2XF3A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
423
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSGEDVAARFIPTFAAAGNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 141
structure length 423
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xf3A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xf3A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xf3A02
4OVDA 1W8YA 3VP4A 3IHAA 3GRJA 1JVJA 4PM8A 3IH8A 4RYEA 5U47A 5JYOA 5F1FA 2G2WA 5EUAA 4K0XA 2XDMA 3FV7A 5DTTA 4JF4A 4BJPA 2HPBA 5HX9A 3UPNA 5DVAA 5FAQA 1K4FA 1MKIA 1BTLA 4GOGA 3GSGA 4PM9A 5EVLA 2WGWB 2OV5A 3N8LA 5E2HA 1ERMA 5HAIA 3N7WA 2EX8A 2ZQCA 1PW8A 4N9KA 4KQRA 5EVIB 1IKGA 2HDRA 3P09A 1XX2A 1YM1A 1PWGA 2HP9A 3FZCA 5D3OA 5A91A 5IHVA 3IF6C 2DCFA 1EI5A 5E2FA 3UPPA 2ZLYA 3A3JA 4ZJ1A 5M18A 1HZOA 1TVFA 3IXBA 1BLCA 4QU3A 1KDWA 2GDNA 3TSGA 3ZG5A 3QHYA 1KE3A 1SCWA 4S2OA 4E6XA 4OOMA 1ES4A 3HLEA 3IT9A 3WWXA 1K55C 1BLHA 1M40A 2WZXA 2Z2LB 4IBRA 4R23A 5CGSA 2XH9A 4P87A 1BT5A 1KGEA 2Y2PA 4EBPA 4CPKA 2A49A 3N6IA 4QY6A 3WS1A 4E3IA 5KMWA 5CECA 2IWCA 2Y2LA 3UE1A 1QMEA 2EFUA 3ISGA 4HEFA 2VGJA 3Q07A 3UY6A 1K57C 1IEMA 1NRFA 1SDEA 1FR1A 3OCLA 2Y2NA 2JC7A 2ZQ9A 3BYDA 5HAQA 3GVBA 5FI6A 3QNCA 4R3BA 3DWZA 1YLZA 3LO7A 1HVBA 2ZC4B 1GHPA 4WZ4A 2ZD8A 5M1AA 5DTSA 4XUZA 1E4DA 2QMIA 3OPRA 1PIOA 4S2MA 1PI4A 5FAPA 5FQJA 5E43A 4OQIA 4B88A 2PBYA 3A3DA 1W8QA 2Y2IA 4OLDA 3BM6A 2C6WB 4GNUA 5FSRA 3BRMA 4OP8A 1N9BA 4P85A 1GCEA 1YLYA 4YINA 2PU4A 1E25A 1OMEA 1XXMA 2Y91A 2ZM8A 3PBNA 5DF8A 2WAEA 2ZC3B 5FQ9A 1FSYA 3A3EA 4K0WA 3RXWA 3ZCZA 3DWKA 2EX2A 2J8YA 4DE0A 4KZAA 4IVKA 5FQKA 4E3MA 3G34A 2B5RA 5GHZA 4ID4A 1SHVA 5EVID 5FQMA 2Y2HA 1G68A 3I7JA 4U3TA 3VP2A 2XD1A 4QJGA 1K57A 3BEBA 1YQSA 1FQGA 2WK0A 3ZDJA 4X56A 4K91A 2Y2QA 4KG6A 3VMAA 1YLJA 5FQQA 3IH9A 3V39A 1PZPA 4Q8IA 2R9XA 2JBFA 3C7VA 3GV9A 4QB8A 2RL3A 3NI9A 2ZC5B 4JXGA 4KZ5A 4R4RA 2H10A 2P9VA 3LY4A 4LCLA 2FFFB 2V1ZA 4S2JA 5A92A 5AQAA 1XGJA 5AQBA 2EXAA 5FQIA 4WBGA 5DF7A 4ZJ3A 3HUMA 3ZG0A 1U60A 1TEMA 4DXBA 4OOYA 1FSWA 4XXRA 1SKFA 3G35A 3IWOA 2Y2GA 3M2JA 1Y54A 5CHMA 4UA9A 3P98A 1LI9A 2XGNA 3LCEA 1IYOA 4ZBEA 1XKZA 1BZAA 1NXYA 1QMFA 3FWLA 2Y4AA 2OLVA 1Z6FA 5CHJA 2XD5A 2XR0A 4FSFA 1MWTA 2ZQ8A 4CJNA 4DF6A 3MBZA 4H8RA 4P0MA 1ES2A 4BQMA 1Q2QA 4LENA 3HVFA 1YLPA 2X01A 3WS4A 1HD8A 4OQGA 2V20A 4Z9QA 4S2IA 2V2FF 3N8RA 4HBTA 1BLSA 1RGYA 3EQUA 1EROA 3OPHA 2XQZA 4BLMA 5HL1A 2WKIA 1PZOA 4OP5A 4X68A 1BLPA 1K25A 1RGZA 3VSKA 4DKIA 5F83A 3UE0A 4JPMA 1W7FA 3W4PA 1EWZA 2P9VB 3CMZA 2RCXA 3W4OA 2OLUA 5CEBA 3EQVA 4BD0A 2Q9NA 1AXBA 1ZG4A 1XP4A 4N9LA 5I94A 5GL9A 1K6RA 4OOLA 4QY5A 3SH8A 3M2KA 1JWZA 1Q2PA 5DF9A 1YLWA 3FKWA 1TDLA 3IF5A 2EXBA 1LHYA 1S6RA 4WZ5C 5J8XA 1BSGA 4MBHA 4WYYA 5CEDA 1NZOA 2ZM0A 1MY8A 4F94A 1YT4A 3SOIA 1HTZA 1KGFA 3O3VA 4GDBA 1WYBA 4DXCA 4PPRA 3VSLA 4DDYA 1XA1A 4S2NA 3IF6A 5L2FA 1IYPA 4JKTA 3PBQA 3HREA 2HDQA 4ZJ2A 3UE3A 3ITAA 3RXXA 3NC8A 1ONHA 2HDUA 2Y59A 3E2KA 3O87A 4X69A 1K56A 4OPYA 3AGEA 1TDGA 1FOFA 1K55A 5FA7A 3IWIA 3MZFA 5CRFA 4DRTA 4EQIA 4ZAMA 3V50A 4MNRA 5HW3A 5KZHA 2P74A 1PWDA 2X02A 4GD6A 4KENB 5EOEA 5F1GA 3UN7A 1PWCA 1JWPA 3NDGA 3ITBA 1I2SA 1IYQA 3V3SA 4M3KA 3ZHHA 2E8IA 5CXWA 2ZC6B 3IHBA 4QD4A 2QZ6A 2UWXA 3C7UA 3HBRA 1E3UD 2H5SA 2Y2MA 3HLDA 3ZNYA 4KQQA 5CGXA 2IWBA 3G32A 3Q7VB 1N4OA 3IQAA 1KVMA 3HLGA 4LV1A 5CTMA 3E2LA 4OQ0A 1IKIA 4PM7A 1MPLA 3NY4A 3G2ZA 2DNSA 5EVIA 2PU2A 5F82A 5JYPA 3VFHA 1VM1A 4N92A 3D4FA 3PBOA 4PM5A 2WAFA 1O07A 4OPRA 1FCNA 3AGFA 2ZM2A 3V5MA 4O7DA 3RJUA 1GHIA 4XUXA 4Y0OA 1O7EA 2ZQAA 3TOIA 4X53A 1L0DA 5FATA 4MBFA 4ZTKA 3GMWA 1ZKJA 4U0XA 3UDFA 3PBTA 1XPBA 3W4QA 2J9PA 3ZG7B 1PW1A 3BLMA 4C75A 1JTDA 1H5XA 3DW0A 2WKHA 4OPQA 4DE1A 3UPOA 4P6BA 2I72A 3Q7VA 4OQHA 4BD1A 2XFSA 4LCMA 4N1XA 1CEGA 1NYYA 3LEZA 4L0LA 4RA7A 4FCFA 3BFDA 2ZC7A 3UDXA 4KG2A 2WZZA 3G2YA 1XGIA 1KDSA 3HL9A 4LV2A 4S2KA 2BG1A 5FI2A 5E2EA 3VFFA 3WRZA 5EOOA 4B4XA 4A5RA 3ZG9B 4KG5A 1DJAA 4MLLA 3MKFA 4KZ3A 1PI5A 4LV0A 3LY3A 1DJBA 1ERQA 2IWDA 2XLNA 1K54C 3MZEA 2EFXA 5EVIC 2Y2KA 4EV4A 2C5WB 2HP5A 5EPHA 1IYSA 1ALQA 2ZQDA 3HLBA 3OC2A 1L2SA 2A3UA 4GKUA 3DTMA 3SS5A 3QNBA 2Q9MA 1MBLA 4KZ8A 4OH0A 4OLGA 4WMCA 3OPLA 1K6SA 1CI9A 1I2WA 4MBKA 1K4EA 4JXVA 4Y0TA 4FD8A 1FCMA 3N8SA 3S4XA 3BECA 4JXSA 4BENA 5A93A 4WEKA 1GA9A 1MXOA 3M6BA 3VP3A 3O86A 5EECA 1K54A 1W5DA 3CZDA 3IXHA 1ES5A 3NCKA 2Y2JA 3W8KA 1W79A 1NJ4A 3GTCA 1CK3A 2FFYA 3HLCA 3HLWA 4E3KA 3G4PA 3UO9A 2XEPA 4JF5A 4R0QA 4S2NC 4OPZA 4RX3A 4UA6A 3S22A 4WMCD 3Q81A 2XFTA 3BFEA 1WYCA 3CJMA 2DRWA 1RCJA 4EWFA 2EX9A 1RP5A 3FKVA 3Q7ZA 4NETA 3OZHA 3MFDA 2ZQ7A 5CERA 3PTEA 5AQ7A 3WS2A 4JLFA 1XA7A 4DDSA 1CI8A 2OSUA 3MKEA 5KSCA 1YMSA 1S0WA 3NIAA 2ZMAA 1JTGA 1FCOA 4FH4A 3PBSA 4WEJA 4YFMA 3OPPA 3VP0A 4MEZA 5GLDA 2G2UA 1ESIA 1LL9A 5G18A 4E6WA 4RVAA 2CC1A 1MWUA 2WADA 1LLBA 3ZVTA 1CEFA 4GB7A 5CHUA 2Y2OA 1IELA 5TGFA 4GZBA 2XK1A 2HDSA 3BFCA 4ZDXA 4WM9A 4S2PA 5CGWA 5TFQA 3O88A 1MWSA 1KE4A 3G30A 4KZ4A 1H8YA 1LL5A 4IEDA 2WYXA 3CG5A 5FDHA 4KZ7A 1YMXA 3IXGA 4HBUA 4RX2A 5DTKA 1G6AA 3C4OA 5TR7A 3OCNA 3A3FA 1M6KA 1NYMA 3ZG8B 3SS4A 3PBRA 3SS3A 2H0TA 2EX6A 3NDEA 4X55A 3NBLA 4GDNA 4E3JA 5FI7A 4UA7A 2HP6A 5CTNA 1KGGA 3WRTA 4D2OA 2ZJ9A 1ESUA 3VOZA 3ZFZA 1DJCA 2R9WA 3BFGA 1ZC2A 5HARA 4Y7PA 4UAAA 2QPNA 3PAGA 3ZGAB 1GHMA 4E3OA 3B3XA 1NY0A 2JCHA 4KZBA 3G31A 3HUNA 1FR6A 3SH7A 4E3LA 4OONA 5HAPA 3MZDA 2WGWA 2JE5A 3HUOA 3PAEA 4OKPA 1LI0A 4HESA 5FASA 3M6HA 4GN2A 3JYIA 3V3RA 5E2GA 4R4SA 3HLFA 4U0TA 4BL2A 2VGKA 3IF6B 1ES3A 4DE2A 1I5QA 4KQOA 3SH9A 1MWRA 1PYYA 2WKEA 5FAOA 1YLTA 5BOHA 2WUQA 1BUEA 4R1GA 4X6TA 3MXRA 1BULA 4Y0UA 3WS5A 4C3QA 4BL3A 2WGVA 1K56D 4IVIA 4NK3A 4E3NA 5KSHA 3IWQA 2BLSA 2H0YA 2J9OA 1KE0A 4JXWA 5GLBA 3UDIA 1SDNA 2J7VA 5AQ9A 4EUZA 1GA0A 1JWVA 3BFFA 3WS0A 4B4ZA 3AGDA 4KZ6A 4S2LA 3MXSA 4PMAA 3VOYA 4DE3A 5GHXA 2WGIA 5A90A 1DY6A 1C3BA 5EE8A 3A3IA 4GD8A 4PM6A 2Y55A 1WE4A 1L0GA 3C4PA 4WZ5A 1J9MA 4WELA 2XF3A 1ZG6A 5GHYA 1L0EA 2Z2MB 3GQZA 3Q1FA 4JBFA 4QHCA 4R3JA 5HFOA 3UNWA 3TG9A 3ZNTA 3ZVWA 4C6YA 3IXDA 4EBNA 3N4IA 5M19A 4N1HA 4UHUA 4IBXA 3Q82A 1L0FA 3BLSA 4JF6A 3S1YA 3VP1A 1H8ZA 3GR2A 5GLCA 3C5AA 4KZ9A 5GLAA 1E3UA 4FH2A 4LV3A 4EBLA 1K38A 1KVLA 1NZUA 1ONGA 1VQQA 3FYZA 2X71A
chains in the Genus database with same CATH superfamily
1IVWA 3TWMA 3U6PA 1L1ZA 5HDSA 3D9YA 1AWIA 1TRPA 1GOVA 5EUAA 4MM3B 3M0EA 1RGFA 3K2NA 2PT7A 2AHMA 1BNGA 3FV7A 1OJ5A 5DTTA 5LMUM 1YVBI 2G7UA 1X1UA 4JGOA 3LICA 5FAQA 3T4SA 3GSGA 5EVLA 1B21A 4CDLA 1OH0A 1LL8A 1OHPA 1LTMA 4XUZA 2HDRA 1B27A 2Z4RA 4HM7B 2BJVA 3SHFA 4ILFA 2DENA 4GRIA 4MGIE 4S12A 2H0IA 3RNTA 4GLQA 4DJ2A 5IHVA 3IF6C 3LR0A 2CRUA 3KP0E 2E2VA 1EI5A 2DCFA 1NO3A 1MZUA 3CC23 5E2FA 3UPPA 3CNMA 3U1WA 1MKMA 3IXBA 1IOUA 4HYZA 4XBTA 3DFZA 3C2WA 1OFIA 3L2AA 1KE3A 4S2OA 4Q0IA 4ETXA 1S66L 1WMOA 3CC73 4HJ4A 3HY5A 2OWJA 2W3FA 2A5YB 1JNUA 3EOIA 4M9XA 4LYLB 2CIUA 1BLHA 2JHEA 2V1UA 4R23A 5CGSA 3U6SA 4LJ8A 3EC9A 5CXOA 1BT5A 1KGEA 3FH1A 4CPKA 2A49A 4CLCB 4EBPA 3GP1A 5KMWA 4KZ1A 2R78A 3A46A 3KYEA 1DP6A 4NPBA 3ISGA 3QP5A 3Q07A 1IEMA 1GY5A 2JC7A 4HM3B 3NOTC 1BRNL 2ZQ9A 2ZBKB 3QP2A 5HAQA 2UUGC 1PRBA 3DGYA 1BRJA 5KPZA 1WA9A 3R7WB 1AR0A 5TJJA 3TDGA 1GD4A 1HVBA 4GIPA 2PD7A 1G71A 1XNRM 1D0MA 7RNTA 1JB4A 1E4DA 3UB7A 1PIOA 1FJGM 5EVEA 2Y2IA 3PVSA 4OLDA 3HOHA 1OTRA 4R7GA 5FEGA 4OP8A 4P85A 2KF3A 3GSPA 2KHHA 5FTJA 1YLYA 4IBCA 1XXMA 2Y91A 4MGKE 2QBYB 2MC8A 3IJEB 3L27A 3RXWA 3SOAA 2JKGA 1IM2A 3H3HA 4JGQA 4HEOA 1KD14 3E4OA 3J80S 5EVID 5A2QS 1GD3A 5FQMA 2CX1A 5C1BA 1IN5A 4F2LA 5BXQA 4U3TA 3VP2A 4QJGA 2D7GA 4LF5M 1GY7A 1X1XA 1NJFA 1BRGA 4LG2A 3IG5A 1JKGB 3VMAA 3E98A 3V39A 3IH9A 5DJTA 3F1OA 2EO2A 3K92A 1NU3A 1BUQA 3SEDA 2IMJA 3LY4A 3H4JA 4LCLA 1IN4A 4S2JA 1TP6A 1OAIA 5KQ8A 3B4OA 2EXAA 4Y2FA 3C58A 3CCQ3 5DF7A 3HUMA 4DBGB 3A0RA 5IWAM 2PYPA 4YNRA 5L10A 4DXBA 4OOYA 1BSBA 1MU5A 1SKFA 2PHYA 5EXTA 1N34M 3K8ZA 5CHMA 3M2JA 4MGHA 4NOOB 1D6UA 1L2DA 2XGNA 3R9XB 4NREA 3LCEA 3P98A 4UEYA 4ZBEA 3T4JA 3BY9A 4MMNA 1TU5A 1QMFA 1WTHA 3AL0C 2Y4AA 1Z6FA 2CV2A 2CMNA 3OTOM 3W68A 2W27A 1MWTA 3DUKA 2ZQ8A 4CJNA 2VLGA 2HOHA 3BU4A 1YIT3 4LRZE 4XT2B 2FNAA 1YLPA 4FCWA 1W6YA 3Q1CA 2HV1A 2KCDA 2F98A 4NHFA 2V2FF 3N8RA 3H9WA 3CCJ3 5FEFA 2Q2EB 4H61A 4BLMA 3I4VA 5HL1A 1DETA 2KNVA 4GKJM 1W2ZA 3MSOA 4HVNA 1QUTA 4LFCM 3I51A 3UB9A 2C9CA 3JAMS 1K25A 1UCIA 5F83A 2L7IA 3HWSA 3NOUC 4JPMA 3L26A 4LGMA 3W4PA 3CMZA 4LRTA 2ZM6M 4EEUA 2JKRM 1QAFA 1G0TA 2L1MA 3EQVA 4BD0A 2Q9NA 3HZPA 2HMJB 5I94A 2GEYA 3J7AS 4LMIA 1K6RA 3FUXA 3SH8A 1JBSA 4GKKM 3OX9A 1RSNA 3HU3A 4NKPA 5DF9A 1NHWC 1YLWA 2BT3A 1S6RA 2BWEA 2I9WA 3X3XA 5CEDA 3T8NA 2PAVP 1KGFA 1HNZM 3KFUG 1WYBA 3DH2A 8CHOA 1XA1A 4S2NA 2QQ8A 2CEAA 2GXFA 1A67A 1DRMA 5L2FA 3HREA 4ZJ2A 3UE3A 3RXXA 3E2KA 3JVVA 1DGBA 1KQS2 1UWNX 1K55A 1OHOA 4W5WA 1Q9EA 3MZFA 5CRFA 2KA6B 3D4AA 3NV0A 3F1PA 1T2IA 4EV5A 5HW3A 1SKOA 2X02A 3Q3FA 4GD6A 4HM6B 3MKIA 2UUAM 3VDUA 4RZMA 4G4OA 4J5KA 2V1CA 1GOUA 2O99A 1IXSB 2VZWA 2Z8YM 1N9LA 1NLYA 1IN7A 2ML5A 1M1K4 1Q864 1HKXA 1XJ6A 2UXBM 3G16A 1OCVA 4Y3IA 4X65M 1XHBA 3FTDA 4JI4M 2H5SA 3HLDA 2YKHA 4KQQA 3S5CA 3GLFA 3WMDA 6STDA 3GLGE 3IQAA 4FD2A 2D1WA 3HLGA 2PR6A 3AMOA 3CXC2 4JXJA 5CTMA 3A45A 3QP8A 4GHOA 3EJVA 3CME3 3M7GA 3OWSA 1F4IA 1RNBA 4PM7A 1W5ZA 3EHCA 5EVIA 2PU2A 2BIRA 4I38A 1VM1A 4N92A 3WA3A 1MN3A 3HIIA 4F1IA 1L1TA 3AGFA 4NXBA 3V5MA 1Z6TA 1LOXA 3UB6A 2R44A 1O7EA 2ZQAA 1BSDA 1IV7A 1W6CA 2WSCF 2CHGA 1ZKJA 4U0XA 1DYUA 3UDFA 1G96A 3W4QA 1H8MA 2LHCA 1JRQA 3BLMA 1GJSA 3CUEA 1JTDA 4X2OA 3NQYA 4II7A 1VEUA 4DE1A 4FR9A 3LFVA 4OQHA 2KF4A 2VV7A 5FTMA 3U2AA 4G4QA 1Q824 1CEGA 2BNKA 8RNTA 1NYYA 3BFDA 2ZC7A 2XSOB 4HZBB 2N35A 3G2YA 2YX9A 3HL9A 4HM5B 5FI2A 2BG1A 3MQOA 1N9NA 4B4XA 5C18A 4H6JB 4MN5A 2CP8A 2CFGA 4FMAA 2DAMA 3HIGA 3ZG9B 4WFOA 2GBXB 1SXJE 4IJEA 1I94M 2DI0A 1OAOC 3F14A 2W3HA 3D72A 1QAOA 2IWDA 3EBYA 1K54C 4R71A 2Y2KA 4ANRA 5KIZA 4GB5A 2HP5A 1DGGA 5EPHA 1A2VA 3UL6A 1ALQA 2ZQDA 2A3UA 2ZMVA 1VQ63 3T1XA 3FE3A 1IFYA 1B2UA 4NEED 4L78A 3V98A 4EC6A 1I2WA 5KPTA 4HOHA 1R2ZA 1K4EA 4FD8A 1N78A 3RGRA 3N8SA 5E26A 4JXSA 4BENA 1UUVB 3DGOA 3GZYB 4N6TA 1G28A 1MXOA 3VP3A 1W5DA 3HK4A 3Q8GA 3IXHA 3HZJA 1ES5A 3NCKA 3NXJA 4AQYM 2H5XA 1TFKA 2WZJA 3GTCA 1IVVA 3K9OA 2FFYA 4F3LA 2EUCA 3HLWA 1O7WB 3PYJA 2WKPA 3LEQA 3G4PA 2RFRA 3KN4A 2CKFB 4R0QA 1XNQM 3LR4A 4OPZA 2ZHXB 4R70A 3X40A 2DWMA 3BFEA 4G3VA 3CCU3 2KXGA 4X64M 3EN8A 4EWFA 5H37D 2EX9A 2V1AA 4RNZA 4NETA 4WW0A 2FFJA 4OVMA 2KAAA 4PKYA 5CERA 5IEPA 3ZQ5A 3WS2A 2W03A 1VEUB 4JLFA 3T6PA 2YFJB 1XA7A 2L1SA 1CI8A 4GW9A 1YMSA 1S0WA 1WXQA 2ZMAA 1FCOA 1OTIA 2K6BA 2F5NA 2Z4SA 4WEJA 4O2HA 3OPPA 3FC7A 1US1A 2G5GX 3JUOA 3PXGA 3GQ4A 4EEPA 1KWIA 5G18A 3QK9A 3N9HA 3LMMA 1VEJA 2Z6BA 3ZVTA 5CHUA 3WOEB 2CWTA 3URPA 2Y2OA 2OPFA 2RKOA 1XXHA 4ZDXA 5HDCA 2K54A 5TFQA 3PNVA 3B47A 2QYBA 1HT2E 2HMLB 1N36M 3G30A 3IBRA 3U61B 1QQWA 4QHTA 1VZZA 4IEDA 5JPUA 3CG5A 3LCVB 4LZIA 4GJ4A 4KZ7A 4IIWA 3EBTA 3GPUA 3VK8A 3FTFA 3FLJA 1DP8A 3IXGA 4HBUA 3GLFE 2HL7A 3C4OA 3OCNA 5EQLA 3FG4A 2FOIC 2LVOC 3UK6A 1ODVA 3PYPA 3FRHA 3GZBA 2UUBM 5FSWA 3SS4A 2EX6A 1LSVA 4GS9B 3NBLA 4GDNA 2B02A 3KW6A 2C98A 5CTNA 4D2OA 4BTWA 2PZVA 3B9PA 2GEXA 2KZUA 2B95A 3IG8A 1SKOB 5C5KA 3PAGA 4GHIA 1JN5B 3X3ZA 2V0UA 2EJSA 4B3RM 3D79A 2I9VA 2JCHA 3HUNA 3U6EA 1W00A 3CITA 4E3LA 5HAPA 4L15A 2Z76A 2JE5A 3HUOA 3PAEA 4OKPA 1BSAA 2CWVA 1SIIA 5E6JA 3V3RA 4R4SA 4U0TA 4LGYA 3DA1A 4DE2A 5AJGA 4KQOA 1BVSA 1U5OA 2KXEA 5KP1A 2W1TB 6GSPA 3W0LB 1JJ22 4H3UA 4R1GA 3KOWE 3MXRA 3CTWB 5HDDA 4AG6A 3WS5A 1NSFA 2CHQA 2JY8A 4X66M 1K56D 2PNCA 3IWQA 2PDRA 2H0YA 1QDRA 4L8RC 5G1LA 4N6UA 4JXWA 1QYRA 1SDNA 3UDIA 4B4ZA 3FTEA 2NQ8C 3FCSB 1DP9A 2M5ZA 4S2LA 3TE6A 3NX0A 2L4VA 1OQYA 1C3BA 1IQXA 1DY6A 3KOZE 1R4GA 1OPYA 2G8LA 1R5LA 3A3IA 4GHLA 1IFQA 3MYTA 1R4YA 3C4PA 3KFQC 5CK6A 5CF1A 2HF6A 2XF3A 1C7HA 4R3JA 1I3FA 2LH0A 4EBNA 3KOXE 1FYSA 3BIRA 1TS7A 1UGHI 4N1HA 4BTXA 3FRIA 3U6LA 4CCVA 4DN0A 1L0FA 3BB9A 3VP1A 2XR8B 2KEBA 3H4MA 1OF5A 5GLAA 5EXPA 4FH2A 1N75A 4LV3A 1K38A 1GSPA 1BUEA 1N9OA 2ML6A 2OOVA 4LF8M 1Q40B 3IHAA 4PM8A 2CV0A 4RYEA 5JYOA 2JKRI 3RGSA 2G2WA 5EVHA 4K0XA 4O01A 1TH2A 3GZRA 1ZTUA 4HZ9B 1NB3I 2HPBA 3J2PB 3T8UA 1GSVA 4XM4A 1BTLA 2O25A 2MGWA 4JN6A 1SARA 3D9RA 1CF0A 1DGHB 2OV5A 3N8LA 1W4NA 3CCV3 3E4PA 4TUWA 2EX8A 2ZQCA 5DTSA 5HAIA 2NUPC 2LQVA 3GDIA 1IKGA 3UJMA 4KODA 2IA7A 1YM1A 2L4RA 5D82A 1T6OA 1N32M 1F5MA 3WDGB 5A91A 1RJOA 1VDDA 2HJ9C 1RGLA 2ZLYA 3ECFA 4A3VB 4HM1B 1HZOA 1BLCA 1W63Q 2LVQD 3ZG5A 5I5LA 3BLZA 3FPWA 5LMNM 3CHWP 3FTCA 2LVAA 4OOMA 1NY6A 1V92A 1ES4A 4FUWA 3BQAA 4HLQA 1K55C 1V34A 2JNHA 4AKZA 1BYWA 1M40A 1A2PA 2KDKA 2WZXA 4I81A 4B7HA 2P5TA 2XH9A 3B74A 4P87A 4M0DA 2QBYA 2Y2PA 2V6ZM 1EQKA 3N6IA 5IT5A 2Y2LA 1QMEA 2B18A 4K61A 3QYEA 2DKLA 5AVEA 2KRKA 1K57C 2W82A 1BOXA 1NRFA 4BBVA 4R38A 1FR1A 2VKSA 2Y2NA 1GJTA 5K5BA 3AV0A 3DWZA 2QGUA 2L7HA 3LZAA 1Q3BA 5ELJA 1K734 2K7SA 3JUNA 2DXIA 1GHPA 5EM0A 4NRWA 1AQZA 4ZM8A 2WKRA 5M1AA 3DTKA 4G3WA 2INWA 1CQSA 4LJ4A 2WOFA 4LZJA 3KZTA 2QMIA 3OPRA 4S2MA 2O9AA 4OQIA 3AOEA 4B88A 1L8QA 5D81A 1WR1B 4CGYB 3BM6A 1G8PA 4GNUA 5FSRA 4BTYA 2JKTI 4IJFA 1NV8A 3BRMA 3U97A 5HD5A 1GCEA 3RFBA 4YINA 1E25A 1OIZA 4HI4A 4HAAA 5HSQA 3PBNA 2CK3H 5DF8A 5DYGA 3A3EA 3ZCZA 3DWKA 3F1PB 4KUKA 3D8LA 2VIIA 2D01A 1VQ73 4DE0A 3PHYA 5GHZA 3HJ8A 5IZ7D 1SHVA 3GZXB 5HWTA 3B7QA 4LFUA 1PJQA 3NBXX 4K08A 1UUGB 3I7JA 5AIFA 2DAEA 1RHLA 4LFBM 3J7Yd 4HY8A 3R8FA 5AYSC 2KW0A 4K91A 2LXEA 1Q3CA 2CG1A 2DWNA 1YLJA 2Q0OA 3U5ZA 3V92A 3LIDA 5FQQA 2ZL1B 4QB8A 4EUVA 3L29A 4BBTA 4FMBA 4LFAM 1WQLB 2H10A 2EA0A 1DMMA 4TX4A 2FFFB 5A92A 2Q07A 1ZMVA 3OW22 4CJ6A 2JDIH 1G02A 5FQIA 1TS0A 4ZJ3A 3ZG0A 3SAUA 4OW0A 3U6CA 1GYBA 4LJ9A 7STDA 4JI3M 1UCJA 4UA9A 4BMWA 3K3CA 1IYOA 3EF8A 4CLCC 3FWLA 1NXYA 1HLUP 4Q0JA 3HU2A 1A2KA 1I2EA 4LEHA 5AIHA 2XD5A 1Z59A 4EERA 2XR0A 4FSFA 1QAKA 1XJ4A 4DF6A 4P0MA 1V33A 4BQMA 1CUKA 4Z8XA 3HVFA 2D7HA 4OQGA 4P17A 1WMNA 4S2IA 4HBTA 2Y79A 3EQUA 3OPHA 4KFDA 2XQZA 4DV3M 1P0ZA 1I0XA 4BBUA 4MJDA 2HMKB 4DUYM 4MMYB 4LF9M 2YFLB 1BLPA 4I3AA 1STFI 3I4YA 3LYGA 3BXWA 4RNYA 3UE0A 2W3DA 2V9AA 2HMOB 2RCXA 3E99A 1IVXA 3QRDA 1O7NB 3LQRA 2JKTM 3X41A 2QPAA 4N9LA 1TF0B 2HMMB 5LC6A 1YGWA 3ZH9B 3M2KA 3GQ5A 1AVKA 1E9SA 2MROB 2EKFA 4B08A 5HWWA 1KSFX 1BANA 1I0VA 3EE1A 4L8OA 4R80A 4YWZA 5BPVA 4WZ5C 5J8XA 3F1OB 2IA2A 4MBHA 4PD2A 4WYYA 1MY8A 4F94A 3HI7A 1YT4A 3SOIA 4GHIB 3GLHE 4EYCA 2GSPA 2QWSA 3AMOB 3IF6A 4STDA 1IYPA 1N33M 1VQ53 2HDQA 3VDPA 4HJLB 3ITAA 1OKSA 8CATA 1F9IA 2HDUA 1MC0A 3NC8A 2OQEC 1TIJA 1ASKA 1L3LA 1FGTA 2VEAA 2VK3A 2J7NA 2W1RA 3QWLA 4WL9A 1FGOA 5IS1A 4D81A 5FA7A 4DRTA 4LF4M 5F69A 4G4RA 3V50A 3WODG 4MNRA 4NG2A 4EQIA 5KZHA 4KENB 4FTXA 2JP7A 3UN7A 1IY1A 2GU3A 3KKGA 1SXJB 5EP4A 4IBFA 3KX0X 2OQ4A 3V3SA 1RRLA 1H3QA 3LCUA 4R3DA 3GPYA 2QZ6A 1N9EA 3M8CA 4P6ZS 1YVSA 4N3VA 1E3UD 2W0NA 3OOVA 1JZOA 5CGXA 3G32A 1GLNA 2SBLA 1IU7A 4X2HA 5A8BA 4YHHM 4LSOA 1BVIA 3SXXA 3OWYA 3B4PA 3UL5A 3E2LA 1IKIA 1RGCA 2V1LA 1YAXA 5HPFA 1SJWA 1MPLA 4JYAM 3NY4A 3G2ZA 3G6OA 2CV1A 2WGOA 2DNSA 5FLXS 5JYPA 2QHKA 3VFHA 3O8YA 4P16A 3D4FA 1B2SA 4OPRA 4NC6A 2MH8A 4EXRA 1RTUA 2SARA 5IREB 3I553 5I97A 2P0MA 1HJPA 3TOIA 4PAUA 2C9OA 4FCMA 2OWPA 4IBEA 3WA2X 3CPTA 1M904 5FTNA 4DUZM 1XPBA 3PBTA 3G0KA 1NVMA 2DZLA 1Q40A 2J3TC 1K0KA 5AIGA 4L16A 2YNMD 2K31A 2QKPA 3VGNA 5HL6A 1H5XA 5EEOA 3DW0A 3KOYE 1PJJA 1FUSA 1QALA 1B20A 1GO5A 3Q7VA 3JUQA 4AEQA 3L9KA 5DNYA 5EP1A 4IHQA 3AHWA 1BNRA 3GQ3A 4FCFA 5AYRB 2CFKA 1F2KA 1RKYA 4AKGA 2WZZA 3LIFA 3HJSA 4S2KA 5LBRA 1BNJA 1YUBA 5IEOA 3S27A 5EOOA 3TL4X 4PCZA 3C30A 4KG5A 1DJAA 1ONGA 1ERQA 2XLNA 3MZEA 2W3GA 4LY6A 1ZX2A 4QHSA 3AKZA 2KNAA 3J81S 1IYSA 1LSXA 1OTBA 5F6AA 3RTYA 3U6MA 4GKUA 1L2SA 1QZMA 2DAIA 1GL7A 3QNBA 3SS5A 2OAQ1 4KZ8A 1XMOM 1BRIA 3GO8A 1CI9A 1GMPA 2J3TD 3GLGB 4KLNA 4RKUF 2WSFF 4OK0A 3BECA 5HZHA 1OUNA 4JI2M 1JR3D 3FPVA 5DYIA 3O86A 2JQ5A 4IJGA 5EECA 5HWVA 1OACA 2C99A 3UMMA 3EGXC 2DVWB 3W8KA 3I04M 4DR6M 2J8XB 4U13A 4E3KA 2RSXA 2Y73A 3K9MC 1BUJA 3P01A 2XEPA 1NJGA 1HNXM 4NXNM 4YY3M 4WMCD 1GOYA 3Q81A 2XFTA 2W2CA 2YQZA 3CNXA 3DXOA 3OZHA 4IBIA 3MFDA 2ZQ7A 4B93A 1D0KA 5DKKA 3D3LA 3W2ZA 4DDSA 1LV7A 1JB5A 3NIAA 2DAGA 2C5RA 1EIJA 3FG1A 3KVWA 5TGNA 4GC5A 3VP0A 5GLDA 2XZFA 1FA3A 1KYIA 3M6AA 1ZO2A 1V9ZA 2BTFP 3HKPA 3CUEC 1Y4OA 3R4KA 2CUZA 1MWUA 2LVNC 4X1MA 1NO1A 3FKEA 3SAVA 1FUTA 4HJ3A 4GZBA 2XK1A 4Z1WA 3T1RA 4J8TA 3J7BA 3TRCA 4S2PA 5CGWA 1A90A 4WP5A 1KE4A 1LOVA 4KZ4A 2BMQB 1H8YA 1ZHHB 1TRQA 2J3WA 4RX2A 5DTKA 1G6AA 3I01M 1NNVA 5EXXA 5IU1A 1M6KA 4GSPA 3SMPA 4L4UA 3IBJA 1X0OA 4Z6YA 1E97A 1T1CA 5BIRA 3F9SA 5BVBA 3SS3A 1ACFA 4X55A 4WUJA 4M9SA 2LNHC 3K0ZA 5IG5A 3FYCA 3EWKA 3WRTA 1O7MB 1MGRA 2ZJ9A 3UB5P 4PKYG 5HARA 3HGIA 3BQ8A 4UAAA 3F8HA 4EBGA 2QPNA 1I2GA 2XSZA 5BU4A 3B3XA 4XB5A 5DFXA 4O3VA 1NRJA 1RRHA 2LB9A 3G31A 3F40A 3U5ZB 3SH7A 3C38A 3J27B 2F5QA 2F5PA 3MZDA 4OONA 1RCKA 4HESA 2YFQA 1OJGA 3KXEC 5HGRA 1VETB 5L8RF 2OWHA 2VGKA 3QAUA 1MJGM 2PYRA 1MWRA 4OX9M 1PYYA 1XFQA 3IS2B 3S7QA 1RN1A 2J5YA 3T4OA 3FGYA 3SVAA 2WUQA 4DMZA 2F5MA 3X42A 2QJ5A 4CIZA 4X6TA 1P9WA 2VX8A 4NXMM 4Y0UA 1OTDA 2H28A 3B7CA 4BL3A 4IVIA 1NB5I 4NK3A 1SQWA 4JF8A 2O9UX 3CC43 2BLSA 5FTLA 3NUVA 2W9PA 4R1KA 4G4NA 3VKHA 1C7YA 4I5QA 4B7FA 3MXSA 3VOYA 4XT2A 5GHXA 1JNQA 3N8BA 2WGIA 5A90A 3F7SA 1QAQA 2R4EA 3V99A 3B89A 2IYJA 5EE8A 2A24B 4PM6A 4JRFA 2Y55A 3LOYA 1L0GA 4JGRA 1J9MA 3DMCA 2W0QA 3E21A 3A76A 1QVF2 2CFOA 1S3SA 1U8CB 1S67L 1W63M 3GQZA 3Q1FA 4DV5M 3TG9A 4C6YA 2HMNB 4GS9A 3IXDA 2QZ4A 4IBBA 2R45A 2DWZB 1UWPX 2H1RA 2RNTA 2QJ7A 4IBXA 4QWOA 3Q82A 1V74A 2BMOB 4M9ZA 4E04A 2DAKA 2R4IA 3GR2A 4WYKA 1E3RA 4EBLA 1KVLA 4HOIA 3FYZA 1TS6A 3PS8A 1W8YA 3VP4A 3GRJA 3GRDA 5F1FA 3ALAA 1Z09A 4B7GA 1K8A4 1QDTA 2JA2A 4BJPA 2LB5A 5HX9A 4O0PA 5DVAA 5AI1A 3F1NB 1TUHA 4I4LA 3F1NA 3WHLA 4HL4A 1N5PA 1LNIA 3CWFA 1YGEA 3LIAA 2WGWB 2NUTC 1SXJC 2RGOA 1JB2A 3SZTA 5E2HA 3N7WA 3DY5A 4KQRA 4GMQA 1LSWA 5EVIB 3CCE3 3ZYTA 3P09A 3SARA 2GJ3A 1XX2A 3Q8XA 1EEJA 1VHMA 3KDSE 1PWGA 1NDOB 4R6LA 3MPHA 3A3JA 2YR0A 4ZJ1A 3BW6A 1TVFA 1OGZA 1KDWA 2GDNA 4LJ6A 4IBDA 3C9PA 1OTEA 3C3DA 4E6XA 1VQM3 2AADA 4FWDA 2K2NA 3HLEA 2K0MA 1VQO3 1R4CA 4X62M 2QEX3 4ORLA 4IBRA 3TQSA 1T19A 2Y0QA 1PYLA 4GC9A 2ACGA 5G4ZA 5TBMB 3S7OA 1UCKA 1PJTA 4KFFA 4QY6A 3WS1A 4EESA 1J5EM 2IWCA 3UE1A 4HEFA 3TE8A 2VJWA 2FE8A 3UNLA 1NNJA 1Y4KA 3OCLA 2Y21A 1TH4A 2JZ1A 2O9BA 2C4BA 1OJLA 3KSED 4JI0M 1TTEA 2QSFX 1G59A 1S723 1CJFA 2CWUA 3GRRA 2ZMFA 4R3BA 3AJIB 1YLZA 2K47A 4WYKB 2ZC4B 4LJ7A 1TTOA 3U6DA 2ZD8A 4RNTA 1P9RA 1K41A 3LT8A 3LVVA 2RGHA 5ELUA 2PBYA 3A3DA 1W8QA 2ZL1A 4N6OB 3G4S3 1BNSA 3VK7A 3CPTB 2C6WB 4XGIA 3F7XA 1IXRC 3CCS3 5DREA 1OMEA 3QP6A 4CQHA 2KF6A 3D5GA 2QCUA 3CI6A 5AIIA 2ZM8A 4I3JA 2WAEA 3NBJA 2A24A 1FSYA 2ZC3B 4K0WA 5FQ9A 1TGUA 2A2LA 3HJKA 4LZZA 2J8YA 3LYXA 2Y0TA 4IVKA 2P09A 1HZ1A 3G34A 2B5RA 1YHQ3 4R9KA 4ID4A 4EW5A 3HHXA 3VLFB 3RGPA 2XD1A 3MHEA 4LF7M 1FQGA 3E9SA 1D7EA 2WK0A 3ZDJA 3SATA 1LRAA 7GSPA 3I0YA 2Y2QA 1RGHA 4Q8IA 3Q90A 1PZPA 1PFPA 2JBFA 3KIIA 2OAP1 3NI9A 1V58A 4JXGA 4KZ5A 1JN5A 2CFLA 1W5SA 4R4RA 1PU4A 2P9VA 2Y8HA 2GQFA 5AQAA 4D80A 2O5RA 3L28A 3MQ0A 1X37A 1B2MA 4WBGA 1NWZA 3FKAA 1L2CA 2V1BA 1FSWA 4EIWA 4PDIA 3DBAA 2E8JA 3DTEA 1UM8A 2FZ0A 3IWOA 1DMNA 2OO9A 3KSJA 1STDA 5CF2A 2HGVA 3NOPC 2DZOB 3LTAA 5FAPA 4RNAA 1DMQA 4XBYA 4EU0A 3T50A 5CHJA 2A15A 2HJEA 4JV5M 3MBZA 4H8RA 3BNEA 1ES2A 4OU7A 4B3TM 2HHHM 3FG8A 3WS4A 2R18A 3PFIA 5FTKA 3S28A 2UUCM 1DV0A 1IDPA 2WKIA 1PZOA 4OP5A 2GNOA 3IPTA 2WO0A 4X68A 1WGNA 2QENA 3LW5F 5JPPA 1T18A 1RGZA 1LVNA 3QP4A 3VSKA 1RLSA 3D5IA 1EWZA 1BAOA 3NV0B 2P9VB 4MB7A 5IF6A 4UQIS 2OLUA 1AUAA 1I3IA 2DNAA 1CYUA 1AXBA 1ZG4A 1XP4A 3B7ZA 1OFHA 3MJQA 4OOLA 4QY5A 2STDA 5ITYA 4AI6A 1KFVA 1SIHA 3FUUA 1TDLA 2WKQA 3IF5A 1GSWA 2EXBA 1IV9A 3BOSA 2K3DA 5J7EA 1TD5A 3T1QB 3PXMA 3H82A 1BSGA 4Y13A 1Q7Y4 1NZOA 5AEUB 1HTZA 3EIEA 4J5GA 3AGOA 3VSLA 4HH3A 3NJAA 4FW9A 4DR2M 4JKTA 1V9YA 3AOGA 5MC7A 3GAXA 3STDA 1DGHA 3H7WB 5KP4A 2Y59A 3S67A 1MGWA 4X69A 3SOYA 1K56A 4OUQA 1RU3A 4LCBA 4HM8B 4XDWA 3CD63 3UMDA 4F3LB 2BHMA 1TDGA 1CYVA 4LRXC 2BJWA 1UI7A 3UB1A 2XLJA 4DR4M 2JUJA 4LPZA 3CF2A 2P74A 5F1GA 5EOEA 3DM8A 5AVFA 3OWUA 2H0GA 2EKKA 4AKHA 1PGYA 5EJCA 1XFNA 1HNWM 1YSYA 3JPUA 5EV0A 1JWPA 4FCJA 1IYQA 1I2SA 1VEGA 1W5TA 2ZC6B 4G6ZA 2P04A 3SBJA 2RGQA 1WMPA 2UWXA 3C7UA 2KZSA 3HBRA 1SXJD 4RF0A 2Y2MA 2AVXA 1ULIB 2CC3A 3CCM3 5EQTA 1ISKA 3Q7VB 2XRXB 1KVMA 4MCWA 2LTUA 2ZAMA 3TW8A 3DZDA 4Y28F 4ESPA 4X1LA 3UZUA 3B8LA 1STZA 2W1TA 1ZAEA 4AG5A 1XJ3A 4PM5A 3KYQA 2LHGA 3BNDA 3RE8A 2XSHB 4O7DA 1IQPA 1PY3A 4IPBA 2AAEA 5L09A 3RJUA 5EP2A 1T1BA 4XUXA 1DO2A 1VQP3 5IT9S 1PJSA 4X53A 2K9DA 2JZ0A 4YOFA 2RBIA 3MK6A 5FATA 3ULFA 1X1YA 4BLCA 2C10A 3NBRA 1FIKA 2J9PA 3ZG7B 1PW1A 3KO6A 4O02B 3EB8A 4LRSA 3T4QA 4C75A 1Y8GA 1JB0F 2Y20A 3FUWA 2I72A 2VV8A 1Z5CA 3EQQB 4LLOB 3T38A 3IMAB 2OOLA 1YNVX 4BD1A 4LCMA 1YSPA 4JGPA 4N1XA 4L0LA 3L25A 3LEZA 4I39A 3UDXA 3LUQA 4EW7A 1ZMWA 4KG2A 5F3WA 1GSXA 4N6LA 1XGIA 1KDSA 4LV2A 1HYFA 4HP9A 5E2EA 3AGNA 4GITA 1VB6A 2UV0E 2QP9X 3WRZA 2DMWA 4A5RA 2B3TA 2UGIA 4RF1A 3KP1E 3MXQA 2HCBA 2ZTCA 2Z6CA 2OOBA 3LVWA 3SHGB 3TWKA 4KZ3A 1PI5A 2R46A 4BIRA 3U61A 4JI5M 9RNTA 1DJBA 3LY3A 5EVIC 1IBLM 3NM7A 1P97A 3IX3A 1K3XA 4AKIA 1D2NA 1XXHB 2JY6B 5KP3A 1F98A 3LH4A 2L4EA 3HCYA 2Q9MA 2VQFM 4WMCA 2B24B 1S1YA 4JXVA 1FCMA 3S4XA 1PFLA 2KF5A 1OPXA 4WEKA 1GA9A 1GL6A 3X3YA 3M6BA 4GH9A 4MMXB 1K54A 1LXEA 3CF0A 2P7JA 2YFIB 3C8CA 3OV4A 2Y2JA 1NJ4A 3S7PA 2OQEA 1CK3A 1SPUA 1HT1E 3CPOA 1ORYB 1SXJA 3QYBA 3DGNA 5KO3A 4UA6A 1OTAA 4MN6A 3UO9A 3U60B 2J80A 4WURA 3UGJA 2MR9A 3V67A 3MG1A 2R62A 1RCJA 1VEKA 1EUIC 2F5OA 1GMRA 1RP5A 3FKVA 3Q7ZA 1K9M4 1SG9A 2QHOB 1L5GB 2FGTA 3PTEA 3AOEC 3PGBA 4CHTB 3AHSA 3OXAA 3MKEA 2C96A 2OTL3 4Q7JA 3L7HA 3PR6A 1HQYE 4DR7M 4FH4A 2W56A 4FOFA 4XBOA 4YFMA 3GLHB 3K5TA 2KRUA 4N6V0 2CG0A 2DHRA 3BJNA 1YJN3 2FS1A 3JUMA 4MEZA 1H0MA 1LL9A 2UX0A 3GPXA 5DFYA 4ARZA 4E6WA 1VDLA 1WGLA 4FWGA 3GRYA 1LLBA 3HJIA 1CEFA 2CW9A 2IUJA 4GB7A 4NXEA 1XJ2A 1IELA 1W01A 4HM0B 1AV4A 2CH9A 4QPRA 2ZOIA 3O88A 3KS8A 1MWSA 3EX9A 1I4WA 1FILA 1LL5A 3T4KA 1PJIA 1LQGC 1W7CA 1E94E 2OOAA 2X8AA 3BWLA 1GKIA 1G5UA 1NYMA 4DR3M 2OOVC 3WR2A 2H0TA 2O01F 3PBRA 2W6JH 3D3OA 3PCRA 3DZLA 2P08A 4HKVB 1NHGC 3KE7A 4MGYE 3IX8A 4UA7A 1JV2B 1KGGA 4XDVA 1TR8A 1IBKM 4BU4A 2L09A 3ZFZA 3BNCA 5ITQA 3BFGA 4Y7PA 4JI8M 4D60A 3GLIB 1EFUB 1TFOA 1Q39A 4LGWA 1GHMA 4MN7A 3FSDA 4L8PA 2ZL8A 1EW0A 4MH0E 4XK8F 3EEHA 1QANA 4NL4H 3RH8B 4PT5A 4DV0M 3N54B 2QIYA 4GN2A 2Z3XA 1GMQA 3JYIA 4Y15A 4KUOA 4BL2A 3HLFA 2EWVA 3NBBA 1ES3A 3SH9A 4O8GA 5EP3A 5FAOA 2WKEA 1OHSA 3EGDC 2LWXA 3GLHA 1YLTA 2HZ5A 2Y74A 1XWIA 1I8VA 1JR3A 4QOSA 3CPW2 4HM4B 1BULA 2CE7A 2JWSA 4JI6M 2V8CA 2WGVA 4E3NA 5KSHA 4I5SA 2BMRB 1JBTA 2VV6A 1T43A 1JZDA 5GLBA 1GVNA 1NY5A 1JWVA 3WS0A 1BRKA 1IY2A 1D0LA 1BNEA 3AGDA 5L8MA 4KZ6A 4PMAA 3RFWA 5FW5A 3A42A 2F4YA 3LR5A 4BWIA 2ZAOA 4DV4M 1WE4A 3DTIA 3GLGA 4WZ5A 4CLCE 4WELA 1WIVA 1F8NA 3BBZA 3GLFB 4CISA 4IUKA 3GPPA 1QZEA 5GHYA 2WOHA 5RNTA 5HFOA 1FUWA 3UNWA 3R7WA 4I8OA 3ZVWA 1BIRA 3B7NA 4HNBA 4AKYA 3N4IA 5M19A 3T15A 4UHUA 1YJW3 1YE9A 3TWLA 3BLSA 3S1YA 4QNMA 4PDGA 1H8ZA 1S1ZA 3EEAA 3P7NA 4KT0F 4KZ9A 4DJ3A 1E3UA 4L9EA 3LMLA 2L2DA 1VQQA 1Z1SA 3ZHHA 1AVLA 2VF8A 4NRVA 1YSQA 4OVDA 4B9OA 1DGFA 1JVJA 4GEWA 2D02A 2KOIA 1T3TA 3IH8A 1YPRA 3KYZA 4UQIM 5U47A 1ROAA 2CFWA 4OVZA 2XDMA 1DO0A 4JF4A 3PNYA 3UPNA 5EFWA 2P05A 3CMA3 1K4FA 4JI1M 5JBSA 1ULJB 1MKIA 4GOGA 4PM9A 3VE4A 3FYDA 1JQJC 1ERMA 4NSOB 3LIBA 4N9KA 1PW8A 3FUTA 2LBCA 5DKLA 3F92A 3U4LP 3KS4A 4FMCA 3K3DA 4X25A 3PXPA 3OBFA 3FZCA 2HP9A 4HQAA 3MWZA 5D3OA 2BO9B 3A0VA 1UCLA 3KCHA 1HR0M 2Z6DA 2F99A 1Z5AA 5M18A 4QU3A 1W02A 3VFDA 3TSGA 5STDA 5GKNA 3QHYA 4CLCD 1SCWA 2QNJA 1DE3A 1HU9A 2C11A 3RDEA 3IT9A 3WWXA 4KFEA 1VQN3 2XSZD 4L9GA 3MQQA 4Y17A 2Z2LB 1D1JA 1LT0A 1UFZA 1UGIA 1NNUC 4WHAA 1BNIA 5TBMA 4ETZA 4E3IA 4MDZA 5ITRA 1CEWI 1XC8A 1KOUA 1ROVA 5CECA 2EFUA 1LNHA 2VGJA 3HX8A 1I2FA 3UY6A 2P0XA 1SDEA 3O5YA 1S4SA 4NSRA 5AEWB 2ZTDA 2APLA 3FG3A 2GZAA 3BYDA 3GVBA 5FI6A 1AIPC 3LI8A 3QNCA 1T2HA 3KSIA 1HQCA 3NWLA 5J3WA 1ZMUA 1OF5B 1OGXA 3KSHA 3LO7A 5F68A 4WZ4A 5CX7A 3HJQA 5G4YA 5HPIA 2UU9M 1OIPA 5FQJA 3L0RA 1PI4A 1JR3E 3SYKA 5IG3A 4WF0A 5E43A 1GABA 2D42A 1FW7A 3B33A 2R41A 1JKGA 3U6OA 1NWWA 1O7PB 1K28A 3ER7A 1N9BA 2W9QA 1RGKA 5HD3A 2R4JA 2PU4A 3KSFA 3NECA 2J7OA 2IY2A 1TDHA 2VA0A 3S7NA 3LTDA 3GLIE 4XBXA 3T4LA 2EX2A 1LQMB 4KZAA 2E5LM 5FQKA 1O7HB 1FGQA 2VGLS 2XRNA 4E3MA 5ITXA 2UXCM 3IECA 2Y2HA 3U60A 3LGOA 4FMDA 3D8BA 3TJZC 5KQDA 1QVRA 1P3QQ 3IX4A 1G68A 1OT9A 1K57A 4AZFA 3BEBA 1FNNA 4FCTA 4WP2A 5LC7A 1D06A 1YLAA 4I3IA 1YQSA 3ZQJA 1CH0A 5JI2E 4X56A 4KG6A 1RMSA 2R9XA 3C7VA 3GV9A 1Z5BA 3E0YA 2RL3A 3GECA 2ZC5B 3MS6A 2ERCA 4K0KM 4R9LA 4QWTA 2V1ZA 3GRUA 4EETB 4KT3B 1XGJA 3CCL3 5AQBA 1MOLA 4DV1M 3E4RA 5JI3E 2PR5A 1C1KA 1U60A 1TEMA 3LI9A 2R0IA 2VDBB 1YKDA 4XXRA 3UMEA 3G35A 2JN7A 2Y2GA 1XXHE 1Y54A 2F4VM 2GNXA 3MF0A 3VV4A 1LI9A 1XKZA 4KQDA 1S5AA 1BZAA 1IN6A 2BASA 1QVG2 2OLVA 1KSIA 2E2TA 3DGMA 3ROBA 2ZBBA 4WLAA 1ZGXA 4EXOA 2M7VA 3FF0A 4KVHA 1Q2QA 4LENA 2X01A 2GBWB 2F86B 2MF7A 1HD8A 5KPRA 1JBRA 4ME4A 2V20A 4Z9QA 1D6ZA 1RNTA 1BLSA 1RGYA 1EROA 3T4TA 1EA2A 1RGEA 3ICYA 3EIHA 4LGQA 1NV9A 5IERA 4PHTA 3WOFB 3MHVC 3LTBA 1VQK3 1W2B2 4JI7M 3GWRA 4CLCA 2M7OA 1UI8A 4DKIA 1T3BA 4GHAA 1BRHA 1UW1A 1W7FA 4D82A 1DVCA 2ZA4A 1BGSA 4DV6M 3K9PA 1WNHA 3W4OA 1O7GB 3SASA 4G3KA 5CEBA 3GRVA 3SLUA 1QAMA 1G3IA 4IBJA 2BU4A 2H0HA 1YJ93 2JXNA 5IG4A 4ITQA 5GL9A 2I7PA 2XROA 1R6BX 2R6FA 1DVDA 1JWZA 1Q2PA 1XMQM 3MFXA 2WGQA 3LT9A 3K1JA 3FKWA 4LF6M 1R7RA 3FUVA 3K2LA 2Z7AA 1LHYA 3KSGA 3AFHA 1VQ83 3WHOA 2XGLA 1PM5A 2VGLM 2ZM0A 2F5WA 5DRVA 4O8SA 4RBNA 1GS3A 3IS2A 3O3VA 2HKJA 4GDBA 3K7CA 4N6MA 4PPRA 4DDYA 4DXCA 4REZA 5D83A 4HH2A 5FGOA 4DR5M 3PBQA 4WWUC 1VETA 1V57A 1ONHA 3T1HM 3SAWA 1Q7HA 1IYYA 3O87A 2IUKA 4OPYA 4L7KA 3CCR3 3AGEA 1T1AA 4QOZC 3UB8A 3MJ5A 1BRSA 1N8QA 2BNGA 1FOFA 3LIEA 1K82A 3NULA 2LVPC 3ZCBB 3IWIA 3S29A 2LYXA 4BB9A 4MGZE 3OLOA 3MMPA 4ZAMA 4AW4A 2FH0A 1PWDA 3G713 3BY8A 5CLKA 1PWCA 4B3SM 4IUHA 3VSYA 5ITTA 1CQAA 3SFZA 1VQL3 2DWLA 5IENA 2ZOHA 3NDGA 3ITBA 1PNEA 1N5HA 4RQ9A 4M3KA 2E8IA 5CXWA 3U6QA 1IXZA 3TPZA 3IHBA 4QD4A 1W6GA 4BBAA 1PRQA 4UN2B 2V0WA 4ZPXA 1UUWB 2XZUA 3THGA 1TDZA 3KSXA 1IVUA 4Q53A 3MG3A 4AFIA 2G3QA 2I7NA 2HWJA 1A0KA 3ZNYA 1A5TA 2IWBA 4HM2B 1EG9B 1N77A 3H7WA 1N4OA 1I70A 2KDLA 2M7UA 1J09A 4LV1A 4GCZA 2JY5A 1YIJ3 1VQ43 4OQ0A 3UE6A 5EM1A 1IQYA 1QMAA 4GL6A 3EN1B 5F82A 3PBOA 1M1XB 5BR8M 4FCZA 2WAFA 5FDSA 1O07A 1FCNA 3KSPA 2ZM2A 1H6UA 3G6E3 1QJGA 3SX1A 4IBGA 2EA9A 4FVMA 1GHIA 4Y0OA 1LOWA 1TF1A 2M1CA 1L0DA 1QUSA 4OVZB 4MBFA 1J7KA 2FXTA 3A98B 4ZTKA 3GMWA 1X1WA 3RGAA 3VF1A 3HHZA 3I563 3W67A 2INXA 2KNZA 1XB2B 1L2BA 1D6YA 2RCDA 3CU3A 1N8R4 3CLOA 4OPQA 2E2UA 2WKHA 1RGAA 3T1YM 3UPOA 4P6BA 1VG5A 3V76A 1BU4A 2XFSA 1BNFA 4R3AA 1R2YA 2CHCA 2GX5A 4RA7A 2K0BX 2VQEM 2KLIA 3FD9A 1K3WA 3H51A 3E46A 1UDII 3BNBA 4N6NB 3CF6E 3VFFA 1IXSA 4P6ZM 3FF2A 3HHWA 3VOLA 2CFDA 5G2GA 4B3MM 5A0OB 2CHVA 4DR1M 1C54A 4MLLA 3MKFA 4LV0A 1E3VA 3T12B 2PRFA 1ZQ9A 2O3OA 3NQZA 3DAVA 2BWBA 2EFXA 3K63A 2XSSA 4EV4A 2F56A 2C5WB 2V8FA 4KHPM 2XA7S 1ZV1A 1T5YA 3JVUA 2WSEF 3OC2A 3HLBA 1TS8A 3DTMA 6RNTA 4M0WA 1MNLA 1MBLA 3MSHA 4HBRA 3MR0A 3OPLA 1K6SA 3SMSA 4OH0A 4OLGA 4MBKA 1Q02A 4Y0TA 4HJ6A 7CATA 5ITUA 4NXFA 2DHYA 4L6V6 3LQQA 5GSPA 5A93A 1J2BA 2FH5A 4G1MB 4MMZB 3CZDA 3SW1A 4EQ1A 5HOHA 1B2ZA 4I4KA 1W79A 3VE3A 1UGUA 1E32A 5DFLA 3ZC7B 3HLCA 2GU1A 2R65A 4ZRRA 1KC84 2PD8A 4JF5A 3Q2PA 3SYLA 4S2NC 1J3WA 4RX3A 3S22A 1MX0A 2P38A 3G8ZA 1WYCA 2W3EA 3CJMA 2DRWA 5IG0A 3SC3A 5EXSA 3GLIA 4K1VA 5AQ7A 1FZUA 4HIAA 1RN4A 3WHKA 2FNQA 2OSUA 1EE8A 3JR5A 3PZWA 3SYUA 5KSCA 1SZVA 1N9JA 4PEJA 1IT8A 1JTGA 3FZWA 3CAXA 3F8XA 1AY7A 3NBIA 3PBSA 1TH3A 3IHPA 2MJ6A 2ZDJA 1NJI4 3UJNA 2PBDP 1ESIA 2G2UA 2VF7A 4Q0HA 2HAKA 3HX3A 4RVAA 4WN5A 5IW9A 1ZS7A 2CC1A 2WADA 3JR4A 3MG2A 4R4KA 4L9FA 1WJ7A 3LR3A 1VQ93 1GY6A 5F5YA 5TGFA 5FL3A 2HDSA 3BFCA 3LXUX 4WM9A 1WHCA 3NM2A 1IY0A 2L6OA 2OTJ3 3HHYA 4IT7A 1IQ8A 1RDSA 4DV7M 2WYXA 3NHXA 5FDHA 3A5EA 1TJDA 3E4QA 1YMXA 4LJAA 1M9GA 5TR7A 4HP4A 3A3FA 1LOYA 3ZG8B 4QNRA 4ARZB 5L07A 2XA7M 4J9AA 2RRUA 3NDEA 4MEIA 1G41A 1IBMM 2B1XB 2W56B 4E3JA 3C3EA 5FI7A 2HP6A 2MJ5B 4Y5FA 3W0FA 1ESUA 3VOZA 2L0WA 2D7EA 1RCLA 2KRTA 1DJCA 1ZC2A 2R9WA 3B42A 4KO8A 3JUPA 1Q814 3ZGAB 4E3OA 5ITXE 1NY0A 1NLZA 1Y28A 3H82B 4KZBA 1EKMA 4LRYC 1FR6A 2EWWA 2WGWA 3A0SA 2CWBA 3DOAA 1LI0A 5FASA 3M6HA 2CX0A 4EV2A 5E2GA 3IF6B 1OT6A 1I5QA 1E9RA 2OCTA 2L4FA 4G3OA 3QP1A 5BOHA 1B2XA 3T1SA 2O9CA 3HU1A 2UXDM 4LJ5A 4DV2M 3NHQA 3ILKA 4C3QA 1G4AE 5G1KA 2J9OA 1KE0A 4EUZA 5AQ9A 1YI23 4IBKA 2J7VA 2DZNB 4K1UA 1GA0A 3PCSA 2X4AA 2JY7A 2JKFA 3BFFA 5J4EA 3DGLA 2X49A 1RN7A 4DE3A 3MMHA 2Z7JA 2W04A 4M4XA 5DJUA 2QA43 3CGWA 3JVCA 2KX6A 2O0YA 4GD8A 2M60A 3VKGA 1IN8A 1G6OA 1ZG6A 1BSCA 2Z77A 1L0EA 1S4RA 2Z2MB 4JBFA 4QHCA 2YKFA 3ZNTA 1VQ1A 2F5SA 4FWHA 1IT7A 1Q42A 4IIAA 4FCVA 1RGGA 4K90B 2ZANA 4JF6A 1IK3A 4HHDA 4NXGA 5GLCA 3C5AA 1FGRA 1BSEA 3LTCA 1NZUA 3T0UA 1FGMA 1B3SA 4H6JA 2X71A
chains in the Genus database with same CATH topology
1IVWA 3TWMA 3U6PA 1L1ZA 5EUAA 4MM3B 3M0EA 2AHMA 3FV7A 5DTTA 5LMUM 1YVBI 5FAQA 3GSGA 5EVLA 4CDLA 1OH0A 1OHPA 2HDRA 2Z4RA 4HM7B 2BJVA 3SHFA 4GRIA 4MGIE 4S12A 5IHVA 3IF6C 3KP0E 2E2VA 1EI5A 2DCFA 1NO3A 5E2FA 3CC23 3UPPA 3CNMA 3U1WA 3IXBA 4HYZA 4XBTA 3DFZA 1OFIA 3L2AA 1KE3A 4S2OA 1WMOA 3CC73 2A5YB 4M9XA 2CIUA 1BLHA 2V1UA 4R23A 5CGSA 3U6SA 4LJ8A 3EC9A 5CXOA 1BT5A 1KGEA 3FH1A 4CPKA 2A49A 4EBPA 3GP1A 5KMWA 4KZ1A 3A46A 3ISGA 3Q07A 1IEMA 1GY5A 2JC7A 4HM3B 2ZQ9A 2ZBKB 5HAQA 5KPZA 1AR0A 3TDGA 1GD4A 1HVBA 4GIPA 1XNRM 1JB4A 1E4DA 1PIOA 1FJGM 2Y2IA 3PVSA 4OLDA 4R7GA 4OP8A 4P85A 5FTJA 1YLYA 4IBCA 1XXMA 2Y91A 4MGKE 2QBYB 2MC8A 3IJEB 3L27A 3RXWA 3SOAA 1IM2A 3H3HA 1KD14 3J80S 5EVID 5A2QS 1GD3A 5FQMA 5C1BA 1IN5A 5BXQA 4U3TA 3VP2A 4QJGA 2D7GA 4LF5M 1GY7A 1NJFA 4LG2A 3IG5A 1JKGB 3VMAA 3V39A 3IH9A 2EO2A 3K92A 1NU3A 1BUQA 3SEDA 2IMJA 3LY4A 4LCLA 1IN4A 4S2JA 1TP6A 5KQ8A 3B4OA 2EXAA 3C58A 3CCQ3 5DF7A 3HUMA 5IWAM 4DXBA 4OOYA 1MU5A 1SKFA 5EXTA 1N34M 3K8ZA 5CHMA 3M2JA 4MGHA 4NOOB 1D6UA 1L2DA 2XGNA 3R9XB 4NREA 3LCEA 3P98A 4ZBEA 1TU5A 1QMFA 1WTHA 3AL0C 2Y4AA 1Z6FA 2CV2A 3OTOM 1MWTA 3DUKA 2ZQ8A 4CJNA 1YIT3 2FNAA 1YLPA 4FCWA 1W6YA 3Q1CA 2KCDA 2F98A 4NHFA 2V2FF 3N8RA 3CCJ3 2Q2EB 4H61A 4BLMA 3I4VA 5HL1A 4GKJM 1W2ZA 3MSOA 4HVNA 4LFCM 3I51A 2C9CA 3JAMS 1K25A 5F83A 2L7IA 3HWSA 4JPMA 3L26A 4LGMA 3W4PA 3CMZA 4LRTA 2ZM6M 1QAFA 3EQVA 4BD0A 2Q9NA 3HZPA 2HMJB 5I94A 2GEYA 3J7AS 4LMIA 1K6RA 3FUXA 3SH8A 4GKKM 3OX9A 3HU3A 5DF9A 1NHWC 1YLWA 2BT3A 1S6RA 2I9WA 3X3XA 5CEDA 3T8NA 1KGFA 1HNZM 3KFUG 1WYBA 8CHOA 1XA1A 4S2NA 2GXFA 2CEAA 1A67A 5L2FA 3HREA 4ZJ2A 3UE3A 3RXXA 3E2KA 1DGBA 1KQS2 1K55A 1OHOA 4W5WA 3MZFA 5CRFA 2KA6B 3NV0A 4EV5A 5HW3A 2X02A 4GD6A 4HM6B 3MKIA 2UUAM 4RZMA 3VDUA 4G4OA 2V1CA 1IXSB 1IN7A 2ML5A 1M1K4 1Q864 1HKXA 2UXBM 3G16A 1OCVA 4X65M 1XHBA 3FTDA 4JI4M 2H5SA 3HLDA 4KQQA 3S5CA 3GLFA 3WMDA 6STDA 3IQAA 4FD2A 2D1WA 3HLGA 3AMOA 3CXC2 4JXJA 5CTMA 3A45A 3EJVA 3CME3 3M7GA 3OWSA 4PM7A 1W5ZA 3EHCA 5EVIA 2PU2A 1VM1A 4N92A 3WA3A 3HIIA 1L1TA 3AGFA 3V5MA 1Z6TA 1LOXA 1O7EA 2ZQAA 1IV7A 1W6CA 2CHGA 1ZKJA 4U0XA 1DYUA 3UDFA 1G96A 3W4QA 1JRQA 3BLMA 1JTDA 4X2OA 3NQYA 4II7A 4DE1A 4FR9A 4OQHA 5FTMA 4G4QA 1Q824 1CEGA 2BNKA 1NYYA 3BFDA 2ZC7A 2XSOB 4HZBB 3G2YA 2YX9A 3HL9A 4HM5B 5FI2A 2BG1A 4B4XA 5C18A 2CFGA 4FMAA 3HIGA 3ZG9B 4WFOA 2GBXB 1SXJE 4IJEA 1I94M 3F14A 1QAOA 2IWDA 3EBYA 1K54C 2Y2KA 4GB5A 2HP5A 1DGGA 5EPHA 1A2VA 3UL6A 1ALQA 2ZQDA 2A3UA 1VQ63 4L78A 3V98A 4EC6A 1I2WA 5KPTA 1K4EA 1R2ZA 4FD8A 1N78A 3RGRA 3N8SA 5E26A 4JXSA 4BENA 1UUVB 3DGOA 3GZYB 4N6TA 1MXOA 3VP3A 1W5DA 3HK4A 3IXHA 3NCKA 1ES5A 3NXJA 4AQYM 1TFKA 3GTCA 1IVVA 2FFYA 2EUCA 3HLWA 1O7WB 3PYJA 3G4PA 2RFRA 3KN4A 2CKFB 4R0QA 1XNQM 4OPZA 3X40A 2DWMA 3BFEA 3CCU3 2KXGA 4X64M 3EN8A 4EWFA 5H37D 2EX9A 4RNZA 4NETA 4WW0A 2FFJA 4OVMA 5CERA 5IEPA 3WS2A 2W03A 4JLFA 2YFJB 1XA7A 1CI8A 1YMSA 1S0WA 1WXQA 2ZMAA 1FCOA 2F5NA 2Z4SA 4WEJA 4O2HA 3OPPA 1US1A 2G5GX 3JUOA 3PXGA 3GQ4A 1KWIA 5G18A 3QK9A 3N9HA 3LMMA 2Z6BA 3ZVTA 5CHUA 3WOEB 2CWTA 2Y2OA 2OPFA 2RKOA 1XXHA 4ZDXA 2K54A 5TFQA 3PNVA 1HT2E 2HMLB 1N36M 3G30A 3U61B 1QQWA 4QHTA 1VZZA 4IEDA 5JPUA 3CG5A 4LZIA 4KZ7A 4IIWA 3EBTA 3GPUA 3VK8A 3FTFA 3FLJA 3IXGA 4HBUA 3C4OA 2HL7A 3OCNA 5EQLA 3FG4A 2FOIC 3UK6A 3GZBA 2UUBM 5FSWA 3SS4A 2EX6A 3NBLA 4GDNA 3KW6A 2C98A 5CTNA 4D2OA 4BTWA 2PZVA 3B9PA 2GEXA 2KZUA 3IG8A 3PAGA 1JN5B 3X3ZA 4B3RM 2JCHA 3HUNA 3U6EA 1W00A 4E3LA 5HAPA 4L15A 2Z76A 2JE5A 3HUOA 3PAEA 4OKPA 2CWVA 1SIIA 5E6JA 3V3RA 4R4SA 4U0TA 4LGYA 3DA1A 4DE2A 4KQOA 1U5OA 2KXEA 5KP1A 3W0LB 1JJ22 4H3UA 4R1GA 3KOWE 3MXRA 3CTWB 4AG6A 3WS5A 1NSFA 2CHQA 4X66M 1K56D 2PNCA 3IWQA 2H0YA 4L8RC 4N6UA 4JXWA 1QYRA 1SDNA 3UDIA 4B4ZA 3FTEA 2NQ8C 3FCSB 2M5ZA 4S2LA 3TE6A 3NX0A 2L4VA 1C3BA 1IQXA 1DY6A 3KOZE 1OPYA 2G8LA 3A3IA 4GHLA 3MYTA 3C4PA 3KFQC 5CK6A 5CF1A 2XF3A 1C7HA 4R3JA 4EBNA 2LH0A 3KOXE 4N1HA 4BTXA 3U6LA 4CCVA 1L0FA 3BB9A 3VP1A 2XR8B 2KEBA 3H4MA 1OF5A 5GLAA 5EXPA 4FH2A 1N75A 4LV3A 1K38A 1BUEA 2ML6A 2OOVA 4LF8M 1Q40B 3IHAA 4PM8A 2CV0A 4RYEA 5JYOA 3RGSA 2G2WA 5EVHA 4K0XA 1TH2A 3GZRA 4HZ9B 1NB3I 2HPBA 3J2PB 3T8UA 4XM4A 1BTLA 4JN6A 3D9RA 1DGHB 2OV5A 3N8LA 1W4NA 3CCV3 5HAIA 4TUWA 2EX8A 2ZQCA 2LQVA 1IKGA 3UJMA 4KODA 2IA7A 1YM1A 5D82A 1N32M 3WDGB 5A91A 1RJOA 1VDDA 2ZLYA 3ECFA 4A3VB 4HM1B 1HZOA 1BLCA 3ZG5A 3BLZA 5LMNM 3FTCA 4OOMA 1NY6A 1ES4A 4HLQA 1K55C 4AKZA 1M40A 2WZXA 4I81A 4B7HA 2P5TA 2XH9A 4P87A 4M0DA 2QBYA 2Y2PA 2V6ZM 1EQKA 3N6IA 2Y2LA 1QMEA 4K61A 2KRKA 1K57C 2W82A 1NRFA 1FR1A 2Y2NA 3AV0A 3DWZA 2QGUA 2L7HA 3LZAA 1Q3BA 5ELJA 1K734 3JUNA 2DXIA 1GHPA 4NRWA 4ZM8A 5M1AA 5DTSA 4XUZA 1CQSA 4LJ4A 2WOFA 4LZJA 3KZTA 2QMIA 3OPRA 4S2MA 4B88A 4OQIA 3AOEA 1L8QA 5D81A 4CGYB 3BM6A 1G8PA 4GNUA 5FSRA 4BTYA 3BRMA 4IJFA 3U97A 1GCEA 4YINA 1E25A 3PBNA 2CK3H 5DF8A 5DYGA 3A3EA 3ZCZA 3DWKA 3D8LA 2VIIA 1VQ73 4DE0A 5GHZA 3HJ8A 5IZ7D 1SHVA 3GZXB 3I7JA 5AIFA 4LFBM 3J7Yd 3R8FA 5AYSC 2KW0A 4K91A 1Q3CA 2LXEA 2CG1A 2DWNA 1YLJA 5FQQA 3U5ZA 3V92A 4QB8A 3L29A 4FMBA 4LFAM 1WQLB 2H10A 2EA0A 1DMMA 4TX4A 2FFFB 5A92A 2Q07A 3OW22 2JDIH 5FQIA 4ZJ3A 3ZG0A 3SAUA 4OW0A 3U6CA 1GYBA 4LJ9A 7STDA 4JI3M 4UA9A 1IYOA 3EF8A 3FWLA 1NXYA 3HU2A 1A2KA 4LEHA 5AIHA 2XD5A 1Z59A 2XR0A 4FSFA 1QAKA 4DF6A 4P0MA 4BQMA 3HVFA 4Z8XA 2D7HA 4OQGA 1WMNA 4S2IA 4HBTA 3EQUA 3OPHA 4KFDA 2XQZA 4DV3M 4MJDA 2HMKB 4DUYM 4MMYB 4LF9M 2YFLB 1BLPA 1STFI 3I4YA 3LYGA 4RNYA 3UE0A 2HMOB 2RCXA 3E99A 1IVXA 3QRDA 1O7NB 3LQRA 3X41A 2QPAA 4N9LA 2HMMB 5LC6A 3ZH9B 3M2KA 3GQ5A 1AVKA 1E9SA 4B08A 1KSFX 3EE1A 4L8OA 4R80A 5BPVA 4WZ5C 5J8XA 4MBHA 4WYYA 4PD2A 1MY8A 4F94A 3HI7A 1YT4A 3SOIA 4EYCA 3AMOB 3IF6A 4STDA 1IYPA 1N33M 1VQ53 2HDQA 3VDPA 4HJLB 3ITAA 8CATA 3NC8A 2HDUA 2OQEC 1TIJA 1ASKA 1FGTA 2J7NA 3QWLA 1FGOA 4D81A 5FA7A 4DRTA 4LF4M 4EQIA 4G4RA 3V50A 3WODG 4MNRA 5KZHA 4KENB 3UN7A 1IY1A 3KKGA 2GU3A 1SXJB 5EP4A 4IBFA 2OQ4A 3V3SA 1RRLA 4R3DA 3GPYA 2QZ6A 1N9EA 3M8CA 4N3VA 1E3UD 5CGXA 3G32A 1GLNA 2SBLA 1IU7A 4X2HA 4YHHM 4LSOA 3SXXA 3OWYA 3B4PA 3UL5A 3E2LA 1IKIA 2V1LA 1SJWA 1MPLA 4JYAM 3NY4A 3G2ZA 2CV1A 2WGOA 2DNSA 5FLXS 5JYPA 3VFHA 3O8YA 4P16A 3D4FA 4OPRA 4EXRA 3I553 5IREB 5I97A 2P0MA 3TOIA 2C9OA 4FCMA 2OWPA 4IBEA 3WA2X 1M904 5FTNA 4DUZM 1XPBA 3PBTA 3G0KA 1NVMA 1Q40A 5AIGA 4L16A 2YNMD 3VGNA 1H5XA 5EEOA 3DW0A 3KOYE 1PJJA 1QALA 3Q7VA 3JUQA 4AEQA 5DNYA 5EP1A 3GQ3A 4FCFA 5AYRB 2CFKA 1RKYA 4AKGA 2WZZA 3HJSA 4S2KA 1YUBA 5IEOA 3S27A 5EOOA 3TL4X 4PCZA 4KG5A 1DJAA 1ERQA 2XLNA 3MZEA 4LY6A 1ZX2A 4QHSA 3AKZA 3J81S 1IYSA 3U6MA 4GKUA 1L2SA 1QZMA 3SS5A 1GL7A 3QNBA 4KZ8A 1XMOM 3GO8A 1CI9A 3GLGB 4KLNA 4OK0A 3BECA 1OUNA 4JI2M 1JR3D 5DYIA 3O86A 2JQ5A 5EECA 1OACA 2C99A 3UMMA 2DVWB 3W8KA 4DR6M 4U13A 4E3KA 2RSXA 2Y73A 3K9MC 2XEPA 1NJGA 1HNXM 4NXNM 4YY3M 4WMCD 3Q81A 2XFTA 2W2CA 2YQZA 3CNXA 3DXOA 3OZHA 4IBIA 3MFDA 2ZQ7A 3D3LA 4DDSA 1LV7A 1JB5A 3NIAA 2C5RA 3FG1A 3KVWA 5TGNA 4GC5A 3VP0A 5GLDA 2XZFA 1FA3A 1KYIA 3M6AA 1ZO2A 3HKPA 2CUZA 1MWUA 3FKEA 3SAVA 4GZBA 2XK1A 4J8TA 3J7BA 4S2PA 5CGWA 1A90A 4WP5A 1KE4A 4KZ4A 2BMQB 1H8YA 4RX2A 5DTKA 1G6AA 5EXXA 1M6KA 3SMPA 4L4UA 4Z6YA 1E97A 3F9SA 5BVBA 3SS3A 4X55A 4M9SA 2LNHC 3K0ZA 5IG5A 3FYCA 3WRTA 1O7MB 2ZJ9A 5HARA 3HGIA 4UAAA 3F8HA 4EBGA 2QPNA 2XSZA 3B3XA 4XB5A 4O3VA 1RRHA 3G31A 3F40A 3U5ZB 3SH7A 4OONA 3J27B 2F5QA 2F5PA 3MZDA 4HESA 2YFQA 3KXEC 5HGRA 2VGKA 3QAUA 1MWRA 4OX9M 1PYYA 3FGYA 3SVAA 2WUQA 3X42A 4X6TA 4NXMM 4Y0UA 3B7CA 4BL3A 4IVIA 1NB5I 4NK3A 1SQWA 4JF8A 2O9UX 3CC43 2BLSA 5FTLA 3NUVA 2W9PA 4R1KA 4G4NA 3VKHA 4B7FA 3MXSA 3VOYA 5GHXA 1JNQA 3N8BA 2WGIA 5A90A 3F7SA 1QAQA 2R4EA 3V99A 5EE8A 4PM6A 4JRFA 2Y55A 3LOYA 1L0GA 1J9MA 3DMCA 2W0QA 3A76A 1QVF2 2CFOA 1S3SA 1U8CB 3GQZA 3Q1FA 4DV5M 3TG9A 4C6YA 2HMNB 3IXDA 2QZ4A 4IBBA 2R45A 2DWZB 2H1RA 4IBXA 3Q82A 1V74A 2BMOB 4M9ZA 2R4IA 3GR2A 4WYKA 1E3RA 4EBLA 1KVLA 3FYZA 3PS8A 1W8YA 3VP4A 3GRJA 3GRDA 5F1FA 3ALAA 4B7GA 1K8A4 2JA2A 4BJPA 5HX9A 5DVAA 5AI1A 1TUHA 4I4LA 3WHLA 4HL4A 1N5PA 1YGEA 2WGWB 1SXJC 2RGOA 1JB2A 5E2HA 3N7WA 3DY5A 4KQRA 4GMQA 5EVIB 3CCE3 3P09A 3SARA 1XX2A 3Q8XA 3KDSE 1PWGA 1NDOB 3MPHA 3A3JA 2YR0A 4ZJ1A 1TVFA 1OGZA 1KDWA 2GDNA 4LJ6A 4IBDA 4E6XA 1VQM3 4FWDA 3HLEA 2K0MA 1VQO3 1R4CA 4X62M 2QEX3 4ORLA 4IBRA 3TQSA 2Y0QA 4GC9A 4KFFA 4QY6A 3WS1A 1J5EM 2IWCA 3UE1A 4HEFA 2FE8A 3UNLA 1NNJA 1Y4KA 3OCLA 2Y21A 1TH4A 1OJLA 3KSED 4JI0M 1G59A 1S723 2CWUA 3GRRA 4R3BA 3AJIB 1YLZA 2K47A 4WYKB 2ZC4B 4LJ7A 3U6DA 2ZD8A 1K41A 3LT8A 3LVVA 2RGHA 5ELUA 2PBYA 3A3DA 1W8QA 4N6OB 3G4S3 3VK7A 2C6WB 4XGIA 3F7XA 1IXRC 3CCS3 5DREA 1OMEA 2QCUA 5AIIA 2ZM8A 2WAEA 3NBJA 2ZC3B 1FSYA 5FQ9A 4K0WA 1TGUA 4LZZA 2J8YA 2Y0TA 4IVKA 2P09A 3G34A 2B5RA 1YHQ3 4R9KA 4ID4A 3HHXA 3VLFB 3RGPA 2XD1A 3MHEA 4LF7M 1FQGA 3E9SA 2WK0A 3ZDJA 3SATA 3I0YA 2Y2QA 4Q8IA 3Q90A 1PZPA 1PFPA 2JBFA 3KIIA 3NI9A 4JXGA 4KZ5A 1JN5A 2CFLA 1W5SA 4R4RA 1PU4A 2P9VA 5AQAA 4D80A 2O5RA 3L28A 1X37A 4WBGA 3FKAA 1L2CA 1FSWA 4EIWA 4PDIA 1UM8A 3IWOA 1DMNA 3KSJA 1STDA 5CF2A 2DZOB 3LTAA 5FAPA 4RNAA 1DMQA 4XBYA 5CHJA 2A15A 4JV5M 3MBZA 4H8RA 3BNEA 1ES2A 4OU7A 4B3TM 2HHHM 3WS4A 2R18A 3PFIA 5FTKA 3S28A 2UUCM 1IDPA 2WKIA 1PZOA 4OP5A 3IPTA 4X68A 2WO0A 2QENA 5JPPA 1RGZA 1LVNA 3VSKA 1EWZA 2P9VB 3NV0B 4MB7A 5IF6A 2OLUA 1CYUA 1AXBA 1ZG4A 1XP4A 1OFHA 4OOLA 4QY5A 2STDA 5ITYA 4AI6A 1KFVA 1SIHA 3FUUA 1TDLA 3IF5A 2EXBA 1IV9A 3BOSA 3PXMA 1BSGA 1Q7Y4 1NZOA 5AEUB 1HTZA 3EIEA 3VSLA 4FW9A 4DR2M 4JKTA 3AOGA 3GAXA 3STDA 1DGHA 5KP4A 2Y59A 3S67A 4X69A 3SOYA 1K56A 4OUQA 3CD63 4LCBA 4HM8B 4XDWA 2BHMA 1TDGA 1CYVA 2BJWA 1UI7A 3UB1A 2XLJA 4DR4M 3CF2A 2P74A 5F1GA 5EOEA 3DM8A 3OWUA 4AKHA 5EJCA 1HNWM 1YSYA 1JWPA 4FCJA 1IYQA 1I2SA 1W5TA 2ZC6B 4G6ZA 3SBJA 2RGQA 1WMPA 2UWXA 3C7UA 2KZSA 3HBRA 1SXJD 4RF0A 2Y2MA 1ULIB 2CC3A 3CCM3 5EQTA 1ISKA 3Q7VB 2XRXB 1KVMA 2ZAMA 3DZDA 3UZUA 3B8LA 1ZAEA 4AG5A 4PM5A 3BNDA 3RE8A 2XSHB 4O7DA 1IQPA 4IPBA 3RJUA 5EP2A 4XUXA 1DO2A 1VQP3 5IT9S 4X53A 3MK6A 5FATA 4BLCA 2C10A 3NBRA 2J9PA 3ZG7B 1PW1A 4O02B 3EB8A 4LRSA 4C75A 2Y20A 3FUWA 2I72A 1Z5CA 3EQQB 3T38A 3IMAB 4BD1A 4LCMA 4N1XA 4L0LA 3L25A 3LEZA 3UDXA 4KG2A 5F3WA 4N6LA 1XGIA 1KDSA 4LV2A 5E2EA 4GITA 2QP9X 3WRZA 4A5RA 4RF1A 3KP1E 2HCBA 3LVWA 3SHGB 3TWKA 4KZ3A 1PI5A 2R46A 3U61A 4JI5M 1DJBA 3LY3A 5EVIC 1IBLM 3NM7A 1K3XA 4AKIA 1D2NA 1XXHB 5KP3A 3LH4A 2Q9MA 2VQFM 4WMCA 2B24B 4JXVA 1FCMA 3S4XA 4WEKA 1GA9A 1GL6A 3X3YA 3M6BA 4GH9A 4MMXB 1K54A 1LXEA 3CF0A 2YFIB 3OV4A 2Y2JA 1NJ4A 2OQEA 1CK3A 1SPUA 1HT1E 3CPOA 1ORYB 1SXJA 3DGNA 4UA6A 5KO3A 3UO9A 3U60B 4WURA 3UGJA 3MG1A 2R62A 1RCJA 2F5OA 1RP5A 3FKVA 3Q7ZA 1K9M4 1L5GB 3PTEA 2FGTA 3AOEC 3PGBA 4CHTB 3OXAA 3MKEA 2C96A 2OTL3 1HQYE 4DR7M 4FH4A 2W56A 4XBOA 4YFMA 3GLHB 3K5TA 2KRUA 4N6V0 2CG0A 2DHRA 1YJN3 3JUMA 4MEZA 1LL9A 2UX0A 3GPXA 4E6WA 4FWGA 3GRYA 1LLBA 1CEFA 2CW9A 2IUJA 4GB7A 1IELA 1W01A 4HM0B 1AV4A 2CH9A 3O88A 3KS8A 1MWSA 3EX9A 1I4WA 1LL5A 1PJIA 1W7CA 1E94E 2X8AA 1GKIA 1NYMA 4DR3M 2OOVC 3PBRA 2H0TA 2W6JH 3PCRA 3DZLA 4HKVB 1NHGC 3KE7A 4MGYE 4UA7A 1JV2B 1KGGA 4XDVA 1IBKM 2L09A 3ZFZA 3BNCA 5ITQA 3BFGA 4Y7PA 4JI8M 3GLIB 1TFOA 1Q39A 1GHMA 3FSDA 4L8PA 2ZL8A 4MH0E 1QANA 4NL4H 4PT5A 4DV0M 3N54B 2QIYA 4GN2A 2Z3XA 3JYIA 4BL2A 3HLFA 3NBBA 1ES3A 3SH9A 5EP3A 5FAOA 2WKEA 1OHSA 2LWXA 3GLHA 1YLTA 2Y74A 1XWIA 1JR3A 4QOSA 3CPW2 4HM4B 1BULA 2CE7A 4JI6M 2WGVA 4E3NA 5KSHA 4I5SA 2BMRB 5GLBA 1GVNA 1NY5A 1JWVA 3WS0A 1IY2A 3AGDA 4KZ6A 4PMAA 3RFWA 5FW5A 3A42A 2ZAOA 4DV4M 1WE4A 4WZ5A 3GLGA 4WELA 1F8NA 3GLFB 4CISA 3GPPA 5GHYA 2WOHA 5HFOA 3UNWA 1FUWA 3ZVWA 4I8OA 4AKYA 3N4IA 5M19A 3T15A 4UHUA 1YJW3 1YE9A 3TWLA 3BLSA 3S1YA 4QNMA 4PDGA 1H8ZA 4KZ9A 1E3UA 3LMLA 1VQQA 1Z1SA 3ZHHA 1AVLA 4NRVA 4OVDA 1DGFA 1JVJA 3IH8A 5U47A 1T3TA 1ROAA 2CFWA 4OVZA 2XDMA 1DO0A 4JF4A 3PNYA 3UPNA 2P05A 3CMA3 1K4FA 4JI1M 5JBSA 1ULJB 1MKIA 4GOGA