2MR9A

Nmr structure of uba domain of dna-damage-inducible 1 protein (ddi1)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
b'GSATFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLFQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA damage-inducible protein 1
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 12
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mr9A00
1GO5A 1HT2E 4GEWA 2QNJA 1G3IA 1BVSA 1VDLA 2OO9A 1T6OA 1XB2B 2H5XA 2R0IA 2BWBA 3F92A 2JNHA 3E46A 2DAEA 2QHOB 2OOBA 4R71A 3FE3A 2MROB 1Y8GA 1OTRA 2DNAA 2LVQD 2JP7A 1OQYA 2CWBA 3BBZA 4DBGB 2HWJA 2EKFA 4F2LA 2JY5A 2DZLA 5DFLA 2B3TA 1VG5A 2DAMA 2JUJA 1OAIA 3LCVB 2DAKA 2JZ1A 1ZMUA 2MJ5B 2LVOC 2DI0A 1CUKA 2EJSA 4Q7JA 2RRUA 1EFUB 1F4IA 2JZ0A 2L4FA 3LCUA 1T43A 1AIPC 1R4GA 3IECA 1JR3E 1QZEA 1PGYA 1HT1E 2K0BX 2CP8A 1NV8A 2DAGA 2JY8A 1V92A 1VEJA 2LBCA 4G3OA 1OKSA 1SG9A 1A5TA 1YLAA 1E94E 1MN3A 2MGWA 3K9OA 2QSFX 2KHHA 2ZTDA 3IHPA 4UN2B 1WJ7A 1ZV1A 5JI2E 1ZMVA 1IXSA 2L4EA 2K9DA 2JY7A 4F1IA 2DKLA 1HJPA 1DO0A 2G3QA 1WIVA 2LVAA 2KNVA 3GLHE 2KNZA 1HQYE 2HAKA 3T6PA 1DV0A 1P3QQ 3FRHA 2DHYA 4WP2A 2LTUA 3GLIE 1TR8A 3E21A 1VQ1A 1TTEA 3GLFE 2ZTCA 1WGLA 2KNAA 1Q02A 1WGNA 1VEGA 3MMPA 2BWEA 2LVPC 1KYIA 1IFYA 2JY6B 2WZJA 3B89A 1UFZA 1WR1B 1G41A 2EKKA 1NV9A 2L2DA 3H4JA 1XXHE 2MR9A 1IM2A 3GLGE 2LVNC 3K9PA 2O25A 2OOAA 3FRIA 1DO2A 1ZMWA 1WHCA 4HEOA 1VEKA 2DENA 1C7YA 2DAIA 1G4AE
chains in the Genus database with same CATH superfamily
4DR7M 3I01M 3GLHB 4GHAA 2ZM6M 2QNJA 3UK6A 1VDLA 4DV5M 3W67A 4B3RM 2OO9A 2C9CA 1L8QA 1AUAA 1GKIA 2BWBA 3U5ZA 3HU1A 1L2CA 5ITUA 2I7NA 4R71A 4DV2M 1NHGC 3GLFB 3C3EA 4HL4A 4WW0A 4B3SM 3MHVC 5IWAM 1QQWA 1E32A 1K3XA 2HL7A 1TDZA 5KPTA 4JI0M 3AOGA 2CRUA 2CWBA 2BNKA 4DBGB 2JXNA 4X66M 3SYKA 1QYRA 2FOIC 4F2LA 2JY5A 4LGYA 5DNYA 3U60B 1EIJA 1J09A 2DZLA 2QENA 2R46A 5A2QS 3A42A 4ANRA 1J5EM 2B3TA 3CF2A 2DWLA 2DZNB 4W5WA 2DAMA 2XGNA 2OQ4A 2DAKA 1DGFA 5C18A 5ITQA 1Z6TA 3VFDA 2WSCF 4L78A 5KPZA 2LHGA 3FUUA 2RRUA 1EFUB 1MX0A 3IG8A 3J80S 3KFUG 4LY6A 4L16A 1IXSB 1GL7A 4LGMA 3IECA 4REZA 1JR3E 4MB7A 1QZEA 1DGHB 2X8AA 3NBIA 3RGSA 3U6OA 2Y20A 5LMNM 1NV8A 2ZAMA 1IY2A 3SC3A 4GHLA 2DAGA 5ITRA 2FFJA 5FTNA 5FTKA 1VEJA 4D80A 5FTLA 1NSFA 4CIZA 4I4LA 3A46A 1SXJA 2D7GA 2FNAA 2KHHA 3OTOM 4DR4M 4K0KM 3HX3A 3FUWA 5IZ7D 1Z59A 1GL6A 5JI2E 1E9RA 1TH2A 2L4EA 4DV1M 3KS8A 2XZUA 4S12A 2R65A 4YY3M 2EUCA 1R7RA 3GRUA 4MH0E 3U5ZB 3KDSE 4AZFA 3A45A 3U6SA 4JI8M 4NXMM 2KW0A 2LVAA 3U6DA 2KNVA 4BLCA 2RKOA 3D8LA 3GLHE 2DWNA 3LVVA 1T3TA 3GRYA 5EP3A 3ZH9B 4DV3M 1XWIA 2Y0QA 1DV0A 3EIEA 2Z3XA 2CV2A 1GVNA 1K82A 3R9XB 1NJGA 3PNYA 4CJ6A 4IBEA 3GLFE 4OVZA 1WGLA 5EXSA 3L26A 4DR3M 1Q02A 1WGNA 1ZAEA 1Z5AA 2C98A 2XSZD 3GPYA 3HY5A 2I7PA 3I04M 3K2LA 4RKUF 2V1UA 3AV0A 1FNNA 3AOEA 4D82A 1QUTA 3KXEC 3L27A 4B7HA 1XHBA 5DYIA 1RU3A 2DWZB 4G4NA 3L29A 5ITXA 1Q3BA 1G41A 3H4JA 3MK6A 1TGUA 3SAUA 3CF0A 1HNXM 5F3WA 1IM2A 2X49A 3HHYA 3HU2A 3I4YA 4QNRA 2UU9M 3PXGA 3K9PA 4DV0M 2OOAA 2L7IA 3HJSA 2WSEF 3U6MA 2F4VM 4CHTB 4II7A 2DZOB 3UZUA 1GLNA 3TQSA 2R62A 3V76A 3M6AA 1XMOM 2YQZA 4DUYM 1L1TA 2O5RA 1SXJB 1HT2E 4NL4H 1F4IA 3KSJA 1BVSA 4PCZA 5FSWA 1TH4A 3B7QA 1N33M 2DVWB 4LRSA 2R0IA 1NVMA 4GH9A 3GP1A 3SHFA 4MM3B 4G4QA 4FVMA 4FCWA 4GC5A 5L8RF 2QCUA 2KZUA 2AHMA 2LVQD 2UUCM 3HZJA 3AL0C 1OQYA 3K8ZA 2HWJA 3FTEA 2ZANA 5EJCA 3U6LA 2KA6B 2UUBM 3GRVA 3PFIA 2R44A 4I8OA 4GKKM 1KSFX 2KZSA 1OFIA 2R45A 3T15A 2CE7A 4PDIA 4XGIA 3GLGB 2C9OA 2LVOC 2CHGA 3Q8GA 2DI0A 1IXZA 4FCVA 1HQCA 1S3SA 2Y0TA 3J2PB 1OFHA 2JZ0A 3LCUA 3KP1E 3TL4X 3T1HM 1KFVA 4JI1M 5KQDA 3SATA 3L2AA 3VLFB 8CATA 4GKJM 1HT1E 4M0DA 4NSRA 1QZMA 3E9SA 2CEAA 2J5YA 4JN6A 3KS4A 4KHPM 1YE9A 2CUZA 4GITA 1G8PA 4NXNM 2XLJA 3VK7A 1XC8A 2LXEA 2YR0A 2N35A 2JY8A 3H4MA 2L7HA 4FWDA 2LBCA 2VQFM 1LTMA 3SYLA 1A5TA 1R5LA 1E94E 2MGWA 3K9OA 3W0LB 3HHZA 2QSFX 4AKHA 1IY1A 3WHKA 4JI4M 3RFWA 1D0MA 4B08A 3IHPA 4JI6M 4JV5M 3R8FA 1XNRM 3LQQA 1ORYB 3FUTA 3I51A 4FCTA 2APLA 1ZMVA 4GRIA 2JY7A 3GLIA 4IBIA 4F1IA 4IBGA 3CGWA 2XSZA 1DO0A 3D8BA 4LF9M 2G3QA 4X62M 2HCBA 3HU3A 3GPUA 3U61A 1SXJE 4LF8M 2H1RA 4FWHA 4NOOB 3BXWA 2ERCA 3FRHA 2O01F 4LJ7A 2LTUA 4WP2A 1I94M 2XEPA 1IY0A 4JYAM 3AKZA 1TTEA 1LV7A 4KO8A 3TPZA 1V33A 4IJFA 4A3VB 4LFBM 3JAMS 3LVWA 5EP4A 2LVPC 4L15A 4LF6M 4NC6A 1SXJC 2JY6B 3B89A 5FTJA 2R18A 2YNMD 4LG2A 3A98B 4MGYE 1WR1B 1IN6A 2L2DA 2J7OA 3HHXA 1N32M 1JQJC 2BJVA 1XNQM 2K6BA 5FTMA 3GLGE 4P16A 2RGOA 3K1JA 4L8RC 4LZZA 2K47A 4R3DA 1WHCA 2M60A 1HR0M 2MH8A 1R2ZA 1I4WA 1C7YA 3KOWE 4B7FA 4IBKA 4GEWA 2KDLA 3DA1A 1VDDA 3JR5A 4AG5A 1XB2B 4PD2A 2H5XA 1HNZM 3ZC7B 1N34M 1NJFA 4CGYB 3GLIB 2DAEA 3U6CA 4JI5M 3RE8A 2UXBM 2OOBA 3SMSA 4AW4A 4AG6A 3FE3A 4RF1A 4KLNA 3FTFA 1PRBA 1Y8GA 1G71A 1N78A 3AOEC 1J7KA 3QWLA 1JB0F 3TWLA 5LMUM 3GO8A 2EA0A 2G8LA 4G4OA 3Q8XA 1Z5CA 2F5NA 4JI2M 1Z5BA 1QAMA 4MGHA 3QAUA 2V1CA 3QYBA 3JR4A 3J7AS 1QANA 2XF3A 3ZQJA 3SARA 2RGHA 3GLHA 5DFLA 3GQ5A 4DV7M 2DXIA 3C9PA 3M0EA 4GC9A 5ITTA 2CHQA 1PJTA 2JZ1A 2UXCM 1CUKA 2EJSA 4Q7JA 3SFZA 2F5OA 4DUZM 3J7BA 1T43A 3AJIB 3C3DA 1R4GA 5EQTA 5GKNA 1JR3D 2QP9X 4IBBA 5C1BA 1Q39A 4QOZC 2K0BX 2R4JA 4LFAM 1D0KA 3FYCA 2CP8A 3KOYE 4LFCM 4DR5M 3I4VA 4DV4M 3U60A 5H37D 4WURA 1TF0B 3VDUA 1ZQ9A 4FD2A 3W68A 1NNUC 1SG9A 1YLAA 2CHVA 3AFHA 3LW5F 4M9SA 3T1YM 3WHLA 2QBYA 2XFTA 2R4EA 4Y28F 1D2NA 1E9SA 3B9PA 3VK8A 1IN5A 3C58A 4OVZB 1R6BX 5KPRA 1WJ7A 1OIZA 1ZV1A 5BR8M 4DV6M 3U6QA 1IXSA 4FWGA 4LCBA 4D81A 1IXRC 1IN8A 4I5SA 1HJPA 3MJ5A 2CV0A 1V34A 3KOZE 1XMQM 1UM8A 3GPPA 3VKGA 1IQPA 3FTDA 3ZCBB 1NY5A 3DOAA 3B74A 3T6PA 1GJTA 4LJ6A 3K92A 3IG5A 1MJGM 1PJIA 2VDBB 4LJ4A 3DFZA 4IBDA 1YUBA 4DR2M 3GLIE 1QUSA 1XXHA 3J27B 4QNMA 1VQ1A 4X64M 4NSOB 2ZTCA 4IBFA 2HKJA 3MMPA 2J7NA 2VIIA 2OPFA 2BWEA 4BB9A 5DYGA 1NHWC 3KOXE 1KYIA 3NBXX 1PM5A 4R7GA 1UFZA 4TUWA 4LRTA 2KRUA 1FJGM 1NV9A 1L1ZA 2LH0A 4LF5M 4ZPXA 3HGIA 4OW0A 2LVNC 4QHTA 4HLQA 1QAOA 3GQ4A 3FRIA 1DO2A 7CATA 4HEOA 2G5GX 1NNJA 2QPAA 4B3MM 4M0WA 2HHHM 2Q2EB 3L28A 2DAIA 1G4AE 3NWLA 3SHGB 3VDPA 4QOSA 5BPVA 2QBYB 4EIWA 1GO5A 2ZAOA 5IT9S 4IBCA 4Z8XA 1QDRA 1G3IA 4G4RA 1PJQA 1T6OA 4L6V6 3L25A 3F92A 2JNHA 3E46A 2ZBKB 2JA2A 2QHOB 3VKHA 4QHSA 2Z7JA 2KXEA 4JI3M 2EO2A 2MROB 4GIPA 1OTRA 5EP2A 2DNAA 3SBJA 2JP7A 2P5TA 4XBOA 3HJ8A 2YFQA 3BBZA 3HKPA 4L4UA 1JR3A 2EKFA 2UXDM 3GQ3A 5IREB 3KSXA 3T38A 1IBLM 4P17A 3SASA 4BBAA 1OIPA 2R6FA 2F5SA 5ITYA 1Q3CA 1YSYA 2A5YB 3HJQA 1W5SA 2BJWA 1XXHB 2W82A 4PDGA 1NY6A 1VG5A 2JUJA 2LNHC 1OAIA 1N75A 4JXJA 3LCVB 5JI3E 2XZFA 5ITXE 1ZMUA 2E5LM 2MJ5B 1QVRA 2L09A 2KRKA 2VF7A 4MGKE 4NRVA 3CF6E 2L4FA 3UMMA 3GPXA 2F5PA 1AIPC 1DGBA 3LQRA 3PVSA 4RF0A 2FS1A 3U6EA 5KQ8A 2C5RA 1HNWM 2CV1A 4Z6YA 2M5ZA 3U6PA 4PT5A 1C1KA 1PGYA 4OX9M 3DZDA 2LWXA 4B7GA 2GNOA 3KP0E 3QYEA 1D0LA 1PJSA 2Z4SA 3U61B 1L2BA 2FH0A 1G59A 1V92A 4G3OA 1OKSA 4MGIE 1H6UA 4ITQA 3FD9A 1MN3A 3E4RA 5E26A 3GLGA 2WSFF 3FKEA 2UUAM 1IBMM 4AQYM 2GQFA 1EE8A 2ZTDA 1N36M 3SAVA 4LF4M 3B7NA 4UN2B 2Z8YM 3HWSA 4LJ5A 3M7GA 4LJAA 3UJNA 4AI6A 1QAQA 2K9DA 3LMMA 4IJEA 3KVWA 4IIWA 4M9XA 2D7HA 1OJLA 3GLFA 1NO1A 2DKLA 2Z4RA 1MU5A 2QQ8A 3KW6A 1K3WA 4B3TM 3PNVA 3RGPA 2V6ZM 1WIVA 3TE6A 2NQ8C 4YHHM 4MGZE 1IN4A 1SXJD 4GMQA 2KNZA 3W0FA 5EXTA 1HQYE 2HAKA 3BOSA 4RNAA 3SMPA 4M9ZA 4AKGA 1GABA 4X65M 3FUVA 3TWKA 2C99A 1P3QQ 3THGA 2DHYA 2KEBA 2FE8A 3FTCA 3UGJA 3HHWA 1TR8A 3E21A 2DHRA 1L2DA 3J81S 2KNAA 2CFOA 1X37A 5EXPA 1VEGA 3ILKA 1R2YA 3EIHA 2QZ4A 4LZJA 3SAWA 1IN7A 1DGGA 1WXQA 4LJ8A 4DR1M 2VQEM 1IFYA 2WZJA 4LF7M 4AKIA 3B7ZA 1QDTA 1DGHA 2X4AA 4KT0F 5EXXA 5FLXS 4LJ9A 2JWSA 4FW9A 1IBKM 2DWMA 2EKKA 2XH9A 5KO3A 4DR6M 2LHCA 4KODA 2F5QA 1TH3A 1XXHE 2MR9A 3FUXA 3FYDA 3GRRA 4OU7A 4CISA 1TDHA 1GJSA 2VF8A 5E6JA 3TWMA 2L6OA 1OAOC 2XFSA 2O25A 4NRWA 1N77A 2C96A 4I81A 1ZMWA 4IBJA 4XK8F 1PJJA 2Y21A 4JI7M 5EP1A 1VEKA 3CTWB 2D7EA 2DENA 1W5TA 4G6ZA
chains in the Genus database with same CATH topology
1GO5A 1HT2E 4GEWA 2QNJA 1G3IA 1BVSA 1VDLA 2OO9A 1T6OA 1XB2B 2H5XA 2R0IA 2BWBA 3F92A 2JNHA 3E46A 2DAEA 2QHOB 2OOBA 4R71A 3FE3A 2MROB 1Y8GA 1OTRA 2DNAA 2LVQD 2JP7A 1OQYA 2CWBA 3BBZA 4DBGB 2HWJA 2EKFA 4F2LA 2JY5A 2DZLA 5DFLA 2B3TA 1VG5A 2DAMA 2JUJA 1OAIA 3LCVB 2DAKA 2JZ1A 1ZMUA 2MJ5B 2LVOC 2DI0A 1CUKA 2EJSA 4Q7JA 2RRUA 1EFUB 1F4IA 2JZ0A 2L4FA 3LCUA 1T43A 1AIPC 1R4GA 3IECA 1JR3E 1QZEA 1PGYA 1HT1E 2K0BX 2CP8A 1NV8A 2DAGA 2JY8A 1V92A 1VEJA 2LBCA 4G3OA 1OKSA 1SG9A 1A5TA 1YLAA 1E94E 1MN3A 2MGWA 3K9OA 2QSFX 2KHHA 2ZTDA 3IHPA 4UN2B 1WJ7A 1ZV1A 5JI2E 1ZMVA 1IXSA 2L4EA 2K9DA 2JY7A 4F1IA 2DKLA 1HJPA 1DO0A 2G3QA 1WIVA 2LVAA 2KNVA 3GLHE 2KNZA 1HQYE 2HAKA 3T6PA 1DV0A 1P3QQ 3FRHA 2DHYA 4WP2A 2LTUA 3GLIE 1TR8A 3E21A 1VQ1A 1TTEA 3GLFE 2ZTCA 1WGLA 2KNAA 1Q02A 1WGNA 1VEGA 3MMPA 2BWEA 2LVPC 1KYIA 1IFYA 2JY6B 2WZJA 3B89A 1UFZA 1WR1B 1G41A 2EKKA 1NV9A 2L2DA 3H4JA 1XXHE 2MR9A 1IM2A 3GLGE 2LVNC 3K9PA 2O25A 2OOAA 3FRIA 1DO2A 1ZMWA 1WHCA 4HEOA 1VEKA 2DENA 1C7YA 2DAIA 1G4AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO5 A;  1HT2 E;  4GEW A;  2QNJ A;  1G3I A;  1BVS A;  1VDL A;  2OO9 A;  1T6O A;  1XB2 B;  2H5X A;  2R0I A;  2BWB A;  3F92 A;  2JNH A;  3E46 A;  2DAE A;  2QHO B;  2OOB A;  4R71 A;  3FE3 A;  2MRO B;  1Y8G A;  1OTR A;  2DNA A;  2LVQ D;  2JP7 A;  1OQY A;  2CWB A;  3BBZ A;  4DBG B;  2HWJ A;  2EKF A;  4F2L A;  2JY5 A;  2DZL A;  5DFL A;  2B3T A;  1VG5 A;  2DAM A;  2JUJ A;  1OAI A;  3LCV B;  2DAK A;  2JZ1 A;  1ZMU A;  2MJ5 B;  2LVO C;  2DI0 A;  1CUK A;  2EJS A;  4Q7J A;  2RRU A;  1EFU B;  1F4I A;  2JZ0 A;  2L4F A;  3LCU A;  1T43 A;  1AIP C;  1R4G A;  3IEC A;  1JR3 E;  1QZE A;  1PGY A;  1HT1 E;  2K0B X;  2CP8 A;  1NV8 A;  2DAG A;  2JY8 A;  1V92 A;  1VEJ A;  2LBC A;  4G3O A;  1OKS A;  1SG9 A;  1A5T A;  1YLA A;  1E94 E;  1MN3 A;  2MGW A;  3K9O A;  2QSF X;  2KHH A;  2ZTD A;  3IHP A;  4UN2 B;  1WJ7 A;  1ZV1 A;  5JI2 E;  1ZMV A;  1IXS A;  2L4E A;  2K9D A;  2JY7 A;  4F1I A;  2DKL A;  1HJP A;  1DO0 A;  2G3Q A;  1WIV A;  2LVA A;  2KNV A;  3GLH E;  2KNZ A;  1HQY E;  2HAK A;  3T6P A;  1DV0 A;  1P3Q Q;  3FRH A;  2DHY A;  4WP2 A;  2LTU A;  3GLI E;  1TR8 A;  3E21 A;  1VQ1 A;  1TTE A;  3GLF E;  2ZTC A;  1WGL A;  2KNA A;  1Q02 A;  1WGN A;  1VEG A;  3MMP A;  2BWE A;  2LVP C;  1KYI A;  1IFY A;  2JY6 B;  2WZJ A;  3B89 A;  1UFZ A;  1WR1 B;  1G41 A;  2EKK A;  1NV9 A;  2L2D A;  3H4J A;  1XXH E;  2MR9 A;  1IM2 A;  3GLG E;  2LVN C;  3K9P A;  2O25 A;  2OOA A;  3FRI A;  1DO2 A;  1ZMW A;  1WHC A;  4HEO A;  1VEK A;  2DEN A;  1C7Y A;  2DAI A;  1G4A E; 
#chains in the Genus database with same CATH topology
 4DR7 M;  3I01 M;  3GLH B;  4GHA A;  2ZM6 M;  2QNJ A;  3UK6 A;  1VDL A;  4DV5 M;  3W67 A;  4B3R M;  2OO9 A;  2C9C A;  1L8Q A;  1AUA A;  1GKI A;  2BWB A;  3U5Z A;  3HU1 A;  1L2C A;  5ITU A;  2I7N A;  4R71 A;  4DV2 M;  1NHG C;  3GLF B;  3C3E A;  4HL4 A;  4WW0 A;  4B3S M;  3MHV C;  5IWA M;  1QQW A;  1E32 A;  1K3X A;  2HL7 A;  1TDZ A;  5KPT A;  4JI0 M;  3AOG A;  2CRU A;  2CWB A;  2BNK A;  4DBG B;  2JXN A;  4X66 M;  3SYK A;  1QYR A;  2FOI C;  4F2L A;  2JY5 A;  4LGY A;  5DNY A;  3U60 B;  1EIJ A;  1J09 A;  2DZL A;  2QEN A;  2R46 A;  5A2Q S;  3A42 A;  4ANR A;  1J5E M;  2B3T A;  3CF2 A;  2DWL A;  2DZN B;  4W5W A;  2DAM A;  2XGN A;  2OQ4 A;  2DAK A;  1DGF A;  5C18 A;  5ITQ A;  1Z6T A;  3VFD A;  2WSC F;  4L78 A;  5KPZ A;  2LHG A;  3FUU A;  2RRU A;  1EFU B;  1MX0 A;  3IG8 A;  3J80 S;  3KFU G;  4LY6 A;  4L16 A;  1IXS B;  1GL7 A;  4LGM A;  3IEC A;  4REZ A;  1JR3 E;  4MB7 A;  1QZE A;  1DGH B;  2X8A A;  3NBI A;  3RGS A;  3U6O A;  2Y20 A;  5LMN M;  1NV8 A;  2ZAM A;  1IY2 A;  3SC3 A;  4GHL A;  2DAG A;  5ITR A;  2FFJ A;  5FTN A;  5FTK A;  1VEJ A;  4D80 A;  5FTL A;  1NSF A;  4CIZ A;  4I4L A;  3A46 A;  1SXJ A;  2D7G A;  2FNA A;  2KHH A;  3OTO M;  4DR4 M;  4K0K M;  3HX3 A;  3FUW A;  5IZ7 D;  1Z59 A;  1GL6 A;  5JI2 E;  1E9R A;  1TH2 A;  2L4E A;  4DV1 M;  3KS8 A;  2XZU A;  4S12 A;  2R65 A;  4YY3 M;  2EUC A;  1R7R A;  3GRU A;  4MH0 E;  3U5Z B;  3KDS E;  4AZF A;  3A45 A;  3U6S A;  4JI8 M;  4NXM M;  2KW0 A;  2LVA A;  3U6D A;  2KNV A;  4BLC A;  2RKO A;  3D8L A;  3GLH E;  2DWN A;  3LVV A;  1T3T A;  3GRY A;  5EP3 A;  3ZH9 B;  4DV3 M;  1XWI A;  2Y0Q A;  1DV0 A;  3EIE A;  2Z3X A;  2CV2 A;  1GVN A;  1K82 A;  3R9X B;  1NJG A;  3PNY A;  4CJ6 A;  4IBE A;  3GLF E;  4OVZ A;  1WGL A;  5EXS A;  3L26 A;  4DR3 M;  1Q02 A;  1WGN A;  1ZAE A;  1Z5A A;  2C98 A;  2XSZ D;  3GPY A;  3HY5 A;  2I7P A;  3I04 M;  3K2L A;  4RKU F;  2V1U A;  3AV0 A;  1FNN A;  3AOE A;  4D82 A;  1QUT A;  3KXE C;  3L27 A;  4B7H A;  1XHB A;  5DYI A;  1RU3 A;  2DWZ B;  4G4N A;  3L29 A;  5ITX A;  1Q3B A;  1G41 A;  3H4J A;  3MK6 A;  1TGU A;  3SAU A;  3CF0 A;  1HNX M;  5F3W A;  1IM2 A;  2X49 A;  3HHY A;  3HU2 A;  3I4Y A;  4QNR A;  2UU9 M;  3PXG A;  3K9P A;  4DV0 M;  2OOA A;  2L7I A;  3HJS A;  2WSE F;  3U6M A;  2F4V M;  4CHT B;  4II7 A;  2DZO B;  3UZU A;  1GLN A;  3TQS A;  2R62 A;  3V76 A;  3M6A A;  1XMO M;  2YQZ A;  4DUY M;  1L1T A;  2O5R A;  1SXJ B;  1HT2 E;  4NL4 H;  1F4I A;  3KSJ A;  1BVS A;  4PCZ A;  5FSW A;  1TH4 A;  3B7Q A;  1N33 M;  2DVW B;  4LRS A;  2R0I A;  1NVM A;  4GH9 A;  3GP1 A;  3SHF A;  4MM3 B;  4G4Q A;  4FVM A;  4FCW A;  4GC5 A;  5L8R F;  2QCU A;  2KZU A;  2AHM A;  2LVQ D;  2UUC M;  3HZJ A;  3AL0 C;  1OQY A;  3K8Z A;  2HWJ A;  3FTE A;  2ZAN A;  5EJC A;  3U6L A;  2KA6 B;  2UUB M;  3GRV A;  3PFI A;  2R44 A;  4I8O A;  4GKK M;  1KSF X;  2KZS A;  1OFI A;  2R45 A;  3T15 A;  2CE7 A;  4PDI A;  4XGI A;  3GLG B;  2C9O A;  2LVO C;  2CHG A;  3Q8G A;  2DI0 A;  1IXZ A;  4FCV A;  1HQC A;  1S3S A;  2Y0T A;  3J2P B;  1OFH A;  2JZ0 A;  3LCU A;  3KP1 E;  3TL4 X;  3T1H M;  1KFV A;  4JI1 M;  5KQD A;  3SAT A;  3L2A A;  3VLF B;  8CAT A;  4GKJ M;  1HT1 E;  4M0D A;  4NSR A;  1QZM A;  3E9S A;  2CEA A;  2J5Y A;  4JN6 A;  3KS4 A;  4KHP M;  1YE9 A;  2CUZ A;  4GIT A;  1G8P A;  4NXN M;  2XLJ A;  3VK7 A;  1XC8 A;  2LXE A;  2YR0 A;  2N35 A;  2JY8 A;  3H4M A;  2L7H A;  4FWD A;  2LBC A;  2VQF M;  1LTM A;  3SYL A;  1A5T A;  1R5L A;  1E94 E;  2MGW A;  3K9O A;  3W0L B;  3HHZ A;  2QSF X;  4AKH A;  1IY1 A;  3WHK A;  4JI4 M;  3RFW A;  1D0M A;  4B08 A;  3IHP A;  4JI6 M;  4JV5 M;  3R8F A;  1XNR M;  3LQQ A;  1ORY B;  3FUT A;  3I51 A;  4FCT A;  2APL A;  1ZMV A;  4GRI A;  2JY7 A;  3GLI A;  4IBI A;  4F1I A;  4IBG A;  3CGW A;  2XSZ A;  1DO0 A;  3D8B A;  4LF9 M;  2G3Q A;  4X62 M;  2HCB A;  3HU3 A;  3GPU A;  3U61 A;  1SXJ E;  4LF8 M;  2H1R A;  4FWH A;  4NOO B;  3BXW A;  2ERC A;  3FRH A;  2O01 F;  4LJ7 A;  2LTU A;  4WP2 A;  1I94 M;  2XEP A;  1IY0 A;  4JYA M;  3AKZ A;  1TTE A;  1LV7 A;  4KO8 A;  3TPZ A;  1V33 A;  4IJF A;  4A3V B;  4LFB M;  3JAM S;  3LVW A;  5EP4 A;  2LVP C;  4L15 A;  4LF6 M;  4NC6 A;  1SXJ C;  2JY6 B;  3B89 A;  5FTJ A;  2R18 A;  2YNM D;  4LG2 A;  3A98 B;  4MGY E;  1WR1 B;  1IN6 A;  2L2D A;  2J7O A;  3HHX A;  1N32 M;  1JQJ C;  2BJV A;  1XNQ M;  2K6B A;  5FTM A;  3GLG E;  4P16 A;  2RGO A;  3K1J A;  4L8R C;  4LZZ A;  2K47 A;  4R3D A;  1WHC A;  2M60 A;  1HR0 M;  2MH8 A;  1R2Z A;  1I4W A;  1C7Y A;  3KOW E;  4B7F A;  4IBK A;  4GEW A;  2KDL A;  3DA1 A;  1VDD A;  3JR5 A;  4AG5 A;  1XB2 B;  4PD2 A;  2H5X A;  1HNZ M;  3ZC7 B;  1N34 M;  1NJF A;  4CGY B;  3GLI B;  2DAE A;  3U6C A;  4JI5 M;  3RE8 A;  2UXB M;  2OOB A;  3SMS A;  4AW4 A;  4AG6 A;  3FE3 A;  4RF1 A;  4KLN A;  3FTF A;  1PRB A;  1Y8G A;  1G71 A;  1N78 A;  3AOE C;  1J7K A;  3QWL A;  1JB0 F;  3TWL A;  5LMU M;  3GO8 A;  2EA0 A;  2G8L A;  4G4O A;  3Q8X A;  1Z5C A;  2F5N A;  4JI2 M;  1Z5B A;  1QAM A;  4MGH A;  3QAU A;  2V1C A;  3QYB A;  3JR4 A;  3J7A S;  1QAN A;  2XF3 A;  3ZQJ A;  3SAR A;  2RGH A;  3GLH A;  5DFL A;  3GQ5 A;  4DV7 M;  2DXI A;  3C9P A;  3M0E A;  4GC9 A;  5ITT A;  2CHQ A;  1PJT A;  2JZ1 A;  2UXC M;  1CUK A;  2EJS A;  4Q7J A;  3SFZ A;  2F5O A;  4DUZ M;  3J7B A;  1T43 A;  3AJI B;  3C3D A;  1R4G A;  5EQT A;  5GKN A;  1JR3 D;  2QP9 X;  4IBB A;  5C1B A;  1Q39 A;  4QOZ C;  2K0B X;  2R4J A;  4LFA M;  1D0K A;  3FYC A;  2CP8 A;  3KOY E;  4LFC M;  4DR5 M;  3I4V A;  4DV4 M;  3U60 A;  5H37 D;  4WUR A;  1TF0 B;  3VDU A;  1ZQ9 A;  4FD2 A;  3W68 A;  1NNU C;  1SG9 A;  1YLA A;  2CHV A;  3AFH A;  3LW5 F;  4M9S A;  3T1Y M;  3WHL A;  2QBY A;  2XFT A;  2R4E A;  4Y28 F;  1D2N A;  1E9S A;  3B9P A;  3VK8 A;  1IN5 A;  3C58 A;  4OVZ B;  1R6B X;  5KPR A;  1WJ7 A;  1OIZ A;  1ZV1 A;  5BR8 M;  4DV6 M;  3U6Q A;  1IXS A;  4FWG A;  4LCB A;  4D81 A;  1IXR C;  1IN8 A;  4I5S A;  1HJP A;  3MJ5 A;  2CV0 A;  1V34 A;  3KOZ E;  1XMQ M;  1UM8 A;  3GPP A;  3VKG A;  1IQP A;  3FTD A;  3ZCB B;  1NY5 A;  3DOA A;  3B74 A;  3T6P A;  1GJT A;  4LJ6 A;  3K92 A;  3IG5 A;  1MJG M;  1PJI A;  2VDB B;  4LJ4 A;  3DFZ A;  4IBD A;  1YUB A;  4DR2 M;  3GLI E;  1QUS A;  1XXH A;  3J27 B;  4QNM A;  1VQ1 A;  4X64 M;  4NSO B;  2ZTC A;  4IBF A;  2HKJ A;  3MMP A;  2J7N A;  2VII A;  2OPF A;  2BWE A;  4BB9 A;  5DYG A;  1NHW C;  3KOX E;  1KYI A;  3NBX X;  1PM5 A;  4R7G A;  1UFZ A;  4TUW A;  4LRT A;  2KRU A;  1FJG M;  1NV9 A;  1L1Z A;  2LH0 A;  4LF5 M;  4ZPX A;  3HGI A;  4OW0 A;  2LVN C;  4QHT A;  4HLQ A;  1QAO A;  3GQ4 A;  3FRI A;  1DO2 A;  7CAT A;  4HEO A;  2G5G X;  1NNJ A;  2QPA A;  4B3M M;  4M0W A;  2HHH M;  2Q2E B;  3L28 A;  2DAI A;  1G4A E;  3NWL A;  3SHG B;  3VDP A;  4QOS A;  5BPV A;  2QBY B;  4EIW A;  1GO5 A;  2ZAO A;  5IT9 S;  4IBC A;  4Z8X A;  1QDR A;  1G3I A;  4G4R A;  1PJQ A;  1T6O A;  4L6V 6;  3L25 A;  3F92 A;  2JNH A;  3E46 A;  2ZBK B;  2JA2 A;  2QHO B;  3VKH A;  4QHS A;  2Z7J A;  2KXE A;  4JI3 M;  2EO2 A;  2MRO B;  4GIP A;  1OTR A;  5EP2 A;  2DNA A;  3SBJ A;  2JP7 A;  2P5T A;  4XBO A;  3HJ8 A;  2YFQ A;  3BBZ A;  3HKP A;  4L4U A;  1JR3 A;  2EKF A;  2UXD M;  3GQ3 A;  5IRE B;  3KSX A;  3T38 A;  1IBL M;  4P17 A;  3SAS A;  4BBA A;  1OIP A;  2R6F A;  2F5S A;  5ITY A;  1Q3C A;  1YSY A;  2A5Y B;  3HJQ A;  1W5S A;  2BJW A;  1XXH B;  2W82 A;  4PDG A;  1NY6 A;  1VG5 A;  2JUJ A;  2LNH C;  1OAI A;  1N75 A;  4JXJ A;  3LCV B;  5JI3 E;  2XZF A;  5ITX E;  1ZMU A;  2E5L M;  2MJ5 B;  1QVR A;  2L09 A;  2KRK A;  2VF7 A;  4MGK E;  4NRV A;  3CF6 E;  2L4F A;  3UMM A;  3GPX A;  2F5P A;  1AIP C;  1DGB A;  3LQR A;  3PVS A;  4RF0 A;  2FS1 A;  3U6E A;  5KQ8 A;  2C5R A;  1HNW M;  2CV1 A;  4Z6Y A;  2M5Z A;  3U6P A;  4PT5 A;  1C1K A;  1PGY A;  4OX9 M;  3DZD A;  2LWX A;  4B7G A;  2GNO A;  3KP0 E;  3QYE A;  1D0L A;  1PJS A;  2Z4S A;  3U61 B;  1L2B A;  2FH0 A;  1G59 A;  1V92 A;  4G3O A;  1OKS A;  4MGI E;  1H6U A;  4ITQ A;  3FD9 A;  1MN3 A;  3E4R A;  5E26 A;  3GLG A;  2WSF F;  3FKE A;  2UUA M;  1IBM M;  4AQY M;  2GQF A;  1EE8 A;  2ZTD A;  1N36 M;  3SAV A;  4LF4 M;  3B7N A;  4UN2 B;  2Z8Y M;  3HWS A;  4LJ5 A;  3M7G A;  4LJA A;  3UJN A;  4AI6 A;  1QAQ A;  2K9D A;  3LMM A;  4IJE A;  3KVW A;  4IIW A;  4M9X A;  2D7H A;  1OJL A;  3GLF A;  1NO1 A;  2DKL A;  2Z4R A;  1MU5 A;  2QQ8 A;  3KW6 A;  1K3W A;  4B3T M;  3PNV A;  3RGP A;  2V6Z M;  1WIV A;  3TE6 A;  2NQ8 C;  4YHH M;  4MGZ E;  1IN4 A;  1SXJ D;  4GMQ A;  2KNZ A;  3W0F A;  5EXT A;  1HQY E;  2HAK A;  3BOS A;  4RNA A;  3SMP A;  4M9Z A;  4AKG A;  1GAB A;  4X65 M;  3FUV A;  3TWK A;  2C99 A;  1P3Q Q;  3THG A;  2DHY A;  2KEB A;  2FE8 A;  3FTC A;  3UGJ A;  3HHW A;  1TR8 A;  3E21 A;  2DHR A;  1L2D A;  3J81 S;  2KNA A;  2CFO A;  1X37 A;  5EXP A;  1VEG A;  3ILK A;  1R2Y A;  3EIH A;  2QZ4 A;  4LZJ A;  3SAW A;  1IN7 A;  1DGG A;  1WXQ A;  4LJ8 A;  4DR1 M;  2VQE M;  1IFY A;  2WZJ A;  4LF7 M;  4AKI A;  3B7Z A;  1QDT A;  1DGH A;  2X4A A;  4KT0 F;  5EXX A;  5FLX S;  4LJ9 A;  2JWS A;  4FW9 A;  1IBK M;  2DWM A;  2EKK A;  2XH9 A;  5KO3 A;  4DR6 M;  2LHC A;  4KOD A;  2F5Q A;  1TH3 A;  1XXH E;  2MR9 A;  3FUX A;  3FYD A;  3GRR A;  4OU7 A;  4CIS A;  1TDH A;  1GJS A;  2VF8 A;  5E6J A;  3TWM A;  2L6O A;  1OAO C;  2XFS A;  2O25 A;  4NRW A;  1N77 A;  2C96 A;  4I81 A;  1ZMW A;  4IBJ A;  4XK8 F;  1PJJ A;  2Y21 A;  4JI7 M;  5EP1 A;  1VEK A;  3CTW B;  2D7E A;  2DEN A;  1W5T A;  4G6Z A; 
#chains in the Genus database with same CATH homology
 1GO5 A;  1HT2 E;  4GEW A;  2QNJ A;  1G3I A;  1BVS A;  1VDL A;  2OO9 A;  1T6O A;  1XB2 B;  2H5X A;  2R0I A;  2BWB A;  3F92 A;  2JNH A;  3E46 A;  2DAE A;  2QHO B;  2OOB A;  4R71 A;  3FE3 A;  2MRO B;  1Y8G A;  1OTR A;  2DNA A;  2LVQ D;  2JP7 A;  1OQY A;  2CWB A;  3BBZ A;  4DBG B;  2HWJ A;  2EKF A;  4F2L A;  2JY5 A;  2DZL A;  5DFL A;  2B3T A;  1VG5 A;  2DAM A;  2JUJ A;  1OAI A;  3LCV B;  2DAK A;  2JZ1 A;  1ZMU A;  2MJ5 B;  2LVO C;  2DI0 A;  1CUK A;  2EJS A;  4Q7J A;  2RRU A;  1EFU B;  1F4I A;  2JZ0 A;  2L4F A;  3LCU A;  1T43 A;  1AIP C;  1R4G A;  3IEC A;  1JR3 E;  1QZE A;  1PGY A;  1HT1 E;  2K0B X;  2CP8 A;  1NV8 A;  2DAG A;  2JY8 A;  1V92 A;  1VEJ A;  2LBC A;  4G3O A;  1OKS A;  1SG9 A;  1A5T A;  1YLA A;  1E94 E;  1MN3 A;  2MGW A;  3K9O A;  2QSF X;  2KHH A;  2ZTD A;  3IHP A;  4UN2 B;  1WJ7 A;  1ZV1 A;  5JI2 E;  1ZMV A;  1IXS A;  2L4E A;  2K9D A;  2JY7 A;  4F1I A;  2DKL A;  1HJP A;  1DO0 A;  2G3Q A;  1WIV A;  2LVA A;  2KNV A;  3GLH E;  2KNZ A;  1HQY E;  2HAK A;  3T6P A;  1DV0 A;  1P3Q Q;  3FRH A;  2DHY A;  4WP2 A;  2LTU A;  3GLI E;  1TR8 A;  3E21 A;  1VQ1 A;  1TTE A;  3GLF E;  2ZTC A;  1WGL A;  2KNA A;  1Q02 A;  1WGN A;  1VEG A;  3MMP A;  2BWE A;  2LVP C;  1KYI A;  1IFY A;  2JY6 B;  2WZJ A;  3B89 A;  1UFZ A;  1WR1 B;  1G41 A;  2EKK A;  1NV9 A;  2L2D A;  3H4J A;  1XXH E;  2MR9 A;  1IM2 A;  3GLG E;  2LVN C;  3K9P A;  2O25 A;  2OOA A;  3FRI A;  1DO2 A;  1ZMW A;  1WHC A;  4HEO A;  1VEK A;  2DEN A;  1C7Y A;  2DAI A;  1G4A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...