2XF3A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
423
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSGEDVAARFIPTFAAAGNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 141
structure length 423
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xf3A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xf3A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xf3A02
3CJMA 2XD5A 3PAEA 2XR0A 1I5QA 1HTZA 3IXGA 1PI5A 4OPQA 4RYEA 3GQZA 4BENA 2Y2JA 3UPPA 3OC2A 4BL2A 4WZ5C 3HVFA 5A90A 2RL3A 3AGEA 3ZG8B 1E25A 2I72A 1ES4A 3SS4A 4LV2A 3VP2A 3IH8A 2WGVA 1ZKJA 5AQAA 3TG9A 4R0QA 3TSGA 5L2FA 4QB8A 1YM1A 4KG6A 2PU2A 4R4RA 1PW1A 2OV5A 4KG2A 4R4SA 3WS4A 2XFSA 2ZC7A 2HP9A 2Y2HA 4KZ9A 3O88A 1BLSA 2Z2MB 1KVMA 4PPRA 3NDGA 5JYOA 4RVAA 4XUZA 4PMAA 1E4DA 3UNWA 3WS1A 4Y0TA 3G32A 3UE0A 3HLWA 4JF4A 3N8LA 5FSRA 4GZBA 1K25A 3ZDJA 1M40A 1K55A 1LL9A 1RP5A 3WRTA 2V1ZA 3IH9A 4U3TA 1BZAA 1NRFA 4ZJ1A 5HAPA 5CECA 1PZOA 1YMXA 2BG1A 1GA0A 4LCLA 3N4IA 4PM6A 4GD8A 1IYPA 3CG5A 1HVBA 1IYQA 4ZJ2A 5A92A 2Q9NA 4DRTA 2EXAA 5EVIC 1YLTA 1YLWA 4KG5A 3LY4A 4K0XA 1L0GA 3SS5A 4EBNA 1XXMA 2V20A 2XLNA 4Y0OA 1ONHA 2EX2A 3MFDA 3ZG5A 1Z6FA 4B4XA 3A3IA 4ID4A 5CRFA 4OQIA 3GTCA 3AGDA 4GDBA 2WKHA 3EQVA 3VFFA 1SKFA 5FI6A 1S0WA 3C5AA 4P6BA 4UA9A 4M3KA 3MKFA 3WRZA 1U60A 3VP4A 1ES2A 3UY6A 2Z2LB 5BOHA 2JE5A 5HX9A 4B4ZA 1H8ZA 2FFYA 3MZDA 3V5MA 3ZCZA 3FZCA 4XXRA 3IF6C 1EROA 4CJNA 1XA1A 1EI5A 1DY6A 3G30A 1K6SA 4OONA 3MBZA 5FI7A 4WM9A 1JTGA 1PIOA 3GMWA 5DTKA 1W7FA 1IKIA 3LO7A 5DF7A 1ALQA 2Q9MA 4OPYA 3RJUA 4OQHA 4OQGA 2WK0A 3IHAA 5AQBA 4NK3A 4Y7PA 3UDXA 5HAQA 5E2FA 4EWFA 4DKIA 1KE0A 1MBLA 2Y2KA 3PBTA 4P87A 4DE1A 5FQKA 5FATA 4JLFA 4WZ5A 4FH2A 1FOFA 2DNSA 4FH4A 4JBFA 2HDRA 3G2ZA 4C6YA 3FYZA 2XDMA 3IF6B 5F1FA 4N92A 1L0EA 4E3JA 3DWZA 2E8IA 3G35A 5CXWA 4E6WA 4MBHA 1BTLA 4ZTKA 1YLZA 3IF5A 2XGNA 3SOIA 2HDUA 4N1XA 3Q81A 1WYCA 3HLGA 5GHYA 3PBRA 1H5XA 1XX2A 3V50A 3ZHHA 3MXRA 3HBRA 2A3UA 4GD6A 4ZJ3A 3E2LA 2Y2OA 4UA7A 2RCXA 1FQGA 1O7EA 4OOMA 3JYIA 1MKIA 1MXOA 2P9VB 4S2LA 2HP5A 5DF9A 4DE3A 3UDFA 1LL5A 3G2YA 3WWXA 1I2WA 1BULA 3FKVA 4KZ3A 4ZDXA 1IYSA 3Q7VA 3W4PA 1TDGA 3C7VA 5HARA 3UDIA 3SH8A 2J7VA 5KSCA 3GR2A 2HP6A 3HLBA 2DRWA 1NYYA 4KZAA 2WADA 1K38A 1E3UD 3BECA 4S2NC 2WZZA 3BFGA 2ZM8A 3ZG7B 1W8YA 4U0TA 1NZOA 4H8RA 4WELA 1PI4A 4WBGA 1LI9A 5DF8A 1IELA 5EVIA 1W5DA 3PBOA 5AQ9A 3AGFA 5FA7A 3CMZA 4B88A 1SHVA 5CGSA 1K57A 5CEBA 5FQ9A 2VGJA 2H5SA 2XF3A 1JWPA 3C7UA 1W79A 2J8YA 3PBNA 1HZOA 4BL3A 1GCEA 3NC8A 4R3BA 2H0TA 2WKEA 4HESA 4S2MA 2XK1A 1K4EA 2ZC6B 3ZNTA 2Y2NA 1GHIA 1K4FA 4S2JA 1ERMA 1Q2QA 2CC1A 5GLDA 5FAOA 1SDEA 5CHJA 1PWCA 4PM8A 1PYYA 3HUOA 1FCNA 4DDYA 3BLSA 1HD8A 1Y54A 4DE0A 3HL9A 4KZBA 4E3IA 1ERQA 2WGWB 3UPNA 4EQIA 5CGWA 2C6WB 4UAAA 3A3FA 1ESIA 3M2KA 2Y2GA 1K56D 3TOIA 3W4QA 4C75A 1MWUA 4RX3A 1KDSA 2J9OA 1JWZA 2PBYA 3IHBA 2JBFA 3GV9A 2Y2IA 4LV0A 4OPZA 3WS0A 2P74A 4U0XA 2J9PA 2ZQ8A 1KGGA 3Q07A 5M1AA 3OZHA 4MBFA 4X55A 3NBLA 5GLCA 1CEGA 1PZPA 1ZG4A 3P09A 2IWBA 1J9MA 3MZEA 1NXYA 2QPNA 3W4OA 1VM1A 3IXBA 1TVFA 3OPPA 4D2OA 2PU4A 3IT9A 3N6IA 4BJPA 3LY3A 3HREA 5G18A 5EOEA 4N1HA 1CEFA 4X53A 4ZAMA 1ZC2A 3GSGA 3ZVWA 3VSLA 1BLCA 3OPRA 4GKUA 3VSKA 5M19A 4OP5A 5EE8A 3VOZA 2ZM0A 5DTSA 3SH9A 3V3SA 3Q82A 4HBTA 3C4OA 2XEPA 2JC7A 2WUQA 2EFXA 5GL9A 1YLYA 2HDSA 1XPBA 3O86A 4MLLA 4EUZA 3DWKA 1NZUA 1RCJA 4RA7A 4MNRA 1WE4A 4PM5A 3NCKA 4S2OA 1KGFA 1MPLA 2WYXA 1ES5A 1NY0A 2ZQ9A 1SCWA 2QZ6A 4IBRA 2X71A 1O07A 5F83A 3M6BA 4GOGA 1YQSA 3M6HA 1IYOA 2BLSA 4QY5A 4RX2A 3ZG0A 1KE4A 2Y55A 3VP3A 1DJAA 3ZGAB 3BFFA 1XA7A 5CEDA 1LLBA 2IWDA 1MWSA 4YINA 1NYMA 5TFQA 3RXWA 3GVBA 2Y91A 2XQZA 3IWIA 3GRJA 3LCEA 1TEMA 2EFUA 1FSYA 4YFMA 2QMIA 1CI9A 1LHYA 3ZNYA 4JXVA 1QMFA 4GB7A 1SDNA 1RGYA 1YLPA 3IQAA 5GLAA 2G2UA 3A3DA 1IEMA 1L0FA 3NI9A 4WYYA 4R1GA 5CHUA 4OKPA 3OPHA 4OP8A 3D4FA 2G2WA 3NIAA 3NDEA 3IXHA 3G31A 3N7WA 4LENA 5E2EA 5F1GA 4P0MA 3QHYA 3HUNA 3PTEA 3V3RA 1DJCA 2WAEA 4KZ8A 2Y59A 2HPBA 1K6RA 2B5RA 1LI0A 3UN7A 2VGKA 3S22A 1N4OA 5U47A 3Q1FA 1PW8A 1FR1A 1S6RA 2JCHA 1BSGA 4HBUA 4HEFA 2Y2PA 2H0YA 5HAIA 4CPKA 4IVIA 5E2HA 5A91A 1RGZA 4OOYA 2ZQDA 2FFFB 5CTMA 4ZBEA 3ZFZA 4LV3A 3E2KA 1EWZA 1AXBA 5TGFA 1FCMA 1FCOA 4QU3A 1C3BA 4BQMA 5FQMA 5I94A 3B3XA 3HLEA 3MXSA 4KENB 3BLMA 1ES3A 1XP4A 3O3VA 4DXBA 1ZG6A 3EQUA 4JXGA 1M6KA 5EUAA 3MKEA 3G34A 5FQJA 3HLFA 3V39A 1XGJA 3O87A 4IVKA 3RXXA 2IWCA 4X56A 5EOOA 4S2PA 3S1YA 4JXSA 4S2IA 4EBLA 4PM7A 4JF6A 4WMCA 3IWQA 4S2KA 3N8RA 4OLGA 4GNUA 5GHZA 5KMWA 1ONGA 3IXDA 1JWVA 3C4PA 1QMEA 4JKTA 2X01A 2GDNA 5CTNA 1YT4A 3ZG9B 3NY4A 3CZDA 5EPHA 4E6XA 3OCNA 4OOLA 3HUMA 3A3EA 4LV1A 4KZ4A 1K54C 3ITAA 2V2FF 3QNBA 4IBXA 1ESUA 1KE3A 3VOYA 4Q8IA 5FASA 4WZ4A 3BFCA 3QNCA 2ZLYA 4UA6A 3W8KA 3FV7A 4GDNA 1VQQA 4Y0UA 2ZMAA 4R3JA 3P98A 3IF6A 5HFOA 3ITBA 4NETA 5FDHA 4OLDA 1TDLA 1MWRA 4QD4A 2EX6A 4QY6A 2WKIA 4WEKA 5CGXA 1BLPA 5DVAA 5EVLA 2WAFA 4KQRA 4K91A 3IWOA 1MY8A 5GHXA 4JF5A 3DW0A 5DTTA 4KZ5A 5F82A 1GHPA 2ZQ7A 2P9VA 4E3LA 2XFTA 3SH7A 3SS3A 4XUXA 3UE1A 4MEZA 4UHUA 3ZVTA 2WZXA 3PBQA 5CHMA 2ZQAA 4OPRA 1WYBA 5GLBA 1FR6A 5FQQA 5E2GA 1N9BA 4MBKA 3UE3A 2OSUA 4P85A 2OLUA 5CERA 1GHMA 2EXBA 1K57C 1OMEA 3VP0A 3ISGA 2ZC3B 5HW3A 5EECA 3MZFA 1PWDA 4KZ6A 2Y2QA 4DE2A 4KQQA 5D3OA 3VMAA 1G6AA 2ZC5B 3N8SA 4O7DA 1G68A 2EX8A 2Y4AA 3PAGA 2ZD8A 1XGIA 3Q7VB 3BYDA 1E3UA 4PM9A 4DXCA 5A93A 4X68A 4E3MA 4E3OA 5FI2A 3VFHA 4F94A 1JVJA 1PWGA 5EVID 2R9WA 4KZ7A 2UWXA 4OQ0A 1K55C 2DCFA 3HLCA 4E3NA 4R23A 3G4PA 5J8XA 1FSWA 5EVIB 1YMSA 4OVDA 5FAQA 3FKWA 1BUEA 4X6TA 1YLJA 4WMCD 2XH9A 1KVLA 4EBPA 1L2SA 2WGIA 5KZHA 4BLMA 4IEDA 4S2NA 1L0DA 2ZM2A 2ZJ9A 1W8QA 1BLHA 4L0LA 3BRMA 3UPOA 2WGWA 4FCFA 1NJ4A 4DF6A 3BFEA 4FD8A 2R9XA 4N9KA 2H10A 4X69A 1JTDA 1I2SA 2Y2MA 1CK3A 4QHCA 4DDSA 3PBSA 3M2JA 2A49A 2OLVA 4LCMA 3WS2A 4FSFA 2C5WB 3OCLA 1IKGA 5TR7A 4A5RA 1MWTA 4KQOA 3A3JA 5IHVA 4BD0A 3Q7ZA 1K56A 2ZQCA 3LEZA 3OPLA 4Z9QA 3UO9A 2EX9A 1BT5A 5E43A 1GA9A 2X02A 3FWLA 3S4XA 5M18A 2ZC4B 1H8YA 1DJBA 3BM6A 4JPMA 1K54A 4K0WA 5AQ7A 4BD1A 4EV4A 5KSHA 4E3KA 1XKZA 4OH0A 2Y2LA 3I7JA 3BEBA 1CI8A 4QJGA 5HL1A 4C3QA 3HLDA 5JYPA 3DTMA 3VP1A 2XD1A 5FQIA 4WEJA 3WS5A 4GN2A 1KGEA 4JXWA 1KDWA 4N9LA 3BFDA 2HDQA 5FAPA 1Q2PA
chains in the Genus database with same CATH superfamily
1GMQA 2XD5A 2ZBKB 3F8XA 4CLCD 3VKHA 1W2B2 1DVDA 2UUAM 3EB8A 1PI5A 4BENA 4B7HA 1FGTA 2VKSA 3SHGB 3OC2A 3HVFA 3PXMA 2OQ4A 1RGHA 2LVQD 3NBBA 4CLCB 4X62M 1S1YA 3SS4A 5HL6A 2K7SA 4ARZB 1UFZA 5AQAA 4R0QA 2DWZB 4O0PA 4KG6A 2PU2A 3BY8A 2OV5A 4N6V0 1H6UA 1ZX2A 1U8CB 1Z5BA 2PZVA 4TUWA 1OT6A 4KG2A 2JNHA 3WS4A 4KZ9A 2ZC7A 5IREB 2Z2MB 1IYYA 4Z8XA 2F5QA 3CWFA 2HKJA 3HU1A 4RVAA 2MR9A 4MMZB 1OGZA 4NEED 2VA0A 3UNWA 4PCZA 3UE0A 3HLWA 1W00A 4LF9M 4IBJA 3ZDJA 2Z4SA 1OQYA 3KW6A 4LF5M 2V1ZA 4DV1M 3MSHA 4NXNM 1TH3A 3C2WA 2HMJB 4ZJ1A 4GD8A 4YWZA 3RFBA 2OOVC 3NV0B 2PD8A 1S66L 4OU7A 1LOXA 3GLGE 3OW22 4LJ4A 1DGHB 1YLTA 4F1IA 2WOHA 2OAP1 3NOUC 1Q3CA 4KG5A 2AAEA 1XXMA 2DKLA 4GW9A 2ZOIA 1ONHA 4KT0F 3ZG5A 4Y2FA 4QWTA 4B4XA 4LLOB 2XA7M 1M1XB 1UW1A 3CCE3 3IMAB 2WKHA 3W0LB 1IN5A 2HWJA 1ODVA 2ZA4A 3GAXA 3BY9A 4UA9A 4M3KA 3WRZA 4HH3A 5EXPA 1VQM3 3RDEA 4AZFA 5BOHA 1RNBA 2YFIB 5GKNA 1UI8A 3ZCZA 1F8NA 3FZCA 1V9YA 1L2BA 1AY7A 1BSAA 1QAKA 3DTEA 4CISA 1A2PA 2B1XB 3BNBA 1DY6A 5FI7A 3MBZA 1RCKA 3X40A 2V0WA 2VV7A 4Y15A 1OTEA 1JTGA 2M7OA 5DTKA 5KQ8A 5DF7A 3UB1A 2C4BA 1IY0A 4OPYA 1TRPA 4EERA 4NPBA 1L5GB 4I3IA 2QZ4A 3LQQA 2K2NA 1YE9A 3MJ5A 3NECA 5AQBA 4NK3A 3UDXA 1L2CA 4NL4H 2VDBB 4DKIA 1W63M 2MC8A 1BRJA 1LOVA 2B18A 4LGMA 1LL8A 4DE1A 1Q3BA 5FQKA 2R46A 4G3OA 2FNAA 1Z6TA 1S1ZA 2QJ5A 2QBYB 3K3DA 2HDRA 1R7RA 5EXSA 3T8UA 4C6YA 3GLFE 1W6YA 2CFOA 4R71A 1RTUA 3X3YA 2DVWB 4BWIA 9RNTA 4E3JA 3ZQJA 1J3WA 2V9AA 1SKOB 3K0ZA 2OO9A 1FUTA 1JB0F 2XGNA 3D4AA 2DHYA 1T18A 4N1XA 5GHYA 4Y28F 3E4RA 1W7CA 1XX2A 3ZHHA 4ZJ3A 2L4EA 2JY5A 1CYVA 4KFFA 2L7IA 1MXOA 3JYIA 2HP5A 4DE3A 1K28A 3K9MC 3UDFA 3SOYA 2CWVA 1I2WA 2Z3XA 3NWLA 1CQAA 4KZ3A 3U60A 3Q90A 1TDGA 3C7VA 2HV1A 5F69A 5FL3A 1PRBA 3UJMA 2EUCA 4XBYA 2WZJA 1W6CA 5HARA 5KSCA 2HP6A 3HLBA 2DRWA 3LIAA 1XXHB 1OGXA 3U6DA 2WADA 1E3UD 3BECA 3BFGA 2LYXA 3ZG7B 2VGLS 5BPVA 2YKFA 1N5HA 4WBGA 2JZ0A 3BNEA 1IELA 5EVIA 4D60A 2BMQB 1IV9A 3K5TA 1B2MA 3GPYA 3AGFA 3EOIA 3JVCA 3JVVA 2QKPA 4F3LA 1RN7A 5FQ9A 5CEBA 2H5SA 1JWPA 3C7UA 3FPWA 1KYIA 1Q864 5EFWA 3KSXA 1RLSA 5K5BA 3F92A 3NM7A 2RNTA 3NC8A 2F5NA 4JGPA 1IXRC 1GMRA 1ISKA 2H0IA 4HESA 1K4EA 2ZC6B 3F14A 1GHIA 1VQ43 2VIIA 1Q2QA 5FAOA 4CDLA 4PM8A 4AW4A 4DDYA 1ZMWA 1Y54A 1JR3A 1TF0B 2Y20A 3OXAA 3GLIB 2YR0A 1FUSA 1S3SA 1LQMB 4EQIA 3MPHA 1ESIA 4KODA 1EUIC 4Q7JA 2PAVP 3CLOA 1K56D 5AYSC 3TOIA 2O9UX 1KDSA 3IHBA 2PBYA 3GV9A 3BLZA 4MEIA 2Y2IA 2RGOA 3FUWA 1A90A 3TWLA 1T1CA 3Q07A 3OZHA 4MBFA 2CHGA 2Q2EB 1OF5A 1CEGA 2BU4A 3NBLA 3KCHA 1RSNA 3ULFA 1BNGA 2FNQA 4LEHA 1J9MA 5A2QS 3NBJA 3LW5F 3W4OA 4HM3B 1BAOA 1TVFA 3IXBA 4D2OA 2PHYA 3CPTA 3HREA 1TRQA 1E9RA 2IUJA 3FKAA 5G18A 1IDPA 3LVVA 2KCDA 4HM6B 2XR8B 1MOLA 1G96A 2CIUA 4D80A 4IBKA 1JBTA 4OP5A 4LMIA 2ZM0A 1VQO3 2L1MA 3LIEA 6STDA 2W3DA 1Q39A 5IEOA 3V3SA 3TE8A 5J4EA 4U13A 1SXJE 1YLYA 1QDRA 4LYLB 3RGRA 1VQK3 1XPBA 2YNMD 1F4IA 2OWJA 4LF7M 1QYRA 1EEJA 1I0XA 4FOFA 1PU4A 3BJNA 4S2OA 2WYXA 4N6MA 1Q40B 2YFLB 5D81A 2QZ6A 2DI0A 4HZBB 4GOGA 4JI8M 4Q53A 3K3CA 1WHCA 3VP3A 1DJAA 1QUSA 4P6ZS 1XA7A 4O3VA 5EXTA 4ITQA 4DMZA 3LTDA 1LLBA 2W1RA 2GBXB 1NWWA 1OFHA 4YINA 1GLNA 1SZVA 1MN3A 1Q42A 3AHWA 2Y91A 2XQZA 3L26A 5BVBA 3HK4A 3GVBA 1JKGB 3LCEA 1IXSA 5F5YA 2VQFM 4GS9B 1B2SA 3LR4A 1S4SA 3KSPA 1HNXM 1XNRM 2INWA 1NNUC 1EIJA 2KF5A 2OTL3 4M4XA 5EJCA 3GPPA 3IQAA 3ZNYA 3FYDA 3A3DA 4XDVA 4EESA 3KP1E 3U6EA 3BWLA 2UGIA 2L6OA 5KPTA 2G2WA 3NDEA 3IXHA 4P0MA 3B7CA 2GQFA 4Z6YA 1E32A 4HL4A 3KOZE 2HPBA 2B5RA 1LI0A 1QZMA 2DZOB 1TFKA 3S22A 1IT8A 1YJN3 1S6RA 2BT3A 4HBUA 1MGRA 4G4NA 1X1WA 5HAIA 1W5ZA 3I04M 4LJ5A 1ZMUA 2GXFA 3V92A 1K3XA 1OIPA 4I5QA 1O7GB 2ZQDA 4DR5M 5CTMA 2YFQA 4K1UA 3OBFA 3SAVA 2PRFA 3S27A 5IERA 3J80S 3S5CA 2UXDM 3E2KA 3IS2B 1JZDA 3CF6E 1C3BA 3T4LA 3KZTA 3T0UA 3WA3A 3HLEA 3M7GA 3GRUA 4HKVB 3O3VA 1HNZM 4JXGA 5ITXA 5EP2A 3RH8B 4BLCA 2GNXA 3T6PA 3M8CA 3HLFA 3V39A 3S67A 3O87A 4IVKA 1WMNA 4WYKA 2KHHA 4JXSA 1V58A 4MGHA 4FUWA 3GRRA 3BNDA 4S2KA 2YKHA 4GNUA 3S7QA 2P0XA 4O02B 4HH2A 3DTKA 4HJ4A 5EPHA 1A2KA 3NXJA 2IA7A 3T1YM 3E0YA 4PKYA 1HQCA 2RKOA 3QP1A 1N33M 4IBXA 2QQ8A 1ESUA 1JQJC 4WZ4A 3QNCA 1UCIA 1FYSA 3THGA 5EM0A 4GDNA 4L15A 2C96A 1VQQA 4JGOA 3B9PA 2XRXB 2ZMAA 1WMPA 3P98A 2ML6A 5HFOA 3ITBA 5FDHA 4I39A 2F4YA 1MJGM 4G3KA 3U1WA 3AOEC 2JDIH 2J7OA 4N6OB 3NHQA 3AL0C 1ZGXA 4K91A 3IWOA 5DJUA 1MY8A 4JF5A 3DW0A 4KZ5A 4LF4M 5F82A 3LTBA 1GHPA 1PNEA 2X8AA 1NNVA 4GHIA 3KYQA 2OOBA 2MGWA 4UHUA 3KN4A 1VZZA 3F1OB 3T1HM 3E46A 5CHMA 2ZQAA 4DR4M 4IT7A 4HEOA 1WYBA 5GLBA 3H4MA 1FR6A 2ZL1A 3CHWP 4GIPA 2ZOHA 4NREA 2VF7A 2MH8A 2CK3H 4P85A 2OLUA 2KRUA 5FEGA 5ITUA 3U6OA 3VP0A 7GSPA 2OOAA 3LEQA 2SBLA 1PWDA 3MZFA 3P01A 2W0NA 5HW3A 4KQQA 1N8QA 2WGQA 2ZC5B 2Y4AA 2EX8A 4W5WA 1XGIA 4DXCA 3CME3 3BYDA 3NOPC 4PM9A 4JI0M 3U6MA 4X68A 3AHSA 4E3MA 3SZTA 4CIZA 4F94A 1GABA 5FTLA 2M1CA 4GHAA 1SQWA 3ZYTA 1JVJA 1ORYB 1XWIA 3B7QA 2KAAA 3UB8A 5F68A 4WFOA 2DCFA 1OACA 2CFLA 4STDA 3G4PA 1JBRA 1MGWA 3DTIA 5TGNA 1RNTA 1MZUA 1OCVA 3CC23 1YMSA 2CHVA 3FKWA 3MHVC 3WR2A 2ZAOA 1RN1A 1LTMA 1PM5A 4LJ8A 3EIEA 4AEQA 4PEJA 3B4PA 3GQ5A 4ANRA 1W8QA 1GD3A 1DYUA 2PR6A 3BRMA 3CC73 3EWKA 4GRIA 4JXJA 4EXOA 3UPOA 1QAMA 2V0UA 4YHHM 2B95A 3TWKA 3UMEA 3UK6A 2R9XA 2W04A 1XXHE 1CYUA 1GSXA 1YUBA 1JTDA 2Y2MA 2BTFP 1NY6A 1K8A4 1I0VA 2C5WB 2W1TB 3OCLA 1IQ8A 4A5RA 1FGOA 3X41A 2GEXA 5FGOA 1JN5B 2GU1A 5DFYA 4MMYB 5DJTA 4QHTA 1BT5A 5E43A 3F1PA 4OVMA 3KSIA 2Y21A 1JB4A 4ZRRA 3CNXA 2Q07A 4CJ6A 2JXNA 4XBXA 4JPMA 1X1UA 1K54A 4RF0A 1PY3A 3S7NA 4EV4A 4ZM8A 5EP3A 4CLCC 4UEYA 1XKZA 4FCTA 2F4VM 2Y2LA 3FG3A 4JGQA 2YQZA 1T1BA 1CI8A 3KXEC 2E8JA 3LTCA 1VHMA 3QP6A 4C3QA 2O5RA 2ZTDA 5L8RF 5IG5A 1N77A 3MG2A 4WEJA 4PD2A 5EQLA 3KO6A 3GLIE 3NHXA 3V99A 1Q2PA 4FCZA 4GH9A 1BNRA 3CJMA 3PAEA 2Y73A 1HTZA 4PT5A 2JKTI 3G6E3 2ZMFA 1W63Q 1X1XA 3T1RA 2B24B 4CGYB 1FILA 3CITA 4EV2A 3LMMA 1RGCA 1UI7A 2CX1A 3AGEA 3ZG8B 4DR3M 3FTDA 4G3VA 4ETZA 4LCBA 3GLGA 1XJ6A 2OOLA 4WN5A 3LR5A 2WGVA 3A5EA 1JV2B 1O7WB 5L2FA 3DGLA 4P6ZM 1ZS7A 3UMDA 1PW1A 2KXEA 3QP2A 4Y13A 3FF2A 1G59A 3K2LA 3CI6A 4R4SA 2HP9A 5HPIA 5JBSA 3G0KA 2WSFF 1KVMA 2SARA 1XB2B 3U6CA 2GX5A 1E4DA 2CFWA 4NXEA 1ROVA 3WS1A 4JYAM 2QIYA 2K9DA 1GD4A 2V1CA 4GC5A 3MHEA 4HM7B 1KOUA 5D83A 1VETB 4MN5A 5FSRA 4GZBA 2R44A 1K25A 4N6NB 1B3SA 2KZSA 5DYIA 2HCBA 2DNAA 1NRFA 5HAPA 4DV4M 2DWLA 3FCSB 1XJ4A 1YMXA 1YI23 2BG1A 1FZUA 1BVSA 1GA0A 4LCLA 3BOSA 2D42A 1IYQA 1FJGM 1DRMA 5I5LA 1NHWC 3GSPA 4EW7A 4EIWA 2Q9NA 2EXAA 5EVIC 1PJTA 2LWXA 2XSHB 2OQEC 2R41A 2CC3A 4K0XA 3SS5A 3KSFA 3SEDA 5I97A 3B42A 2XLNA 4Y0OA 4IJFA 2EX2A 5AVFA 3EF8A 1OHOA 1Z6FA 1S4RA 4DJ3A 1W01A 3J7AS 4GDBA 3EQVA 2GBWB 2DWMA 1SKFA 4P6BA 5FEFA 1L3LA 5H37D 2HJ9C 1U60A 3GLFA 3U5ZB 4HM4B 1QDTA 3E21A 2Z2LB 3TJZC 4HOHA 5HX9A 1UGUA 3RNTA 3GQ4A 1AV4A 3F1NA 1TR8A 4HP9A 3V5MA 1S67L 2KF3A 1UUVB 1S5AA 4XXRA 1TS7A 1C1KA 4DV7M 3VE3A 4X1LA 2H0HA 1EROA 1P0ZA 2IMJA 3G30A 4OONA 3HX3A 2HJEA 1PIOA 1K9M4 2LVAA 1W7FA 1QANA 1IKIA 3IECA 3NBXX 1WJ7A 1IVUA 5FLXS 2F99A 3DBAA 3D3OA 2ERCA 2DMWA 1V34A 3OWYA 4LRYC 3ZH9B 3UNLA 2QWSA 5J3WA 2LNHC 4DUZM 1S723 2O9CA 3S7OA 5IS1A 1MBLA 3PBTA 1VEKA 4ORLA 5F6AA 3T4JA 1BSDA 1LRAA 3JUOA 2F5OA 3RE8A 2FS1A 2Z7AA 1RGFA 1QAFA 4WZ5A 4F2LA 4FH4A 5FATA 3T4KA 2PT7A 4LG2A 5E6JA 4DV2M 1UGHI 4I5SA 2HMLB 3FYZA 4B3MM 1XJ3A 1ASKA 1E9SA 1M1K4 2E8IA 2A15A 2LH0A 4R4KA 2BMRB 4E6WA 5L09A 3J27B 5EV0A 5DFXA 2QENA 3TDGA 1YLZA 2HDUA 1YIT3 1WYCA 4GMQA 2EJSA 3IBJA 3PBRA 3DGOA 1IM2A 1D0LA 2ZDJA 3WA2X 2MF7A 2A3UA 4GD6A 3LR0A 4UA7A 3VLFB 1BRIA 3PNVA 1GL6A 1FQGA 1O7EA 2RCXA 4S2LA 2P9VB 3WHKA 3D9RA 3F7XA 3BQAA 4FCVA 4KQDA 4GC9A 4X25A 4ZDXA 3GO8A 4QOSA 2F86B 1QVF2 1NO3A 2L2DA 4BMWA 3Q7VA 3U61B 2QGUA 3LR3A 3W4PA 2G3QA 3SOAA 3GECA 2ZANA 3UZUA 4JGRA 2RCDA 3SH8A 3TE6A 1V74A 4QNRA 3VDPA 4QHSA 1N32M 3W68A 1JNUA 3T1SA 4KZAA 3H82A 5DRVA 4FVMA 5TBMB 2ZM8A 2W9QA 4LJ7A 2WO0A 1NZOA 2ZBBA 2X49A 3VSYA 4I3AA 5AIHA 5IZ7D 2CX0A 5AQ9A 5FA7A 4OVZB 3CMZA 4LFCM 1MKMA 5CGSA 3LXUX 2O9AA 2VGJA 4HVNA 6RNTA 2G7UA 2A24B 3PBNA 3H4JA 4E04A 2O0YA 1VQ73 1HZOA 2W27A 1WIVA 3JUPA 1GCEA 3MMPA 3LOYA 3PFIA 3FKEA 4TX4A 4EW5A 1TU5A 3LI9A 4R3BA 1LXEA 4MN6A 3ZNTA 2Y2NA 2FFJA 3G713 3MKIA 1VQ93 1ERMA 2E5LM 5GLDA 1SDEA 5CHJA 2I9WA 5IF6A 1PYYA 1FCNA 2BWBA 3D8LA 3FGYA 3GPUA 3B33A 2UU9M 4RKUF 4KZBA 1VEGA 2XSOB 3VGNA 2WGWB 1NJI4 4XK8F 5CGWA 5RNTA 4UAAA 1RJOA 3M2KA 1SXJA 4ETXA 1IVXA 1PFLA 3ALAA 1MWUA 4RX3A 2J9OA 4OPZA 1GJSA 2JBFA 4IJEA 1OFIA 3WHOA 4LJ9A 2P74A 4QPRA 2Y0QA 5M1AA 1VQ63 4X55A 1PZPA 2HF6A 1R4YA 1GYBA 1V9ZA 3MZEA 1NXYA 2EWVA 1ZO2A 3MQQA 3OPPA 4B08A 5C18A 1ZTUA 4FWGA 2PU4A 3O8YA 3HJKA 3T4QA 3LY3A 2R45A 2XSZA 3EIHA 3QAUA 1UGIA 1VQN3 4N1HA 1CEFA 5LBRA 3FTFA 3K92A 3GSGA 5ITYA 3HZPA 3A45A 5JI2E 1N34M 4JI4M 3HY5A 2KDLA 3FZWA 1ZV1A 2KEBA 3GZXB 1QVRA 3LMLA 5EE8A 4CLCA 3B74A 1IVVA 2HMKB 3G4S3 5DTSA 3ZC7B 1QMAA 1IBLM 3S29A 4H6JA 1W6GA 4DV6M 4G6ZA 3C4OA 4ARZA 2JC7A 2C99A 3DY5A 4D81A 3U60B 1Q9EA 1Z5AA 3DGYA 4MMXB 4KZ1A 2HDSA 4KUKA 4EUZA 3DWKA 2FOIC 5G2GA 3JVUA 2B02A 1WE4A 4FMBA 1XFNA 2XSSA 1SIIA 3QRDA 3D9YA 4K08A 1P9WA 4PM5A 1ES5A 1SCWA 2NUPC 1TDHA 1WGNA 4RX2A 1KE4A 4REZA 3ZGAB 3H9WA 5HSQA 3QK9A 3BFFA 3PGBA 5CEDA 1NDOB 2W03A 4MGIE 5TFQA 1NYMA 1BRKA 4MGZE 5F3WA 4J5GA 3GRJA 2EFUA 1FSYA 1UWNX 1JB2A 3PS8A 4YFMA 1SG9A 2JA2A 1CI9A 1C7HA 4WW0A 3KS4A 2OTJ3 5GLAA 1J5EM 4KLNA 1JNQA 3X3ZA 3NV0A 4IBIA 1L0FA 2PYRA 3X3XA 4WYYA 5CHUA 4RNAA 4OKPA 1RU3A 2UX0A 1NU3A 3D4FA 4HAAA 1DGHA 2BIRA 4LSOA 2P08A 5KPZA 3CCV3 1DE3A 3QHYA 2HAKA 5EEOA 3HCYA 2L7HA 2LBCA 3T15A 2WAEA 2Y59A 1YHQ3 2MROB 4G4QA 2Z7JA 1B2XA 3NBIA 3Q1FA 1PW8A 2JCHA 3E4PA 1BSGA 2Y2PA 4L6V6 2H0YA 3CMA3 4LZIA 2J5YA 3F8HA 4P17A 2L4RA 1OJLA 4HP4A 2FFFB 1NY5A 4HJ3A 4ZBEA 4HM8B 1BNSA 1PJJA 4LV3A 1YSPA 3F7SA 1EWZA 3K9OA 5AEWB 2H28A 4FR9A 1FCOA 1W5TA 5FQMA 5I94A 4KENB 3SXXA 1XP4A 3A0VA 2PNCA 2AHMA 4HZ9B 5EUAA 1M6KA 2C9CA 3MKEA 3GZRA 2OQEA 1PFPA 2J8XB 3B7NA 4I81A 5CF2A 3QP4A 4HOIA 3NQYA 3T8NA 3S1YA 3LVWA 1C54A 4EUVA 4S2IA 3UB6A 4J8TA 4HYZA 3IBRA 3CC43 3U6SA 1IBKM 2C11A 2JKTM 3N8RA 1R4CA 4OLGA 5GHZA 5A8BA 4GLQA 1JWVA 3C4PA 1QMEA 2X01A 2GDNA 3NX0A 3Q8XA 5CTNA 3UB7A 3ZG9B 3FUUA 2LB5A 1BNJA 1NV8A 3KSGA 4LV1A 4KZ4A 2P38A 1STDA 1K54C 3QP5A 4NRVA 3T1XA 2R4EA 2L1SA 2QBYA 3FV7A 3A46A 2RSXA 3VK8A 1OKSA 4G4OA 2GU3A 3JPUA 4HI4A 4XT2B 4Y0UA 2LQVA 3D79A 4AG5A 3RGAA 1GVNA 1F98A 4QD4A 3WMDA 2DHRA 1SKOA 3CD63 5EVLA 1ROAA 1BLPA 1HT2E 2PBDP 3CF2A 2WAFA 3S7PA 3OTOM 2UXBM 1I94M 3MG3A 3E98A 3LZAA 4N6LA 2R62A 5HGRA 1NLYA 1R4GA 3U2AA 4AKIA 4KUOA 4O2HA 1IXSB 2XFTA 1BSCA 4O8SA 1OTBA 2P5TA 3FG1A 3LICA 3K8ZA 4XUXA 2AADA 3I553 1YVSA 3ZVTA 3W0FA 3PBQA 1TH2A 1K734 1IN6A 4OPRA 1N9BA 2R65A 3L27A 1PJQA 4FW9A 1QAQA 3D8BA 5ITTA 1WNHA 3EEHA 3UE3A 2OSUA 4NXGA 1Y28A 1G71A 1EA2A 1GHMA 3B7ZA 1XXHA 4L9EA 5CERA 3FG4A 1K57C 1YLAA 1BOXA 3EN8A 2V1BA 3EJVA 2EA9A 4G3WA 5EECA 4EEUA 5EVHA 2Y2QA 3UL6A 3SVAA 4MB7A 3EC9A 1HNWM 4NXMM 1OJGA 5A93A 4BBAA 5DKLA 5KO3A 1E3UA 3DOAA 4E3OA 1IXZA 1OAOC 2G8LA 3C3EA 3LH4A 4LZZA 1T3TA 2CEAA 2QHKA 2HMOB 4LFAM 4D82A 4OX9M 2R9WA 5G4YA 3U4LP 1YNVX 4L78A 1T19A 4Q0IA 1J2BA 4MM3B 1VQL3 2K0BX 3IX8A 2WKRA 2W82A 2W3FA 3QYEA 3W2ZA 3SHFA 2P0MA 5AYRB 1L2SA 4BLMA 3F9SA 4EBPA 3NUVA 1NVMA 4BB9A 2INXA 4WUJA 4L0LA 1OAIA 3PYJA 3GLIA 4GB5A 4FCWA 3IX3A 2FE8A 3R8FA 4G1MB 3KFQC 1YAXA 2CMNA 4FCFA 4WL9A 5EVEA 1TD5A 3BFEA 4FD8A 4N9KA 3UL5A 3HJIA 2JKRI 4R9KA 1B27A 5CLKA 4NHFA 3E9SA 3SLUA 4OW0A 1OH0A 2OLVA 3M2JA 1FGQA 4R1KA 4FSFA 1IKGA 4LCMA 3FH1A 3R9XB 1LSWA 1OUNA 4KQOA 1DGFA 1VEUB 1K56A 1TFOA 3C30A 2RFRA 4EV5A 3PYPA 2HOHA 1BVIA 1BU4A 3HIIA 2ZC4B 3U6LA 4K0WA 3C8CA 4NXBA 4KHPM 2KRKA 4OH0A 2EWWA 1N75A 2VQEM 4MN7A 3I7JA 2W56B 5EQTA 2CHQA 2OPFA 1O7PB 1TP6A 1V57A 3LIFA 2KX6A 3HLDA 1D6YA 3LCUA 1HR0M 1RRLA 1Q7HA 3DTMA 2XD1A 5FQIA 2CHCA 3WS5A 4JXWA 3HHXA 2UXCM 1VDDA 4LFBM 3BFDA 4IBBA 4KFEA 3OWSA 3K2NA 2HL7A 3HOHA 2XR0A 1I5QA 4I38A 1SARA 3IXGA 4L7KA 1JJ22 4ILFA 4RYEA 3GQZA 1JZOA 3D72A 2DENA 3KVWA 4MGKE 3J7Yd 4BL2A 4WZ5C 3UPPA 1UM8A 2LHCA 5A90A 3LTAA 2RL3A 4IBFA 1Q40A 1RRHA 1ES4A 1QQWA 4IBDA 3AMOB 3BU4A 4LV2A 3IH8A 1SJWA 3VKGA 3GZBA 3U97A 3TG9A 4HJ6A 3TSGA 2R6FA 2KXGA 1YM1A 4R4RA 3LIDA 4EEPA 4GSPA 1I8VA 3IJEB 4XM4A 1BNFA 4I8OA 2DZNB 3HJQA 2OAQ1 1V33A 1UCJA 1RGEA 1Y4OA 1JKGA 1BLSA 5IW9A 3NDGA 4GS9A 5JYOA 2D7GA 3WODG 4HIAA 2L09A 4XUZA 3GLHB 3IHPA 4K0KM 1IT7A 4PMAA 4JRFA 2J3TC 8CHOA 4Y0TA 3G32A 4RF1A 4FD2A 4JF4A 3N8LA 1Q02A 5G1LA 4ZPXA 3JUNA 4IPBA 3B8LA 1LV7A 2H1RA 1K55A 1RP5A 1YPRA 3OLOA 3IH9A 2W0QA 1D6UA 1YGWA 2C9OA 2O99A 3FPVA 4Z1WA 5HD3A 1W5SA 1LNHA 3MQ0A 4PM6A 1IYPA 3CG5A 4ZJ2A 5A92A 3FG8A 4H3UA 4L9FA 2JY8A 3H7WB 4EBNA 1L0GA 2AVXA 4WWUC 2IUKA 2XGLA 1TIJA 3IS2A 1X37A 2VEAA 4O01A 1N5PA 4B93A 4K90B 2VF8A 3PCSA 3A3IA 3D5GA 4ID4A 3F1PB 3JUQA 4LF6M 5CRFA 4OQIA 2D02A 3GTCA 4S12A 1C7YA 1I70A 3T4SA 3VFFA 5MC7A 1S0WA 1E94E 3MJQA 1QALA 1KFVA 3MXQA 3VP4A 2JKFA 1ES2A 2JE5A 3L9KA 4FMAA 1YIJ3 5HOHA 1GL7A 3TRCA 4AKGA 4JI5M 4B4ZA 2FFYA 3MZDA 4B3TM 2UUGC 5DNYA 1Q814 1SXJC 1SIHA 2VV8A 1EI5A 3GWRA 4WM9A 2CP8A 2A5YB 4NSRA 1DP9A 2WSCF 3FE3A 4J9AA 1OPXA 2IA2A 3LO7A 4DBGB 2L4VA 2OCTA 2W3GA 2Q9MA 1GY7A 4I4KA 3R7WB 4OQGA 1TS6A 1B21A 1IY2A 2WK0A 3IHAA 4L8PA 3AOGA 4LGQA 1LSVA 1NLZA 3I4VA 3EGXC 5HAQA 1LOWA 4EWFA 1KE0A 2LVNC 2Y2KA 4P87A 4GKKM 4DR2M 1FA3A 5HWVA 1TF1A 3LT9A 1CF0A 1H0MA 3EHCA 1I3IA 3NULA 2CG0A 4JLFA 3KX0X 2P04A 4Y3IA 2KW0A 3KP0E 3SAWA 1N9OA 3CNMA 2JY7A 5BXQA 3CGWA 3GRVA 3I563 3G2ZA 1G8PA 3IF6B 5F1FA 4N92A 3MFXA 2EKFA 3MK6A 1WR1B 1B2UA 3DWZA 5CXWA 1PJIA 2V8CA 5AEUB 2N35A 2O3OA 2KDKA 1BTLA 2CWTA 3SOIA 1VDLA 4GKJM 2VLGA 2CWBA 5L10A 3MXRA 3RTYA 3HBRA 1K82A 2Y2OA 2RBIA 5KQDA 1YJ93 2Y74A 5DF9A 3MG1A 3X42A 2JP7A 3G2YA 5EXXA 3LYXA 4HJLB 2Y8HA 4BTWA 3FSDA 1IYSA 3CTWB 8CATA 1IN7A 5D82A 5BIRA 4BBTA 3GRYA 2J7VA 3GR2A 3A98B 1G6OA 1NYYA 3HI7A 5AIGA 1K38A 4S2NC 2WZZA 3L28A 3U6QA 2CUZA 3HHYA 3E4OA 4JI6M 1N9EA 3VOLA 1PI4A 1LI9A 3M0EA 1I2GA 2OWPA 1KD14 1W5DA 3KSJA 1Z1SA 1L2DA 3OOVA 1SHVA 4B88A 3AGOA 2FXTA 1K57A 2XF3A 4AKHA 2JUJA 2P09A 2J8YA 2V1LA 4BL3A 3AKZA 2WKPA 5CXOA 2LTUA 2XK1A 1HZ1A 3B47A 1KWIA 1K4FA 4LZJA 2CC1A 3CUEC 1F9IA 4HM2B 3LUQA 1PWCA 1TS8A 2KA6B 2W1TA 4LGYA 3BLSA 3NBRA 3HL9A 1NHGC 3FUTA 4NSOB 2CV0A 1ULJB 1JN5A 1ERQA 4DR1M 4L8RC 2C6WB 4R6LA 2Y2GA 3W4QA 4M0WA 4K1VA 3KOYE 1XC8A 5C1BA 1BSEA 2KZUA 3KSED 1KGGA 2BWEA 5ITXE 4RNTA 5L07A 3RGPA 2CV2A 2QNJA 1ZG4A 2XRNA 5EP4A 4PAUA 5A0OB 3LIBA 5HZHA 1G5UA 1AQZA 5IWAM 5HDCA 4LRXC 3N6IA 3I51A 4BTXA 2CFDA 3DZDA 2BJVA 2PR5A 3O5YA 3MYTA 1G4AE 5CK6A 1DGBA 3FF0A 1DVCA 2YFJB 4ZAMA 1ZC2A 3TL4X 1J09A 2M60A 3VSLA 5JPUA 3ZQ5A 6GSPA 3DUKA 3PZWA 1BLCA 1A2VA 1K0KA 1OTIA 1YJW3 5M19A 4EETB 3SC3A 2Z76A 3KS8A 4FMDA 1VQP3 2LVPC 1TJDA 5AIIA 2VV6A 5BR8M 2VX8A 3Q82A 4KFDA 4HBTA 1T43A 4JI2M 3CPW2 3GP1A 3HJSA 2H0GA 4OUQA 3O86A 4DV0M 4RA7A 3NCKA 3QWLA 1BRSA 1EQKA 2O25A 1RCLA 1KGFA 1MPLA 1NJFA 5F83A 1OT9A 3WOFB 1QAOA 1IYOA 2C5RA 4AQYM 1T3BA 3FRHA 2Y55A 3F40A 3IG8A 2Z6DA 1OHSA 1PYLA 1GMPA 4DV5M 1RGLA 1VETA 1MWSA 3ER7A 3RXWA 3CCQ3 3IWIA 1TEMA 2QCUA 4LRSA 1AWIA 2QMIA 3LFVA 1Y4KA 3MSOA 1LHYA 1QMFA 4GB7A 1SDNA 3L0RA 4I3JA 2G2UA 1RN4A 1D6ZA 1IEMA 3NI9A 1K3WA 4R1GA 2F5PA 1M904 2CE7A 2JKRM 3OPHA 3NIAA 4ME4A 4OP8A 2G5GX 3G31A 4LENA 5E2EA 5F1GA 3K9PA 3E99A 1LQGC 1N9LA 3PTEA 1DJCA 2FH5A 1YGEA 1XMOM 1Q824 5IG0A 3SAUA 3V67A 1FR1A 1IU7A 4CPKA 4FTXA 2K47A 4IVIA 3Q8GA 1GY6A 2QHOB 1BRHA 2W2CA 1RGZA 4OOYA 1US1A 3CCL3 3T50A 1XJ2A 3GLHE 2FH0A 3U5ZA 2EKKA 1FW7A 2BJWA 4NKPA 2D01A 4BQMA 1FCMA 4QU3A 3VE4A 4R3DA 4LGWA 3B3XA 3MXSA 3BLMA 1RDSA 1ES3A 1X0OA 1DETA 4DXBA 3HWSA 1I4WA 1ZG6A 5HDSA 3G34A 1BUJA 3B89A 1HYFA 3RXXA 2F5MA 2X4AA 7STDA 4N3VA 4II7A 4EBLA 5LMUM 4JF6A 3HJ8A 1FNNA 4WMCA 2Y79A 4XGIA 2D7EA 1ONGA 3L2AA 4JKTA 4BBUA 2BASA 1YT4A 5IENA 4H6JB 4E6XA 5G4ZA 3Q2PA 5KP4A 1BANA 2R0IA 3SYLA 1KE3A 4Q8IA 5FASA 4X64M 3BFCA 1HJPA 1XMQM 3CAXA 2ZLYA 4R38A 3GZYB 2E2UA 3W8KA 4BBVA 1YVBI 5FTNA 3EX9A 3HX8A 4K61A 2QYBA 3AJIB 2I9VA 4NETA 2CW9A 3G6OA 3WDGB 2V1AA 3HIGA 1TDLA 1MWRA 4N6TA 4B7FA 2QPAA 5AJGA 2WKIA 3NQZA 4WEKA 5CGXA 1J7KA 2QP9X 5ITQA 5DVAA 3KYEA 5C5KA 1QJGA 3TW8A 3R4KA 5GHXA 2RGHA 2XROA 1G41A 1O7MB 2ZQ7A 2J7NA 4CQHA 1OHPA 2ZL8A 2P9VA 4E3LA 5LC6A 3SH7A 2P7JA 3UE1A 5GSPA 4G4RA 1F2KA 4M9SA 1HU9A 3PVSA 2BO9B 2JQ5A 3BQ8A 3U61A 5E2GA 3PNYA 3KE7A 4MBKA 3W67A 3CU3A 1I2FA 2BNKA 3FUXA 4WHAA 5CF1A 4RQ9A 2EXBA 1OMEA 1BNIA 2ZC3B 5TBMA 2C98A 4KZ6A 2ACGA 1O7HB 2EO2A 1A67A 1OTRA 5D3OA 3VMAA 3WOEB 1ULIB 1G68A 3NOTC 2VJWA 2ZD8A 1E3VA 1TTOA 3H3HA 2QA43 3PAGA 4X1MA 4OVZA 4KT3B 5FI2A 3VFHA 1YSYA 3BBZA 2K6BA 4GEWA 4XB5A 1PWGA 5EVID 1H3QA 1SPUA 2A24A 3H51A 4OQ0A 1E97A 2DXIA 1NSFA 1K55C 4E3NA 1NJGA 1IVWA 4R23A 4RBNA 3V98A 5J8XA 1BUQA 2XZFA 4MDZA 2YX9A 4QWOA 5EVIB 4OVDA 5FAQA 1V92A 1BUEA 5KZHA 1YLJA 1Z59A 2WSEF 2XH9A 1KVLA 2Z6BA 2I7NA 1NNJA 3L29A 4DR6M 4S2NA 1L0DA 4F3LB 4HM5B 2ZJ9A 2UV0E 4A3VB 3EBTA 1KQS2 1IOUA 2WGWA 2M7UA 5HDDA 4XBOA 1NJ4A 2R4IA 2H10A 5TJJA 4X69A 4EC6A 1JR3D 1I2SA 5ELJA 2KLIA 4QHCA 5EM1A 2M7VA 2WKQA 3EQQB 2DAMA 1BRGA 3WS2A 1EE8A 4JI7M 1IV7A 4FCMA 4B7GA 5TR7A 3A3JA 4RZMA 5IEPA 1PRQA 2ZQCA 4DJ2A 1D0MA 2LB9A 4HY8A 1CUKA 3FD9A 4Z9QA 2EX9A 3GQ3A 2HGVA 5M18A 1W02A 1GA9A 2X02A 3VK7A 3CUEA 3A76A 2K3DA 2W6JH 1HKXA 2DAEA 2CKFB 3HU3A 1IN4A 1DJBA 3BM6A 5AQ7A 5KSHA 1R2ZA 2ML5A 1L1TA 1X1YA 3VFDA 1OF5B 1U5OA 2C10A 1R5LA 5HL1A 2CV1A 5JYPA 1RMSA 1W4NA 5IG3A 3VP1A 2O01F 3BB9A 4X66M 3CPTB 5AVEA 5FAPA 1NO1A 4MCWA 1G6AA 4GHOA 4JF8A 2ZAMA 1I3FA 3QYBA 2F5SA 3N9HA 5JPPA 2KNAA 2GJ3A 4OPQA 2B3TA 2Y2JA 1L1ZA 4IBGA 3TPZA 2Z6CA 3AV0A 1CQSA 1GOYA 2V1UA 1ZQ9A 4L8OA 1XHBA 1E25A 1L8QA 2R18A 2CFKA 5KP3A 2I72A 4B9OA 1EKMA 3K7CA 4AKZA 3VP2A 1N9JA 1ZKJA 2JKGA 4X2OA 5HPFA 4QB8A 5FW5A 3PR6A 2V8FA 4HNBA 1G0TA 2KNVA 2A2LA 2XFSA 1A0KA 2Y2HA 1UUGB 3O88A 3UB9A 3KOXE 4PPRA 4L4UA 1M9GA 1LSXA 1CEWI 1VQ53 1IFQA 3UMMA 4B3RM 3T38A 4R9LA 1YSQA 3ROBA 3NM2A 4DN0A 4H61A 1BGSA 4LJAA 1M40A 3HGIA 1LL9A 3WRTA 5IT5A 1STZA 3GPXA 2IYJA 4FWHA 1GSPA 1DO2A 1BSBA 3OV4A 1JBSA 1BZAA 4U3TA 5CECA 1DV0A 3QP8A 1PZOA 1QZEA 3N4IA 1HVBA 2QJ7A 4X65M 2K31A 2PD7A 3UE6A 4DRTA 4KO8A 1QUTA 4IUKA 3SW1A 1YLWA 3LY4A 3FC7A 2V6ZM 5LMNM 3PXPA 2F98A 2V20A 8RNTA 1GS3A 2VK3A 3MFDA 2L4FA 1DO0A 1P3QQ 2LXEA 3AGDA 2J3WA 3T1QB 1IN8A 3C5AA 1LNIA 5FI6A 1QVG2 3MKFA 4WF0A 3Q3FA 1RGGA 3BNCA 1TDZA 3UY6A 4YY3M 3WHLA 4GL6A 2EA0A 2KF6A 1Z09A 4R3AA 5L8MA 1H8ZA 4GHLA 2OWHA 1RGKA 4X2HA 3J2PB 5BU4A 3CF0A 3EN1B 3SX1A 1O7NB 4BU4A 4JV5M 3IF6C 1IQPA 4MMNA 4CJNA 4LJ6A 1XA1A 1K6SA 1GKIA 1DGGA 2LHGA 5KPRA 1NB5I 1UCKA 2Z8YM 1IBMM 4WYKB 5HWWA 2L0WA 3GMWA 4UN2B 3ZCBB 3CCJ3 1IQXA 4RNZA 4DUYM 1ALQA 1RKYA 3RJUA 3KKGA 4OQHA 2DAIA 1ACFA 5FDSA 4XT2A 3PXGA 1D1JA 2D7HA 2K0MA 4Y7PA 2HMNB 4JI3M 5E2FA 2CG1A 1DMNA 2XZUA 5FSWA 2DAGA 1GOUA 3G16A 2NQ8C 3FLJA 2XLJA 3LGOA 1FOFA 3L25A 2DNSA 4FH2A 4JBFA 4JN6A 2ZHXB 2BHMA 3C38A 3MMHA 3I01M 4Q0JA 4Y5FA 2XDMA 3T4TA 2LVOC 1L0EA 1KC84 3K1JA 3G35A 3AFHA 3SMSA 4MBHA 4ZTKA 5G1KA 3IF5A 3V76A 1G28A 3Q81A 3HLGA 4CLCE 4WURA 1NB3I 2D1WA 3CCM3 1H5XA 1AIPC 1T1AA 5E26A 3JR5A 3V50A 3FUVA 2WOFA 3E2LA 3FRIA 2FGTA 1PJSA 1RHLA 4OOMA 4L9GA 1MKIA 4GHIB 4R80A 1LL5A 3MR0A 3WWXA 2E2TA 1TS0A 3OWUA 1BULA 3FKVA 4LY6A 2ZL1B 3VV4A 1BIRA 3UDIA 5ITRA 1WQLB 4QNMA 1D2NA 4I4LA 1OJ5A 3C9PA 3BXWA 2OOVA 1W8YA 3DA1A 1DMQA 4IIAA 4H8RA 4U0TA 4WELA 5DF8A 4PDGA 3PBOA 5JI3E 3SFZA 2I7PA 4M0DA 2BMOB 2JZ1A 3UB5P 1VQ1A 4AG6A 1VQ83 3HZJA 3I0YA 1W79A 4NXFA 5DYGA 2Z77A 3SYKA 4IIWA 4LPZA 3RGSA 2M5ZA 2H0TA 2WKEA 3EE1A 4S2MA 4AFIA 2UUBM 1AVLA 4S2JA 2WGOA 1Y8GA 3IX4A 3HUOA 2W9PA 3CPOA 1GJTA 3OX9A 2W3HA 4NOOB 1T2HA 1HD8A 1VEUA 3LI8A 5LC7A 4E3IA 3HKPA 2DZLA 3E4QA 2JHEA 3UPNA 1G3IA 3A3FA 1BRNL 2HZ5A 2ZTCA 1VEJA 4MJDA 4C75A 1F5MA 4DE0A 1JWZA 3WS0A 4LV0A 5IT9S 2RRUA 1DP8A 4U0XA 1WGLA 5FTJA 2J9PA 1IY1A 2ZQ8A 1JB5A 2W56A 1N8R4 5GLCA 4EU0A 2MJ5B 3U6PA 3P09A 5STDA 2IWBA 5HWTA 1MC0A 2QPNA 3KIIA 1VM1A 3JUMA 1E3RA 3EBYA 3IT9A 4BJPA 2KF4A 1TH4A 2KOIA 2JN7A 3C58A 2PYPA 5EOEA 3PCRA 4IUHA 4X53A 4Y17A 3P7NA 3C3DA 4IJGA 3ZVWA 1PGYA 3FYCA 3CCS3 1RGAA 1AUAA 1DP6A 1IFYA 2H5XA 3OPRA 4GKUA 3K63A 1R2YA 3VSKA 1TTEA 1FUWA 1OTDA 2R78A 3VOZA 4EQ1A 1JR3E 1XNQM 1OPYA 2HMMB 1UUWB 2ZMVA 3SH9A 4UQIS 2MJ6A 4O8GA 2VGLM 3HU2A 2GNOA 4B3SM 3AMOA 3KFUG 2XEPA 2WUQA 2EFXA 5GL9A 1EG9B 3IPTA 1N9NA 4EXRA 4MLLA 1NZUA 1RCJA 3UJNA 2Z4RA 3FTCA 4WP2A 4MNRA 4NRWA 4BIRA 3LCVB 1DMMA 1FIKA 1NY0A 2ZQ9A 1GY5A 1R6BX 3GLGB 2X71A 4DV3M 1O07A 4IBRA 3M6BA 1YQSA 3M6HA 3DZLA 3ZG0A 2CWUA 2BLSA 3GLHA 2O9BA 4CCVA 4QY5A 4HQAA 1Z5CA 1T6OA 2NUTC 1KSFX 3BW6A 1WMOA 2IWDA 3AGNA 3IG5A 1IK3A 1YKDA 2P05A 4JXVA 4NC6A 3F1OA 2W3EA 1RGYA 3SMPA 3TQSA 1LVNA 1YLPA 3VDUA 1T2IA 1NWZA 5J7EA 1BNEA 4N6UA 3JR4A 5DFLA 1AR0A 3N7WA 2VZWA 3H7WA 1N78A 1WTHA 3DGMA 4OK0A 3VF1A 3HUNA 3V3RA 4KZ8A 1I2EA 1TUHA 1K6RA 3UN7A 2VGKA 1H8MA 1LT0A 1N4OA 1N36M 4HHDA 5U47A 1IQYA 4IHQA 3LYGA 4HEFA 3A0SA 4Q0HA 1MU5A 4MGYE 4RNYA 5E2HA 4DR7M 3S28A 5A91A 2PDRA 3MS6A 3KSHA 3ZFZA 1OIZA 3KOWE 4LRTA 4M9ZA 1AXBA 2CFGA 5TGFA 3SASA 4LFUA 1XFQA 2XA7S 1AVKA 3EQUA 3HHZA 5CX7A 5FQJA 4JI1M 1XGJA 2UUCM 3GLFB 1UDII 5HD5A 2IWCA 4X56A 3HHWA 5EOOA 3D3LA 2JWSA 4XBTA 4KVHA 4S2PA 5DKKA 4HM1B 4PM7A 1MNLA 3R7WA 3F1NB 1A5TA 3B4OA 3IWQA 3A42A 5KMWA 3N54B 3IXDA 1B20A 1ZMVA 3M6AA 1P97A 3NY4A 3CZDA 4YOFA 5ELUA 2F56A 3OCNA 4OOLA 3HUMA 5IG4A 3A3EA 2IY2A 2GEYA 3ITAA 2JY6B 4L16A 2V2FF 3QNBA 3VOYA 2HHHM 1KSIA 2ZM6M 3RFWA 4UA6A 4P16A 2FZ0A 4EYCA 2E2VA 1NRJA 3BIRA 4PKYG 4QOZC 4R3JA 7RNTA 3IF6A 4R70A 4NG2A 4OLDA 2DWNA 2DAKA 2EX6A 4QY6A 4HM0B 1CH0A 2APLA 1D0KA 3MWZA 1B2ZA 4KQRA 1D7EA 3MQOA 1Q7Y4 5DTTA 3GRDA 3DFZA 3Q1CA 4GCZA 3I4YA 1VG5A 1BYWA 4FWDA 2STDA 3STDA 1FGMA 4WP5A 3ICYA 2J80A 2K54A 1HLUP 3SBJA 1NV9A 3SS3A 2CH9A 3LQRA 4MEZA 4GITA 5EP1A 2BNGA 5AI1A 1P9RA 1GSVA 2WZXA 4BTYA 3T4OA 5FQQA 1UCLA 3A0RA 2J3TD 2R4JA 5KP1A 5FTKA 1G02A 1VB6A 3SATA 3GDIA 2Y0TA 3ISGA 3UGJA 1GSWA 4HLQA 1K41A 1HQYE 4DE2A 1LOYA 4IBEA 4ESPA 1T5YA 3TWMA 3N8SA 4O7DA 4PHTA 4M9XA 3Q7VB 2QEX3 5FTMA 3T12B 3H82B 4KZ7A 2UWXA 1ZHHB 4WLAA 2RGQA 1FGRA 2Q0OA 3HLCA 2CRUA 4EBGA 1FSWA 3EEAA 4LRZE 4X6TA 4WMCD 2WGIA 3L7HA 3D5IA 4IEDA 4FCJA 2ZM2A 4YNRA 1D06A 4HBRA 3DAVA 3J81S 3SARA 1BLHA 1OTAA 4AI6A 1MX0A 3SYUA 1STFI 4CHTB 4LF8M 5AIFA 3KYZA 1GOVA 3DGNA 1UWPX 4DF6A 3N8BA 4IBCA 1CK3A 3FTEA 4DDSA 3PBSA 3CCU3 3EGDC 2A49A 5DREA 1MWTA 3ECFA 3CCR3 1EW0A 1SXJD 5IHVA 4BD0A 3Q7ZA 3J7BA 3NJAA 1HT1E 3LEZA 3OPLA 4R7GA 1CJFA 1WXQA 3UO9A 3DXOA 1SXJB 3FWLA 1TGUA 7CATA 3S4XA 3DM8A 3JAMS 1H8YA 3URPA 4BD1A 4FMCA 5IU1A 1WA9A 4J5KA 4E3KA 3DH2A 3PHYA 1EFUB 3KDSE 2GSPA 3BEBA 1ZAEA 3MF0A 1W2ZA 1GO5A 1JRQA 4QJGA 4XDWA 2XSZD 3DMCA 4MH0E 2KRTA 3LT8A 4GJ4A 2F5WA 5KIZA 2QSFX 4GN2A 1KGEA 3AOEA 3G8ZA 2KNZA 4UQIM 1KDWA 4N9LA 2HDQA 3ILKA 4PDIA 3CXC2 2GZAA 4AKYA
chains in the Genus database with same CATH topology
2XD5A 2ZBKB 3F8XA 3VKHA 1W2B2 1DVDA 2UUAM 3EB8A 1PI5A 4BENA 4B7HA 1FGTA 3SHGB 3OC2A 3HVFA 3PXMA 2OQ4A 3NBBA 4X62M 3SS4A 5AQAA 4R0QA 2DWZB 4KG6A 2PU2A 2OV5A 4N6V0 1H6UA 1ZX2A 1U8CB 1Z5BA 2PZVA 4TUWA 4KG2A 3WS4A 4KZ9A 2ZC7A 5IREB 2Z2MB 4Z8XA 2F5QA 2HKJA 3HU1A 4RVAA 4MMZB 1OGZA 3UNWA 4PCZA 3UE0A 3HLWA 1W00A 4LF9M 4IBJA 3ZDJA 2Z4SA 4LF5M 3KW6A 2V1ZA 4DV1M 4NXNM 1TH3A 4ZJ1A 2HMJB 4GD8A 2OOVC 3NV0B 4OU7A 1LOXA 3OW22 4LJ4A 1DGHB 1YLTA 2WOHA 1Q3CA 4KG5A 1XXMA 1ONHA 3ZG5A 4QWTA 4B4XA 1M1XB 1UW1A 3CCE3 3IMAB 2WKHA 3W0LB 1IN5A 3GAXA 4UA9A 4M3KA 3WRZA 5EXPA 1VQM3 3RDEA 4AZFA 5BOHA 2YFIB 5GKNA 1UI8A 3ZCZA 1F8NA 3FZCA 1L2BA 1QAKA 4CISA 2B1XB 3BNBA 1DY6A 5FI7A 3MBZA 3X40A 1JTGA 2M7OA 5DTKA 5KQ8A 5DF7A 3UB1A 1IY0A 4OPYA 1L5GB 2QZ4A 3LQQA 1YE9A 3MJ5A 5AQBA 4NK3A 3UDXA 1L2CA 4NL4H 4DKIA 2MC8A 4LGMA 4DE1A 1Q3BA 5FQKA 2R46A 2FNAA 1Z6TA 2QBYB 2HDRA 1R7RA 5EXSA 3T8UA 4C6YA 1W6YA 2CFOA 3X3YA 2DVWB 4E3JA 3K0ZA 2XGNA 4N1XA 5GHYA 3E4RA 1W7CA 1XX2A 3ZHHA 4ZJ3A 1CYVA 4KFFA 2L7IA 1MXOA 3JYIA 2HP5A 4DE3A 1K28A 3K9MC 3UDFA 3SOYA 2CWVA 1I2WA 2Z3XA 3NWLA 4KZ3A 3U60A 3Q90A 1TDGA 3C7VA 3UJMA 5HARA 2EUCA 4XBYA 1W6CA 5KSCA 2HP6A 3HLBA 2DRWA 1XXHB 1OGXA 3U6DA 2WADA 1E3UD 3BECA 3BFGA 2LYXA 3ZG7B 5BPVA 1N5HA 4WBGA 3BNEA 1IELA 5EVIA 2BMQB 1IV9A 3K5TA 3GPYA 3AGFA 3JVCA 1RN7A 5FQ9A 5CEBA 2H5SA 1JWPA 3C7UA 1KYIA 1Q864 3KSXA 3NM7A 3NC8A 2F5NA 1IXRC 1ISKA 4HESA 1K4EA 2ZC6B 3F14A 1GHIA 1VQ43 2VIIA 1Q2QA 5FAOA 4CDLA 4PM8A 4AW4A 4DDYA 1Y54A 1JR3A 2Y20A 3OXAA 3GLIB 2YR0A 1S3SA 4EQIA 3MPHA 1ESIA 4KODA 1K56D 5AYSC 3TOIA 2O9UX 1KDSA 3IHBA 2PBYA 3GV9A 3BLZA 4MEIA 2Y2IA 2RGOA 3FUWA 1A90A 3TWLA 3Q07A 3OZHA 4MBFA 2CHGA 2Q2EB 1OF5A 1CEGA 3NBLA 2FNQA 4LEHA 1J9MA 5A2QS 3NBJA 3W4OA 4HM3B 3IXBA 1TVFA 4D2OA 3HREA 1E9RA 2IUJA 3FKAA 5G18A 1IDPA 3LVVA 2KCDA 4HM6B 2XR8B 1MOLA 1G96A 2CIUA 4D80A 4IBKA 4OP5A 4LMIA 2ZM0A 1VQO3 6STDA 1Q39A 5IEOA 3V3SA 4U13A 1SXJE 1YLYA 3RGRA 1VQK3 1XPBA 2YNMD 4LF7M 1QYRA 1PU4A 4S2OA 2WYXA 4N6MA 1Q40B 2YFLB 5D81A 2QZ6A 4HZBB 4GOGA 4JI8M 4Q53A 3VP3A 1DJAA 1XA7A 4O3VA 5EXTA 4ITQA 3LTDA 1LLBA 2GBXB 1NWWA 1OFHA 4YINA 1GLNA 1Q42A 3GVBA 2Y91A 2XQZA 3L26A 5BVBA 3HK4A 1JKGB 3LCEA 2VQFM 3KSPA 1HNXM 1XNRM 1NNUC 2OTL3 3ZNYA 5EJCA 3GPPA 3IQAA 3FYDA 3A3DA 4XDVA 3KP1E 3U6EA 2L6OA 5KPTA 2G2WA 3NDEA 3IXHA 4P0MA 3B7CA 4Z6YA 1E32A 4HL4A 3KOZE 2HPBA 2B5RA 1LI0A 1QZMA 2DZOB 1TFKA 3S22A 1IT8A 1YJN3 1S6RA 2BT3A 4HBUA 4G4NA 5HAIA 1W5ZA 4LJ5A 2GXFA 3V92A 1K3XA 1O7GB 2ZQDA 4DR5M 5CTMA 2YFQA 4K1UA 3SAVA 3S27A 5IERA 3J80S 3S5CA 2UXDM 3E2KA 3CF6E 1C3BA 3KZTA 3T0UA 3WA3A 3HLEA 3M7GA 3GRUA 4HKVB 3O3VA 1HNZM 4JXGA 5ITXA 5EP2A 4BLCA 3M8CA 3HLFA 3V39A 3S67A 3O87A 4IVKA 1WMNA 4WYKA 4JXSA 4MGHA 3GRRA 3BNDA 4S2KA 4GNUA 2P0XA 4O02B 5EPHA 1A2KA 3NXJA 2IA7A 3T1YM 1HQCA 2RKOA 1N33M 4IBXA 1ESUA 1JQJC 4WZ4A 3QNCA 3THGA 4GDNA 4L15A 2C96A 1VQQA 3B9PA 2XRXB 2ZMAA 1WMPA 3P98A 2ML6A 5HFOA 3ITBA 5FDHA 3U1WA 3AOEC 2JDIH 2J7OA 4N6OB 3AL0C 4K91A 3IWOA 1MY8A 4JF5A 3DW0A 4KZ5A 4LF4M 5F82A 3LTBA 1GHPA 2X8AA 4UHUA 3KN4A 1VZZA 3T1HM 5CHMA 2ZQAA 4DR4M 4IT7A 1WYBA 5GLBA 3H4MA 1FR6A 4GIPA 4NREA 2CK3H 4P85A 2OLUA 2KRUA 5ITUA 3U6OA 3VP0A 5HW3A 2SBLA 1PWDA 3MZFA 4KQQA 1N8QA 2WGQA 2ZC5B 2Y4AA 2EX8A 4W5WA 1XGIA 4DXCA 3CME3 3BYDA 4PM9A 4JI0M 3U6MA 4X68A 4E3MA 4F94A 5FTLA 4GHAA 1SQWA 1JVJA 1ORYB 1XWIA 4WFOA 2DCFA 1OACA 2CFLA 4STDA 3G4PA 5TGNA 1YMSA 1OCVA 3CC23 2CHVA 3FKWA 3MHVC 2ZAOA 1PM5A 4LJ8A 3EIEA 4AEQA 4PEJA 3B4PA 3GQ5A 1W8QA 1GD3A 1DYUA 3BRMA 3CC73 3UPOA 4GRIA 4JXJA 1QAMA 4YHHM 3TWKA 3UK6A 2R9XA 2W04A 1CYUA 1JTDA 1YUBA 2Y2MA 1NY6A 1K8A4 2C5WB 3OCLA 4A5RA 1IQ8A 1FGOA 3X41A 2GEXA 5FGOA 1JN5B 2GU1A 4MMYB 4QHTA 1BT5A 5E43A 4OVMA 2Y21A 1JB4A 3CNXA 2Q07A 4XBXA 4JPMA 1K54A 4RF0A 4EV4A 4ZM8A 5EP3A 1XKZA 4FCTA 2F4VM 2Y2LA 3FG3A 2YQZA 1CI8A 3KXEC 3LTCA 4C3QA 2O5RA 5IG5A 1N77A 3MG2A 4WEJA 4PD2A 5EQLA 3NHXA 3V99A 1Q2PA 4FCZA 4GH9A 3CJMA 3PAEA 2Y73A 1HTZA 4PT5A 3G6E3 2B24B 4CGYB 4EV2A 3LMMA 1UI7A 3AGEA 3ZG8B 4DR3M 3FTDA 4LCBA 3GLGA 2WGVA 1JV2B 1O7WB 5L2FA 3DGLA 1PW1A 2KXEA 3FF2A 1G59A 3K2LA 4R4SA 2HP9A 5JBSA 3G0KA 1KVMA 3U6CA 1E4DA 2CFWA 1ROVA 3WS1A 4JYAM 2QIYA 1GD4A 2V1CA 4GC5A 3MHEA 4HM7B 5D83A 5FSRA 4GZBA 1K25A 4N6NB 2KZSA 5DYIA 2HCBA 1NRFA 5HAPA 4DV4M 2DWLA 3FCSB 1YMXA 1YI23 2BG1A 1GA0A 4LCLA 3BOSA 2D42A 1IYQA 1FJGM 1NHWC 4EIWA 2Q9NA 2EXAA 5EVIC 2LWXA 2XSHB 2OQEC 2CC3A 4K0XA 3SS5A 3SEDA 5I97A 2XLNA 4Y0OA 4IJFA 2EX2A 3EF8A 1OHOA 1Z6FA 1W01A 3J7AS 4GDBA 3EQVA 2GBWB 2DWMA 1SKFA 4P6BA 5H37D 1U60A 3GLFA 3U5ZB 4HM4B 2Z2LB 5HX9A 3GQ4A 1AV4A 3V5MA 1UUVB 1S5AA 4XXRA 1C1KA 4DV7M 1EROA 2IMJA 3G30A 4OONA 1PIOA 1K9M4 1W7FA 1QANA 1IKIA 1IVUA 5FLXS 2F99A 2ERCA 3OWYA 3ZH9B 3UNLA 2LNHC 4DUZM 1S723 1MBLA 3PBTA 4ORLA 3JUOA 2F5OA 3RE8A 2Z7AA 5FATA 1QAFA 4WZ5A 4FH4A 4LG2A 5E6JA 4DV2M 2HMLB 4I5SA 3FYZA 4B3MM 1ASKA 1E9SA 1M1K4 2E8IA 2A15A 2LH0A 4R4KA 2BMRB 4E6WA 3J27B 2QENA 3TDGA 1YLZA 2HDUA 1YIT3 1WYCA 4GMQA 3PBRA 3DGOA 1IM2A 2ZDJA 3WA2X 2MF7A 2A3UA 4GD6A 4UA7A 3VLFB 3PNVA 1GL6A 1FQGA 1O7EA 2RCXA 4S2LA 2P9VB 3WHKA 3D9RA 3F7XA 4FCVA 4GC9A 4ZDXA 3GO8A 4QOSA 2F86B 1QVF2 1NO3A 3Q7VA 3U61B 2QGUA 3W4PA 3SOAA 2ZANA 3UZUA 2RCDA 3SH8A 3TE6A 1V74A 4QNRA 3VDPA 4QHSA 1N32M 4KZAA 5DRVA 4FVMA 2ZM8A 2W9QA 4LJ7A 2WO0A 1NZOA 2X49A 3VSYA 5AIHA 5IZ7D 5AQ9A 5FA7A 4OVZB 3CMZA 4LFCM 5CGSA 3LXUX 2VGJA 4HVNA 3PBNA 1VQ73 1HZOA 3JUPA 1GCEA 3LOYA 3PFIA 3FKEA 4TX4A 1TU5A 4R3BA 1LXEA 3ZNTA 2Y2NA 2FFJA 3G713 3MKIA 1VQ93 1ERMA 2E5LM 5GLDA 1SDEA 5CHJA 2I9WA 5IF6A 1PYYA 1FCNA 3D8LA 3FGYA 3GPUA 2UU9M 4KZBA 2XSOB 3VGNA 2WGWB 1NJI4 5CGWA 4UAAA 1RJOA 3M2KA 1SXJA 1IVXA 3ALAA 1MWUA 4RX3A 2J9OA 4OPZA 2JBFA 4IJEA 1OFIA 4LJ9A 2P74A 2Y0QA 5M1AA 1VQ63 4X55A 1PZPA 1GYBA 3MZEA 1NXYA 1ZO2A 3OPPA 4B08A 5C18A 4FWGA 2PU4A 3O8YA 3LY3A 2R45A 2XSZA 3EIHA 3QAUA 1VQN3 4N1HA 1CEFA 3FTFA 3K92A 3GSGA 5ITYA 3HZPA 3A45A 5JI2E 1N34M 4JI4M 3FZWA 3GZXB 3LMLA 2KEBA 1QVRA 5EE8A 2HMKB 1IVVA 3G4S3 5DTSA 3ZC7B 1QMAA 1IBLM 3S29A 1W6GA 4DV6M 4G6ZA 3C4OA 2JC7A 2C99A 3DY5A 4D81A 3U60B 1Z5AA 4MMXB 4KZ1A 2HDSA 4EUZA 3DWKA 2FOIC 5G2GA 1WE4A 4FMBA 4PM5A 1SIIA 3QRDA 1ES5A 1SCWA 1TDHA 4RX2A 1KE4A 4REZA 3ZGAB 3QK9A 3BFFA 3PGBA 5CEDA 1NDOB 2W03A 4MGIE 5TFQA 1NYMA 4MGZE 5F3WA 3GRJA 2EFUA 1FSYA 1JB2A 3PS8A 4YFMA 2JA2A 1CI9A 1C7HA 4WW0A 3KS4A 2OTJ3 5GLAA 1J5EM 4KLNA 1JNQA 3X3ZA 3NV0A 4IBIA 1L0FA 3X3XA 4WYYA 5CHUA 4RNAA 4OKPA 2UX0A 1NU3A 3D4FA 1DGHA 4LSOA 5KPZA 3CCV3 3QHYA 5EEOA 2L7HA 3T15A 2WAEA 2Y59A 1YHQ3 4G4QA 2Z7JA 3NBIA 3Q1FA 1PW8A 2JCHA 1BSGA 2Y2PA 2H0YA 3CMA3 4LZIA 3F8HA 1OJLA 2FFFB 1NY5A 4ZBEA 4HM8B 1PJJA 4LV3A 3F7SA 1EWZA 5AEWB 4FR9A 1FCOA 1W5TA 5FQMA 5I94A 4KENB 3SXXA 1XP4A 2PNCA 2AHMA 4HZ9B 5EUAA 1M6KA 2C9CA 3MKEA 3GZRA 2OQEA 1PFPA 4I81A 5CF2A 3NQYA 3T8NA 3S1YA 3LVWA 4S2IA 4J8TA 4HYZA 3CC43 3U6SA 1IBKM 2C11A 3N8RA 4OLGA 1R4CA 5GHZA 1JWVA 3C4PA 1QMEA 2X01A 2GDNA 3NX0A 3Q8XA 5CTNA 3ZG9B 3FUUA 4LV1A 4KZ4A 2P38A 1STDA 1K54C 4NRVA 2R4EA 2QBYA 3FV7A 3A46A 2RSXA 3VK8A 4G4OA 2GU3A 4Y0UA 2LQVA 4AG5A 3RGAA 1GVNA 4QD4A 3WMDA 2DHRA 3CD63 5EVLA 1ROAA 1BLPA 1HT2E 3CF2A 2WAFA 3OTOM 2UXBM 1I94M 3MG3A 3LZAA 4N6LA 2R62A 5HGRA 4AKIA 4O2HA 1IXSB 2XFTA 4O8SA 2P5TA 3FG1A 4XUXA 3K8ZA 3I553 3ZVTA 3W0FA 3PBQA 1TH2A 1K734 1IN6A 4OPRA 1N9BA 2R65A 3L27A 4FW9A 1QAQA 3D8BA 5ITTA 1WNHA 3UE3A 2OSUA 5CERA 1EA2A 1GHMA 1XXHA 3FG4A 1K57C 3EN8A 5EECA 3EJVA 5EVHA 2Y2QA 3UL6A 3SVAA 4MB7A 3EC9A 1HNWM 4NXMM 5A93A 4BBAA 5KO3A 1E3UA 3DOAA 4E3OA 1IXZA 2G8LA 3LH4A 4LZZA 1T3TA 2CEAA 2HMOB 4LFAM 4D82A 4OX9M 2R9WA 4L78A 1J2BA 4MM3B 1VQL3 2W82A 4EBPA 3SHFA 2P0MA 5AYRB 1L2SA 4BLMA 3F9SA 3NUVA 1NVMA 4BB9A 2INXA 4L0LA 3PYJA 4GB5A 3GLIA 4FCWA 2FE8A 3R8FA 4G1MB 3KFQC 4FCFA 3BFEA 4FD8A 4N9KA 3UL5A 4R9KA 5CLKA 4NHFA 3E9SA 3SLUA 4OW0A 1OH0A 2OLVA 3M2JA 1FGQA 4R1KA 4FSFA 1IKGA 4LCMA 3FH1A 3R9XB 4KQOA 1OUNA 1DGFA 1K56A 1TFOA 2RFRA 4EV5A 3HIIA 2ZC4B 3U6LA 4K0WA 4KHPM 2KRKA 4OH0A 1N75A 2VQEM 3I7JA 2W56B 5EQTA 2CHQA 2OPFA 1O7PB 1TP6A 3HLDA 1D6YA 1HR0M 1RRLA 3DTMA 2XD1A 5FQIA 2CHCA 3WS5A 4JXWA 3HHXA 2UXCM 1VDDA 4LFBM 3BFDA 4IBBA 4KFEA 3OWSA 2HL7A 2XR0A 1I5QA 3IXGA 4L7KA 1JJ22 4RYEA 3GQZA 3KVWA 4MGKE 3J7Yd 3UPPA 4BL2A 4WZ5C 1UM8A 5A90A 3LTAA 2RL3A 4IBFA 1Q40A 1RRHA 1ES4A 1QQWA 4IBDA 3AMOB 4LV2A 3IH8A 1SJWA 3VKGA 3GZBA 3U97A 3TG9A 3TSGA 2KXGA 1YM1A 4R4RA 4XM4A 3IJEB 4I8OA 2DZNB 3HJQA 1JKGA 1BLSA 5IW9A 3NDGA 5JYOA 2D7GA 3WODG 2L09A 4XUZA 3GLHB 4PMAA 4K0KM 1IT7A 4JRFA 8CHOA 4Y0TA 3G32A 4RF1A 4FD2A 4JF4A 3N8LA 4ZPXA 3JUNA 4IPBA 3B8LA 1LV7A 2H1RA 1K55A 1RP5A 3IH9A 2W0QA 1D6UA 2C9OA 1W5SA 1LNHA 4PM6A 1IYPA 3CG5A 4ZJ2A 5A92A 4H3UA 4EBNA 1L0GA 4WWUC 2IUKA 2XGLA 1TIJA 1X37A 1N5PA 4K90B 3PCSA 3A3IA 4ID4A 3JUQA 4LF6M 5CRFA 4OQIA 3GTCA 4S12A 3VFFA 1S0WA 1E94E 1QALA 1KFVA 3VP4A 1ES2A 2JE5A 4FMAA 1YIJ3 1GL7A 4AKGA 4JI5M 4B4ZA 2FFYA 3MZDA 4B3TM 5DNYA 1Q814 1SXJC 1SIHA 1EI5A 3GWRA 4WM9A 4NSRA 2A5YB 4J9AA 3LO7A 2L4VA 2OCTA 2Q9MA 1GY7A 4I4KA 4OQGA 2WK0A 1IY2A 3IHAA 4L8PA 3AOGA 4LGQA 3I4VA 5HAQA 4EWFA 1KE0A 2Y2KA 4P87A 4GKKM 4DR2M 1FA3A 3LT9A 3EHCA 2CG0A 4JLFA 2KW0A 3KP0E 3SAWA 3CNMA 5BXQA 3GRVA 3I563 3G2ZA 1G8PA 3IF6B 5F1FA 4N92A 3MK6A 3DWZA 5CXWA 1PJIA 5AEUB 2O3OA 1BTLA 2CWTA 3SOIA 4GKJM 3MXRA 3HBRA 1K82A 2Y2OA 5KQDA 1YJ93 2Y74A 5DF9A 3MG1A 3X42A 3G2YA 5EXXA 4HJLB 4BTWA 3FSDA 1IYSA 3CTWB 8CATA 1IN7A 5D82A 3GRYA 2J7VA 3GR2A 3A98B 1NYYA 3HI7A 5AIGA 1K38A 4S2NC 2WZZA 3L28A 3U6QA 2CUZA 3HHYA 4JI6M 1N9EA 1PI4A 1LI9A 3M0EA 2OWPA 1KD14 1W5DA 3KSJA 1Z1SA 1L2DA 4B88A 1SHVA 2FXTA 1K57A 2XF3A 4AKHA 2P09A 2J8YA 2V1LA 4BL3A 3AKZA 5CXOA 2XK1A 1KWIA 1K4FA 4LZJA 2CC1A 4HM2B 1PWCA 2KA6B 4LGYA 3BLSA 3NBRA 3HL9A 1NHGC 3FUTA 4NSOB 2CV0A 1ULJB 1JN5A 1ERQA 4DR1M 4L8RC 2C6WB 2Y2GA 3W4QA 4M0WA 4K1VA 3KOYE 1XC8A 5C1BA 2KZUA 3KSED 1KGGA 5ITXE 3RGPA 2CV2A 1ZG4A 5EP4A 5A0OB 5IWAM 3N6IA 3I51A 4BTXA 2CFDA 3DZDA 2BJVA 3MYTA 1G4AE 5CK6A 1DGBA 3FF0A 1DVCA 2YFJB 4ZAMA 1ZC2A 3TL4X 1J09A 2M60A 3VSLA 5JPUA 3DUKA 3PZWA 1BLCA 1A2VA 1YJW3 5M19A 3SC3A 2Z76A 3KS8A 4FMDA 1VQP3 5AIIA 5BR8M 3Q82A 4KFDA 4HBTA 4JI2M 3CPW2 3GP1A 3HJSA 4OUQA 3O86A 4DV0M 4RA7A 3NCKA 3QWLA 1EQKA 1KGFA 1MPLA 1NJFA 5F83A 3WOFB 1QAOA 1IYOA 2C5RA 4AQYM 2Y55A 3F40A 3IG8A 1OHSA 4DV5M 1MWSA 3ER7A 3RXWA 3CCQ3 3IWIA 1TEMA 2QCUA 4LRSA 2QMIA 1Y4KA 3MSOA 1LHYA 1QMFA 4GB7A 1SDNA 3L0RA 2G2UA 1D6ZA 1IEMA 3NI9A 1K3WA 4R1GA 2F5PA 1M904 2CE7A 3OPHA 4OP8A 3NIAA 2G5GX 3G31A 4LENA 5E2EA 5F1GA 3E99A 3PTEA 1DJCA 1YGEA 1XMOM 1Q824 5IG0A 3SAUA 1FR1A 1IU7A 4CPKA 2K47A 4IVIA 1GY6A 2W2CA 1RGZA 4OOYA 1US1A 3CCL3 3U5ZA 2BJWA 4BQMA 1FCMA 4QU3A 4R3DA 3B3XA 3MXSA 3BLMA 1ES3A 4DXBA 3HWSA 1I4WA 1ZG6A 3G34A 3RXXA 7STDA 2X4AA 4N3VA 4II7A 4EBLA 5LMUM 4JF6A 3HJ8A 1FNNA 4WMCA 4XGIA 2D7EA 1ONGA 3L2AA 4JKTA 1YT4A 5IENA 4E6XA 3Q2PA 5KP4A 3SYLA 1KE3A 4Q8IA 5FASA 4X64M 3BFCA 1XMQM 2ZLYA 3GZYB 2E2UA 3W8KA 1YVBI 5FTNA 3EX9A 3HX8A 4K61A 3AJIB 4NETA 2CW9A 3WDGB 3HIGA 1TDLA 1MWRA 4N6TA 4B7FA 2QPAA 2WKIA 3NQZA 4WEKA 5CGXA 1J7KA 2QP9X 5ITQA 5DVAA 1QJGA 5GHXA 2RGHA 1G41A 1O7MB 2ZQ7A 2J7NA 1OHPA 2ZL8A 2P9VA 4E3LA 5LC6A 3SH7A 3UE1A 4G4RA 4M9SA 1HU9A 3PVSA 2BO9B 2JQ5A 3U61A 5E2GA 3PNYA 3KE7A 4MBKA 3CU3A 2BNKA 3FUXA 4WHAA 5CF1A 2EXBA 1OMEA 2ZC3B 2C98A 4KZ6A 1O7HB 2EO2A 1A67A 5D3OA 3VMAA 3WOEB 1ULIB 1G68A 3PAGA 2ZD8A 1E3VA 3H3HA 2QA43 4OVZA 5FI2A 3VFHA 1YSYA 4XB5A 1PWGA 5EVID 1SPUA 4OQ0A 3H51A 1E97A 2DXIA 1NSFA 1K55C 4E3NA 1NJGA 1IVWA 4R23A 4RBNA 3V98A 5J8XA 1BUQA 2XZFA 2YX9A 5EVIB 4OVDA 5FAQA 1BUEA 5KZHA 1YLJA 1Z59A 2XH9A 1KVLA 2Z6BA 2I7NA 1NNJA 3L29A 4DR6M 4S2NA 1L0DA 4HM5B 2ZJ9A 4A3VB 3EBTA 1KQS2 2WGWA 4XBOA 1NJ4A 2R4IA 2H10A 4X69A 4EC6A 1JR3D 1I2SA 5ELJA 4QHCA 3EQQB 3WS2A 4FCMA 1EE8A 4JI7M 1IV7A 4B7GA 5TR7A 3A3JA 4RZMA 5IEPA 2ZQCA 3FD9A </