2MR9A

Nmr structure of uba domain of dna-damage-inducible 1 protein (ddi1)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
GSATFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLFQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DNA damage-inducible protein 1
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mr9A00
2H5XA 2DAIA 1TR8A 3IHPA 2JUJA 2BWEA 1VDLA 1XXHE 2EJSA 2MJ5B 1OQYA 1R4GA 3GLGE 2DKLA 2OOAA 2DAMA 1VEJA 2RRUA 1UFZA 2DAEA 3LCUA 1T43A 4Q7JA 1WGNA 4GEWA 3F92A 2JZ1A 1WJ7A 2KHHA 2LVPC 1Y8GA 2LVAA 1WIVA 3GLHE 2DAKA 1HT2E 2HWJA 2DENA 1TTEA 3GLIE 2LTUA 4R71A 3LCVB 4WP2A 1BVSA 2JZ0A 3MMPA 1JR3E 2EKKA 3T6PA 1AIPC 1VEKA 1HT1E 1VG5A 1PGYA 4F1IA 1DO0A 1DO2A 2JY7A 4HEOA 2JY8A 2LBCA 2OOBA 2K9DA 2DZLA 1WGLA 2CP8A 2L4FA 1VEGA 2JY6B 2R0IA 1ZMVA 1HJPA 5DFLA 3K9OA 2K0BX 4F2LA 1Q02A 1G41A 1MN3A 1OKSA 2WZJA 1E94E 2L4EA 2EKFA 1IFYA 1KYIA 2OO9A 3FE3A 1EFUB 1G3IA 2QNJA 3E46A 1DV0A 1HQYE 2DI0A 4G3OA 2JP7A 1ZMUA 5JI2E 2QHOB 1YLAA 2KNAA 3H4JA 2BWBA 1A5TA 2LVOC 1VQ1A 3IECA 2L2DA 2LVNC 2JNHA 2CWBA 1IM2A 3BBZA 1SG9A 2HAKA 1GO5A 1WR1B 1QZEA 1OTRA 2KNZA 2DNAA 3FRHA 4DBGB 1ZMWA 1WHCA 1F4IA 2DAGA 2DHYA 1OAIA 3E21A 2JY5A 1G4AE 1C7YA 3FRIA 1P3QQ 1T6OA 1ZV1A 1IXSA 2ZTCA 3K9PA 2KNVA 2QSFX 3GLFE 2G3QA 2MGWA 2MR9A 3B89A 1CUKA 2O25A 1NV9A 4UN2B 2LVQD 2ZTDA 1V92A 1XB2B 2MROB 1NV8A 2B3TA
chains in the Genus database with same CATH superfamily
3U5ZB 3B9PA 3LQQA 4IBEA 3ILKA 2JUJA 3Q8XA 4G4NA 2J5YA 2BWEA 3OTOM 3GRUA 5FTMA 1YE9A 4GMQA 2XFSA 2CV1A 3FUVA 4DR5M 2DKLA 3KOZE 4AW4A 1C1KA 3C3EA 3I4YA 2J7OA 3R9XB 1VEJA 4BBAA 4AZFA 2VF7A 2KXEA 3VLFB 4DV6M 2DAEA 3SAUA 1S3SA 3AOGA 3U61A 4LF4M 4KODA 2JZ1A 1IQPA 3KSJA 1QDRA 4M0DA 2ZM6M 3W0LB 4GKKM 2KHHA 2VDBB 3K8ZA 3M7GA 4OVZB 1DGBA 2LVAA 3RGPA 4CIZA 3ZQJA 5F3WA 3HHYA 4FWHA 2DAKA 1HT2E 2HWJA 2YR0A 2C5RA 2CV2A 3GLIE 3W68A 4LF9M 3UZUA 2CV0A 4KHPM 2FH0A 2JZ0A 3MMPA 4A3VB 1VDDA 1XNRM 4IBBA 3BXWA 3FD9A 2EKKA 3THGA 5H37D 4HLQA 1HR0M 1IN8A 3VKHA 1VEKA 2Z8YM 1PJQA 4IIWA 2F4VM 1UM8A 2DHRA 3KP0E 3U60A 4F1IA 3GLIA 2EUCA 4HEOA 2JY8A 3QYBA 2LBCA 3HHXA 2K9DA 3SYKA 5IWAM 1WGLA 2L4FA 1OFHA 3E9SA 3SBJA 3AFHA 3TL4X 3GLGA 2VIIA 3KOYE 2MH8A 2DZOB 1D0MA 3GPYA 3L2AA 3K9OA 1IXSB 2K0BX 2APLA 1Q02A 2JA2A 3EIEA 1E94E 2GNOA 2EKFA 3DA1A 3QAUA 1IFYA 4W5WA 1QAOA 5BPVA 2OPFA 2FFJA 2UXCM 1QAQA 2DVWB 2R45A 3CTWB 3Q8GA 2QNJA 3E46A 2GQFA 2ZBKB 2CHQA 1LV7A 4G3OA 2Y21A 3KOXE 1NY5A 3FUWA 3B74A 1TH3A 3A46A 2Y0TA 1Z59A 4B3MM 3KS8A 1HNWM 2ZAOA 2Z3XA 3JAMS 3GLFB 4REZA 2D7EA 3U6EA 3U6SA 4OW0A 3PFIA 3W0FA 1SG9A 3A45A 4LFAM 2HAKA 4QHTA 5FTNA 4JN6A 1OIZA 4GH9A 4JXJA 5C18A 3SAWA 1N32M 3I01M 1QZEA 1EIJA 4B3TM 2CEAA 3AOEC 3UMMA 2XH9A 3T15A 2R6FA 1MU5A 4MM3B 3TWMA 4LJ8A 2KNZA 4NSOB 2LWXA 4G4RA 2UUBM 1F4IA 1KFVA 4IBCA 4AI6A 2R46A 1N75A 2DAGA 1XNQM 4LG2A 4LF5M 4Z8XA 1G4AE 4LJ7A 5EQTA 2L09A 1DGGA 2CE7A 3T1HM 4YY3M 1DGFA 3CF2A 3TWLA 3K9PA 2ZTCA 5KQ8A 1NO1A 3GQ3A 1IBKM 3SAVA 3L28A 3TPZA 4K0KM 1OAOC 2G3QA 1KSFX 2LNHC 3B89A 2BJWA 1CUKA 1TDHA 1Z5BA 4DV1M 1NV9A 4UN2B 3SFZA 3SHGB 1QDTA 4LCBA 8CATA 3M6AA 4JI6M 3GLHB 1J5EM 2ZAMA 2DAIA 2EO2A 3DZDA 3C9PA 3TE6A 1NHWC 2XLJA 1VDLA 1L2BA 2EJSA 3TQSA 2MJ5B 4CISA 2DWZB 2WSFF 3FTCA 2UUAM 1IXZA 2DAMA 4MH0E 4NC6A 2NQ8C 4LZJA 3U6LA 4AKHA 4PDGA 4XBOA 1UFZA 4P16A 4G4OA 1R7RA 3B7QA 4QHSA 2EA0A 1IY1A 3MK6A 1WGNA 1NNUC 1QUTA 3SC3A 4JYAM 2RKOA 3H4MA 1PJJA 2J7NA 4DV5M 2LVPC 4DR7M 2G5GX 5IZ7D 3HKPA 1WIVA 1TDZA 4D81A 4RNAA 2LTUA 1TGUA 1HNXM 3GPXA 1ZQ9A 2QP9X 4G4QA 2F5SA 5EP2A 3LMMA 3PNYA 5E6JA 1JR3E 1GKIA 4B08A 1TH2A 3V76A 5FTLA 5A2QS 2KA6B 4MGIE 4RKUF 2QBYA 1AIPC 2I7PA 4CHTB 2QZ4A 2KRUA 5C1BA 5BR8M 1HT1E 1SXJE 1VG5A 4GRIA 4B3RM 2D7GA 3FYDA 3GRYA 5FLXS 3U5ZA 1L1TA 2CFOA 4FCVA 3HX3A 1R6BX 2DZLA 1QVRA 3CGWA 4CGYB 1JR3A 2R0IA 4B7GA 4I81A 4NSRA 2LXEA 1QUSA 1W5SA 3U61B 1SXJA 4IJEA 4AQYM 3U6PA 2Z4RA 1MN3A 1OKSA 3J7BA 1MJGM 4LJ4A 3BOSA 3SYLA 2JWSA 1GJSA 3GP1A 4MGKE 1N34M 2HKJA 2V1CA 1G3IA 2R18A 1E9SA 1DGHB 1NNJA 2Z7JA 5LMUM 4OVZA 3IG5A 1DV0A 2X49A 4HL4A 3D8LA 2HCBA 2QHOB 2KNAA 1PJTA 2BWBA 2L7IA 2JXNA 2F5QA 4DR2M 2C99A 2JNHA 2A5YB 5ITUA 4LZZA 1IM2A 3HJSA 1RU3A 1MX0A 2XZUA 1V34A 4XGIA 2DXIA 1JB0F 4B7HA 1N36M 3J80S 3U6QA 1N77A 3HJ8A 2XSZD 4JV5M 1E9RA 1OTRA 4DBGB 3FRHA 3KDSE 1L2DA 1XXHB 1ZMWA 1G71A 3C58A 4LJAA 3GLGB 3AOEA 2UUCM 2W82A 3DOAA 4LJ9A 1XC8A 3KW6A 3FRIA 3QYEA 1P3QQ 2P5TA 1ZAEA 5EP3A 2LHCA 1IXSA 2I7NA 5ITTA 2KNVA 3U6CA 1IY2A 3GLFE 2MR9A 3JR5A 4NL4H 5KPZA 1IY0A 1LTMA 5EXSA 5KO3A 1QAMA 1V92A 4NOOB 1XB2B 1IN6A 2C9CA 4AG5A 3T38A 5KQDA 3PNVA 2B3TA 4MB7A 4PDIA 1R2YA 2DWLA 1IN5A 2H5XA 2R44A 1TR8A 3IHPA 3AL0C 4X66M 2QQ8A 3J81S 2KW0A 3MHVC 4LRTA 4S12A 3GLFA 4NXNM 1OQYA 4KLNA 2VQEM 2N35A 1E32A 2OOAA 4IJFA 5EJCA 3L26A 5EXPA 2CUZA 2C96A 4IBIA 4LY6A 2O01F 2RRUA 4DR3M 3LCUA 1PJSA 2BJVA 4Q7JA 4GEWA 3F92A 3E4RA 4JI5M 1NJGA 3LVWA 4D80A 1GL6A 3T1YM 3FTFA 1N33M 1GL7A 1WJ7A 2QENA 5EXTA 2KZUA 4ANRA 3GLHE 4BB9A 2KRKA 4X64M 1R2ZA 3HHWA 2DENA 1TTEA 2F5PA 3FUTA 1K3XA 1ORYB 4LF6M 1QYRA 4JI0M 2AHMA 5FTKA 1GJTA 1XHBA 5FSWA 1GVNA 4L4UA 2F5OA 4R3DA 3T6PA 2BNKA 3HGIA 1Q3CA 4BLCA 5ITXE 2R4EA 2M5ZA 3UJNA 1J09A 2DZNB 4DR1M 1PJIA 2UXDM 3GLHA 1AUAA 1H6UA 5EP4A 4I5SA 1DO0A 1DO2A 3KOWE 3A98B 5GKNA 3WHKA 4AKIA 4DV3M 4B7FA 1FJGM 2CP8A 1V33A 2YQZA 3GRVA 5E26A 1VEGA 3KVWA 4B3SM 2JY6B 1OIPA 2G8LA 1L2CA 1ZMVA 4G6ZA 3GQ4A 4M9SA 5L8RF 4LF7M 4DR4M 5ITXA 2QPAA 1Z5AA 4X65M 1WXQA 3RGSA 4F2LA 4XK8F 2WSEF 1G41A 5LMNM 2WZJA 3VDPA 1JQJC 3HU2A 2ZANA 1I4WA 2CRUA 4QNMA 4WURA 3SHFA 4L8RC 4JI8M 2H1RA 3QWLA 3EIHA 1IN4A 4L16A 4EIWA 4AKGA 1FNNA 1NHGC 3U6DA 1HQYE 3A42A 3VK8A 4PT5A 1PRBA 2JP7A 2LHGA 3I4VA 3H4JA 4KO8A 4Z6YA 3IECA 3PVSA 4DV4M 3J2PB 1HNZM 3PXGA 2L2DA 3ZCBB 3GQ5A 1D2NA 2LH0A 2QBYB 4AG6A 2FS1A 3M0EA 3FTEA 3SATA 1K82A 3UGJA 1GO5A 1NVMA 2YNMD 2D7HA 2R62A 4YHHM 3MJ5A 3FUUA 4GIPA 4DR6M 4NRWA 2C98A 4P17A 3K2LA 1Q39A 4GITA 1XMQM 3E21A 3LVVA 4TUWA 4FW9A 3W67A 3GRRA 1SXJB 4LJ6A 4KT0F 1T6OA 4MGZE 3C3DA 2FNAA 1QZMA 3FUXA 5FTJA 3L29A 4DUZM 4LGYA 2HHHM 4DUYM 1NY6A 2O25A 4Y28F 3K1JA 1DGHA 1GABA 4NRVA 2FE8A 2MROB 1NV8A 3U60B 3BBZA 2QCUA 3GO8A 4L6V6 3SARA 3GLIB 1X37A 1YUBA 1EE8A 5EP1A 4R7GA 3VFDA 1Z6TA 1IBLM 4II7A 1XMOM 1IN7A 3I04M 1XXHE 5DNYA 3TWKA 3L25A 1R4GA 3J27B 4X62M 3GLGE 3ZH9B 3RE8A 1GLNA 3AKZA 4M9ZA 1YSYA 4IBDA 2WSCF 4L78A 2L6OA 1XWIA 3VK7A 4FVMA 5ITQA 1J7KA 1T43A 2UXBM 4M9XA 5KPTA 1SXJC 4L15A 4LFBM 4IBKA 1D0LA 1XXHA 2O5RA 4LJ5A 4M0WA 2RGOA 1Y8GA 2KZSA 4FWDA 3LQRA 3KP1E 2XGNA 2R4JA 4GHAA 3UK6A 5ITRA 2OQ4A 4R71A 3LCVB 2HL7A 1BVSA 4WP2A 3R8FA 3SMSA 1QANA 4CJ6A 3HU1A 1R5LA 3GPPA 3U6OA 5ITYA 3AV0A 1I94M 4DV0M 2DWMA 3HZJA 4NXMM 4GC5A 3K92A 1L1ZA 4GHLA 4FD2A 1PGYA 2F5NA 3D8BA 4ITQA 3WHLA 3B7ZA 3KSXA 3NBXX 2JY7A 3GPUA 3U6MA 4RF0A 2CHVA 4OX9M 2KEBA 2OOBA 3HHZA 1IBMM 3HWSA 2E5LM 3VDUA 2K6BA 4JI4M 4QOSA 2VQFM 3VKGA 2M60A 1PM5A 4MGYE 3SMPA 1HJPA 2Y20A 3NBIA 1JR3D 5DFLA 2FOIC 2Z4SA 2C9OA 2L4EA 2V1UA 2VF8A 3IG8A 1KYIA 2ERCA 2RGHA 1OJLA 4QOZC 2X4AA 2CHGA 2OO9A 3FE3A 1EFUB 1SXJD 4JI3M 4DV2M 3RFWA 1QQWA 2XEPA 3CF0A 2DI0A 1TH4A 2X8AA 1ZMUA 3HY5A 5JI2E 1YLAA 4LGMA 1A5TA 2LVOC 1VQ1A 1G59A 2UU9M 4IBFA 3NWLA 2K47A 5IT9S 1NSFA 5DYGA 2LVNC 3LW5F 2CWBA 2V6ZM 3FYCA 3L27A 2Q2EB 4IBJA 1G8PA 3CF6E 2XSZA 3DFZA 4RF1A 5IREB 4PD2A 3B7NA 3KXEC 3AJIB 4IBGA 1T3TA 4WW0A 1TF0B 3ZC7B 4PCZA 7CATA 3KS4A 4JI1M 1WR1B 2R65A 5JI3E 2DWNA 4I4LA 2XFTA 4JI2M 4DV7M 1IXRC 3I51A 4LFCM 1L8QA 2YFQA 5KPRA 4LRSA 4FCWA 2DNAA 4D82A 4GKJM 2XF3A 5EXXA 1WHCA 3FKEA 4GC9A 1HQCA 2DHYA 1OAIA 3JR4A 3J7AS 4FWGA 4LF8M 3KFUG 1Q3BA 2JY5A 4QNRA 5DYIA 2L7HA 1Z5CA 1NJFA 3HU3A 1C7YA 1ZV1A 2KDLA 1W5TA 1OFIA 1N78A 2XZFA 2QSFX 4OU7A 1K3WA 4FCTA 4I8OA 2MGWA 4ZPXA 4JI7M 4MGHA 2LVQD 2Y0QA 2ZTDA 3SASA 3FTDA 3HJQA 1D0KA
chains in the Genus database with same CATH topology
2H5XA 2DAIA 1TR8A 3IHPA 2JUJA 2BWEA 1VDLA 1XXHE 2EJSA 2MJ5B 1OQYA 1R4GA 3GLGE 2DKLA 2OOAA 2DAMA 1VEJA 2RRUA 1UFZA 2DAEA 3LCUA 1T43A 4Q7JA 1WGNA 4GEWA 3F92A 2JZ1A 1WJ7A 2KHHA 2LVPC 1Y8GA 2LVAA 1WIVA 3GLHE 2DAKA 1HT2E 2HWJA 2DENA 1TTEA 3GLIE 2LTUA 4R71A 3LCVB 4WP2A 1BVSA 2JZ0A 3MMPA 1JR3E 2EKKA 3T6PA 1AIPC 1VEKA 1HT1E 1VG5A 1PGYA 4F1IA 1DO0A 1DO2A 2JY7A 4HEOA 2JY8A 2LBCA 2OOBA 2K9DA 2DZLA 1WGLA 2CP8A 2L4FA 1VEGA 2JY6B 2R0IA 1ZMVA 1HJPA 5DFLA 3K9OA 2K0BX 4F2LA 1Q02A 1G41A 1MN3A 1OKSA 2WZJA 1E94E 2L4EA 2EKFA 1IFYA 1KYIA 2OO9A 3FE3A 1EFUB 1G3IA 2QNJA 3E46A 1DV0A 1HQYE 2DI0A 4G3OA 2JP7A 1ZMUA 5JI2E 2QHOB 1YLAA 2KNAA 3H4JA 2BWBA 1A5TA 2LVOC 1VQ1A 3IECA 2L2DA 2LVNC 2JNHA 2CWBA 1IM2A 3BBZA 1SG9A 2HAKA 1GO5A 1WR1B 1QZEA 1OTRA 2KNZA 2DNAA 3FRHA 4DBGB 1ZMWA 1WHCA 1F4IA 2DAGA 2DHYA 1OAIA 3E21A 2JY5A 1G4AE 1C7YA 3FRIA 1P3QQ 1T6OA 1ZV1A 1IXSA 2ZTCA 3K9PA 2KNVA 2QSFX 3GLFE 2G3QA 2MGWA 2MR9A 3B89A 1CUKA 2O25A 1NV9A 4UN2B 2LVQD 2ZTDA 1V92A 1XB2B 2MROB 1NV8A 2B3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5X A;  2DAI A;  1TR8 A;  3IHP A;  2JUJ A;  2BWE A;  1VDL A;  1XXH E;  2EJS A;  2MJ5 B;  1OQY A;  1R4G A;  3GLG E;  2DKL A;  2OOA A;  2DAM A;  1VEJ A;  2RRU A;  1UFZ A;  2DAE A;  3LCU A;  1T43 A;  4Q7J A;  1WGN A;  4GEW A;  3F92 A;  2JZ1 A;  1WJ7 A;  2KHH A;  2LVP C;  1Y8G A;  2LVA A;  1WIV A;  3GLH E;  2DAK A;  1HT2 E;  2HWJ A;  2DEN A;  1TTE A;  3GLI E;  2LTU A;  4R71 A;  3LCV B;  4WP2 A;  1BVS A;  2JZ0 A;  3MMP A;  1JR3 E;  2EKK A;  3T6P A;  1AIP C;  1VEK A;  1HT1 E;  1VG5 A;  1PGY A;  4F1I A;  1DO0 A;  1DO2 A;  2JY7 A;  4HEO A;  2JY8 A;  2LBC A;  2OOB A;  2K9D A;  2DZL A;  1WGL A;  2CP8 A;  2L4F A;  1VEG A;  2JY6 B;  2R0I A;  1ZMV A;  1HJP A;  5DFL A;  3K9O A;  2K0B X;  4F2L A;  1Q02 A;  1G41 A;  1MN3 A;  1OKS A;  2WZJ A;  1E94 E;  2L4E A;  2EKF A;  1IFY A;  1KYI A;  2OO9 A;  3FE3 A;  1EFU B;  1G3I A;  2QNJ A;  3E46 A;  1DV0 A;  1HQY E;  2DI0 A;  4G3O A;  2JP7 A;  1ZMU A;  5JI2 E;  2QHO B;  1YLA A;  2KNA A;  3H4J A;  2BWB A;  1A5T A;  2LVO C;  1VQ1 A;  3IEC A;  2L2D A;  2LVN C;  2JNH A;  2CWB A;  1IM2 A;  3BBZ A;  1SG9 A;  2HAK A;  1GO5 A;  1WR1 B;  1QZE A;  1OTR A;  2KNZ A;  2DNA A;  3FRH A;  4DBG B;  1ZMW A;  1WHC A;  1F4I A;  2DAG A;  2DHY A;  1OAI A;  3E21 A;  2JY5 A;  1G4A E;  1C7Y A;  3FRI A;  1P3Q Q;  1T6O A;  1ZV1 A;  1IXS A;  2ZTC A;  3K9P A;  2KNV A;  2QSF X;  3GLF E;  2G3Q A;  2MGW A;  2MR9 A;  3B89 A;  1CUK A;  2O25 A;  1NV9 A;  4UN2 B;  2LVQ D;  2ZTD A;  1V92 A;  1XB2 B;  2MRO B;  1NV8 A;  2B3T A; 
#chains in the Genus database with same CATH topology
 3U5Z B;  3B9P A;  3LQQ A;  4IBE A;  3ILK A;  2JUJ A;  3Q8X A;  4G4N A;  2J5Y A;  2BWE A;  3OTO M;  3GRU A;  5FTM A;  1YE9 A;  4GMQ A;  2XFS A;  2CV1 A;  3FUV A;  4DR5 M;  2DKL A;  3KOZ E;  4AW4 A;  1C1K A;  3C3E A;  3I4Y A;  2J7O A;  3R9X B;  1VEJ A;  4BBA A;  4AZF A;  2VF7 A;  2KXE A;  3VLF B;  4DV6 M;  2DAE A;  3SAU A;  1S3S A;  3AOG A;  3U61 A;  4LF4 M;  4KOD A;  2JZ1 A;  1IQP A;  3KSJ A;  1QDR A;  4M0D A;  2ZM6 M;  3W0L B;  4GKK M;  2KHH A;  2VDB B;  3K8Z A;  3M7G A;  4OVZ B;  1DGB A;  2LVA A;  3RGP A;  4CIZ A;  3ZQJ A;  5F3W A;  3HHY A;  4FWH A;  2DAK A;  1HT2 E;  2HWJ A;  2YR0 A;  2C5R A;  2CV2 A;  3GLI E;  3W68 A;  4LF9 M;  3UZU A;  2CV0 A;  4KHP M;  2FH0 A;  2JZ0 A;  3MMP A;  4A3V B;  1VDD A;  1XNR M;  4IBB A;  3BXW A;  3FD9 A;  2EKK A;  3THG A;  5H37 D;  4HLQ A;  1HR0 M;  1IN8 A;  3VKH A;  1VEK A;  2Z8Y M;  1PJQ A;  4IIW A;  2F4V M;  1UM8 A;  2DHR A;  3KP0 E;  3U60 A;  4F1I A;  3GLI A;  2EUC A;  4HEO A;  2JY8 A;  3QYB A;  2LBC A;  3HHX A;  2K9D A;  3SYK A;  5IWA M;  1WGL A;  2L4F A;  1OFH A;  3E9S A;  3SBJ A;  3AFH A;  3TL4 X;  3GLG A;  2VII A;  3KOY E;  2MH8 A;  2DZO B;  1D0M A;  3GPY A;  3L2A A;  3K9O A;  1IXS B;  2K0B X;  2APL A;  1Q02 A;  2JA2 A;  3EIE A;  1E94 E;  2GNO A;  2EKF A;  3DA1 A;  3QAU A;  1IFY A;  4W5W A;  1QAO A;  5BPV A;  2OPF A;  2FFJ A;  2UXC M;  1QAQ A;  2DVW B;  2R45 A;  3CTW B;  3Q8G A;  2QNJ A;  3E46 A;  2GQF A;  2ZBK B;  2CHQ A;  1LV7 A;  4G3O A;  2Y21 A;  3KOX E;  1NY5 A;  3FUW A;  3B74 A;  1TH3 A;  3A46 A;  2Y0T A;  1Z59 A;  4B3M M;  3KS8 A;  1HNW M;  2ZAO A;  2Z3X A;  3JAM S;  3GLF B;  4REZ A;  2D7E A;  3U6E A;  3U6S A;  4OW0 A;  3PFI A;  3W0F A;  1SG9 A;  3A45 A;  4LFA M;  2HAK A;  4QHT A;  5FTN A;  4JN6 A;  1OIZ A;  4GH9 A;  4JXJ A;  5C18 A;  3SAW A;  1N32 M;  3I01 M;  1QZE A;  1EIJ A;  4B3T M;  2CEA A;  3AOE C;  3UMM A;  2XH9 A;  3T15 A;  2R6F A;  1MU5 A;  4MM3 B;  3TWM A;  4LJ8 A;  2KNZ A;  4NSO B;  2LWX A;  4G4R A;  2UUB M;  1F4I A;  1KFV A;  4IBC A;  4AI6 A;  2R46 A;  1N75 A;  2DAG A;  1XNQ M;  4LG2 A;  4LF5 M;  4Z8X A;  1G4A E;  4LJ7 A;  5EQT A;  2L09 A;  1DGG A;  2CE7 A;  3T1H M;  4YY3 M;  1DGF A;  3CF2 A;  3TWL A;  3K9P A;  2ZTC A;  5KQ8 A;  1NO1 A;  3GQ3 A;  1IBK M;  3SAV A;  3L28 A;  3TPZ A;  4K0K M;  1OAO C;  2G3Q A;  1KSF X;  2LNH C;  3B89 A;  2BJW A;  1CUK A;  1TDH A;  1Z5B A;  4DV1 M;  1NV9 A;  4UN2 B;  3SFZ A;  3SHG B;  1QDT A;  4LCB A;  8CAT A;  3M6A A;  4JI6 M;  3GLH B;  1J5E M;  2ZAM A;  2DAI A;  2EO2 A;  3DZD A;  3C9P A;  3TE6 A;  1NHW C;  2XLJ A;  1VDL A;  1L2B A;  2EJS A;  3TQS A;  2MJ5 B;  4CIS A;  2DWZ B;  2WSF F;  3FTC A;  2UUA M;  1IXZ A;  2DAM A;  4MH0 E;  4NC6 A;  2NQ8 C;  4LZJ A;  3U6L A;  4AKH A;  4PDG A;  4XBO A;  1UFZ A;  4P16 A;  4G4O A;  1R7R A;  3B7Q A;  4QHS A;  2EA0 A;  1IY1 A;  3MK6 A;  1WGN A;  1NNU C;  1QUT A;  3SC3 A;  4JYA M;  2RKO A;  3H4M A;  1PJJ A;  2J7N A;  4DV5 M;  2LVP C;  4DR7 M;  2G5G X;  5IZ7 D;  3HKP A;  1WIV A;  1TDZ A;  4D81 A;  4RNA A;  2LTU A;  1TGU A;  1HNX M;  3GPX A;  1ZQ9 A;  2QP9 X;  4G4Q A;  2F5S A;  5EP2 A;  3LMM A;  3PNY A;  5E6J A;  1JR3 E;  1GKI A;  4B08 A;  1TH2 A;  3V76 A;  5FTL A;  5A2Q S;  2KA6 B;  4MGI E;  4RKU F;  2QBY A;  1AIP C;  2I7P A;  4CHT B;  2QZ4 A;  2KRU A;  5C1B A;  5BR8 M;  1HT1 E;  1SXJ E;  1VG5 A;  4GRI A;  4B3R M;  2D7G A;  3FYD A;  3GRY A;  5FLX S;  3U5Z A;  1L1T A;  2CFO A;  4FCV A;  3HX3 A;  1R6B X;  2DZL A;  1QVR A;  3CGW A;  4CGY B;  1JR3 A;  2R0I A;  4B7G A;  4I81 A;  4NSR A;  2LXE A;  1QUS A;  1W5S A;  3U61 B;  1SXJ A;  4IJE A;  4AQY M;  3U6P A;  2Z4R A;  1MN3 A;  1OKS A;  3J7B A;  1MJG M;  4LJ4 A;  3BOS A;  3SYL A;  2JWS A;  1GJS A;  3GP1 A;  4MGK E;  1N34 M;  2HKJ A;  2V1C A;  1G3I A;  2R18 A;  1E9S A;  1DGH B;  1NNJ A;  2Z7J A;  5LMU M;  4OVZ A;  3IG5 A;  1DV0 A;  2X49 A;  4HL4 A;  3D8L A;  2HCB A;  2QHO B;  2KNA A;  1PJT A;  2BWB A;  2L7I A;  2JXN A;  2F5Q A;  4DR2 M;  2C99 A;  2JNH A;  2A5Y B;  5ITU A;  4LZZ A;  1IM2 A;  3HJS A;  1RU3 A;  1MX0 A;  2XZU A;  1V34 A;  4XGI A;  2DXI A;  1JB0 F;  4B7H A;  1N36 M;  3J80 S;  3U6Q A;  1N77 A;  3HJ8 A;  2XSZ D;  4JV5 M;  1E9R A;  1OTR A;  4DBG B;  3FRH A;  3KDS E;  1L2D A;  1XXH B;  1ZMW A;  1G71 A;  3C58 A;  4LJA A;  3GLG B;  3AOE A;  2UUC M;  2W82 A;  3DOA A;  4LJ9 A;  1XC8 A;  3KW6 A;  3FRI A;  3QYE A;  1P3Q Q;  2P5T A;  1ZAE A;  5EP3 A;  2LHC A;  1IXS A;  2I7N A;  5ITT A;  2KNV A;  3U6C A;  1IY2 A;  3GLF E;  2MR9 A;  3JR5 A;  4NL4 H;  5KPZ A;  1IY0 A;  1LTM A;  5EXS A;  5KO3 A;  1QAM A;  1V92 A;  4NOO B;  1XB2 B;  1IN6 A;  2C9C A;  4AG5 A;  3T38 A;  5KQD A;  3PNV A;  2B3T A;  4MB7 A;  4PDI A;  1R2Y A;  2DWL A;  1IN5 A;  2H5X A;  2R44 A;  1TR8 A;  3IHP A;  3AL0 C;  4X66 M;  2QQ8 A;  3J81 S;  2KW0 A;  3MHV C;  4LRT A;  4S12 A;  3GLF A;  4NXN M;  1OQY A;  4KLN A;  2VQE M;  2N35 A;  1E32 A;  2OOA A;  4IJF A;  5EJC A;  3L26 A;  5EXP A;  2CUZ A;  2C96 A;  4IBI A;  4LY6 A;  2O01 F;  2RRU A;  4DR3 M;  3LCU A;  1PJS A;  2BJV A;  4Q7J A;  4GEW A;  3F92 A;  3E4R A;  4JI5 M;  1NJG A;  3LVW A;  4D80 A;  1GL6 A;  3T1Y M;  3FTF A;  1N33 M;  1GL7 A;  1WJ7 A;  2QEN A;  5EXT A;  2KZU A;  4ANR A;  3GLH E;  4BB9 A;  2KRK A;  4X64 M;  1R2Z A;  3HHW A;  2DEN A;  1TTE A;  2F5P A;  3FUT A;  1K3X A;  1ORY B;  4LF6 M;  1QYR A;  4JI0 M;  2AHM A;  5FTK A;  1GJT A;  1XHB A;  5FSW A;  1GVN A;  4L4U A;  2F5O A;  4R3D A;  3T6P A;  2BNK A;  3HGI A;  1Q3C A;  4BLC A;  5ITX E;  2R4E A;  2M5Z A;  3UJN A;  1J09 A;  2DZN B;  4DR1 M;  1PJI A;  2UXD M;  3GLH A;  1AUA A;  1H6U A;  5EP4 A;  4I5S A;  1DO0 A;  1DO2 A;  3KOW E;  3A98 B;  5GKN A;  3WHK A;  4AKI A;  4DV3 M;  4B7F A;  1FJG M;  2CP8 A;  1V33 A;  2YQZ A;  3GRV A;  5E26 A;  1VEG A;  3KVW A;  4B3S M;  2JY6 B;  1OIP A;  2G8L A;  1L2C A;  1ZMV A;  4G6Z A;  3GQ4 A;  4M9S A;  5L8R F;  4LF7 M;  4DR4 M;  5ITX A;  2QPA A;  1Z5A A;  4X65 M;  1WXQ A;  3RGS A;  4F2L A;  4XK8 F;  2WSE F;  1G41 A;  5LMN M;  2WZJ A;  3VDP A;  1JQJ C;  3HU2 A;  2ZAN A;  1I4W A;  2CRU A;  4QNM A;  4WUR A;  3SHF A;  4L8R C;  4JI8 M;  2H1R A;  3QWL A;  3EIH A;  1IN4 A;  4L16 A;  4EIW A;  4AKG A;  1FNN A;  1NHG C;  3U6D A;  1HQY E;  3A42 A;  3VK8 A;  4PT5 A;  1PRB A;  2JP7 A;  2LHG A;  3I4V A;  3H4J A;  4KO8 A;  4Z6Y A;  3IEC A;  3PVS A;  4DV4 M;  3J2P B;  1HNZ M;  3PXG A;  2L2D A;  3ZCB B;  3GQ5 A;  1D2N A;  2LH0 A;  2QBY B;  4AG6 A;  2FS1 A;  3M0E A;  3FTE A;  3SAT A;  1K82 A;  3UGJ A;  1GO5 A;  1NVM A;  2YNM D;  2D7H A;  2R62 A;  4YHH M;  3MJ5 A;  3FUU A;  4GIP A;  4DR6 M;  4NRW A;  2C98 A;  4P17 A;  3K2L A;  1Q39 A;  4GIT A;  1XMQ M;  3E21 A;  3LVV A;  4TUW A;  4FW9 A;  3W67 A;  3GRR A;  1SXJ B;  4LJ6 A;  4KT0 F;  1T6O A;  4MGZ E;  3C3D A;  2FNA A;  1QZM A;  3FUX A;  5FTJ A;  3L29 A;  4DUZ M;  4LGY A;  2HHH M;  4DUY M;  1NY6 A;  2O25 A;  4Y28 F;  3K1J A;  1DGH A;  1GAB A;  4NRV A;  2FE8 A;  2MRO B;  1NV8 A;  3U60 B;  3BBZ A;  2QCU A;  3GO8 A;  4L6V 6;  3SAR A;  3GLI B;  1X37 A;  1YUB A;  1EE8 A;  5EP1 A;  4R7G A;  3VFD A;  1Z6T A;  1IBL M;  4II7 A;  1XMO M;  1IN7 A;  3I04 M;  1XXH E;  5DNY A;  3TWK A;  3L25 A;  1R4G A;  3J27 B;  4X62 M;  3GLG E;  3ZH9 B;  3RE8 A;  1GLN A;  3AKZ A;  4M9Z A;  1YSY A;  4IBD A;  2WSC F;  4L78 A;  2L6O A;  1XWI A;  3VK7 A;  4FVM A;  5ITQ A;  1J7K A;  1T43 A;  2UXB M;  4M9X A;  5KPT A;  1SXJ C;  4L15 A;  4LFB M;  4IBK A;  1D0L A;  1XXH A;  2O5R A;  4LJ5 A;  4M0W A;  2RGO A;  1Y8G A;  2KZS A;  4FWD A;  3LQR A;  3KP1 E;  2XGN A;  2R4J A;  4GHA A;  3UK6 A;  5ITR A;  2OQ4 A;  4R71 A;  3LCV B;  2HL7 A;  1BVS A;  4WP2 A;  3R8F A;  3SMS A;  1QAN A;  4CJ6 A;  3HU1 A;  1R5L A;  3GPP A;  3U6O A;  5ITY A;  3AV0 A;  1I94 M;  4DV0 M;  2DWM A;  3HZJ A;  4NXM M;  4GC5 A;  3K92 A;  1L1Z A;  4GHL A;  4FD2 A;  1PGY A;  2F5N A;  3D8B A;  4ITQ A;  3WHL A;  3B7Z A;  3KSX A;  3NBX X;  2JY7 A;  3GPU A;  3U6M A;  4RF0 A;  2CHV A;  4OX9 M;  2KEB A;  2OOB A;  3HHZ A;  1IBM M;  3HWS A;  2E5L M;  3VDU A;  2K6B A;  4JI4 M;  4QOS A;  2VQF M;  3VKG A;  2M60 A;  1PM5 A;  4MGY E;  3SMP A;  1HJP A;  2Y20 A;  3NBI A;  1JR3 D;  5DFL A;  2FOI C;  2Z4S A;  2C9O A;  2L4E A;  2V1U A;  2VF8 A;  3IG8 A;  1KYI A;  2ERC A;  2RGH A;  1OJL A;  4QOZ C;  2X4A A;  2CHG A;  2OO9 A;  3FE3 A;  1EFU B;  1SXJ D;  4JI3 M;  4DV2 M;  3RFW A;  1QQW A;  2XEP A;  3CF0 A;  2DI0 A;  1TH4 A;  2X8A A;  1ZMU A;  3HY5 A;  5JI2 E;  1YLA A;  4LGM A;  1A5T A;  2LVO C;  1VQ1 A;  1G59 A;  2UU9 M;  4IBF A;  3NWL A;  2K47 A;  5IT9 S;  1NSF A;  5DYG A;  2LVN C;  3LW5 F;  2CWB A;  2V6Z M;  3FYC A;  3L27 A;  2Q2E B;  4IBJ A;  1G8P A;  3CF6 E;  2XSZ A;  3DFZ A;  4RF1 A;  5IRE B;  4PD2 A;  3B7N A;  3KXE C;  3AJI B;  4IBG A;  1T3T A;  4WW0 A;  1TF0 B;  3ZC7 B;  4PCZ A;  7CAT A;  3KS4 A;  4JI1 M;  1WR1 B;  2R65 A;  5JI3 E;  2DWN A;  4I4L A;  2XFT A;  4JI2 M;  4DV7 M;  1IXR C;  3I51 A;  4LFC M;  1L8Q A;  2YFQ A;  5KPR A;  4LRS A;  4FCW A;  2DNA A;  4D82 A;  4GKJ M;  2XF3 A;  5EXX A;  1WHC A;  3FKE A;  4GC9 A;  1HQC A;  2DHY A;  1OAI A;  3JR4 A;  3J7A S;  4FWG A;  4LF8 M;  3KFU G;  1Q3B A;  2JY5 A;  4QNR A;  5DYI A;  2L7H A;  1Z5C A;  1NJF A;  3HU3 A;  1C7Y A;  1ZV1 A;  2KDL A;  1W5T A;  1OFI A;  1N78 A;  2XZF A;  2QSF X;  4OU7 A;  1K3W A;  4FCT A;  4I8O A;  2MGW A;  4ZPX A;  4JI7 M;  4MGH A;  2LVQ D;  2Y0Q A;  2ZTD A;  3SAS A;  3FTD A;  3HJQ A;  1D0K A; 
#chains in the Genus database with same CATH homology
 2H5X A;  2DAI A;  1TR8 A;  3IHP A;  2JUJ A;  2BWE A;  1VDL A;  1XXH E;  2EJS A;  2MJ5 B;  1OQY A;  1R4G A;  3GLG E;  2DKL A;  2OOA A;  2DAM A;  1VEJ A;  2RRU A;  1UFZ A;  2DAE A;  3LCU A;  1T43 A;  4Q7J A;  1WGN A;  4GEW A;  3F92 A;  2JZ1 A;  1WJ7 A;  2KHH A;  2LVP C;  1Y8G A;  2LVA A;  1WIV A;  3GLH E;  2DAK A;  1HT2 E;  2HWJ A;  2DEN A;  1TTE A;  3GLI E;  2LTU A;  4R71 A;  3LCV B;  4WP2 A;  1BVS A;  2JZ0 A;  3MMP A;  1JR3 E;  2EKK A;  3T6P A;  1AIP C;  1VEK A;  1HT1 E;  1VG5 A;  1PGY A;  4F1I A;  1DO0 A;  1DO2 A;  2JY7 A;  4HEO A;  2JY8 A;  2LBC A;  2OOB A;  2K9D A;  2DZL A;  1WGL A;  2CP8 A;  2L4F A;  1VEG A;  2JY6 B;  2R0I A;  1ZMV A;  1HJP A;  5DFL A;  3K9O A;  2K0B X;  4F2L A;  1Q02 A;  1G41 A;  1MN3 A;  1OKS A;  2WZJ A;  1E94 E;  2L4E A;  2EKF A;  1IFY A;  1KYI A;  2OO9 A;  3FE3 A;  1EFU B;  1G3I A;  2QNJ A;  3E46 A;  1DV0 A;  1HQY E;  2DI0 A;  4G3O A;  2JP7 A;  1ZMU A;  5JI2 E;  2QHO B;  1YLA A;  2KNA A;  3H4J A;  2BWB A;  1A5T A;  2LVO C;  1VQ1 A;  3IEC A;  2L2D A;  2LVN C;  2JNH A;  2CWB A;  1IM2 A;  3BBZ A;  1SG9 A;  2HAK A;  1GO5 A;  1WR1 B;  1QZE A;  1OTR A;  2KNZ A;  2DNA A;  3FRH A;  4DBG B;  1ZMW A;  1WHC A;  1F4I A;  2DAG A;  2DHY A;  1OAI A;  3E21 A;  2JY5 A;  1G4A E;  1C7Y A;  3FRI A;  1P3Q Q;  1T6O A;  1ZV1 A;  1IXS A;  2ZTC A;  3K9P A;  2KNV A;  2QSF X;  3GLF E;  2G3Q A;  2MGW A;  2MR9 A;  3B89 A;  1CUK A;  2O25 A;  1NV9 A;  4UN2 B;  2LVQ D;  2ZTD A;  1V92 A;  1XB2 B;  2MRO B;  1NV8 A;  2B3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...