2XF3A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
423
Chain Sequence
b'VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSGEDVAARFIPTFAAAGNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 141
structure length 423
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xf3A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xf3A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xf3A02
1H8ZA 2EX8A 2PBYA 4FSFA 5EOEA 3QNCA 5F1FA 2Y2PA 1EI5A 3MBZA 4FH2A 5HX9A 2Y55A 1M6KA 1MPLA 1LHYA 3HLDA 3BECA 1PW1A 4S2IA 4FCFA 4JF4A 3M6HA 4QY6A 2XLNA 2WGWA 4HESA 2EFUA 3G2ZA 3RJUA 3VSKA 5CHJA 5E2FA 1KGFA 1ES5A 4QB8A 1RP5A 1LI0A 2DCFA 5EVIC 3PAGA 3Q1FA 2WKIA 3SH7A 4MEZA 1L0EA 3WS5A 4X69A 4U0XA 4Y0OA 4OOYA 4OQ0A 5FASA 3NIAA 2XGNA 1KE0A 5EVLA 4HEFA 3MFDA 4WZ5A 2QMIA 3ZHHA 4E6WA 5E2HA 3WWXA 3S22A 1JWZA 5DF9A 1CEGA 1FSYA 5CEBA 1FQGA 2ZQ9A 1SDEA 5CERA 3UN7A 3M2JA 4CJNA 4WEJA 5FQIA 3EQVA 3HBRA 3OPLA 4R0QA 1BUEA 3GQZA 2ZMAA 4UA6A 2H5SA 1SHVA 1IYSA 4IBRA 4GD8A 4OQHA 3MKEA 4JKTA 4LENA 4QJGA 1KDSA 1PI4A 2RL3A 1HTZA 4K0WA 4PMAA 5FSRA 1TVFA 1LL5A 1VM1A 4OQIA 1KDWA 3GSGA 5FAPA 3Q7VA 4E3NA 1PZPA 3HLBA 4KQOA 4R4RA 1AXBA 1ONGA 2V2FF 4KQQA 4OP5A 2V20A 1L0GA 2B5RA 4UA7A 3HUNA 5CTNA 1ZKJA 3N8RA 4BL3A 2HDRA 3OCNA 3UO9A 2VGJA 4UHUA 1K56A 2HP5A 5FQKA 3V3SA 1XKZA 5M19A 2XH9A 4LCLA 4OKPA 3UE0A 5TGFA 3FZCA 1K4EA 4Z9QA 3VP1A 4DDYA 4JLFA 5CHUA 1JWVA 3CG5A 1ES4A 1W5DA 4WEKA 2FFFB 4IVIA 1KE3A 4OLGA 4R23A 4MBKA 3SS5A 4DE3A 3G34A 2JCHA 3IXBA 3NC8A 4OOLA 3WS1A 3BFDA 5CTMA 4KG2A 4KG5A 3VFHA 3HLWA 2WK0A 2V1ZA 2OSUA 4K0XA 5E43A 5KSHA 3C7VA 1YMXA 3DTMA 1EWZA 4N1XA 3I7JA 4PM7A 4WELA 4X55A 3W4QA 3LEZA 1JWPA 4HBUA 3MKFA 1BLSA 3ZGAB 1WYCA 4JBFA 4KZ5A 4S2KA 5TR7A 1QMFA 1XXMA 3V39A 2WZZA 1GHPA 2WGVA 5JYPA 5F83A 4N1HA 4EBLA 3MZFA 4RYEA 3BFCA 2ZD8A 2ZM0A 3WRZA 5HFOA 2WKEA 3ZDJA 3LO7A 5HARA 3O3VA 5FI6A 1YLJA 1DY6A 3NDGA 1LI9A 4E3KA 5G18A 4Y0TA 3AGEA 1GHIA 5DTTA 1KGGA 1K54A 3HLEA 4S2JA 1SKFA 2EXBA 1K4FA 4OPRA 4C75A 3LY3A 3NBLA 2X71A 5GLCA 4OONA 3W8KA 4GB7A 2J9OA 3WS2A 3FKWA 4ZAMA 5A93A 2QPNA 5EPHA 1ERQA 2ZQ7A 4O7DA 2Q9NA 4JPMA 2ZJ9A 4GDNA 1Q2PA 1HD8A 4DE2A 3PTEA 4C6YA 3ZVWA 1XA7A 3Q7VB 1HZOA 3HL9A 4DF6A 5M18A 1IEMA 2UWXA 2FFYA 1WYBA 5F82A 4QU3A 3SH8A 2JBFA 4OH0A 1Y54A 2EXAA 1O7EA 4KZ7A 5HAIA 4ZJ1A 3A3IA 1GA0A 2HP9A 1YLZA 3OPPA 3ZCZA 4BD0A 1M40A 3P09A 3DW0A 3S4XA 1KVLA 3E2LA 3C7UA 2IWCA 3IXHA 5DVAA 1K57C 4JF5A 5FI2A 4R3JA 1HVBA 4BENA 1TDGA 1I5QA 4OP8A 2H0YA 1GA9A 3W4PA 2XFTA 5A90A 5FQ9A 4PM6A 3ITBA 1L0FA 1ALQA 5AQBA 2EFXA 3NCKA 3G35A 2Y2OA 4S2MA 5GLDA 4LCMA 4ZDXA 2ZC3B 4XUXA 2Z2LB 2ZQCA 1XX2A 5GHXA 4BD1A 3N6IA 4RX3A 2J9PA 3WS0A 3UPOA 4X53A 3CMZA 3Q7ZA 1PI5A 5E2GA 4OOMA 1E25A 4KZBA 1OMEA 2JE5A 3DWZA 4KG6A 3LCEA 1XA1A 2WGIA 4DE1A 3IQAA 2ZC7A 1PW8A 3TSGA 3GV9A 1E3UD 3IF6A 4WZ5C 1NZOA 3PBTA 3ZVTA 1PWCA 3HUOA 1YLYA 4LV3A 2ZC4B 3N7WA 4R3BA 5AQ7A 1K55A 3RXXA 3VP3A 3Q07A 1ERMA 4JXVA 4IEDA 5FATA 1PWGA 4EV4A 1C3BA 3GVBA 1I2WA 5BOHA 3ZG7B 3G31A 3OPRA 5U47A 3DWKA 4HBTA 1ESUA 3IH9A 2P9VA 1MWTA 1NY0A 3ITAA 1MWUA 1I2SA 3PBNA 1NZUA 1W79A 3BEBA 3HVFA 1BZAA 4JXSA 4M3KA 3PBSA 4S2LA 4R4SA 2DRWA 4Y0UA 4F94A 1NRFA 4KZ8A 1GHMA 4OVDA 2HDQA 2EX6A 5EVID 5FA7A 4LV1A 4S2NA 1DJBA 1ZG6A 3ZNYA 1K6SA 1KGEA 4QHCA 5TFQA 4PM9A 3SH9A 5GHYA 1LLBA 1YM1A 1G6AA 1RGYA 2HP6A 5FQQA 1MWSA 3BLMA 2Y91A 5CGSA 4ZBEA 5FQMA 2QZ6A 1BLHA 1RCJA 1K38A 3ZNTA 1W8QA 2ZM8A 4MNRA 1U60A 2Y2HA 3NY4A 3PAEA 5A91A 3V5MA 4EBNA 3QNBA 2X01A 2WAFA 3C4OA 4R1GA 5M1AA 2ZQ8A 3SS3A 4E3LA 1NYMA 1MY8A 4FD8A 1MBLA 2J8YA 4NK3A 5DTSA 3C4PA 3UDXA 4BLMA 2WZXA 3OZHA 4UA9A 3IWIA 3SS4A 4A5RA 1RGZA 4N9KA 4S2OA 2Y2QA 2Y2IA 5E2EA 3VP4A 4KZ4A 3G32A 2A3UA 1BT5A 1IKGA 2Y2LA 3P98A 1ONHA 3IWQA 2VGKA 3Q81A 2A49A 3BRMA 3IF6B 3QHYA 4XUZA 1YT4A 5HAPA 4CPKA 2BLSA 4LV2A 1IYOA 4EBPA 1K6RA 3ZG5A 1LL9A 3S1YA 2WYXA 3BLSA 1YLPA 2WADA 4H8RA 1K54C 2J7VA 3NDEA 1GCEA 2ZM2A 3HLCA 1MKIA 3JYIA 3VFFA 1MWRA 1H5XA 1TEMA 2DNSA 4KQRA 2P9VB 1E3UA 1S6RA 1ESIA 3B3XA 3VP0A 1XGIA 3ZFZA 4P87A 2G2UA 4OLDA 4OQGA 2XF3A 4JXGA 3HLFA 1K25A 4P0MA 2Z2MB 4WZ4A 3A3FA 2EX9A 4E6XA 3UE3A 4KZ3A 5HAQA 1H8YA 4ID4A 1W8YA 2Y2GA 3TOIA 3UDFA 3ZG9B 1VQQA 3HREA 5IHVA 1FCNA 1FR6A 4RX2A 3OPHA 5CECA 3C5AA 3FYZA 1DJCA 3IXGA 4QD4A 3G30A 4UAAA 4WYYA 3UDIA 4RVAA 1IYPA 3O88A 2XD5A 4XXRA 4KENB 5FQJA 4PM8A 3BYDA 2HDSA 4GNUA 3V50A 2XR0A 3MXSA 3ZG8B 5KZHA 5KMWA 3VOZA 5GHZA 1ES2A 1L0DA 1L2SA 4WMCA 1JVJA 2ZC6B 5EVIA 5I94A 4NETA 3ISGA 3VP2A 2Y2NA 5FAOA 4WBGA 5FDHA 1FR1A 3SOIA 3TG9A 4E3IA 5EECA 5FAQA 3ZG0A 1ES3A 3BFGA 1TDLA 3IXDA 3E2KA 2XD1A 2OV5A 4P85A 2PU2A 3PBRA 1J9MA 4E3JA 4GD6A 5GLAA 5HL1A 1XGJA 3BFFA 4BJPA 5EUAA 3A3EA 5CHMA 1NYYA 3V3RA 1BLPA 4E3OA 2IWBA 4DKIA 3FKVA 2H0TA 4C3QA 5EOOA 1DJAA 4ZTKA 4JXWA 4KZ6A 4X68A 3HLGA 1KVMA 1BLCA 5DTKA 2G2WA 2X02A 3IF6C 2ZQDA 3IHBA 3IT9A 4GDBA 4P6BA 4IVKA 5JYOA 1Z6FA 5DF8A 2CC1A 2XK1A 5A92A 4WM9A 1SCWA 2H10A 1YQSA 4KZ9A 3VSLA 4Q8IA 2XEPA 4D2OA 4RA7A 3FV7A 1K55C 1Q2QA 2RCXA 4MBFA 3WS4A 4BL2A 3UE1A 3G2YA 5CGWA 2JC7A 2E8IA 2ZLYA 1JTDA 1YLTA 2ZQAA 1CI9A 5CEDA 2OLVA 4WMCD 1CK3A 4YINA 2Y2KA 1FOFA 3MZDA 5AQAA 4E3MA 2XFSA 1YLWA 4ZJ3A 1N9BA 3OC2A 4GZBA 1BTLA 4OPQA 4B4XA 1EROA 2BG1A 4S2PA 5F1GA 4PM5A 4N92A 4OPZA 5GL9A 2R9XA 3NI9A 4EUZA 1FCOA 1N4OA 3G4PA 1QMEA 4MLLA 3UPPA 4S2NC 5AQ9A 3W4OA 3D4FA 1W7FA 5GLBA 3VMAA 3PBOA 4LV0A 2WUQA 1PIOA 4U0TA 3RXWA 1E4DA 3A3DA 4KZAA 4X6TA 4Y7PA 4DE0A 1WE4A 1NXYA 1O07A 4YFMA 3VOYA 3EQUA 5EVIB 4QY5A 5HW3A 3GTCA 2P74A 1KE4A 1PWDA 3FWLA 3GMWA 3M2KA 3GRJA 5CXWA 2R9WA 3IF5A 1XPBA 4EWFA 2WGWB 4U3TA 4B88A 1FCMA 1BULA 1IKIA 1S0WA 3UY6A 2XQZA 2IWDA 1CEFA 5FI7A 3PBQA 1MXOA 1IELA 1BSGA 3A3JA 5KSCA 5EE8A 4N9LA 4DXCA 4GKUA 3CZDA 3O86A 4EQIA 3M6BA 2HPBA 3N8SA 3LY4A 2Y2JA 3BM6A 4MBHA 3GR2A 4DDSA 5D3OA 1PYYA 4OPYA 4BQMA 2ZC5B 2GDNA 3IH8A 3N4IA 1K56D 5L2FA 2HDUA 4DRTA 3CJMA 3WRTA 5CRFA 1SDNA 1G68A 1ZC2A 4B4ZA 1CI8A 1YMSA 2C5WB 2OLUA 4FH4A 3UPNA 4ZJ2A 1ZG4A 3O87A 2EX2A 4K91A 5DF7A 2Y2MA 4GOGA 1NJ4A 3MZEA 2C6WB 5J8XA 1XP4A 2XDMA 2WKHA 2Y59A 3AGDA 1JTGA 3OCLA 5CGXA 3N8LA 1PZOA 3BFEA 1FSWA 3IHAA 4IBXA 4DXBA 3Q82A 4L0LA 4JF6A 4PPRA 3IWOA 1K57A 2Y4AA 3UNWA 3HUMA 2PU4A 3AGFA 2WAEA 4GN2A 3MXRA 2Q9MA 4X56A 2I72A 1IYQA
chains in the Genus database with same CATH superfamily
4FSFA 5EOEA 5G2GA 1G6OA 2Y2PA 3MBZA 4EXRA 4I5SA 3FUUA 1IT7A 3BECA 1OCVA 2MGWA 4AFIA 2HMNB 1YE9A 1Q7HA 4FCFA 3U97A 3FPWA 2PZVA 4IJFA 2VV7A 4IJGA 3VSKA 1RGGA 2V9AA 5E2FA 4BMWA 3T1HM 3Q1FA 4R70A 3UZUA 4KFFA 3T15A 3E4OA 4X69A 1WR1B 1SXJB 2O0YA 1Q02A 4R9KA 5AYRB 4NHFA 5EVLA 1GLNA 3B33A 3D5GA 1UFZA 3MFDA 3T4SA 3D5IA 1Z5CA 4KHPM 5EM1A 2QMIA 3V76A 4E6WA 3KSJA 4UQIM 2EUCA 5HZHA 4LYLB 1YJ93 2OQEC 2IYJA 3BXWA 2WKRA 2JP7A 1T6OA 5FQIA 4EQ1A 3CU3A 3OPLA 4NOOB 2CHQA 1BUEA 2ZMAA 1W00A 4R6LA 4HQAA 4PT5A 4GD8A 1NWWA 2MROB 1SXJE 1P3QQ 1D0LA 1PI4A 2RL3A 4QJGA 4HAAA 4K0WA 1TVFA 1LL5A 1Y4OA 2C98A 3FF2A 4Y13A 3T8UA 3DZLA 1GY7A 1MX0A 3AGOA 4OP5A 1E3VA 2V20A 3FYCA 3CC23 1NV8A 1L0GA 1NHWC 4NXMM 4K90B 5IENA 3LUQA 3CPOA 4HJ4A 2VGJA 1RMSA 2QJ5A 2JQ5A 4WYKA 5M19A 5C1BA 2OWJA 1PJSA 3MK6A 3FZCA 4GCZA 2DWZB 5TGFA 3G4S3 1JWVA 4G3KA 1KD14 1W5DA 2VV8A 4WEKA 4OLGA 1DO0A 1X1WA 4O8SA 4NREA 1W5ZA 1XXHB 3DTKA 3IXBA 3KOZE 2J5YA 5FTKA 2F98A 5A0OB 2ZAMA 9RNTA 4TX4A 4Y2FA 4R80A 3UL6A 3PFIA 1NDOB 3DTMA 4DR2M 1BSAA 1EWZA 4N1XA 3OXAA 1HQYE 1P97A 3PCRA 5STDA 4HIAA 1JWPA 4GMQA 1UI8A 1BLSA 4GKJM 3I01M 1U5OA 2L6OA 1WMOA 4HM4B 4HOHA 4JBFA 5G4YA 5TR7A 1X37A 3U6DA 5F83A 2DI0A 2JHEA 3MZFA 2ZD8A 1Q39A 5HFOA 3ZDJA 2J8XB 2Z7AA 4E3KA 3MQOA 4HJ3A 4KFEA 1KGGA 3D72A 2VGLS 3A46A 4GKKM 4HEOA 3U6CA 3GSPA 1TU5A 1K4FA 3T1SA 5GLCA 1IQPA 3W8KA 3WS2A 2J9OA 1PFPA 4W5WA 1NRJA 3H7WA 5BR8M 1YVSA 1DE3A 1XMQM 4ESPA 3KXEC 1LOWA 2Q9NA 3LR3A 2UX0A 3VKGA 4JPMA 1US1A 4ARZB 1E94E 2LXEA 1WQLB 3MPHA 3PTEA 1MN3A 4FCZA 1ZHHB 2JNHA 3UB5P 3H3HA 4KFDA 1UUWB 3B47A 2F86B 3VK7A 2PR5A 3VK8A 2UWXA 4GLQA 1R2ZA 4D60A 4F2LA 3GPPA 3FRHA 5F82A 5G1KA 3SH8A 2WKQA 3PS8A 4KZ7A 2M1CA 3VF1A 3A3IA 2XSZD 4MN6A 3ZCZA 1RHLA 3HIIA 3P09A 3DW0A 1KVLA 5LMUM 3Q8XA 4AEQA 1A0KA 4NXNM 1K28A 3BNEA 3C7UA 4GS9B 3IMAB 2KF3A 2JXNA 4R3JA 2H28A 4BENA 1FZUA 1TDGA 1W5TA 1FUSA 2H0YA 4FWGA 1MU5A 3NOUC 4OP8A 3W4PA 4CLCD 1MGWA 1VQ93 4PM6A 2JY6B 2HMKB 4EUVA 1L0FA 1I94M 1ALQA 2EFXA 1AIPC 5EP4A 1L1ZA 2M5ZA 2V1CA 4F3LB 1X1UA 4XUXA 2L0WA 2Z2LB 3T1RA 4G3WA 1P0ZA 4UQIS 1JKGB 1NB3I 3EBTA 3WS0A 3GP1A 3C58A 4I3AA 2R6FA 3DZDA 2F5PA 3CMZA 4X53A 4FCTA 3IS2B 3E0YA 5E2GA 4B3RM 2CWVA 1DV0A 3GLHB 3VDUA 2R65A 4O02B 4KG6A 1IM2A 2LHCA 2QZ4A 1GL7A 1XNQM 4FMDA 1LNIA 2K3DA 3QRDA 5HWWA 2OQ4A 1LRAA 1NJGA 1NJFA 4UN2B 3K5TA 3ZVTA 3NM2A 4AI6A 2W3EA 1S1ZA 4LV3A 5L09A 3CAXA 3K2LA 1DMQA 1D0KA 1V58A 5CK6A 3MFXA 4HHDA 4R3BA 5AQ7A 1SPUA 4B9OA 3FG4A 2UXBM 3PR6A 4JXVA 1UGUA 3RE8A 4R7GA 1I2WA 5BOHA 4H6JB 4R4KA 4L6V6 3DWKA 4HBTA 4KUOA 3EB8A 1ESUA 2P9VA 1NY0A 3NJAA 3GLHE 2LVAA 1MWUA 3PBNA 1QAQA 1UUGB 3BEBA 3CF0A 1JN5A 4JXSA 3BBZA 4R4SA 3D8LA 4Y28F 1NRFA 1N33M 1VEKA 1G0TA 1BSBA 2SBLA 2L1MA 4DUYM 4S2NA 1VZZA 4HM5B 4L8OA 1ZG6A 3TE8A 1KGEA 4QHCA 1F2KA 2DAEA 2JA2A 2YX9A 1G6AA 3GLFB 5FTLA 2HP6A 1DO2A 3PXPA 4GRIA 3SX1A 4ZBEA 3F8XA 2BNKA 4B7FA 2BMRB 3ZNTA 3U60A 1Q864 4MNRA 1QDTA 1MNLA 3NY4A 3I04M 3AMOB 3V5MA 5DYIA 2X01A 2WAFA 4R1GA 1S1YA 3SS3A 1NJI4 1NYMA 3QYBA 1MY8A 2CWBA 2WO0A 3CXC2 2WSFF 1T5YA 1JBRA 1RN1A 2P7JA 5DREA 3C4PA 3NQYA 4N6UA 3K7CA 5DRVA 3SS4A 3JVVA 1I2FA 3GLFE 2J3TC 3LI8A 4FCVA 3E4RA 2Y2IA 3FG1A 1A2KA 5KPZA 2K7SA 4OUQA 2LB9A 1R4CA 4LFBM 2W6JH 2DWLA 4LJ4A 3DGYA 1SKOB 1O7NB 1V9ZA 5KO3A 2A49A 3IF6B 4NEED 1KOUA 3CCL3 1YT4A 5HAPA 1G8PA 1JBTA 4LV2A 1IYOA 3UMMA 3ZG5A 2Q07A 1HKXA 1IY1A 3U6OA 2D1WA 3OWYA 1L8QA 4H8RA 3DXOA 1BNFA 3JYIA 1QVRA 3VFFA 3GQ5A 5BVBA 1TEMA 3IG8A 2DNSA 4P6ZS 3CCM3 3S27A 4LPZA 3DGLA 1STFI 3VP0A 2Z7JA 2XLJA 1JB5A 2L4EA 1IN4A 4OQGA 1ZMVA 2CX1A 3JPUA 2XF3A 3UB1A 2RGOA 1GSXA 4M9ZA 3LR4A 3GLIB 4P0MA 4DJ3A 3HU2A 1FGOA 4FOFA 1TS7A 3RFWA 3HJSA 2VQFM 4E6XA 4KZ3A 5HAQA 4FCWA 1W7CA 1Q7Y4 2QENA 1W8YA 2NUTC 3TOIA 3LQQA 3ZG9B 1VQQA 3TDGA 3GO8A 3HREA 4RNZA 1BUQA 5IHVA 1TRQA 1VQM3 3LIEA 3HWSA 3J81S 3LZAA 3FYZA 2KF5A 1DJCA 2MJ5B 3AMOA 1HNWM 4UAAA 4WYYA 5HDDA 2EWWA 4STDA 2R41A 2ZMFA 1GKIA 1TJDA 1OTAA 4PM8A 3QWLA 3MMPA 3MXSA 3ZG8B 5KMWA 3LT9A 5EM0A 1ES2A 3QP4A 5FTMA 1L2SA 1JVJA 1NY6A 1Q40A 2HMLB 3EIEA 2Y2NA 3ISGA 5FAQA 1TDLA 3BY8A 2KRUA 3UB6A 1XJ4A 2QHKA 3KSIA 3PBRA 5GLAA 1GMPA 4N6V0 3UE6A 3VE4A 2L7IA 4BJPA 1OT6A 1NYYA 3MSOA 2IWBA 3GRYA 3HHXA 3G0KA 4DKIA 4C3QA 5EOOA 1GJTA 1RU3A 2HMJB 3V67A 1RN4A 1DJAA 2O9UX 4LCBA 3Q2PA 3I4YA 1DGHA 2ZMVA 2E2UA 1CF0A 1VETA 4ORLA 2F5SA 5FTJA 5DTKA 2PRFA 1TS0A 2ZQDA 3IHBA 3J2PB 1KFVA 4XK8F 4IVKA 5JYOA 2CC1A 1CJFA 4FTXA 1SCWA 4DR4M 3DGOA 2YKFA 2C9OA 1A5TA 5J3WA 4D2OA 1UI7A 3B4OA 1Q2QA 3GLIA 2HJ9C 1OJLA 5EVEA 3G2YA 4JGOA 2X49A 5CGWA 4JI5M 2UUBM 2OLVA 2V1LA 4WMCD 4HZ9B 5AQAA 1QQWA 3NOTC 4ZJ3A 5ELUA 1BTLA 4JI1M 4M9SA 3JR4A 1EROA 2RKOA 5F1GA 4Z8XA 2F5QA 2HMOB 4OPZA 4B93A 3NI9A 2HMMB 3UK6A 3PXMA 5JPUA 1N4OA 1YGEA 2KCDA 2K0BX 3RGSA 1W2B2 1QMEA 3L26A 1R4YA 4S2NC 4R3DA 2GU3A 1RCLA 4MGZE 1W7FA 4XBYA 4OVZA 4LV0A 4AKZA 2HHHM 1B2MA 3A3DA 1B2SA 3L27A 1E9RA 2G8LA 4JI7M 3EQUA 2Z6BA 3Q8GA 5DNYA 1FIKA 3EEAA 2W27A 2W82A 3SYLA 1GSVA 2K54A 2XRXB 1ZQ9A 2R9WA 1QALA 2DAGA 4K1UA 4B88A 4MMXB 1FCMA 3OTOM 1YKDA 1WIVA 1T18A 1ROVA 3TPZA 3LGOA 1STZA 1IELA 1BOXA 1BSGA 4DUZM 3A3JA 1N8QA 2DAIA 1W4NA 5KSCA 4G4QA 4CDLA 4GKUA 4I4KA 1GVNA 1BRSA 3LMLA 4IBEA 2KXEA 2VQEM 1E3RA 1PYYA 4LF7M 3EN8A 2RNTA 4BQMA 1F8NA 3IH8A 5L2FA 3T38A 3WRTA 1SDNA 2UU9M 2K6BA 1CI8A 1YPRA 3B9PA 4FH4A 1RDSA 1M904 1FJGM 1R4GA 3R7WA 4X1MA 4K91A 3DA1A 5DF7A 2CRUA 3KCHA 2STDA 1PJQA 5J8XA 4BLCA 5EEOA 2XDMA 1UM8A 4OW0A 4XDWA 5CGXA 3E4QA 4HNBA 4L0LA 2DNAA 4ETZA 2G7UA 1GJSA 2CEAA 1SXJD 3GDIA 4QWTA 2Y4AA 1I2EA 2PU4A 3GLGB 5KP3A 4TUWA 2RFRA 3I553 4JF8A 4GN2A 5KP1A 4REZA 2UXDM 4IIAA 2Q9MA 3QAUA 1YJN3 3VDPA 4X56A 2I72A 1IYQA 1H8ZA 3NHQA 2EX8A 1YJW3 1WTHA 1EI5A 3HZPA 3SMPA 3HLDA 3EJVA 2GNOA 2Z77A 3SATA 3M6HA 4JF4A 4QY6A 4WUJA 2KEBA 2XLNA 3FKAA 3KS8A 2EFUA 1VQ73 3H82B 2UUGC 4G4RA 4QB8A 1LI0A 4B3MM 4J5KA 1N32M 1AVLA 3ECFA 3WDGB 1K9M4 2V8FA 2ZL1B 4G4OA 3SH7A 3GLGE 1KE0A 4PKYA 4LGQA 5A8BA 1T3BA 1KYIA 2N35A 1BUJA 3ZHHA 4RNAA 2C99A 5E2HA 3WWXA 3Q3FA 3OOVA 4CISA 1C54A 1IBMM 4HBRA 1LT0A 4L16A 5CERA 2HAKA 1IU7A 1IVVA 3T12B 4WEJA 2R78A 3EQVA 3WOEB 3LIBA 4IPBA 3SW1A 3KN4A 1R2YA 1W01A 1DGFA 2H5SA 1DMNA 4FD2A 3F40A 4B7HA 1V74A 1KWIA 2YKHA 3KO6A 4OQHA 4JKTA 4BIRA 1KDSA 1KQS2 5FSRA 3MHVC 2EA9A 4OQIA 2F5OA 2LTUA 4IBBA 1LL8A 3SMSA 3Q7VA 5FEFA 2ML6A 1PZPA 3HLBA 4X64M 1N9OA 2MH8A 5KIZA 1ONGA 1TH4A 4KQQA 1VHMA 2V1AA 2F4YA 1EW0A 3X41A 4Y3IA 1N5HA 4UA7A 3T4OA 1V9YA 4JI3M 1JB2A 2HDRA 2DHYA 3UO9A 3KKGA 5FQKA 1XKZA 5E26A 4JI6M 3UE0A 1D6UA 3EN1B 3WHKA 1LSWA 3TQSA 3GECA 4DDYA 1SG9A 3WA2X 1FGMA 4WHAA 3LTBA 1V33A 2FFFB 2KF6A 3MS6A 4MBKA 3G34A 3CCS3 3WR2A 3BFDA 4I39A 3WS1A 2IMJA 3T4TA 4JGRA 4GL6A 1MGRA 5E6JA 1RGLA 3VFHA 3HLWA 1RGEA 2KOIA 3IX4A 5E43A 3EGDC 4L8PA 2W0NA 4P16A 3K9OA 5EP2A 3I7JA 1AR0A 4LLOB 1N75A 2KZSA 3BY9A 4X55A 1IY2A 3LEZA 5J4EA 4CQHA 4H3UA 1OKSA 3FYDA 2HF6A 2NQ8C 1RNTA 1WYCA 4KZ5A 4I4LA 1ZO2A 4KQDA 4S2KA 4LG2A 1XXMA 2WZZA 1K41A 3LCUA 5KPTA 5JYPA 1D6ZA 1TTEA 4B7GA 1GOUA 1IFYA 4KVHA 2ZM0A 4A3VB 5HARA 3O3VA 3OV4A 4K61A 3E46A 2OTJ3 1DY6A 4Q0HA 1PYLA 3GZXB 2FFJA 1LI9A 2YFIB 4LF9M 1TS8A 1GHIA 2QPAA 3T4KA 2W9QA 3K9PA 3MG2A 2ZAOA 2DVWB 3LY3A 3NBLA 5GKNA 2YFLB 2L09A 3K63A 2M7OA 4KT0F 3LIAA 3FKWA 3F1OA 4GB7A 1X1YA 4ZAMA 1IBLM 2QPNA 4FVMA 5EPHA 1OT9A 1P9RA 1ERQA 2C11A 3L25A 4HM6B 2ZJ9A 1HD8A 4HJ6A 2GQFA 4MGIE 1OTBA 2B3TA 1M1XB 2INWA 4DV7M 1LXEA 1BNIA 1Z5BA 1IEMA 2L4FA 1DETA 3T8NA 2FFYA 4RBNA 3U6PA 4AZFA 3RGRA 4HY8A 2JBFA 5KP4A 2KRKA 4JI4M 1EIJA 1YGWA 1O7EA 4G4NA 3LVVA 2W3DA 3SYKA 1GA0A 3V99A 2HZ5A 4WYKB 4HVNA 1EUIC 3CCV3 4AG6A 3S4XA 4BD0A 4D81A 1J7KA 3CF2A 3KP0E 4ZM8A 4LSOA 2IWCA 3MJQA 2A2LA 5DVAA 2VJWA 4RQ9A 1BSDA 5IS1A 2PBDP 2FOIC 1I5QA 5FDSA 5A90A 1BIRA 1XNRM 1BANA 3LI9A 5AQBA 2Y2OA 2OO9A 1O7PB 3X40A 1TR8A 4LCMA 2ZC3B 1D2NA 2V1UA 1VDDA 1XX2A 2I7PA 4BD1A 1W63Q 5KQ8A 4LMIA 4XB5A 4RX3A 1GY5A 4G3VA 1GYBA 4LF6M 2OWHA 3N8BA 2L2DA 5CF2A 1E25A 1OMEA 1BGSA 1S4RA 3DWZA 3LCEA 3CCE3 3IX8A 2WGIA 2VLGA 2ZC7A 1PW8A 4AKGA 1FGTA 3R9XB 3GV9A 5TBMA 3TSGA 3CPW2 1MZUA 1Q814 5ITXA 4N6NB 2CHGA 3PBTA 2OAQ1 1PWCA 3KYEA 1IVWA 1YLYA 1EE8A 4LFAM 3N7WA 3AL0C 2R4IA 5L8MA 1L2DA 3VP3A 4CGYB 4WL9A 4HLQA 4F1IA 4MM3B 5EXSA 2ZDJA 2A24A 4IEDA 4EV4A 3KX0X 2CV2A 3K3DA 3ZG7B 5IG4A 3H7WB 3MF0A 3NHXA 5U47A 2D7HA 4IBFA 2EKFA 2UGIA 4II7A 2C10A 2G5GX 1I2SA 3UJMA 7RNTA 4HH3A 1TDHA 3PCSA 1ODVA 1JV2B 1W79A 3LEQA 4CJ6A 1EQKA 1EKMA 4M3KA 1LV7A 3PBSA 3OWSA 1JNQA 4Y0UA 3KSED 4ZPXA 4J5GA 3VV4A 1IN8A 4MMYB 4OVDA 5TGNA 4ITQA 4QHSA 4AW4A 4XT2A 3B74A 1K6SA 1ORYB 5TFQA 4JGQA 4PM9A 5RNTA 3A98B 5JBSA 4JXJA 1ACFA 1LLBA 4O0PA 2H5XA 5FQQA 4DR7M 3NOPC 2R18A 5FQMA 2Y73A 2R46A 4EIWA 2IUKA 3MG3A 4N3VA 3DAVA 3FC7A 4I3IA 3OX9A 2QIYA 4NG2A 1K38A 1W8QA 3FSDA 3K3CA 1Y4KA 1U60A 2WKPA 3SEDA 5EV0A 3QNBA 3LH4A 3P7NA 1GABA 3M6AA 5G1LA 4NK3A 2EJSA 4HH2A 3A0SA 1T1BA 1GL6A 4LRYC 4BLMA 3OZHA 1XXHE 5AIFA 3IWIA 1ULIB 4WN5A 2KA6B 1GD4A 5E2EA 3S28A 1OTRA 1HZ1A 3VP4A 3NBIA 3BOSA 1VQP3 1YLAA 1BT5A 4DR1M 2XZFA 1XFQA 3P98A 1ONHA 3IWQA 3SAVA 3FGYA 3Q81A 3BRMA 4BWIA 3QHYA 2ZBKB 4JYAM 3H51A 4CPKA 2BLSA 2CFKA 5BXQA 4EV2A 5I5LA 1QZEA 4G6ZA 1LL9A 1NNJA 3S1YA 2GEXA 1YLPA 1NLZA 2LYXA 3NDEA 4ANRA 4I38A 2KDLA 1CEWI 4IBGA 2PHYA 2YR0A 3EWKA 4MJDA 1DP6A 3KOYE 2P9VB 3VFDA 1XGIA 2WSEF 1S5AA 1GMRA 4P87A 4Q7JA 2ZOHA 4R1KA 2BASA 1WNHA 4JXGA 3GPXA 1TTOA 1JN5B 4P6ZM 4Q0JA 1H3QA 1BAOA 1VDLA 3NECA 1VG5A 1IQYA 4GEWA 4ID4A 4LZJA 2Y2GA 3U2AA 5LC6A 4BTXA 2R62A 1Q9EA 1FCNA 2Q2EB 1FR6A 1Z6TA 1AVKA 3ZCBB 4RX2A 1B20A 5CECA 2XZUA 2Y79A 3C5AA 4LRXC 2QHOB 3G30A 2ZL8A 4NPBA 2D7GA 3X3ZA 4XXRA 4KENB 4GNUA 4HM0B 4LF8M 2F5MA 3U60B 1ZX2A 2Y21A 3LXUX 5EQTA 1N9LA 4IUKA 1YAXA 3U61A 1A2PA 2ZC6B 3KYZA 5I94A 5DKLA 2E5LM 4LY6A 1Z5AA 2BJVA 4WBGA 5EJCA 3AGNA 3BFGA 3IXDA 2GZAA 3EOIA 2PU2A 4BTWA 1J9MA 1WA9A 5HL1A 2CWTA 3KFQC 2JKFA 5EUAA 3A3EA 3V3RA 1ZV1A 2Z6CA 1G96A 5AIIA 2H0TA 3AOGA 3K92A 3AV0A 3E4PA 3K2NA 4EETB 4HP4A 4NSOB 2D01A 1T1CA 4X68A 3F92A 4PCZA 4DV1M 2KLIA 3UB7A 5IERA 1IXRC 4GDBA 4P6BA 3TRCA 2QCUA 5DF8A 3KYQA 3F14A 5FGOA 2W2CA 3CCU3 2B18A 4CIZA 2XEPA 1OIZA 4I8OA 3GRUA 4GC9A 3U6SA 3WODG 5DJUA 1D6YA 2VKSA 3A0RA 2ZQAA 3TE6A 1UGIA 1I3FA 3LTAA 3RTYA 1CK3A 4HOIA 5AI1A 2Y2KA 4E3MA 4D80A 1YVBI 1YLWA 1IN6A 1N9BA 2JZ1A 2O01F 3X42A 5EFWA 2CG1A 3J7Yd 1N9NA 3UMEA 1BNGA 3B8LA 2R9XA 8RNTA 4EUZA 5K5BA 3HX3A 1K3XA 4MLLA 4KLNA 3UPPA 3T1XA 1IXSA 1T2HA 4B3TM 5GLBA 1RGHA 4XDVA 1G5UA 3B7ZA 3CCJ3 1H8MA 2BU4A 4GHOA 1FILA 3RXWA 1E4DA 1NO1A 3JVUA 2H0IA 2DKLA 2CIUA 4DV0M 2RRUA 1O07A 3QP2A 2UV0E 4QY5A 1Q40B 2P74A 2X4AA 3FWLA 3M2KA 5IG3A 1BSEA 1EG9B 2WGOA 3BW6A 1W5SA 1F9IA 1OFIA 1FGQA 4X1LA 4ME4A 3D9YA 4EWFA 1XHBA 3S7PA 4EEUA 2BNGA 3F1NA 1W63M 3UY6A 2WZJA 4MN5A 4LJAA 2K0MA 3K9MC 1CEFA 1I0VA 3G16A 3BIRA 2JKGA 2XQZA 2VK3A 2M7VA 1XB2B 4IIWA 1RRLA 3LTCA 4FWDA 2LVPC 4JI2M 6GSPA 5EE8A 1QDRA 1DGHB 1MJGM 2BTFP 3O86A 3J7AS 4RF1A 3A76A 1VETB 3N8SA 4G1MB 2D42A 2RGHA 2QJ7A 5HPIA 4HM3B 1N9EA 2ZC5B 3FCSB 4S12A 3SASA 3X3YA 2CV1A 1B2ZA 3CNXA 1ZMWA 4Z1WA 3TL4X 1G68A 3M8CA 3HZJA 1YMSA 2DENA 4LFCM 5CX7A 3MWZA 2EX2A 4RZMA 1KSIA 1GY6A 3MZEA 1OHPA 3OWUA 2C6WB 5HL6A 5IW9A 1BRJA 3WA3A 3HI7A 3OCLA 3BFEA 4LJ7A 4JF6A 2PAVP 1K57A 3MR0A 3S7OA 1SIIA 3H9WA 1JZOA 2QWSA 2AHMA 4LJ6A 3MXRA 2CKFB 2W56A 2PBYA 5MC7A 3EQQB 1OTDA 3GLIE 5EXTA 5AYSC 4OVZB 4MH0E 1GOVA 5HX9A 1BNJA 1MPLA 1LHYA 2Y8HA 3HU3A 4BBVA 2EKKA 4B08A 3KSHA 4HESA 3N54B 4DV4M 2UUAM 4R9LA 3MG1A 3LT8A 3G2ZA 5CHJA 1KGFA 3EF8A 4DV3M 1RP5A 2ZTCA 2DCFA 2EO2A 3D9RA 2WKIA 4MEZA 2Z4SA 3T4QA 4U0XA 4CCVA 5FASA 3T1YM 2XGNA 4LFUA 2QP9X 1TF0B 5LMNM 2RSXA 3CME3 1K734 2PDRA 1I8VA 3SOAA 2CUZA 1IVXA 1W6GA 1H6UA 3S22A 1JWZA 5DF9A 1W02A 2DZNB 1CEGA 1FSYA 1DGGA 5CEBA 1SDEA 1JQJC 3UN7A 3FE3A 3UJNA 1F4IA 5IT5A 1Q3BA 1I0XA 1YSPA 3CPTA 4MMZB 3PNYA 3HBRA 2OOLA 1JR3A 3GQZA 3L29A 4UA6A 1SHVA 3GRVA 3QYEA 2PT7A 2H0HA 4LENA 1SARA 1N5PA 4PMAA 4DR5M 3L28A 3NULA 1UDII 4MEIA 1WMPA 2F56A 4KQOA 3R7WB 1AXBA 3IECA 2XGLA 2CG0A 1N36M 2B5RA 1QVG2 2EWVA 5CTNA 4E04A 1PY3A 4BL3A 1HYFA 2O9BA 3W0FA 2KRTA 3VOLA 2JWSA 1K56A 1CYVA 3V3SA 4ETXA 3CUEA 4OKPA 2DZOB 2W1TA 1J09A 2W9PA 2Z4RA 4Z9QA 2QA43 3AOEA 1Y8GA 3T4JA 5CHUA 4HM8B 2FZ0A 1ES4A 4IVIA 1KE3A 3QK9A 3JVCA 1OGXA 3SS5A 2KXGA 4OOLA 3LIFA 5CTMA 1I4WA 6RNTA 4KG2A 4KG5A 1YUBA 2Y0TA 5IG5A 2FE8A 4Y15A 1IN5A 4K0XA 5A2QS 3C7VA 1YMXA 5IG0A 1G28A 2FH0A 3EIHA 3W4QA 2GJ3A 3MKFA 3S7NA 1TGUA 3FTCA 1QMFA 4GIPA 4GHIA 1GHPA 2WGVA 3RFBA 1J2BA 5L8RF 3NWLA 1L5GB 1SJWA 1IY0A 4GSPA 3BFCA 4RYEA 3WRZA 3LO7A 4CLCA 1AWIA 3MHEA 1YLJA 2APLA 2H0GA 3VE3A 3U6EA 1K54A 3KVWA 1OPXA 4S2JA 5F5YA 2EXBA 4C75A 3CITA 2YFJB 4OONA 3GZRA 2Z3XA 3S29A 3PNVA 3WMDA 1O7WB 1UCKA 2Z76A 4NL4H 4YNRA 2XA7M 1N8R4 2ZQ7A 4GH9A 4XM4A 3DM8A 4DBGB 4P17A 1AY7A 3IBRA 4GDNA 4C6YA 1IOUA 3Q7VB 3HKPA 1HZOA 4H61A 4IT7A 1DP8A 1R6BX 4AKHA 5H37D 2A15A 5M18A 1ULJB 4M0DA 3C3EA 1ZS7A 3KS4A 1WYBA 3ILKA 1TF1A 3W68A 2Z8YM 2J3TD 4OH0A 1Y54A 4RNTA 5DFLA 2EXAA 5HAIA 4ZJ1A 1FW7A 3CCR3 2BHMA 5HPFA 1YLZA 2VIIA 3LMMA 1CUKA 4OX9M 3OPPA 3EE1A 3QP6A 4MMNA 1W6YA 3SHGB 3E2LA 3IBJA 3IXHA 2JY7A 2PR6A 1K57C 2R4JA 1Z1SA 1HVBA 1B2XA 1GO5A 4Q53A 4PAUA 2C96A 3KW6A 4JV5M 2XFTA 2CFOA 3AHSA 2FS1A 4Y17A 3BB9A 1TH2A 3BNCA 2XRNA 5FQ9A 2KDKA 3ITBA 3JUNA 3NCKA 4S2MA 5GLDA 3J80S 3Q1CA 1Q3CA 2CP8A 1P9WA 3T50A 4EESA 1QAKA 3A0VA 2V1BA 3FUTA 2W0QA 2J9PA 3VGNA 3SOYA 4GITA 3AKZA 3Q7ZA 2LVOC 4LEHA 4GJ4A 4KZBA 3HHZA 4N6MA 4OOMA 2LHGA 3TWMA 2KNVA 2CWUA 1B27A 1XA1A 1QAMA 1PJJA 1BRHA 4J9AA 1HU9A 4NRWA 1TDZA 4IHQA 3HUOA 1BSCA 4KT3B 2ZC4B 3IX3A 4EC6A 4DR3M 4PD2A 1XJ3A 3F7XA 3MQ0A 3Q07A 3RXXA 4EV5A 1ERMA 1PWGA 1UCLA 2VZWA 3F1OB 3GVBA 1OPYA 3G31A 3OPRA 4NKPA 8CHOA 4WFOA 4LZZA 3IH9A 1MWTA 3HX8A 4IBIA 4FCMA 3G713 3ITAA 2DMWA 5ITRA 1V92A 3UB8A 2HL7A 3SAUA 4IBCA 3UGJA 1BZAA 4S2LA 3BNDA 1HQCA 1JZDA 4K0KM 2E8JA 1ZMUA 2OCTA 3TJZC 1RRHA 4RF0A 5JI3E 2HDQA 2EX6A 5L07A 4LV1A 3SC3A 5F69A 5HGRA 1YM1A 2DAMA 1RGYA 5GHYA 4GHLA 1MWSA 4DN0A 1A67A 3BLMA 2LBCA 5CGSA 2QZ6A 1BLHA 3AOEC 1RCJA 1J5EM 1IV9A 3LICA 2JY5A 1BNEA 1T2IA 4MN7A 3N9HA 2Y2HA 5IZ7D 5FLXS 5KQDA 1NSFA 2Y0QA 1FYSA 3CMA3 1TRPA 3MXQA 2HV1A 1OFHA 3BJNA 3RNTA 3L7HA 5DJTA 3PGBA 3I563 4FD8A 2ZTDA 2J80A 1DGBA 1BRNL 1MBLA 2X8AA 2MR9A 1NO3A 2J8YA 3UDXA 1LSXA 4LRZE 2WZXA 4UA9A 4A5RA 1RGZA 4N9KA 1OHOA 2Y2QA 3TWLA 3GPUA 4N6TA 4FUWA 2F5WA 3G32A 2H1RA 2A3UA 5HDCA 2OPFA 1SQWA 1RTUA 2IUJA 1XC8A 4OU7A 4DV5M 1IQXA 2Y2LA 1C7YA 1I3IA 1SIHA 3ZQJA 5TBMB 2VGKA 4WF0A 2XA7S 3L0RA 3T4LA 4XUZA 1RGCA 2BMQB 2CX0A 3HHWA 4CLCC 3GWRA 5J7EA 2ZBBA 1T3TA 1Z09A 3SBJA 4WW0A 1D06A 4LZIA 2WYXA 1K54C 2A24B 5C18A 2CH9A 1VEUA 1B2UA 2GBXB 4O8GA 5BPVA 2W04A 1K0KA 3HIGA 4QPRA 1E3UA 3ZFZA 2F5NA 4WZ4A 2G2UA 3D8BA 7GSPA 1ZTUA 3CWFA 1AUAA 2LH0A 4XBOA 1ZGXA 5ITXE 3HY5A 2KAAA 1U8CB 3A3FA 2EX9A 4I3JA 3LQRA 2L7HA 2GSPA 3EGXC 1YIT3 4DMZA 1OQYA 3AFHA 3G6OA 4XT2B 1IN7A 4QD4A 3IXGA 4WURA 2W03A 2KZUA 4RVAA 1IYPA 3LOYA 1VQ1A 4BBTA 5ITUA 1OGZA 2KW0A 3HOHA 5FW5A 3BYDA 4CHTB 1ISKA 5HDSA 3H4MA 3HJIA 3KE7A 2XR0A 5KZHA 2AVXA 1S3SA 3NQZA 3VOZA 5GHZA 2HOHA 2DWMA 2CFGA 3CC73 1S4SA 4WMCA 3LCVB 5EVIA 4R38A 4NETA 2P38A 3BNBA 1FUTA 4EW7A 5FDHA 1FR1A 4E3IA 3W0LB 2QBYB 3ZG0A 5EECA 1ES3A 1JRQA 3ZC7B 5EVHA 1VQO3 2XD1A 2OV5A 2ZANA 2I9WA 3HGIA 3A5EA 4GD6A 1XGJA 3BFFA 1A2VA 1MKMA 3U4LP 3B42A 2XROA 1Z59A 3SZTA 4JN6A 4E3OA 3ICYA 1L2CA 2D7EA 5I97A 3FKVA 8CATA 3K1JA 1YSQA 2A5YB 3UB9A 1G02A 4QOZC 1TD5A 2VA0A 3EX9A 1TFKA 1IV7A 4ZTKA 3UL5A 3NV0A 4JXWA 4NSRA 2MC8A 3GZYB 1NLYA 2W3GA 1UW1A 2IY2A 3SVAA 1PFLA 2QEX3 6STDA 1BLCA 4J8TA 2CHVA 2G2WA 2X02A 3A45A 3FTFA 3U6QA 1Z6FA 1AV4A 5A92A 2CMNA 4WM9A 2H10A 1YI23 3VSLA 4Q8IA 5ELJA 4RA7A 2LQVA 4KODA 2RCXA 1WGLA 3WHLA 5TJJA 3WS4A 1DRMA 3LR0A 5AJGA 3KOXE 1IK3A 3ZQ5A 1PGYA 2ZLYA 1JTDA 2HKJA 4I81A 3LYXA 3HJ8A 1VEGA 4AKYA 1LOYA 3MZDA 4MDZA 4YINA 1TS6A 2C4BA 1XFNA 1KC84 5L10A 2PYPA 3J27B 4OPQA 4B4XA 3ALAA 4S2PA 4PM5A 4GB5A 5AVFA 4MGYE 5AVEA 5GL9A 3U5ZA 2LVQD 1GD3A 3KSFA 1TP6A 3C8CA 3G4PA 4LJ5A 5AQ9A 3QP8A 1CH0A 2XSOB 2J3WA 1H0MA 2KNAA 2QBYA 1OACA 5CF1A 4U0TA 2O9AA 3FLJA 3AJIB 1K82A 4MB7A 4KZAA 4X6TA 1WE4A 4HI4A 4HM1B 4YFMA 3E9SA 3EEHA 3U61B 4IBJA 2KNZA 3FTDA 2OOBA 3GRJA 1RGKA 1XJ2A 1PRBA 2IA2A 3IF5A 1XPBA 3P01A 5EXPA 3RGAA 3H4JA 1IFQA 1SXJA 2WGWB 4BBAA 4AKIA 4U3TA 1JR3D 1OJ5A 3PHYA 1PJTA 1NHGC 3NBRA 1BULA 1IKIA 4FW9A 2I9VA 5HD5A 2LVNC 3DTIA 5FI7A 5CLKA 1MXOA 2PNCA 1NVMA 2BIRA 2Y20A 1JNUA 1LOVA 3LVWA 2ACGA 4DXCA 4N9LA 2VF8A 2HJEA 1EEJA 3CZDA 3R8FA 4EQIA 3M6BA 2BWBA 2P09A 3ZH9B 2Y2JA 4L9GA 3GR2A 5D3OA 2R44A 4RKUF 3OBFA 4OPYA 2JUJA 3A42A 1K56D 4WP2A 5LBRA 3CJMA 1HNZM 4HM2B 2OOVA 3RH8B 1M1K4 4X62M 3F1PB 2M7UA 4DV2M 2WGQA 3M7GA 3G8ZA 3CHWP 4JRFA 3HJKA 4R3AA 4B4ZA 2C5WB 3FTEA 4ZJ2A 3O87A 3DGNA 4K08A 4UEYA 2Y2MA 4GOGA 1XP4A 4QOSA 1C7HA 2WKHA 1VQ53 2FGTA 1JTGA 3N8LA 1PZOA 4DXBA 4IBXA 3Q82A 1N78A 1IQ8A 3IWOA 2DZLA 3UNWA 2CFLA 3IPTA 3AGFA 3FPVA 2VF7A 3K8ZA 3SFZA 1XXHA 1TFOA 3B4PA 1IXSB 3UMDA 3DH2A 5EXXA 3QNCA 5F1FA 4FH2A 1OIPA 4N6OB 1M6KA 1OTIA 2Y55A 1PW1A 5FSWA 4S2IA 1QZMA 4BTYA 4X2OA 1YHQ3 5DYGA 2JKRM 2WGWA 2VDBB 4IJEA 3BU4A 1HLUP 3RJUA 4FR9A 4HM7B 5ITQA 1ES5A 5AIHA 5EVIC 4XBTA 3PAGA 3GPYA 3GAXA 1L0EA 3PYPA 3WS5A 4Y0OA 1CYUA 4OOYA 1OUNA 1EFUB 3NIAA 4OQ0A 1TH3A 5JPPA 2LB5A 2JKRI 4HEFA 5IEOA 3CI6A 3F1NB 2L1SA 4WZ5A 1OJGA 4FCJA 4KO8A 1K3WA 1UCJA 1R5LA 4L9EA 4Y5FA 4HYZA 3D3OA 3CD63 1FQGA 2ZQ9A 3BWLA 2GBWB 4HKVB 5C5KA 3M2JA 4QWOA 1MOLA 3F1PA 4EU0A 1QVF2 4CJNA 5ITTA 2QNJA 1IXZA 1BRIA 3I4VA 1FGRA 1PNEA 4R0QA 3C9PA 3B7NA 1IYSA 4IBRA 2JKTM 3MKEA 3BLZA 1IYYA 1HTZA 4HP9A 2GXFA 1BU4A 4ARZA 3IHPA 1VM1A 1KDWA 3GSGA 3E98A 5FAPA 5AEUB 4E3NA 1LSVA 4R4RA 1UUVB 2V2FF 1J3WA 3OLOA 2DAKA 1HT1E 1OAIA 5F3WA 3HUNA 1ZKJA 3N8RA 1GMQA 2JKTI 3OCNA 4UHUA 4YY3M 2HP5A 1GOYA 2XH9A 3KSPA 2VV6A 3MSHA 4LCLA 2WOHA 2O5RA 2L4VA 1K4EA 1XJ6A 1NNVA 4JLFA 3VP1A 1OAOC 3CG5A 1Y28A 2ZHXB 4GS9A 2ERCA 5DKKA 3F9SA 1G59A 2P0MA 1OHSA 5FEGA 4R23A 4DE3A 2W56B 2JCHA 3NC8A 2E2TA 3AHWA 5AIGA 4K1VA 4FMCA 2FH5A 3DUKA 2KHHA 3CTWB 2WK0A 2SARA 2V1ZA 2OSUA 1G4AE 2F4VM 3DMCA 4F3LA 7CATA 2DHRA 4WWUC 5KSHA 4OK0A 3KSGA 4ZRRA 4L8RC 1JB4A 2CFWA 1EA2A 4PM7A 4WELA 5F68A 1JKGA 4R71A 4HBUA 2HCBA 3ZGAB 1I2GA 1HJPA 2R4EA 3L9KA 4KZ1A 2PYRA 3LTDA 3IS2A 5DFXA 3L2AA 3V39A 1WXQA 1YSYA 3GLHA 1W6CA 1YIJ3 4X25A 4N1HA 4EBLA 3QP1A 3HCYA 1QYRA 3LIDA 1SXJC 1NY5A 4LJ8A 2WKEA 4LF5M 1AQZA 3U6MA 3ER7A 3NXJA 4I5QA 4QNRA 3F8HA 1UWNX 5FI6A 4KUKA 3NDGA 5G18A 3ZYTA 3AGEA 4Y0TA 5DTTA 1UGHI 3HLEA 5DFYA 1SKFA 2D02A 5IREB 3CF6E 3IJEB 4OPRA 3PYJA 3MJ5A 1PM5A 3CPTB 2X71A 1IBKM 2B24B 1VEJA 2OOAA 2P05A 2FNAA 2ZOIA 4H6JA 5A93A 4NXBA 1BRGA 1VQK3 2ZA4A 3S67A 4O7DA 3JUPA 3NBBA 5HWVA 2OOVC 1Q2PA 4DE2A 3ZVWA 3J7BA 1BVSA 1XA7A 3KP1E 5LC7A 1YNVX 3RDEA 1NWZA 3HL9A 4DF6A 2K9DA 1F5MA 2RBIA 4LRTA 2L4RA 4QU3A 1WHCA 1XMOM 2V0WA 2HP9A 3SHFA 1M40A 2W1TB 3GLFA 3B89A 3EC9A 4O3VA 2J7OA 4WP5A 5EQLA 1Q824 1X0OA 1JR3E 3FG8A 1QUTA 4JF5A 5FI2A 1HNXM 1LOXA 4IBDA 3MMHA 1GA9A 3NM7A 1O7GB 2RGQA 1D0MA 4L9FA 1RGFA 1T43A 3NBXX 2GEYA 3G35A 3DOAA 4EW5A 1JJ22 2MF7A 4ZDXA 4BB9A 2DXIA 5HD3A 5BIRA 2ZQCA 4X65M 3DFZA 5GHXA 3TW8A 1N34M 3JUMA 4GHAA 3SLUA 4NXEA 4M9XA 3UPOA 3FD9A 1BRKA 3HHYA 3K0ZA 1PI5A 1JB0F 3F7SA 4GHIB 2JE5A 5AEWB 1S723 3V92A 4LF4M 4DE1A 3IQAA 1B21A 2Z6DA 1F98A 1SKOA 3JUOA 4CLCB 4DV6M 1E3UD 3IF6A 1NV9A 4WZ5C 4NC6A 1OF5B 1NZOA 5ITYA 3VLFB 1IDPA 3GRDA 3U1WA 1DP9A 4DJ2A 3FKEA 1CQAA 1E32A 1K55A 1LTMA 1T19A 5FATA 2LWXA 1TIJA 1C3BA 4BBUA 4O2HA 3ULFA 2HGVA 1HT2E 3CGWA 3WOFB 1VQL3 4XGIA 4BU4A 1T1AA 1G41A 3C3DA 1NZUA 4LRSA 3B7QA 1D7EA 3I51A 2P08A 3HVFA 2XR8B 3W2ZA 4CLCE 2DRWA 4F94A 1V34A 4PDGA 2MJ6A 2C5RA 1V57A 4KZ8A 1GHMA 5EVID 5FA7A 1RCKA 3OW22 1DJBA 2BT3A 3TWKA 3ZNYA 2PD7A 2O9CA 1FUWA 5EP1A 2QGUA 2Q0OA 2Y91A 2CFDA 1G3IA 4YWZA 1RGAA 1E97A 4MGKE 2V8CA 3FRIA 3NUVA 3JAMS 1CQSA 1G71A 2ZM8A 1S66L 3KSXA 5HOHA 5A91A 3PAEA 4N6LA 4EBNA 3EBYA 3C4OA 3FUXA 3SARA 5M1AA 2ZQ8A 3LR5A 2CW9A 4E3LA 4EXOA 2XSZA 1PU4A 4IBKA 1WMNA 5DTSA 1QANA 3DTEA 1OTEA 2C9CA 3SAWA 2CHCA 1W2ZA 3FG3A 2AAEA 5IWAM 4FWHA 1LQMB 4S2OA 3RGPA 3EHCA 1VQ43 4O01A 1OF5A 4KZ4A 2HWJA 2I7NA 1IKGA 3URPA 3S7QA 3DGMA 1R7RA 2FNQA 7STDA 4NXGA 3KDSE 1RNBA 3JR5A 3QP5A 2BJWA 5EP3A 4M0WA 4EYCA 4EBPA 5HWTA 1MC0A 1K6RA 2JDIH 3KIIA 3ROBA 2EA0A 3BLSA 2WADA 3G6E3 2J7VA 3W67A 1GCEA 2ZM2A 3HLCA 1MKIA 2BMOB 1MWRA 2JZ0A 4RNYA 1H5XA 5D82A 5KPRA 1C1KA 1RSNA 4PHTA 4KQRA 1K8A4 4YOFA 2INXA 4X66M 1ESIA 3U6LA 1UCIA 1S6RA 3B3XA 3PVSA 1X1XA 3JUQA 4L4UA 1UWPX 4OLDA 3CCQ3 3O8YA 1STDA 2CK3H 2FXTA 1BNSA 4L7KA 1NNUC 5D83A 1K25A 3HLFA 4U13A 4L78A 2QSFX 4FMAA 5CXOA 3Q90A 1RKYA 2V0UA 2V6ZM 2Z2MB 3LFVA 5F6AA 3GQ3A 1RN7A 3UE3A 3B7CA 1H8YA 3UDFA 2RCDA 2W1RA 1O7HB 3HJQA 2KX6A 4IUHA 3CNMA 3T1QB 3OPHA 3UNLA 1HR0M 2KF4A 3R4KA 4NXFA 2E2VA 3UDIA 4MGHA 3O88A 1RJOA 4L15A 1NB5I 2XD5A 4JI0M 5FQJA 3V50A 3KZTA 2HDSA 5BU4A 1VB6A 3LW5F 3PZWA 3IG5A 1N9JA 1PJIA 1L0DA 1DYUA 2M60A 3KOWE 4QHTA 4JI8M 2P5TA 4Q0IA 3VP2A 5D81A 5FAOA 4AG5A 1VQ83 3SOIA 4OVMA 3S5CA 3TG9A 1TUHA 1KSFX 2O25A 3E2KA 2O99A 1WJ7A 4P85A 4E3JA 2YQZA 2QQ8A 2CC3A 1LNHA 5CHMA 2ZM6M 5HSQA 3MYTA 1BLPA 2PD8A 4DR6M 1N77A 2OAP1 5FTNA 2BO9B 3X3XA 1E9SA 2K31A 3V98A 1GSPA 2OQEA 1L3LA 3VKHA 3GQ4A 1QJGA 2R0IA 4GW9A 4EBGA 3T6PA 2O3OA 4KZ6A 1WGNA 4B3SM 1ASKA 3HLGA 1KVMA 4D82A 2UXCM 4G3OA 3VSYA 1BNRA 3IF6C 3IT9A 1DVCA 5IU1A 2OTL3 1O7MB 2XK1A 4GC5A 4YHHM 2CV0A 4ILFA 4KZ9A 1YQSA 3CLOA 4PKYG 4FMBA 2ML5A 3FV7A 1K55C 3BQAA 4MBFA 4BL2A 1VEUB 2XSSA 3UE1A 2DWNA 3PXGA 3D79A 1ROAA 2JC7A 1QAOA 2E8IA 3SXXA 1S67L 1YLTA 1CI9A 5CEDA 4EERA 5G4ZA 2F99A 2AADA 2B02A 1FOFA 3T0UA 2K2NA 2XFSA 2Y74A 2GX5A 3OC2A 4GZBA 1RLSA 3C30A 1A90A 2W3HA 5FL3A 2OWPA 3C2WA 4PEJA 3CUEC 2BG1A 2YFQA 5GSPA 1QMAA 4N92A 3STDA 2K47A 5IF6A 3GLGA 1QUSA 3KFUG 1JBSA 1FCOA 2B95A 1Q42A 4Z6YA 3W4OA 2LNHC 3CC43 4LJ9A 3D4FA 3VMAA 3C38A 1FNNA 3FZWA 3SYUA 3PBOA 3SH9A 5IT9S 1BVIA 3MKIA 1PIOA 2WUQA 2WSCF 2YNMD 4Y7PA 3NBJA 5IEPA 2GNXA 1NXYA 1QAFA 3E21A 3D4AA 2NUPC 4DE0A 1OH0A 1XWIA 3HU1A 4X2HA 3WHOA 2QYBA 3VOYA 1B3SA 5EVIB 3H82A 1IT8A 5HW3A 3GTCA 3GMWA 1KE4A 1PWDA 2J7NA 5CXWA 3THGA 2ZL1A 1IVUA 3D3LA 1PRQA 3FUWA 4PDIA 4LGMA 1DVDA 1D1JA 1SZVA 2JY8A 1S0WA 4MCWA 1VQN3 2QKPA 1FA3A 2IWDA 4JGPA 3PBQA 1LQGC 3GZBA 1VQ63 3MQQA 1LVNA 2BWEA 2GU1A 2P04A 3NV0B 3HK4A 3I0YA 2IA7A 2HPBA 3GRRA 3LY4A 3BM6A 4MBHA 2JN7A 4DDSA 3DBAA 4NRVA 4LGWA 3O5YA 4HZBB 2GDNA 3N4IA 1I70A 2HDUA 3FUVA 4DRTA 2WOFA 4WLAA 4HJLB 4M4XA 5CRFA 1ZAEA 1ZC2A 5JI2E 1GS3A 2OLUA 1DMMA 3UPNA 2B1XB 3FH1A 2VGLM 1GSWA 1ZG4A 4EEPA 1NU3A 4QNMA 1M9GA 1NJ4A 2G3QA 3FF0A 3NX0A 1BYWA 2VX8A 2Y59A 3AGDA 2UUCM 1L2BA 4LGYA 4AQYM 3LYGA 3BQ8A 1FSWA 2VEAA 3IHAA 2CE7A 2W3FA 4PPRA 2XSHB 3E99A 4XBXA 3DY5A 3U5ZB 3HUMA 2R45A 2P0XA 2WAEA 4HL4A 3M0EA 1L1TA 3N6IA
chains in the Genus database with same CATH topology
4FSFA 5EOEA 5G2GA 2Y2PA 3MBZA 4EXRA 4I5SA 3FUUA 1IT7A 3BECA 1OCVA 2HMNB 1YE9A 4FCFA 3U97A 2PZVA 4IJFA 3VSKA 5E2FA 3T1HM 3Q1FA 3UZUA 4KFFA 3T15A 4X69A 1SXJB 5AYRB 4R9KA 4NHFA 5EVLA 1GLNA 3MFDA 1Z5CA 4KHPM 2QMIA 4E6WA 3KSJA 2EUCA 1YJ93 2OQEC 5FQIA 3CU3A 3OPLA 4NOOB 2CHQA 1BUEA 2ZMAA 1W00A 4PT5A 4GD8A 1NWWA 1SXJE 4QJGA 1PI4A 2RL3A 4K0WA 1TVFA 1LL5A 2C98A 3FF2A 3T8UA 3DZLA 1GY7A 1MX0A 4OP5A 1E3VA 2V20A 3FYCA 3CC23 1L0GA 1NHWC 4NXMM 4K90B 5IENA 3CPOA 2VGJA 2JQ5A 4WYKA 5M19A 5C1BA 3MK6A 3FZCA 5TGFA 2DWZB 3G4S3 1JWVA 1KD14 1W5DA 4WEKA 4OLGA 1DO0A 4O8SA 4NREA 1W5ZA 1XXHB 3IXBA 3KOZE 5FTKA 2F98A 5A0OB 2ZAMA 4TX4A 4R80A 3UL6A 3PFIA 1NDOB 3DTMA 4DR2M 4N1XA 1EWZA 3OXAA 1HQYE 3PCRA 5STDA 1JWPA 4GMQA 1UI8A 1BLSA 4GKJM 1WMOA 1U5OA 2L6OA 4HM4B 4JBFA 5TR7A 1X37A 3U6DA 5F83A 3MZFA 2ZD8A 1Q39A 5HFOA 3ZDJA 2Z7AA 4E3KA 4KFEA 1KGGA 3A46A 4GKKM 1K4FA 3U6CA 1TU5A 5GLCA 1IQPA 3W8KA 3WS2A 2J9OA 1PFPA 4W5WA 5BR8M 1XMQM 3KXEC 2Q9NA 2UX0A 3VKGA 4JPMA 1US1A 1E94E 2LXEA 1WQLB 3MPHA 3PTEA 4FCZA 3H3HA 4KFDA 1UUWB 2F86B 3VK7A 3VK8A 2UWXA 1R2ZA 3GPPA 5F82A 3SH8A 3PS8A 4KZ7A 3VF1A 3A3IA 2XSZD 3ZCZA 3HIIA 3P09A 3DW0A 1KVLA 5LMUM 3Q8XA 4AEQA 4NXNM 1K28A 3BNEA 3C7UA 3IMAB 4R3JA 4BENA 1TDGA 4OP8A 1W5TA 2H0YA 4FWGA 1MU5A 3W4PA 1VQ93 4PM6A 2HMKB 1L0FA 1I94M 1ALQA 2EFXA 5EP4A 1L1ZA 2M5ZA 2V1CA 4XUXA 2Z2LB 1JKGB 1NB3I 3EBTA 3WS0A 3GP1A 3C58A 3DZDA 2F5PA 3CMZA 4X53A 4FCTA 5E2GA 4B3RM 2CWVA 3GLHB 3VDUA 2R65A 4O02B 4KG6A 1IM2A 2QZ4A 1GL7A 1XNQM 4FMDA 3QRDA 2OQ4A 1NJGA 1NJFA 3K5TA 3ZVTA 3NM2A 4AI6A 4LV3A 3K2LA 1DMQA 4R3BA 5CK6A 5AQ7A 1SPUA 3FG4A 2UXBM 4JXVA 3RE8A 4R7GA 1I2WA 5BOHA 4R4KA 3DWKA 4HBTA 3EB8A 1ESUA 2P9VA 1NY0A 1MWUA 3PBNA 1QAQA 3BEBA 3CF0A 1JN5A 4JXSA 4R4SA 3D8LA 1NRFA 1N33M 2SBLA 4DUYM 4S2NA 1VZZA 4HM5B 4L8OA 1ZG6A 1KGEA 4QHCA 2JA2A 2YX9A 1G6AA 3GLFB 5FTLA 2HP6A 1DO2A 4GRIA 3SX1A 4ZBEA 3F8XA 2BNKA 4B7FA 2BMRB 3ZNTA 3U60A 1Q864 4MNRA 1MNLA 3NY4A 3AMOB 3V5MA 5DYIA 2X01A 2WAFA 4R1GA 3SS3A 1NJI4 1NYMA 1MY8A 2WO0A 3CXC2 1T5YA 5DREA 3C4PA 3NQYA 4N6UA 3K7CA 5DRVA 3SS4A 4FCVA 3E4RA 2Y2IA 3FG1A 1A2KA 5KPZA 4OUQA 1R4CA 4LFBM 2W6JH 2DWLA 4LJ4A 1O7NB 5KO3A 2A49A 3IF6B 1YT4A 3CCL3 5HAPA 1G8PA 4LV2A 1IYOA 3UMMA 3ZG5A 2Q07A 1HKXA 1IY1A 3U6OA 2D1WA 3OWYA 1L8QA 4H8RA 3DXOA 3JYIA 1QVRA 3VFFA 3GQ5A 5BVBA 1TEMA 3IG8A 2DNSA 3CCM3 3S27A 3DGLA 1STFI 3VP0A 2Z7JA 2XLJA 1JB5A 1IN4A 4OQGA 2XF3A 3UB1A 2RGOA 4M9ZA 3GLIB 4P0MA 3HU2A 1FGOA 3RFWA 3HJSA 2VQFM 4E6XA 4KZ3A 5HAQA 4FCWA 1W7CA 1Q7Y4 2QENA 1W8YA 3TOIA 3ZG9B 3LQQA 1VQQA 3TDGA 3GO8A 3HREA 4RNZA 1BUQA 5IHVA 1VQM3 3HWSA 3J81S 3LZAA 3FYZA 1DJCA 3AMOA 1HNWM 4UAAA 4WYYA 4STDA 1GKIA 4PM8A 3QWLA 3MXSA 3ZG8B 5KMWA 3LT9A 1ES2A 5FTMA 1L2SA 1JVJA 1NY6A 1Q40A 2HMLB 3EIEA 2Y2NA 3ISGA 5FAQA 1TDLA 2KRUA 3PBRA 5GLAA 4N6V0 2L7IA 4BJPA 1NYYA 3MSOA 2IWBA 3GRYA 3HHXA 3G0KA 4DKIA 4C3QA 5EOOA 2HMJB 1DJAA 2O9UX 4LCBA 3Q2PA 3I4YA 1DGHA 2E2UA 4ORLA 2F5SA 5FTJA 5DTKA 3IHBA 2ZQDA 3J2PB 1KFVA 4IVKA 5JYOA 2CC1A 1SCWA 4DR4M 3DGOA 2C9OA 4D2OA 1UI7A 3B4OA 1Q2QA 3GLIA 1OJLA 3G2YA 5CGWA 2X49A 4JI5M 2UUBM 2OLVA 2V1LA 4WMCD 4HZ9B 5AQAA 1QQWA 4ZJ3A 5ELUA 1BTLA 4JI1M 4M9SA 3JR4A 1EROA 2RKOA 5F1GA 4Z8XA 2F5QA 2HMOB 4OPZA 3NI9A 2HMMB 3UK6A 3PXMA 5JPUA 1N4OA 1YGEA 2KCDA 3RGSA 1W2B2 1QMEA 3L26A 4S2NC 4R3DA 2GU3A 4MGZE 1W7FA 4XBYA 4OVZA 4LV0A 4AKZA 2HHHM 3A3DA 3L27A 1E9RA 2G8LA 4JI7M 3EQUA 2Z6BA 5DNYA 2W82A 3SYLA 2K54A 2XRXB 1ZQ9A 2R9WA 1QALA 4K1UA 4B88A 4MMXB 1FCMA 3OTOM 1ROVA 3TPZA 1IELA 1BSGA 4DUZM 3A3JA 1N8QA 1W4NA 5KSCA 4G4QA 4CDLA 4GKUA 4I4KA 1GVNA 3LMLA 4IBEA 2KXEA 2VQEM 1E3RA 1PYYA 4LF7M 3EN8A 4BQMA 1F8NA 3IH8A 5L2FA 3T38A 3WRTA 1SDNA 2UU9M 1CI8A 3B9PA 4FH4A 1M904 1FJGM 4K91A 3DA1A 5DF7A 2STDA 5J8XA 4BLCA 5EEOA 2XDMA 1UM8A 4OW0A 4XDWA 5CGXA 4L0LA 2CEAA 1SXJD 4QWTA 2Y4AA 2PU4A 3GLGB 5KP3A 4TUWA 2RFRA 3I553 4JF8A 4GN2A 5KP1A 4REZA 2UXDM 4IIAA 2Q9MA 3QAUA 1YJN3 3VDPA 4X56A 2I72A 1IYQA 1H8ZA 2EX8A 1YJW3 1WTHA 1EI5A 3HZPA 3SMPA 3HLDA 3EJVA 2Z77A 3SATA 3M6HA 4JF4A 4QY6A 2KEBA 2XLNA 3FKAA 3KS8A 2EFUA 1VQ73 4G4RA 4QB8A 1LI0A 4B3MM 1N32M 1AVLA 3ECFA 3WDGB 1K9M4 3SH7A 4G4OA 1KE0A 4LGQA 1KYIA 3ZHHA 4RNAA 2C99A 5E2HA 3WWXA 4CISA 1IBMM 4HBRA 4L16A 5CERA 1IU7A 1IVVA 4WEJA 3EQVA 3WOEB 4IPBA 3KN4A 1R2YA 1W01A 1DGFA 2H5SA 1DMNA 4FD2A 3F40A 4B7HA 1V74A 1KWIA 4OQHA 4JKTA 1KDSA 1KQS2 5FSRA 3MHVC 4OQIA 2F5OA 4IBBA 3SMSA 3Q7VA 2ML6A 1PZPA 3HLBA 4X64M 1ONGA 1TH4A 4KQQA 3X41A 1N5HA 4UA7A 4JI3M 1JB2A 2HDRA 3UO9A 3KKGA 5FQKA 1XKZA 5E26A 4JI6M 3UE0A 1D6UA 3EN1B 3WHKA 4DDYA 3TQSA 3WA2X 1FGMA 4WHAA 3LTBA 2FFFB 4MBKA 3G34A 3CCS3 3WS1A 3BFDA 2IMJA 4GL6A 5E6JA 3VFHA 3HLWA 5E43A 4L8PA 4P16A 5EP2A 3I7JA 1AR0A 1N75A 2KZSA 4X55A 1IY2A 3LEZA 4H3UA 3FYDA 2NQ8C 1WYCA 4KZ5A 4I4LA 1ZO2A 4S2KA 4LG2A 1XXMA 2WZZA 1K41A 5KPTA 5JYPA 1D6ZA 4B7GA 4KVHA 2ZM0A 4A3VB 5HARA 3O3VA 3OV4A 4K61A 2OTJ3 1DY6A 3GZXB 2FFJA 1LI9A 2YFIB 4LF9M 1GHIA 2QPAA 2W9QA 3MG2A 2ZAOA 2DVWB 3LY3A 3NBLA 5GKNA 2YFLB 2L09A 3K63A 2M7OA 4GB7A 3FKWA 4ZAMA 1IBLM 2QPNA 4FVMA 5EPHA 1ERQA 2C11A 3L25A 4HM6B 2ZJ9A 1HD8A 4MGIE 1M1XB 4DV7M 1LXEA 1Z5BA 1IEMA 3T8NA 2FFYA 4RBNA 3U6PA 4AZFA 3RGRA 2JBFA 5KP4A 2KRKA 4JI4M 1O7EA 4G4NA 3LVVA 3SYKA 1GA0A 3V99A 4WYKB 4HVNA 3CCV3 4AG6A 3S4XA 4BD0A 4D81A 1J7KA 3CF2A 3KP0E 4ZM8A 4LSOA 2IWCA 5DVAA 2FOIC 1I5QA 5A90A 1XNRM 5AQBA 2Y2OA 1O7PB 3X40A 4LCMA 2ZC3B 1D2NA 2V1UA 1VDDA 1XX2A 2I7PA 4BD1A 5KQ8A 4LMIA 4XB5A 4RX3A 1GY5A 1GYBA 4LF6M 3N8BA 5CF2A 1E25A 1OMEA 3DWZA 3LCEA 3CCE3 2WGIA 2ZC7A 1PW8A 4AKGA 1FGTA 3R9XB 3GV9A 3TSGA 3CPW2 1Q814 5ITXA 4N6NB 2CHGA 3PBTA 1PWCA 1IVWA 1YLYA 1EE8A 4LFAM 3N7WA 3AL0C 2R4IA 1L2DA 3VP3A 4CGYB 4HLQA 4MM3B 5EXSA 2ZDJA 4IEDA 4EV4A 2CV2A 3ZG7B 5IG4A 5U47A 3NHXA 2D7HA 4IBFA 4II7A 2C10A 2G5GX 1I2SA 3UJMA 1TDHA 3PCSA 1JV2B 1W79A 1EQKA 1EKMA 4M3KA 1LV7A 3PBSA 3OWSA 1JNQA 4Y0UA 3KSED 4ZPXA 1IN8A 4MMYB 4OVDA 5TGNA 4ITQA 4QHSA 4AW4A 1K6SA 5TFQA 1ORYB 3SH9A 4PM9A 3A98B 5JBSA 4JXJA 1LLBA 5FQQA 4DR7M 2R18A 5FQMA 2Y73A 2R46A 4EIWA 2IUKA 3MG3A 4N3VA 3OX9A 2QIYA 1K38A 1W8QA 3FSDA 1Y4KA 1U60A 3SEDA 3QNBA 3LH4A 3M6AA 4NK3A 1GL6A 4BLMA 3OZHA 5AIFA 3IWIA 1ULIB 2KA6B 1GD4A 5E2EA 3S28A 3VP4A 3NBIA 3BOSA 1VQP3 1BT5A 4DR1M 2XZFA 3P98A 1ONHA 3IWQA 3SAVA 3FGYA 3Q81A 3BRMA 3QHYA 2ZBKB 4JYAM 3H51A 4CPKA 2BLSA 2CFKA 5BXQA 4EV2A 4G6ZA 1LL9A 3S1YA 1NNJA 2GEXA 1YLPA 2LYXA 3NDEA 1CEWI 4IBGA 2YR0A 4MJDA 3KOYE 2P9VB 3VFDA 1XGIA 1S5AA 4P87A 4R1KA 4JXGA 1WNHA 3GPXA 1JN5B 1IQYA 4ID4A 4LZJA 2Y2GA 5LC6A 4BTXA 2R62A 1FCNA 2Q2EB 1FR6A 1Z6TA 1AVKA 3ZCBB 4RX2A 5CECA 2XZUA 3C5AA 3G30A 2ZL8A 2D7GA 3X3ZA 4XXRA 4KENB 4GNUA 4HM0B 4LF8M 3U60B 1ZX2A 2Y21A 3LXUX 5EQTA 3U61A 2ZC6B 5I94A 2E5LM 4LY6A 1Z5AA 2BJVA 4WBGA 5EJCA 3BFGA 3IXDA 2PU2A 4BTWA 1J9MA 5HL1A 2CWTA 3KFQC 5EUAA 3A3EA 3V3RA 1G96A 5AIIA 2H0TA 3AOGA 3K92A 3AV0A 4NSOB 4X68A 4PCZA 4DV1M 5IERA 1IXRC 4GDBA 4P6BA 2QCUA 5DF8A 3F14A 5FGOA 2W2CA 3CCU3 2XEPA 4I8OA 3GRUA 4GC9A 3U6SA 3WODG 1D6YA 2ZQAA 3TE6A 3LTAA 1CK3A 5AI1A 2Y2KA 4E3MA 4D80A 1YVBI 1YLWA 1IN6A 1N9BA 3X42A 2CG1A 3J7Yd 2R9XA 3B8LA 4EUZA 1K3XA 4MLLA 4KLNA 3UPPA 4B3TM 5GLBA 4XDVA 3CCJ3 3RXWA 1E4DA 2CIUA 4DV0M 1O07A 4QY5A 1Q40B 2P74A 2X4AA 3FWLA 3M2KA 5IG3A 1EG9B 2WGOA 1W5SA 1OFIA 1FGQA 4EWFA 1XHBA 2BNGA 3UY6A 4LJAA 2K0MA 3K9MC 1CEFA 3G16A 2XQZA 4IIWA 1RRLA 3LTCA 4FWDA 4JI2M 5EE8A 1DGHB 3O86A 3J7AS 4RF1A 3A76A 3N8SA 4G1MB 2D42A 2RGHA 4HM3B 1N9EA 2ZC5B 3FCSB 4S12A 3SASA 3X3YA 2CV1A 3CNXA 3TL4X 1G68A 3M8CA 1YMSA 4LFCM 3MWZA 2EX2A 4RZMA 1KSIA 1GY6A 3MZEA 1OHPA 3OWUA 2C6WB 5IW9A 3WA3A 3HI7A 3OCLA 3BFEA 4LJ7A 4JF6A 1K57A 1SIIA 2AHMA 4LJ6A 3MXRA 2CKFB 2W56A 2PBYA 3EQQB 5EXTA 5AYSC 4OVZB 4MH0E 5HX9A 1MPLA 1LHYA 3HU3A 4B08A 4HESA 3N54B 4DV4M 2UUAM 4R9LA 3MG1A 3LT8A 3G2ZA 5CHJA 1KGFA 3EF8A 4DV3M 1RP5A 2DCFA 2EO2A 3D9RA 2WKIA 4MEZA 2Z4SA 4U0XA 4CCVA 5FASA 3T1YM 2XGNA 2QP9X 5LMNM 2RSXA 3CME3 1K734 3SOAA 2CUZA 1IVXA 1W6GA 1H6UA 3S22A 1JWZA 5DF9A 1W02A 2DZNB 1CEGA 1FSYA 1DGGA 5CEBA 1SDEA 1JQJC 3UN7A 3UJNA 1Q3BA 4MMZB 3PNYA 3HBRA 1JR3A 3GQZA 3L29A 4UA6A 1SHVA 3GRVA 4LENA 1N5PA 4PMAA 4DR5M 3L28A 4MEIA 1WMPA 4KQOA 1AXBA 2XGLA 2CG0A 1N36M 2B5RA 1QVG2 5CTNA 4BL3A 3W0FA 2KRTA 1K56A 3V3SA 1CYVA 4OKPA 2DZOB 1J09A 2W9PA 2Z4RA 4Z9QA 2QA43 3AOEA 5CHUA 4HM8B 1ES4A 4IVIA 1KE3A 3QK9A 3JVCA 1OGXA 3SS5A 2KXGA 4OOLA 5CTMA 1I4WA 4KG2A 4KG5A 1YUBA 2Y0TA 5IG5A 2FE8A 1IN5A 4K0XA 5A2QS 3C7VA 1YMXA 5IG0A 3EIHA 3W4QA 3MKFA 1TGUA 3FTCA 1QMFA 4GIPA 1GHPA 2WGVA 1J2BA 3NWLA 1L5GB 1SJWA 1IY0A 4RYEA 3BFCA 3WRZA 3LO7A 3MHEA 1YLJA 3U6EA 1K54A 3KVWA 4S2JA 2EXBA 4C75A 2YFJB 4OONA 3GZRA 2Z3XA 3S29A 3PNVA 3WMDA 1O7WB 2Z76A 4NL4H 1N8R4 2ZQ7A 4GH9A 4XM4A 3DM8A 4GDNA 4C6YA 3Q7VB 3HKPA 1HZOA 4H61A 4IT7A 1R6BX 4AKHA 5H37D 2A15A 5M18A 1ULJB 4M0DA 3KS4A 1WYBA 3ILKA 4OH0A 1Y54A 2EXAA 5HAIA 4ZJ1A 3CCR3 2BHMA 1YLZA 2VIIA 3LMMA 4OX9M 3OPPA 3EE1A 1W6YA 3SHGB 3E2LA 3IXHA 1K57C 2R4JA 1Z1SA 1HVBA 4Q53A 2C96A 3KW6A 4JV5M 2XFTA 2CFOA 3BB9A 1TH2A 3BNCA 5FQ9A 3ITBA 3JUNA 3NCKA 4S2MA 5GLDA 3J80S 3Q1CA 1Q3CA 1QAKA 3FUTA 2W0QA 2J9PA 3VGNA 3SOYA 4GITA 3AKZA 3Q7ZA 4LEHA 4KZBA 4OOMA 3HHZA 4N6MA 3TWMA 2CWUA 1XA1A 1QAMA 1PJJA 4J9AA 1HU9A 4NRWA 1TDZA 3HUOA 2ZC4B 4EC6A 4DR3M 4PD2A 3F7XA 3RXXA 3Q07A 4EV5A 1ERMA 1PWGA 3GVBA 1OPYA 3G31A 3OPRA 8CHOA 4WFOA 4LZZA 3IH9A 1MWTA 3HX8A 4IBIA 4FCMA 3G713 3ITAA 5ITRA 2HL7A 3SAUA 4IBCA 3UGJA 1BZAA 4S2LA 3BNDA 1HQCA 4K0KM 2OCTA 1RRHA 4RF0A 5JI3E 2HDQA 2EX6A 4LV1A 3SC3A 5GHYA 5HGRA 1YM1A 1RGYA 4GHLA 1MWSA 1A67A 3BLMA 5CGSA 2QZ6A 1BLHA 3AOEC 1RCJA 1J5EM 1IV9A 3N9HA 2Y2HA 5IZ7D 5FLXS 5KQDA 1NSFA 2Y0QA 3CMA3 1OFHA 3PGBA 3I563 4FD8A 1DGBA 1MBLA 2X8AA 1NO3A 2J8YA 3UDXA 2WZXA 4UA9A 4A5RA 1RGZA 4N9KA 1OHOA 2Y2QA 3TWLA 3GPUA 4N6TA 3G32A 2H1RA 2A3UA 2OPFA 1SQWA 2IUJA 1XC8A 4OU7A 4DV5M 1IQXA 2Y2LA 1SIHA 2VGKA 3L0RA 4XUZA 2BMQB 3HHWA 3GWRA 1T3TA 3SBJA 4WW0A 2WYXA 4LZIA 1K54C 5C18A 2CH9A 2GBXB 5BPVA 2W04A 3HIGA 1E3UA 3ZFZA 2F5NA 2G2UA 3D8BA 2LH0A 4XBOA 3A3FA 5ITXE 4WZ4A 1U8CB 2EX9A 3LQRA 2L7HA 1YIT3 3AFHA 1IN7A 4QD4A 3IXGA 4WURA 2W03A 2KZUA 4RVAA 1IYPA 3LOYA 5ITUA 1OGZA 2KW0A 5FW5A 3BYDA 4CHTB 1ISKA 3H4MA 3KE7A 2XR0A 5KZHA 3NQZA 1S3SA 3VOZA 5GHZA 2DWMA 2CFGA 3CC73 4WMCA 5EVIA 4NETA 3BNBA 2P38A 5FDHA 1FR1A 4E3IA 3W0LB 2QBYB 5EECA 3ZG0A 1ES3A 1JRQA 3ZC7B 5EVHA 1VQO3 2XD1A 2OV5A 2ZANA 2I9WA 3HGIA 4GD6A 1XGJA 3BFFA 1A2VA 1Z59A 4JN6A 4E3OA 1L2CA 2D7EA 5I97A 3FKVA 8CATA 3K1JA 2A5YB 4QOZC 3EX9A 1TFKA 1IV7A 4ZTKA 3UL5A 3NV0A 4JXWA 4NSRA 2MC8A 3GZYB 1UW1A 3SVAA 2QEX3 6STDA 1BLCA 4J8TA 2CHVA 2G2WA 2X02A 3A45A 3FTFA 3U6QA 1Z6FA 1AV4A 5A92A 4WM9A 2H10A 1YI23 3VSLA 4Q8IA 5ELJA 4RA7A 2LQVA 4KODA 2RCXA 3WHLA 3WS4A 3KOXE 1IK3A 2ZLYA 1JTDA 2HKJA 4I81A 3HJ8A 4AKYA 4YINA 3MZDA 1KC84 4OPQA 3J27B 4B4XA 3ALAA 4S2PA 4PM5A 4GB5A 4MGYE 5GL9A 3U5ZA 1GD3A 1TP6A 3G4PA 4LJ5A 5AQ9A 2XSOB 2QBYA 1OACA 5CF1A 4U0TA 3FLJA 3AJIB 1K82A 4MB7A 4KZAA 4X6TA 1WE4A 4YFMA 4HM1B 3E9SA 3U61B 4IBJA 3FTDA 3GRJA 3IF5A 1XPBA 5EXPA 3RGAA 1SXJA 2WGWB 4BBAA 4AKIA 4U3TA 1JR3D 3NBRA 1NHGC 1BULA 1IKIA 4FW9A 5FI7A 5CLKA 1MXOA 2PNCA 1NVMA 2Y20A 3LVWA 4DXCA 4N9LA 3CZDA 4EQIA 3R8FA 3M6BA 2P09A 3ZH9B 2Y2JA 3GR2A 5D3OA 4OPYA 3A42A 1K56D 3CJMA 1HNZM 4HM2B 2OOVA 1M1K4 4X62M 4DV2M 2WGQA 3M7GA 3G8ZA 4B4ZA 4JRFA 2C5WB 3FTEA 4ZJ2A 3O87A 3DGNA 2Y2MA 4GOGA 1XP4A 4QOSA 1C7HA 2WKHA 1VQ53 2FGTA 1JTGA 3N8LA 1PZOA 4DXBA 4IBXA 3Q82A 1N78A 1IQ8A 3IWOA 3UNWA 2CFLA 3IPTA 3AGFA 3K8ZA 3SFZA 1XXHA 1TFOA 3B4PA 1IXSB 5EXXA 3QNCA 5F1FA 4FH2A 2Y55A 4N6OB 1M6KA 1PW1A 5FSWA 4S2IA 1QZMA 4BTYA 4X2OA 1YHQ3 5DYGA 2WGWA 4IJEA 3RJUA 4FR9A 4HM7B 5ITQA 1ES5A 5AIHA 5EVIC 4XBTA 3PAGA 3GPYA 3GAXA 1L0EA 3WS5A 4Y0OA 1CYUA 4OOYA 1OUNA 4OQ0A 3NIAA 1TH3A 5JPPA 4HEFA 5IEOA 4WZ5A 4FCJA 4KO8A 1K3WA 4HYZA