2XF3A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
423
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSGEDVAARFIPTFAAAGNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 141
structure length 423
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xf3A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xf3A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xf3A02
4WM9A 3ZDJA 2G2UA 2Y2QA 4JBFA 1YLPA 4MLLA 1ALQA 1YLJA 3MZEA 2QPNA 3HLBA 1LL9A 5E2GA 5FQKA 4P87A 1VM1A 3HBRA 1PW8A 4N9LA 2UWXA 2ZC6B 4JF5A 1I2WA 1MWUA 5HAQA 3N4IA 3UO9A 5HW3A 3ZNYA 1ZG6A 3UDXA 4DXCA 3GV9A 4B4XA 5FDHA 4FCFA 4QY6A 5CGSA 2WKEA 2Y2NA 1FCOA 2ZLYA 3BFEA 3DWKA 2OV5A 4E3OA 1BLHA 4P85A 2XD1A 3SH8A 4QJGA 1ES2A 3IH9A 4OPRA 5CXWA 2A49A 3BECA 1J9MA 4R1GA 4HESA 1TDLA 3LY4A 4E6WA 5HL1A 5KSHA 4S2NA 1ES3A 4S2IA 2R9XA 1JTGA 3UE1A 2JE5A 3A3EA 3C5AA 1XPBA 3ZG5A 1M6KA 1FQGA 3WWXA 3M2JA 1ZC2A 2EX8A 2V1ZA 2HDRA 1H8ZA 2A3UA 2WZZA 5HAPA 5GLBA 4WYYA 4DDSA 1W8YA 3A3DA 4L0LA 4PM5A 4PPRA 3BEBA 3PTEA 2WAEA 4ZJ3A 4EQIA 5E43A 1HD8A 4S2OA 3IXGA 4JF6A 3GRJA 3SH7A 2HP9A 4KG2A 4U0TA 3CJMA 1HTZA 5EOOA 5AQ9A 2XH9A 2H0TA 3QHYA 1SDEA 4FSFA 5J8XA 3VFHA 3P09A 2V20A 4RVAA 3HLEA 1LI0A 1PWGA 4OVDA 2RL3A 3BFCA 3DTMA 4D2OA 2E8IA 3MZDA 4MEZA 5E2EA 2EFUA 3BYDA 3C7VA 3M6HA 5EVIB 4E3JA 4C75A 2WAFA 3O87A 3S1YA 1W8QA 4K0WA 3NIAA 5FQ9A 3OC2A 4X55A 1ZKJA 4OOYA 1MWRA 3N7WA 4BLMA 1CK3A 1BLCA 5EOEA 4OPYA 3GSGA 2P9VA 1YT4A 1DY6A 1NYYA 4E3IA 1Q2PA 2Z2LB 5M1AA 3D4FA 2XEPA 1ESUA 4BL2A 1FCNA 2Y2HA 4KZ5A 3N8SA 3ZG8B 2OLUA 1MPLA 3BFFA 4WMCA 5CECA 3ZFZA 5D3OA 4XUXA 1K4EA 2WGWA 2IWBA 3Q7ZA 2C5WB 2PU2A 4EBNA 1IYOA 3LO7A 5DTKA 3SS5A 3FKWA 5DF9A 3S22A 4KZ3A 1MBLA 1L2SA 1FR1A 3AGDA 3FWLA 4DF6A 4DXBA 1YMSA 2WGVA 2X01A 4IVKA 1PWDA 3O3VA 2XFTA 1PZOA 3EQUA 5FI6A 4Y0UA 1I5QA 5IHVA 2Y2MA 4EBPA 2EX6A 2VGJA 3HL9A 5FI2A 5GLAA 4GD8A 1K54C 2ZQCA 3OPLA 4Z9QA 1FCMA 4ZJ1A 3IWIA 3Q1FA 3IXBA 2HDQA 1K56A 1N9BA 1TVFA 1XP4A 2QZ6A 2XGNA 4OPQA 4X56A 3IXDA 4OLGA 2J7VA 4WMCD 3NC8A 4JXWA 5G18A 5EECA 3ZVWA 2JC7A 2ZMAA 3LY3A 3HVFA 5U47A 4DKIA 4E3NA 2H0YA 2ZC5B 3OCLA 4JXVA 1XGIA 4IBRA 4WBGA 2B5RA 2EXBA 4LCMA 2VGKA 3VP4A 3A3IA 5CGWA 5E2FA 3BFDA 4OQGA 2C6WB 4EWFA 1NRFA 3UE0A 3VOYA 1L0DA 3N8LA 1N4OA 1SKFA 1K4FA 2DCFA 3LEZA 4RA7A 2I72A 2CC1A 4LENA 1FOFA 1DJAA 4QHCA 4MBKA 1O7EA 2EX2A 1GA0A 3ITAA 4WEJA 1WYBA 3ZGAB 1K56D 2ZM8A 2G2WA 4EV4A 4DE1A 3W8KA 1YLWA 3WS0A 2ZC3B 1IYQA 3NBLA 1YLYA 5KSCA 3HLWA 2WZXA 4CPKA 4Y0OA 4XUZA 5F1FA 3IH8A 3WRZA 4GB7A 4C3QA 4S2KA 4EBLA 5DF7A 1PW1A 4KZ4A 1K57C 2Y2OA 1IELA 4DE3A 2ZC7A 4HEFA 5KMWA 1IKGA 2Y4AA 1MWTA 4OQ0A 4OQHA 2HDSA 5GHZA 1SCWA 1IEMA 3OZHA 4UHUA 3GVBA 4OH0A 4UA7A 3UNWA 1CI9A 1K6RA 1XXMA 4UAAA 3ZG9B 1GA9A 5CHJA 1NXYA 3QNBA 2V2FF 3HLFA 4GNUA 3V5MA 1VQQA 1PI5A 3IHBA 3NCKA 2Y2GA 1PZPA 3G30A 4N1XA 1K25A 1S0WA 3MKFA 4LV1A 3PBOA 4LV0A 4N92A 5AQ7A 4PMAA 3ITBA 1BLPA 1ONHA 4QY5A 3UPOA 3UE3A 1TDGA 1XX2A 5FQJA 4GD6A 5GL9A 2ZQ7A 2QMIA 1S6RA 3ZNTA 1U60A 1G6AA 3V3SA 3UN7A 4KZ6A 3B3XA 3O86A 1KDSA 1NY0A 4OOLA 4ZBEA 3W4OA 3WS4A 4YFMA 2HP6A 1WYCA 1L0FA 4H8RA 4OOMA 4S2NC 5CTNA 4Q8IA 2P74A 1LLBA 4E3KA 2X71A 3RXXA 3E2LA 2GDNA 5GHYA 2WK0A 5L2FA 3OCNA 4P6BA 1BUEA 3PAGA 1XA1A 4GZBA 4Y7PA 3MKEA 4X53A 5TGFA 4BQMA 3HLCA 5FASA 1KDWA 3ISGA 3PBRA 4IBXA 4QU3A 3WRTA 3Q82A 1E25A 1YLZA 3I7JA 3N6IA 1W7FA 4GKUA 2FFFB 1E4DA 5F1GA 1L0GA 4OPZA 3BLSA 1C3BA 1WE4A 3RXWA 4X6TA 3C4OA 4WZ5A 3IT9A 4KQOA 3IHAA 1KE0A 3TOIA 4E6XA 5KZHA 3VSLA 2J8YA 4JLFA 4OP5A 1ZG4A 4R23A 2Y91A 1XKZA 4FH2A 1MKIA 1YLTA 3HUNA 2XLNA 1LI9A 5EVIC 4NETA 5TR7A 1EWZA 1K55A 3AGFA 3TG9A 5F83A 1DJBA 1E3UD 1KE4A 1IYSA 1NYMA 1EROA 3NI9A 1PIOA 2XQZA 3Q7VA 3IF6A 3CMZA 1K38A 2EFXA 4JXGA 4ZAMA 1GHMA 5CTMA 5HX9A 1TEMA 3HREA 3C7UA 1G68A 3ZG0A 4MBFA 5I94A 3BFGA 4S2PA 4OKPA 5CHUA 3G2YA 2WKIA 3MXRA 4ID4A 3UDFA 3DWZA 5CRFA 5GLCA 3UDIA 3P98A 4MBHA 1JWPA 4HBUA 4PM6A 4KZ8A 1KVLA 4IEDA 3UY6A 4KENB 1CEFA 1SDNA 3M6BA 4R3BA 4JKTA 4O7DA 4UA9A 1EI5A 1FSYA 5FI7A 3G4PA 1AXBA 1H8YA 3V50A 1YM1A 4DE0A 2J9OA 4R4SA 2J9PA 1MWSA 1JVJA 4JF4A 4PM9A 3G2ZA 5FAOA 3IF5A 5AQAA 3G31A 3HUMA 3M2KA 4FD8A 3UPPA 2ZM0A 2OSUA 3HLDA 1BZAA 4M3KA 3V39A 5A90A 1ERMA 4OP8A 2XFSA 4RX2A 3RJUA 1RGZA 2H10A 2ZQ8A 3OPRA 4HBTA 5EVLA 5HARA 1CEGA 3OPHA 1OMEA 3ZCZA 1YMXA 2Z2MB 3VOZA 2ZM2A 3C4PA 1ESIA 4MNRA 2HPBA 2Y59A 2BLSA 2DNSA 4LCLA 5FAQA 4KZBA 1L0EA 4GN2A 5CGXA 1ONGA 1Y54A 5FQIA 2ZC4B 1DJCA 1CI8A 3VP0A 1KGGA 3SS4A 3ZVTA 1JWVA 3W4PA 1MXOA 3SS3A 3PBNA 2WUQA 5E2HA 1QMFA 3GQZA 1GCEA 1XGJA 4DRTA 3PBTA 5FATA 5A93A 3ZG7B 5BOHA 5FSRA 3VMAA 2Y2JA 3VP3A 4S2MA 5DTTA 2BG1A 1O07A 2Q9MA 3G35A 1FR6A 1I2SA 4ZDXA 4EUZA 4GDNA 2ZQAA 4DDYA 5CEDA 1NZUA 1IYPA 4WELA 2WADA 3AGEA 2Y2IA 2ZQDA 3A3FA 3Q07A 3HLGA 5DF8A 4K91A 4PM7A 2FFYA 5GHXA 2Y2LA 3E2KA 3CG5A 3WS5A 2Y55A 5FQMA 3OPPA 3UPNA 1BT5A 1RP5A 2IWCA 5FA7A 3S4XA 3CZDA 1GHIA 4Y0TA 5M18A 3MZFA 4GDBA 4XXRA 5CHMA 1ES4A 2RCXA 5TFQA 2XR0A 1Q2QA 2XDMA 3FYZA 1E3UA 3W4QA 4CJNA 4F94A 2WKHA 3NDEA 5AQBA 4RYEA 4BL3A 3BLMA 4KZ7A 4BD1A 2ZJ9A 1M40A 2P9VB 4P0MA 1GHPA 3MBZA 3PAEA 1KVMA 1NJ4A 4X68A 3LCEA 5A92A 3IWQA 3BM6A 4UA6A 1BULA 1XA7A 4U3TA 3FZCA 1Z6FA 4LV3A 3FKVA 4KQRA 4NK3A 1BSGA 3MXSA 2WGWB 3MFDA 4R4RA 1HZOA 3WS2A 5CERA 2XK1A 1FSWA 4K0XA 4R3JA 3ZHHA 2XF3A 4JPMA 2ZD8A 4RX3A 3EQVA 2PU4A 5DVAA 1ES5A 5EVIA 1LL5A 1H5XA 4N9KA 5EPHA 4A5RA 4OONA 5CEBA 4KG5A 2Y2KA 1KGFA 1KE3A 1JWZA 3G32A 3Q81A 3Q7VB 3TSGA 5GLDA 3IF6B 4QB8A 1NZOA 4C6YA 3VSKA 3DW0A 4WZ5C 1BTLA 3G34A 2XD5A 4GOGA 4IVIA 3PBQA 3SOIA 1K54A 4E3MA 2EXAA 2DRWA 3GTCA 4S2JA 3VP2A 3BRMA 4N1HA 1ERQA 3GR2A 4YINA 3IXHA 1JTDA 1K55C 2WGIA 1W5DA 3VP1A 3JYIA 2Q9NA 4KQQA 2H5SA 5HFOA 5EVID 1MY8A 1YQSA 4ZJ2A 5JYOA 4X69A 4WEKA 4LV2A 3IWOA 3IF6C 2WYXA 4R0QA 4BJPA 3QNCA 4OLDA 2ZQ9A 4KZAA 3N8RA 4B4ZA 3GMWA 1QMEA 4BENA 3PBSA 3FV7A 5HAIA 5M19A 1SHVA 3NY4A 4KZ9A 2HDUA 2R9WA 4JXSA 5JYPA 4WZ4A 1K6SA 1PWCA 4U0XA 3NDGA 4DE2A 1BLSA 5FAPA 3SH9A 3IQAA 4S2LA 2EX9A 2HP5A 2JCHA 4KG6A 2IWDA 1PYYA 1HVBA 3O88A 4FH4A 4OQIA 4QD4A 5FQQA 5EUAA 1RCJA 1PI4A 1W79A 2Y2PA 5A91A 3WS1A 2X02A 4B88A 5DTSA 3VFFA 4PM8A 2JBFA 1K57A 1LHYA 5EE8A 4ZTKA 2PBYA 4BD0A 3HUOA 1KGEA 1RGYA 4E3LA 1IKIA 2OLVA 3V3RA 5F82A 3A3JA
chains in the Genus database with same CATH superfamily
1XHBA 2VIIA 4FCZA 3NUVA 4LGYA 2K6BA 4K1UA 3HLBA 1LL9A 3SHGB 3DTIA 1Y4KA 4HM2B 4MMZB 3BJNA 2W2CA 4PEJA 2UWXA 2F5SA 3GLFA 1MWUA 1GKIA 3GLHA 5ITQA 3N4IA 5HW3A 3ZNYA 2M1CA 5IERA 1XMQM 3CMA3 5HPIA 2Y2NA 3UK6A 2L4VA 1K41A 2ZLYA 3Q1CA 3BFEA 3SH8A 1TH3A 2BJWA 1VQ43 1ES2A 3IH9A 2A49A 4OU7A 1DGHA 3BECA 4H3UA 1TDLA 3LY4A 2R4IA 5KSHA 3FCSB 3GPPA 1ES3A 4S2NA 4JI3M 4S2IA 1BRSA 3PZWA 3C5AA 1XPBA 1FZUA 3NHXA 1IQPA 2DNAA 2H0HA 2Z3XA 4K0KM 1Q9EA 3A98B 1IQYA 3HOHA 2V0UA 1QJGA 2XGLA 4CLCA 1XJ3A 4JGOA 2HDRA 3D8BA 2WZZA 2XZFA 5GLBA 3URPA 3KP0E 2I9VA 4L0LA 2R65A 3T4LA 4PPRA 1JBTA 1DE3A 2YFLB 5GSPA 4B3MM 4EQIA 3K7CA 5E43A 3CCS3 4OUQA 4JF6A 1H8MA 3GRJA 2JZ0A 2R4EA 3ECFA 1QAKA 1NRJA 4U0TA 3CJMA 1PU4A 1PYLA 5EXTA 1JRQA 3U60A 1JZDA 2L09A 4DR3M 2D02A 4FSFA 4CHTB 3LCUA 1IXSA 1F4IA 2F4YA 1DGGA 1UM8A 3GRUA 2CWTA 3P09A 1PWGA 2CRUA 3DTMA 4D2OA 2E8IA 2EFUA 3M6HA 3GPYA 3HIIA 3S1YA 3KKGA 4D60A 1VDLA 1WGNA 1L2BA 1IV7A 4R9LA 3NIAA 4K0WA 1WMOA 1YAXA 2KHHA 5J7EA 1CUKA 1CQSA 3V99A 5LMNM 1IDPA 1ZKJA 3LQRA 4X55A 1CK3A 1BLCA 5DJTA 4PCZA 5BIRA 4OPYA 5EOEA 1T2HA 2D7HA 3KSXA 3EBTA 3R4KA 2JKFA 3CF2A 2EJSA 2Z2LB 1JB4A 5CLKA 4L4UA 4CQHA 2L4EA 1FCNA 2OOLA 4KFDA 2CFOA 3KZTA 3ZG8B 4DR4M 4RKUF 3T8NA 5CECA 5D81A 2LB9A 1YI23 4LF6M 2VJWA 2WGWA 2C5WB 1NJFA 4NXFA 1JB2A 2ZBBA 2OWPA 3FKWA 2E2VA 3NOTC 3S22A 3CC73 4KZ3A 1VQ93 3Q8XA 3ER7A 1V9YA 1GOVA 1GD3A 2ZDJA 4HM4B 4RNAA 3O3VA 1AV4A 5FI6A 3HX8A 1VZZA 2EX6A 2ZMVA 1LOYA 3CPOA 2E8JA 3HL9A 5TBMB 1K54C 1LSXA 3T50A 3Q1FA 3J80S 1NO3A 3PCRA 4BTYA 2QENA 2G3QA 2ZA4A 3D9YA 1X0OA 4MGIE 1OTBA 3IXDA 1T19A 1BSEA 4UQIM 2J7VA 4WMCD 1BRGA 1DYUA 3ZVWA 2LBCA 4WP2A 5C18A 3X3XA 4CIZA 3WHOA 4JXVA 2Z7JA 4LCMA 2PRFA 1DO2A 3TWLA 4JF8A 3T1RA 4KFFA 1SXJA 4BBAA 1NRFA 3LI9A 3UE0A 1RN1A 2CFWA 2YFQA 3F92A 1JN5A 5AIGA 2I72A 2XLJA 4EXOA 4MBKA 1FGOA 1UFZA 2DWMA 4OK0A 3ZGAB 1PNEA 3S67A 1K56D 2KF4A 1YLWA 4WHAA 4AQYM 3EIHA 5FW5A 3NBLA 1U5OA 2Y20A 3HLWA 3V67A 3GLHB 4CPKA 2WZXA 1ZX2A 1OFHA 5F1FA 2KF3A 4C3QA 2E2TA 1GL6A 3U6EA 4S2KA 5DF7A 2AVXA 4KZ4A 4JI1M 2Y2OA 1Q02A 1YIT3 4DE3A 5KMWA 3C2WA 4RNTA 3PNVA 3L29A 1DMMA 4Y13A 2X8AA 2LTUA 1MZUA 3UB5P 4GKJM 2C98A 3HIGA 3UNWA 1DGHB 4GB5A 2V6ZM 2PD8A 3CUEA 2QZ4A 4NC6A 2V2FF 3HLFA 3V5MA 3LW5F 3BY8A 1VQ83 5G1KA 1PZPA 1R7RA 1RCKA 3DY5A 4CLCB 5L09A 1W63Q 3LR3A 3T4JA 3PBOA 4LV0A 1IBMM 3LIFA 1VHMA 4PMAA 5AQ7A 2JQ5A 3KCHA 4GC9A 4QY5A 3UE3A 5GL9A 3G0KA 4B3TM 2ZQ7A 2KRUA 2QMIA 1S6RA 3KO6A 5DRVA 3CD63 2KNZA 3B3XA 3U60B 1KDSA 3WS4A 4B9OA 1HLUP 4FR9A 3K9MC 2HP6A 1L0FA 1IXSB 2P74A 4HP4A 2WO0A 5BU4A 2EO2A 1PM5A 3RXXA 4E3KA 3E2LA 1UCKA 5GHYA 2ZL8A 1TP6A 3T1QB 5HSQA 4E3OA 3QWLA 4P6BA 1T3TA 4GZBA 1M1K4 3MKEA 1VETA 1KDWA 4UEYA 4QU3A 5LMUM 1QAFA 4MN7A 1E25A 4RF0A 2GX5A 3WRTA 2LVQD 1B3SA 2P38A 3BLZA 3I7JA 3J2PB 2O9CA 4H6JA 4I39A 3A46A 2KCDA 3F8XA 1AR0A 1RGCA 2OO9A 4EUVA 1EKMA 4EC6A 4AKHA 3KP1E 3EBYA 1C3BA 3H7WA 4X25A 2KF6A 3KOZE 3ICYA 4NXNM 1T1BA 5KZHA 4KQDA 1YHQ3 3FF0A 2HMLB 3VSLA 2J8YA 1RGHA 4OP5A 2AADA 1JQJC 3DOAA 1ZG4A 2IUJA 3KSHA 4R23A 1MGRA 5ELJA 2FGTA 3FG4A 1XKZA 2GEXA 4FVMA 1B20A 4NETA 1O7MB 3WODG 1OAOC 1ZMWA 3SYLA 1IVUA 1E3UD 2EKKA 5KPZA 3CCL3 1NYMA 2OTJ3 1EROA 4DV4M 1HKXA 1M1XB 1RTUA 2XQZA 4WL9A 3F8HA 1AWIA 2EFXA 1GHMA 1TEMA 3HREA 4IBKA 5FTKA 4XT2A 3DFZA 4L7KA 3EEAA 1WMNA 5JI3E 3PXPA 4OKPA 3ZQ5A 2ACGA 4L9EA 2H0IA 3MF0A 2R4JA 3CCQ3 1YSQA 2B95A 1MOLA 2K7SA 5GLCA 3FTFA 1P3QQ 4MBHA 1YSPA 1V74A 4HM8B 4MEIA 2KRTA 3EB8A 2Z6CA 2C10A 3C38A 1DP9A 1SDNA 1SXJB 3FG8A 4A3VB 1QAOA 1MU5A 4DV2M 3OTOM 1S5AA 2KX6A 1FSYA 4IBEA 1KFVA 1JN5B 4KUKA 1MWSA 5IS1A 1U8CB 1QDTA 2FNAA 2J7NA 2W82A 1LNHA 5FAOA 1DVDA 3IF5A 3HUMA 1ZO2A 3M2KA 2E5LM 1A5TA 4K90B 3DUKA 3HLDA 2QNJA 1STFI 2H10A 1L5GB 1SKOA 3OPHA 4O8GA 1OMEA 1I2FA 3ZCZA 1C1KA 1ESIA 4MNRA 3C3DA 4EV2A 2W3GA 4PKYG 3E4QA 1UCIA 4LCLA 2X4AA 4ORLA 4G3OA 1Y54A 3F40A 2ZC4B 1QALA 6GSPA 1DGFA 3S28A 2QJ7A 2IMJA 5IEPA 3LTCA 1JR3E 3BIRA 4KO8A 1Q40A 1GSXA 3LTBA 4X2HA 3SS3A 3T15A 2L2DA 1QMFA 1YPRA 1GMQA 2P05A 2QCUA 3K2LA 3MPHA 3VMAA 1YJW3 3L26A 1DVCA 2DZLA 3TRCA 4FTXA 1I2SA 2G8LA 4EBGA 1W63M 3HJSA 4REZA 1Z09A 1NZUA 2QP9X 1A2VA 1IYPA 3QP4A 4Y2FA 5DREA 1OQYA 3AOEA 1YJN3 2Y2IA 3KDSE 4G4OA 1YGEA 3AGEA 3LFVA 4ZRRA 5DF8A 2CFLA 2R46A 3L7HA 4CCVA 4P6ZM 3KFUG 2CV1A 5IG3A 3G8ZA 2Y55A 5FQMA 3UPNA 1SQWA 5EP1A 4HBRA 4EESA 3SEDA 1YVSA 2SBLA 2W9PA 1VETB 2AAEA 5TFQA 2HWJA 3A0SA 3GRRA 3Q8GA 3VDUA 4CJNA 1IN8A 3UJNA 1JR3A 4H6JB 2I7NA 2HCBA 4DV0M 3SLUA 3BLMA 3UNLA 1KOUA 3GZXB 1M40A 2P9VB 2KLIA 4M9SA 4P0MA 3D9RA 3H7WB 1IY0A 4I3JA 3CNXA 4ETZA 3IWQA 1IN7A 4GS9A 3IS2A 4IT7A 4U3TA 2HKJA 3WHLA 5JI2E 2J80A 4NOOB 2O25A 3J27B 3FKVA 5AIHA 3MXSA 3MFDA 2ZMFA 4F3LA 4G1MB 3D8LA 4R3JA 1CQAA 1JKGB 4MCWA 5EP4A 3NBIA 4BIRA 4HM7B 3HHYA 1ACFA 1ES5A 2GQFA 1EEJA 5LC6A 2KW0A 4A5RA 3T1XA 2R18A 1DV0A 1RLSA 3NBXX 2IYJA 3H82A 2Y2KA 1BYWA 1KGFA 3HJQA 1GD4A 4IBCA 4LZZA 1VEGA 2JHEA 2DAKA 3BNEA 1NZOA 3NWLA 3BNDA 3EJVA 1A67A 3FC7A 3EEHA 1BTLA 4WZ5C 4DV7M 4XT2B 4GOGA 3SOIA 3VKGA 4E3MA 4S2JA 2ZHXB 2LHCA 4FWHA 5AEWB 3SYKA 2L7HA 3EQQB 4HEOA 4CGYB 4FWDA 1ERQA 3KSJA 3KOXE 1BNSA 1JTDA 2WGIA 1W5DA 5IWAM 3JYIA 1K3XA 1TH4A 2OQ4A 4N6UA 1OT9A 3OV4A 5EVID 1MY8A 4K1VA 3R7WB 1RU3A 2WYXA 4R0QA 4B08A 1ISKA 2B02A 1QMEA 1H0MA 5M19A 1A2PA 1STZA 5IENA 1WGLA 2B18A 4KZ9A 1WR1B 4JXSA 1SKOB 1UI7A 3HZJA 1JB5A 3EIEA 4FW9A 2XSZD 2GBXB 4S2LA 3L2AA 1LT0A 2HP5A 4JGRA 1BRKA 5AVFA 1GOYA 2HF6A 3C9PA 2W0NA 4FH4A 3WS1A 2YQZA 3G6E3 3S27A 4K08A 1K57A 1N78A 3X3YA 1Q40B 4ZTKA 2JZ1A 4NXEA 3IBRA 3V98A 4FCTA 2OLVA 4XBXA 1BIRA 1B27A 3A3JA 2LVAA 3I553 2P7JA 4MMNA 3ZDJA 1BNEA 1OACA 1YLPA 2VQEM 4HKVB 1ALQA 4UN2B 3MZEA 5E2GA 1NWWA 3OWSA 4LG2A 4P87A 2CX1A 5FQKA 4WLAA 5HD3A 3X42A 1VM1A 4F2LA 3QYBA 1H6UA 1US1A 1PW8A 2PYRA 3J7Yd 2WOFA 4N9LA 3MG2A 2ZC6B 4IHQA 1MX0A 5HAQA 4EV5A 1LRAA 2VF8A 1E3RA 2DWLA 4HZBB 3BQ8A 2R6FA 2CFGA 1VG5A 2WKEA 4R3AA 1OGZA 3RTYA 5HWWA 1OJGA 1EIJA 3K92A 4P85A 2UXCM 4DR1M 3MFXA 3SFZA 4R1GA 1K0KA 5HL1A 4KHPM 4N6V0 4L9GA 3UE1A 2YFJB 1JTGA 2JE5A 3AV0A 3S7PA 2DWZB 1FQGA 4P16A 2V1ZA 3FKEA 1S67L 3P7NA 3LCVB 2MC8A 2IA7A 4QNRA 1H8ZA 3JR4A 4X66M 3IMAB 4NKPA 4WYYA 1W8YA 4DDSA 4PM5A 1VDDA 4N6MA 4GSPA 2G7UA 4NRVA 2WAEA 4ZJ3A 5FDSA 3LT9A 1HD8A 1T2IA 4GS9B 3IS2B 5AQ9A 1HTZA 1BSCA 2F56A 2XH9A 3C3EA 1GY5A 2H0TA 2MJ5B 2NQ8C 3KS4A 4HIAA 4F3LB 3VFHA 4FMCA 3HLEA 3FF2A 2RL3A 2APLA 3MZDA 5F68A 1W8QA 2QYBA 2V1CA 1TS7A 3VE4A 1Y28A 3H82B 5HDCA 3N7WA 4DUZM 1P0ZA 1HQYE 3GSGA 4RQ9A 1D2NA 3VKHA 2DXIA 1DY6A 1YT4A 4E3IA 3KS8A 1Q2PA 3MQQA 5M1AA 1FGRA 3D4FA 2XEPA 3A0RA 2IUKA 2W56A 5IG0A 3S7QA 4EQ1A 5H37D 4WWUC 2OLUA 1MPLA 1N33M 3BFFA 4WMCA 4OX9M 1Z6TA 3GZBA 1HYFA 4XUXA 3SC3A 2IWBA 2DVWB 2PU2A 5ITRA 3LIBA 1IYOA 1AQZA 3RGSA 3SS5A 2A2LA 1LOXA 1IN5A 2CHGA 3FWLA 1RGAA 1F9IA 1FR1A 1L2SA 1PJJA 1HZ1A 1YMSA 3AGDA 3G4S3 4DF6A 8CATA 3U61A 3B4OA 2XSSA 3IHPA 4YOFA 4PDGA 1TDZA 2XFTA 1PZOA 2O99A 3LR5A 4O2HA 4RZMA 1I5QA 2OQEC 2Y2MA 2PR5A 3GLFE 2VGJA 5JPPA 3KYZA 5FI2A 3GLHE 3Q90A 1NHWC 3B9PA 3OPLA 1FCMA 5BPVA 1K56A 4GKKM 2HMJB 3JUPA 4OPQA 2XGNA 2ZAMA 2FH0A 4DMZA 4OLGA 3JUOA 2A24A 3U6QA 3BNCA 4FCWA 5EECA 4E3NA 3HVFA 1PRQA 2ZC5B 3H3HA 2MJ6A 5A2QS 2OTL3 3GDIA 3RE8A 2BNGA 5CK6A 1CYUA 4WBGA 2R41A 4H61A 3IX4A 1XNRM 2HL7A 1L3LA 1ZGXA 3A3IA 3NHQA 1HNWM 3FD9A 5E2FA 4EW7A 1QUSA 1QYRA 4IIWA 3LOYA 3VOYA 4CLCE 3T4QA 1L0DA 1N4OA 1EQKA 3LEZA 1LNIA 1K4FA 1B2SA 4LENA 4JYAM 3K8ZA 3V92A 4QHCA 2KDKA 3VDPA 1O7EA 4D80A 4KT3B 2UV0E 2QQ8A 1NU3A 1WYBA 4EV4A 4M4XA 4DE1A 2ZC3B 2Q0OA 1UWPX 2VGLS 2RCDA 4AG5A 5ITUA 2L0WA 3JVVA 4CJ6A 2D7EA 3IH8A 4BBTA 2JKRM 1OIPA 1R2YA 1PW1A 1I3IA 3MWZA 3SXXA 1S66L 2R44A 1Q3BA 4K61A 4HEFA 2Z7AA 3FGYA 1IKGA 3KYEA 1MWTA 1VQK3 2PHYA 4I4LA 3OBFA 4JGQA 4NG2A 4OQ0A 1WXQA 3CCE3 3OZHA 4OQHA 4UHUA 3K9OA 3HZPA 3GVBA 4OH0A 5EP2A 2F86B 2O3OA 6STDA 4GLQA 5F69A 1CI9A 1XXMA 1BSAA 3ROBA 5KP4A 1NXYA 3QNBA 5CHJA 5DFXA 1VQQA 4DBGB 4XDVA 2OOVA 1YE9A 3IHBA 3NCKA 3C8CA 4N1XA 1CYVA 4EIWA 2OPFA 4GJ4A 3AGOA 5EM0A 3U6MA 1BOXA 3ITBA 3SAWA 3TW8A 1BLPA 3T1SA 4RBNA 3GLGE 5FQJA 2UUBM 5FEFA 3F1PA 7STDA 1EE8A 2H1RA 1R4GA 4XBYA 1AY7A 2RSXA 3CF0A 1C7YA 4LJ8A 1GMRA 3EC9A 1NY0A 4KZ6A 1RGLA 4OOLA 2DAEA 4YFMA 4LRTA 1W5TA 4OOMA 1V58A 5J3WA 1P97A 3MSOA 2WKRA 4R71A 2J7OA 3OCNA 3HGIA 1XA1A 4Y7PA 2JP7A 2CG1A 4BQMA 1T5YA 4HM3B 2J3TD 3ISGA 3JUNA 3OWUA 2DENA 2RKOA 2EA9A 1W5SA 4F1IA 3UB7A 3N6IA 1W7FA 2C9OA 4X1MA 2KXEA 1BU4A 2F5QA 3TWMA 1L0GA 4OPZA 2W56B 5AJGA 3RXWA 4WW0A 3IT9A 4LGMA 2LVPC 3LZAA 3AFHA 1SXJE 1KE0A 3IHAA 4JLFA 3UB1A 2BMRB 4STDA 2JXNA 4FH2A 1MKIA 3HUNA 3MS6A 1ASKA 1LI9A 5EVIC 2F5MA 1J5EM 3GLGA 3LMMA 1I94M 2XRXB 4HM0B 1K55A 4LLOB 3U61B 3DGLA 3TG9A 3FG1A 1DJBA 4MGHA 5FSWA 4I3AA 2R78A 4LF4M 4MDZA 1ZHHB 3S29A 2W3FA 4LJ5A 3G713 2V1UA 1OJLA 3S5CA 3K9PA 3UGJA 4JXGA 3GP1A 3STDA 4ZAMA 1GLNA 3GLIA 2DWNA 5CTMA 1TU5A 4Z1WA 3PS8A 1X37A 3HWSA 4L8RC 1VQ63 2A24B 4X1LA 2DHYA 4PHTA 4JI4M 4HAAA 2UUAM 2I9WA 3F7XA 4O01A 1FUSA 2QPAA 3MK6A 3ZH9B 1GO5A 5CX7A 3UDIA 3FUTA 4BU4A 3GRDA 1BUQA 3UY6A 3SMSA 2WSCF 4GRIA 3KX0X 1F98A 2Z4SA 5FI7A 3KIIA 1DP6A 2C11A 1N9OA 4AFIA 1W02A 4JF4A 4PM9A 2M7VA 2XA7S 2UGIA 2V9AA 2F4VM 1ZQ9A 2W0QA 3LH4A 2V8FA 3VGNA 2D42A 2J5YA 4XK8F 1BZAA 3V39A 2CKFB 4FWGA 4OP8A 2XFSA 4XB5A 1RGZA 3W68A 3QK9A 4NPBA 1CEGA 4IBIA 3B4PA 3HKPA 1W00A 3RGRA 1YMXA 2Z2MB 2JKGA 2ZM2A 3TDGA 3T12B 3VOZA 3GLFB 5EXPA 4HQAA 3S7OA 4NXBA 2DNSA 1NY6A 3W0LB 2M5ZA 1L0EA 4GN2A 2VF7A 1ONGA 2ZTCA 5FQIA 3MG1A 3NULA 4R6LA 3U6LA 1DJCA 2FZ0A 5EP3A 3BW6A 3SS4A 4GHIA 3ZVTA 1SARA 1JWVA 3CAXA 5FLXS 2AHMA 3DTEA 8RNTA 2WUQA 4GW9A 3SARA 1KSFX 4KFEA 3PBTA 5FATA 5IZ7D 5BOHA 1BVSA 2K0MA 2Y2JA 4XM4A 3VP3A 1JB0F 3EOIA 2BG1A 3CLOA 3BB9A 5FTMA 1CF0A 2HGVA 3G35A 2KNVA 2SARA 3GRVA 1NWZA 2W1RA 4GDNA 4HOHA 4GMQA 3SAVA 4B93A 2PZVA 4JI7M 1H3QA 3LI8A 4LZJA 3F1PB 1D0KA 1OTIA 3F14A 2Z6DA 4WELA 2G5GX 4R9KA 2OAQ1 4R80A 3A3FA 2QHOB 2OCTA 3VSYA 4K91A 3RDEA 4FMAA 2Y2LA 3KXEC 3GRYA 1TS0A 3WS5A 3I0YA 3OPPA 1F8NA 3VE3A 2L1MA 4Y0TA 3NQYA 1P9WA 1KC84 3IX3A 2J3WA 1OHSA 2A5YB 2XR0A 4LFCM 2YFIB 4BMWA 3FUWA 1OFIA 1V34A 4IBFA 4JI0M 5G1LA 3LR0A 3GZYB 1DP8A 4LSOA 4HJ3A 3NQZA 3MBZA 3PAEA 4M0WA 4JRFA 3LCEA 1TDHA 1OIZA 3V76A 1BULA 1XA7A 3MQ0A 4MM3B 7RNTA 4HVNA 3FZCA 2P0MA 1Z6FA 4QPRA 2DZNB 4AZFA 4KQRA 4NK3A 5HL6A 2WGWB 2B3TA 3U4LP 5TJJA 2L1SA 2XK1A 2HAKA 3ZHHA 3FRIA 3GLGB 5IT9S 4RX3A 3EQVA 3GPUA 3J81S 3BNBA 5EVIA 4LPZA 2KZUA 5EPHA 1V9ZA 1F5MA 1IN4A 2M7UA 5CEBA 1ORYB 2VKSA 4CLCD 3IG5A 4Q7JA 5KP3A 1DRMA 2STDA 4HM5B 2Y79A 3CGWA 3GLIB 1T6OA 4C6YA 2BT3A 3DW0A 3DAVA 5E26A 3G34A 2XD5A 3CCM3 4IVIA 5L07A 1ZS7A 4R38A 2JY6B 1N77A 3DMCA 1K54A 5STDA 1ULJB 2DRWA 2EXAA 3GTCA 1QANA 3F9SA 4U13A 1Y4OA 4PT5A 1IFYA 1Q3CA 2XSZA 1X1UA 3BRMA 4XBOA 3K3CA 4N1HA 2CP8A 4YINA 2JN7A 3FE3A 3U5ZA 3UJMA 2HOHA 3KE7A 1NNJA 1STDA 1G02A 1JBRA 1UI8A 5HFOA 4DV1M 2GU1A 1G6OA 2UUGC 4ZJ2A 3B42A 2ZL1A 4WEKA 2W6JH 3IWOA 3IF6C 4BJPA 1J7KA 5A0OB 1I2EA 2KXGA 5F5YA 4LRXC 1W2B2 3GQ3A 2UX0A 4BENA 1QAMA 3PBSA 5HAIA 2PBDP 1IVXA 1WA9A 1I70A 1UGIA 4LCBA 1I0XA 5I5LA 5MC7A 2W1TA 1JNQA 1S1ZA 4NREA 2JUJA 2V1LA 3B89A 3IQAA 2DHRA 3RFWA 1QUTA 1W4NA 9RNTA 4G3KA 3VLFB 4FMBA 4YNRA 1FGQA 1LQMB 3EN1B 2QKPA 2JY5A 1O7PB 3N8BA 5DKKA 4QD4A 2EKFA 3O88A 1Z5BA 2KDLA 3B74A 1W79A 3GAXA 5EUAA 2X02A 2NUPC 4PM8A 4HYZA 3O5YA 4GHIB 5EE8A 3EGDC 1GVNA 3D5IA 4Q0IA 3SASA 3H9WA 4E3LA 3PR6A 1FGMA 1IKIA 3KSFA 4PAUA 1S1YA 4LFAM 1VQN3 2W3HA 5HDSA 1YIJ3 2G2UA 2Y2QA 2Q07A 4JBFA 2D1WA 5IG4A 3B7NA 2QPNA 3VOLA 3FG3A 3WMDA 3HU2A 2PDRA 4I8OA 2CV2A 4JF5A 1I2WA 4QOZC 1VQ53 1NV8A 2KRKA 4EW5A 4J8TA 1ZG6A 3UDXA 4DXCA 2Y0TA 3F1NA 3AL0C 3FTDA 1UW1A 1OKSA 5CGSA 1SXJD 4J5KA 4N6NB 1FCOA 2HJEA 2HMKB 3K5TA 2OV5A 5ITTA 1BLHA 3HJ8A 1GMPA 4QJGA 5CXWA 2JA2A 2YR0A 4KZ1A 1J9MA 2FOIC 4LJ7A 1VEKA 2QIYA 4E6WA 2R9XA 5LC7A 3A3EA 2KF5A 1WMPA 2J3TC 3E0YA 1M6KA 3WWXA 3M2JA 5ELUA 3QP8A 4LGWA 2Z77A 2QGUA 5EFWA 1MGWA 2MR9A 2DZOB 2B24B 2A3UA 2Y21A 2JKTI 2VEAA 3LQQA 3A3DA 4Z6YA 4GCZA 1XJ2A 3NBBA 3PGBA 2H5XA 3E21A 3BEBA 3F1OA 4GHAA 1O7WB 3PTEA 5HPFA 1L1ZA 1BNGA 1UCLA 4S2OA 3IXGA 1W7CA 3FLJA 3NBRA 3FTCA 2QJ5A 4KG2A 2CWVA 2GBWB 4LF9M 3QHYA 1SDEA 3N9HA 5IU1A 4LFBM 1IV9A 2V20A 4RVAA 1K82A 1DMQA 1LI0A 4OVDA 1W2ZA 4QHSA 3LYXA 5E2EA 3D5GA 1RKYA 3C7VA 5EVIB 4E3JA 1RHLA 1ZMVA 5DYIA 4L8OA 1T43A 5FQ9A 4NSOB 3GO8A 4CISA 4OOYA 1MWRA 4BLMA 3GPXA 3WA3A 2YX9A 1G28A 3PHYA 1NLYA 5E6JA 1BNJA 3DZLA 1Z1SA 4ILFA 3JAMS 1NYYA 3NECA 3WDGB 2LNHC 2ZAOA 3B47A 2LHGA 4OW0A 4G4QA 1UWNX 1ESUA 4WUJA 4KZ5A 2ZTDA 4QWTA 3N8SA 1QZMA 3ZFZA 2YNMD 4DR2M 1QMAA 1OF5A 3U5ZB 4MGYE 4ME4A 4UQIS 3HU3A 2CX0A 3QAUA 5DF9A 5DTKA 4Y3IA 1N5HA 2PR6A 4DR5M 3T6PA 2ZL1B 3K3DA 4IVKA 2IY2A 3JUQA 3QRDA 4O0PA 4MMYB 5IHVA 4GHLA 3AMOA 4AKGA 5GLAA 4GD8A 1WNHA 2IA2A 1UUGB 4Z9QA 1HJPA 2GJ3A 2R45A 4HHDA 1I4WA 3IXBA 1TS6A 5G4ZA 3PXMA 1Q864 1TD5A 3FPWA 1BRJA 1ROVA 4DV6M 1XP4A 2QZ6A 4GC5A 3G6OA 1IYYA 4TX4A 1IBLM 3KSED 3NC8A 5G18A 3CTWB 4DKIA 2JC7A 2ZMAA 3CPTA 3HJKA 3LY3A 1NO1A 1K9M4 4M0DA 1VQ1A 1XMOM 4HJLB 1XGIA 3OCLA 3EWKA 2B5RA 3L25A 3T1HM 1D6UA 3AJIB 3AOGA 1NB3I 2VGKA 3PYPA 3VP4A 2EA0A 3BFDA 4OQGA 2W3EA 4R3DA 4N6OB 2O01F 3HU1A 1RN4A 2DCFA 3DZDA 1ZAEA 2RGHA 2CC1A 1DJAA 1GA0A 3RGAA 4IBBA 1VB6A 3CF6E 4ANRA 2G2WA 1D06A 4W5WA 3W8KA 4X65M 2WKPA 2EUCA 4JV5M 5FTNA 4PDIA 3CC23 1IYQA 1BAOA 1YLYA 5DFLA 1Q824 3LEQA 1EW0A 2Y73A 1N75A 2JKRI 5KO3A 4FCMA 1NLZA 3F1NB 4GB7A 1N8QA 1G5UA 1QDRA 3U1WA 1IELA 1ZMUA 2ZC7A 1X1XA 2HDSA 1SCWA 1OGXA 2CW9A 1LL8A 4UA7A 4O8SA 4NEED 2CV0A 2BMOB 1D0MA 2CIUA 2YKHA 1CJFA 3CHWP 4IJGA 1RNBA 4UAAA 1V57A 3L9KA 4GNUA 3UB8A 2CFKA 2EWVA 1PI5A 2PD7A 5FGOA 1QVF2 3CU3A 5EVHA 2BNKA 3G30A 2XSHB 2GEYA 5FTLA 1K25A 1S0WA 4I38A 2H0GA 3VFDA 1RCLA 4QHTA 4ESPA 1B2ZA 1FA3A 1B2UA 1J2BA 3M7GA 3F1OB 4HJ4A 2JNHA 3I4VA 3CCV3 1XX2A 4YWZA 5EEOA 4GD6A 4HJ6A 3BU4A 4QNMA 3ZNTA 1U60A 2ZM6M 4HLQA 4KT0F 3O86A 3W4OA 1DGBA 1RNTA 3DXOA 4S2NC 2LYXA 3K0ZA 1ULIB 5D83A 1TRQA 1LLBA 3UL6A 2WK0A 5L2FA 2Y74A 3IECA 3I563 3AHSA 1GJTA 3FKAA 1FIKA 3PAGA 3DTKA 4NXMM 5FASA 4X53A 4CLCC 4L16A 1TFKA 3PBRA 4IBXA 2W27A 3Q82A 1SJWA 2Y0QA 2LWXA 3CCJ3 2FFFB 2L4FA 1TIJA 3T0UA 2LVOC 3FUUA 4ETXA 1VQ73 1IM2A 3TQSA 4X6TA 4WZ5A 1OPXA 4IUHA 2GXFA 2BHMA 1IQ8A 2VLGA 4KQOA 4E6XA 1E3VA 1XXHA 3BXWA 3FUVA 2INWA 3T38A 1OF5B 2VV7A 4IBJA 1RMSA 2B1XB 5BXQA 3UB6A 1YLTA 1W6GA 5TR7A 1BSBA 3AGFA 1QAQA 1XFNA 5F83A 2M60A 1AUAA 1ZTUA 1JR3D 1IYSA 3L28A 1E9SA 3LYGA 3AMOB 1I8VA 3Q7VA 5HDDA 1K38A 2JY8A 2RGQA 1BRHA 3KN4A 5LBRA 3B7QA 2LXEA 3C7UA 1IT8A 1EFUB 3ZG0A 1G68A 5I94A 3BFGA 4S2PA 4L9FA 3G2YA 2VK3A 2WSEF 4YHHM 1NNUC 3HJIA 4ID4A 3LTDA 2WKQA 3CPTB 3DWZA 3UDFA 1YJ93 3X41A 2HJ9C 5CRFA 2MGWA 1OT6A 3P98A 1MJGM 3PVSA 3FPVA 4HBUA 3CCR3 5EJCA 5IEOA 4HH3A 4PM6A 2HMNB 4KZ8A 1TRPA 5KIZA 1KVLA 4AEQA 1RN7A 1SIHA 1CEFA 4I4KA 2L6OA 1WQLB 1JNUA 4JKTA 4CDLA 3E4RA 1RGKA 3AGNA 1AXBA 3G4PA 4DE0A 2J9OA 1PJQA 5HOHA 1G3IA 3B33A 3G31A 4FD8A 2ZM0A 5A90A 4RX2A 3UPPA 3KOWE 4HBTA 3OPRA 5EVLA 3GECA 1LV7A 1T3BA 5IW9A 4LGQA 3SMPA 3FUXA 3TWKA 3O8YA 4IIAA 1ODVA 5ITXA 2PYPA 1E32A 4DJ2A 1TF0B 4FD2A 3KOYE 1FILA 4KZBA 5FAQA 2GU3A 2CC3A 3CI6A 4ARZA 1SXJC 4FMDA 1L1TA 1P9RA 3IX8A 3VP0A 1KGGA 2UXDM 3R9XB 1KD14 1N8R4 3X3ZA 3W4PA 1YGWA 2GNOA 3THGA 4DR6M 3KSGA 5HZHA 3EHCA 1KYIA 3PBNA 3OWYA 2K31A 5E2HA 3U6SA 3T1YM 3BBZA 1GCEA 5EV0A 1XGJA 4P6ZS 4X64M 1S4SA 1DO0A 4LYLB 2DAIA 2Z6BA 4D81A 2VV8A 1HU9A 2W04A 3Q3FA 4QOSA 1VEUA 3PXGA 1CEWI 2Q9MA 1FR6A 3C58A 4KVHA 4EUZA 8CHOA 1R6BX 4JI5M 2ZQAA 4DDYA 1HT2E 3HY5A 3M0EA 1E97A 3VV4A 5CEDA 1RRHA 4NRWA 1PFLA 3CNMA 3I01M 2WADA 1IXRC 1A90A 2ZQDA 3PNYA 3Q07A 5EQTA 3TE6A 1GYBA 3FRHA 2OWHA 3LMLA 3HLGA 3OLOA 2FFYA 2HMOB 4MGKE 3CUEC 3SOYA 4PM7A 5GHXA 3E2KA 3CG5A 3U6OA 1TFOA 3GLIE 1WTHA 1BT5A 3S4XA 5M18A 1OHPA 1GHIA 1HQCA 2OWJA 1BANA 1Z59A 1LQGC 5CHMA 1ES4A 3H4MA 2RCXA 1OTRA 3SW1A 3M6AA 1Q2QA 1FUWA 4LY6A 1E3UA 3FYZA 3W4QA 3E46A 4F94A 3DH2A 2WKHA 3NDEA 5AQBA 1BNFA 3W2ZA 1PY3A 2ERCA 4BL3A 3KSIA 2F5OA 4KZ7A 2ZOHA 4BD1A 4S12A 4IUKA 2CWBA 1GHPA 5DNYA 3D3OA 1NJ4A 4GHOA 3A5EA 5A92A 3EN8A 3NV0A 2QWSA 1XXHB 3MKIA 4RF1A 1BSGA 4LZIA 3T4SA 1HZOA 4AKYA 1XC8A 1OJ5A 5CERA 4K0XA 3OW22 2PT7A 4JPMA 2PU4A 2HV1A 1LL5A 4ITQA 4JI2M 1FW7A 4N9KA 3E4PA 4OONA 4Q0JA 1N9NA 2E2UA 4I81A 1LOWA 3LT8A 1JWZA 1KE3A 3G32A 3Q81A 3Q7VB 4QB8A 3DBAA 4EU0A 3MMPA 5AVEA 2JY7A 4O3VA 3CC43 2OQEA 2WSFF 3OXAA 1K28A 5KP1A 4X62M 3LIAA 3ZC7B 4ZM8A 3T4OA 1UUWB 3VP2A 1Q7Y4 1FUTA 1EUIC 2V1AA 1OTDA 2RBIA 1OCVA 1G96A 3GR2A 4Y15A 4JXJA 3UMEA 3VP1A 4KUOA 1PGYA 2Q9NA 2H5SA 5EVEA 1K734 4LFUA 1HT1E 2INXA 1YQSA 2CK3H 5HGRA 1OTAA 5JYOA 5KPRA 4GITA 2R0IA 3HHXA 5AYSC 4LV2A 3B7CA 1Q39A 3QNCA 1UDII 2ZQ9A 4M9XA 2UUCM 3GMWA 4B4ZA 2LH0A 3EX9A 1EG9B 3J7AS 4BBVA 4NSRA 5G2GA 2P08A 3QYEA 3NY4A 2K0BX 4G6ZA 5JYPA 2K3DA 1Y8GA 1K6SA 1PWCA 4DV3M 4U0XA 2FE8A 3U6CA 1BLSA 3MQOA 3LGOA 5FAPA 3SH9A 5KPTA 1KSIA 2K47A 2EX9A 2JCHA 1ZV1A 3WA2X 1IFQA 4KG6A 4ARZB 2IWDA 4WYKA 1NB5I 1HVBA 5A91A 3WS0A 3BY9A 4R7GA 4XGIA 3DM8A 2Y2PA 4RNYA 4Z8XA 2H28A 3NJAA 1LHYA 5D82A 2GZAA 1Q7HA 4J5GA 5K5BA 2PBYA 4BD0A 3HUOA 1KGEA 1AIPC 1RGYA 1IXZA 3QP5A 3V3RA 5RNTA 4LEHA 4WM9A 1XNQM 3DGNA 1VQO3 2P0XA 2VZWA 1WIVA 4L8PA 2ZOIA 4MLLA 1YKDA 1B2MA 1GY6A 1YLJA 2V1BA 4D82A 4XBTA 3HK4A 1CH0A 3U97A 2ZBKB 5EXSA 3HBRA 5CXOA 1VEUB 4Y17A 1XJ6A 2D01A 3UO9A 4YY3M 3SBJA 5BVBA 2VA0A 1SIIA 3D72A 5ITYA 3VF1A 3GV9A 3UB9A 4B4XA 3JR5A 5FDHA 4FCFA 4QY6A 3DGYA 3TL4X 3FYCA 3DWKA 3DA1A 4G4NA 2F5PA 2C5RA 1XWIA 2XD1A 4HP9A 4OPRA 1W01A 3E9SA 1OHOA 1LSVA 4HESA 3RGPA 4II7A 2YKFA 1G59A 3ZG5A 1J09A 4O02B 1N34M 1M9GA 4WF0A 2CHVA 4FCVA 2BTFP 1ZC2A 2EX8A 2P04A 1G8PA 3I51A 1S4RA 3LIDA 2J8XB 2VX8A 1SG9A 1WHCA 2LVNC 1NHGC 2GSPA 3WOEB 5L8RF 3EGXC 2UU9M 4OVZA 5HAPA 4LJ9A 4EEPA 4LMIA 3NOPC 4HOIA 2I7PA 3G16A 1R5LA 3AOEC 2K2NA 3T8UA 4E04A 3I4YA 4BTWA 1W6CA 4LJ4A 4MJDA 3SH7A 2HP9A 4LF8M 1XB2B 1LVNA 3SVAA 2A15A 3NV0B 5IT5A 5EOOA 1AVLA 3ULFA 5J8XA 1IT7A 4I5QA 3NM7A 4DUYM 3AHWA 1RGEA 3BFCA 3L0RA 4MEZA 3BYDA 4C75A 2WAFA 3O87A 3QP1A 2F5NA 1N36M 1VQL3 5EQLA 5C1BA 3OC2A 3T4TA 4HL4A 3GZRA 1ROAA 1UGHI 4EETB 2P9VA 4AW4A 3LVWA 2BWEA 3U6PA 1NJGA 1XJ4A 4BL2A 3LIEA 2Y2HA 1JBSA 1IOUA 3PFIA 3NX0A 2F98A 2F99A 4GL6A 2LB5A 1GSWA 3FTEA 1RGFA 1RGGA 3K1JA 1JV2B 5D3OA 1K4EA 3R8FA 3Q7ZA 4EBNA 2FNQA 1QZEA 1MC0A 3LO7A 2FFJA 2OOBA 1JKGA 3U2AA 1N9JA 1MBLA 4WN5A 3CITA 4DXBA 1BVIA 5AYRB 2WGVA 2X01A 3UMDA 1PWDA 1D6YA 3EQUA 4Y0UA 3M8CA 4Y5FA 1B21A 4EBPA 2CHQA 2P09A 5G4YA 3U6DA 2ZQCA 4Q0HA 2GNXA 4ZJ1A 3IWIA 2HDQA 4MGZE 1N9BA 1T18A 1TVFA 4FCJA 2MF7A 3NXJA 4M9ZA 4X56A 1YVBI 2OAP1 1XFQA 3DGOA 2CMNA 2KNAA 4HY8A 4JI8M 4MMXB 4JXWA 3J7BA 3SHFA 1NNVA 3NM2A 5U47A 1GL7A 2H0YA 1HR0M 4LRSA 4IBRA 1PJSA 4WYKB 2PAVP 2EXBA 4HH2A 1KWIA 3R7WA 2KOIA 5CGWA 2C6WB 4EWFA 1FGTA 5AI1A 5EM1A 2W3DA 1VQP3 3N8LA 4B3SM 1SKFA 3JPUA 5F6AA 3TPZA 4RA7A 1IK3A 1FOFA 5L10A 1I2GA 1K8A4 2EX2A 5CF1A 1NDOB 1M904 2QSFX 2ZANA 5KQDA 1X1YA 3ITAA 1UCJA 4WEJA 3KW6A 2ZM8A 1KQS2 2L7IA 2O9BA 5FEGA 1UGUA 1I3FA 5L8MA 1N5PA 4GIPA 3GSPA 1YSYA 3GWRA 5KSCA 5FTJA 4DV5M 1IU7A 2Y8HA 7CATA 1GY7A 4Y0OA 4XUZA 2O5RA 3WRZA 1G4AE 2QBYA 4EBLA 3X40A 1D6ZA 1K57C 4Y28F 3ALAA 3IBJA 2Y4AA 1AVKA 3JVUA 1Z5AA 5GHZA 1IEMA 1BSDA 2QHKA 3ZQJA 4N6LA 1WJ7A 2XRNA 3FH1A 2KEBA 1K6RA 3ZG9B 2VGLM 1GA9A 2BWBA 1JJ22 1IBKM 1J3WA 2Y2GA 2MH8A 3UZUA 3HCYA 3BOSA 3SX1A 3EE1A 3MYTA 5DYGA 3MKFA 4LV1A 1IVVA 4WURA 4OVZB 4N92A 2RRUA 2O9UX 3H51A 4LRZE 4I5SA 1ONHA 1QQWA 1DETA 3UPOA 1TDGA 3A42A 1A2KA 1Z5CA 1I0VA 1MKMA 3CWFA 3SATA 1G6AA 3V3SA 3UN7A 1T1CA 4R4KA 2WGOA 1O7HB 3JUMA 5AIIA 2FH5A 4NXGA 4ZBEA 4G3VA 1WYCA 1OAIA 3N54B 2QEX3 3CCU3 4H8RA 5CTNA 4Q8IA 5TGNA 1G71A 2X71A 4WFOA 2HMMB 2Q2EB 2GDNA 5FL3A 3T4KA 1BUEA 4LJ6A 4WP5A 2XROA 5TGFA 3RH8B 4L6V6 3HLCA 2WGQA 3LR4A 3WR2A 3ZCBB 1YLZA 2BJVA 1BRIA 1Q814 4J9AA 4R70A 2ML6A 2MROB 3D4AA 4GKUA 1F2KA 2VV6A 2RFRA 4PKYA 5EXXA 1E4DA 3IJEB 5F1GA 3EF8A 3BLSA 1WE4A 3C4OA 2XZUA 1YLAA 1RJOA 3CPW2 1O7NB 3TOIA 2V0WA 4IBGA 3C30A 2KAAA 4B7FA 1SPUA 2VDBB 1BGSA 2W9QA 3HI7A 1LSWA 2Y91A 2PNCA 1SZVA 3UMMA 2XLNA 1MN3A 4DJ3A 1EWZA 4N6TA 1GSPA 3ILKA 1KE4A 1G41A 3NI9A 3PYJA 1PIOA 3IF6A 3CMZA 1C54A 3LVVA 5HX9A 1YNVX 3LICA 1C7HA 3CME3 5JPUA 4NL4H 2P5TA 4MBFA 5F3WA 1GS3A 5CHUA 4G4RA 2WKIA 2W1TB 1IY1A 4EEUA 3MXRA 3B7ZA 1NVMA 3NOUC 2C99A 3A45A 4LF5M 2ML5A 5J4EA 3IPTA 1JWPA 2BO9B 1BNRA 2KZSA 2X49A 4IEDA 4KENB 1VQM3 3M6BA 3MG3A 1TUHA 4EXRA 5AEUB 4R3BA 4O7DA 3FZWA 4UA9A 3A76A 3Q2PA 1EI5A 2KA6B 1R4YA 3LTAA 4JN6A 1H8YA 3V50A 1YM1A 4R4SA 2J9PA 3LUQA 1NSFA 5AIFA 1JVJA 3G2ZA 5KQ8A 3OOVA 5AQAA 2WOHA 1D7EA 2OSUA 4M3KA 1G0TA 4RNZA 1N32M 3TJZC 4HM6B 4L15A 1ERMA 3RJUA 2ZQ8A 5DFYA 5HARA 4LRYC 2EWWA 1LTMA 2C96A 2BASA 2FS1A 1EA2A 3DGMA 3C4PA 3I04M 1L2DA 4BLCA 1IQXA 1N9LA 5C5KA 3D79A 2QBYB 4TUWA 2BLSA 4N3VA 2HPBA 2Y59A 3PCSA 4MH0E 4L78A 1L8QA 5CGXA 4GEWA 3ZYTA 5BR8M 1CI8A 2XA7M 4B7GA 2BU4A 3MHEA 3MMHA 5HWVA 3D3LA 1MXOA 1K3WA 4AKIA 1JZOA 3WOFB 1NV9A 1Q42A 3S7NA 2C4BA 3FSDA 4X2OA 3GQZA 1PFPA 1LXEA 4I3IA 4DRTA 1TGUA 3MJ5A 1T1AA 1E94E 4HI4A 5A93A 3ZG7B 2O0YA 1HNZM 4BBUA 5FSRA 1PRBA 4S2MA 5DTTA 1FJGM 1UUVB 1XXHE 1O07A 3P01A 3UL5A 4XDWA 4ZDXA 3KVWA 4KLNA 4MB7A 4OVMA 2R62A 3JVCA 1R2ZA 3E99A 3GQ4A 2K9DA 4IJFA 4AI6A 4BWIA 3B8LA 4AG6A 3VK7A 3HHZA 1TJDA 5A8BA 1MNLA 3K2NA 1FYSA 4FUWA 1PJIA 1TS8A 2UXBM 4EERA 3WHKA 3AKZA 1IN6A 2M7OA 4LJAA 4MN5A 2OOVC 3MJQA 2RNTA 5GKNA 2WZJA 4JI6M 1RP5A 2IWCA 2CG0A 5FA7A 1IY2A 3CZDA 2N35A 3MHVC 3MZFA 1OH0A 1NJI4 4GDBA 4HNBA 2FXTA 5IREB 4XXRA 3TE8A 1TH2A 3SZTA 5CF2A 2DAMA 3CXC2 2XDMA 2BMQB 4EYCA 2Z76A 1D0LA 1OUNA 2JKTM 4RYEA 2BIRA 1RSNA 4HM1B 1D1JA 2ZJ9A 2DMWA 4P17A 1X1WA 3KSPA 1KVMA 2DI0A 4X68A 4ZPXA 3MXQA 5DJUA 3BM6A 4BB9A 4UA6A 2XR8B 3SYUA 3L27A 2K54A 4KODA 1W5ZA 4MN6A 4QWOA 4AKZA 2OOAA 4IBDA 4LV3A 4GH9A 1GJSA 4R4RA 1GOUA 5DKLA 3WS2A 2V8CA 3HHWA 1FSWA 2O9AA 1QVRA 4BTXA 2XF3A 1BUJA 2ZD8A 5DVAA 1H5XA 3W67A 2W03A 1O7GB 1YUBA 1TF1A 4KG5A 1PJTA 4IJEA 1TTEA 3QP2A 3TSGA 5GLDA 3IF6B 1DMNA 3SAUA 4Q53A 3FYDA 3VSKA 5ITXE 2DAGA 1E9RA 3HX3A 3PBQA 2CHCA 2L4RA 4PD2A 4B7HA 1OPYA 4FOFA 3NBJA 2JWSA 1N9EA 2CE7A 1R4CA 3VK8A 1LOVA 5IF6A 5IG5A 3W0FA 4LF7M 1NY5A 2DKLA 1A0KA 3IXHA 3BWLA 1GSVA 1K55C 1HNXM 4R1KA 2QA43 2VQFM 2XSOB 4JGPA 3UE6A 4KQQA 2Z8YM 3OX9A 1V33A 3K63A 1TR8A 4G3WA 1B2XA 4X69A 1VEJA 3IG8A 2HZ5A 3QP6A 4OLDA 3KYQA 3GQ5A 3RNTA 3N8RA 4KZAA 1IVWA 4NHFA 1OTEA 5TBMA 4HZ9B 3FV7A 1L2CA 3E98A 3A0VA 1S723 1W6YA 1SHVA 5I97A 2RGOA 3H4JA 5HD5A 2HDUA 2R9WA 4WZ4A 2CUZA 3RFBA 2CFDA 5HWTA 2Z4RA 3BQAA 3NDGA 4DE2A 1TTOA 1BRNL 2LQVA 4B3RM 2JDIH 2NUTC 4IPBA 3MR0A 2CWUA 1RRLA 1GABA 3KFQC 4DN0A 1S3SA 1PYYA 3E4OA 2D7GA 4OQIA 3F7SA 5FQQA 1RCJA 2C9CA 1PI4A 4B88A 1BNIA 5DTSA 3VFFA 7GSPA 2CEAA 2F5WA 2JBFA 2HHHM 3MSHA 4DR7M 3SOAA 5JBSA 3LXUX 1RDSA 1V92A 2CH9A 1QVG2 1FNNA 5F82A 6RNTA
chains in the Genus database with same CATH topology
1XHBA 2VIIA 4FCZA 3NUVA 4LGYA 4K1UA 3HLBA 1LL9A 3SHGB 1Y4KA 4HM2B 4MMZB 2W2CA 4PEJA 2UWXA 2F5SA 3GLFA 1MWUA 1GKIA 3GLHA 5ITQA 3N4IA 5HW3A 3ZNYA 5IERA 1XMQM 3CMA3 2Y2NA 3UK6A 2L4VA 1K41A 2ZLYA 3Q1CA 3BFEA 3SH8A 1TH3A 2BJWA 1VQ43 1ES2A 3IH9A 2A49A 4OU7A 1DGHA 3BECA 4H3UA 1TDLA 3LY4A 2R4IA 5KSHA 3FCSB 3GPPA 1ES3A 4S2NA 4JI3M 4S2IA 3PZWA 3C5AA 1XPBA 3NHXA 1IQPA 2Z3XA 4K0KM 3A98B 1IQYA 1QJGA 2XGLA 2HDRA 3D8BA 2WZZA 2XZFA 5GLBA 3KP0E 4L0LA 2R65A 4PPRA 2YFLB 4B3MM 4EQIA 3K7CA 5E43A 3CCS3 4OUQA 4JF6A 3GRJA 3ECFA 2R4EA 1QAKA 4U0TA 3CJMA 1PU4A 5EXTA 3U60A 1JRQA 2L09A 4DR3M 4FSFA 4CHTB 3P09A 1DGGA 1UM8A 3GRUA 2CWTA 1PWGA 3DTMA 4D2OA 2E8IA 2EFUA 3M6HA 3GPYA 3HIIA 3S1YA 3KKGA 1L2BA 1IV7A 4R9LA 3NIAA 4K0WA 1WMOA 1CQSA 3V99A 1ZKJA 5LMNM 1IDPA 4X55A 3LQRA 1CK3A 1BLCA 4PCZA 5EOEA 4OPYA 2D7HA 3KSXA 3EBTA 3CF2A 2Z2LB 1JB4A 5CLKA 4L4UA 1FCNA 4KFDA 2CFOA 3KZTA 3ZG8B 4DR4M 3T8NA 5CECA 5D81A 1YI23 4LF6M 2WGWA 2C5WB 1NJFA 1JB2A 2OWPA 3FKWA 2E2VA 3S22A 3CC73 4KZ3A 1VQ93 3Q8XA 3ER7A 1GD3A 2ZDJA 4HM4B 4RNAA 3O3VA 1AV4A 5FI6A 3HX8A 1VZZA 2EX6A 3CPOA 3HL9A 1K54C 3Q1FA 3J80S 1NO3A 3PCRA 4BTYA 2QENA 4MGIE 3IXDA 2J7VA 4WMCD 1DYUA 3ZVWA 5C18A 3X3XA 4JXVA 2Z7JA 4LCMA 1DO2A 3TWLA 4JF8A 4KFFA 1SXJA 4BBAA 1NRFA 3UE0A 2CFWA 2YFQA 1JN5A 5AIGA 2I72A 2XLJA 4MBKA 1FGOA 2DWMA 4OK0A 3ZGAB 3S67A 1K56D 1YLWA 4WHAA 4AQYM 3EIHA 5FW5A 3NBLA 1U5OA 2Y20A 3HLWA 3GLHB 2WZXA 4CPKA 1ZX2A 1OFHA 5F1FA 4C3QA 2E2TA 1GL6A 3U6EA 4S2KA 5DF7A 4KZ4A 4JI1M 2Y2OA 1YIT3 4DE3A 5KMWA 3PNVA 3L29A 1DMMA 2X8AA 4GKJM 2C98A 3HIGA 3UNWA 1DGHB 4GB5A 2V6ZM 2QZ4A 2V2FF 3HLFA 3V5MA 1VQ83 1PZPA 1R7RA 3DY5A 3PBOA 4LV0A 1IBMM 5AQ7A 4PMAA 2JQ5A 4GC9A 4QY5A 3UE3A 5GL9A 3G0KA 4B3TM 2ZQ7A 2KRUA 2QMIA 1S6RA 5DRVA 3CD63 3B3XA 3U60B 1KDSA 3WS4A 4FR9A 3K9MC 2HP6A 1L0FA 1IXSB 2P74A 2WO0A 4E3KA 2EO2A 1PM5A 3RXXA 3E2LA 5GHYA 2ZL8A 1TP6A 3QWLA 4P6BA 1T3TA 4GZBA 1M1K4 3MKEA 1KDWA 4QU3A 5LMUM 1QAFA 3WRTA 1E25A 4RF0A 2P38A 3BLZA 3I7JA 3J2PB 3A46A 2KCDA 3F8XA 1AR0A 1EKMA 4EC6A 4AKHA 3KP1E 3EBYA 1C3BA 3KOZE 4NXNM 5KZHA 1YHQ3 3FF0A 2HMLB 3VSLA 2J8YA 4OP5A 1JQJC 3DOAA 1ZG4A 2IUJA 4R23A 5ELJA 2FGTA 3FG4A 1XKZA 2GEXA 4FVMA 4NETA 1O7MB 3WODG 3SYLA 1IVUA 1E3UD 5KPZA 3CCL3 1NYMA 2OTJ3 1EROA 4DV4M 1HKXA 1M1XB 2XQZA 3F8HA 2EFXA 1GHMA 1TEMA 3HREA 4IBKA 5FTKA 3DFZA 4L7KA 1WMNA 5JI3E 4OKPA 2R4JA 3CCQ3 1MOLA 5GLCA 3FTFA 4MBHA 1V74A 4HM8B 4MEIA 2KRTA 3EB8A 2C10A 1SDNA 1SXJB 4A3VB 1QAOA 1MU5A 4DV2M 3OTOM 1S5AA 1FSYA 4IBEA 1KFVA 1JN5B 1MWSA 1U8CB 2FNAA 2J7NA 2W82A 1LNHA 5FAOA 1DVDA 3IF5A 3HUMA 1ZO2A 3M2KA 2E5LM 4K90B 3DUKA 3HLDA 1STFI 2H10A 1L5GB 3OPHA 1OMEA 3ZCZA 1C1KA 1ESIA 4MNRA 4EV2A 4LCLA 2X4AA 4ORLA 1Y54A 3F40A 2ZC4B 1QALA 1DGFA 3S28A 2IMJA 5IEPA 3LTCA 4KO8A 1Q40A 3LTBA 4X2HA 3SS3A 3T15A 1QMFA 2P05A 2QCUA 3K2LA 3MPHA 3VMAA 1YJW3 3L26A 1DVCA 1I2SA 2G8LA 4EBGA 3HJSA 4REZA 1NZUA 2QP9X 1A2VA 1IYPA 5DREA 1YJN3 3AOEA 2Y2IA 3AGEA 3KDSE 4G4OA 1YGEA 5DF8A 2CFLA 2R46A 4CCVA 3KFUG 2CV1A 5IG3A 3G8ZA 2Y55A 5FQMA 3UPNA 1SQWA 5EP1A 4HBRA 3SEDA 2SBLA 2W9PA 5TFQA 3GRRA 3VDUA 4CJNA 1IN8A 3UJNA 1JR3A 2I7NA 2HCBA 4DV0M 3SLUA 3BLMA 3UNLA 3GZXB 1M40A 2P9VB 4M9SA 4P0MA 3D9RA 1IY0A 3CNXA 3IWQA 1IN7A 4IT7A 4U3TA 2HKJA 3WHLA 5JI2E 4NOOB 3J27B 3FKVA 5AIHA 3MXSA 3MFDA 4G1MB 3D8LA 4R3JA 1JKGB 5EP4A 3NBIA 4HM7B 3HHYA 1ES5A 5LC6A 2KW0A 4A5RA 2R18A 2Y2KA 1KGFA 3HJQA 1GD4A 4IBCA 4LZZA 3BNEA 1NZOA 3NWLA 3BNDA 3EJVA 1A67A 4WZ5C 1BTLA 4DV7M 4GOGA 3SOIA 3VKGA 4E3MA 4S2JA 4FWHA 5AEWB 3SYKA 2L7HA 3EQQB 4CGYB 4FWDA 1ERQA 3KSJA 3KOXE 1JTDA 2WGIA 1W5DA 5IWAM 3JYIA 1K3XA 1TH4A 2OQ4A 4N6UA 3OV4A 5EVID 1MY8A 4K1VA 2WYXA 4R0QA 4B08A 1ISKA 1QMEA 5M19A 5IENA 4KZ9A 4JXSA 1UI7A 1JB5A 3EIEA 4FW9A 2XSZD 2GBXB 4S2LA 3L2AA 2HP5A 4FH4A 3WS1A 2YQZA 3G6E3 3S27A 1K57A 1N78A 3X3YA 1Q40B 4ZTKA 3V98A 4FCTA 2OLVA 4XBXA 3A3JA 3I553 3ZDJA 1OACA 1YLPA 2VQEM 4HKVB 1ALQA 3MZEA 5E2GA 1NWWA 3OWSA 4LG2A 4P87A 5FQKA 3X42A 1VM1A 1H6UA 1US1A 1PW8A 3J7Yd 2WOFA 4N9LA 3MG2A 2ZC6B 1MX0A 5HAQA 4EV5A 1E3RA 2DWLA 4HZBB 2CFGA 2WKEA 1OGZA 3K92A 4P85A 2UXCM 4DR1M 3SFZA 4R1GA 5HL1A 4KHPM 4N6V0 3UE1A 2YFJB 1JTGA 2JE5A 3AV0A 2DWZB 1FQGA 4P16A 2V1ZA 3FKEA 2MC8A 2IA7A 4QNRA 1H8ZA 3JR4A 4X66M 3IMAB 4WYYA 4DDSA 1W8YA 4PM5A 1VDDA 4N6MA 4NRVA 2WAEA 4ZJ3A 3LT9A 1HD8A 5AQ9A 1HTZA 2XH9A 1GY5A 2H0TA 2NQ8C 3KS4A 3VFHA 4FMCA 3HLEA 3FF2A 2RL3A 3MZDA 1W8QA 2V1CA 3N7WA 4DUZM 1HQYE 3GSGA 1D2NA 3VKHA 2DXIA 1DY6A 1YT4A 4E3IA 3KS8A 1Q2PA 5M1AA 1FGRA 3D4FA 2XEPA 2IUKA 2W56A 5IG0A 5H37D 4WWUC 2OLUA 1MPLA 1N33M 3BFFA 4WMCA 4OX9M 1Z6TA 3GZBA 4XUXA 3SC3A 2IWBA 2DVWB 2PU2A 5ITRA 1IYOA 3RGSA 3SS5A 1LOXA 1IN5A 2CHGA 3FWLA 1L2SA 1FR1A 3AGDA 4DF6A 1PJJA 1YMSA 3G4S3 8CATA 3U61A 3B4OA 4PDGA 1TDZA 2XFTA 1PZOA 4O2HA 4RZMA 1I5QA 2OQEC 2Y2MA 2VGJA 5JPPA 5FI2A 3Q90A 1NHWC 3B9PA 3OPLA 1FCMA 5BPVA 1K56A 4GKKM 2HMJB 3JUPA 4OPQA 2XGNA 2ZAMA 4OLGA 3JUOA 3U6QA 3BNCA 4FCWA 5EECA 4E3NA 3HVFA 2ZC5B 3H3HA 5A2QS 2OTL3 4WBGA 3RE8A 2BNGA 5CK6A 1CYUA 4H61A 1XNRM 2HL7A 3A3IA 5E2FA 1HNWM 3FD9A 1QYRA 4IIWA 3LOYA 3VOYA 1L0DA 1N4OA 1EQKA 3LEZA 1K4FA 4LENA 4JYAM 3K8ZA 3V92A 4QHCA 3VDPA 1O7EA 4D80A 1WYBA 1NU3A 4EV4A 4DE1A 2ZC3B 2RCDA 4AG5A 5ITUA 2D7EA 3IH8A 1R2YA 1PW1A 3MWZA 3SXXA 1Q3BA 4K61A 4HEFA 2Z7AA 3FGYA 1IKGA 1VQK3 1MWTA 4OQ0A 4I4LA 4OQHA 1WXQA 3CCE3 3OZHA 4UHUA 3HZPA 3GVBA 4OH0A 5EP2A 2F86B 2O3OA 6STDA 1CI9A 1XXMA 5KP4A 3ROBA 1NXYA 3QNBA 5CHJA 4XDVA 1VQQA 3IHBA 2OOVA 1YE9A 3NCKA 4N1XA 1CYVA 4EIWA 2OPFA 3U6MA 3ITBA 3SAWA 1BLPA 4RBNA 5FQJA 2UUBM 7STDA 1EE8A 2H1RA 4XBYA 2RSXA 3CF0A 3EC9A 4LJ8A 4KZ6A 4OOLA 1NY0A 4YFMA 4LRTA 1W5TA 4OOMA 3MSOA 2J7OA 3OCNA 3HGIA 1XA1A 4Y7PA 2CG1A 4BQMA 1T5YA 4HM3B 3ISGA 3JUNA 3OWUA 2RKOA 1W5SA 3N6IA 1W7FA 2C9OA 2KXEA 2F5QA 3TWMA 1L0GA 4OPZA 2W56B 3RXWA 4WW0A 3IT9A 4LGMA 3LZAA 3AFHA 1SXJE 1KE0A 3IHAA 4JLFA 3UB1A 2BMRB 4STDA 4FH2A 1MKIA 3HUNA 1ASKA 1LI9A 5EVIC 1J5EM 3GLGA 3LMMA 1I94M 2XRXB 4HM0B 1K55A 3TG9A 3U61B 3DGLA 3FG1A 1DJBA 4MGHA 5FSWA 4LF4M 3S29A 4LJ5A 3G713 2V1UA 1OJLA 3S5CA 3UGJA 4JXGA 3GP1A 3STDA 4ZAMA 1GLNA 3GLIA 2DWNA 5CTMA 1TU5A 3PS8A 1X37A 3HWSA 4L8RC 1VQ63 4JI4M 2UUAM 2I9WA 3F7XA 2QPAA 3MK6A 3ZH9B 3UDIA 3FUTA 3GRDA 1BUQA 3UY6A 3SMSA 4GRIA 2Z4SA 5FI7A 3KIIA 2C11A 1W02A 4JF4A 4PM9A 2F4VM 1ZQ9A 2W0QA 3LH4A 3VGNA 2D42A 1BZAA 3V39A 2CKFB 4FWGA 4OP8A 2XFSA 4XB5A 1RGZA 3QK9A 1CEGA 4IBIA 3B4PA 3HKPA 1W00A 3RGRA 1YMXA 2Z2MB 2ZM2A 3VOZA 3TDGA 3GLFB 5EXPA 2DNSA 1NY6A 2M5ZA 3W0LB 1L0EA 4GN2A 1ONGA 5FQIA 3MG1A 3U6LA 1DJCA 5EP3A 3SS4A 3ZVTA 1JWVA 5FLXS 2AHMA 2WUQA 3SARA 1KSFX 4KFEA 3PBTA 5FATA 5IZ7D 5BOHA 2K0MA 2Y2JA 4XM4A 3VP3A 2BG1A 3BB9A 5FTMA 3G35A 3GRVA 4GDNA 4GMQA 3SAVA 2PZVA 4JI7M 4LZJA 3F14A 4WELA 2G5GX 4R9KA 4R80A 3A3FA 2OCTA 3VSYA 4K91A 3RDEA 4FMAA 2Y2LA 3KXEC 3GRYA 3WS5A 3I0YA 3OPPA 1F8NA 4Y0TA 3NQYA 1KC84 1OHSA 2A5YB 2XR0A 4LFCM 2YFIB 3FUWA 1OFIA 4IBFA 4JI0M 3GZYB 4LSOA 3NQZA 3MBZA 3PAEA 4M0WA 4JRFA 3LCEA 1TDHA 1BULA 1XA7A 4MM3B 4HVNA 3FZCA 2P0MA 1Z6FA 2DZNB 4AZFA 4KQRA 4NK3A 2WGWB 2XK1A 3ZHHA 3GLGB 5IT9S 4RX3A 3EQVA 3GPUA 3J81S 3BNBA 5EVIA 2KZUA 5EPHA 1IN4A 5CEBA 1ORYB 3IG5A 5KP3A 2STDA 4HM5B 3GLIB 4C6YA 2BT3A 3DW0A 5E26A 3G34A 2XD5A 3CCM3 4IVIA 1N77A 3DMCA 1K54A 5STDA 1ULJB 2DRWA 2EXAA 3GTCA 1QANA 3F9SA 4U13A 4PT5A 1Q3CA 2XSZA 3BRMA 4XBOA 4N1HA 4YINA 3U5ZA 3UJMA 3KE7A 1NNJA 1STDA 1UI8A 5HFOA 4DV1M 2GU1A 4ZJ2A 4WEKA 2W6JH 3IWOA 3IF6C 4BJPA 1J7KA 5A0OB 2KXGA 1W2B2 3GQ3A 2UX0A 4BENA 1QAMA 3PBSA 5HAIA 1IVXA 4LCBA 1JNQA 4NREA 2V1LA 3IQAA 2DHRA 3RFWA 1W4NA 3VLFB 4FMBA 1FGQA 3EN1B 1O7PB 3N8BA 4QD4A 3O88A 1Z5BA 5EUAA 1W79A 3GAXA 2X02A 4PM8A 4HYZA 5EE8A 1GVNA 3SASA 4E3LA 1FGMA 1IKIA 4LFAM 1VQN3 1YIJ3 2G2UA 2Y2QA 2Q07A 4JBFA 2D1WA 5IG4A 2QPNA 3FG3A 3WMDA 3HU2A 4I8OA 2CV2A 4JF5A 1I2WA 4QOZC 1VQ53 2KRKA 4J8TA 1ZG6A 3UDXA 4DXCA 2Y0TA 3AL0C 3FTDA 1UW1A 5CGSA 1SXJD 4N6NB 1FCOA 2OV5A 2HMKB 3K5TA 4E3OA 5ITTA 1BLHA 3HJ8A 4QJGA 5CXWA 2JA2A 2YR0A 4KZ1A 1J9MA 2FOIC 4LJ7A 4E6WA 2QIYA 2R9XA 5LC7A 3A3EA 1WMPA 1M6KA 3WWXA 3M2JA 5ELUA 2Z77A 2QGUA 2DZOB 2B24B 2A3UA 2Y21A 3LQQA 3A3DA 4Z6YA 3NBBA 3PGBA 3BEBA 3PTEA 4GHAA 1O7WB 1L1ZA 4S2OA 3IXGA 1W7CA 3FLJA 3NBRA 3FTCA 4KG2A 2CWVA 2GBWB 4LF9M 3QHYA 1SDEA 3N9HA 4LFBM 1IV9A 2V20A 4RVAA 1K82A 1DMQA 1LI0A 4OVDA 1W2ZA 4QHSA 5E2EA 1RKYA 3C7VA 5EVIB 4E3JA 5DYIA 4L8OA 5FQ9A 4NSOB 3GO8A 4CISA 4OOYA 1MWRA 4BLMA 3GPXA 3WA3A 2YX9A 5E6JA 3DZLA 1Z1SA 3JAMS 1NYYA 3WDGB 2LNHC 2ZAOA 4G4QA 4OW0A 1ESUA 4KZ5A 4QWTA 3N8SA 1QZMA 3ZFZA 2YNMD 4DR2M 1QMAA 1OF5A 3U5ZB 4MGYE 5DTKA 3HU3A 3QAUA 5DF9A 1N5HA 4DR5M 4IVKA 3JUQA 3QRDA 4MMYB 5IHVA 4GHLA 3AMOA 4AKGA 5GLAA 4GD8A 1WNHA 4Z9QA 2R45A 1I4WA 3IXBA 3PXMA 1Q864 1ROVA 1XP4A 4DV6M 2QZ6A 4GC5A 4TX4A 1IBLM 3KSED 3NC8A 5G18A 3CTWB 2JC7A 2ZMAA 3LY3A 4DKIA 1K9M4 4M0DA 1XMOM 3OCLA 4HJLB 1XGIA 2B5RA 3L25A 3T1HM 1D6UA 3AJIB 3AOGA 1NB3I 2VGKA 3VP4A 2EA0A 3BFDA 4OQGA 4R3DA 4N6OB 3HU1A 2DCFA 3DZDA 1ZAEA 2RGHA 2CC1A 1DJAA 1GA0A 3RGAA 4IBBA 3CF6E 2G2WA 4W5WA 3W8KA 4X65M 2EUCA 4JV5M 5FTNA 4PDIA 3CC23 1IYQA 1YLYA 1Q824 2Y73A 1N75A 5KO3A 4FCMA 4GB7A 1N8QA 3U1WA 1IELA 2ZC7A 2HDSA 1SCWA 1OGXA 2CW9A 4UA7A 4O8SA 2CV0A 2BMOB 2CIUA 4UAAA 4GNUA 2CFKA 1PI5A 5FGOA 1QVF2 3CU3A 5EVHA 2BNKA 3G30A 2XSHB 2GEYA 5FTLA 1K25A 1S0WA 3VFDA 4QHTA 1FA3A 1J2BA 3M7GA 3I4VA 3CCV3 1XX2A 5EEOA 4GD6A 4QNMA 3ZNTA 1U60A 2ZM6M 4HLQA 3O86A 3W4OA 1DGBA 3DXOA 4S2NC 2LYXA 3K0ZA 1ULIB 5D83A 1LLBA 3UL6A 2WK0A 5L2FA 2Y74A 3I563 3FKAA 3PAGA 4NXMM 5FASA 4X53A 4L16A 1TFKA 3PBRA 4IBXA 3Q82A 1SJWA 2Y0QA 2LWXA 3CCJ3 2FFFB 1TIJA 3T0UA 3FUUA 1VQ73 1IM2A 3TQSA 4X6TA 4WZ5A 2GXFA 2BHMA 1IQ8A 4KQOA 4E6XA 1E3VA 1XXHA 3FUVA 3T38A 1OF5B 4IBJA 2B1XB 5BXQA 1YLTA 1W6GA 5TR7A 3AGFA 1QAQA 5F83A 2M60A 1JR3D 1IYSA 3L28A 1E9SA 3LYGA 3AMOB 3Q7VA 1K38A 2RGQA 3KN4A 2LXEA 3C7UA 1IT8A 1G68A 3ZG0A 5I94A 3BFGA 4S2PA 3G2YA 4YHHM 1NNUC 4ID4A 3UDFA 3LTDA 3DWZA 1YJ93 3X41A 5CRFA 3P98A 3PVSA 4HBUA 3CCR3 5EJCA 5IEOA 4PM6A 2HMNB 4KZ8A 1KVLA 4AEQA 1RN7A 1SIHA 1CEFA 4I4KA 2L6OA 1WQLB 4JKTA 4CDLA 3E4RA 3G4PA 1AXBA 4DE0A 2J9OA 1G3IA 3G31A 4FD8A 2ZM0A 5A90A 4RX2A 3UPPA 3KOWE 4HBTA 3OPRA 5EVLA 1LV7A 5IW9A 4LGQA 3SMPA 3FUXA 3TWKA 3O8YA 4IIAA 5ITXA 1E32A 5FAQA 4FD2A 3KOYE 4KZBA 2GU3A 2CC3A 1SXJC 4FMDA 1L1TA 3VP0A 1KGGA 2UXDM 3R9XB 1KD14 1N8R4 3X3ZA 3W4PA 3THGA 4DR6M 3EHCA 1KYIA 3PBNA 3OWYA 5E2HA 3U6SA 3T1YM 1GCEA 1XGJA 4X64M 1DO0A 2Z6BA 4D81A 1HU9A 2W04A 4QOSA 2Q9MA 3PXGA 1CEWI 1FR6A 3C58A 4KVHA 4EUZA 8CHOA 1R6BX 4JI5M 2ZQAA 4DDYA 1HT2E 3M0EA 1E97A 5CEDA 1RRHA 4NRWA 3CNMA 2WADA 1IXRC 1A90A 2ZQDA 3PNYA 3Q07A 5EQTA 3TE6A 1GYBA 3HLGA 3LMLA 4PM7A 2FFYA 2HMOB 4MGKE 5GHXA 3SOYA 3E2KA 3CG5A 3U6OA 1TFOA 1WTHA 1BT5A 3S4XA 5M18A 1OHPA 1GHIA 1HQCA 1Z59A 5CHMA 1ES4A 3H4MA 2RCXA 3M6AA 1Q2QA 1FUWA 4LY6A 1E3UA 3FYZA 3W4QA 4F94A 2WKHA 3NDEA 5AQBA 2ERCA 4BL3A 2F5OA 4KZ7A 4BD1A 4S12A 1GHPA 5DNYA 1NJ4A 5A92A 3EN8A 3NV0A 1XXHB 3MKIA 4RF1A 1BSGA 4LZIA 1HZOA 4AKYA 1XC8A 5CERA 4K0XA 3OW22 4JPMA 2PU4A 1LL5A 4ITQA 4JI2M 4N9KA 4OONA 2E2UA 4I81A 3LT8A 1JWZA 1KE3A 3G32A 3Q81A 3Q7VB 4QB8A 4O3VA 3CC43 2OQEA 3OXAA 1K28A 5KP1A 4X62M 3ZC7B 4ZM8A 1UUWB 3VP2A 1Q7Y4 1OCVA 1G96A 3GR2A 4JXJA 3VP1A 2Q9NA 2H5SA 1K734 1HT1E 2INXA 1YQSA 2CK3H 5HGRA 5JYOA 5KPRA 4GITA 3HHXA 5AYSC 4LV2A 3B7CA 1Q39A 3QNCA 2ZQ9A 4M9XA 2UUCM 3GMWA 4B4ZA 2LH0A 3EX9A 1EG9B 3J7AS 4NSRA 5G2GA 3NY4A 4G6ZA 5JYPA 1K6SA 1PWCA 4DV3M 4U0XA 2FE8A 3U6CA 1BLSA 5FAPA 3SH9A 5KPTA 1KSIA 2K47A 2EX9A 2JCHA 3WA2X 4KG6A 2IWDA 4WYKA 1NB5I 1HVBA 5A91A 3WS0A 4R7GA 4XGIA 3DM8A 2Y2PA 4RNYA 4Z8XA 1LHYA 5D82A 2PBYA 4BD0A 3HUOA 1KGEA 1RGYA 1IXZA 3V3RA 4LEHA 4WM9A 1XNQM 3DGNA 1VQO3 2P0XA 4L8PA 4MLLA 1YLJA 1GY6A 4D82A 4XBTA 3HK4A 3U97A 2ZBKB 5EXSA 3HBRA 5CXOA 3UO9A 4YY3M 3SBJA 5BVBA 1SIIA