2MR9A

Nmr structure of uba domain of dna-damage-inducible 1 protein (ddi1)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
GSATFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLFQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords DNA damage-inducible protein 1
total genus 12
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mr9A00
3GLIE 2DENA 3K9PA 1HQYE 1YLAA 2QHOB 1NV8A 1IFYA 1VEKA 2JUJA 1HJPA 1ZMUA 3F92A 2R0IA 1OKSA 2QSFX 2BWBA 3B89A 3E46A 3FRHA 1VDLA 1R4GA 3K9OA 2JNHA 2DKLA 1WR1B 1E94E 1EFUB 2DAEA 2O25A 3LCUA 3GLGE 1ZV1A 2DAKA 1XB2B 3LCVB 1G3IA 2LVAA 2B3TA 1OAIA 2OOAA 2LVQD 1ZMWA 2HWJA 2DNAA 1TTEA 2LVNC 1ZMVA 1VG5A 2JY8A 1HT2E 3FRIA 4DBGB 2MGWA 2KHHA 1XXHE 2JP7A 2JZ1A 2JY6B 2K9DA 1WGLA 1DO0A 1P3QQ 2KNZA 1KYIA 2WZJA 1TR8A 2ZTCA 3GLHE 4GEWA 1GO5A 1NV9A 2CP8A 3IHPA 2KNVA 2DAMA 1G4AE 4Q7JA 1WHCA 2LVOC 4G3OA 1T43A 4F1IA 1Q02A 1T6OA 2H5XA 3FE3A 2LBCA 3H4JA 1IM2A 1MN3A 2L4FA 2DHYA 1DO2A 5DFLA 5JI2E 2ZTDA 2K0BX 2DI0A 2KNAA 1JR3E 1Y8GA 1VQ1A 2JZ0A 2RRUA 1A5TA 3BBZA 2EKKA 2LTUA 2OOBA 2HAKA 1CUKA 2CWBA 1WIVA 2DAIA 1UFZA 2JY5A 2MR9A 2EKFA 2G3QA 2DAGA 2L4EA 2QNJA 1WGNA 1OQYA 3GLFE 4F2LA 1DV0A 3IECA 2OO9A 1PGYA 1IXSA 3MMPA 4WP2A 1G41A 2L2DA 4UN2B 4R71A 1VEGA 3T6PA 1WJ7A 1VEJA 2JY7A 2MJ5B 1C7YA 1OTRA 2EJSA 4HEOA 2DZLA 1HT1E 1BVSA 1QZEA 3E21A 2BWEA 1AIPC 1SG9A 2MROB 1F4IA 2LVPC 1V92A
chains in the Genus database with same CATH superfamily
4P17A 2C9CA 3KSJA 4RF1A 1YLAA 2CRUA 2L7IA 2R4JA 3KXEC 4IBGA 5KPTA 4MM3B 3M0EA 2QBYA 4D80A 4FVMA 2JUJA 1HJPA 3GPPA 4QOZC 2I7NA 3U6MA 4BBAA 1Q3BA 3H4MA 1TDZA 1QAQA 2KRUA 2R0IA 2F5SA 2RGOA 3VKGA 1VDDA 1R6BX 2JWSA 3B9PA 2QBYB 1XWIA 1ZAEA 1GABA 3TPZA 1GJSA 4II7A 3ZQJA 1J7KA 1N78A 2A5YB 2DKLA 1WR1B 1Z5BA 3T15A 5FTKA 2EA0A 3J81S 1PRBA 3HX3A 4GH9A 1QDTA 4S12A 4IJEA 1ZV1A 1Z5AA 3QYEA 3LVVA 2UXDM 2GNOA 1G3IA 2ZANA 4LFAM 4PDIA 2C98A 2I7PA 3KOYE 4R7GA 5FTLA 4DR7M 3U61A 3TWLA 4LFCM 4JI8M 1E32A 3GRUA 4I5SA 4G4RA 2JY8A 1HT2E 2Y20A 3GLGB 2APLA 3HU2A 3I01M 2M60A 1OAOC 3UJNA 1GVNA 1EE8A 2F4VM 3FTFA 1P3QQ 1DGBA 4MGZE 4DV7M 2XEPA 2UUCM 1NV9A 4I81A 2Y0TA 3C9PA 1NY6A 1DGGA 4AQYM 2F5QA 2FNAA 2CP8A 2ZAOA 1XMQM 1TGUA 2NQ8C 1Q3CA 4IBEA 1DGFA 4B3MM 5E26A 3L26A 1QQWA 4AI6A 2OQ4A 4IBKA 4Z8XA 5EJCA 4QNRA 4G4OA 2H1RA 1GJTA 2L09A 4G3OA 2DWZB 4NXMM 4F1IA 3FUXA 1TF0B 2Q2EB 2HHHM 1IBMM 1EIJA 1IQPA 4LJ9A 4JYAM 1IM2A 1MN3A 2L4FA 2YQZA 1DO2A 4B7HA 1L2CA 4GKKM 2E5LM 2P5TA 3JR5A 5FSWA 5ITTA 3SYKA 2JZ0A 4KLNA 3KFUG 4G4QA 4LRSA 2KW0A 2XSZD 4NRWA 2FS1A 5EXTA 4D81A 2CWBA 4IIWA 2VDBB 4GKJM 1OFIA 1IY2A 4M9ZA 3J80S 3TWMA 4LF4M 3L2AA 2L4EA 3QAUA 3AOEA 4RNAA 5FTNA 1NNUC 1N36M 1WGNA 5FLXS 3LW5F 3HJQA 3V76A 3HHYA 4OU7A 2XFTA 2EUCA 1OQYA 4IBJA 3U6EA 1D0LA 3FTDA 4X65M 1HNZM 3FUUA 2LWXA 1QANA 3AKZA 1IXSA 2BJWA 4LJ5A 4JI5M 4B08A 4LF6M 1R2YA 1X37A 4Y28F 3GLGA 1WJ7A 2BNKA 3I4YA 2LHCA 2CUZA 1OTRA 4CGYB 3CF0A 1E9RA 1HT1E 4M0WA 3E21A 2DXIA 2BWEA 4RF0A 4MGKE 3UZUA 3ZCBB 3FD9A 5LMNM 3U6SA 3FKEA 3LVWA 5FTMA 3VK8A 3KS4A 4NXNM 3U6LA 2QENA 2F5NA 3GLIE 1IXZA 2UXBM 3KOXE 2QHOB 3GQ3A 4PT5A 1PJTA 3CF6E 4IBDA 3E4RA 3HHZA 1I4WA 3Q8GA 3GLHA 1IFYA 3AJIB 1MX0A 3SASA 3KDSE 1G59A 3SAVA 4B7GA 3FRHA 3B89A 3L29A 4PDGA 5F3WA 3VFDA 3ILKA 2QPAA 2KZUA 4DV6M 2JNHA 2BJVA 2R65A 3KP0E 4JI6M 3LCUA 1R2ZA 2AHMA 1SXJB 3DFZA 1NHGC 3T1HM 2QQ8A 1XB2B 3SBJA 3LCVB 2N35A 4HL4A 1PJIA 2B3TA 4JV5M 5JI3E 4NRVA 4B3TM 2ZBKB 2LVQD 3R8FA 1XXHB 1QUSA 1ZMWA 2HWJA 2KA6B 4AZFA 1NNJA 4REZA 1TTEA 3GRYA 3J27B 4NOOB 1K82A 4LF9M 1V34A 4KT0F 5L8RF 3FRIA 3LQRA 4DBGB 2EO2A 1SXJE 3KW6A 4LGMA 1QZMA 1XXHE 2KRKA 2JP7A 4LZJA 2V6ZM 2K9DA 3FTEA 3IG5A 2CE7A 3GLHE 2VQFM 1KYIA 3SFZA 1GO5A 1OJLA 8CATA 3HZJA 4OW0A 2LXEA 3L28A 1RU3A 3ZC7B 2OPFA 3FYCA 4LJ6A 4Q7JA 3GLFA 2FH0A 1HNXM 3K1JA 1PJJA 4MGYE 2QZ4A 3KOWE 1SXJA 3U5ZA 3LQQA 2R62A 1E9SA 2R45A 2O5RA 3C58A 2L7HA 4DUZM 3VK7A 3HJSA 3SHFA 3HHWA 1UM8A 2LBCA 2XZUA 3H4JA 1IY0A 2MH8A 2WSFF 2Z4RA 3AFHA 3IG8A 5DFLA 5JI2E 3RGPA 4NL4H 4BLCA 1G71A 2X49A 2HL7A 3VKHA 2XSZA 1VQ1A 2XLJA 2R6FA 1A5TA 2EKKA 3SAWA 2OOBA 5DYGA 1SXJC 3W67A 2G5GX 2DAIA 3L27A 2DWMA 3DA1A 2JY5A 4DR5M 3W0FA 4P16A 4BB9A 4CIZA 2QNJA 5C1BA 3M7GA 1L1TA 4JI3M 4LCBA 3M6AA 3FUWA 3IECA 3U6CA 1ORYB 4DR1M 4LF5M 3MMPA 1XNQM 3AOEC 4Z6YA 4UN2B 4R71A 2FE8A 3VDPA 1TH3A 3BOSA 4LRTA 5IREB 2KXEA 2JY7A 1QYRA 1JB0F 1C7YA 2XH9A 3FUTA 1OFHA 3B7NA 5KPRA 1MU5A 2XFSA 1QZEA 1QVRA 2XF3A 3SARA 1L1ZA 4MGHA 1AIPC 1DGHB 1Z6TA 4GMQA 5ITXE 1N75A 5ITUA 2CHVA 4FWDA 1NO1A 1V92A 4R3DA 3K8ZA 4JN6A 4LFBM 1D0KA 3SC3A 4IBFA 5LMUM 2Z7JA 1V33A 3HU3A 4B7FA 1VEKA 1G8PA 4MGIE 5ITYA 1ZMUA 1W5SA 2DVWB 3A98B 2DHRA 2CV0A 1NY5A 5ITRA 4X62M 3PNVA 3WHKA 1YSYA 1R4GA 5ITXA 2F5PA 2KDLA 3AV0A 3K9OA 3KOZE 3C3DA 3W0LB 1QAMA 3U60A 4ANRA 2DAEA 2O25A 4LZZA 3UGJA 3GLGE 1WXQA 4AKHA 2DAKA 1GKIA 3PNYA 5EP3A 1IY1A 1JR3D 4LF7M 4PCZA 4L78A 5KQ8A 3SYLA 3K92A 3NBXX 2DNAA 2UUAM 4I8OA 1IBKM 1ZMVA 4IBCA 5H37D 1L2DA 2Z8YM 3C3EA 4HLQA 4IJFA 3VLFB 1Z5CA 2D7EA 2KHHA 4CJ6A 2ZM6M 3J7AS 2JZ1A 4NC6A 1GLNA 2JY6B 3CF2A 4XBOA 1IXSB 3HHXA 4GRIA 4JI1M 1DO0A 4GEWA 1TR8A 4FD2A 4DR3M 4LY6A 5EP2A 5EXPA 3UMMA 4DR2M 2KNVA 2DAMA 2R46A 5KPZA 3GLIA 2Z3XA 3MJ5A 4DV4M 2XGNA 4GC5A 1XHBA 3DZDA 3RGSA 2DWNA 3KSXA 3L25A 1Z59A 1HQCA 1L8QA 2W82A 3U6PA 2Z4SA 1H6UA 4QNMA 2CHQA 4M0DA 1IN4A 2QP9X 2CFOA 2UUBM 1JQJC 2DHYA 3THGA 4NSRA 3UK6A 2ZTDA 4JI2M 4QHTA 2YFQA 1YE9A 2DI0A 3DOAA 3RFWA 1QDRA 2Y0QA 3W68A 1AUAA 4A3VB 3I4VA 4YHHM 4G4NA 2RRUA 3HGIA 1KSFX 4FCTA 2X8AA 2G8LA 4W5WA 2CV1A 1R7RA 2LTUA 4JXJA 7CATA 1TDHA 1CUKA 1PM5A 1LV7A 3CGWA 1XC8A 1FJGM 1UFZA 2QCUA 3KVWA 2EKFA 2UXCM 2C96A 2DAGA 4MB7A 1MJGM 4L6V6 1XNRM 2X4AA 4PD2A 1HR0M 3B7ZA 3U61B 1IN6A 4X66M 4YY3M 2C5RA 1C1KA 3TL4X 3U5ZB 3GLFE 2KEBA 1LTMA 3I51A 2LH0A 4F2LA 2UU9M 2R44A 1DV0A 5DNYA 1PGYA 3E9SA 3MHVC 4ZPXA 4GITA 1DGHA 3T1YM 3AL0C 1PJQA 4OX9M 4GHLA 1VEJA 2MJ5B 4XGIA 3Q8XA 1N77A 4KODA 4LF8M 2EJSA 2CV2A 4HEOA 3D8BA 2DZLA 2CHGA 1BVSA 3HU1A 5IT9S 1TH2A 1D0MA 1FNNA 1Q39A 3LMMA 4FCVA 4M9SA 3PXGA 3T38A 2WSCF 2DZNB 2MROB 1NVMA 2R4EA 2L6OA 1F4IA 4FWHA 2LVPC 5KQDA 4AG6A 4DV1M 4KHPM 3I04M 2DENA 4NSOB 3EIHA 3K9PA 1HQYE 3PFIA 2J7NA 2V1CA 4L15A 1T3TA 1NV8A 2J5YA 3SHGB 2VQEM 4OVZB 1KFVA 4QOSA 4FW9A 3KS8A 4LGYA 5EQTA 3SMSA 1GL6A 4L8RC 3F92A 4QHSA 1OKSA 3HKPA 2QSFX 3HWSA 2YR0A 2BWBA 3E46A 3HY5A 1VDLA 3GLIB 3CTWB 2M5ZA 2VF8A 3GP1A 4DUYM 2RKOA 4G6ZA 4EIWA 1E94E 1EFUB 4IBIA 4K0KM 1IN7A 3OTOM 3JAMS 4L4UA 3PVSA 4RKUF 2R18A 2Y21A 2LVAA 3A42A 1R5LA 5EXSA 4I4LA 1OAIA 1TH4A 1ZQ9A 2FFJA 2K47A 2OOAA 2FOIC 4LJ7A 4B3SM 4AKGA 4B3RM 2ERCA 3JR4A 1IXRC 4DV3M 1J5EM 2LVNC 3FUVA 4ITQA 4LJ8A 3VDUA 1N33M 1VG5A 3J2PB 3GPYA 1QUTA 3RE8A 4AW4A 1IN8A 2C9OA 2MGWA 1IBLM 2F5OA 3J7BA 2J7OA 3A45A 2K6BA 3GLFB 2CEAA 5A2QS 1IN5A 1WGLA 2KNZA 2LHGA 2WZJA 2ZTCA 5C18A 5GKNA 4DV5M 1XXHA 2YNMD 4JI4M 2DZOB 2KZSA 3MK6A 4DV0M 3U60B 1GL7A 5EXXA 2VIIA 3IHPA 3GQ4A 1OIZA 3D8LA 1SXJD 2WSEF 1G4AE 1JR3A 4M9XA 3KP1E 1NSFA 1K3WA 2D7HA 1WHCA 2LVOC 4D82A 4GC9A 4L16A 3TE6A 4JI7M 1T43A 1W5TA 2D7GA 1D2NA 1Q02A 1T6OA 2JXNA 2H5XA 1PJSA 5FTJA 3WHLA 5IWAM 2V1UA 3FE3A 1S3SA 3U6DA 2XZFA 5DYIA 4KO8A 2K0BX 4WURA 3TQSA 5EP1A 1NJFA 1YUBA 2KNAA 1NHWC 1N34M 1JR3E 1NJGA 1Y8GA 4X64M 3GPUA 3SAUA 4JI0M 3BBZA 5IZ7D 1OIPA 2GQFA 2HAKA 3TWKA 4MH0E 3GO8A 2RGHA 1WIVA 2DWLA 4XK8F 4DV2M 4DR6M 1I94M 3B7QA 2VF7A 4LJAA 2MR9A 4IBBA 2G3QA 3NWLA 5ITQA 1N32M 3U6QA 1XMOM 3SATA 3SMPA 3GLHB 4CHTB 3FYDA 3GPXA 4FCWA 2HCBA 5BR8M 4WW0A 4AKIA 3AOGA 2OO9A 2O01F 3EIEA 3QYBA 1L2BA 4WP2A 3B74A 1G41A 2L2DA 5E6JA 3HJ8A 1K3XA 2C99A 4GHAA 1VEGA 3T6PA 5BPVA 5KO3A 2HKJA 2LNHC 1J09A 3K2LA 3R9XB 4LJ4A 2ZAMA 3BXWA 4DR4M 1QAOA 4FWGA 3U6OA 4TUWA 3QWLA 3A46A 3NBIA 4GIPA 3GQ5A 4LG2A 3FTCA 1SG9A 2JA2A 5EP4A 3ZH9B 3GRRA 1HNWM 3GRVA 4CISA 4OVZA 4AG5A
chains in the Genus database with same CATH topology
3GLIE 2DENA 3K9PA 1HQYE 1YLAA 2QHOB 1NV8A 1IFYA 1VEKA 2JUJA 1HJPA 1ZMUA 3F92A 2R0IA 1OKSA 2QSFX 2BWBA 3B89A 3E46A 3FRHA 1VDLA 1R4GA 3K9OA 2JNHA 2DKLA 1WR1B 1E94E 1EFUB 2DAEA 2O25A 3LCUA 3GLGE 1ZV1A 2DAKA 1XB2B 3LCVB 1G3IA 2LVAA 2B3TA 1OAIA 2OOAA 2LVQD 1ZMWA 2HWJA 2DNAA 1TTEA 2LVNC 1ZMVA 1VG5A 2JY8A 1HT2E 3FRIA 4DBGB 2MGWA 2KHHA 1XXHE 2JP7A 2JZ1A 2JY6B 2K9DA 1WGLA 1DO0A 1P3QQ 2KNZA 1KYIA 2WZJA 1TR8A 2ZTCA 3GLHE 4GEWA 1GO5A 1NV9A 2CP8A 3IHPA 2KNVA 2DAMA 1G4AE 4Q7JA 1WHCA 2LVOC 4G3OA 1T43A 4F1IA 1Q02A 1T6OA 2H5XA 3FE3A 2LBCA 3H4JA 1IM2A 1MN3A 2L4FA 2DHYA 1DO2A 5DFLA 5JI2E 2ZTDA 2K0BX 2DI0A 2KNAA 1JR3E 1Y8GA 1VQ1A 2JZ0A 2RRUA 1A5TA 3BBZA 2EKKA 2LTUA 2OOBA 2HAKA 1CUKA 2CWBA 1WIVA 2DAIA 1UFZA 2JY5A 2MR9A 2EKFA 2G3QA 2DAGA 2L4EA 2QNJA 1WGNA 1OQYA 3GLFE 4F2LA 1DV0A 3IECA 2OO9A 1PGYA 1IXSA 3MMPA 4WP2A 1G41A 2L2DA 4UN2B 4R71A 1VEGA 3T6PA 1WJ7A 1VEJA 2JY7A 2MJ5B 1C7YA 1OTRA 2EJSA 4HEOA 2DZLA 1HT1E 1BVSA 1QZEA 3E21A 2BWEA 1AIPC 1SG9A 2MROB 1F4IA 2LVPC 1V92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLI E;  2DEN A;  3K9P A;  1HQY E;  1YLA A;  2QHO B;  1NV8 A;  1IFY A;  1VEK A;  2JUJ A;  1HJP A;  1ZMU A;  3F92 A;  2R0I A;  1OKS A;  2QSF X;  2BWB A;  3B89 A;  3E46 A;  3FRH A;  1VDL A;  1R4G A;  3K9O A;  2JNH A;  2DKL A;  1WR1 B;  1E94 E;  1EFU B;  2DAE A;  2O25 A;  3LCU A;  3GLG E;  1ZV1 A;  2DAK A;  1XB2 B;  3LCV B;  1G3I A;  2LVA A;  2B3T A;  1OAI A;  2OOA A;  2LVQ D;  1ZMW A;  2HWJ A;  2DNA A;  1TTE A;  2LVN C;  1ZMV A;  1VG5 A;  2JY8 A;  1HT2 E;  3FRI A;  4DBG B;  2MGW A;  2KHH A;  1XXH E;  2JP7 A;  2JZ1 A;  2JY6 B;  2K9D A;  1WGL A;  1DO0 A;  1P3Q Q;  2KNZ A;  1KYI A;  2WZJ A;  1TR8 A;  2ZTC A;  3GLH E;  4GEW A;  1GO5 A;  1NV9 A;  2CP8 A;  3IHP A;  2KNV A;  2DAM A;  1G4A E;  4Q7J A;  1WHC A;  2LVO C;  4G3O A;  1T43 A;  4F1I A;  1Q02 A;  1T6O A;  2H5X A;  3FE3 A;  2LBC A;  3H4J A;  1IM2 A;  1MN3 A;  2L4F A;  2DHY A;  1DO2 A;  5DFL A;  5JI2 E;  2ZTD A;  2K0B X;  2DI0 A;  2KNA A;  1JR3 E;  1Y8G A;  1VQ1 A;  2JZ0 A;  2RRU A;  1A5T A;  3BBZ A;  2EKK A;  2LTU A;  2OOB A;  2HAK A;  1CUK A;  2CWB A;  1WIV A;  2DAI A;  1UFZ A;  2JY5 A;  2MR9 A;  2EKF A;  2G3Q A;  2DAG A;  2L4E A;  2QNJ A;  1WGN A;  1OQY A;  3GLF E;  4F2L A;  1DV0 A;  3IEC A;  2OO9 A;  1PGY A;  1IXS A;  3MMP A;  4WP2 A;  1G41 A;  2L2D A;  4UN2 B;  4R71 A;  1VEG A;  3T6P A;  1WJ7 A;  1VEJ A;  2JY7 A;  2MJ5 B;  1C7Y A;  1OTR A;  2EJS A;  4HEO A;  2DZL A;  1HT1 E;  1BVS A;  1QZE A;  3E21 A;  2BWE A;  1AIP C;  1SG9 A;  2MRO B;  1F4I A;  2LVP C;  1V92 A; 
#chains in the Genus database with same CATH topology
 4P17 A;  2C9C A;  3KSJ A;  4RF1 A;  1YLA A;  2CRU A;  2L7I A;  2R4J A;  3KXE C;  4IBG A;  5KPT A;  4MM3 B;  3M0E A;  2QBY A;  4D80 A;  4FVM A;  2JUJ A;  1HJP A;  3GPP A;  4QOZ C;  2I7N A;  3U6M A;  4BBA A;  1Q3B A;  3H4M A;  1TDZ A;  1QAQ A;  2KRU A;  2R0I A;  2F5S A;  2RGO A;  3VKG A;  1VDD A;  1R6B X;  2JWS A;  3B9P A;  2QBY B;  1XWI A;  1ZAE A;  1GAB A;  3TPZ A;  1GJS A;  4II7 A;  3ZQJ A;  1J7K A;  1N78 A;  2A5Y B;  2DKL A;  1WR1 B;  1Z5B A;  3T15 A;  5FTK A;  2EA0 A;  3J81 S;  1PRB A;  3HX3 A;  4GH9 A;  1QDT A;  4S12 A;  4IJE A;  1ZV1 A;  1Z5A A;  3QYE A;  3LVV A;  2UXD M;  2GNO A;  1G3I A;  2ZAN A;  4LFA M;  4PDI A;  2C98 A;  2I7P A;  3KOY E;  4R7G A;  5FTL A;  4DR7 M;  3U61 A;  3TWL A;  4LFC M;  4JI8 M;  1E32 A;  3GRU A;  4I5S A;  4G4R A;  2JY8 A;  1HT2 E;  2Y20 A;  3GLG B;  2APL A;  3HU2 A;  3I01 M;  2M60 A;  1OAO C;  3UJN A;  1GVN A;  1EE8 A;  2F4V M;  3FTF A;  1P3Q Q;  1DGB A;  4MGZ E;  4DV7 M;  2XEP A;  2UUC M;  1NV9 A;  4I81 A;  2Y0T A;  3C9P A;  1NY6 A;  1DGG A;  4AQY M;  2F5Q A;  2FNA A;  2CP8 A;  2ZAO A;  1XMQ M;  1TGU A;  2NQ8 C;  1Q3C A;  4IBE A;  1DGF A;  4B3M M;  5E26 A;  3L26 A;  1QQW A;  4AI6 A;  2OQ4 A;  4IBK A;  4Z8X A;  5EJC A;  4QNR A;  4G4O A;  2H1R A;  1GJT A;  2L09 A;  4G3O A;  2DWZ B;  4NXM M;  4F1I A;  3FUX A;  1TF0 B;  2Q2E B;  2HHH M;  1IBM M;  1EIJ A;  1IQP A;  4LJ9 A;  4JYA M;  1IM2 A;  1MN3 A;  2L4F A;  2YQZ A;  1DO2 A;  4B7H A;  1L2C A;  4GKK M;  2E5L M;  2P5T A;  3JR5 A;  5FSW A;  5ITT A;  3SYK A;  2JZ0 A;  4KLN A;  3KFU G;  4G4Q A;  4LRS A;  2KW0 A;  2XSZ D;  4NRW A;  2FS1 A;  5EXT A;  4D81 A;  2CWB A;  4IIW A;  2VDB B;  4GKJ M;  1OFI A;  1IY2 A;  4M9Z A;  3J80 S;  3TWM A;  4LF4 M;  3L2A A;  2L4E A;  3QAU A;  3AOE A;  4RNA A;  5FTN A;  1NNU C;  1N36 M;  1WGN A;  5FLX S;  3LW5 F;  3HJQ A;  3V76 A;  3HHY A;  4OU7 A;  2XFT A;  2EUC A;  1OQY A;  4IBJ A;  3U6E A;  1D0L A;  3FTD A;  4X65 M;  1HNZ M;  3FUU A;  2LWX A;  1QAN A;  3AKZ A;  1IXS A;  2BJW A;  4LJ5 A;  4JI5 M;  4B08 A;  4LF6 M;  1R2Y A;  1X37 A;  4Y28 F;  3GLG A;  1WJ7 A;  2BNK A;  3I4Y A;  2LHC A;  2CUZ A;  1OTR A;  4CGY B;  3CF0 A;  1E9R A;  1HT1 E;  4M0W A;  3E21 A;  2DXI A;  2BWE A;  4RF0 A;  4MGK E;  3UZU A;  3ZCB B;  3FD9 A;  5LMN M;  3U6S A;  3FKE A;  3LVW A;  5FTM A;  3VK8 A;  3KS4 A;  4NXN M;  3U6L A;  2QEN A;  2F5N A;  3GLI E;  1IXZ A;  2UXB M;  3KOX E;  2QHO B;  3GQ3 A;  4PT5 A;  1PJT A;  3CF6 E;  4IBD A;  3E4R A;  3HHZ A;  1I4W A;  3Q8G A;  3GLH A;  1IFY A;  3AJI B;  1MX0 A;  3SAS A;  3KDS E;  1G59 A;  3SAV A;  4B7G A;  3FRH A;  3B89 A;  3L29 A;  4PDG A;  5F3W A;  3VFD A;  3ILK A;  2QPA A;  2KZU A;  4DV6 M;  2JNH A;  2BJV A;  2R65 A;  3KP0 E;  4JI6 M;  3LCU A;  1R2Z A;  2AHM A;  1SXJ B;  3DFZ A;  1NHG C;  3T1H M;  2QQ8 A;  1XB2 B;  3SBJ A;  3LCV B;  2N35 A;  4HL4 A;  1PJI A;  2B3T A;  4JV5 M;  5JI3 E;  4NRV A;  4B3T M;  2ZBK B;  2LVQ D;  3R8F A;  1XXH B;  1QUS A;  1ZMW A;  2HWJ A;  2KA6 B;  4AZF A;  1NNJ A;  4REZ A;  1TTE A;  3GRY A;  3J27 B;  4NOO B;  1K82 A;  4LF9 M;  1V34 A;  4KT0 F;  5L8R F;  3FRI A;  3LQR A;  4DBG B;  2EO2 A;  1SXJ E;  3KW6 A;  4LGM A;  1QZM A;  1XXH E;  2KRK A;  2JP7 A;  4LZJ A;  2V6Z M;  2K9D A;  3FTE A;  3IG5 A;  2CE7 A;  3GLH E;  2VQF M;  1KYI A;  3SFZ A;  1GO5 A;  1OJL A;  8CAT A;  3HZJ A;  4OW0 A;  2LXE A;  3L28 A;  1RU3 A;  3ZC7 B;  2OPF A;  3FYC A;  4LJ6 A;  4Q7J A;  3GLF A;  2FH0 A;  1HNX M;  3K1J A;  1PJJ A;  4MGY E;  2QZ4 A;  3KOW E;  1SXJ A;  3U5Z A;  3LQQ A;  2R62 A;  1E9S A;  2R45 A;  2O5R A;  3C58 A;  2L7H A;  4DUZ M;  3VK7 A;  3HJS A;  3SHF A;  3HHW A;  1UM8 A;  2LBC A;  2XZU A;  3H4J A;  1IY0 A;  2MH8 A;  2WSF F;  2Z4R A;  3AFH A;  3IG8 A;  5DFL A;  5JI2 E;  3RGP A;  4NL4 H;  4BLC A;  1G71 A;  2X49 A;  2HL7 A;  3VKH A;  2XSZ A;  1VQ1 A;  2XLJ A;  2R6F A;  1A5T A;  2EKK A;  3SAW A;  2OOB A;  5DYG A;  1SXJ C;  3W67 A;  2G5G X;  2DAI A;  3L27 A;  2DWM A;  3DA1 A;  2JY5 A;  4DR5 M;  3W0F A;  4P16 A;  4BB9 A;  4CIZ A;  2QNJ A;  5C1B A;  3M7G A;  1L1T A;  4JI3 M;  4LCB A;  3M6A A;  3FUW A;  3IEC A;  3U6C A;  1ORY B;  4DR1 M;  4LF5 M;  3MMP A;  1XNQ M;  3AOE C;  4Z6Y A;  4UN2 B;  4R71 A;  2FE8 A;  3VDP A;  1TH3 A;  3BOS A;  4LRT A;  5IRE B;  2KXE A;  2JY7 A;  1QYR A;  1JB0 F;  1C7Y A;  2XH9 A;  3FUT A;  1OFH A;  3B7N A;  5KPR A;  1MU5 A;  2XFS A;  1QZE A;  1QVR A;  2XF3 A;  3SAR A;  1L1Z A;  4MGH A;  1AIP C;  1DGH B;  1Z6T A;  4GMQ A;  5ITX E;  1N75 A;  5ITU A;  2CHV A;  4FWD A;  1NO1 A;  1V92 A;  4R3D A;  3K8Z A;  4JN6 A;  4LFB M;  1D0K A;  3SC3 A;  4IBF A;  5LMU M;  2Z7J A;  1V33 A;  3HU3 A;  4B7F A;  1VEK A;  1G8P A;  4MGI E;  5ITY A;  1ZMU A;  1W5S A;  2DVW B;  3A98 B;  2DHR A;  2CV0 A;  1NY5 A;  5ITR A;  4X62 M;  3PNV A;  3WHK A;  1YSY A;  1R4G A;  5ITX A;  2F5P A;  2KDL A;  3AV0 A;  3K9O A;  3KOZ E;  3C3D A;  3W0L B;  1QAM A;  3U60 A;  4ANR A;  2DAE A;  2O25 A;  4LZZ A;  3UGJ A;  3GLG E;  1WXQ A;  4AKH A;  2DAK A;  1GKI A;  3PNY A;  5EP3 A;  1IY1 A;  1JR3 D;  4LF7 M;  4PCZ A;  4L78 A;  5KQ8 A;  3SYL A;  3K92 A;  3NBX X;  2DNA A;  2UUA M;  4I8O A;  1IBK M;  1ZMV A;  4IBC A;  5H37 D;  1L2D A;  2Z8Y M;  3C3E A;  4HLQ A;  4IJF A;  3VLF B;  1Z5C A;  2D7E A;  2KHH A;  4CJ6 A;  2ZM6 M;  3J7A S;  2JZ1 A;  4NC6 A;  1GLN A;  2JY6 B;  3CF2 A;  4XBO A;  1IXS B;  3HHX A;  4GRI A;  4JI1 M;  1DO0 A;  4GEW A;  1TR8 A;  4FD2 A;  4DR3 M;  4LY6 A;  5EP2 A;  5EXP A;  3UMM A;  4DR2 M;  2KNV A;  2DAM A;  2R46 A;  5KPZ A;  3GLI A;  2Z3X A;  3MJ5 A;  4DV4 M;  2XGN A;  4GC5 A;  1XHB A;  3DZD A;  3RGS A;  2DWN A;  3KSX A;  3L25 A;  1Z59 A;  1HQC A;  1L8Q A;  2W82 A;  3U6P A;  2Z4S A;  1H6U A;  4QNM A;  2CHQ A;  4M0D A;  1IN4 A;  2QP9 X;  2CFO A;  2UUB M;  1JQJ C;  2DHY A;  3THG A;  4NSR A;  3UK6 A;  2ZTD A;  4JI2 M;  4QHT A;  2YFQ A;  1YE9 A;  2DI0 A;  3DOA A;  3RFW A;  1QDR A;  2Y0Q A;  3W68 A;  1AUA A;  4A3V B;  3I4V A;  4YHH M;  4G4N A;  2RRU A;  3HGI A;  1KSF X;  4FCT A;  2X8A A;  2G8L A;  4W5W A;  2CV1 A;  1R7R A;  2LTU A;  4JXJ A;  7CAT A;  1TDH A;  1CUK A;  1PM5 A;  1LV7 A;  3CGW A;  1XC8 A;  1FJG M;  1UFZ A;  2QCU A;  3KVW A;  2EKF A;  2UXC M;  2C96 A;  2DAG A;  4MB7 A;  1MJG M;  4L6V 6;  1XNR M;  2X4A A;  4PD2 A;  1HR0 M;  3B7Z A;  3U61 B;  1IN6 A;  4X66 M;  4YY3 M;  2C5R A;  1C1K A;  3TL4 X;  3U5Z B;  3GLF E;  2KEB A;  1LTM A;  3I51 A;  2LH0 A;  4F2L A;  2UU9 M;  2R44 A;  1DV0 A;  5DNY A;  1PGY A;  3E9S A;  3MHV C;  4ZPX A;  4GIT A;  1DGH A;  3T1Y M;  3AL0 C;  1PJQ A;  4OX9 M;  4GHL A;  1VEJ A;  2MJ5 B;  4XGI A;  3Q8X A;  1N77 A;  4KOD A;  4LF8 M;  2EJS A;  2CV2 A;  4HEO A;  3D8B A;  2DZL A;  2CHG A;  1BVS A;  3HU1 A;  5IT9 S;  1TH2 A;  1D0M A;  1FNN A;  1Q39 A;  3LMM A;  4FCV A;  4M9S A;  3PXG A;  3T38 A;  2WSC F;  2DZN B;  2MRO B;  1NVM A;  2R4E A;  2L6O A;  1F4I A;  4FWH A;  2LVP C;  5KQD A;  4AG6 A;  4DV1 M;  4KHP M;  3I04 M;  2DEN A;  4NSO B;  3EIH A;  3K9P A;  1HQY E;  3PFI A;  2J7N A;  2V1C A;  4L15 A;  1T3T A;  1NV8 A;  2J5Y A;  3SHG B;  2VQE M;  4OVZ B;  1KFV A;  4QOS A;  4FW9 A;  3KS8 A;  4LGY A;  5EQT A;  3SMS A;  1GL6 A;  4L8R C;  3F92 A;  4QHS A;  1OKS A;  3HKP A;  2QSF X;  3HWS A;  2YR0 A;  2BWB A;  3E46 A;  3HY5 A;  1VDL A;  3GLI B;  3CTW B;  2M5Z A;  2VF8 A;  3GP1 A;  4DUY M;  2RKO A;  4G6Z A;  4EIW A;  1E94 E;  1EFU B;  4IBI A;  4K0K M;  1IN7 A;  3OTO M;  3JAM S;  4L4U A;  3PVS A;  4RKU F;  2R18 A;  2Y21 A;  2LVA A;  3A42 A;  1R5L A;  5EXS A;  4I4L A;  1OAI A;  1TH4 A;  1ZQ9 A;  2FFJ A;  2K47 A;  2OOA A;  2FOI C;  4LJ7 A;  4B3S M;  4AKG A;  4B3R M;  2ERC A;  3JR4 A;  1IXR C;  4DV3 M;  1J5E M;  2LVN C;  3FUV A;  4ITQ A;  4LJ8 A;  3VDU A;  1N33 M;  1VG5 A;  3J2P B;  3GPY A;  1QUT A;  3RE8 A;  4AW4 A;  1IN8 A;  2C9O A;  2MGW A;  1IBL M;  2F5O A;  3J7B A;  2J7O A;  3A45 A;  2K6B A;  3GLF B;  2CEA A;  5A2Q S;  1IN5 A;  1WGL A;  2KNZ A;  2LHG A;  2WZJ A;  2ZTC A;  5C18 A;  5GKN A;  4DV5 M;  1XXH A;  2YNM D;  4JI4 M;  2DZO B;  2KZS A;  3MK6 A;  4DV0 M;  3U60 B;  1GL7 A;  5EXX A;  2VII A;  3IHP A;  3GQ4 A;  1OIZ A;  3D8L A;  1SXJ D;  2WSE F;  1G4A E;  1JR3 A;  4M9X A;  3KP1 E;  1NSF A;  1K3W A;  2D7H A;  1WHC A;  2LVO C;  4D82 A;  4GC9 A;  4L16 A;  3TE6 A;  4JI7 M;  1T43 A;  1W5T A;  2D7G A;  1D2N A;  1Q02 A;  1T6O A;  2JXN A;  2H5X A;  1PJS A;  5FTJ A;  3WHL A;  5IWA M;  2V1U A;  3FE3 A;  1S3S A;  3U6D A;  2XZF A;  5DYI A;  4KO8 A;  2K0B X;  4WUR A;  3TQS A;  5EP1 A;  1NJF A;  1YUB A;  2KNA A;  1NHW C;  1N34 M;  1JR3 E;  1NJG A;  1Y8G A;  4X64 M;  3GPU A;  3SAU A;  4JI0 M;  3BBZ A;  5IZ7 D;  1OIP A;  2GQF A;  2HAK A;  3TWK A;  4MH0 E;  3GO8 A;  2RGH A;  1WIV A;  2DWL A;  4XK8 F;  4DV2 M;  4DR6 M;  1I94 M;  3B7Q A;  2VF7 A;  4LJA A;  2MR9 A;  4IBB A;  2G3Q A;  3NWL A;  5ITQ A;  1N32 M;  3U6Q A;  1XMO M;  3SAT A;  3SMP A;  3GLH B;  4CHT B;  3FYD A;  3GPX A;  4FCW A;  2HCB A;  5BR8 M;  4WW0 A;  4AKI A;  3AOG A;  2OO9 A;  2O01 F;  3EIE A;  3QYB A;  1L2B A;  4WP2 A;  3B74 A;  1G41 A;  2L2D A;  5E6J A;  3HJ8 A;  1K3X A;  2C99 A;  4GHA A;  1VEG A;  3T6P A;  5BPV A;  5KO3 A;  2HKJ A;  2LNH C;  1J09 A;  3K2L A;  3R9X B;  4LJ4 A;  2ZAM A;  3BXW A;  4DR4 M;  1QAO A;  4FWG A;  3U6O A;  4TUW A;  3QWL A;  3A46 A;  3NBI A;  4GIP A;  3GQ5 A;  4LG2 A;  3FTC A;  1SG9 A;  2JA2 A;  5EP4 A;  3ZH9 B;  3GRR A;  1HNW M;  3GRV A;  4CIS A;  4OVZ A;  4AG5 A; 
#chains in the Genus database with same CATH homology
 3GLI E;  2DEN A;  3K9P A;  1HQY E;  1YLA A;  2QHO B;  1NV8 A;  1IFY A;  1VEK A;  2JUJ A;  1HJP A;  1ZMU A;  3F92 A;  2R0I A;  1OKS A;  2QSF X;  2BWB A;  3B89 A;  3E46 A;  3FRH A;  1VDL A;  1R4G A;  3K9O A;  2JNH A;  2DKL A;  1WR1 B;  1E94 E;  1EFU B;  2DAE A;  2O25 A;  3LCU A;  3GLG E;  1ZV1 A;  2DAK A;  1XB2 B;  3LCV B;  1G3I A;  2LVA A;  2B3T A;  1OAI A;  2OOA A;  2LVQ D;  1ZMW A;  2HWJ A;  2DNA A;  1TTE A;  2LVN C;  1ZMV A;  1VG5 A;  2JY8 A;  1HT2 E;  3FRI A;  4DBG B;  2MGW A;  2KHH A;  1XXH E;  2JP7 A;  2JZ1 A;  2JY6 B;  2K9D A;  1WGL A;  1DO0 A;  1P3Q Q;  2KNZ A;  1KYI A;  2WZJ A;  1TR8 A;  2ZTC A;  3GLH E;  4GEW A;  1GO5 A;  1NV9 A;  2CP8 A;  3IHP A;  2KNV A;  2DAM A;  1G4A E;  4Q7J A;  1WHC A;  2LVO C;  4G3O A;  1T43 A;  4F1I A;  1Q02 A;  1T6O A;  2H5X A;  3FE3 A;  2LBC A;  3H4J A;  1IM2 A;  1MN3 A;  2L4F A;  2DHY A;  1DO2 A;  5DFL A;  5JI2 E;  2ZTD A;  2K0B X;  2DI0 A;  2KNA A;  1JR3 E;  1Y8G A;  1VQ1 A;  2JZ0 A;  2RRU A;  1A5T A;  3BBZ A;  2EKK A;  2LTU A;  2OOB A;  2HAK A;  1CUK A;  2CWB A;  1WIV A;  2DAI A;  1UFZ A;  2JY5 A;  2MR9 A;  2EKF A;  2G3Q A;  2DAG A;  2L4E A;  2QNJ A;  1WGN A;  1OQY A;  3GLF E;  4F2L A;  1DV0 A;  3IEC A;  2OO9 A;  1PGY A;  1IXS A;  3MMP A;  4WP2 A;  1G41 A;  2L2D A;  4UN2 B;  4R71 A;  1VEG A;  3T6P A;  1WJ7 A;  1VEJ A;  2JY7 A;  2MJ5 B;  1C7Y A;  1OTR A;  2EJS A;  4HEO A;  2DZL A;  1HT1 E;  1BVS A;  1QZE A;  3E21 A;  2BWE A;  1AIP C;  1SG9 A;  2MRO B;  1F4I A;  2LVP C;  1V92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...