2XF3A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
423
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSGEDVAARFIPTFAAAGNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 141
structure length 423
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xf3A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xf3A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xf3A02
1NY0A 1NZOA 4MBKA 3V3SA 2V1ZA 4OQIA 3SOIA 3GQZA 3IHAA 1E3UD 4MEZA 5GHXA 2Y2JA 4UAAA 2ZC7A 3UE1A 1PWCA 1J9MA 1FSYA 2WZXA 5F1GA 5M19A 3HLDA 4S2NC 4WM9A 2VGKA 3S1YA 4OLGA 3UPPA 3NY4A 1PWGA 4U0TA 4CPKA 5EOOA 4C6YA 4S2NA 2XH9A 2EX2A 4LV0A 3MXRA 1LLBA 1FR6A 2C5WB 1Q2PA 1XP4A 2QMIA 2HP5A 3WRTA 4BLMA 1BLCA 4E3NA 5DF8A 1ZC2A 3DWZA 4DRTA 4JPMA 5AQ9A 2EXBA 2V2FF 3HLWA 2A49A 3PBOA 1FCOA 5HX9A 5DTSA 2EX9A 1YMSA 4ZJ3A 4JXVA 2G2WA 2PU4A 5EVID 2C6WB 3WS2A 4O7DA 3M6HA 5A93A 4IVIA 3PBNA 5CECA 3HL9A 1SKFA 3HLBA 4K91A 4MNRA 2XFTA 1ZKJA 5FDHA 3OZHA 1XA1A 3WS1A 4JF5A 3BFFA 4WYYA 1CEGA 1FQGA 5FAPA 4QD4A 1K57C 4PPRA 5DTTA 4X68A 3BFGA 1MWRA 4OQGA 4Q8IA 1ERQA 1H8ZA 3Q81A 4KZ4A 5TR7A 1K6SA 3HLFA 1YLYA 4N9LA 2X02A 1HD8A 5E2FA 2WYXA 5D3OA 5HAQA 5FASA 5FI6A 3RXWA 4P0MA 3ZDJA 1XX2A 3O3VA 4N9KA 4OOLA 1W5DA 5A90A 1PZPA 1KGEA 4IBXA 3S4XA 2RL3A 5EVIC 2OLVA 4DXBA 2ZQ7A 2EX6A 4E3LA 3GVBA 1LL5A 2H5SA 4QU3A 1XXMA 1RCJA 4OQ0A 1K4EA 3IH9A 4H8RA 3ZG0A 2XD1A 4JKTA 4OKPA 1O7EA 1CEFA 1G6AA 4OPYA 1ES4A 1NZUA 4NETA 3P09A 5F82A 2WUQA 1KE4A 3P98A 3SH8A 1NXYA 1IKGA 3ITBA 5CHUA 1BTLA 2BG1A 4B4XA 4OVDA 4X53A 4FSFA 3CMZA 1ZG4A 4UA9A 5CRFA 1BLHA 2Y2KA 1L0EA 3A3DA 3ZNYA 2B5RA 2G2UA 1AXBA 4XUXA 5E2EA 2J9PA 3FKWA 5DF7A 1YLTA 3PBTA 3ISGA 1MBLA 2WKEA 3LO7A 4RA7A 3SH9A 1YMXA 3IF6C 1E4DA 3TSGA 2JBFA 4BENA 5J8XA 4QHCA 2H0YA 4MLLA 3ZG9B 3A3FA 3IWQA 4GZBA 5HARA 2Y2IA 3UN7A 5EVLA 1LI0A 3G2ZA 3HLCA 5FAQA 1S6RA 3MZEA 4KG5A 3NCKA 2J7VA 4YINA 2ZC5B 3BFDA 3I7JA 4GNUA 3IHBA 1MXOA 1RGZA 3B3XA 3O86A 3PBQA 3M2JA 4KZBA 5AQBA 3ZG5A 3N6IA 4DDSA 4DXCA 4X6TA 5DF9A 1H8YA 1JWVA 3C4PA 2Z2LB 2VGJA 2Y2GA 3WS4A 1L0FA 5FAOA 4N1XA 1Q2QA 1YLWA 3M6BA 1IYQA 4WEKA 5U47A 2Z2MB 3VP2A 3HUNA 3UE3A 4OPRA 3VOZA 4GDNA 2ZM0A 3MFDA 3AGEA 3IXDA 1K55A 1PI4A 4N1HA 1K4FA 1C3BA 1HVBA 1NYYA 1ES3A 1PYYA 2FFYA 3W4PA 3QNBA 3NDGA 4D2OA 3IT9A 2OSUA 5CEDA 5FATA 4R4SA 3Q1FA 1KDWA 3FWLA 4KZ7A 1NYMA 1ES2A 4OH0A 4BQMA 2XQZA 2H10A 2X01A 1BSGA 2WGWA 3EQVA 3NI9A 1SCWA 3IH8A 4OONA 2FFFB 5DVAA 5GLCA 3N4IA 4GOGA 4KZ6A 3MXSA 1SHVA 2HP6A 3DTMA 3W4QA 3Q7ZA 3BECA 3IWIA 4EBPA 1W8QA 1MPLA 1W79A 4R0QA 2E8IA 1KDSA 2J8YA 4X69A 2ZQ9A 3NIAA 3OPLA 4OPZA 4GKUA 2ZLYA 1KGGA 2IWCA 2JE5A 1YM1A 3UPNA 5HW3A 3G34A 5CTMA 4X55A 3OPHA 3G2YA 4E3IA 1W7FA 4IVKA 3LY4A 2ZC3B 2V20A 4OLDA 4QY5A 4WBGA 1NRFA 4Y0UA 4C3QA 3PBSA 4LCMA 1EWZA 3UDIA 2PBYA 2Y2NA 1IYPA 2Y59A 1BZAA 3A3EA 3OC2A 2H0TA 2HDUA 4GD6A 1L0GA 4IBRA 1K25A 3HREA 4YFMA 4JXWA 1IEMA 4BL3A 4EUZA 5AQAA 4E3OA 1I2SA 3VP1A 4HBTA 4OOMA 3G35A 4PM7A 3ZNTA 4B88A 4RYEA 3AGDA 5FA7A 5GL9A 2EXAA 3N7WA 1L2SA 2QZ6A 2QPNA 3PTEA 2P9VA 4NK3A 5JYOA 1QMEA 3SS4A 4K0WA 5TFQA 3C7VA 1GHPA 4P85A 5CTNA 1BLPA 4BL2A 3LEZA 1TEMA 2XDMA 4KZ8A 5FQ9A 5GHZA 3V5MA 4UHUA 1FOFA 5CGSA 4EBLA 1I5QA 1U60A 2P74A 2Y2PA 3E2LA 4EV4A 3OPPA 3C7UA 4Y0OA 4PM8A 3VSKA 4OP8A 5FQJA 1XGJA 4FCFA 1K38A 3S22A 2PU2A 3FKVA 3NDEA 1VQQA 1L0DA 1VM1A 4PMAA 3RXXA 2ZMAA 1IYOA 3ZGAB 3VOYA 5M1AA 4HBUA 1JVJA 4EWFA 4ZJ2A 1ES5A 4KG6A 1ESIA 1WYCA 1DJAA 4WZ4A 5EUAA 4E3MA 3ZG7B 2GDNA 3W4OA 2A3UA 3GRJA 4WMCA 4KZAA 5KSHA 3NC8A 2Y2HA 1NJ4A 1LL9A 4RVAA 4JBFA 4UA6A 5GLDA 3UE0A 3WS5A 2EFXA 1M40A 3Q07A 5EOEA 4RX2A 5AQ7A 3SS5A 5GHYA 2XLNA 2WK0A 3CG5A 3DW0A 3GV9A 5E2GA 2XK1A 4DE3A 1K54A 3ZHHA 4LENA 1JWPA 2WZZA 4E6WA 1IYSA 2XFSA 1CI8A 1KVLA 2X71A 5GLBA 1WYBA 3N8RA 3UDXA 3GTCA 3WS0A 3NBLA 2XR0A 4KZ5A 3ITAA 3OPRA 4N92A 3WRZA 5KZHA 1W8YA 4S2MA 3HUMA 5G18A 3MZFA 3V50A 4LV3A 3MZDA 1JTDA 4PM5A 4U0XA 1KE3A 4OQHA 5M18A 2HDRA 2Q9MA 4FH4A 1N4OA 1QMFA 4JXGA 3M2KA 4FD8A 1ZG6A 3FZCA 4KQQA 1GA9A 1LHYA 2HP9A 3GMWA 2Y4AA 3C4OA 1M6KA 3FV7A 3IXHA 1ALQA 3RJUA 5CERA 3UO9A 4ZBEA 3BLMA 3UPOA 1BT5A 2XGNA 4CJNA 4WZ5A 5EPHA 3IQAA 4S2IA 4ZJ1A 3HLEA 1FSWA 1TDGA 4PM9A 4S2KA 3PAGA 4OP5A 5CGXA 3ZCZA 3Q7VA 2Y2MA 3BFEA 1CI9A 3DWKA 3Q7VB 3IXGA 3IWOA 1SDEA 1SDNA 2JCHA 3D4FA 4FH2A 4LCLA 1TDLA 2WAEA 1PIOA 3CZDA 1KVMA 4JF6A 3TG9A 1TVFA 1ESUA 5HAIA 5L2FA 1IELA 1K6RA 4P6BA 1YQSA 4WZ5C 2IWDA 2OLUA 3MKFA 3A3IA 5A92A 2WGIA 4U3TA 1EROA 5E43A 5EECA 4ZDXA 4B4ZA 1G68A 3N8LA 5CEBA 1FR1A 4F94A 2DNSA 1HTZA 3CJMA 4WMCD 5BOHA 2WAFA 4KZ3A 1KGFA 1MWTA 4KQRA 5FSRA 3BLSA 3VP3A 5HFOA 4P87A 1ERMA 3SS3A 4ZAMA 3QNCA 3MBZA 5JYPA 1GHIA 3G30A 4LV2A 2ZQAA 2DCFA 3IXBA 4OPQA 1S0WA 3WWXA 5CXWA 1BLSA 5CHJA 1Y54A 3BYDA 3PAEA 3LY3A 4UA7A 2P9VB 3ZVTA 5CGWA 4DE0A 2RCXA 1E3UA 1FCMA 4MBFA 5HAPA 3E2KA 1KE0A 3AGFA 4XXRA 4KQOA 3ZVWA 3VP4A 2Y2QA 3BEBA 3BFCA 5F1FA 1K55C 1XPBA 2DRWA 4RX3A 4R3BA 2XEPA 1JTGA 5TGFA 2R9WA 1RP5A 2ZM2A 3HVFA 1WE4A 1DJBA 4R3JA 1K56D 4GN2A 5FI2A 1ONHA 4R23A 4ZTKA 1YLJA 4Z9QA 4GD8A 3ZFZA 2ZC6B 1RGYA 1JWZA 4KG2A 1H5XA 1PW8A 5E2HA 4HESA 2EX8A 1IKIA 2Y2LA 1DJCA 2R9XA 3LCEA 4DE2A 1YT4A 1XGIA 4HEFA 3UNWA 1I2WA 3N8SA 5KMWA 4KENB 1FCNA 3IF6A 1YLZA 3IF6B 4GDBA 4JF4A 4OOYA 4S2PA 1EI5A 4Y0TA 5EVIA 1PW1A 3BRMA 4BD0A 2ZM8A 1E25A 3GR2A 1PZOA 4X56A 4QJGA 4KZ9A 1XA7A 2OV5A 1PI5A 2JC7A 3A3JA 3VMAA 1YLPA 1LI9A 2J9OA 3G31A 3PBRA 2ZQDA 1MY8A 2I72A 5EVIB 2HDSA 3BM6A 3O87A 5A91A 4PM6A 2WADA 4E3JA 3W8KA 3JYIA 3G4PA 4EQIA 3VP0A 4R1GA 1K54C 1DY6A 3VFFA 1MWSA 2XF3A 3G32A 2Y91A 3UY6A 3IF5A 1BUEA 2ZQ8A 4QB8A 4A5RA 2HDQA 4ID4A 3TOIA 4EBNA 1CK3A 1ONGA 3GSGA 4L0LA 2ZD8A 1OMEA 5HL1A 5DTKA 5FQIA 2UWXA 5I94A 2Q9NA 2ZC4B 4K0XA 5FQQA 1MKIA 2Y55A 5EE8A 2BLSA 2WGVA 5FI7A 1O07A 4BD1A 3HLGA 5F83A 2Y2OA 4WEJA 1HZOA 3HUOA 2WKHA 1Z6FA 5KSCA 4E3KA 3OCNA 3OCLA 2XD5A 4IEDA 1XKZA 4LV1A 4R4RA 3VSLA 1PWDA 4QY6A 1K57A 2ZJ9A 3HBRA 4MBHA 4S2JA 5FQMA 4DDYA 4E6XA 3SH7A 4BJPA 4DKIA 1GA0A 4S2OA 5FQKA 4JXSA 4S2LA 2IWBA 3V39A 2ZQCA 4Y7PA 4XUZA 5IHVA 1K56A 3UDFA 3C5AA 3ZG8B 3EQUA 2WKIA 4DF6A 1N9BA 2WGWB 3VFHA 3O88A 3FYZA 1MWUA 3V3RA 3Q82A 4C75A 1GCEA 3MKEA 5GLAA 4M3KA 3QHYA 4JLFA 4GB7A 4WELA 5CHMA 4DE1A 2CC1A 2HPBA 1GHMA 1BULA 2EFUA
chains in the Genus database with same CATH superfamily
1UUGB 1T1BA 4L15A 4OQIA 4HJ3A 3SOIA 4CLCD 3GQZA 3T50A 3CCV3 2R62A 2GSPA 1D1JA 4MEZA 5GHXA 1XB2B 2Y2JA 1IOUA 4HJLB 4CQHA 4IBCA 2FXTA 1FSYA 2WZXA 1HNZM 5F1GA 3B74A 2OAP1 3HLDA 4WM9A 2VGKA 1DO0A 3WOFB 2KDKA 4DV5M 2KOIA 3NBJA 4NPBA 1Y28A 4ITQA 3D8LA 4U0TA 1T6OA 2BT3A 2ERCA 3N54B 2L7IA 4LJ6A 3VDUA 1FW7A 3MXRA 1FR6A 4I4KA 2C5WB 4GW9A 1BVSA 4BLMA 1NO3A 4E3NA 5DF8A 1ZC2A 1RSNA 4ORLA 3EEHA 4JPMA 2R45A 2VF8A 2V2FF 7CATA 4BBUA 5TBMB 3LIFA 3HU3A 3SZTA 4IUHA 3UGJA 3PBOA 1BGSA 1OT9A 2BWEA 3V67A 5FLXS 2KF5A 4BTXA 1FCOA 5DTSA 3KYQA 2F4YA 5BVBA 2WSFF 1G3IA 3CPTB 4BBTA 4EW5A 1T1CA 2B95A 2YNMD 3LGOA 3VF1A 3GPYA 2MJ6A 5EVID 2C6WB 3DMCA 4O7DA 3WS2A 5A93A 5CECA 5DFXA 1O7HB 3F1PB 2LNHC 3WHKA 4YNRA 4MNRA 2XFTA 1ZKJA 3CI6A 3OZHA 1E9SA 1A67A 3BFFA 4WYYA 4QD4A 2P0MA 1K82A 1W4NA 1K57C 3I4VA 1UFZA 4EEUA 1S1YA 3PNYA 3J2PB 2VQEM 5EFWA 3HKPA 1T19A 1AIPC 1YGEA 1E97A 4KZ4A 4I38A 4N9LA 1CH0A 1IQXA 1HD8A 5E2FA 2RBIA 1HZ1A 5D3OA 1GL7A 5HAQA 5FI6A 1OJGA 4P0MA 1K28A 3NUVA 3MQ0A 2RCDA 4UQIS 2DENA 3KSED 4N9KA 1Z5CA 1Q02A 1KGEA 4IBXA 1I2GA 1R4YA 2V1CA 3I563 1YSQA 4F2LA 3T8NA 1TRQA 1UGUA 3ZQ5A 1XXMA 4H8RA 1N9NA 2XD1A 1BNFA 1BSAA 1EW0A 3LOYA 3MG3A 2ZMFA 3SAVA 1Q7HA 4GHOA 1JBSA 1RGKA 1ES4A 1NZUA 1J09A 2WUQA 3T4JA 5EJCA 1RGEA 1IKGA 3U6QA 2VK3A 3ICYA 4KT3B 1LL8A 4X53A 1ZG4A 5DFLA 4UA9A 4AG6A 2OQEA 3WODG 3T1YM 3W67A 3A3DA 2B5RA 4N6V0 1TS0A 2G2UA 3HJKA 1QUTA 3QP1A 2V1BA 1D06A 2DXIA 2Z6CA 3PBTA 1MBLA 2JKRI 3MK6A 2WKEA 4BENA 1LSWA 1OCVA 3FTDA 2G3QA 4QHCA 2WGQA 4MLLA 1NHGC 1TRPA 3A3FA 3GRVA 2Y2IA 5HARA 1LI0A 3G2ZA 3B9PA 1EEJA 3HLCA 5FAQA 1S6RA 3MZEA 2DZOB 2STDA 3HWSA 1LRAA 1CF0A 2RGQA 3I7JA 1Z59A 1RGZA 4GJ4A 3B3XA 3CWFA 3HHYA 1Y4KA 1LOYA 4KZBA 3N6IA 3GZBA 3C3DA 3HK4A 3WHLA 1A0KA 3U2AA 5IG3A 1NDOB 2INXA 3WS4A 2O99A 1UGIA 1YUBA 2NQ8C 4WEKA 1DYUA 1I2FA 5U47A 3VP2A 1RN4A 3FF0A 3E9SA 3MFDA 2P5TA 3K9MC 1JRQA 1YVSA 3DZDA 3VV4A 1K4FA 4B93A 1HVBA 1I2EA 2IUJA 1ES3A 1NSFA 1R4CA 3W4PA 1G41A 2Q2EB 3BNCA 2F5WA 3FG1A 2DAEA 5LC6A 4NL4H 1IU7A 2LHGA 4LRTA 1X1XA 5FATA 3UK6A 1NYMA 1YIT3 3H7WB 2WGWA 4HP9A 4HBRA 1SCWA 2FFFB 2K31A 2G8LA 4DR4M 1J3WA 3N4IA 4IUKA 5ITTA 1N36M 1VQO3 4LZJA 3VK8A 3HZJA 4BWIA 2H28A 1VQ53 3BECA 3LR4A 1MPLA 1E9RA 4FCZA 1ODVA 3D79A 4R0QA 3CNMA 1PRBA 3CGWA 4HL4A 2DZLA 1RKYA 3CD63 2J8YA 4X69A 1OUNA 2IWCA 4DR7M 1YM1A 5JBSA 3A76A 4STDA 1XMQM 5FDSA 1TTOA 2ZC3B 3LUQA 1QDRA 4EV5A 2OWHA 1W2B2 4WBGA 1IDPA 4QY5A 1DO2A 1RCLA 2PD8A 4Y0UA 4LCMA 2JXNA 3UDIA 2PBYA 2Y2NA 1IYPA 3PFIA 4MGYE 3FKEA 3EF8A 8RNTA 1V74A 2XLJA 1N78A 2W04A 1NLYA 4GD6A 4P6ZS 4B7FA 1K25A 4YFMA 1JKGB 4R1KA 3LMLA 3L9KA 3N9HA 2D02A 4I39A 4EUZA 1QZEA 3VE4A 4E3OA 4LF5M 3G6E3 4OOMA 3FUVA 4JN6A 4IBJA 1ROVA 2WOHA 3MFXA 1SXJA 2C9CA 4NHFA 3EIHA 3LR3A 4N6UA 1DGHB 1IBLM 4NK3A 3UB9A 5FTLA 3G16A 1WJ7A 1QMEA 5TFQA 2W27A 3UJMA 1NJFA 2V8FA 1TH3A 1JBRA 3DTIA 3IG5A 1ZQ9A 1TD5A 1WMNA 4HJ4A 2IUKA 4W5WA 4KZ8A 3K5TA 1JZDA 1TS7A 3RTYA 3U97A 4EBLA 3CCU3 1Y8GA 3HJ8A 4GC9A 5G4ZA 1R7RA 1PJTA 4G4NA 1IM2A 3F1NB 4MDZA 3G0KA 3ZH9B 4CLCE 1XGJA 2CV0A 3LR0A 3FKVA 3ZGAB 1L0DA 1VM1A 3SVAA 4JI5M 2CFWA 1CUKA 2G5GX 1NVMA 2RGOA 3ALAA 3K7CA 1JVJA 1B27A 1P3QQ 3SYKA 1ZMUA 1IBMM 3CMA3 1DJAA 1N8R4 4WMCA 2LVAA 4R9LA 4KUOA 2Y2HA 3D9RA 1X1YA 3L29A 3U1WA 2ZOIA 3JVVA 1GLNA 2DNAA 3SS5A 2OAQ1 3HIGA 5CTNA 1E3RA 2WOFA 4F3LA 2J7OA 5JI2E 3L0RA 5EM1A 1V92A 2PBDP 2JN7A 2CWTA 4DE3A 2Y74A 1YI23 1Z6TA 2ZAMA 2KRUA 4LENA 3NHXA 3LH4A 1J7KA 1IYSA 1JWPA 1T18A 3EEAA 3EOIA 5HPIA 1WYBA 3GTCA 3OTOM 1HT1E 2XR0A 3ZCBB 2E2UA 4HH2A 3AV0A 4HZ9B 3MZFA 1OKSA 3MZDA 1JTDA 4DR6M 5D81A 1Q40B 4U0XA 3RE8A 2Q9MA 4FD2A 4FH4A 4CGYB 5BR8M 1VQP3 1BNGA 3LVVA 1NY5A 4JXGA 2C9OA 2VV7A 2A24A 4HM7B 4KQQA 4LRYC 4MM3B 4R3DA 3R9XB 2QP9X 4QNRA 2E2VA 3VK7A 3BLMA 3F7XA 3CC43 1C7YA 2PYPA 1RGFA 3MS6A 3WRZA 1DVCA 3FC7A 2L09A 1FIKA 1TDGA 4DR5M 2DAKA 2QHOB 4TUWA 3I01M 4DJ2A 4QPRA 5CGXA 3ZCZA 3KCHA 2R44A 4EXRA 2Y2MA 2WO0A 1VQ73 3T12B 1N8QA 3TJZC 3KDSE 2E5LM 4ILFA 3IXGA 3IWOA 4N6TA 3D4FA 1TDLA 1RGHA 1XXHA 4FMCA 4JF6A 3TG9A 4P6BA 4WZ5C 3FH1A 3MKFA 1UWNX 4U3TA 5I97A 3NOTC 2BJWA 1FUTA 5EXPA 3DZLA 3KZTA 3CXC2 1G68A 5CEBA 2DNSA 1E32A 5ITUA 5JPPA 4BBVA 2WAFA 2XZUA 1W2ZA 4QHTA 4GKJM 1BNEA 4PKYA 3BLSA 4AKZA 5EP1A 3UNLA 4P87A 1L3LA 1NO1A 3LMMA 2F5PA 3QNCA 4RF1A 3FZWA 5JYPA 5FTKA 3CITA 1FGQA 2Z8YM 3G30A 4L78A 4AKHA 4OK0A 1EE8A 3KW6A 1TS8A 3O5YA 1Y4OA 3T4KA 1W02A 5AI1A 5CXWA 1QVG2 4UA7A 3KSHA 1S4SA 4RF0A 2P9VB 2MJ5B 2O9BA 5HSQA 4X2HA 3NV0B 5HPFA 3CHWP 3AGFA 4XXRA 4IIAA 4Z6YA 5CX7A 3ZVWA 3BEBA 2MH8A 3RGPA 4NXFA 2D01A 3JAMS 4PEJA 2XEPA 3EHCA 4JI0M 2ACGA 3MQQA 1PFLA 4ME4A 3EJVA 2DHRA 1RN7A 5HGRA 2APLA 2MF7A 1A5TA 2OQ4A 4ZTKA 3ZFZA 1GY5A 2B02A 1XJ4A 2B3TA 1VDDA 3X40A 1YHQ3 4EXOA 4KG2A 4HESA 3TDGA 4HI4A 5BIRA 1DJCA 3LCEA 3H4JA 4DE2A 3F1NA 4JGOA 4JI4M 4L6V6 4DV7M 1YE9A 1YT4A 2G7UA 1XGIA 1ZO2A 4H6JA 2KCDA 2LHCA 1DETA 1FCNA 1L5GB 1WNHA 3RGAA 2C99A 1YLZA 2JKGA 3IF6A 4GDBA 1ROAA 4JF4A 4OOYA 1I0XA 4HZBB 1X1WA 1HQYE 4B3RM 1T2HA 4BD0A 3F9SA 1E25A 3U60B 2JKRM 4KZ9A 2VQFM 1DP6A 5KQ8A 4MGHA 2YFQA 5ITXE 3U6PA 2LYXA 2I72A 2ZQDA 3DTKA 2HDSA 5TGNA 2BTFP 2PDRA 4OVZB 1BSCA 2LBCA 3LR5A 4WF0A 2M60A 2KAAA 3UB8A 3PNVA 1UI7A 3MJ5A 3BXWA 4NXNM 4K0KM 3G32A 3UY6A 4CHTB 2RFRA 5EP2A 1IVWA 3F1OB 2BMQB 3B42A 5DTKA 5FQIA 2UWXA 3HIIA 3LT9A 2ZC4B 2ZL8A 1MKIA 5FI7A 3K92A 1O07A 3E46A 2BO9B 4L8OA 1PJSA 1HZOA 3HUOA 1SIIA 5KSCA 3AHSA 4IEDA 2I7NA 1DVDA 3SATA 1XKZA 4LV1A 2QJ7A 2W9PA 1A2PA 4KLNA 3J7BA 1K57A 4S2JA 5DREA 2LB9A 4GB5A 4DKIA 1F5MA 4Y15A 4BJPA 1FGTA 2E2TA 3CAXA 1TJDA 2ZQCA 5IHVA 1BANA 3STDA 1JB4A 3UDFA 5DNYA 3J7Yd 3KN4A 2WKIA 5JI3E 4AI6A 2WGWB 1Z1SA 3GZYB 4LJ8A 5F69A 2DKLA 3FD9A 3WMDA 1V58A 4M3KA 1WXQA 3LIEA 2CV1A 1N33M 5KP3A 5EEOA 5HOHA 4PAUA 3GPXA 1Q3BA 5CHMA 4DE1A 4XT2A 1Z5BA 2CC1A 5EPHA 1GHMA 1BULA 1SZVA 1NY0A 1QYRA 4JI7M 2QWSA 2CG0A 3NJAA 4BLCA 1WA9A 3IHAA 3GPUA 1R4GA 5J3WA 5IENA 3UE1A 3PCSA 5DJTA 4LF7M 1OJLA 3EQQB 3QYEA 2HOHA 2VV8A 4Y28F 2KLIA 2VGLS 4KVHA 4JI6M 1US1A 2VEAA 4WYKB 1CQSA 4C6YA 5EP4A 4XB5A 1QANA 8CATA 3QP6A 4LV0A 2MGWA 4XBXA 4XBOA 1LLBA 2QMIA 4WLAA 3SLUA 3QRDA 2HP5A 4CLCC 1FJGM 1OHOA 4RZMA 1OGXA 3IS2B 2KZSA 1OGZA 3DWZA 2R6FA 1IQYA 3U4LP 1HNWM 2PR5A 3BB9A 4MGZE 4DRTA 5AQ9A 5AIIA 1I3IA 2KEBA 3FUWA 3JUOA 1I94M 2GBXB 3MG1A 2A49A 4K1UA 4J9AA 4FMDA 2D1WA 3T15A 5HX9A 4IBKA 3RGSA 3HHWA 1XNRM 4X64M 5ITQA 4BTYA 3DGOA 2VKSA 3RH8B 4ZJ3A 2GQFA 1IVUA 2G2WA 4D81A 1GMQA 4GCZA 1RGLA 4Q0HA 3FCSB 3MYTA 3KOXE 3JR5A 5FDHA 1XA1A 4IBEA 4KT0F 4GHAA 3OV4A 5HWTA 1FGMA 1MWRA 4HM6B 4FWGA 2C4BA 3IMAB 4O8SA 1N5HA 4OQGA 4Q8IA 2OWJA 1IXSB 2UXCM 3A0VA 3GLHB 1I8VA 3CC23 2WYXA 3GQ3A 3RXWA 3MMPA 1GD3A 1VEJA 2K0BX 1IBKM 2GXFA 2JA2A 4OX9M 2KXGA 2L1SA 3LYGA 3DBAA 3O3VA 3TE8A 3ILKA 3PS8A 1PZPA 5AEWB 4GS9B 6STDA 5HDSA 2GNXA 1B20A 3J7AS 1IVVA 3T8UA 2RL3A 5EVIC 4DXBA 3GVBA 4QU3A 2V0WA 4JRFA 3IH9A 2YFLB 2OTL3 2CX1A 1JNUA 2VA0A 3DA1A 3T1SA 4RKUF 2W3GA 3FG8A 2X4AA 1CEFA 5IG5A 4AEQA 4NETA 4M9XA 2JUJA 3HU2A 1NXYA 3T6PA 1AVLA 2KNAA 1BTLA 5IT9S 4N6NB 2Q07A 5L8RF 4IPBA 2Z6BA 1BSBA 1L0EA 3ZNYA 1ULJB 3KP0E 4WL9A 4XUXA 4NREA 3CCL3 4MGIE 3BWLA 1YLTA 3ISGA 2AAEA 2Z7AA 4RA7A 1ACFA 1E4DA 1QMAA 4I4LA 2JBFA 2OO9A 3B7ZA 5J8XA 2H5XA 3IWQA 4GZBA 3B4PA 1D0MA 3UN7A 4FUWA 1K8A4 3NHQA 2J5YA 1MX0A 4LJ7A 1KSFX 2DAMA 4LJAA 3CCJ3 3NCKA 2ZC5B 1Z09A 3SC3A 3BFDA 3KS4A 2HKJA 3CF0A 3O86A 2CKFB 2RNTA 3ZG5A 5AQBA 3W0LB 2P05A 3LTAA 3M2JA 4DXCA 3ZQJA 1K734 2RGHA 2V0UA 2KDLA 3I0YA 1GD4A 4IJFA 1U8CB 3C4PA 1A2KA 1TR8A 2Z2LB 1BSDA 5FEGA 2R0IA 1F4IA 3PXMA 3MWZA 2KNZA 1L0FA 2PYRA 1K3WA 5FAOA 1DMNA 3T4OA 1PU4A 3RNTA 4O01A 2YKFA 1O7WB 3UE3A 4DBGB 1N34M 1HU9A 3FPWA 2ZM0A 4KQDA 3E0YA 3D3OA 1K55A 3IXDA 2AHMA 2ZTDA 4N1HA 2FFYA 5KP1A 4ZRRA 3WHOA 3QNBA 3NDGA 3PHYA 6GSPA 1M904 3OLOA 2M7UA 3BU4A 2O01F 3Q1FA 3SAWA 3PZWA 4LFBM 4LLOB 4OH0A 1T3BA 1GYBA 2XQZA 1NRJA 3V98A 1BSGA 3EQVA 1I0VA 3KSGA 4OONA 4IBFA 1ZX2A 1RNTA 5F5YA 2MR9A 2R4EA 3J81S 4GOGA 2K9DA 3UB1A 3MXSA 2OOLA 5GLCA 1BU4A 1BAOA 4H3UA 2HHHM 3W4QA 4KO8A 4J5KA 4GHLA 3IWIA 4EBPA 1B3SA 4HM3B 2OWPA 2BNKA 1NLZA 4LZZA 2ZQ9A 3OPLA 2XA7S 3UPNA 2ZLYA 1OHPA 5BPVA 4JI1M 2IMJA 1DGBA 3OPHA 2A5YB 1LOWA 3LY4A 4M0DA 4G4OA 4OLDA 3FUXA 3N8BA 3D5IA 3A3EA 3OC2A 3NOPC 3TPZA 1WMOA 4EV2A 2R78A 2X49A 2IY2A 3PXPA 4G4QA 5AQAA 2NUPC 3NWLA 3VP1A 3VFDA 2FOIC 4S12A 4B88A 3ZNTA 1AV4A 3DUKA 5TBMA 1DGGA 3AGDA 3B7CA 1YNVX 3BNBA 2EXAA 5KPTA 1IFQA 2F56A 4LF9M 1GJSA 3SS4A 1ZAEA 2VV6A 3JR4A 1V9YA 1NWZA 3C7VA 4K0WA 2KZUA 2MC8A 4P85A 3LEZA 2BMOB 4LCBA 3AOGA 1JR3D 2B18A 2I7PA 1I3FA 1TEMA 4MN6A 5FQ9A 5EXXA 3UJNA 3GP1A 2M5ZA 1I5QA 3BY9A 2Y2PA 3OPPA 3C7UA 1G4AE 4PM8A 5CLKA 3G4S3 2GU3A 4FCFA 1H3QA 3G713 1BNSA 1VQQA 5IG0A 1TU5A 1T43A 4IHQA 3PYJA 5M1AA 2CHCA 3VOYA 4FOFA 4EWFA 4EC6A 2F4VM 1RMSA 1ESIA 5EUAA 4WZ4A 3ZG7B 2GDNA 2QZ4A 4DV4M 1H6UA 1UW1A 1P9WA 2A3UA 4KZAA 4AG5A 4KFDA 4IBGA 1NJ4A 4JBFA 5GLDA 5C18A 3KIIA 3Q07A 4XM4A 1NB3I 1EIJA 3X42A 2PAVP 4UN2B 2OCTA 3GPPA 2C5RA 3QP5A 1Q39A 4P17A 3MSOA 1F9IA 2CRUA 1TUHA 3GQ5A 1K54A 4HKVB 2NUTC 3KO6A 4E6WA 1KSIA 1CI8A 2UU9M 3GLGA 1GO5A 1FGOA 3N8RA 3UDXA 3AGNA 1W5TA 5FTNA 1Q9EA 3NBLA 4Y2FA 3LT8A 2ZBKB 3OPRA 4P16A 4N92A 1QAKA 1RCKA 1W8YA 4S2MA 1XJ2A 5G18A 2LH0A 3V50A 1VQ83 4G6ZA 4LV3A 1G0TA 3IX4A 1NWWA 4WN5A 4OQHA 1E94E 1GSVA 2Z4RA 5STDA 4R4KA 1N4OA 3M2KA 1YKDA 4I3AA 3FZCA 2BMRB 2K6BA 4QNMA 3CCM3 1QUSA 1LHYA 2HP9A 3GMWA 3C4OA 3FV7A 3UO9A 2W9QA 4YWZA 5CERA 3IBJA 2OTJ3 3DGLA 4AQYM 4FW9A 4BB9A 1BRKA 4N6MA 2JZ0A 2R65A 1MNLA 3IQAA 4WZ5A 4X2OA 3K2NA 1O7NB 5AIGA 1P0ZA 3HLEA 2KX6A 2O9CA 3DAVA 3M7GA 4PM9A 4S2KA 3QYBA 3JUPA 3CCQ3 1G28A 1P97A 3H9WA 4M9ZA 3QAUA 4OP5A 4HOHA 3Q7VA 3BFEA 3Q7VB 1CI9A 3DWKA 3KXEC 2WKPA 2JY7A 5GSPA 4FCWA 5IW9A 1JZOA 1YJ93 4EQ1A 3H7WA 1LQMB 3KSXA 5KO3A 1DP9A 2Z76A 3H3HA 1K3XA 4HOIA 1K6RA 2EJSA 1M1K4 2OLUA 5KPRA 1UDII 1EROA 4N6OB 5IERA 3GO8A 4IJGA 4B4ZA 2XSZD 3MG2A 1ORYB 4F94A 3HY5A 1VQK3 1HTZA 5BOHA 3OBFA 1G6OA 2JZ1A 4KQRA 5FSRA 1XC8A 2VF7A 1NNVA 3QP4A 1ERMA 3SS3A 3BNDA 4M0WA 1D6ZA 1GHIA 4I3IA 2EA0A 2DCFA 4OPQA 4ETXA 2HMKB 1JR3A 1BLSA 2CG1A 3BYDA 1STZA 1DGHA 1S1ZA 2PNCA 1VG5A 5AIHA 4BTWA 2P09A 2RCXA 4MBFA 5BU4A 5HAPA 4MJDA 1UM8A 3H51A 3GAXA 3DY5A 3VP4A 3MJQA 4NKPA 3C30A 1A90A 4REZA 2DRWA 4JI8M 5IS1A 1B2SA 5FW5A 2ZM2A 3HVFA 1WE4A 1DJBA 3KS8A 1RTUA 4R3JA 3SFZA 1K56D 5FI2A 2P0XA 3KYEA 1NHWC 3FUUA 1FUWA 1JN5B 1FZUA 3FTEA 1RGYA 1RLSA 2CHVA 1MOLA 1N5PA 1G59A 2LWXA 2QENA 1WMPA 3SW1A 1YSYA 1BIRA 2R9XA 3KSIA 2O9UX 3H82B 4HEFA 3UNWA 2H1RA 2W56A 4WP5A 1A2VA 2CUZA 4S2PA 5EVIA 3U5ZB 2CFKA 2W03A 2ZM8A 2YFIB 3GR2A 4X56A 4QJGA 4K61A 1X0OA 2OV5A 1PI5A 4Q0JA 5DRVA 3A3JA 3VMAA 1LI9A 3G31A 1HT2E 4EETB 1K9M4 1GOYA 3MF0A 4PM6A 1XHBA 1XNQM 1L1TA 2O0YA 2JKTM 1KC84 3VP0A 4R1GA 1JNQA 1MWSA 4A3VB 1BRIA 1TDHA 4PDIA 2QIYA 2OOVA 1BUEA 2ZQ8A 2CX0A 1OTRA 5ITYA 5ITRA 4A5RA 4EBNA 4HAAA 3GSGA 2L4RA 2ZD8A 1OMEA 2LXEA 3SOAA 4K0XA 4JGQA 5EE8A 1BNJA 2BLSA 5EM0A 5DKKA 3GRDA 1UGHI 3WOEB 2Y2OA 3S7OA 1Z6FA 4G3VA 4E3KA 3OCNA 2L0WA 5FTJA 1B2UA 4MMZB 3VSLA 3MQOA 4QY6A 1IXZA 2ZJ9A 4MBHA 5FQMA 2GEYA 2QGUA 3GRUA 3NM7A 5C1BA 1JB2A 1TFKA 4G3WA 4D60A 4JXSA 4S2LA 1NY6A 3F92A 3K1JA 4Y7PA 4XUZA 4GHIA 3G6OA 3CNXA 2QBYA 5HDCA 3HHXA 3VFHA 3FYZA 4O8GA 4O02B 1D2NA 1QAOA 2IYJA 4OVMA 1OTIA 4C75A 1JQJC 2ML6A 4Q7JA 3SHGB 2K0MA 1R2YA 5GLAA 3LIDA 2C96A 2QYBA 2VGLM 2J3TC 4B7HA 1NV8A 2HAKA 3DGNA 1LNHA 3O8YA 4MEIA 2EWWA 4X1LA 1IN8A 5CF1A 4X1MA 1XFQA 1RCJA 3KE7A 1W5SA 1LQGC 2ZANA 1NZOA 2DVWB 3TL4X 2V1ZA 3EN1B 4MBKA 4JYAM 4Q0IA 3D8BA 4WW0A 3LCUA 1E3UD 3K0ZA 1Q42A 3TWKA 4LF4M 2W82A 2ZOHA 3NQYA 3LQQA 2P38A 5M19A 3LIAA 4OLGA 1G71A 3K9PA 4DUYM 3SARA 3CLOA 4AFIA 1RNBA 4CPKA 5EOOA 4S2NA 2QQ8A 2XH9A 5CXOA 3L27A 1SKOB 2UUGC 1VQ1A 4LFAM 3IX3A 3HCYA 1BLCA 5G1KA 1OQYA 4HP4A 3LTCA 2HMLB 4Q53A 4ANRA 4PDGA 5EVHA 2BU4A 5H37D 4M9SA 2Y79A 2CWVA 3HX8A 2M1CA 3HZPA 1CJFA 4XBTA 2F5NA 4OU7A 3A0RA 3T1XA 1YMSA 4J5GA 1AUAA 3U6OA 1NNJA 3NX0A 3DTEA 4LJ4A 4JXVA 4LGWA 2PU4A 2J80A 3OX9A 4WP2A 1IN6A 1OPYA 3PBNA 1H0MA 3HLBA 2KF6A 3WS1A 2N35A 2F5SA 1FNNA 4HNBA 5F3WA 4B7GA 1L2CA 5ITXA 4PPRA 4NSRA 5DTTA 3D5GA 2QA43 4X68A 4X62M 3GLGB 4Y13A 2DAIA 3Q81A 1M9GA 5IF6A 2UX0A 3QP8A 2XSZA 3B4OA 3HLFA 5TR7A 4EBGA 1DMQA 1GY6A 1LNIA 4LF8M 4HM0B 5CK6A 3KKGA 4FMBA 2KA6B 3EX9A 5G2GA 5FASA 1B2MA 5IWAM 1XX2A 4FR9A 4OOLA 5A90A 3AGOA 1IXSA 3BIRA 3HI7A 2XRXB 3BBZA 2ZQ7A 2EX6A 1D6YA 1RRHA 3CPW2 1LL5A 5AYSC 3ZG0A 1K4EA 1C1KA 4YY3M 3KSPA 1I70A 3HJQA 3KOZE 4JKTA 3MHVC 3BLZA 1V33A 1G6AA 4OKPA 4IJEA 4D82A 3HU1A 1N9OA 2HCBA 1RN1A 1QAMA 1LV7A 1N9JA 2VX8A 1IY1A 3K9OA 2GU1A 4U13A 4RQ9A 1IN7A 4FVMA 2YFJB 4MMXB 1O7PB 4OVDA 4FSFA 3F1OA 3LW5F 2Y2KA 3AOEC 3CPOA 4KHPM 5EP3A 1AXBA 5E2EA 1XWIA 3HHZA 4FWHA 2J9PA 3OOVA 5DF7A 4ETZA 1SXJC 3LO7A 3SH9A 2HWJA 1BRSA 3JVUA 1KWIA 2BJVA 3JUNA 3OWYA 1YMXA 2HZ5A 1ULIB 2H0IA 2H0YA 3ZG9B 3PXGA 2PT7A 1PYLA 4HEOA 3GLFE 2J3WA 3KVWA 3KX0X 1F98A 4KG5A 3OW22 2J7VA 4YINA 5IREB 4XDVA 3U6DA 3IHBA 1MXOA 4GNUA 4DDSA 1PRQA 3AOEA 1Q3CA 3S5CA 4B08A 2CHQA 3CC73 3T38A 4HVNA 3EBTA 1PM5A 1PFPA 1VETA 3U6CA 2VGJA 2ZL1A 2LVNC 2Y2GA 2KW0A 1VHMA 4X65M 2WZJA 5HL6A 3A42A 1Q2QA 1YLWA 3B33A 2W3HA 1IYQA 3FYCA 1H8MA 2BIRA 3JUMA 4OPRA 5FEFA 4GDNA 2KHHA 1PI4A 3NULA 3KFUG 1LSVA 3FGYA 3CCS3 3E4PA 4DV1M 1PYYA 4GLQA 3E4OA 4QWOA 2AVXA 2X71A 4D2OA 3FUTA 1U5OA 2R41A 3VGNA 3IT9A 2CFDA 4QOSA 3T1QB 2BASA 2A15A 6RNTA 3A46A 3X3YA 1KDWA 4KZ7A 4AW4A 1SPUA 1EFUB 3LTDA 1O7MB 2XR8B 4M4XA 5EXTA 4KZ6A 2HP6A 3DTMA 3A0SA 3Q7ZA 2L4VA 2YR0A 2ZL1B 1XFNA 2V1LA 1W8QA 5KPZA 1W79A 3CU3A 2RSXA 1KDSA 5D82A 3H82A 4FCMA 4E04A 3NIAA 2EKKA 4EERA 1KGGA 5HW3A 2PR6A 3M8CA 3AHWA 3G2YA 3U61B 4XGIA 3KSFA 1RDSA 1W7FA 4IVKA 1NRFA 4C3QA 3KOYE 1JN5A 4GEWA 3KSJA 4YHHM 4DV6M 1EWZA 1RRLA 2Y59A 1BUJA 2YKHA 1HYFA 2JY5A 2H0TA 4NXBA 4PHTA 4IBRA 3HREA 3I04M 1GSXA 3CME3 3DGYA 2KXEA 1IYYA 2IA7A 4BL3A 1VQ93 2W3FA 4LRXC 1JKGA 3A5EA 3ZYTA 1I2SA 2EO2A 3F8XA 2VZWA 2GZAA 1LT0A 3G35A 4QOZC 2CIUA 3D9YA 5FA7A 4GKKM 4NSOB 5EQTA 2QPNA 3PTEA 4I5SA 4G4RA 1O7GB 1OTDA 2HMMB 2Y73A 1UCJA 5FTMA 2HF6A 4BL2A 3D3LA 4K90B 1BRNL 4DR3M 1BLPA 2EA9A 1ISKA 1MZUA 2K47A 3X3ZA 3E98A 2V8CA 3VOLA 5IG4A 4LPZA 4UHUA 3DM8A 1C7HA 5CGSA 2OPFA 3UZUA 2KF3A 1AQZA 1U60A 3T4SA 1WGLA 3KOWE 3FG3A 3E2LA 4EV4A 3GDIA 4Y0OA 1IFYA 1UCKA 3Q1CA 3VSKA 4OP8A 1QQWA 4GMQA 1K38A 3FSDA 1SJWA 3S22A 4GITA 3F40A 2K7SA 2PU2A 3GSPA 3HX3A 3RXXA 1IYOA 3EIEA 4DUZM 4HBUA 3EWKA 1S3SA 2GNOA 3NOUC 4ZJ2A 2O25A 4KG6A 4E3MA 3U6EA 2O3OA 4NXGA 3GRJA 3BJNA 3JVCA 5KSHA 3NC8A 4RVAA 1VQL3 4UA6A 3LCVB 3UE0A 1FILA 1OTAA 5AQ7A 5EOEA 3DFZA 1FUSA 2XLNA 5IZ7D 4Z1WA 5L07A 4WURA 1W6GA 3GV9A 5E2GA 2FNAA 5J7EA 3MXQA 4F3LB 3GLIB 2WZZA 4JF8A 1D7EA 1OTEA 1Q40A 2DAGA 1BRJA 1KVLA 3U6MA 2O9AA 1VQ63 3M6AA 1VETB 2W1TB 4X66M 5TJJA 4EYCA 1S4RA 2F5MA 3GLFB 4DV3M 1WIVA 3ITAA 3MSHA 4HLQA 3S67A 3WA3A 4KZ5A 3HUMA 5KZHA 2FFJA 2KRKA 1SG9A 4F1IA 2BNGA 4PM5A 3VLFB 1TF1A 5KP4A 2HDRA 2KNVA 4Z8XA 4QHSA 4LGYA 2YX9A 3IPTA 1OF5B 1IXRC 1BRHA 1ZG6A 3C58A 4FD8A 3B7QA 1GA9A 4DR1M 2Z77A 3RJUA 3IXHA 5LC7A 1OACA 3M0EA 4N6LA 3X3XA 1GJTA 1WHCA 2YQZA 1BT5A 2W1RA 4XT2B 1N75A 2EKFA 4CJNA 2CFLA 4I5QA 4DV0M 1FSWA 1WGNA 3I51A 1OFIA 1BNRA 2OOBA 2CW9A 1BVIA 1HLUP 2UUCM 3PAGA 4HIAA 5K5BA 2EWVA 2XZFA 3OXAA 4JGRA 2Y21A 2SARA 3WA2X 3CCE3 1PNEA 1SDNA 2JCHA 2R46A 4FH2A 4LCLA 1HQCA 2FZ0A 2B1XB 3SMSA 1KVMA 2LVPC 2V1UA 3X41A 5HAIA 1ESUA 3FG4A 3JUQA 1IELA 4NRVA 4HQAA 2V6ZM 3IG8A 1J2BA 3SOYA 2Z3XA 3Q2PA 1K0KA 1W01A 3A3IA 3GZXB 1YSPA 2JKFA 5E43A 1CQAA 4I3JA 5EECA 4ZDXA 3N8LA 2Z4SA 4PT5A 2UV0E 3LEQA 4FCTA 4WMCD 3C8CA 4ESPA 4EUVA 1IQ8A 5HD5A 4CLCB 4KZ3A 3T1RA 4LGMA 1IQPA 1TFOA 1MWTA 4LJ9A 1BUQA 2QPAA 4R9KA 3T0UA 4RBNA 2QKPA 5HFOA 3S7NA 3T4LA 1UCLA 2JNHA 4ZAMA 1EA2A 1N77A 4R7GA 1HJPA 3U61A 4LV2A 1UI8A 3S27A 3DOAA 3E4RA 4G1MB 5D83A 1S0WA 2KRTA 3E21A 1S5AA 3TW8A 5CHJA 3K2LA 5EXSA 5G4YA 3LY3A 4DE0A 1CEWI 5LBRA 1NJGA 3GRYA 2C10A 3E2KA 3IS2A 2FS1A 4BBAA 1KE0A 3UMEA 3NBRA 3CTWB 5KQDA 3MMHA 3D72A 3PGBA 2DWMA 5F1FA 3IECA 5A0OB 3BFCA 3GRRA 4CISA 2SBLA 5IEPA 1K55C 3SYUA 4R71A 1XPBA 4RX3A 2FE8A 3UL5A 1JTGA 3S29A 2ZTCA 2W3EA 5TGFA 1DP8A 5G1LA 2R9WA 1RP5A 4LMIA 1QJGA 4CCVA 4GN2A 1T3TA 2UXBM 1GMRA 4GD8A 1WR1B 3J80S 1TGUA 1JWZA 1Q824 1UUVB 2QNJA 2LTUA 5E2HA 4QWTA 3C2WA 4K08A 4AKIA 7GSPA 3UMMA 4FMAA 2ZBBA 3NECA 1GOVA 3HOHA 5AVEA 1GMPA 2JHEA 3GECA 3N8SA 4OUQA 3U5ZA 3CF2A 3HGIA 1IVXA 3GLGE 1RHLA 4NEED 3BRMA 1KFVA 1W7CA 3TQSA 1GABA 3B7NA 4GS9A 4I8OA 1XA7A 2CHGA 3B8LA 3GWRA 3RFBA 1YLPA 1JV2B 2LQVA 4OW0A 1MY8A 5EV0A 3AMOB 1FA3A 2D42A 1G8PA 5A91A 3AFHA 2HV1A 1Q864 3NM2A 4E3JA 3G4PA 2JP7A 1Z5AA 3QP2A 2XSOB 1K54C 3VFFA 1YJW3 2HMNB 3NBIA 1AWIA 3OWSA 2PHYA 3TOIA 4IIWA 1CK3A 4L0LA 1B2XA 4UQIM 1M1XB 1OF5A 5I94A 2EUCA 5FQQA 3W68A 3BQ8A 3LI9A 3K8ZA 3G8ZA 4R38A 2WGVA 4BD1A 3LIBA 3LI8A 4L8RC 4KZ1A 1TIJA 4NC6A 1EQKA 1LTMA 3RDEA 1Q7Y4 4HM5B 1VQN3 3TE6A 3EB8A 1R6BX 4DV2M 1QVRA 2CH9A 2X8AA 4LG2A 4NXEA 1PWDA 4GIPA 3L25A 4OVZA 4E6XA 1VEGA 1T2IA 2ZM6M 2QSFX 3GLIA 3MHEA 1GA0A 5FQKA 2IWBA 3R4KA 4MMNA 1K56A 2A2LA 3C5AA 3SAUA 3EQUA 1OFHA 2BWBA 2LB5A 2CV2A 4FTXA 2CFOA 4GSPA 1AVKA 2C11A 3Q82A 4Y17A 1F8NA 4IBBA 3OWUA 3MKEA 4BU4A 4L9GA 4MGKE 3GZRA 1HR0M 4JLFA 2CE7A 2J7NA 2WSCF 4LZIA 3ROBA 3HLWA 2LVOC 1GS3A 1I4WA 4DF6A 2AADA 4Y0TA 2V1AA 3V3SA 3UB6A 1ZGXA 4JV5M 3FYDA 2F86B 3TWLA 2A24B 2ZHXB 4UAAA 2ZC7A 1PWCA 4L9FA 3FRIA 1J9MA 1MGRA 2LVQD 4S2NC 3S1YA 1KD14 3NY4A 3UPPA 1PWGA 4G3KA 3BW6A 1B21A 3GLFA 2EX2A 3K3DA 3LXUX 3SYLA 1Q2PA 1V34A 1S67L 1XP4A 3WRTA 3UL6A 1KYIA 3LQRA 3R8FA 7STDA 1STFI 1ZMWA 2XA7M 5F68A 2EXBA 1FGRA 1TS6A 4Y3IA 3CUEC 7RNTA 1ZHHB 4MCWA 4MMYB 4L8PA 2VJWA 3ULFA 2K3DA 1N9LA 2EX9A 1D0LA 3RFWA 3URPA 2VDBB 3HJSA 5J4EA 4ARZA 5FSWA 3M6HA 4IVIA 3AMOA 1YPRA 4LRZE 3HL9A 1SKFA 1L2BA 1KOUA 4K91A 5DJUA 1FYSA 4AKGA 5FL3A 1RGAA 4JF5A 3VDPA 4PCZA 1CEGA 3BOSA 3UB7A 3T4QA 2OOVC 5A8BA 4B3TM 1FQGA 5FAPA 1SIHA 4EEPA 3BFGA 4WUJA 1NNUC 1R2ZA 1WTHA 3V92A 4HY8A 1ERQA 1H8ZA 1OAIA 3F7SA 1K6SA 1YLYA 4H6JB 1BRGA 1TP6A 2X02A 1XJ3A 4EU0A 1GVNA 4RNAA 1J5EM 3W0FA 2WSEF 1XMOM 1ZS7A 1WQLB 3Q90A 3ZDJA 5HWWA 1W5DA 2JY6B 2RRUA 3LVWA 3Q8GA 3S4XA 1QDTA 2HL7A 2OLVA 4E3LA 3FPVA 2H5SA 4ZPXA 4GL6A 4OQ0A 3ZC7B 4DMZA 1SXJD 1O7EA 5EQLA 3L28A 1D6UA 1GL6A 4OPYA 5AJGA 4DJ3A 3P09A 5F82A 1KE4A 3P98A 3SH8A 3T4TA 2PRFA 2Q0OA 3ITBA 2CWBA 2Y20A 4Y5FA 5CHUA 2Z7JA 3S28A 2I9VA 1OIZA 2ZAOA 1OJ5A 2BG1A 3NV0A 3K3CA 3AKZA 4B4XA 3CMZA 5CRFA 3VE3A 1BLHA 3DH2A 1NU3A 1T5YA 5CF2A 1X1UA 3BY8A 2DWNA 4R70A 3FKWA 4KUKA 1K41A 4LGQA 3TSGA 3IF6C 1IN4A 2RKOA 3L2AA 3S7PA 3MPHA 2DMWA 1BOXA 3DGMA 5EVLA 4PKYG 2D7GA 3NQZA 1VQM3 2DHYA 5HD3A 4CLCA 2GX5A 1SKOA 3UE6A 5M18A 3PBQA 1W5ZA 1MN3A 3EGDC 3LFVA 3EE1A 4X6TA 4LFCM 2VIIA 4L16A 5DF9A 2J8XB 2KF4A 1HNXM 1H8YA 1JWVA 1V9ZA 3ER7A 2J3TD 2I9WA 2W56B 5EVEA 4N1XA 3GQ4A 3BNEA 1XXHB 3M6BA 2PD7A 4JXJA 4YOFA 3RGRA 2Z2MB 3NXJA 2Y0TA 3HUNA 3VOZA 3PCRA 1TF0B 2D7EA 3AGEA 5IEOA 3P01A 1AY7A 1GOUA 1C3BA 1PJJA 1NYYA 3FKAA 2JWSA 3LYXA 1E3VA 1SQWA 3FF2A 2OSUA 5CEDA 3SMPA 5HDDA 1PY3A 2HMJB 1GKIA 1IV9A 2L1MA 4R3AA 3SEDA 4R4SA 3W2ZA 3FWLA 3C38A 1MGWA 1VEUB 1ES2A 4LJ5A 4BQMA 2H10A 2X01A 3NI9A 3IH8A 3C3EA 5DVAA 3AJIB 4GHIB 4WHAA 3H4MA 5DYGA 5MC7A 1SHVA 3F8HA 2D7HA 1KQS2 2E8IA 1RU3A 1HKXA 1Q814 4O0PA 3CUEA 2XSHB 2ZMVA 1UCIA 2DZNB 3HJIA 4GKUA 4OPZA 2JE5A 2UUBM 3G34A 5CTMA 4X55A 2FH0A 4E3IA 2CK3H 2V9AA 2V20A 4LF6M 1JR3E 2CEAA 2ZDJA 1JBTA 3PBSA 2W0NA 2WKQA 3F1PA 1BZAA 1QAQA 1OHSA 3LICA 5L09A 2JDIH 4LYLB 4RNTA 1S66L 2M7OA 2F99A 2HDUA 1L0GA 5ELJA 2INWA 4JXWA 4HYZA 2JQ5A 1IEMA 4TX4A 2L2DA 4IT7A 4HBTA 4PM7A 3SX1A 4RYEA 1TDZA 4L9EA 3I553 5GL9A 4KFEA 2MROB 3N7WA 1L2SA 1W63M 2QZ6A 2QJ5A 3E4QA 2DWLA 4R6LA 2P9VA 5JYOA 3CCR3 4CIZA 4EIWA 1GHPA 5LMUM 4G3OA 3SHFA 5A2QS 3SBJA 2XDMA 3L7HA 1XXHE 3VKHA 1ASKA 4JGPA 5GHZA 3V5MA 2WKRA 4DN0A 5HWVA 4EESA 1FOFA 1RJOA 2H0GA 2UGIA 2P74A 2JY8A 1STDA 1IV7A 1N32M 4H61A 4XDWA 4BMWA 5FQJA 4L7KA 3GLHA 3VKGA 5I5LA 3NDEA 2L6OA 4PMAA 3R7WB 1MKMA 2ZMAA 1TH4A 2HMOB 1SXJB 2DI0A 3IX8A 2W2CA 4K1VA 1QVF2 2L4EA 2W6JH 1ES5A 1WYCA 5AVFA 1VEKA 1G96A 3CPTA 4I81A 4BIRA 1NV9A 3W4OA 3MKIA 4ZM8A 1RGGA 3WS5A 1LL9A 1VB6A 2P04A 2H0HA 1BSEA 2EFXA 1M40A 4B9OA 4RX2A 2O5RA 3WDGB 1LXEA 5GHYA 3CG5A 2WK0A 2HGVA 1YJN3 1DRMA 3DW0A 1VQ43 3U6LA 4ARZB 2GEXA 2XK1A 1AR0A 3E99A 4HM2B 4JI2M 2UXDM 3UMDA 3ZHHA 3D4AA 2XFSA 1LOXA 5GLBA 3WS0A 4LY6A 3P7NA 3S7QA 4FWDA 1X37A 3IJEB 1L2DA 3Q3FA 1F2KA 1KE3A 2P7JA 5DFYA 1R5LA 2QEX3 5GKNA 3UB5P 4GH9A 2ZA4A 1QMFA 5KIZA 4CDLA 4WWUC 1DE3A 1MU5A 4O2HA 3QWLA 4HM4B 2CFGA 4RNZA 2Y4AA 4O3VA 1M6KA 2W3DA 1ALQA 2HJ9C 4WYKA 4ZBEA 1ZTUA 1RGCA 3UPOA 3DXOA 1G02A 2XGNA 4J8TA 3LZAA 1MC0A 2GBWB 4S2IA 2E8JA 3IHPA 4ZJ1A 2PZVA 1EUIC 3A98B 1YLAA 1TH2A 1BYWA 2R18A 4FCJA 1T1AA 5HZHA 1LSXA 1YAXA 1C54A 4EW7A 3J27B 3F14A 1OPXA 4LRSA 4DR2M 3MR0A 3FE3A 3KFQC 2CMNA 2OQEC 1SDEA 2QHKA 4AZFA 2WAEA 1PIOA 3CZDA 3I4YA 3SASA 1TVFA 4N3VA 5L2FA 1CYVA 1YQSA 2IWDA 4MB7A 5E26A 1W63Q 1YVBI 5BXQA 2WGIA 5A92A 2Y0QA 1QZMA 1SXJE 4NG2A 2XRNA 1QALA 2CC3A 1FR1A 4MN7A 1DGFA 4L4UA 1GY7A 1W6YA 4FCVA 3CJMA 1CYUA 4LEHA 1NB5I 2P08A 4XBYA 2F5QA 3THGA 4KFFA 3B89A 1KGFA 1PJIA 3K63A 3VP3A 2Z6DA 1PJQA 5DYIA 1JJ22 2JKTI 1B2ZA 1XJ6A 3MBZA 3EBYA 4WFOA 3NBBA 4UEYA 5F6AA 2ZQAA 4NOOB 3IXBA 1L8QA 4B3SM 2GJ3A 3WWXA 2VLGA 1VDLA 1N9EA 1Y54A 3PAEA 1SARA 3V76A 3PR6A 3ZVTA 2QBYB 5CGWA 3Q8XA 1L1ZA 1E3UA 1FCMA 1GSPA 1IK3A 5ELUA 3EN8A 4KQOA 2F5OA 4HH3A 2Y2QA 4HJ6A 1TTEA 2HJEA 3EGXC 3PYPA 3NBXX 1JB5A 4R3BA 2WGOA 8CHOA 2FNQA 4LFUA 2K54A 1BNIA 1IN5A 2ML5A 3JPUA 4RNYA 5RNTA 1EG9B 2C98A 1ONHA 2XROA 4IBIA 3T1HM 4R23A 1ZV1A 1YLJA 4Z9QA 5FGOA 2ZC6B 3TRCA 4B3MM 5E6JA 2FH5A 4NRWA 1W6CA 1S723 1H5XA 2OOAA 4LSOA 5AIFA 1PW8A 2EX8A 1IKIA 2Y2LA 1VZZA 2UUAM 5JPUA 3GLHE 2FGTA 3U60A 4HM8B 1I2WA 2QCUA 5KMWA 3WR2A 4KENB 2DWZB 2XGLA 2K2NA 4MN5A 1MJGM 4HM1B 3IF6B 3FLJA 1G5UA 3IBRA 3SXXA 3FTFA 1EI5A 2B24B 1OTBA 4KODA 1PW1A 3BQAA 4AKYA 3R7WA 5IU1A 4D80A 3AL0C 3ECFA 1PZOA 2R4JA 1IY0A 1YIJ3 2JC7A 5AYRB 4GRIA 4II7A 2J9OA 3PBRA 5EVIB 4HHDA 3BM6A 3O87A 2M7VA 5L10A 2BHMA 1QAFA 4P6ZM 2WADA 3PVSA 5AEUB 4R80A 3W8KA 1W00A 3JYIA 5L8MA 4EQIA 3FTCA 3A45A 1DY6A 3GLIE 4NXMM 2XF3A 1V57A 1OAOC 2Y91A 2W1TA 3IF5A 4QB8A 2F98A 2HDQA 4ID4A 1ONGA 1OT6A 2IA2A 3FRHA 5HL1A 3CF6E 2L7HA 2Q9NA 1GSWA 2Y55A 1IT7A 2R4IA 3HLGA 2W0QA 4X25A 5F83A 1LOVA 4WEJA 5LMNM 2WKHA 1IT8A 1PGYA 1EKMA 3OCLA 3VSYA 1LVNA 2XD5A 1D0KA 9RNTA 4R4RA 1OIPA 1P9RA 3B47A 1OH0A 3HBRA 4DDYA 1DMMA 2Y8HA 3SH7A 5IT5A 3LTBA 4S2OA 5C5KA 3QK9A 1UWPX 3V39A 1ZMVA 3TWMA 1DV0A 3V99A 3ZG8B 1YGWA 3EC9A 3C9PA 1N9BA 3O88A 3KYZA 1MWUA 2XSSA 3V3RA 1VEUA 1GCEA 1UUWB 2L4FA 1JB0F 3L26A 2HPBA 4XK8F 4PD2A 3KP1E 1IY2A 3U6SA 2CP8A 3QHYA 4IBDA 5DKLA 4GB7A 4WELA 4MH0E 4CJ6A 4GC5A 4JI3M 1NJI4 2CWUA 2EFUA
chains in the Genus database with same CATH topology
4L15A 4OQIA 3SOIA 3GQZA 3CCV3 2R62A 5GHXA 4MEZA 2Y2JA 4HJLB 4IBCA 2FXTA 1FSYA 2WZXA 1HNZM 5F1GA 3HLDA 4WM9A 2VGKA 1DO0A 3WOFB 4DV5M 3NBJA 4U0TA 4ITQA 3D8LA 2BT3A 3N54B 2ERCA 2L7IA 4LJ6A 3VDUA 3MXRA 1FR6A 4I4KA 2C5WB 4BLMA 1NO3A 4E3NA 5DF8A 1ZC2A 4ORLA 4JPMA 2R45A 2V2FF 7CATA 3HU3A 3UGJA 3PBOA 5FLXS 4BTXA 1FCOA 5DTSA 5BVBA 1G3IA 2YNMD 3VF1A 3GPYA 5EVID 2C6WB 3DMCA 4O7DA 3WS2A 5A93A 5CECA 1O7HB 2LNHC 3WHKA 4MNRA 2XFTA 1ZKJA 3OZHA 1E9SA 1A67A 3BFFA 4WYYA 4QD4A 2P0MA 1K82A 1W4NA 1K57C 3I4VA 3PNYA 3J2PB 2VQEM 3HKPA 1YGEA 1E97A 4KZ4A 4N9LA 1HD8A 1IQXA 5E2FA 5D3OA 1GL7A 5HAQA 5FI6A 4P0MA 1K28A 3NUVA 2RCDA 3KSED 4N9KA 1Z5CA 1KGEA 4IBXA 2V1CA 3I563 3T8NA 1XXMA 4H8RA 2XD1A 3LOYA 3MG3A 3SAVA 1ES4A 1NZUA 1J09A 2WUQA 5EJCA 1IKGA 3U6QA 4X53A 1ZG4A 4UA9A 4AG6A 2OQEA 3WODG 3T1YM 3A3DA 2B5RA 4N6V0 2G2UA 3PBTA 2DXIA 1MBLA 2WKEA 3MK6A 4BENA 1OCVA 3FTDA 4QHCA 2WGQA 4MLLA 1NHGC 3A3FA 5HARA 3GRVA 2Y2IA 1LI0A 3G2ZA 3B9PA 3HLCA 5FAQA 1S6RA 3MZEA 2DZOB 2STDA 3HWSA 2RGQA 3I7JA 1Z59A 1RGZA 3B3XA 4KZBA 3HHYA 1Y4KA 3N6IA 3GZBA 3HK4A 3WHLA 5IG3A 1NDOB 2INXA 3WS4A 1YUBA 2NQ8C 4WEKA 1DYUA 5U47A 3VP2A 3FF0A 3E9SA 3MFDA 2P5TA 3K9MC 1JRQA 3DZDA 1K4FA 1HVBA 2IUJA 1ES3A 1NSFA 1R4CA 3W4PA 1G41A 2Q2EB 3BNCA 3FG1A 5LC6A 4NL4H 1IU7A 4LRTA 5FATA 3UK6A 1NYMA 1YIT3 2WGWA 4HBRA 1SCWA 2FFFB 2G8LA 4DR4M 3N4IA 5ITTA 1N36M 1VQO3 4LZJA 3VK8A 1VQ53 3BECA 1MPLA 1E9RA 4FCZA 4R0QA 3CNMA 4HL4A 1RKYA 3CD63 2J8YA 4X69A 1OUNA 2IWCA 4DR7M 1YM1A 5JBSA 3A76A 4STDA 1XMQM 2ZC3B 4EV5A 1W2B2 4WBGA 1IDPA 4QY5A 1DO2A 4Y0UA 4LCMA 3UDIA 2PBYA 2Y2NA 1IYPA 3PFIA 4MGYE 3FKEA 3EF8A 1V74A 2XLJA 1N78A 2W04A 4GD6A 4B7FA 1K25A 4YFMA 1JKGB 4R1KA 3LMLA 3N9HA 4EUZA 4E3OA 4LF5M 3G6E3 4OOMA 3FUVA 4JN6A 4IBJA 1ROVA 2WOHA 1SXJA 2C9CA 4NHFA 3EIHA 4N6UA 1DGHB 1IBLM 4NK3A 5FTLA 3G16A 1QMEA 5TFQA 3UJMA 1NJFA 1TH3A 3IG5A 1ZQ9A 1WMNA 4KZ8A 2IUKA 4W5WA 3K5TA 3U97A 4EBLA 3CCU3 3HJ8A 4GC9A 1R7RA 4G4NA 1IM2A 3G0KA 3ZH9B 1XGJA 2CV0A 3FKVA 3ZGAB 1L0DA 1VM1A 3SVAA 4JI5M 2CFWA 2G5GX 1NVMA 2RGOA 3ALAA 3K7CA 1JVJA 3SYKA 1DJAA 1IBMM 3CMA3 1N8R4 4WMCA 4R9LA 2Y2HA 3D9RA 3L29A 3U1WA 1GLNA 3SS5A 3HIGA 1E3RA 2WOFA 2J7OA 5JI2E 3L0RA 2CWTA 4DE3A 2Y74A 1YI23 1Z6TA 2ZAMA 2KRUA 4LENA 3NHXA 3LH4A 1J7KA 1IYSA 1JWPA 1WYBA 3GTCA 3OTOM 1HT1E 2XR0A 3ZCBB 2E2UA 3AV0A 4HZ9B 3MZFA 3MZDA 1JTDA 4DR6M 5D81A 1Q40B 4U0XA 3RE8A 2Q9MA 4FD2A 4FH4A 4CGYB 5BR8M 1VQP3 3LVVA 1NY5A 4JXGA 2C9OA 4HM7B 4KQQA 4MM3B 4R3DA 3R9XB 2QP9X 4QNRA 2E2VA 3VK7A 3BLMA 3F7XA 3CC43 1DVCA 2L09A 1TDGA 4DR5M 4TUWA 5CGXA 3ZCZA 2Y2MA 4EXRA 2WO0A 1VQ73 1N8QA 3KDSE 2E5LM 3IXGA 3IWOA 4N6TA 3D4FA 1TDLA 1XXHA 4FMCA 4JF6A 3TG9A 4P6BA 4WZ5C 3FH1A 3MKFA 4U3TA 5I97A 2BJWA 5EXPA 3DZLA 3KZTA 3CXC2 1G68A 5CEBA 2DNSA 1E32A 5ITUA 5JPPA 2WAFA 2XZUA 1W2ZA 4QHTA 4GKJM 3BLSA 4AKZA 5EP1A 3UNLA 4P87A 3LMMA 2F5PA 3QNCA 3FZWA 4RF1A 5JYPA 5FTKA 1FGQA 3G30A 4L78A 4AKHA 4OK0A 1EE8A 3KW6A 1W02A 5AI1A 5CXWA 1QVG2 4UA7A 4RF0A 2P9VB 4X2HA 3NV0B 3AGFA 4XXRA 4IIAA 4Z6YA 3ZVWA 3BEBA 3RGPA 3JAMS 4PEJA 2XEPA 3EHCA 4JI0M 3EJVA 2DHRA 1RN7A 5HGRA 2MF7A 4ZTKA 2OQ4A 3ZFZA 1GY5A 1VDDA 3X40A 1YHQ3 4KG2A 4HESA 3TDGA 1DJCA 3LCEA 4DE2A 4JI4M 4DV7M 1YE9A 1YT4A 1XGIA 1ZO2A 2KCDA 1FCNA 1L5GB 1WNHA 3RGAA 2C99A 1YLZA 3IF6A 4GDBA 4JF4A 1ROAA 4OOYA 4HZBB 1HQYE 4B3RM 4BD0A 3F9SA 1E25A 3U60B 4KZ9A 2VQFM 5KQ8A 4MGHA 2YFQA 5ITXE 3U6PA 2LYXA 2I72A 2ZQDA 2HDSA 5TGNA 4OVZB 2M60A 3PNVA 1UI7A 3MJ5A 4NXNM 4K0KM 3G32A 3UY6A 4CHTB 2RFRA 5EP2A 1IVWA 2BMQB 5DTKA 5FQIA 2UWXA 3HIIA 3LT9A 2ZC4B 2ZL8A 1MKIA 5FI7A 3K92A 1O07A 2BO9B 4L8OA 1HZOA 3HUOA 1SIIA 5KSCA 4IEDA 2I7NA 1DVDA 3SATA 1XKZA 4LV1A 2W9PA 4KLNA 3J7BA 1K57A 4S2JA 5DREA 4BJPA 4GB5A 4DKIA 1FGTA 2E2TA 2ZQCA 5IHVA 3STDA 1JB4A 3UDFA 5DNYA 3J7Yd 3KN4A 2WKIA 5JI3E 4AI6A 2WGWB 1Z1SA 3GZYB 4LJ8A 3FD9A 3WMDA 4M3KA 1WXQA 2CV1A 1N33M 5KP3A 5EEOA 5CHMA 3GPXA 1Q3BA 4DE1A 1Z5BA 2CC1A 5EPHA 1GHMA 1BULA 1NY0A 1QYRA 4JI7M 2CG0A 4BLCA 3IHAA 3GPUA 5IENA 3UE1A 3PCSA 4LF7M 1OJLA 3EQQB 4KVHA 4JI6M 1US1A 4WYKB 1CQSA 4C6YA 5EP4A 4XB5A 1QANA 8CATA 4LV0A 4XBXA 4XBOA 1LLBA 2QMIA 3SLUA 3QRDA 2HP5A 1FJGM 1OHOA 4RZMA 1OGXA 2KZSA 1OGZA 3DWZA 4DRTA 1IQYA 1HNWM 3BB9A 4MGZE 5AQ9A 5AIIA 2KEBA 3FUWA 3JUOA 1I94M 2GBXB 3MG1A 2A49A 4K1UA 4J9AA 4FMDA 2D1WA 3T15A 5HX9A 4IBKA 3RGSA 3HHWA 1XNRM 4X64M 5ITQA 4BTYA 3DGOA 4ZJ3A 1IVUA 2G2WA 4D81A 3FCSB 3MYTA 3KOXE 3JR5A 5FDHA 1XA1A 4IBEA 4GHAA 3OV4A 1FGMA 4HM6B 1MWRA 4FWGA 3IMAB 4OQGA 4O8SA 1N5HA 4Q8IA 1IXSB 2UXCM 3GLHB 3CC23 2WYXA 3GQ3A 3RXWA 1GD3A 1IBKM 2GXFA 2JA2A 4OX9M 2KXGA 3LYGA 3O3VA 3ILKA 3PS8A 1PZPA 5AEWB 6STDA 1IVVA 3J7AS 2RL3A 3T8UA 5EVIC 4DXBA 3GVBA 4QU3A 4JRFA 3IH9A 2YFLB 2OTL3 3DA1A 2X4AA 1CEFA 5IG5A 4AEQA 4NETA 4M9XA 3HU2A 1NXYA 1AVLA 1BTLA 5IT9S 4N6NB 2Q07A 4IPBA 2Z6BA 1L0EA 3ZNYA 1ULJB 3KP0E 4XUXA 4NREA 3CCL3 4MGIE 1YLTA 3ISGA 2Z7AA 4RA7A 1E4DA 1QMAA 4I4LA 2JBFA 5J8XA 3IWQA 4GZBA 3B4PA 3UN7A 1K8A4 1MX0A 4LJ7A 1KSFX 3CCJ3 4LJAA 3NCKA 2ZC5B 3BFDA 3SC3A 3KS4A 2HKJA 3CF0A 3O86A 2CKFB 5AQBA 3ZG5A 3W0LB 2P05A 3LTAA 3M2JA 4DXCA 1K734 2RGHA 3I0YA 1GD4A 4IJFA 1U8CB 3C4PA 1A2KA 2Z2LB 3PXMA 1L0FA 3MWZA 5FAOA 1K3WA 1DMNA 1PU4A 1O7WB 3UE3A 1N34M 1HU9A 2ZM0A 3IXDA 1K55A 2AHMA 4N1HA 2FFYA 5KP1A 3QNBA 3NDGA 1M904 3Q1FA 3SAWA 3PZWA 4LFBM 4OH0A 1GYBA 2XQZA 3V98A 1BSGA 3EQVA 4OONA 4IBFA 1ZX2A 5GLCA 2R4EA 3J81S 4GOGA 3UB1A 3MXSA 4H3UA 2HHHM 3W4QA 4KO8A 4GHLA 3IWIA 4EBPA 4HM3B 2OWPA 2BNKA 2ZQ9A 4LZZA 3OPLA 3UPNA 2ZLYA 1OHPA 5BPVA 4JI1M 2IMJA 1DGBA 3OPHA 2A5YB 3LY4A 4M0DA 4G4OA 4OLDA 3FUXA 3N8BA 3A3EA 3OC2A 3TPZA 1WMOA 4EV2A 2X49A 4G4QA 5AQAA 3NWLA 3VP1A 3VFDA 2FOIC 4S12A 4B88A 3ZNTA 1AV4A 3DUKA 1DGGA 3AGDA 3B7CA 3BNBA 2EXAA 5KPTA 4LF9M 3SS4A 1ZAEA 4K0WA 3JR4A 3C7VA 4P85A 2KZUA 2MC8A 3LEZA 2BMOB 4LCBA 3AOGA 1JR3D 2I7PA 1TEMA 5FQ9A 5EXXA 3UJNA 3GP1A 2M5ZA 1I5QA 2Y2PA 3OPPA 3C7UA 1G4AE 4PM8A 5CLKA 3G4S3 2GU3A 4FCFA 3G713 1VQQA 5IG0A 1TU5A 3PYJA 5M1AA 2CHCA 3VOYA 4EWFA 4EC6A 2F4VM 1ESIA 5EUAA 4WZ4A 3ZG7B 2GDNA 2QZ4A 4DV4M 1H6UA 1UW1A 2A3UA 4KZAA 4AG5A 4KFDA 4IBGA 1NJ4A 4JBFA 5GLDA 5C18A 3KIIA 3Q07A 4XM4A 1NB3I 3X42A 2OCTA 3GPPA 2C5RA 1Q39A 3MSOA 1TUHA 3GQ5A 1K54A 4HKVB 4E6WA 1KSIA 1CI8A 2UU9M 3GLGA 1FGOA 3N8RA 3UDXA 1W5TA 5FTNA 3NBLA 3LT8A 2ZBKB 3OPRA 4P16A 4N92A 1QAKA 1W8YA 4S2MA 5G18A 2LH0A 3V50A 1VQ83 4G6ZA 4LV3A 1NWWA 4OQHA 1E94E 2Z4RA 5STDA 4R4KA 1N4OA 3M2KA 3FZCA 2BMRB 4QNMA 3CCM3 1LHYA 2HP9A 3GMWA 3C4OA 3FV7A 3UO9A 2W9QA 5CERA 2OTJ3 3DGLA 4AQYM 4FW9A 4BB9A 4N6MA 1MNLA 2R65A 4WZ5A 3IQAA 4X2OA 1O7NB 5AIGA 3HLEA 3M7GA 4PM9A 4S2KA 3JUPA 3CCQ3 4M9ZA 3QAUA 4OP5A 3Q7VA 3BFEA 3Q7VB 1CI9A 3DWKA 3KXEC 4FCWA 5IW9A 1YJ93 3KSXA 5KO3A 2Z76A 3H3HA 1K3XA 1K6RA 1M1K4 2OLUA 5KPRA 1EROA 4N6OB 5IERA 3GO8A 4B4ZA 2XSZD 3MG2A 1ORYB 4F94A 1VQK3 1HTZA 5BOHA 4KQRA 5FSRA 1XC8A 1ERMA 3SS3A 3BNDA 4M0WA 1D6ZA 1GHIA 2EA0A 2DCFA 4OPQA 2HMKB 1JR3A 1BLSA 2CG1A 3BYDA 1DGHA 2PNCA 5AIHA 4BTWA 2P09A 2RCXA 4MBFA 5HAPA 4MJDA 1UM8A 3H51A 3GAXA 3DY5A 3VP4A 1A90A 4REZA 2DRWA 4JI8M 5FW5A 2ZM2A 3HVFA 1WE4A 1DJBA 3KS8A 4R3JA 3SFZA 1K56D 5FI2A 2P0XA 1NHWC 3FUUA 1FUWA 1JN5B 3FTEA 1RGYA 2CHVA 1MOLA 1N5PA 1G59A 2LWXA 2QENA 1WMPA 1YSYA 2R9XA 2O9UX 4HEFA 3UNWA 2H1RA 2W56A 4WP5A 1A2VA 2CUZA 4S2PA 5EVIA 3U5ZB 2CFKA 2W03A 2ZM8A 2YFIB 3GR2A 4X56A 4QJGA 4K61A 2OV5A 1PI5A 5DRVA 3A3JA 3VMAA 1LI9A 3G31A 1HT2E 1K9M4 4PM6A 1XHBA 1XNQM 1L1TA 1KC84 3VP0A 4R1GA 1JNQA 1MWSA 4A3VB 1TDHA 4PDIA 2QIYA 2OOVA 1BUEA 2ZQ8A 4A5RA 5ITRA 5ITYA 4EBNA 3GSGA 2ZD8A 1OMEA 2LXEA 3SOAA 4K0XA 5EE8A 2BLSA 3GRDA 3WOEB 2Y2OA 1Z6FA 4E3KA 3OCNA 5FTJA 4MMZB 3VSLA 4QY6A 1IXZA 2ZJ9A 4MBHA 5FQMA 2GEYA 2QGUA 3GRUA 3NM7A 5C1BA 1JB2A 1TFKA 4JXSA 4S2LA 1NY6A 3K1JA 4Y7PA 4XUZA 3CNXA 2QBYA 3HHXA 3VFHA 3FYZA 4O02B 1D2NA 1QAOA 4OVMA 4C75A 1JQJC 2ML6A 3SHGB 2K0MA 1R2YA 5GLAA 2C96A 4B7HA 3DGNA 1LNHA 3O8YA 4MEIA 1IN8A 5CF1A 1RCJA 3KE7A 1W5SA 1NZOA 2ZANA 4MBKA 2DVWB 3TL4X 2V1ZA 3EN1B 4JYAM 3D8BA 4WW0A 1E3UD 3K0ZA 1Q42A 3TWKA 4LF4M 2W82A 3NQYA 3LQQA 2P38A 5M19A 4OLGA 3SARA 4DUYM 4CPKA 5EOOA 4S2NA 2XH9A 5CXOA 3L27A 4LFAM 1BLCA 3LTCA 2HMLB 4Q53A 4PDGA 5EVHA 5H37D 4M9SA 2CWVA 3HX8A 3HZPA 4XBTA 2F5NA 4OU7A 1YMSA 3U6OA 1NNJA 3NX0A 4LJ4A 4JXVA 2PU4A 3OX9A 1IN6A 1OPYA 3PBNA 3HLBA 3WS1A 2F5SA 1FNNA 5F3WA 4B7GA 1L2CA 5ITXA 4PPRA 4NSRA 5DTTA 2QA43 4X68A 4X62M 3GLGB 3Q81A 1M9GA 5IF6A 2UX0A 5TR7A 2XSZA 3B4OA 3HLFA 4EBGA 1DMQA 1GY6A 4LF8M 4HM0B 5CK6A 3KKGA 4FMBA 2KA6B 3EX9A 5G2GA 5FASA 5IWAM 1XX2A 4FR9A 4OOLA 5A90A 3HI7A 2XRXB 2ZQ7A 2EX6A 1D6YA 1RRHA 3CPW2 1LL5A 5AYSC 3ZG0A 1K4EA 1C1KA 4YY3M 3KSPA 3HJQA 3KOZE 4JKTA 3MHVC 3BLZA 1G6AA 4OKPA 4IJEA 4D82A 3HU1A 2HCBA 1QAMA 1LV7A 1N9JA 1IY1A 2GU1A 4U13A 1IN7A 4FVMA 2YFJB 4MMXB 1O7PB 4OVDA 4FSFA 2Y2KA 3AOEC 3CPOA 4KHPM 5EP3A 1AXBA 5E2EA 1XWIA 3HHZA 4FWHA 2J9PA 5DF7A 1SXJC 3LO7A 3SH9A 1KWIA 2BJVA 3JUNA 3OWYA 1YMXA 1ULIB 2H0YA 3ZG9B 3PXGA 3KVWA 4KG5A 3OW22 2J7VA 4YINA 5IREB 4XDVA 3U6DA 3IHBA 1MXOA 4GNUA 4DDSA 3AOEA 1Q3CA 3S5CA 4B08A 2CHQA 3CC73 3T38A 4HVNA 3EBTA 1PM5A 1PFPA 3U6CA 2VGJA 2Y2GA 2KW0A 4X65M 3A42A 1Q2QA 1YLWA 1IYQA 3FYCA 3JUMA 4OPRA 4GDNA 1PI4A 3KFUG 3FGYA 3CCS3 4DV1M 1PYYA 4D2OA 3FUTA 1U5OA 3VGNA 3IT9A 2CFDA 4QOSA 2A15A 3A46A 3X3YA 1KDWA 4KZ7A 4AW4A 1SPUA 3LTDA 1O7MB 2XR8B 5EXTA 4KZ6A 2HP6A 3DTMA 3Q7ZA 2L4VA 2YR0A 2V1LA 1W8QA 5KPZA 1W79A 3CU3A 2RSXA 1KDSA 5D82A 4FCMA 3NIAA 1KGGA 5HW3A 3M8CA 3G2YA 3U61B 4XGIA 1W7FA 4IVKA 1NRFA 4C3QA 3KOYE 1JN5A 1EWZA 3KSJA 4YHHM 4DV6M 2Y59A 1RRLA 2H0TA 4IBRA 3HREA 3CME3 2KXEA 2IA7A 1VQ93 4BL3A 1JKGA 1I2SA 2EO2A 3F8XA 3G35A 4QOZC 2CIUA 5FA7A 4GKKM 4NSOB 5EQTA 2QPNA 3PTEA 4I5SA 4G4RA 1O7GB 2HMMB 2Y73A 5FTMA 5CTNA 3D3LA 4K90B 1BLPA 4DR3M 4BL2A 1ISKA 2K47A 3X3ZA 5IG4A 4UHUA 3DM8A 1C7HA 5CGSA 2OPFA 3UZUA 1U60A 3KOWE 3FG3A 3E2LA 4EV4A 4Y0OA 3Q1CA 3VSKA 4OP8A 1QQWA 4GMQA 1K38A 3FSDA 1SJWA 3S22A 4GITA 3F40A 2PU2A 3RXXA 1IYOA 3EIEA 4DUZM 4HBUA 1S3SA 4ZJ2A 4KG6A 4E3MA 3U6EA 2O3OA 3GRJA 3JVCA 5KSHA 3NC8A 4RVAA 1VQL3 4UA6A 3UE0A 5AQ7A 5EOEA 3DFZA 2XLNA 5IZ7D 4WURA 1W6GA 3GV9A 5E2GA 2FNAA 3GLIB 2WZZA 4JF8A 2X71A 5GLBA 1Q40A 1KVLA 3U6MA 1VQ63 3M6AA 4X66M 4EYCA 3GLFB 3ITAA 4DV3M 4KZ5A 3WRZA 5KZHA 4HLQA 3S67A 3WA3A 3HUMA 2FFJA 2KRKA 2BNGA 4PM5A 3VLFB 5KP4A 2HDRA 4Z8XA 4QHSA 4LGYA 2YX9A 3IPTA 1OF5B 1IXRC 1ZG6A 4FD8A 3C58A 1GA9A 4DR1M 2Z77A 3RJUA 3IXHA 5LC7A 1OACA 3M0EA 4N6LA 3X3XA 2YQZA 1BT5A 1N75A 4CJNA 2CFLA 4DV0M 1FSWA 3I51A 1OFIA 2CW9A 3PAGA 2UUCM 2XZFA 3OXAA 2Y21A 3WA2X 3CCE3 1SDNA 2JCHA 2R46A 4FH2A 4LCLA 1HQCA 2B1XB 3SMSA 1KVMA 2V1UA 3X41A 5HAIA 1ESUA 3FG4A 3JUQA 1IELA 4NRVA 2V6ZM 3IG8A 1J2BA 3SOYA 2Z3XA 3Q2PA 3A3IA 1W01A 3GZXB 5E43A 5EECA 4ZDXA 3N8LA 2Z4SA 4PT5A 4FCTA 4WMCD 1IQ8A 4KZ3A 4LGMA 1IQPA 1TFOA 1MWTA 4LJ9A 1BUQA 2QPAA 4R9KA 3T0UA 4RBNA 5HFOA 4ZAMA 1EA2A 1N77A 4R7GA 3U61A 4LV2A 1UI8A 3S27A 3DOAA 3E4RA 4G1MB 5D83A 1S0WA 2KRTA 1S5AA 5CHJA 3K2LA 5EXSA 3LY3A 4DE0A 1CEWI 1NJGA 3GRYA 2C10A 3E2KA 4BBAA 1KE0A 3NBRA 3CTWB 5KQDA 3PGBA 2DWMA 5F1FA 3BFCA 5A0OB 3GRRA 4CISA 2SBLA 5IEPA 1K55C 1XPBA 4RX3A 2FE8A 3UL5A 1JTGA 3S29A 5TGFA 2R9WA 1RP5A 4LMIA 1QJGA 4CCVA 4GN2A 1T3TA 2UXBM 4GD8A 3J80S 1TGUA 1JWZA 1Q824 1UUVB 5E2HA 4QWTA 4AKIA 3UMMA 4FMAA 3N8SA 4OUQA 3U5ZA 3CF2A 3HGIA 1IVXA 3BRMA 1KFVA 1W7CA 3TQSA 4I8OA 1XA7A 2CHGA 3B8LA 3GWRA 1YLPA 1JV2B 2LQVA 4OW0A 1MY8A 3AMOB 1FA3A 2D42A 1G8PA 5A91A 3AFHA 4E3JA 1Q864 3NM2A 3G4PA 1Z5AA 2XSOB 1K54C 3VFFA 1YJW3 2HMNB 3NBIA 3OWSA 3TOIA 4IIWA 1CK3A 4L0LA 1M1XB 1OF5A 5I94A 2EUCA 5FQQA 3K8ZA 3G8ZA 2WGVA 4BD1A 4L8RC 4KZ1A 1TIJA 1EQKA 3RDEA 1Q7Y4 4HM5B 1VQN3 3TE6A 3EB8A 1R6BX 4DV2M 1QVRA 2CH9A 2X8AA 4LG2A 1PWDA 4GIPA 3L25A 4OVZA 4E6XA 2ZM6M 3GLIA 3MHEA 1GA0A 5FQKA 2IWBA 1K56A 3C5AA 3SAUA 3EQUA 1OFHA 2CV2A 2CFOA