA 1CEGA 3PBTA 4JXGA 1YLPA 5TR7A 3BEBA 3UN7A 3UPOA 4Q8IA 3G34A 4RA7A 1GHMA 2WKEA 3ZDJA 5DTSA 2HDSA 2V20A 3N7WA 3QNBA 4GN2A 2HDRA 4QJGA 4X6TA 5FQKA 4S2JA 1FSWA 1K6SA 1DJAA 3WS1A 4YINA 2H10A 5J8XA 5CGXA 4LV0A 5E2FA 3UNWA 2A3UA 2QPNA 3IHBA 4Y0TA 3G32A 2UWXA 1EROA 3PAEA 5F1GA 1PWDA 5FASA 5KMWA 4B4XA 4GNUA 4IVIA 1GA9A 3AGEA 1K55C 3MZEA 1M40A 1RGZA 3NIAA 4QD4A 4C75A 3GVBA 2J9OA 1XP4A 1YT4A 4R23A 3VP2A 3HLGA 5EOOA 2Y2GA 4FSFA 1G6AA 1K57C 3RXWA 4PM9A 4E3MA 2ZQ7A 2Y2PA 2Q9NA 4P6BA 1MWRA 4XUZA 5FI6A 1JTDA 4UA7A 1IKGA 2J7VA 3A3IA 3G31A 3VOYA 2OSUA 4KG5A 3IXDA 4K91A 1QMEA 4S2LA 5EVLA 2EX9A 3PTEA 3W8KA 4DDYA 3ZGAB 2X02A 4BL2A 2WGVA 1XA1A 3SS5A 4OPYA 1I2WA 4DKIA 3N4IA 3C5AA 1GCEA 3HUOA 2HP5A 3NC8A 3NCKA 1KGEA 3OPLA 2QMIA 5JYOA 3WRTA 2XLNA 5IHVA 5AQ9A 4H8RA 4JF4A 3S1YA 5KSHA 2ZQDA 4KZ6A 5TFQA 3ZG0A 5HARA 1KE4A 1JTGA 4JXVA 5HAQA 4ZAMA 4N1XA 3G2YA 3IF6A 3MBZA 4KQQA 4GDNA 2ZM0A 2ZQCA 5AQBA 5HAPA 4WM9A 3M6HA 1BUEA 3PBNA 3BFFA 5BOHA 2HPBA 1CI9A 4JF6A 2V2FF 5FQ9A 4OH0A 4B4ZA 3IQAA 4LV2A 3GMWA 4LENA 4KENB 4DXCA 3IWIA 4YFMA 4GB7A 3VP4A 3VP3A 4EBLA 4JF5A 5E2EA 4U0XA 5FATA 4NK3A 1HVBA 5FDHA 3UPPA 4N1HA 1KVMA 1NYYA 4FCFA 2XH9A 2Y2KA 2Y2JA 1FCNA 1TVFA 1GHIA 2EXAA 5CXWA 3NY4A 5EPHA 4CPKA 1LI9A 1O07A 4QY6A 4L0LA 1MXOA 1NJ4A 3BFDA 1K55A 1TDGA 4KZAA 2H5SA 4S2PA 4X68A 2Y2HA 3LEZA 4X69A 5CGSA 1FOFA 2C5WB 3UPNA 4BQMA 1J9MA 3OPRA 4N92A 4X55A 3ZNYA 1XXMA 3TG9A 5DTTA 1YMSA 3EQVA 4DXBA 2Y2OA 4EQIA 2H0YA 1FSYA 1NY0A 3Q82A 3BRMA 1GA0A
chains in the Genus database with same CATH superfamily
5BVBA 1O7PB 1L3LA 5IW9A 4G4QA 5DJTA 3W4PA 4GHIA 1L1TA 2ZL1B 2Z76A 4Q7JA 4LG2A 4N6OB 5STDA 1IQYA 1YM1A 1YLYA 1RGYA 1KGFA 4AG5A 3CUEA 4K0WA 2R46A 3WR2A 3SOAA 2G8LA 3KDSE 2EUCA 3MKFA 3OZHA 1AV4A 3GQ4A 5DKKA 1F98A 3WOFB 3Q7VA 3F7SA 1Q2QA 3IF6C 3LO7A 4LCMA 4P0MA 3RNTA 3IG8A 1G28A 1G8PA 5DVAA 2CIUA 3PZWA 4JI8M 3V99A 3CXC2 3T12B 1WJ7A 5HWTA 1H8MA 1T43A 3LI9A 3BECA 2EFXA 4M9SA 4LFUA 3N6IA 4WLAA 3U2AA 1A2VA 1SXJB 4HBRA 2QENA 3DOAA 4IBRA 5FEGA 2INXA 2PR6A 1TTEA 1PZPA 3W0FA 5LMUM 2Y4AA 3CG5A 3A3EA 3MYTA 1ONGA 4KQRA 3D9RA 4NXEA 1CYVA 1CEFA 4BTYA 1BLPA 4FH2A 4DV2M 8RNTA 1XC8A 2Z6CA 3FRIA 5FAPA 2OQEA 4K0XA 3SX1A 4HZBB 1N36M 1J2BA 1DGBA 1FUTA 4N6NB 3TDGA 4IBJA 4MGKE 5EXSA 4STDA 2JE5A 1SDEA 1BLCA 1XXHB 4DV1M 1GS3A 3Q81A 4GJ4A 4DDSA 1PFPA 4OU7A 1XA7A 1R4CA 2FFYA 4B3TM 3WS5A 2FFFB 1EKMA 4MGYE 2Z4SA 3IXHA 3CCM3 1OKSA 2DHRA 1J5EM 1OTBA 2B95A 4PM7A 1XJ6A 3DAVA 1DY6A 2IWCA 3TJZC 2QZ6A 1SKFA 1PWCA 1R5LA 1J3WA 3IHPA 2L6OA 1LTMA 5GHXA 3X41A 1CI8A 4U3TA 1W2B2 2KHHA 1R2ZA 1N9BA 3GSGA 3P7NA 1NO3A 2JWSA 2W6JH 1JR3A 2P9VB 1QZEA 3RGAA 3A3FA 3MZDA 2W3GA 2HMNB 4NG2A 4DE0A 3LUQA 2ZM8A 5F83A 2AHMA 5FL3A 1PWGA 4L9EA 1G6OA 2J8XB 3CMZA 1IYOA 3BFEA 3J80S 4BLCA 3H82B 3OC2A 3LTAA 3UB7A 3Q1CA 2QBYB 2VV8A 5GHZA 1S4RA 2Y59A 5JYPA 5IZ7D 4R71A 2CK3H 3FG4A 4N9LA 4AFIA 3E4PA 1ERQA 4KT3B 1RN4A 1K25A 2YFJB 1KD14 5CECA 1L2CA 2V6ZM 3SBJA 4FMDA 1XFQA 5IREB 1BSEA 2GEYA 4XBTA 1D7EA 1OTDA 3O8YA 2ZOHA 4BU4A 2VV7A 4GD6A 4L4UA 2D7HA 1OTAA 2IA2A 4LJ6A 1GMPA 8CHOA 3B7QA 4LJ5A 3H7WA 3U1WA 3CPTB 1GY5A 1LOXA 2GSPA 1IYSA 3JUOA 2O9AA 4L8PA 3VFFA 3C3DA 1JKGA 3T1XA 1IXSB 4RKUF 4KZBA 2HDQA 2YQZA 5EXTA 4OKPA 1IY2A 3HLEA 1ULJB 3PXPA 2NUPC 5A8BA 1B2XA 1V9ZA 4ETXA 5EVIC 2QHKA 1TF1A 1T1CA 4R3AA 3AJIB 3KSIA 3Q90A 4I3JA 3FZWA 3WRZA 1RCKA 3HVFA 5KPTA 3LR4A 2WO0A 3U5ZB 2D01A 3S4XA 3U6OA 3M0EA 4PEJA 3MPHA 1NJFA 4WYKB 1EI5A 1ES3A 5KP1A 2KX6A 2KW0A 5FA7A 1KOUA 3VFHA 4EWFA 1L2DA 3I0YA 2QJ7A 4P85A 3DBAA 3FPVA 2WGWA 2C99A 3OCLA 3Q1FA 3HLBA 2XA7M 1W8QA 2GU1A 4M0WA 1YLTA 2Z4RA 1Z5BA 5I97A 4DE1A 1BSCA 3LTBA 1Q7Y4 5CRFA 2O3OA 2Z6BA 3EF8A 2V0WA 3UDFA 5HL6A 2PD7A 1BT5A 4MMZB 5IG0A 3RXXA 2JNHA 1JWVA 3WHOA 3D3OA 1X1XA 1KC84 3S67A 3CWFA 2GNOA 4HJ6A 1D6YA 4EBGA 4R3JA 1JZOA 1XJ2A 3HKPA 1UCKA 1F9IA 3S29A 2ZTDA 3NOPC 1EE8A 4FOFA 1BYWA 4Y0UA 2QIYA 3NHXA 5AIHA 3BNBA 1X1UA 2V0UA 1S1YA 1BGSA 1RRLA 2ZDJA 1ZG6A 2J9PA 2L1MA 3AGFA 4GD8A 3E0YA 5BPVA 1TFOA 4IPBA 5LC7A 4WBGA 3V3RA 2R0IA 3AOEA 4MN5A 1DGGA 1MNLA 4JGPA 4LCLA 4LGYA 1UCLA 1W79A 2P5TA 3FUVA 4R3BA 4ARZA 1XXHE 1ULIB 4FMBA 5G18A 1NJGA 1N4OA 2BJVA 4GC5A 5KP3A 1H6UA 2EKFA 4ESPA 1YJW3 5AEWB 4WUJA 1GD3A 1BTLA 5EP2A 1IVXA 4NC6A 1NWWA 3GZYB 3QHYA 3AHWA 4R9LA 2QPAA 1XB2B 4TX4A 3I4VA 1JB4A 3K5TA 2LTUA 1V58A 3OOVA 3BYDA 1BLSA 4LGWA 1NHGC 5GKNA 3NJAA 2Y91A 4GHIB 1FR6A 4ZJ1A 1AQZA 2C6WB 2RGHA 2F5QA 2A15A 3HLDA 4AW4A 2ZMAA 3DM8A 2E5LM 5TGFA 2ZMFA 4GS9A 1OFHA 3GSPA 4O2HA 4IJFA 2OOAA 1HD8A 4GDBA 2G2UA 4KZ5A 1S0WA 3C4OA 3Q7VB 1X1WA 1ROVA 3SOIA 5E2HA 3LOYA 3J2PB 2F86B 1OT6A 1G4AE 1F2KA 3SYKA 4FCJA 4JGRA 2L7IA 1EFUB 1VEKA 1E4DA 3K92A 5EP4A 3G713 2JY7A 1MU5A 2CC1A 4OOLA 3IF5A 1PRBA 1C3BA 3OLOA 4WMCA 1L0GA 2LBCA 3RE8A 3GLGE 1Z09A 2R65A 5CHUA 4LV1A 1TDZA 3EWKA 3U6SA 2HMKB 2DI0A 4KQDA 3OX9A 4OQHA 1GYBA 3EEAA 4K61A 3UO9A 1DO2A 3W68A 1IQ8A 1D2NA 3LY4A 2YX9A 4B7GA 2IUJA 4ZDXA 5G4ZA 1HNWM 4FD8A 2XEPA 3CCR3 2BNGA 2A24B 3JUNA 1NHWC 1IBKM 1G71A 1BRGA 5AIGA 4HI4A 3HHYA 4HP4A 1GMRA 2LHGA 2HL7A 1YMXA 3GLHA 1WYBA 4XXRA 5DFXA 1JN5B 3EBTA 3RJUA 4BMWA 3G8ZA 5L2FA 4JXSA 4BBAA 3KSGA 2GBXB 1K56D 2HP6A 1PI5A 4MCWA 3O88A 2O25A 2PZVA 4JKTA 1A90A 5DRVA 1I2GA 5CEBA 4KUKA 1QUSA 4I8OA 5ITXA 1IK3A 2C96A 3H3HA 7STDA 1YKDA 3CC43 1BSGA 3T4LA 1S66L 2GEXA 4QHSA 2DNSA 7CATA 1QZMA 3JVCA 2O99A 3N8RA 5HW3A 4CDLA 5C1BA 3VKHA 4ZJ3A 4ORLA 4DR1M 2ZLYA 2ACGA 3SZTA 4OVZA 1W6GA 1YNVX 3KSJA 2P7JA 3UE6A 2V1AA 2ZAMA 3N8LA 5MC7A 4NXGA 5FAQA 2MJ6A 2CWTA 1RTUA 4R80A 3DW0A 3S7QA 1KGGA 1IV9A 4LRTA 3PGBA 2XZFA 2UUBM 1W01A 3I7JA 2KDLA 3HIIA 3NBJA 5E26A 2JKRM 2FNAA 2PHYA 3WMDA 5D3OA 1IXRC 3GRYA 3GLFE 4NETA 5GHYA 2W0NA 4GKUA 4IBKA 4PKYA 2K6BA 2WYXA 1CQSA 3A0SA 1VQO3 5AYSC 2UV0E 2QCUA 4KZ4A 2B24B 4LJ4A 2FGTA 5BXQA 1OH0A 3Q3FA 2HP9A 3E2LA 3L27A 4D82A 1DJCA 4M3KA 3K63A 3LFVA 4U0TA 1A5TA 2XFTA 3BIRA 4O02B 3ZG9B 1RCJA 3HBRA 3IH8A 1DVDA 3PBTA 5TR7A 3UN7A 2R41A 3NV0A 3G34A 3G16A 2CV2A 4LJ9A 4PCZA 3H4JA 1GJSA 3N7WA 2HAKA 1UUGB 3EGDC 3T4QA 1FSWA 2W9QA 3M8CA 3WS1A 3ILKA 2X49A 1VQ53 4HAAA 2Z3XA 2H10A 1JB5A 3EN1B 4ANRA 4KZ1A 3SOYA 4LV0A 2CHQA 5E2FA 8CATA 4JXJA 4IBFA 3EE1A 2A3UA 4Y0TA 3PAEA 3TE6A 3DGMA 4B4XA 1OGZA 4NL4H 5D82A 3MZEA 1RGZA 4C75A 1U5OA 3GVBA 1XP4A 1XHBA 3T0UA 3X3YA 3B42A 2DWMA 2BU4A 4EUVA 1N34M 1XMOM 1E3VA 1T1BA 1ZTUA 4FSFA 1K57C 3RXWA 2W3HA 4L8RC 1L5GB 3GPXA 4UA7A 3LMLA 2OWJA 4F3LB 2JUJA 2HV1A 2ZBKB 3CI6A 5ELJA 4L78A 3PTEA 3J7BA 1BU4A 3FG8A 3MJQA 3F40A 1K28A 3MQOA 2LVNC 4FCZA 1FILA 1XA1A 3SS5A 2ZL1A 3LIDA 1ZX2A 2BMOB 1GCEA 3A0RA 2HP5A 3HUOA 3NCKA 3F1PB 1QAOA 2QMIA 4LF9M 2F4YA 2SBLA 3KO6A 3PS8A 4I4KA 5FTLA 6GSPA 2ZQDA 1WMPA 5TFQA 1T3TA 4JXVA 4ZAMA 1NVMA 3BJNA 3G2YA 3IF6A 2XA7S 2ZM0A 3MBZA 4GDNA 4WW0A 1M904 2K9DA 4XK8F 4MN6A 4WM9A 1Q3CA 1BUEA 4YHHM 1VETB 3BFFA 4DR7M 4MN7A 4JF6A 3QP5A 5BIRA 3NOTC 1RGGA 3EIEA 2CWUA 2V2FF 5FQ9A 3IQAA 1YPRA 5HWVA 3H51A 3J27B 1SXJA 2OOLA 2CRUA 4FMCA 4GB7A 4DV4M 4EEUA 1BRJA 4EBLA 3D8BA 3I4YA 4EC6A 3MKIA 4NK3A 1HVBA 1BSDA 4PHTA 4EV5A 4DV5M 3UPPA 1KVMA 1E32A 4FCFA 3G6E3 1JR3E 2XH9A 3PCRA 2Y2KA 4I39A 1FCNA 1OFIA 5CXWA 2CE7A 1I2FA 4CPKA 1GKIA 1HU9A 1O07A 1NNUC 1MXOA 4X69A 1K55A 3SAVA 4BQMA 2Y2HA 4AKHA 1I70A 1XXHA 2QZ4A 4EXOA 3HWSA 1IN8A 4FCWA 3HHZA 1BOXA 1N33M 3C8CA 3OPRA 4N92A 3RFBA 3UJNA 3TG9A 4JF8A 1YMSA 2O5RA 3ZGAB 1CYUA 2HJ9C 1L8QA 2L4RA 2PYRA 1LNIA 4IIAA 3THGA 4Q0IA 1NJI4 2EX2A 2D1WA 1R2YA 4L8OA 3WODG 3OWUA 1EWZA 2PBYA 3Q2PA 1B2ZA 4XBXA 5KPZA 3HUMA 3SYLA 4QHCA 3LQQA 3LT9A 2P9VA 1HQYE 1HYFA 4EW5A 1YSYA 2FS1A 3NM2A 3R7WA 3VP1A 2A5YB 4G4RA 1O7WB 3UL5A 3ZCZA 4MLLA 4JLFA 3UDXA 4I3IA 4E3NA 2VA0A 1B2MA 3UB1A 4D81A 2QBYA 1G3IA 2KLIA 1OAIA 1OTIA 3PNVA 1GSPA 1A2KA 3TE8A 1GL6A 3NQYA 2ZANA 4PDIA 1GOUA 5F69A 3GLHB 2GXFA 1NNVA 2KEBA 4ILFA 1IM2A 1U8CB 1CF0A 1VZZA 3BY8A 4E3JA 2XD5A 3UY6A 1XJ3A 2UXBM 4HVNA 4Q0HA 3ZCBB 1KWIA 1PIOA 3BU4A 3S7OA 1FIKA 3KP1E 4EW7A 2B5RA 5CHMA 3LICA 3CPTA 3UB9A 2FZ0A 3WS0A 2KOIA 5E6JA 1C7HA 4N6UA 3K3DA 1VQL3 2Y79A 3E2KA 4OPZA 2JDIH 3KS4A 1X0OA 3EB8A 1N75A 3ZH9B 2P38A 3WDGB 1C7YA 3QRDA 5AIIA 1CK3A 1VEUB 3BLMA 4H6JB 3ZG8B 5KQDA 1ES4A 2YR0A 1HZOA 3FZCA 4XBYA 1YE9A 2F5OA 4DR6M 2BIRA 5EVIA 2WSFF 2ZM6M 2H28A 1G5UA 3W67A 5E43A 2J3TC 4R4RA 1QYRA 4NSRA 4LV3A 3ZG7B 2W1TA 3PNYA 4WURA 1EA2A 1BSAA 4DE2A 5ELUA 1WHCA 3B7NA 3U5ZA 3ZQJA 1QMFA 1LI0A 4WYKA 1WNHA 4LF4M 3I51A 3IS2B 5FI7A 5ITYA 3DTIA 5KZHA 3JR4A 2BWEA 1G02A 3MG1A 3SH8A 1UDII 1NDOB 2OOBA 2CX1A 1GO5A 5DNYA 1GOYA 2F4VM 1ONHA 1HKXA 4XDWA 3LTDA 1YSQA 3D79A 1KE0A 5EM0A 5HL1A 1NLYA 3D3LA 4E3IA 1D6UA 3NV0B 3HLWA 4M0DA 3BQ8A 1HT2E 1LRAA 2Y8HA 4BLMA 4KHPM 4X56A 4BD1A 2KNVA 1RMSA 3F9SA 5L07A 4LGQA 2XGNA 1RCLA 3FG3A 4ZBEA 2ZHXB 3KYEA 3ZVWA 1Z5CA 3NWLA 3X42A 4MBKA 1JR3D 1ESIA 2L4EA 1JRQA 3PXGA 1JB0F 1TF0B 2QYBA 1VM1A 1KVLA 4WL9A 1R7RA 1NZUA 5DFLA 4O7DA 3T38A 5FTKA 4YNRA 2JQ5A 1NZOA 3OPPA 1TS7A 1OTRA 2DAIA 4DBGB 4GOGA 1TH2A 1N32M 1EEJA 2OTJ3 3D4AA 1NU3A 2XGLA 4NREA 5D83A 4OONA 2DMWA 3BY9A 1SPUA 2VQFM 5FI2A 3WS2A 2NQ8C 1LXEA 5IG5A 1MGWA 3L26A 3BW6A 2K3DA 3CD63 3DTMA 3LMMA 3FYZA 1VEJA 4EERA 3RGPA 4GKJM 1QDTA 4OLGA 3ZYTA 1IY0A 2PAVP 1HR0M 5JI3E 1IXZA 2JKGA 2Q0OA 2KF5A 4LF8M 2XSZA 3CF2A 2RGQA 4HLQA 2H0GA 5EJCA 3IG5A 3WOEB 2XSSA 4DR5M 4E6WA 2SARA 3MZFA 3IF6B 4Y17A 1A67A 1SHVA 1HTZA 3JUPA 2EA9A 2V1LA 3MR0A 1MJGM 2JC7A 2Q07A 1X37A 2UUGC 3CF0A 2DHYA 4BWIA 4RX2A 1J7KA 4E04A 5H37D 3HHWA 2WKQA 2FXTA 5HPFA 2LH0A 1BNRA 3GLHE 3HZJA 3MSOA 1DMNA 3NBXX 2JA2A 1FW7A 5BU4A 4JI6M 1Q2PA 3GDIA 3IH9A 3V50A 3KYQA 3N9HA 3GR2A 4R3DA 1GLNA 3PBRA 1BUQA 4DRTA 2HDUA 5ITXE 3Q7ZA 1MBLA 3AFHA 3BNDA 3C9PA 1DP6A 4G4NA 1XNRM 4J8TA 2Z8YM 2RKOA 4LF7M 3NUVA 1IY1A 1AWIA 3FKWA 3KOZE 3SARA 4Y7PA 4LEHA 2HGVA 3LTCA 1K8A4 2Y21A 4QNRA 1D6ZA 1SJWA 1L2SA 1W7FA 1DGHB 2A24A 2BG1A 3DMCA 3TPZA 2JKTM 3JVUA 1DV0A 1FGOA 1XPBA 4CLCC 3GRJA 5FTJA 3I553 3GO8A 1BAOA 2VGJA 3KN4A 1BNEA 3DXOA 1CJFA 1XGIA 1JN5A 3MXRA 3ZFZA 3CCV3 2DAMA 4MJDA 4L7KA 4XGIA 3GTCA 3ISGA 2KNAA 1CEWI 3B47A 3BB9A 3A46A 1DJBA 2UX0A 5CXOA 2RRUA 3KOYE 4LFCM 3B8LA 4FWHA 4LFBM 2X71A 4D60A 2IWBA 2I7NA 2I72A 4QB8A 1RNBA 3R7WB 3W0LB 1IVVA 1UGHI 4HNBA 3AKZA 1RDSA 3A98B 5DF8A 1YAXA 4YOFA 4I3AA 3HJSA 4DR2M 4ZTKA 2ZD8A 2HWJA 3S5CA 4QOSA 5KP4A 3SATA 1K82A 2VGKA 5EXPA 2Z2LB 3HZPA 1E9RA 2F5WA 2GDNA 4NXMM 3O87A 1GJTA 3EIHA 1LSWA 2C10A 2EXBA 2Y2NA 3MG3A 4OUQA 2WSCF 3GZBA 2WUQA 4DR4M 4GCZA 3NBRA 1AVLA 2WAFA 3FC7A 4MB7A 2P0MA 4X53A 1ZQ9A 1W4NA 2L1SA 4GMQA 4J5KA 3FTDA 3L2AA 4N6V0 3GPYA 1G0TA 3MK6A 2BNKA 5AVFA 3VE4A 1SQWA 3U6LA 3HJIA 4IBXA 5EUAA 5IS1A 1PJTA 2APLA 4ZPXA 1UGUA 1PJQA 2DWNA 1BRIA 5HGRA 2PR5A 3JAMS 3S27A 1DO0A 4B7FA 3PBOA 2Q2EB 1YJN3 4MEIA 3LVVA 4GITA 1OT9A 4QHTA 1WIVA 3CNMA 1YI23 4OPQA 1IT7A 1UM8A 4W5WA 4LZZA 1RGFA 4IVKA 2Z2MB 1EUIC 3B89A 1AR0A 4MGIE 4R0QA 1RJOA 4Y28F 2CUZA 4FH4A 1FNNA 4S2NC 5EVIB 4EBPA 4MGHA 3GQZA 1RSNA 2WKHA 3E99A 4JGQA 1JJ22 2PU2A 2W1TB 5IERA 4RNAA 5CF1A 4WMCD 2XFSA 4BJPA 2CG1A 4B3RM 1W6CA 4KFEA 2JY6B 1IKIA 3M6AA 2R9WA 1N9NA 2BMRB 3O86A 2W04A 2CHVA 2F99A 1K57A 3TOIA 1NNJA 5AI1A 1IBLM 1FGTA 1TS6A 1VQQA 5EP1A 1EW0A 1JV2B 4F3LA 4P17A 3B4OA 3L25A 1TFKA 1ZKJA 2ZMVA 4BL3A 3SFZA 2W56A 2GNXA 2RL3A 1L0FA 2RCDA 3WA2X 1ES2A 1SXJE 3I04M 2C98A 1N9OA 3E4OA 1I2EA 3NULA 4R4KA 3B4PA 1BZAA 5CK6A 3V76A 4K1VA 4OVMA 3HUNA 1D0LA 1H5XA 4Y13A 4MGZE 3GP1A 2ZC5B 3F1PA 1IYYA 4N6LA 2V8FA 5A93A 2JY5A 3A5EA 4HJ4A 2Y2IA 4OVDA 3PFIA 3ULFA 3KCHA 2WKPA 3JVVA 2M7VA 2CFOA 4RYEA 2VGLM 3HL9A 1BVIA 3P09A 2V1BA 2H0TA 1OPYA 2Y73A 5DREA 3EBYA 3CITA 2IA7A 4HM6B 5CX7A 2VLGA 4JXGA 1JB2A 4WZ5C 2O9UX 4Q8IA 1B20A 1VETA 3OBFA 4RA7A 1WGLA 3W2ZA 5DTSA 3ZDJA 4HKVB 1WR1B 4QJGA 2DENA 2XRNA 3ECFA 1R4YA 1S4SA 5J3WA 4YINA 5J8XA 4AKIA 3FF2A 4WWUC 2VX8A 3IBJA 1TIJA 2XRXB 2PBDP 1KYIA 2QPNA 4GRIA 1ZMUA 5JPPA 4IBBA 1ZMVA 3G32A 3QP1A 1QVF2 1PWDA 5FASA 2F5NA 4IVIA 4O8SA 4JI4M 5FW5A 4OX9M 1ZAEA 1M40A 3GWRA 2L09A 3DGNA 2JXNA 4X2OA 5HDDA 4R23A 3HLGA 2E2VA 4O8GA 3K2LA 2RBIA 4G1MB 4O0PA 2UUAM 3DTKA 2DXIA 1BIRA 4Y2FA 4XUZA 1JTDA 1IKGA 3QWLA 1JBTA 2OSUA 1NY6A 1YHQ3 1A2PA 1AUAA 1GY7A 1O7MB 3D5IA 4DDYA 2BMQB 1F4IA 2X02A 2G7UA 4OPYA 5EV0A 3AGNA 4MMXB 2OPFA 3LZAA 3FKEA 1GSXA 1QVG2 2M60A 4I81A 4HM4B 1DMQA 1Z6TA 1PGYA 4DMZA 1FJGM 3MF0A 4Q0JA 4G3OA 3CME3 3WRTA 2ZBBA 5JYOA 5IHVA 5AQ9A 2LVAA 3KS8A 2K0BX 2V1CA 2XSHB 1LOWA 1TU5A 4Z8XA 4JF4A 4ZM8A 2R4EA 3LT8A 3S1YA 5KSHA 1IDPA 4X64M 3ZG0A 4KQQA 1NV8A 2ZQCA 1K9M4 2JY8A 3IX3A 3KYZA 3M6HA 3CU3A 3V92A 3T4TA 5L8RF 1ZGXA 3EHCA 5AJGA 3VV4A 3NX0A 4OH0A 4B4ZA 2QHOB 1N5HA 4IBIA 3GMWA 3K9MC 7GSPA 3A45A 3O5YA 4KENB 4LENA 1RN1A 3IWIA 1NB3I 1VDLA 2IMJA 2MR9A 3VP3A 4DV3M 4JF5A 3KSPA 3G6OA 4U0XA 3MS6A 3KX0X 3KXEC 3FKAA 2H5XA 1NYYA 4P6ZM 3EEHA 5HDSA 2BASA 3LXUX 2STDA 2NUTC 5FGOA 1GY6A 2DNAA 5IWAM 4QY6A 1RGLA 4KZAA 3ZNTA 1TDGA 2H5SA 5CGSA 2F5MA 3K7CA 1W5SA 1VQK3 2C5WB 1VG5A 5F3WA 4MH0E 3WHLA 3IX4A 4HM5B 4JV5M 1UI7A 4DXBA 1VEUA 2Y2OA 1FSYA 1LVNA 1NY0A 3Q82A 5IG3A 3CCS3 4H6JA 2HOHA 4M9XA 3F8HA 3J7Yd 2UGIA 1GA0A 1FUWA 3TWLA 3G4PA 5FQQA 3QP8A 4AQYM 4QY5A 3V98A 1SXJD 4KFFA 2Y2MA 4HM8B 4FCVA 5AQAA 5TBMA 1ZG4A 1N9JA 1UCIA 2KXGA 5J4EA 4LZJA 4D80A 3U6PA 3CCJ3 1M1K4 3Q8GA 1BNSA 2VQEM 5DF7A 4LFAM 4LJ7A 1KE3A 3IS2A 4GHLA 2L4VA 3FV7A 4PM8A 4HM2B 1VQ43 1W2ZA 4AKGA 3EQUA 1Y28A 3VMAA 4BBUA 1BVSA 2OWPA 1GABA 2HHHM 1VQ83 1MPLA 3OTOM 2L4FA 4R38A 1YVSA 1BNIA 1BRSA 4GSPA 3CCU3 4JI1M 5L8MA 4ITQA 2ZM2A 3B9PA 2LYXA 2OLUA 3AL0C 4GC9A 1BNJA 2FH0A 3NXJA 4CQHA 4NXNM 1O7HB 1N9EA 2EX6A 3SYUA 3T1QB 1EQKA 4F1IA 2QNJA 1WYCA 4Z6YA 2CKFB 2XQZA 1IV7A 4IUKA 3HX3A 1OQYA 5G4YA 2EKKA 4RZMA 5AVEA 1TH4A 1Z59A 2G3QA 1TTOA 3UJMA 3CAXA 3IWOA 3IECA 3LR5A 3L29A 4D2OA 3LI8A 5RNTA 3SLUA 1WE4A 5HOHA 4IIWA 4Z9QA 1LQMB 2JKFA 3DY5A 3G4S3 1B2UA 2J7NA 4FCMA 4KZ3A 1K3XA 2DRWA 3H4MA 2W56B 3FH1A 4NOOB 2D42A 4CJNA 4REZA 3FUUA 3DGLA 2E8IA 1W63Q 1KDWA 3NQZA 2ZQ9A 1OIPA 5HSQA 1R4GA 1W00A 1JNUA 3LR0A 1JBRA 4X62M 2N35A 4LZIA 2WADA 5FSRA 5J7EA 1BNGA 1LL5A 4FVMA 1K6RA 3OXAA 1TDHA 3CLOA 1JWPA 1W5ZA 2MF7A 4GLQA 2Q9MA 4ID4A 3BNCA 3K8ZA 3DH2A 5F1FA 5DYIA 1PZOA 4S2IA 1V92A 2LVPC 4OP8A 4TUWA 5DJUA 1NYMA 5L09A 4UAAA 3FKVA 1FR1A 5EVID 5A2QS 4LPZA 5EVEA 3PAGA 5EVHA 1ACFA 1RP5A 2HF6A 4QU3A 3IJEB 3PCSA 3MG2A 1I3IA 3VSKA 5HZHA 4HHDA 3D5GA 3AMOB 5IENA 4E3KA 5HX9A 2A49A 1GMQA 3A42A 3ICYA 3KOWE 2FNQA 4GH9A 2QJ5A 2W27A 2CFLA 1LHYA 1DVCA 4UA9A 4K90B 1WMNA 3L7HA 5E2GA 1PNEA 3K9PA 3X3ZA 4MMNA 4PM6A 3NOUC 2XR8B 1Y8GA 2CP8A 3LVWA 1U60A 2VGLS 3LYGA 2J8YA 3M7GA 1FQGA 3TWKA 3LGOA 3LCUA 3FUWA 1XFNA 5JPUA 1DGHA 1MZUA 1NXYA 4C6YA 5FLXS 1KDSA 3E46A 3V3SA 3DGYA 4L6V6 5KSCA 4AKZA 5IT9S 1ZV1A 3MJ5A 4BTWA 2A2LA 1DGFA 3QP6A 3T4OA 4MNRA 3GQ3A 1XNQM 3ZHHA 2WGIA 4JXWA 3VLFB 2UXDM 5AEUB 6STDA 3U61A 4KO8A 3UMMA 2P0XA 3T1HM 3TSGA 3K9OA 3BM6A 3GLIB 1SIIA 2P74A 4OOMA 3CGWA 2ZOIA 1E3UA 4RVAA 5EECA 3FTEA 4Q53A 3FTCA 1XX2A 4BIRA 1GHPA 1ZO2A 1UFZA 1LOYA 3SS3A 4B88A 4LY6A 1PFLA 4WP5A 3M2JA 3LIAA 4ME4A 2CEAA 1P0ZA 3T1YM 5LBRA 5C18A 5EOEA 3ITBA 3GZRA 1SKOB 2ZQ8A 3F14A 1FYSA 3W4OA 2WZJA 2XD1A 3IWQA 3S28A 1W7CA 4R1GA 1OIZA 3QK9A 1V74A 2LVQD 1LOVA 4X1LA 3K1JA 2WKIA 4XUXA 5A90A 4NHFA 3PR6A 1BANA 4EESA 4S2MA 2OOVC 1QUTA 4OQGA 5A92A 2VF8A 4J5GA 2Y2LA 3FF0A 4EQ1A 2XDMA 1Q40A 4X65M 3VDUA 2RFRA 1ZMWA 4QNMA 1GSVA 1VQ1A 2Y0TA 4NPBA 3IBRA 1YGWA 3X40A 2O0YA 2E2TA 3HY5A 2XSZD 4XT2A 3MHEA 3SASA 1IYPA 1IFQA 1TEMA 3VOLA 5LMNM 3J81S 2OLVA 1XKZA 2Z7JA 4X1MA 4RF0A 3RFWA 4XBOA 1I3FA 3FLJA 4Y0OA 4R6LA 2Y55A 2E8JA 3OV4A 3U60A 1B21A 3NECA 4LYLB 4NXFA 4Z1WA 1IVWA 1P97A 3SMSA 4S2NA 4MDZA 1K38A 2PD8A 3F1NB 3VKGA 3U97A 2R4JA 1FCOA 2WAEA 1FGMA 5TBMB 4RQ9A 1KSIA 1FGRA 2DKLA 4WP2A 1BRNL 2C5RA 1I0VA 5M19A 2W03A 4P6ZS 3LIEA 3E21A 1K4FA 3KFUG 1LSXA 1X1YA 2WKRA 2JKRI 2W3FA 3UL6A 2Y20A 3TW8A 1D0KA 1HNZM 4HYZA 5CTNA 4B3SM 4JI2M 2R44A 1Y4KA 1VHMA 2KCDA 3F1OA 2XF3A 3SC3A 4OPRA 2ZTCA 4R4SA 2CFGA 5I94A 1OMEA 1HZ1A 2L2DA 5C5KA 1RGHA 3VSYA 1VQP3 4JI0M 2PNCA 3AGDA 2MGWA 2DAGA 1SDNA 5EQLA 3NBBA 2F98A 2R62A 3SVAA 4I5QA 3CC73 4N3VA 4N6TA 1H8ZA 2ZQAA 4OK0A 3CHWP 3DTEA 3FYDA 4OQ0A 3UE1A 1YGEA 4LF5M 2CC3A 4UQIM 2ML5A 2VJWA 5TGNA 1K4EA 2WSEF 1YIJ3 2W1RA 3ZG5A 1W5DA 3C4PA 3G0KA 3LYXA 3UDIA 2KF4A 3PBQA 3GPUA 4LF6M 1LL9A 5GL9A 1IOUA 3BBZA 1SARA 1O7EA 3FGYA 5EE8A 4GL6A 2BHMA 2PU4A 4Y15A 2ZJ9A 2QQ8A 2VK3A 3KVWA 5EP3A 4WHAA 3MMHA 3HLFA 3GPPA 2WK0A 4O01A 1N77A 4KVHA 2HKJA 5G1LA 2VV6A 3G30A 3OPHA 4A5RA 1I4WA 1DP9A 3EJVA 4KG2A 2RNTA 2M7UA 1US1A 3HK4A 1VB6A 3CNXA 3N8SA 1SIHA 3ER7A 2OAQ1 4R70A 5GLDA 3UB5P 4EV4A 4RX3A 5FEFA 2K7SA 1LT0A 1K54C 2C9CA 4IBDA 1G68A 3I01M 5JBSA 1GD4A 2CFDA 5CGWA 2ZC3B 3MQ0A 5FAOA 1LNHA 1QAMA 1P9WA 2CFWA 2FFJA 1FCMA 4KQOA 3S22A 3PBSA 3OWSA 2EFUA 2FH5A 4B93A 3HU2A 1MGRA 2C4BA 2MC8A 1AXBA 1QQWA 1NSFA 5U47A 3T15A 3UE0A 3TQSA 1W6YA 2JHEA 2JZ1A 3C2WA 3U6EA 3C7UA 3E98A 2D02A 3DWKA 3NI9A 3T1SA 5CHJA 4IJEA 3BWLA 3B7CA 1KFVA 1YSPA 4WEKA 1ODVA 2M7OA 3LW5F 3VP0A 3V39A 4E3LA 1MY8A 2R45A 3F8XA 1IN6A 4MMYB 1BLHA 3NM7A 2QGUA 3K2NA 4G3KA 3M6BA 4AEQA 4RF1A 1S3SA 4DV6M 1QAFA 4U13A 1MX0A 3URPA 1MC0A 3CCL3 3FE3A 1JVJA 2B1XB 1M6KA 1NY5A 5CERA 2XROA 1GOVA 4R7GA 5DTKA 3RTYA 1XJ4A 5F68A 1I5QA 3B74A 4RNTA 1IU7A 2M5ZA 4E6XA 4KZ9A 2INWA 1JQJC 2GX5A 1ZS7A 3Q07A 2V1ZA 3V5MA 2P08A 3BQAA 1TDLA 2V9AA 3KP0E 1CEGA 4LJ8A 1YLPA 3UPOA 3B7ZA 3KOXE 1RNTA 4IJGA 4HY8A 1K41A 1QAQA 1OHOA 2O9CA 2WKEA 1GL7A 3RH8B 1SXJC 2AADA 2V20A 4GN2A 3QNBA 4I38A 4CLCB 3PYJA 5KO3A 2B18A 1RRHA 2GJ3A 3NHQA 2CW9A 4LSOA 1Q02A 4S2JA 5FQKA 4MM3B 3J7AS 1NV9A 1PM5A 1DJAA 4II7A 2O01F 4K1UA 3LR3A 5CGXA 3T8UA 1LSVA 3UNWA 2J3WA 3IHBA 4G3WA 4Y5FA 2ZL8A 3V67A 3Q8XA 2O9BA 2AAEA 3U61B 3D72A 4X25A 4GNUA 5K5BA 1K55C 2Z7AA 2J9OA 1YLAA 1YT4A 4G3VA 1DETA 4HH2A 2QKPA 1TJDA 3FPWA 3LIBA 2ZQ7A 1PJSA 3ZC7B 2HMMB 2Q9NA 3IX8A 4P6BA 1MWRA 4DN0A 3MSHA 5FI6A 1RKYA 2J7VA 3A3IA 4K08A 2CMNA 5CF2A 4K91A 1FUSA 1QMEA 5EVLA 4JI7M 1ASKA 3E9SA 4LJAA 3VK7A 2KZUA 2LQVA 3HX8A 3HOHA 4R9KA 4BL2A 5IEPA 4DJ3A 5AYRB 3DFZA 4DR3M 3TRCA 4WN5A 4J9AA 1TP6A 1NB5I 3N4IA 4FWGA 3NC8A 1KGEA 3OPLA 3SAWA 2BO9B 4L9GA 1T5YA 1N8R4 1Q40B 1N8QA 2CX0A 4H8RA 3LQRA 3EQQB 1M1XB 1H0MA 2GU3A 4IHQA 4N1XA 1EIJA 4XT2B 3H9WA 3KW6A 1OJGA 3VF1A 5BOHA 2H1RA 5EM1A 3T4KA 3BLZA 4ZRRA 4RNYA 1Q824 3UB6A 3AV0A 4LRYC 3BXWA 2IYJA 4CGYB 5DKLA 3U60B 4YFMA 4G4OA 3VP4A 1T6OA 1TS0A 1IN5A 3GLGB 2CV1A 1STFI 5FATA 1RN7A 5FDHA 3DUKA 3A0VA 3T1RA 2GZAA 1R6BX 3CMA3 1UUVB 4EU0A 3EN8A 2Y2JA 1GHIA 1STZA 5EPHA 1IFYA 1BUJA 1LI9A 4H61A 4EXRA 1NJ4A 9RNTA 4X68A 1EG9B 2ML6A 1T2HA 3LEZA 1FOFA 2WGOA 4XB5A 3UPNA 1BRHA 2DZLA 2OQ4A 4X55A 3CPOA 4GIPA 3MQQA 2LXEA 2H0YA 2W9PA 3BRMA 3AGOA 1AIPC 1IN4A 2KDKA 3SXXA 4I5SA 2RGOA 2ZA4A 3F1OB 4L16A 4PKYG 4BD0A 2KRKA 2WZXA 3BNEA 3IHAA 1YLZA 4HM0B 2OAP1 3CCQ3 4BENA 1TS8A 4MBFA 3D4FA 2MROB 2KA6B 3CTWB 5M18A 1XWIA 2OWHA 5FDSA 4L15A 3KIIA 4WFOA 1DP8A 2G5GX 4PDGA 1RLSA 4HBUA 3UMEA 1VDDA 4FTXA 1G41A 4IT7A 2JCHA 2XSOB 4FCTA 3VGNA 2HMOB 4N9KA 2CFKA 2UXCM 3DGOA 4HBTA 3GAXA 3D9YA 1RU3A 4K0KM 3G35A 5FQMA 3KSFA 4CLCE 1BRKA 4KG6A 4RBNA 2ERCA 1B27A 3S7PA 2J5YA 3GLFB 1VQ73 4AG6A 2J7OA 2J3TD 3HU3A 2DZOB 3EGXC 3SAUA 1T2IA 3ZQ5A 3AMOA 2IWDA 3N8BA 3WA3A 5KQ8A 1Y4OA 1OCVA 1CUKA 2Z6DA 1OJ5A 4UN2B 4UQIS 3ROBA 5TJJA 3W4QA 2G2WA 1TRQA 2B02A 1QALA 1L0EA 2I9WA 4QWOA 1L0DA 3UK6A 1Z6FA 4HQAA 3S7NA 3DZLA 4UA6A 2K31A 4JBFA 4PD2A 1AVKA 3L9KA 1MWSA 1FA3A 4WZ4A 3VFDA 2EX8A 5F82A 2CHCA 4GS9B 1OF5A 3T8NA 2H0IA 1ERMA 2DCFA 3VE3A 2AVXA 4QOZC 3SH7A 3FTFA 3IT9A 1UGIA 1VQ63 2RSXA 2YNMD 2QWSA 2K0MA 1W63M 4HJ3A 4JYAM 4G6ZA 3HCYA 4FD2A 4P87A 4HJLB 1JZDA 2MJ5B 3CUEC 4S2OA 5HAIA 1I2SA 1PJIA 3MKEA 3PYPA 2X4AA 1QAKA 3SEDA 1B2SA 2GBWB 2EA0A 4F2LA 4GW9A 3GLIA 4DF6A 1G59A 4JGOA 1PYYA 1WGNA 3FWLA 4GKKM 5GSPA 2HMJB 3BLSA 3FSDA 4XDVA 5IU1A 1C54A 4KUOA 5M1AA 3N54B 1IT8A 3SH9A 3KSXA 2W2CA 3HLCA 1IELA 2JZ0A 2CHGA 1T3BA 3BOSA 2EJSA 1SCWA 4Y3IA 1SKOA 3HU1A 2D7GA 1Q7HA 3GZXB 1FZUA 1LLBA 4EBNA 1T19A 4L9FA 1E94E 4E3OA 4P16A 1BULA 4YWZA 2DVWB 4S2KA 2JKTI 2OOVA 4DE3A 4MEZA 2KF3A 1TGUA 2OO9A 2W3EA 4KZ8A 5HD5A 4WF0A 2OQEC 2KRTA 2MH8A 2CV0A 5L10A 1D0MA 1O7NB 4R1KA 4HOIA 5FQJA 1I0XA 2LB5A 2WZZA 4UEYA 4BBTA 1OHPA 1TRPA 4FW9A 1HQCA 1TR8A 2BWBA 3NBLA 3DA1A 2X01A 3VSLA 4NEED 2P09A 3L0RA 5IG4A 3MHVC 3GECA 3AOGA 3IMAB 4IBCA 3FG1A 5LC6A 3IXGA 3MFXA 1HNXM 1PW8A 2VDBB 5IEOA 4NKPA 3ZVTA 1WMOA 1OAOC 2VKSA 3B33A 1K0KA 3UZUA 3F1NA 3LIFA 3CZDA 4HH3A 1TD5A 3RGRA 3U6MA 2DZNB 3SHFA 3EOIA 4EETB 3T50A 1NRFA 4HESA 3GQ5A 4KLNA 4HEFA 4WELA 4ETZA 2FE8A 4JRFA 2PT7A 3CCE3 3E4QA 1TUHA 2ZC7A 1Q9EA 4JN6A 2BJWA 1IBMM 2LVOC 3R8FA 1S723 3C7VA 3P98A 4H3UA 4NRVA 1MWUA 1N5PA 1XGJA 2XK1A 5ITUA 1K3WA 4JPMA 1LQGC 3DZDA 4NRWA 2Y2QA 2YFLB 4OQIA 1YIT3 3ITAA 5EFWA 2DAEA 2FOIC 3CF6E 1IEMA 4CLCD 1W8YA 4XM4A 5CLKA 3A3JA 1OGXA 1V34A 3QYEA 2R9XA 2GQFA 2I7PA 5DFYA 1HLUP 3BFCA 2HMLB 4B9OA 4EIWA 5GLAA 3CJMA 3UNLA 4WZ5A 5I5LA 5FQIA 1BNFA 3H7WB 4A3VB 1ESUA 3O3VA 2Z77A 1IQPA 3NBIA 1E3UD 1JKGB 3R4KA 3EC9A 5GLCA 2QEX3 3QYBA 4LMIA 2KZSA 4DUZM 1S6RA 2CWVA 3UE3A 2YFIB 3EX9A 1Z5AA 5DF9A 2J80A 2OV5A 3PXMA 2PRFA 3STDA 4YY3M 1K734 2ZC4B 4FWDA 5IT5A 1N9LA 3U4LP 4OOYA 4GEWA 1E25A 3LCEA 2RCXA 2VEAA 4WEJA 5GLBA 3VK8A 1ROAA 2WGQA 4MBHA 2P04A 3KKGA 1F8NA 2KAAA 2PYPA 2QP9X 4FMAA 3BFGA 1UWNX 2W3DA 5F5YA 2Y0QA 2XZUA 4CIZA 1STDA 3VOZA 5G2GA 4LLOB 1K54A 1RGEA 2K2NA 1SG9A 3QP4A 3CPW2 2DWLA 2OTL3 1GSWA 1MKIA 3D8LA 2WGWB 3T6PA 1WA9A 1CQAA 5CTMA 2I9VA 1ZHHB 3GRDA 1J09A 4CHTB 2DAKA 4LGMA 2EWWA 2ZAOA 2E2UA 2BTFP 4EUZA 4HZ9B 2R78A 1IQXA 1UI8A 4FUWA 4PMAA 3FYCA 3SHGB 1PRQA 3KE7A 3NDEA 2R6FA 3P01A 4M9ZA 2KRUA 2C11A 4GZBA 4AI6A 2WOFA 1MWTA 1YQSA 4DJ2A 3KSED 3SS4A 2VF7A 4DV0M 1T18A 2Y74A 3WS4A 1IYQA 4OP5A 3A76A 4NXBA 1K56A 4LRZE 1QMAA 3HGIA 4X2HA 2KXEA 3C30A 1W5TA 1ZC2A 2BLSA 2F5SA 1QDRA 1UCJA 1C1KA 4HM3B 4IUHA 5DYGA 1Q864 1PI4A 3UB8A 4CISA 2C9OA 1S1ZA 3G2ZA 1ISKA 3AOEC 3UGJA 2PDRA 3HREA 4ARZB 1JWZA 4DV7M 1ES5A 2CG0A 2IUKA 5ITQA 2ZC6B 4HL4A 1V33A 1YLWA 3LY3A 3DWZA 2JBFA 5IF6A 4HP9A 1DRMA 3WWXA 4O3VA 2V8CA 5A91A 1PJJA 1MN3A 5JI2E 2OCTA 4EV2A 1RGAA 4JI3M 4RNZA 5ITTA 2XR0A 3JPUA 5CEDA 4B08A 3CC23 3MFDA 4CLCA 1OF5B 3AHSA 5G1KA 5F6AA 4EYCA 3TL4X 1LV7A 2EWVA 3GV9A 1IVUA 2CWBA 4OW0A 1BSBA 2CH9A 3JYIA 5AQ7A 3MXSA 5HWWA 1TH3A 4KZ7A 3E4RA 4B7HA 1PYLA 3HIGA 1Q3BA 4JI5M 2BT3A 3HI7A 5HDCA 3HJ8A 2IY2A 5FTMA 3QNCA 4EEPA 2XLJA 1ALQA 2KF6A 1OJLA 1NO1A 4LRSA 3FCSB 3I563 2HCBA 3KZTA 4PM5A 1E3RA 3RGSA 1PW1A 1YJ93 1NLZA 3IXBA 2B3TA 2X8AA 3FUTA 1H8YA 3U6DA 4C3QA 1OTEA 2F5PA 3B3XA 1QJGA 3NDGA 1Y54A 1NRJA 1LL8A 4HEOA 1YLJA 1Q39A 1MOLA 1RHLA 1YVBI 3L28A 3FD9A 2L0WA 2UUCM 7RNTA 3MXQA 4IEDA 4PPRA 3PVSA 4F94A 3HHXA 1MKMA 2LNHC 3T4SA 3GRUA 4X66M 1V9YA 4M4XA 1KSFX 2HJEA 3F7XA 3M2KA 3C58A 1AY7A 4BB9A 1D1JA 3OCNA 3RDEA 4PT5A 4I4LA 5FSWA 4OLDA 5EEOA 5KIZA 2P05A 3JUMA 1A0KA 3LEQA 2KNZA 2R18A 2UU9M 3H82A 5HFOA 2W82A 1G96A 2W0QA 3A3DA 1RGKA 4HM1B 4WYYA 4UHUA 1OACA 1CH0A 1PY3A 3BEBA 4DUYM 4GHOA 5KPRA 1OUNA 1Z1SA 1GHMA 2HDSA 4BBVA 1SZVA 2HDRA 3X3XA 1KQS2 4X6TA 3VDPA 3R9XB 1K6SA 3KFQC 1M9GA 1IN7A 4HOHA 4AZFA 1ORYB 3FRHA 3GLGA 1Q42A 2VZWA 5HPIA 4KODA 1F5MA 3LCVB 2UWXA 2EO2A 1EROA 3U6QA 5F1GA 5KMWA 4AKYA 1GA9A 1YUBA 2LHCA 3AGEA 3GRRA 3LH4A 3KSHA 3NIAA 4QD4A 4QPRA 3ALAA 3JR5A 1IXSA 4S12A 1I94M 3VP2A 1H3QA 1QVRA 4GHAA 5EOOA 4OVZB 4HM7B 3QAUA 3MMPA 1G6AA 2Y2GA 2K54A 4PM9A 4E3MA 1OHSA 2Y2PA 1UWPX 3K0ZA 1DE3A 2R4IA 2VIIA 5EXXA 3WHKA 3G31A 4PAUA 4NSOB 3VOYA 4CCVA 6RNTA 1JNQA 4KG5A 3FUXA 1S5AA 3IXDA 4S2LA 2EX9A 4B3MM 1DMMA 1E97A 4LRXC 1W02A 3W8KA 1D06A 4FR9A 1DYUA 1B3SA 5BR8M 4N6MA 2QSFX 2WGVA 1I2WA 3OW22 4DKIA 5AIFA 1E9SA 1HT1E 1L2BA 2M1CA 3C5AA 3OWYA 1P3QQ 1Q814 3GRVA 1VQ93 4KT0F 3SW1A 2XLNA 3QP2A 2F56A 4QWTA 5D81A 2LB9A 2YFQA 4KZ6A 2D7EA 5HARA 1KE4A 1JTGA 1JBSA 5HAQA 4LCBA 5AQBA 2L7HA 5FTNA 2H0HA 5HAPA 3HJQA 5EQTA 3PBNA 1S67L 2HPBA 2JN7A 4KFDA 1CI9A 2V1UA 2DWZB 3K3CA 1N78A 2LWXA 4HIAA 1O7GB 4IBGA 3IPTA 1OPXA 2K47A 1WQLB 4LV2A 3HJKA 2YKFA 1VQN3 3SMPA 1VQM3 4IBEA 4DXCA 3UMDA 1XMQM 1RGCA 1T1AA 5HD3A 5ITRA 4BTXA 3GLFA 5E2EA 3C3EA 4CJ6A 5A0OB 4N1HA 1FGQA 1WTHA 3U6CA 1UUWB 1I8VA 2WOHA 2QA43 1TVFA 2EXAA 1QANA 3NY4A 4GB5A 1HJPA 1V57A 4L0LA 1P9RA 3BFDA 2JP7A 4ZJ2A 4S2PA 3GLIE 1NWZA 1L1ZA 3PHYA 1J9MA 1WXQA 3MWZA 3C38A 3ZNYA 1PU4A 1XXMA 5DTTA 1GVNA 3EQVA 3TWMA 3F92A 1UW1A 4EQIA 1VEGA 3JUQA 2YKHA 3T4JA 2HZ5A
chains in the Genus database with same CATH topology
5BVBA 1O7PB 5IW9A 4G4QA 3W4PA 1L1TA 2Z76A 4LG2A 4N6OB 5STDA 1IQYA 1YM1A 1YLYA 1RGYA 1KGFA 4AG5A 4K0WA 2R46A 3SOAA 2G8LA 3KDSE 2EUCA 3MKFA 3OZHA 1AV4A 3GQ4A 3WOFB 3Q7VA 3F7SA 1Q2QA 3IF6C 3LO7A 4LCMA 4P0MA 3IG8A 1G8PA 5DVAA 2CIUA 3PZWA 4JI8M 3V99A 3CXC2 3BECA 2EFXA 4M9SA 3N6IA 1A2VA 1SXJB 4HBRA 2QENA 3DOAA 4IBRA 2INXA 1PZPA 3W0FA 5LMUM 2Y4AA 3CG5A 3A3EA 3MYTA 1ONGA 4KQRA 3D9RA 1CYVA 1CEFA 4BTYA 1BLPA 4FH2A 4DV2M 1XC8A 5FAPA 2OQEA 4K0XA 3SX1A 4HZBB 1N36M 1J2BA 1DGBA 4N6NB 3TDGA 4IBJA 4MGKE 5EXSA 4STDA 2JE5A 1SDEA 1BLCA 1XXHB 4DV1M 1GS3A 3Q81A 4DDSA 1PFPA 4OU7A 1XA7A 1R4CA 2FFYA 4B3TM 3WS5A 2FFFB 1EKMA 4MGYE 2Z4SA 3IXHA 3CCM3 4PM7A 2DHRA 1J5EM 1DY6A 2IWCA 2QZ6A 1SKFA 1PWCA 2L6OA 5GHXA 3X41A 1CI8A 4U3TA 1W2B2 1R2ZA 1N9BA 3GSGA 1NO3A 2W6JH 1JR3A 2P9VB 3RGAA 3A3FA 3MZDA 2HMNB 4DE0A 2ZM8A 5F83A 2AHMA 1PWGA 3CMZA 1IYOA 3BFEA 3J80S 4BLCA 3OC2A 3LTAA 3Q1CA 2QBYB 5GHZA 2Y59A 5JYPA 5IZ7D 2CK3H 3FG4A 4N9LA 1ERQA 1K25A 2YFJB 1KD14 5CECA 1L2CA 2V6ZM 3SBJA 4FMDA 5IREB 2GEYA 4XBTA 3O8YA 4GD6A 4L4UA 2D7HA 4LJ6A 8CHOA 4LJ5A 3U1WA 1GY5A 1LOXA 1IYSA 3JUOA 4L8PA 3VFFA 1JKGA 1IXSB 4KZBA 2HDQA 2YQZA 5EXTA 4OKPA 1IY2A 3HLEA 1ULJB 5EVIC 3AJIB 3Q90A 3FZWA 3WRZA 3HVFA 5KPTA 2WO0A 3U5ZB 3S4XA 3U6OA 3M0EA 4PEJA 3MPHA 1NJFA 4WYKB 1EI5A 1ES3A 5KP1A 5FA7A 2KW0A 3VFHA 4EWFA 1L2DA 3I0YA 4P85A 2WGWA 2C99A 3OCLA 3Q1FA 3HLBA 1W8QA 2GU1A 4M0WA 1YLTA 2Z4RA 1Z5BA 5I97A 4DE1A 1Q7Y4 3LTBA 5CRFA 2O3OA 2Z6BA 3EF8A 3UDFA 1BT5A 4MMZB 5IG0A 3RXXA 1JWVA 1KC84 3S67A 1D6YA 4EBGA 4R3JA 3HKPA 3S29A 1EE8A 4Y0UA 2QIYA 3NHXA 5AIHA 3BNBA 1RRLA 2ZDJA 1ZG6A 2J9PA 3AGFA 4GD8A 5BPVA 1TFOA 4IPBA 5LC7A 4WBGA 3V3RA 3AOEA 1DGGA 1MNLA 4LCLA 4LGYA 1W79A 2P5TA 3FUVA 4R3BA 1ULIB 4FMBA 5G18A 1NJGA 1N4OA 2BJVA 4GC5A 5KP3A 1H6UA 1YJW3 5AEWB 1GD3A 1BTLA 5EP2A 1IVXA 1NWWA 3GZYB 3QHYA 4R9LA 2QPAA 4TX4A 3I4VA 1JB4A 3K5TA 3BYDA 1BLSA 1NHGC 5GKNA 2Y91A 1FR6A 4ZJ1A 2C6WB 2RGHA 2F5QA 2A15A 3HLDA 4AW4A 2ZMAA 3DM8A 2E5LM 5TGFA 1OFHA 4O2HA 4IJFA 1HD8A 4GDBA 2G2UA 4KZ5A 1S0WA 3C4OA 3Q7VB 1ROVA 3SOIA 5E2HA 3LOYA 3J2PB 2F86B 1G4AE 3SYKA 4FCJA 2L7IA 1E4DA 3K92A 5EP4A 3G713 1MU5A 2CC1A 4OOLA 3IF5A 1C3BA 4WMCA 1L0GA 3RE8A 2R65A 5CHUA 4LV1A 1TDZA 3U6SA 2HMKB 4OQHA 3OX9A 1GYBA 4K61A 3UO9A 1DO2A 4ZDXA 1D2NA 1IQ8A 3LY4A 2YX9A 4B7GA 2IUJA 1HNWM 4FD8A 2XEPA 3CCR3 2BNGA 3JUNA 1NHWC 1IBKM 5AIGA 3HHYA 2HL7A 1YMXA 3GLHA 1WYBA 4XXRA 3RJUA 1JN5B 3EBTA 5L2FA 3G8ZA 4JXSA 4BBAA 2GBXB 1K56D 2HP6A 1PI5A 3O88A 2PZVA 4JKTA 1A90A 5DRVA 5CEBA 4I8OA 5ITXA 1IK3A 2C96A 3H3HA 7STDA 3CC43 1BSGA 2GEXA 4QHSA 2DNSA 7CATA 1QZMA 3JVCA 3N8RA 5HW3A 4CDLA 5C1BA 3VKHA 4ZJ3A 4ORLA 4DR1M 2ZLYA 4OVZA 1W6GA 3KSJA 2ZAMA 3N8LA 5FAQA 2CWTA 4R80A 3DW0A 1KGGA 1IV9A 3PGBA 4LRTA 2XZFA 2UUBM 1W01A 3I7JA 3HIIA 3NBJA 5E26A 2FNAA 3WMDA 5D3OA 1IXRC 3GRYA 4NETA 5GHYA 4GKUA 4IBKA 2WYXA 1CQSA 1VQO3 5AYSC 2QCUA 4KZ4A 2B24B 4LJ4A 2FGTA 5BXQA 1OH0A 2HP9A 3E2LA 3L27A 4D82A 1DJCA 4M3KA 3K63A 4U0TA 2XFTA 4O02B 3ZG9B 1RCJA 3HBRA 3IH8A 1DVDA 3PBTA 5TR7A 3UN7A 3NV0A 3G34A 3G16A 2CV2A 4LJ9A 4PCZA 3N7WA 1FSWA 2W9QA 3M8CA 3WS1A 3ILKA 2X49A 1VQ53 2Z3XA 2H10A 1JB5A 3EN1B 4KZ1A 3SOYA 4LV0A 2CHQA 5E2FA 8CATA 4JXJA 4IBFA 3EE1A 2A3UA 4Y0TA 3PAEA 3TE6A 3DGMA 4B4XA 1OGZA 4NL4H 5D82A 3MZEA 1RGZA 4C75A 1U5OA 3GVBA 1XP4A 1XHBA 3T0UA 3X3YA 2DWMA 1N34M 1XMOM 1E3VA 4FSFA 1K57C 3RXWA 4L8RC 1L5GB 3GPXA 4UA7A 3LMLA 2ZBKB 5ELJA 4L78A 3PTEA 3J7BA 3F40A 1K28A 4FCZA 1XA1A 3SS5A 1ZX2A 2BMOB 1GCEA 3HUOA 2HP5A 3NCKA 1QAOA 2QMIA 4LF9M 2SBLA 3PS8A 4I4KA 5FTLA 2ZQDA 1WMPA 5TFQA 1T3TA 4JXVA 4ZAMA 1NVMA 3G2YA 3IF6A 3MBZA 4GDNA 2ZM0A 4WW0A 1M904 4WM9A 1Q3CA 1BUEA 4YHHM 3BFFA 4DR7M 4JF6A 2V2FF 3EIEA 2CWUA 5FQ9A 3IQAA 3H51A 3J27B 1SXJA 4FMCA 4GB7A 4DV4M 4EBLA 3D8BA 3I4YA 4EC6A 3MKIA 4NK3A 1HVBA 4EV5A 4DV5M 3UPPA 1KVMA 1E32A 4FCFA 3G6E3 2XH9A 3PCRA 2Y2KA 1FCNA 1OFIA 5CXWA 2CE7A 4CPKA 1GKIA 1HU9A 1O07A 1NNUC 1MXOA 4X69A 1K55A 3SAVA 4BQMA 2Y2HA 4AKHA 1XXHA 2QZ4A 3HWSA 1IN8A 4FCWA 3HHZA 3OPRA 1N33M 4N92A 3UJNA 3TG9A 4JF8A 1YMSA 2O5RA 1CYUA 1L8QA 4IIAA 3THGA 1NJI4 2EX2A 2D1WA 1R2YA 4L8OA 3WODG 3OWUA 1EWZA 2PBYA 3Q2PA 4XBXA 5KPZA 3HUMA 3SYLA 4QHCA 3LQQA 3LT9A 2P9VA 1HQYE 1YSYA 3NM2A 3VP1A 2A5YB 4G4RA 1O7WB 3UL5A 3ZCZA 4MLLA 4JLFA 3UDXA 4E3NA 3UB1A 4D81A 2QBYA 1G3IA 3PNVA 1A2KA 1GL6A 3NQYA 2ZANA 4PDIA 3GLHB 2GXFA 2KEBA 1IM2A 1U8CB 4E3JA 1VZZA 2XD5A 3UY6A 2UXBM 4HVNA 3ZCBB 1KWIA 1PIOA 3KP1E 2B5RA 5CHMA 3WS0A 5E6JA 1C7HA 4N6UA 1VQL3 3E2KA 4OPZA 2JDIH 3KS4A 3EB8A 1N75A 3ZH9B 2P38A 3WDGB 3QRDA 1CK3A 5AIIA 3ZG8B 3BLMA 5KQDA 1ES4A 2YR0A 1HZOA 3FZCA 4XBYA 1YE9A 2F5OA 4DR6M 5EVIA 2ZM6M 5E43A 4R4RA 1QYRA 4NSRA 4LV3A 3ZG7B 3PNYA 4WURA 1EA2A 4DE2A 5ELUA 3U5ZA 1QMFA 1LI0A 4WYKA 1WNHA 4LF4M 3I51A 5FI7A 5ITYA 5KZHA 3JR4A 3MG1A 3SH8A 1NDOB 5DNYA 2F4VM 1ONHA 1HKXA 4XDWA 3LTDA 1KE0A 5HL1A 3D3LA 4E3IA 1D6UA 3NV0B 3HLWA 4M0DA 1HT2E 4BLMA 4KHPM 4X56A 4BD1A 3F9SA 4LGQA 2XGNA 3FG3A 4ZBEA 3ZVWA 1Z5CA 3NWLA 3X42A 4MBKA 1JR3D 1ESIA 1JRQA 3PXGA 1VM1A 1KVLA 1R7RA 1NZUA 4O7DA 3T38A 5FTKA 2JQ5A 1NZOA 3OPPA 4GOGA 1TH2A 1N32M 2OTJ3 1NU3A 2XGLA 4NREA 5D83A 4OONA 1SPUA 2VQFM 5FI2A 3WS2A 2NQ8C 1LXEA 5IG5A 3L26A 3CD63 3DTMA 3LMMA 3FYZA 3RGPA 4GKJM 4OLGA 1IY0A 1HR0M 5JI3E 1IXZA 2RGQA 2XSZA 3CF2A 4LF8M 4HLQA 5EJCA 3IG5A 3WOEB 4DR5M 4E6WA 3MZFA 3IF6B 1A67A 1SHVA 1HTZA 3JUPA 2V1LA 2JC7A 2Q07A 1X37A 3CF0A 4RX2A 1J7KA 5H37D 3HHWA 2FXTA 2LH0A 3MSOA 1DMNA 2JA2A 4JI6M 1Q2PA 3IH9A 3V50A 3N9HA 3GR2A 4R3DA 1GLNA 3PBRA 1BUQA 4DRTA 2HDUA 5ITXE 3Q7ZA 1MBLA 3AFHA 3BNDA 4G4NA 1XNRM 4J8TA 4LF7M 2RKOA 3NUVA 3FKWA 1IY1A 3KOZE 3SARA 4Y7PA 4LEHA 3LTCA 1K8A4 2Y21A 4QNRA 1D6ZA 1SJWA 1L2SA 1W7FA 1DGHB 2BG1A 3DMCA 3TPZA 1FGOA 1XPBA 3GRJA 5FTJA 3I553 3GO8A 2VGJA 3KN4A 3DXOA 1XGIA 1JN5A 3MXRA 3ZFZA 3CCV3 4MJDA 4L7KA 4XGIA 3GTCA 3ISGA 1CEWI 3BB9A 3A46A 1DJBA 2UX0A 5CXOA 3KOYE 4LFCM 3B8LA 4FWHA 4LFBM 2X71A 2IWBA 2I7NA 2I72A 4QB8A 3W0LB 1IVVA 3AKZA 3A98B 5DF8A 3HJSA 4DR2M 4ZTKA 2ZD8A 3S5CA 4QOSA 5KP4A 3SATA 1K82A 2VGKA 5EXPA 2Z2LB 3HZPA 1E9RA 2GDNA 4NXMM 3O87A 3EIHA 2C10A 2EXBA 2Y2NA 3MG3A 4OUQA 3GZBA 2WUQA 4DR4M 3NBRA 1AVLA 2WAFA 4MB7A 2P0MA 4X53A 1ZQ9A 1W4NA 4GMQA 3FTDA 3L2AA 4N6V0 3GPYA 3MK6A 2BNKA 1SQWA 3U6LA 4IBXA 5EUAA 4ZPXA 2DWNA 5HGRA 3JAMS 3S27A 1DO0A 4B7FA 3PBOA 2Q2EB 1YJN3 4MEIA 3LVVA 4GITA 4QHTA 3CNMA 1YI23 4OPQA 1IT7A 1UM8A 4W5WA 4LZZA 4IVKA 2Z2MB 1AR0A 4MGIE 4R0QA 1RJOA 5EVIB 2CUZA 4FH4A 1FNNA 4S2NC 4EBPA 4MGHA 3GQZA 2WKHA 3E99A 1JJ22 2PU2A 5IERA 4RNAA 5CF1A 4WMCD 2XFSA 4BJPA 2CG1A 4B3RM 1W6CA 4KFEA 1IKIA 3M6AA 2R9WA 2BMRB 3O86A 2W04A 2CHVA 2F99A 1K57A 3TOIA 1NNJA 5AI1A 1IBLM 1FGTA 1VQQA 5EP1A 1JV2B 3B4OA 3L25A 1TFKA 1ZKJA 4BL3A 3SFZA 2W56A 2RL3A 1L0FA 2RCDA 3WA2X 1ES2A 1SXJE 2C98A 4R4KA 3B4PA 1BZAA 5CK6A 4K1VA 4OVMA 3HUNA 1H5XA 4MGZE 3GP1A 2ZC5B 4N6LA 5A93A 2Y2IA 4OVDA 3PFIA 2CFOA 4RYEA 3HL9A 3P09A 2H0TA 1OPYA 2Y73A 5DREA 3EBYA 2IA7A 4HM6B 4JXGA 1JB2A 2O9UX 4Q8IA 4RA7A 3ZDJA 5DTSA 4HKVB 4QJGA 3ECFA 4YINA 5J8XA 4AKIA 3FF2A 4WWUC 1TIJA 2XRXB 1KYIA 2QPNA 4GRIA 3G32A 5JPPA 4IBBA 1QVF2 1PWDA 5FASA 2F5NA 4IVIA 4O8SA 4JI4M 5FW5A 4OX9M 1ZAEA 1M40A 3GWRA 2L09A 3DGNA 4X2OA 4R23A 3HLGA 2E2VA 3K2LA 4G1MB 2UUAM 2DXIA 4XUZA 1JTDA 1IKGA 3QWLA 2OSUA 1NY6A 1YHQ3 1GY7A 1O7MB 4DDYA 2BMQB 2X02A 4OPYA 4MMXB 2OPFA 3LZAA 3FKEA 1QVG2 2M60A 4I81A 4HM4B 1DMQA 1Z6TA 5JYOA 1FJGM 3WRTA 3CME3 5IHVA 5AQ9A 3KS8A 2V1CA 2XSHB 1TU5A 4JF4A 3S1YA 4Z8XA 5KSHA 4ZM8A 2R4EA 3LT8A 1IDPA 4X64M 3ZG0A 4KQQA 2ZQCA 1K9M4 3M6HA 3CU3A 3V92A 3EHCA 3NX0A 4OH0A 4B4ZA 1N5HA 4IBIA 3GMWA 3K9MC 3A45A 4LENA 4KENB 3IWIA 1NB3I 2IMJA 3VP3A 4DV3M 4JF5A 3KSPA 4U0XA 3KXEC 3FKAA 1NYYA 3LXUX 2STDA 5FGOA 1GY6A 5IWAM 4QY6A 3ZNTA 4KZAA 1TDGA 2H5SA 5CGSA 3K7CA 1W5SA 1VQK3 2C5WB 5F3WA 4MH0E 3WHLA 4HM5B 4JV5M 1UI7A 4DXBA 2Y2OA 1FSYA 1LVNA 1NY0A 3Q82A 5IG3A 3CCS3 4M9XA 3F8HA 3J7Yd 1GA0A 1FUWA 3TWLA 3G4PA 5FQQA 4AQYM 4QY5A 3V98A 1SXJD 4KFFA 2Y2MA 4HM8B 4FCVA 5AQAA 1ZG4A 1N9JA 2KXGA 4LZJA 4D80A 3U6PA 3CCJ3 1M1K4 2VQEM 5DF7A 4LFAM 4LJ7A 1KE3A 4GHLA 2L4VA 3FV7A 4PM8A 4HM2B 1VQ43 1W2ZA 4AKGA 3EQUA 3VMAA 2OWPA 2HHHM 1VQ83 1MPLA 3OTOM 3CCU3 4JI1M 4ITQA 2ZM2A 3B9PA 2LYXA 2OLUA 3AL0C 4GC9A 3NXJA 4NXNM 1O7HB 1N9EA 2EX6A 1EQKA 1WYCA 4Z6YA 2CKFB 2XQZA 1IV7A 4RZMA 1TH4A 1Z59A 3UJMA 3IWOA 3L29A 4D2OA 3SLUA 1WE4A 4IIWA 4Z9QA 3DY5A 3G4S3 2J7NA 4FCMA 4KZ3A 1K3XA 2DRWA 3H4MA 2W56B 3FH1A 4NOOB 2D42A 4CJNA 4REZA 3FUUA 3DGLA 2E8IA 1KDWA 3NQZA 2ZQ9A 1W00A 4X62M 4LZIA 2WADA 5FSRA 1LL5A 4FVMA 1K6RA 3OXAA 1TDHA 1JWPA 1W5ZA 2MF7A 2Q9MA 4ID4A 3BNCA 3K8ZA 5F1FA 5DYIA 1PZOA 4S2IA 4OP8A 4TUWA 1NYMA 4UAAA 3FKVA 1FR1A 5EVID 5A2QS 3PAGA 5EVHA 1RP5A 4QU3A 3IJEB 3PCSA 3MG2A 3VSKA 3AMOB 5IENA 4E3KA 5HX9A 2A49A 3A42A 3KOWE 2FNQA 4GH9A 2CFLA 1LHYA 1DVCA 4UA9A 4K90B 1WMNA 5E2GA 4PM6A 3X3ZA 2XR8B 1U60A 3LVWA 3LYGA 2J8YA 3M7GA 1FQGA 3TWKA 3FUWA 4C6YA 5JPUA 1DGHA 1NXYA 5FLXS 1KDSA 3V3SA 5KSCA 4AKZA 5IT9S 3MJ5A 4BTWA 1DGFA 4MNRA 3GQ3A 1XNQM 3ZHHA 2WGIA 4JXWA 3VLFB 2UXDM 5AEUB 6STDA 3U61A 4KO8A 3UMMA 2P0XA 3T1HM 3TSGA 3BM6A 3GLIB 1SIIA 2P74A 4OOMA 5EECA 1E3UA 4RVAA 3FTEA 4Q53A 3FTCA 1XX2A 1GHPA 1ZO2A 4B88A 3SS3A 4LY6A 4WP5A 3M2JA 2CEAA 3T1YM 5C18A 5EOEA 3ITBA 3GZRA 2ZQ8A 3F14A 3W4OA 2XD1A 3IWQA 3S28A 1W7CA 4R1GA 3QK9A 1V74A 3K1JA 2WKIA 4XUXA 5A90A 4NHFA 4S2MA 2OOVC 4OQGA 5A92A 2Y2LA 3FF0A 2XDMA 1Q40A 4X65M 3VDUA 2RFRA 4QNMA 2Y0TA 3X40A 2E2TA 2XSZD 3MHEA 3SASA 1IYPA 1TEMA 5LMNM 3J81S 2OLVA 1XKZA 2Z7JA 4RF0A 3RFWA 4XBOA 3FLJA 4Y0OA 2Y55A 3OV4A 3U60A 1IVWA 4S2NA 3SMSA 1K38A 3VKGA 3U97A 2R4JA 1FCOA 2WAEA 1FGMA 1KSIA 1FGRA 2C5RA 5M19A 2W03A 1K4FA 3KFUG 3UL6A 2Y20A 1HNZM 4HYZA 5CTNA 4B3SM 4JI2M 1Y4KA 2KCDA 4OPRA 2XF3A 3SC3A 4R4SA 2CFGA 5I94A 1OMEA 3VSYA 1VQP3 4JI0M 2PNCA 3AGDA 1SDNA 5EQLA 3NBBA 2F98A 2R62A 3SVAA 3CC73 4N3VA 4N6TA 1H8ZA 2ZQAA 4OK0A 4OQ0A 4WZ5C 3FYDA 3UE1A 1YGEA 4LF5M 2CC3A 2ML5A 5TGNA 1K4EA 1YIJ3 3ZG5A 1W5DA 3C4PA 3G0KA 3UDIA 3PBQA 3GPUA 4LF6M 1LL9A 5GL9A 1O7EA 3FGYA 5EE8A 4GL6A 2BHMA 2PU4A 2ZJ9A 3KVWA 5EP3A 4WHAA 3HLFA 3GPPA 2WK0A 1N77A 4KVHA 2HKJA 3G30A 4A5RA 3OPHA 1I4WA 4KG2A 3EJVA 1US1A 3HK4A 3N8SA 3CNXA 5GLDA 1SIHA 3ER7A 4EV4A 4RX3A 1K54C 2C9CA 4IBDA 1G68A 5JBSA 1GD4A 2CFDA 5CGWA 2ZC3B 5FAOA 1LNHA 1QAMA 2CFWA 2FFJA 1FCMA 4KQOA 3S22A 3PBSA 3OWSA 2EFUA 3HU2A 2MC8A 1AXBA 1QQWA 1NSFA 5U47A 3T15A 3UE0A 3TQSA 1W6YA 3C7UA 3NI9A 4OQIA 3U6EA 3DWKA 5CHJA 4IJEA 3B7CA 1KFVA 4WEKA 2M7OA 3VP0A 3V39A 4E3LA 1MY8A 2R45A 3F8XA 1IN6A 4MMYB 1BLHA 3NM7A 2QGUA 3M6BA 4AEQA 4RF1A 1S3SA 4DV6M 1QAFA 4U13A 1MX0A 5CERA 3CCL3 1JVJA 2B1XB 1M6KA 1NY5A 4R7GA 5DTKA 1I5QA 1IU7A 2M5ZA 4E6XA 4KZ9A 1JQJC 3Q07A 2V1ZA 3V5MA 1TDLA 3KP0E 1CEGA 4LJ8A 1YLPA 3UPOA 3KOXE 1K41A 1QAQA 1OHOA 2WKEA 1GL7A 1SXJC 2V20A 4GN2A 3QNBA 3PYJA 5KO3A 1RRHA 2CW9A 4LSOA 5FQKA 4S2JA 4MM3B 3J7AS 1PM5A 1DJAA 4II7A 4K1UA 5CGXA 3T8UA 3UNWA 3IHBA 2ZL8A 3Q8XA 3U61B 4GNUA 1K55C 2Z7AA 2J9OA 1YT4A 2ZQ7A 2HMMB 3ZC7B 2Q9NA 4P6BA 1MWRA 5FI6A 1RKYA 2J7VA 3A3IA 5CF2A 4K91A 1QMEA 5EVLA 4JI7M 1ASKA 3E9SA 4LJAA 3VK7A 2KZUA 2LQVA 3HX8A 4R9KA 5IEPA 3ZGAB 4BL2A 5AYRB 3DFZA 4DR3M 4J9AA 1TP6A 1NB5I 3N4IA 4FWGA 3NC8A 1KGEA 3OPLA 3SAWA 2BO9B 1T5YA 1N8R4 1Q40B 1N8QA 4H8RA 3LQRA 3EQQB 1M1XB 2GU3A 4N1XA 3KW6A 3VF1A 5BOHA 2H1RA 3BLZA 4RNYA 1Q824 3AV0A 4CGYB 3U60B 4YFMA 4G4OA 3VP4A 1IN5A 3GLGB 2CV1A 1STFI 5FATA 1RN7A 5FDHA 3DUKA 1R6BX 3CMA3 1UUVB 3EN8A 2Y2JA 1GHIA 5EPHA 1LI9A 4H61A 4EXRA 1NJ4A 4X68A 1EG9B 2ML6A 3LEZA 1FOFA 2WGOA 4XB5A 3UPNA 2OQ4A 4X55A 3CPOA 4GIPA 2LXEA 2H0YA 2W9PA 3BRMA 1IN4A 3SXXA 4I5SA 2RGOA 4L16A 4BD0A 2KRKA 2WZXA 3BNEA 3IHAA 1YLZA 4HM0B 3CCQ3 4BENA 4MBFA 3D4FA 2KA6B 3CTWB 5M18A 1XWIA 4L15A 3KIIA 4WFOA 2G5GX 4PDGA 4HBUA 1VDDA 1G41A 4IT7A 2JCHA 2XSOB