3K2LA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
410
structure length
402
Chain Sequence
VDLGTENLYFMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPQKLLDASKRAKNFVSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Structures of Down Syndrome Kinases, DYRKs, Reveal Mechanisms of Kinase Activation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 402
sequence length 410
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k2lA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k2lA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k2lA02
4R77A 2XBAA 1UVRA 4RSSA 3ODYX 4ZEGA 3LM0A 2XIZA 4L52A 3NUXA 2XB7A 2C0OA 3F6XA 5CAQA 4AE9A 4D2PA 3V01A 3HECA 3MFUA 2UVXA 3OG7A 3QRTA 4H36A 1WBNA 4F1TA 3MH1A 3EN5A 5H8GA 4AW0A 5D12A 3NMUF 4ENXA 3EZRA 3QALE 5L6OA 2VTIA 3BHHA 2CN8A 2Z7RA 2XM8A 1UKIA 2EU9A 3COHA 2R4BA 2YM5A 4I4EA 4E6AA 3KK8A 3OBGA 3DXPA 3OW4A 1VEBA 4RFMA 4CTBA 4D4SA 2OWBA 3FY0A 4UX9A 2GNLA 1PMEA 3PP1A 4GW8A 3DAKA 3W2QA 2W4OA 4O2ZA 2PU8A 3OWJA 4O7ZA 4EWHA 5ANKA 2W9ZB 4EHEA 1HCKA 3PFQA 3AMYA 3QUPA 2UW5A 4GEOA 3UDBA 4Q9ZA 4DBNA 4BDCA 4C2WA 3W2RA 3AC1A 1A48A 3MFTA 4CRSA 3BU6A 2QHMA 3TT0A 5LWNA 3HVCA 3ZFYA 3GFEA 4QYHA 3CEKA 2WTKB 3UIMA 1KE7A 1UNGA 4MXZA 2QG5A 4FNYA 4BDEA 2CGXA 2ACXA 1JKLA 2QU6A 4RFZA 4BBMA 3VJOA 3SXSA 4GG7A 1VZOA 3DKCA 4U7ZA 4UBAA 3RK5A 4CFXA 3DNEA 5CEIA 2BILB 2QLUA 1Z9XA 4ZTLA 3REPA 4G31A 1W7HA 4ZTMA 1FVRA 4NT4A 3LW0A 5T6KA 2GNJA 3G33A 2A0CX 4G5PA 4IIRA 2ONLA 3K54A 3QUEA 3GU4A 4F64A 3QQJA 3A7FA 4ZZNA 3LXKA 4MWIA 3BHYA 3QRUA 3R28A 4EL9A 2XS0A 4FSYA 5IQIA 2F2UA 3AGLA 4PUZA 3T3UA 4QQTA 2WEVA 3KB7A 4HYIA 2JDOA 3PPJA 3HUCA 4WHZA 2JKQA 3A7GA 3EN4A 4JAJA 1WBPA 3NUAA 2QOBA 3R1SA 4D9UA 2RG6A 4AQCA 2XA4A 3DY7A 4I94A 4J95A 3EQBA 3DT1A 3H9OA 3R1QA 4D9TA 4D1XA 3OOMA 1YXXA 2W1FA 5C9CA 4EC8A 3R83A 1OPJA 2VWYA 2W1ZA 2I6LA 4D4RA 4OAVB 4C59A 5BVOA 4FMQA 4C3RA 4O0XA 3A8WA 4NM5A 3MBLA 4BTMA 2BDWA 3I6WA 4L3JA 3ZCLA 4ZSJA 4YHFA 3BYUA 3MN3A 4AZSA 3R9HA 2VWIA 3QKMA 4OW8A 4ALVA 3QKLA 5F1ZA 3UIBA 3BWFA 1GJOA 2QLQA 2G2FA 3SW4A 5L6PA 5L8KA 3AC4A 4CEGA 3RAWA 4U81A 2HY0A 4H1JA 4ANSA 5C03A 3RALA 3VF9A 5J9ZA 2VU3A 5IQDA 3QLFA 4FTLA 3O71A 4K6ZA 3C9WA 3NRMA 4IFGA 1CKIA 4L8MA 4EQUA 3NUYA 4YTHA 3LFBA 1ZRZA 2OKRA 2QC6A 4X2GA 1IEPA 4S31A 4MAOA 3F9NA 1YDRE 3CSVA 3E8CA 3TNWA 3ENHA 3VBXA 5AX9A 3VN9A 4O84A 3LJ2A 2HOGA 4L6QA 2XBJA 4E5WA 2R3GA 4JX7A 1DI8A 2PVLA 2UV2A 4D2SA 4E3CA 5JRQA 2VN9A 1CTPE 3KC3A 3DKGA 3Q6WA 5L6WL 5CTPA 2PK9A 3W33A 5IEXA 5LQFA 3GFWA 3FLQA 3ALOA 3ZONA 4Y83A 4FKPA 2DYLA 3PG1A 4GFOA 5CVFA 5CVHA 3QTQA 5D9HA 3ZRMA 2GU8A 4TWCA 4J53A 4FC0A 2ESMA 5DH3A 4PP7A 3DQWA 3F5UA 4RIYB 4YGAA 5EDQA 3IPHA 4YNOA 3KQ7A 5IMEA 4IM3A 4WUAA 5KMIA 2PE0A 3RWPA 3QTIA 4UMPA 1Y6AA 2JITA 1M52A 5M55A 3ZEWA 4ARKA 5AUVA 5BVWA 4ZLZA 4IX4A 4ITJA 4M3QA 2XKEA 2PZRA 4EOLA 2WAJA 2WHBA 4PP9A 3EQGA 4L44A 4XHKB 3ZO1A 5DT3A 4BFMA 3O8PA 3VUDA 3B2TA 3Q2MA 4RA5A 4OTPA 2IZRA 4NU1A 4FVQA 2QOLA 4IVAA 1V0PA 1YQJA 2UW3A 1ZY5A 2B9FA 3CXWA 3HMIA 4BICA 3NGAA 3O17A 4Z55A 4D0XA 3TM0A 3DPKA 2YAKA 4ZIMA 5LMAA 3G6GA 1YI4A 4NEUA 3UMXA 2UW9A 3H30A 4FTQA 3R9RA 2C3IB 2W4KA 3NS9A 3U87A 4JDKA 1B39A 3AOXA 1ZXEA 4HCUA 5CSWA 3Q53A 3KULA 5DWRA 3PPKA 4DFLA 5ETIA 3A99A 4HVHA 4BKZA 3AC8A 2PZPA 3E62A 3I0QA 2ZMDA 2C0IA 3LXPA 4WSQA 4MHAA 3VS3A 2ITUA 4BCGA 3G6HA 2UZDA 4GJ2A 4EOSA 2FA2A 3NCZA 3KRXA 3NUUA 2EVAA 4XG9A 4FIJA 2C5YA 4LRMA 1YKRA 4JQ8A 3N9XA 4C4EA 2IPXA 1XH9A 3QZFA 1H0VA 2Y4IC 2I0VA 5HE2A 5A6OA 3FZTA 4E4MA 3ZLWA 1CKPA 3QD2B 2UW7A 2WMQA 1JKSA 4EKLA 2R3PA 2RFEA 3CTHA 3UVRA 3EHAA 1B38A 1U46A 3OS3A 4RC4A 4W4YA 3JVRA 1REJA 3WZUA 4ZMFA 1O6KA 4HYHA 3AXWA 3QGWA 4OBPA 2OJFE 2CLXA 3PY0A 2VTHA 4XV3A 5D11A 5ACBC 3UTOA 4EOIA 3VC4A 5KZIA 4P2KA 4DFNA 3R63A 4L00A 4KKEA 2XYUA 3ZSIA 4V0GA 1OL6A 2H8HA 1O9UA 2X0GA 5LXMA 4C02A 1PYXA 2HELA 5EKOA 3UJGA 4Y72A 4NM3A 1PXOA 4Q5EA 1FOTA 4FTMA 1X8BA 2V62A 1U4DA 2WO6A 5ACKA 1OIRA 4F08A 3OTUA 1JAMA 3QAME 4PL5A 4E6DA 4QMZA 4E73A 4UWBA 4IH8A 2O0UA 5HESA 3PZEA 4XV9A 3ELJA 3CCNA 4LL5A 3DV3A 1FINA 3IG7A 4I5MA 4RQKA 4UALA 4BCNA 3JYAA 4D58A 2R3NA 3GU5A 4XG2A 3ZLSA 3TNHA 4BR3A 4FSRA 2CGUA 4PNIA 4B99A 4F1OA 3PXYA 3SG8A 3TDVA 2GHLA 2IVSA 3ZH8A 1MQ4A 1KWPA 1ZYSA 4DITA 4IAAA 5ITAA 3Q9YA 2A1AB 5IA0A 3QL8A 2C6TA 3AC2A 3C4XA 3FC2A 2X39A 4WNPA 4AS0A 5LMKA 4FEWA 4JXFA 2XIKA 3THBA 4ACHA 1M2QA 1FQ1B 2HK5A 5DPVA 2ETMA 4IAIA 5ETFA 2AC3A 3OZ6A 4DA5A 4O7RA 3UC3A 2WQEA 3MDYA 4QP1A 3IW7A 2QOIA 2ZAZA 4A9RA 3TNPC 4F9WA 2VO7A 2GPHA 2R3QA 5CXZA 4PMPA 1XJDA 5CF4A 3LJ0A 4R1YA 2XCKA 1SMHA 4MXAA 2ZB1A 4IW0A 4XRJA 4BDHA 5F20A 2WTVA 1BUHA 2ITWA 3NW6A 3FMJA 1OL1A 3BV2A 3GNIB 2XCHA 3ZUUA 3L9PA 2Y7JA 4UYNA 3SQQA 4J8NA 3RPRA 3HKOA 3ORKA 4I6QA 2W1CA 4E5AX 3HMPA 4C57A 4B6LA 4M67A 2LAVA 3UPZA 4IZYA 4M13A 4ERKA 3DXQA 3FPMA 1MQBA 3UZPA 3TIYA 3LCDA 4MX9A 3I5NA 3P79A 4TNBA 5HORA 2B53A 4XV2A 4KINA 3D0EA 4MCVA 4I4FA 3RPVA 5HQ0A 5M4CA 4HVIA 3NPCA 2C30A 5AADA 1BMKA 4GUBA 2X4ZA 4IM2A 5CENA 3LMHA 5FM2A 4FODA 4FR4A 4IJPA 5AR5A 2BTRA 3F3ZA 2BMCA 2WMVA 2EUFB 2WMUA 5LMBA 5HG7A 5IPJA 2OK1A 4V0GB 3OBJA 5GHVA 4O7WA 4BDFA 3DS6A 1UU3A 3OVVA 4MQ2A 5M56A 5TT7A 4QT1A 3U6IA 4HNIA 4E93A 1UU8A 4GU9A 4O0RA 4RVMA 4YJVA 2JKOA 3D9VA 3R8UA 4DGOA 4PDYA 3O2MA 4CQEA 4HNFA 4D5KA 3NNVA 3VW8A 3RK9A 1BLXA 3E3PA 4WBBB 2FSLX 2ITTA 5HCZA 5B2MA 3KVWA 4FKRA 5JGBA 4M84A 4AT5A 3VUIA 4QTAA 4YO4A 2X2KA 5CALA 3GENA 5CT7A 3R04A 4EOMA 5IDNA 1NVSA 2JDVA 3GCSA 3OY3A 4JR3A 4WT6A 3WILA 2ZV9A 4ASXA 1PXMA 2QVSE 5ICPA 4WRSA 4GKIA 3UYSA 3AD4A 3O23A 2O65A 3S00A 2YDKA 4RX7A 5IKWA 5FXRA 1UWHA 3OW3A 4M66A 5HG9A 5C1QB 1K2PA 4MXXA 2C5NA 2P33A 4MXOA 4YTCA 3Q32A 3CJFA 5EH0A 2YLFA 5M08A 1KV2A 3CD3A 3D7ZA 4F99A 4KKGA 2J0KA 3DJ5A 4OBOA 4N6ZA 4K33A 4D2TA 2RSVA 3F7WA 4RJ6A 4O83A 3C4CA 4HJOA 3OROA 4AFEA 2GS7A 3O7LD 4IXPA 3RMFA 3TIZA 4IZ7A 3OHTA 3QX2A 3V8SA 1YDSE 2XYNA 1R39A 4X3FA 5J1VA 3MPAA 2I0YA 5FTOA 4D4VA 4EI4A 5LVLA 5AWMA 3WIKA 3OT3A 2YCSA 4QMWA 3LFDA 4F0GA 3JUHA 2Q0NA 3DBQA 4YC6A 3PE1A 4FBXA 4FKLA 3QHRA 3T8OA 3LFCA 4EZ7A 1Q5KA 4W4XA 3V04A 1WFCA 4C7TA 3JY9A 4G3EA 4AGDA 3EFLA 3AG9A 4JNWA 4ZJJA 4F65A 4R1VA 5ANIA 1H07A 5I9UA 5CF5A 5AA9A 4U41A 5KE0A 2VWBA 3C5IA 5IF1A 3AMAA 1OZ1A 2P3GX 4IAYA 4PPBA 5H3QA 3W8LA 1ZYCA 3FLSA 2CNVA 3TDWA 3FHRA 2ETRA 3FSKA 3OFMA 4W8EA 5E8UA 3QTXA 2ZDTA 5LCKA 4KA3A 4EK5A 2J4ZA 1IA9A 3EIDA 3GC8A 3TNIA 3LMIA 4DT8A 3NWWA 2YM7A 5IQFA 2HZNA 2XRUA 5AP6A 1SM2A 1ZYJA 5EYKA 5CLPA 1PKDA 2C69A 3IECA 3IGGA 2YDJA 1VYWA 3PY3A 3NIZA 4C35A 5C26A 3E8DA 1BKXA 3FUPA 4CMOA 4J96A 2V7AA 2JKKA 2CNUA 3OUNB 5FEQA 4MBIA 5HGIA 5LOHA 1QMZA 4L68A 2F4JA 2FUMA 2J51A 2V22A 4OLIA 3RNYA 3IS5A 4S2ZA 5IH4A 2FSOX 2YEXA 3ZFXA 4OAUC 3VBVA 1QL6A 3O51A 4IB1A 3Q4ZA 5HLWA 3BE9A 4X6QC 3TKIA 2J0LA 3QCYA 3E63A 4BGGA 5B7VA 4LUDA 2G15A 4FSNA 4OTDA 5BPYA 4XP3A 3TG1A 4D28A 3PRIA 2GTNA 2PE2A 2JIIA 4GIHA 3CS9A 4IWPA 4Y95A 3FZSA 5H2UA 2IW8A 4FF8A 5DHJA 5AP4A 2WFYA 2XKCA 4EOQA 2G1TA 1SNXA 2IZTA 4IZ5A 2WXVA 4FTNA 4KIOA 4WIHA 2PVRA 3QC9A 2YN8A 2GNIA 2WEIA 4ASEA 4J8MA 5C01A 4ANNA 4E4XA 1H1SA 4FE2A 3I5ZA 3OCGA 3ZO2A 4DYMA 2PSQA 3QTZA 1ZMVA 4CZUA 2VX0A 4KWPA 5CI7A 2KULA 3I6UA 5CY3A 3PSBA 2R64A 3CY2A 2XKDA 3BGPA 3MA3A 4L7FA 5LVMA 3GGFA 1QPDA 4FKSA 4U44A 4KS7A 3ZU7A 3HMOA 3WE4A 1QPJA 3FXXA 4EH7A 4AGUA 3PPZA 1LEZA 3MVLA 4EUTA 1XBBA 2BDFA 4B7TA 3UQGA 3PJ8A 3EL7A 4K1BA 3DBDA 1ZOEA 4EUUA 3HDNA 4LMUA 2VGPA 1YDTE 2C6LA 1IR3A 2O2UA 4KIKA 3R8PA 4FGBA 3VRZA 3U9NA 2H96A 2QKRA 3WARA 3WBLA 1Q3DA 4IAZA 4CCBA 4YZCA 4JL9A 4NZWB 1JKKA 1LEWA 5DNRA 1E1VA 2PUUA 3WF9A 4CGAA 4Y85A 4CKRA 3W16A 3WYYA 4NUSA 2AUHA 1AGWA 4QNYA 4YLKA 5K0KA 2XNBA 5DFPA 3KGAA 5CWZA 4BI0A 1W0XC 4OR5A 3AD6A 3FJQE 3QXPA 3JPVA 4K8AA 1VYZA 4QRCA 4BCFA 3LXNA 5M4FA 2PULA 4GKHA 1UU7A 4P90A 2XK8A 3I7BA 2JIVA 4YSJA 3R7GA 5AAEA 3PDTA 3HNGA 4GT5A 4NFMA 5HNBA 1M2RA 4BDDA 2XIXA 4JIAA 4QMPA 3RWQA 4ZTHA 4H05A 3CD8A 1JNKA 2GSFA 5IA3A 2IVVA 3GOKA 3FWQA 3RZFA 4A4OA 2ZM3A 4JBPA 2OJGA 3PG3A 4PF4A 4PX6A 4GVAA 4LI5A 3ROYA 5HU9A 3NLBA 3RVGA 2ZM1A 4NW5A 3D83A 2DUVA 4HGEA 3C4ZA 3GI3A 4RVLA 4X2FA 4EH9A 2R3JA 3HLLA 1PXIA 3CQEA 3IONA 3R9DA 5FXQA 3OCBA 5I9ZA 4FEXA 4PL3A 4TYIA 4TYHA 3UBDA 2HWOA 3L8PA 2YIXA 4NK9A 5ANDA 2XMYA 3EQIA 4I24A 2VWZA 1OUYA 4FV1A 4MNFA 1PF8A 5E90A 4NL0A 3FY2A 5I5ZA 4WD5A 5HBHA 4OTQA 4LYNA 4FV9A 4II5A 4U97A 5AR3A 4WNMA 5FEEA 4B9DA 4G1WA 3G0FA 2PUPA 2JEDA 4J98A 3F69A 3KRRA 5GIOE 1OL7A 1OKWA 4XG4A 5KMOA 3JS2A 4IX5A 2VO3A 1S9JA 1SYKA 2QR7A 2XK7A 3EQHA 3QQFA 1BI7A 2OIDA 2WNTA 4UB7A 2I0HA 2PL0A 3FZ1A 3BI6A 2C5VA 4LGHA 4A06A 2G2HA 5IUGA 1Y57A 3KU2A 3MYGA 3RNIA 5KHWA 4BDBA 3UG1A 4MKCA 4NCTC 4R7HA 3UO4A 2OLCA 1T45A 3A60A 5E8YA 1PYEA 4YTIA 2WMWA 4LG4A 4ANMA 4BZNA 3BE2A 4RVTA 3MFRA 5E7RA 3T9IA 1ZOHA 4I0RA 4S34A 4YJUA 2GQRA 1MRUA 3SW7A 3KN6A 3PTGA 1GZNA 3QQKA 4RJ4A 4DG3E 3KRJA 4AN2A 3MS9A 3MY1A 2R3KA 4JRVA 5DOSA 5L2TA 1J7IA 3LCSA 4EQCA 4O7YA 3POZA 4BCJA 4R78A 3TV6A 4F1MA 1E1XA 5CASA 3ULZA 3H10A 5JKGA 3R8ZA 2X7OA 3C0HA 3UG2A 3CLYA 3RCJA 3WZEA 5J5SA 5AAFA 1OECA 2OIBA 3WOWA 4HCVA 3WZJA 3PXQA 5JQ5A 1AQ1A 1BX6A 4YC8A 3TJDA 3D94A 1F5QA 5KBQA 4OTHA 4QMUA 1OB3A 4FTRA 4QMSA 4W4WA 4CMUA 2V7OA 3RHXA 4ORKA 3QTRA 5ANOA 1K9AA 1M17A 2IWIA 4MD8E 3FLYA 5ANGA 4YZMA 5HCYA 5FXSA 3HAVA 4RBLA 2WQMA 1XKKA 5AV0A 2WB8A 3UOHA 5A14A 4NJDA 1V1KA 5AMNA 2F7XE 4FX3A 4C2VA 1TKIA 2BAJA 4EH5A 2B9JA 3FMEA 2ITXA 3ANRA 3C5UA 4KS8A 4NWMA 3MB7A 1J91A 1U59A 3M2WA 4I92A 4ZSEA 4Y5HA 4K9YA 1YI6A 4AW1A 3DNDA 1RDQE 3CKXA 1KE5A 4LM5A 4O0WA 2OXYA 4O1OA 1CKJA 4F9YA 4NTSA 5HE3A 3D7TB 4CQGA 3BYSA 2F7EE 3LFQA 3PVGA 4NCTA 4W8DA 3VAPA 5A9UA 2Z8CA 3UYTA 5KNJA 2OF4A 3HV5A 4X2JA 2EXMA 4E7WA 3EFWA 5FBOA 3GT8A 2R7BA 3E8EA 3QX4A 5F94A 4E6QA 5LVOA 3JY0A 3F3TA 1O6YA 2X6DA 4M15A 4X3JA 1WAKA 3D2IA 5DR9A 4MYGA 3LZBA 3BHVA 2ONLC 4IWDA 1Z57A 3W2PA 5HLNA 3R21A 4YMJA 1R0EA 2WQBA 1H1PA 3L1SA 2PMOX 3QZGA 4JVGA 3DQXA 3HA6A 4G17A 4HGTA 3CGFA 4M0ZA 1V0OA 3OF0A 4QMTA 2BHEA 5KHXA 4LV8A 4AT4A 1GAGA 5AFVA 4CT2A 3HYHA 3UIUA 4HYSA 4C4GA 2WMXA 4EZ3A 4FKJA 2J0MB 4TXCA 1ZMWA 2YWPA 3HAMA 1PHKA 2BROA 3MSSA 3B2WA 2HZIA 3R73A 3BLRA 2JGZA 3HEGA 3Q4CA 1Q8UA 2GFCA 4G2FA 2XNPA 4XLIA 5CYIA 4H1MA 3A7HA 4IFCA 4C4JA 5B0XA 4FV6A 4TW9A 4DEHA 5CU4A 3EYGA 5DBXA 2QOHA 3AT4A 4FV5A 3GOPA 1U54B 3V5WA 3PYYA 4UYAA 4TWOA 5JFXA 4CZTA 4DH8A 4QMQA 3N4VA 4N70A 5KMJA 3MTFA 1GY3A 3ZBXA 5C4KA 2CGVA 5A3XA 3VBQA 5DMZA 1FVTA 4HPTE 4YJOA 2RFNA 1ZARA 3ORNA 5CVGA 1NW1A 2DS1A 2XNEA 4GSBA 4KAOA 5AR2A 5TOZA 4E8AA 4BYJA 3C13A 4CFWA 2Y6OA 3SRVA 4F7JA 4HVGA 4AZEA 2QOCA 3MJ1A 4YO6A 3GQLA 1KOAA 4I5PA 3CTQA 5IQBA 2FVDA 3FI4A 1ZYDA 4E4NA 4FT5A 3KMUA 5AV4A 4BN1A 3T3VA 5JEBA 3MTLA 4FOBA 3BGQA 4IBMA 4MBLA 4AACA 4ZY5A 2YACA 5HTCA 3LIJA 4CLJA 4MTAA 2X8IA 1Z5MA 5AIKA 4C0TA 4FIIA 5CZHA 4U42A 1H26A 3RTPA 3TWJA 3VS0A 4CV9A 4ACMA 4S32A 5DRDA 3H0YA 4ANBA 3WI6A 4DC2A 3BHUA 3HZTA 4C4HA 5B2LA 3HP5A 3CQUA 3COKA 3E88A 4P4CA 2Z60A 3U9CA 3ZSHA 1NXKA 4C4IA 4JQEA 5CAVA 4BB4A 5ANEA 3R9OA 3GC7A 3SDJA 2QNJA 3TACA 2W1HA 4FZAB 4Z9LA 3BLQA 5KMKA 1MRYA 5AEPA 4QTEA 5HTIA 2X8DA 3LCOA 4LL0A 2OW3A 4BCOA 5K5NA 3DBFA 3DXNA 2WQNA 4O22A 4GH2A 5BVEA 3II5A 5JGDA 3MH0A 4ALUA 2JFMA 3V51A 3BHTA 1PRYA 5CNNA 5M4IA 3MFSA 3DBEA 4L01A 4QP9A 1DM2A 3S1HA 4QPAA 3U54A 1GIHA 4GRBA 3BV3A 1H27A 2VUWA 2YIWA 2VO6A 1R1WA 4FOCA 3UP2A 5BYLA 1ZMUA 2QOFA 4OTWA 4YJSA 3KXXA 4JG7A 4D2VA 4EOKA 1OUKA 1ZOGA 1HCLA 2EXEA 3DAEA 4FKVA 2VNWA 3GCQA 1PMUA 3VUTA 4AN9A 5HHWA 4EJ7A 3QWJA 3ET7A 4UWCA 3ZO3A 4CMTA 4N0SA 5B2KA 2CKQA 2CMWA 3GU7A 3U8WA 3UNJA 4DG0E 1BL7A 1QPCA 4O0VA 4O21A 2R5TA 2WTJA 2HXQA 3DK7A 4KBCA 4KD1A 2G2IA 2QODA 2XNNA 3V6RA 5IA4A 4CFVA 3PWYA 3ETAA 2OXXA 4P5QA 4F09A 2ZDUA 4L42A 3HA8A 5DEWA 3JVSA 3WF5A 3OXIA 4BTKA 3D5VA 3TTJA 3KN5A 4FKQA 2IVUA 3U4WA 3C0IA 3Q60A 3W32A 4UMQA 4YBKA 4B0GA 2A27A 4F7NA 3FKLA 3N4TA 4A9TA 4TYJA 3ITZA 4IB3A 1XH4A 5EG3A 2R3OA 1LP4A 4QPMA 3NUNA 5H8BA 3NR9A 4I0TA 3AC3A 1H24A 5FDXA 4BGHA 2R0UA 3RGFA 4GG5A 3QQHA 2WMTA 2EB3A 4TKSA 2OO8X 2FSMX 3E93A 1Q3WA 2C5OA 2OFUA 3NYOA 1MRVA 1SZMA 3D14A 3ZHPC 5L4QA 4DH1A 2QURA 1P4FA 2BZJA 3COMA 5L2SA 3DU8A 1PY5A 2JD5A 4O38A 4AFJA 4XX9A 3BGZA 2NPQA 2UZEA 5BVNA 5AM7A 3TUDA 4AGCA 2GS6A 5CAOA 1YWRA 3PXKA 1XBCA 5GZAA 1ATPE 4EOPA 4HCTA 3RI1A 3PP0A 2WOTA 5AV3A 5HCXA 2WELA 3UODA 2C1BA 2OH4A 4A9UA 5CF6A 3SD0A 5LMKC 4YR8A 2FH9A 3CBLA 4F6UA 4PPAA 5GNKA 2C6MA 5TE0A 4AX8A 5FTGA 2E9NA 2QOQA 1IAHA 4X21A 3C0GA 3QRKA 2W17A 4NSTA 5EM8A 3DAJA 1M7NA 2OIQA 3AQVA 4EK8A 3UNKA 3KCKA 4BWKA 4KIQA 1UNLA 3BLHA 3E92A 4L3PA 3KL8A 4ZK5A 4BCQA 3VQHA 4FL2A 3W55A 1PJKA 3ZC6A 2W1IA 2YM8A 5BUIA 3FPQA 4X2KA 3UMWA 2JAMA 1L8TA 1DI9A 4WO5A 4IAFA 4I20A 3VF8A 5F9EA 5AP0A 5HI2A 4Z7HA 2X2LA 4TRLA 3PWDA 5BYYA 2XNGA 5IUHA 4BHZA 1FBNA 3GQIA 2VRXA 3BU3A 2C47A 3PVWA 2VX3A 2UUEA 5TKDA 2UZNA 3E7VA 3SGCA 2BIYA 5AIRA 3M1SA 4L7SA 4JS8A 5HIDA 4BHNA 5M4UA 4JLCA 4U0IA 4FIEA 1NA7A 2C6KA 4LMNA 2P2IA 3OP5A 2NP8A 3KF4A 4QP4A 5CT0A 4E4LA 2YZLA 3EMGA 4QOXA 5E8SA 4FZDB 2PVHA 3OOGA 2QHNA 3QTUA 3F3UA 4J52A 4A7CA 4BCHA 3GP0A 2W4JA 2PMIA 2XEYA 2ZYBA 5AR4A 1Q24A 3PY1A 4FTKA 4QP3A 3D5WA 4XG8A 5A4QA 3KF7A 1OITA 4CKJA 4NM0A 5I9WA 3VUMA 2WD1A 3OXZA 4H3PA 5I3OA 3SX9A 5D1JA 5JFWA 4R3PA 5HKMA 2XVDA 3NW5A 4NH1A 4DEAA 4ANLA 4HVSA 5BVDA 5IISA 2ZJWA 2W99B 2H9VA 2QO7A 4G3DA 1DS5A 3UOJA 4ZSGA 2EB2A 2CNQA 3F7ZA 5FDPA 4DGNA 3U6HA 5BYZA 3S4QA 3UC4A 4AN3A 2UZBA 3Q52A 5BMMA 4LUEA 5HLPA 3KULB 5IA2A 2OU7A 4I23A 4IHPA 3ZLYA 1NY3A 4O7NA 4BY9E 2ITOA 1OKZA 4DH7A 5BX0A 4X7QA 3FMLA 2YM6A 3QQUA 5AP2A 1I44A 3K5VA 4AOIA 1I09A 3L9NA 3LM5A 4IX6A 3QD0A 4DLIA 4DF3A 2J9MA 2PHKA 2ZOQA 2OSCA 4PRJA 2GNGA 3QGYA 4APCA 3HV3A 3PIYA 2BKZA 2VTLA 1YWNA 4XS2A 4ZY4A 3C4WA 1OBDA 5I9XA 3KFAA 1M7QA 3OT8A 2BRGA 4NKSA 4FYNA 1P4OA 4FSTA 5FUTA 1F0QA 4LOPA 3ROCA 5AUUA 1DAWA 2BVAA 2Y4PA 4X3FC 4XG3A 5J87A 2XK3A 2WMAA 3QKKA 5EOLA 4AOJA 3ZMMA 2J7TA 4FSMA 5CU3A 4H58A 2CPKE 2GTMA 5HX8A 3NAYA 3QA8A 2EXCX 3COIA 5E8ZA 1U5RA 1ERKA 2ZB0A 4FTUA 5CAPA 1JKTA 1P2AA 1WBTA 4CFFA 3HL7A 5I0BA 2VAGA 4MH7A 4KRCA 2AC5A 3VS7A 4AW5A 4Z16A 4ZMEA 4G9RA 4RGJA 3KK9A 3P78A 1RE8A 4IQ6A 2J5EA 4ZTQA 5D7VA 2YISA 3IK3A 2OH0E 4D2RA 3R6XA 3ZYAA 2R7IA 1ZWSA 3F2NA 3L9LA 5AV2A 4USEA 3CY3A 3BQCA 1YOJA 2O64A 3HX4A 3LAUA 4G6OA 3PUPA 4RWIA 5JZJA 1G3NA 2GQSA 3R9NA 3E7OA 4FEUA 4OGRA 4C34A 5KUPA 2ITPA 4OT5A 3ZM9A 2X4FA 3FQSA 1YHSA 2O3PA 5FBNC 4GVJA 5FQDC 4ASDA 5AP1A 4ZTRA 3EN7A 4AZTA 2GCDA 1UU9A 3SOCA 1WBVA 3RP9A 3OWPA 2I1MA 1Y6BA 2J6MA 5E8WA 4RZWA 4TY1A 3KY2A 4FYOA 3FMDA 3VS4A 2WKMA 3G51A 3UOKA 1CM8A 3QYWA 4QYFA 4AZWA 3DK6A 1XH8A 4FZFB 4MNEA 3KMWA 2Y4IB 5BUJA 4IC8A 4IM0A 4L67A 4YC3A 2WPAA 2RL5A 5EI8A 4L43A 4GT3A 2KTYA 4AA4A 4JDJA 3DKFA 2P0CA 5HE0A 4ACDA 2ERKA 5J7BA 4CNHA 4KSQA 4FTCA 4FUXA 4WSYA 4KBKA 3QQGA 4FG9A 2QOOA 1RJBA 5DR6A 2FB8A 3VUHA 4BI2A 2GHMA 3ZM4A 3QF9A 4RJ3A 2RFSA 2OG8A 1NT2A 3OMVA 4BDKA 2B0QA 4RC3A 1RW8A 1K3AA 2OBJA 3MI9A 4YBJA 5ETCA 5T68A 2O8YA 3UO5A 4DE4A 2QU5A 4KRDA 5IMXA 4JIKA 3TZ8A 3POOA 4IZAA 3SHEA 4CG9A 4KUJA 2UVZA 2OJJA 3EFKA 3FBVA 4JAIA 4W9WA 5I9VA 2JDRA 4HPUE 5AJQA 1TQMA 3R7IA 4BTJA 3NYVA 3MH3A 1H4LA 3OD6X 4RQVA 3ATTA 4PY1A 4PDOA 3JR1A 2CCIA 2H34A 3OY1A 2B55A 4B8MA 3A4OX 3FL4A 4CFUA 3R01A 5CI6A 3LFSA 3SOAA 4A07A 2QOKA 1OI9A 3OCTA 3P08A 3TEIA 3D5UA 4FTTA 4EH8A 2VWXA 2HZ0A 2UVYA 4MVFA 4IVBA 4IADA 3B8RA 3DB6A 5L2IA 2XJ2A 3NYNA 3R30A 4NTTA 2ZMCA 4BDIA 1PXJA 1W83A 3B8QA 5G1XA 4NIFA 2IZSA 3R7VA 2PZIA 4MBJA 3SV0A 2WIHA 3HGKA 4N4SA 2BDJA 3CKWA 3IKAA 4GYIA 4K0YA 4M14A 4ZP5A 2R3HA 3QRIA 3MA6A 3HRCA 4G5JA 4A9SA 5G6VA 5CSHA 4R7BA 4M69A 4BYIA 1P14A 2ITQA 2V5QA 3GVUA 3H3CA 3KXZA 4QQJA 4XMOA 2W9FB 3R1NA 4GYGA 4BDAA 5IU2A 1Q41A 5HNIX 3LXLA 2WGJA 4FTOA 2UZOA 3PXFA 3V5TA 5KMLA 3BYOA 2JBOA 3G90X 5IH5A 1KE9A 3F3WA 5DGZA 1QCFA 4FGRA 2XNMA 3FV8A 3O50A 3KXNA 2B9IA 4TYEA 2F57A 3I81A 2J0IA 3VO3A 4YUQA 4BCMA 4XLVA 2YERA 1Q4LA 4QYGA 5GJFA 5BMSA 2C6EA 5A6NA 4Q2AA 4PWNA 4AZVA 2BAQA 5E8XA 5FLFA 4KKHA 4AW2A 1IG1A 2XK9A 2VTJA 4X3FB 1BYGA 4G16A 4UY9A 1OM1A 3CJGA 3DA6A 3IW8A 1V0BA 2ZV7A 3EOCA 4IC7A 3G9NA 4OT6A 4BF2A 3PJCA 3Q3BA 2JDTA 5FP6A 2R3MA 4XG6A 2A4LA 3UZTA 4LQMA 3TN8A 4JI9A 2GFSA 2ITVA 3QTSA 1RQQA 3QU0A 3MIAA 5CS6A 2DQ7X 2DWBA 2C3JA 2R9SA 3Q5IA 4FKOA 4IB0A 4LRJA 4OBQA 2PUIA 3Q6UA 1STCE 4FSUA 3VS1A 3KCFA 2CHLA 3IOPA 4BRXA 3R02A 4YZDA 4M0YA 1PKGA 2I0EA 1H1QA 4JJRA 4PQNA 5HD7A 5M44A 3TUBA 3UQCA 4O82A 4O6EA 4XEYA 1QPEA 4EYJA 3UE4A 1GIJA 3GUBA 5BVFA 3EQDA 2QI8A 4G6LA 5JFSA 4M7IA 3Q4TA 4F6SA 4JR7A 2PTKA 3N4UA 4CV8A 5E8TA 3SVVA 2J2IB 4FVPA 5ETAA 3NNWA 2WOUA 3FLNC 4IDVA 4PMMA 3HMNA 1UNHA 4TPTA 3KXHA 2ETKA 1IASA 1ZLTA 4AP7A 5FM3A 2PYWA 1HOWA 4CFNA 4D1SA 2E9UA 2BFXA 4F9CA 4QNAA 3G0EA 3W8QA 2E2BA 4RVKA 5AUXA 4QYEA 5FWKK 2YA9A 2WTDA 3FI2A 3ORTA 3O7LB 1DAYA 3FLZA 2OZOA 1YXTA 3GCPA 4OTGA 4YPDA 3AC5A 2QKWB 3GC9A 4QD6A 3TZMA 2CKPA 4O7SA 4BCPA 4YURA 4FV3A 3PA3A 2E9VA 5CSXA 4I93A 5KMNA 1PXPA 4RLKA 4EK3A 4YSMA 4DG2E 2BZKB 4ZOGA 4CFMA 4EEVA 4ZTNA 5J8IA 3CE3A 5J9LA 3TXOA 4P5ZA 4R3CA 4RIXA 5CQUA 2PWLA 2VTSA 3KMMA 3MH2A 3IQ7A 3P7BA 3PXRA 3LQ5A 4I22A 4WBOA 1PXLA 3E87A 3QC4A 4RA4A 4CKIA 2PPQA 4PL4A 4EOJA 2OZAA 2WTIA 3I79A 4O2PA 1LUFA 3BU5A 4EH4A 3FYJX 4ZXTA 5IQHA 4U5JA 3A7IA 1JQHA 3A62A 2UW6A 3CPCA 5GZ9A 3KXMA 2BAKA 5GJDA 4DEGA 5A54A 4C8BA 4UZDA 5DN3A 5JZNA 2Y0AA 3DCVA 4B8LA 5FGKA 4LRKA 4FIHA 4KIKB 4AXAA 3HRFA 3C51A 4DHFA 3VBWA 5DVRA 3HRBA 3QLGA 5HEZA 3D2KA 3S3IA 2I7QA 1UA2A 2RF9A 1OIYA 4FTJA 4YZNA 5E1SA 3BZ3A 1URWA 1FGIA 2I40A 2UZWE 2YJSA 4RIOA 1T46A 1SNUA 5FEDA 5KO1A 2B54A 4QP2A 4USDA 2VTOA 3R2BA 1XBAA 4LGGA 5IG1A 4PNKA 4OTFA 2YITA 3M11A 1Y8GA 4BIDA 5JK3A 3IW6A 1OVEA 2VD5A 2VTTA 5H8EA 3V5LA 4D0WA 2GNHA 3R7OA 4DCEA 2C3KA 2OJ9A 4BBEA 2JC6A 3PSCA 3V6SA 2CDZA 2B9HA 3O8TA 4JDIA 1KE8A 3DTCA 3O0GA 4GT4A 1PMNA 3CGOA 4TN6A 5J7HA 2EWAA 4NW6A 3MGYA 2AYPA 3R71A 4A4LA 3ALNA 3PVBA 4BDGA 3LLTA 3DJ7A 4XNEA 3WIGA 1A06A 3W2SA 3ZXTA 1JVPP 5M53A 1IAJA 3EB0A 3NAXA 4C37A 4LV5A 2R3LA 2VTNA 5T3QA 2UZVA 3MPMA 2R3IA 3DZQA 3IO7A 4WG5A 2CLQA 2YM4A 3V5QA 3LJ1A 3MESA 5LJJA 2HWPA 3NW7A 4I41A 4TL0A 3FZOA 4RX5A 2B1PA 5TO8A 4CYJA 5JMSA 4ZS4A 2OJIA 4A9YA 2W1GA 5AUTA 5CEMA 5HZNA 4CSVA 3NVMB 4TYHB 1OMWA 5K4JA 2XZSA 3DDQA 2ITNA 3C50A 3R7YA 3RINA 3V5PA 4U40A 4DFBA 5CEPA 4JQ7A 4K18A 5HTBA 1Q97A 2RG5A 4U8ZA 2PE1A 2J90A 1GIIA 2C4GA 4KSPA 5BVKA 4PMTA 4W9XA 4JT3A 3TKHA 4NJ3A 2FGIA 2YM3A 4S33A 4QPSA 2C6OA 3VW6A 2YIRA 4Z7GA 4ANOA 4UN0C 2OGVA 3Q5ZA 2XKFA 3DFAA 4FV4A 3Q9WA 3H4JA 4YJQA 5DA3A 4AZFA 4UMUA 2OZAB 3F3VA 1XWSA 4FG7A 3QCSA 3LLAA 5CEQA 4DLJA 4PTGA 3ULIA 4W4VA 4FV7A 2R3RA 3PRFA 4G9CA 3SXFA 3QBNA 2F9GA 3KEXA 3VNTA 4EK6A 1B6CB 3PJ1A 4O0SA 2C6IA 4FT0A 3D5XA 5M51A 2YIYA 3OTVA 4FEQA 3C1XA 2XK6A 3KRLA 3RJCA 4BL1A 3I1AA 5EYDA 1LPUA 5IA5A 4FZ7A 3HUBA 3HV7A 4RJ8A 1BI8A 4WNKA 4I0SA 4MK0A 5E92A 2CN5A 2WZJA 3C4EA 4QO9A 5EM5A 4EONA 3L8VA 2OF2A 3BRBA 3MY0A 4KIPA 4YJRA 5DE2A 4GK4A 3D4QA 1UV5A 3LHJA 4JG6A 4UMTA 5IQEA 4LOOA 4JRNA 3RAHA 1KV1A 4J97A 3RM6A 4ZJVA 2X9EA 3BX5A 5A46A 5HU3A 4U3YA 4DTAA 4FNXA 1JSUA 3L8SA 5CU6A 5EHLA 2BZHB 3OXTA 5D10A 3WZDA 2HZ4A 4XP2A 3MJ2A 1ZZ2A 4FUYA 1L3RE 4FKUA 3I0OA 5CXHA 1YVJA 4EOOA 3VHEA 4YZBA 4XYFA 3EKKA 5FG8A 2PVKA 1AD5A 3O8UA 3R8LA 1ND4A 5EDPA 1W98A 3MPTA 4JOAA 1OKYA 5E91A 4P7EA 3EQFA 1XQZA 3UOLA 2LGCA 5DYJA 4YTFA 2IG7A 4IB5A 4RIYA 2HXLA 4O7TA 2PVFA 2IZUA 1WVXA 3N51A 2WMBA 4FA2A 4R6VA 2PUNA 5E9EA 1OGUA 4L9IA 4XBRA 3JXWA 4GFGA 4JX3A 3W2OA 4GFMA 4N57A 2WQOA 4DTBA 1TQIA 4PMSA 2SRCA 2V55A 1R0PA 5CSVA 5KCVA 2UW8A 1SVEA 3RCDA 2O63A 4RG0A 2X7FA 1Q61A 4EYMA 3EN6A 1YOMA 4RZVA 4GMYA 3U6JA 4GS6A 3Q9XA 4RC2A 2G01A 3RPOA 1J7UA 2C3LA 5FTQA 2BTSA 2E9OA 3FMNA 2IN6A 1GZ8A 2BIKB 1U5QA 1WBWA 3C7QA 3G2FA 2WIPA 3QTWA 4FT9A 4HYUA 4OUCA 3LCKA 3RBWA 4EWQA 1ZYLA 4GV1A 4D55A 5AA8A 4GIIA 3VUKA 3UQFA 4F9BA 3WF6A 5M09A 4FL1A 4IJ9A 5LARA 4GK2A 4RJ5A 2BRHA 3CPBA 3ZTXA 4FICA 1SVHA 4ACCA 3UGCA 2W5AA 5EKNA 2Z7QA 1JSVA 3ZZWA 3BELA 3EWHA 3ZUTA 4GJ3A 1OIUA 2QONA 4U79A 5AX3A 5BQ0A 2QG7A 2X8EA 5FRIA 2VX1A 3QCXA 4XOYA 3RZBA 4WOVA 3ZFMA 4CZYB 5HOAA 4QP6A 4U3ZA 4WA9A 4BWPA 5I4NA 3PSDA 1KSWA 4DT9A 3UVPA 4F9AA 3Q2JA 4EH6A 3K3IA 3RK7A 3FE3A 1UKHA 3HV4A 3PE2A 1G8SA 3ORLA 4DINA 2CKEA 3L9MA 5EHYA 3CIKA 3P86A 1F3MC 1PMVA 3DB8A 3P23A 3F82A 3O96A 3OCSA 4FKWA 4AT3A 3FHIA 5EM6A 1R3CA 3NVKI 3GBZA 4PPCA 3SRVB 4FTAA 1A9UA 1M14A 1Q8TA 3KRWA 4O7LA 5EM7A 3FMKA 4G34A 4IANA 3VVHA 4O1PA 3WZKA 2E9PA 2CGWA 3A7JA 4TTHB 3E64A 3WYXA 4FKIA 4DGLC 3SG9A 4V04A 5KKRC 2X81A 4DCAA 1JSTA 5M06A 4CD0A 4ZZMA 3DLZA 5C8MA 3G5DA 5AP3A 4PDSA 2JIUA 3MVJA 5EW9A 3HDMA 4FK6A 2NNWB 1O6LA 4ZS0A 1YI3A 4MD7E 5CANA 2ITYA 4RX9A 2X9FA 4EH3A 3GB2A 2FYSA 4RX8A 2XJ0A 1BL6A 3OEFX 5IUIA 1H08A 4EKKA 2YWVA 2OXDA 1FMOE 4Q5HA 4DEBA 3I4BA 4BCKA 5M57A 3ZSGA 1IRKA 5CZIA 3W2CA 3A2CA 2JFLA 3R1YA 4I3ZA 1OL5A 3DZOA 3F66A 3VULA 4AA5A 4U9AA 4YP8A 5FD2A 2GHGA 3V8TA 3P5KA 4RT7A 3UP7A 3IDBA 3FEGA 4FSWA 2W5BA 1VR2A 3WF8A 4C4FA 2C0TA 2VTAA 4D2WA 5E4HA 4I5CA 5E8VA 5AP5A 4F70A 2BR1A 1P5EA 4UZHA 4ZSLA 4EORA 4G3GA 1YWVA 4YJPA 2P2HA 3VUGA 3PLAE 3R0TA 4ONAA 3VIDA 3MW1A 5DI1A 3E8NA 3TZ7A 5AUWA 2QD9A 3NNXA 4M12A 4XP0A 2NRUA 2WTCA 4AGWA 2PVYA 4XOZA 4YZ9A 1PW2A 4FKTA 1WMKA 1WVYA 3K3JA 5JFVA 4YHTA 4HGSA 3HV6A 3LFNA 4XBUA 2XF0A 4E20A 3ATSA 2YABA 4X2NA 3F61A 3CR0A 4QMNA 2BPMA 2GS2A 2YZAA 4F6WA 1Q8YA 4QQCA 4O81A 2XJ1A 5IQCA 4U45A 1Y8YA 2A19B 3GCVA 3AD5A 5IQAA 3DDPA 4KABA 3VS5A 5C8KA 2BALA 4EC9A 2O5KA 2W5HA 3GC0A 2P55A 5A4TA 3AT3A 3KREA 1WCCA 3AGMA 2IW9A 2Q0BA 5AR8A 5HG5A 4LOQA 2IVTA 3I60A 4J7BA 5CU0A 2YDIA 3UIXA 3RAIA 4RWKA 5HO6A 1YXVA 2VV9A 3UZRA 3LFEA 4ZLYA 3UPXA 4YHJA 5IEVA 4BVUA 3EYHA 4XV1A 2X2MA 3LFFA 3ENMA 5DLSA 2VZ6A 5K3YA 3SC1A 3SLSA 4D1ZA 5EQYA 3R8MA 4F0IA 5AR7A 5CX9A 3G15A 2VNYA 4QMVA 4EK4A 5AP7A 2WTWA 3TUCA 3MWUA 3LOKA 3ORMA 4FT7A 2IO6A 4G6NA 3FI3A 5D7AA 1Q62A 1YOLA 3Q04A 4ID7A 3QCQA 2UZUE 2VO0A 3BEAA 3BIZA 4GL9A 2CKOA 5EQEA 4BZDA 1H25A 1J7LA 1M2PA 4K77A 2OICA 3FXWA 3UNZA 2A2AA 4BKYA 3V5JA 2F7ZE 4UXQA 5GZ8A 4TNDA 4XRLA 5DEYA 3EQRA 3OEZA 4Y46A 1S9IA 2VWVA 4FI1A 2BFYA 4FZ6A 4CRLA 1CMKE 1YXUA 3FMMA 3P0MA 4QMYA 4DFZE 4I6FA 1GZOA 3RPSA 4Z3VA 2HY81 5C8NA 4IDTA 2BRMA 5EW3A 4L3LA 1MUOA 3VHKA 3VBTA 1W84A 2B7AA 4I5HA 3ZRKA 3ODZX 4QMOA 3LQ3A 3NZ0A 2WMSA 4FIFA 2Z7SA 3W10A 3BEGA 4AUAA 2BKKA 4ACGA 3EQCA 5EDRA 3ACKA 3QZIA 2GNFA 3FQHA 1NVQA 3VS2A 2BHHA 4JBQA 2YIQA 4J1RA 4HOKA 1REKA 2VTPA 2WU7A 1H0WA 4AOTA 3OWLA 4BWXA 3ZDIA 5LWMA 5KKRB 2Y9QA 4DFYA 2JDSA 3A61A 4FV0A 2W05A 4FVRA 4AWIA 4XJ0A 5A4CA 1FPUA 2ZV2A 4MD9E 3VRYA 1CDKA 5FP5A 4DEEA 1JLUE 3GU8A 4XG7A 3EZVA 4DEDA 3H0ZA 3Q4UA 2ZM4A 3LCTA 3TZ9A 3QYZA 5AUYA 2B4SB 3L8XA 4JBOA 4F0FA 2XP2A 4DBXA 2PVJA 1LR4A 4KBAA 2FO0A 2XH5A 2Z7LA 4BC6A 3MY5A 2Y8OA 3EN9A 3KVXA 4PTEA 3ZXZA 4TYGA 4FL3A 3R8VA 4QMMA 2RIOA 2NO3A 5AV1A 1XH5A 2C68A 4O6LA 3TCPA 3ZC5A 2QQ7A 3TV4A 4C38A 4ZZOA 3LPBA 5J95A 3ZBFA 5JQ8A 3BCEA 4QTCA 3QXOA 2ZV8A 5IZFA 4BIBA 5DR2A 2OI4X 4G3CA 4ERWA 5CQWA 4AU8A 4FT3A 3NIEA 5H9BA 3NNUA 3ZZEA 2W96B 5BUEA 3FYKX 4FNZA 3R22A 4AE6A 2NRYA 4CTCA 3DLSA 3F5PA 3QD4A 3DKOA 5KZ0A 1EH4A 4AAAA 4FV2A 3MVMA 3IDPA 5L8JA 1KUTA 1H01A 5EFQA 3R00A 3P9JA 5DG5A 3ANQA 5L3AA 3R2YA 2VWUA 3RHKA 3BYVA 3UVQA 2X7GA 3QA0A 4DTKA 3TI1A 3QZHA 4O91A 1PXKA 5JT2A 1YHVA 3AMBA 5EI2A 2R0IA 3V3VA 3HMMA 4C3PA 3FZPA 5GJGA 3WE8A 4CLIA 5JRSA 3ZLXA 4F4PA 2CJMA 2PY3A 3ZEPA 3DFCB 4IX3A 4FIGA 4NM7A 3LQ8A 4QP7A 5JGAA 5GINE 2UW4A 4JG8A 4R5SA 1H00A 4AF3A 1ZZLA 2BUJA 3ORIA 3R7EA 1APME 4K2RA 3FDNA 2W0JA 3ORPA 4RPVA 3OWKA 3TJCA 4O96A 3NSZA 2V0DA 1YW2A 3TL8A 4AA0A 1GOLA 4O0TA 4EZ5A 2YCFA 3GCUA 3QUDA 4IWQA 4TT7A 5HVJA 3ZO4A 4IAKA 5CAUA 2XIRA 3EFJA 3F5GA 3AT2A 5EW8A 5KMMA 5TF9A 2F2CB 1KE6A 1CSNA 5J1WA 4ENYA 5M07A 4CCUA 4FKGA 2CSNA 2H6DA 4FEVA 4DAWA 5AM6A 3F2AA 4DFXE 4BGQA 2UZTA 5HO7A 1Q99A 4IVDA 4WNOA 3OUKA 5IQGA 2VWWA 4DGMA 3IGOA 4IE9A 2C1AA 2REIA 3PVUA 4O27B 1OIQA 4RIWA 4HW7A 5A4LA 5CEKA 2HENA 4O86A 4C61A 5F95A 4UMRA 5K0XA 5HVYA 4D4YA 4B4LA 4H3QA 2OFVA 4HZSA 5JN2A 1H28A 3NUPA 4MEDA 5K4IA 3C4FA 4GU6A 3QD3A 5CU2A 2R2PA 2VTRA 3LVPA 4EBVA 3W1FA 4LFIA 4DFUA 1OPKA 3CQWA 4Y73A 3I7CA 2Z02A 4X0MA 3W18A 1SVGA 3P7AA 5J79A 3GXLA 3R7UA 4ZLOA 4WG4A 2P4IA 4FSZA 4NKAA 2BRNA 3IW4A 3A4PA 4PTCA 3RKBA 3WF7A 3KXGA 3TKUA 3GU6A 5C4LA 1FMKA 5KX8A 1TVOA 2W1EA 4RRVA 3KA0A 3NYXA 3BPRA 3BBTB 2QO9A 3P1AA 4QYYA 4UEUA 4MNEB 5HNGA 5A4EA 4YLJA 1ZAOA 3ORZA 3VWAA 3LE6A 5IEYA 5K9IA 3SAYA 1WBSA 2X6EA 3FAAA 4G3FA 4BZOA 2RFDA 4FNWA 3PIZA 4OTIA 3ZOSA 4J99A 4ZSAA 4V05A 4YJTA 4O0YA 2YFXA 1H1WA 2WMRA 4WRGA 3OC1A 3F5XA 4C58A 1OKVA 3BBWA 4RWLA 4MXYA 4HVDA 5TR6A 4HZRA 1JBPE 4M68A 3H9FA 4BBFA 3PXZA 5HBJA 4WUNA 4R3RA 5J9YA 4BIEA 1WZYA 2ZVAA 1XHAA 1PXNA 2XEZA 1G5SA 3U4UA 2ERZE 2G9XA 2VGOA 3BKBA 2W06A 3Q96A 4TWPA 3VS6A 2JAVA 4UV0A 4ZTSA 3TV7A 3D15A 1Q8ZA 2JKMA 3BWJA 2RKUA 3K5UA 2XUUA 1XO2B 3S95A 3NCGA 2HYYA 2YCRA 3NEWA 4EQMA 4FK3A 4FSQA 3DOGA 2WU6A 3P7CA 4QMXA 3RPYA 4ASZA 4YU2A 3CC6A 2RGPA 4ZAUA 4EJNA 2HW7A 4U80A 5IDPA 2PVNA 4MF1A 4TWNA 3PLSA 2QO2A 4FV8A 4RFYA 4BCIA 4MF0A 3PA4A 1W82A 4F63A 5I3RA 2QCSA 4I1ZA 3IDCA 4R8QA 3TTIA 3CTJA 4CG8A 3ORXA 3EKNA 4OTRA 2R3FA 1UWJA 4C33A 4YPSA 3DJ6A 4RIWB 4AG8A 4NIFB 4RMZA 3KKVA 3CP9A 3RM7A 5AAGA 5HVKA 2XK4A 3VJNA 4V01A 3S2PA 4IACA 2XRWA 3U51A 2XM9A 5I9YA 4XUFA 1GZKA 4QP8A 2UZLA 2J50A 1W8CA 4KB8A 2Z2WA 4N6YA 2CCHA 4M69B 3FI8A 3FXZA 4NFNA 3ID6C 5KBRA 2YJRA 4PDPA 4U6RA 4Y8DA 4J71A 5IA1A 2J0JA 4M97A 5DIAA 5LVNA 5CF8A 3S0OA 5EI6A 3FKNA 3TNQB 5EQPA 4ITIA 1MP8A 4UXLA 5EYCA 3V8WA 3EJ1A 4E26A 4C3FA 3M42A 5C27A 2XNOA 5HIEA 3E3BX 3FMHA 4GK3A 1WBOA 4C36A 4YNEA 4EHGA 4BKJA 4L53A 4DEIA 3EQPA 4XH6A 1IA8A 3FSFA 3RAKA 3ZRLA 1H1RA 3SXRA 1J1CA 3D7TA 5EK7A 2WTKC 3NUSA 2UW0A 2XIYA 5HIBA 3T9TA 3SA0A 5HX6A 3FL5A 4JDHA 4H3BA 3MB6A 4I6HA 2J5FA 1E9HA 4HGLA 4M8TA 3E5AA 4R5YA 4WG3A 4E5BA 1OBGA 4LGDA 5CSPA 2JLDA 2PZ5A 3ZUVA 1OPLA 5CNOA 2HCKA 5J5TA 2YAAA 3NX8A 3FQEA 3LFAA 1H8FA 4U43A 4QTDA 2C5XA 3NDMA 1XH6A 4C62A 3FLWA 1FVVA 2FSTX 4UWYA 1J1BA 4RJ7A 3K2LA 3F88A 3VBYA 4NYEA 5L2WA 3ERKA 4I6BA 4O0UA 2BRBA 5L8LA 3PJ2A 5LVPA 5DT4A 5LCJA 4YJNA 3QFVA 2F49A 2W1DA 1KOBA 3PA5A 4FG8A 4CVAA 4GUEA 1YHWA 5ANJA 5HO8A 4CT1A 3DBCA 1JOWB 4APPA 4TZRA 1NVRA 4FTIA 2YCQA 4XCUA 4ALWA 3MVHA 3P4KA 4EBWA 4MXCA 3QQLA 1XH7A 4I21A 4DH3A 4WKQA 4E6CA 4RLLA 2YHVA 3H9RA 4USFA 4L46A 3MV5A 5DRBA 5HE1A 1URCA 3GEQA 2PMNX 4QQ5A 3U55A 4Y5QA 3DGKA 3G9LX 4MWHA 4EHVA 5HD4A 1WVWA 2VTMA 3PZHA 4DGGA 1JPAA 5IH6A 3QHWA 2HAKA 4H39A 4ANQA 1U54A 4F7SA 5AUZA 4ITHA 4L45A 1YXSA 5EHOA 4EH2A 3UO6A 2HIWA 3QWKA 2GDOA 4GCJA 4DH5A 3A8XA 4IEBA 5F4NA 2JBPA 3BYMA 4JBVA 5DT0A 5EYMA 2PZYA 1YRPA 4IVCA 2ITZA 2VTQA 4A4XA 3VQUA 2IW6A 5EOBA 2GQGA 5E1EA 1R78A 4ZY6A 1XR1A 3PIXA 2HW6A 3QRJA 1OL2A 3ACJA 4BDJA 4PV0A 2X1NA 4ZJIA 3ZDUA 3DK3A 5JH6A 4BTFA 4R7IA 3F2RA 3EL8A 4IWOA 5JSMA 2IJMA 2PVMA 1Q8WA 5CEOA 4KNBA 5HG8A 4E1ZA 3FZRA 4EHZA 4QMLA 3BQRA 4S30A 4F7LA 3HP2A 4MQ1A 3DTWA 4K11A 2GMXA 2YLEA 3FC1X 4RIXB 1TQPA 4CYIA 4D5HA 3Q9ZA 5BNJA 1GNGA 3FKOA 1FGKA 4Q9SA 4BI1A 5HICA 3MIYA 4QTBA 4X6RA 2Q83A 1JWHA 4CXAA 3LMGA 1G8AA 3PJ3A 1Y91A 3LKMA 2PMLX 4IMYA 4O7VA 5GIPE 2Y6MA 1VJYA 2B52A 3IOKA 1ZY4A 5HBEA 5K5XA 4RWJA 3IW5A 2QR8A 4YLLA 3SKCA 2W7XA 3ZS5A 3EH9A 4DN5A 5D41A 2C6DA 5L2QA 2BCJA 1J3HA 2BZIB
chains in the Genus database with same CATH superfamily
4RSSA 3LM0A 4L52A 5CAQA 4F1TA 3QRTA 3MH1A 2Z4SA 5FTNA 4ENXA 2CN8A 2R4BA 2DZOB 3DAKA 2KA6B 3W2QA 3FUTA 4JI1M 4O7ZA 4MM3B 3CGWA 2J7NA 3QUPA 2F5QA 4Q9ZA 3W2RA 4CRSA 2C5RA 5LWNA 3GQ3A 2R46A 3FTEA 2KNVA 2CGXA 4RFZA 2QU6A 4GG7A 4U7ZA 4CFXA 5CEIA 2QLUA 3REPA 4G31A 1W7HA 3HWSA 3QUEA 3QQJA 4ZZNA 3LXKA 3BHYA 4EL9A 2JY6B 5IQIA 3T3UA 3KB7A 3PPJA 3A7GA 3EN4A 1WBPA 2QOBA 4D9UA 4CHTB 3DT1A 2W1FA 3R83A 2UUCM 4D4RA 4O0XA 4L3JA 3I6WA 3ZCLA 4ZSJA 4AZSA 3R9HA 3UIBA 5L6PA 1GJOA 2G2FA 4CEGA 4H1JA 3RALA 2VU3A 5IQDA 2AQXA 3NRMA 4IFGA 4YTHA 1ZRZA 2OKRA 4MAOA 3CSVA 5AX9A 2XBJA 4JX7A 5JRQA 2CP8A 1CTPE 2VN9A 5L6WL 3ZONA 3PG1A 5CVFA 3DQWA 5KMIA 5EDQA 3KQ7A 3SHFA 3RWPA 4UMPA 1Y6AA 2AHMA 3ZEWA 4ARKA 5AUVA 4M3QA 1MU5A 2WHBA 4I6LA 4PP9A 4XHKB 3ZO1A 3GLHB 1ZY5A 3NGAA 3TM0A 2ZAOA 3UMXA 4FTQA 4HCUA 3Q53A 3VKHA 4HVHA 4BKZA 3I0QA 2C0IA 1Q3CA 4RF1A 3KRXA 5CZIA 4FIJA 4C4EA 3QZFA 1H0VA 3BL7A 2I0VA 5HE2A 3ZLWA 2UW7A 2WMQA 2R3PA 2RFEA 4ZMFA 2LVAA 4LG2A 1O6KA 4XV3A 3QGWA 5ICPA 2CLXA 5ACBC 1IY1A 3VC4A 4P2KA 4DFNA 2XYUA 1O9UA 1PYXA 5EKOA 4Y72A 4Q5EA 3OTUA 4QMZA 4UWBA 5HESA 2EUCA 3DV3A 3IG7A 4UALA 4D58A 3GU5A 3TNHA 4B99A 4F1OA 3SG8A 2GHLA 3ZH8A 4AKIA 5ITAA 4IAAA 5LMKA 2CE7A 1FQ1B 3MDYA 3HY5A 3IW7A 2R3QA 3GLFA 4PMPA 1DO0A 3LJ0A 2XCKA 1BUHA 1OL1A 1PRBA 3GNIB 4UYNA 3VKGA 4I6QA 2W1CA 4M67A 2LAVA 4M13A 2BWBA 1MQBA 3MK6A 2DWNA 5HORA 4I4FA 2X4ZA 5CENA 5FM2A 4FR4A 5AR5A 2BTRA 3F3ZA 1VG5A 2EUFB 3KP0E 5HG7A 4O7WA 1UU3A 5M56A 4QT1A 3D9VA 4D5KA 3E3PA 2FNAA 4YO4A 5CALA 1KFVA 1NVSA 3OY3A 4JR3A 4ASXA 3S00A 5IKWA 1UWHA 2XFSA 2DHRA 4QHSA 1KV2A 2JY7A 2J0KA 3DJ5A 4KKGA 4K33A 3F7WA 4RJ6A 4O83A 4HJOA 4IXPA 3U61A 4X3FA 2I0YA 3W0NA 3HZJA 5LVLA 3WIKA 3OT3A 2YCSA 3JUHA 5EJCA 4YC6A 3PE1A 4G4QA 3QHRA 4EZ7A 3FKEA 4JNWA 4ZJJA 3LQRA 5ANIA 1H07A 5CF5A 5AA9A 2VWBA 4TUWA 5IF1A 4IAYA 5H3QA 3W8LA 1ZYCA 3FLSA 2CNVA 3FHRA 3FSKA 1IA9A 2J4ZA 2J5YA 3EIDA 3GC8A 1TTEA 4LZJA 2HZNA 1VLRA 3RE8A 2YDJA 4PDIA 3E8DA 1VQ1A 3ZCBB 3W0RA 2R62A 5FEQA 5LOHA 1QMZA 4L68A 4OLIA 3IS5A 2FSOX 3VBVA 3Q4ZA 4BGGA 5B7VA 4LUDA 2G15A 3S1HA 4XP3A 3PRIA 5H2UA 3FZSA 5DHJA 2WFYA 1ZQ9A 4EOQA 2G1TA 1SNXA 2WXVA 4KIOA 4WIHA 2PVRA 3QC9A 2GNIA 4E4XA 3ZO2A 5CY3A 2VQFM 3BGPA 2QCUA 1QPJA 3FXXA 4EUTA 4EUUA 3VRZA 1IR3A 1Q3DA 4YZCA 3FTFA 1E1VA 2PUUA 4CGAA 3KGAA 4BI0A 2ZBKB 5M4FA 3I7BA 3PDTA 4NFMA 3GPXA 5HNBA 4QMPA 3RWQA 4FD2A 3GOKA 4A4OA 2ZM3A 2OJGA 4PF4A 4DUYM 4RVLA 4EH9A 3HLLA 3IONA 5I9ZA 3UBDA 3EQIA 4MNFA 5E90A 1XNRM 5I5ZA 4B9DA 4U97A 4II5A 5AR3A 4WNMA 2PUPA 1OKWA 3T1YM 2XK7A 3QQFA 4UB7A 1G41A 4M9ZA 2PL0A 2C5VA 5KHWA 4R7HA 4NCTC 3UO4A 3A60A 4BZNA 3L25A 2KZSA 3KN6A 4DG3E 4RJ4A 3R8FA 5DOSA 1XXHA 5JKGA 3U60A 2XH9A 3UG2A 3WZJA 3PXQA 1AQ1A 4YC8A 3D94A 4OTHA 4QMUA 3RHXA 4ORKA 3GQ5A 4MD8E 1Q3BA 3FLYA 4O4EA 5HCYA 1VDDA 1XKKA 4NJDA 1KSFX 1TKIA 2BAJA 3FMEA 4I92A 4Y5HA 4K9YA 2XFTA 1KE5A 4O1OA 3PVGA 5A9UA 4NCTA 4W8DA 4X2JA 3F3TA 1O6YA 2D7HA 5ITXA 3D2IA 1Z57A 2PMOX 3DQXA 3HA6A 4HGTA 2BHEA 5KHXA 2J0MB 1ZMWA 2YWPA 3MSSA 3B2WA 4G2FA 4XLIA 2CV1A 4IJFA 3EYGA 5KO3A 3V5WA 3PYYA 4DH8A 4N70A 5C4KA 2RFNA 1NW1A 1OAIA 4F7JA 4I5PA 1ZYDA 4FT5A 2C96A 3MTLA 4ZY5A 4GC5A 5AIKA 4U42A 1UFZA 4CV9A 3H0YA 4ANBA 4DC2A 3BHUA 4JXJA 4DV0M 4C4HA 3E88A 2Z60A 3U9CA 1QQWA 1NXKA 3R9OA 3SDJA 4Z9LA 3BLQA 5AEPA 1LV7A 2X8DA 1W5TA 5BVEA 4ALUA 3BHTA 4NXNM 1IN8A 2GNOA 1DM2A 1GIHA 4AKGA 5BYLA 1ZMUA 3KXXA 4D2VA 4R7GA 1OUKA 2EXEA 3VUTA 3QWJA 4CMTA 4N0SA 3U8WA 1OGYA 3UNJA 4O4CA 4KBCA 2XNNA 5IA4A 2OXXA 4P5QA 4L42A 3JVSA 4BTKA 2CFOA 3KN5A 4FKQA 5ITUA 4B0GA 3FKLA 4TYJA 3ITZA 3B89A 1LP4A 4QPMA 3NUNA 5H8BA 3AC3A 5FDXA 4FWDA 3RGFA 2K47A 4GG5A 2EB3A 4GRIA 2OO8X 1DGFA 3NYOA 1MRVA 5L4QA 3DU8A 1FJGM 2JD5A 3NWLA 4LFCM 5AM7A 3TUDA 4AGCA 3B7NA 5CAOA 3PXKA 5GZAA 1QYRA 1ATPE 2WOTA 2WELA 2OH4A 4AX8A 5FTGA 3QRKA 4GEWA 5EM8A 3UNKA 4BWKA 3BLHA 3E92A 4L3PA 4ZK5A 3VQHA 5BUIA 2JAMA 1DI9A 4WO5A 3VF8A 5BYYA 3GQIA 2VRXA 3PVWA 2VX3A 3E7VA 2BIYA 5AIRA 5M4UA 4U0IA 2C6KA 2YZLA 5E8SA 5JI3E 4FZDB 2QHNA 3F3UA 2PMIA 2ZYBA 4FTKA 4QP3A 4LGMA 2YR0A 1OITA 3UJNA 3OXZA 5EXPA 5JFWA 4P16A 4NH1A 5BVDA 2DAGA 2ZJWA 2W99B 2H9VA 1DS5A 4ZSGA 4LGYA 5BYZA 3UC4A 2UZBA 5BMMA 4LUEA 4WURA 4IHPA 5KPTA 3WHLA 3MHVC 2G5GX 2PHKA 2VTLA 3C4WA 5FUTA 4LOPA 3ROCA 4M9SA 3FYCA 4H58A 2GTMA 3NAYA 5E8ZA 2ZB0A 1P2AA 2KNAA 4CFFA 3HL7A 4AQYM 3A45A 3P78A 2UUBM 4LJ4A 2OH0E 5AV2A 3JAMS 3BQCA 3LAUA 5FTKA 3E7OA 4OGRA 5KUPA 2ITPA 4GVJA 2JNHA 4P17A 3EN7A 3SOCA 3RP9A 1Y6BA 5E8WA 3KOWE 3KY2A 4FYOA 3G51A 1CM8A 3QYWA 4AZWA 3D8BA 4YC3A 2RL5A 4AA4A 5HE0A 4ACDA 2ERKA 4CNHA 4FG9A 1SXJB 2GHMA 3ZM4A 2RFSA 2I7PA 2B0QA 5ETCA 3MI9A 5T68A 4DE4A 2QU5A 4KRDA 4IZAA 4JAIA 2OJJA 4W9WA 5I9VA 4HPUE 4BTJA 3R7IA 4PDOA 2H34A 4A07A 1E94E 3LFSA 3OCTA 2UVYA 4MVFA 3DB6A 3CF6E 4QHTA 1W83A 3B8QA 4MBJA 2WIHA 4N4SA 4M14A 2R3HA 3QRIA 3HRCA 2R45A 1NNJA 5G6VA 4R7BA 3H3CA 3GVUA 4BDAA 1Q41A 2CV2A 2JBOA 3O50A 2B9IA 2F57A 3VO3A 4YUQA 4QYGA 5A6NA 4Q2AA 2BAQA 5E8XA 5FLFA 4KKHA 1NHWC 5EXTA 2VTJA 1OM1A 3DA6A 4OT6A 3PJCA 4XG6A 3TN8A 3QU0A 4FKOA 3Q5IA 4OBQA 1STCE 3KCFA 2CHLA 4BRXA 2I0EA 3TUBA 1QPEA 3I51A 5BVFA 3EQDA 5JFSA 2OOBA 5ETAA 3NNWA 3FLNC 4PMMA 2FFJA 3HMNA 1UNHA 5FM3A 2E9UA 5JI2E 4F9CA 2YA9A 3FI2A 3O7LB 4JI2M 1YXTA 2OZOA 2QKWB 3GC9A 1WHCA 4YURA 4EK3A 4YSMA 4QDVA 4CFMA 4MGYE 3CE3A 5J8IA 5J9LA 4R3CA 4RIXA 5CQUA 2PWLA 3KMMA 4I22A 4GH9A 4O2PA 4FWGA 1N77A 4APCA 3GLFE 5JZNA 2Y0AA 4NSOB 3E4RA 4AXAA 3KOXE 3QLGA 5HEZA 1OIYA 5FEDA 4QP2A 5IG1A 4PNKA 2VD5A 4BBEA 3HX3A 1KE8A 4GT4A 5J7HA 4NW6A 2AYPA 4A4LA 1I4WA 3DJ7A 1JVPP 4C37A 3LMMA 4WG5A 3V5QA 4JI0M 5LJJA 2BJVA 3NW7A 4I41A 4TL0A 4RX5A 4ZS4A 4A9YA 2W1GA 4CSVA 5KPRA 4TYHB 5CEPA 2KW0A 1GIIA 4KSPA 4S33A 4QPSA 4DR2M 4FV4A 3DZDA 4LJ9A 3PRFA 3SXFA 4F78A 1B6CB 3DFZA 5E26A 4FT0A 5M51A 2YIYA 3R9XB 3C1XA 2XK6A 3KRLA 3I1AA 1LPUA 4FZ7A 4I0SA 2WZJA 4QO9A 4KIPA 2L7IA 4GK4A 3D4QA 3LHJA 3OXTA 3MJ2A 1L3RE 4FKUA 3O8UA 3VFDA 3MPTA 1E9SA 1XQZA 3UOLA 2IG7A 2RGOA 1WJ7A 4R6VA 4XBRA 4GFGA 3W2OA 4GFMA 4DTBA 1Q61A 4EYMA 3EN6A 4RZVA 3GLHA 3Q9XA 4RC2A 2G01A 2BTSA 2E9OA 1GZ8A 3C7QA 1WBWA 2WIPA 4GIIA 3UQFA 4REZA 5LARA 2BRHA 3CPBA 4ACCA 3ZUTA 2QONA 4U79A 5AX3A 2X8EA 5FRIA 4FVMA 1S3SA 3ZFMA 4LJAA 5HOAA 4U3ZA 5I4NA 4DT9A 4AXDA 1UKHA 1IM2A 5EHYA 2EA0A 3DB8A 3NVKI 4PPCA 3SRVB 1A9UA 4O1PA 2CGWA 4DCAA 4ZZMA 3DLZA 5C8MA 2JIUA 5EW9A 2NNWB 1YI3A 5CANA 2ITYA 3OEFX 4Q5HA 4DEBA 1WR1B 1HR0M 1IRKA 3A2CA 1OL5A 1GL7A 4F2LA 3DZOA 3F66A 3VULA 4YP8A 5FD2A 2GHGA 3UP7A 4CJ6A 4D2WA 5KQ8A 5AP5A 4A3VB 4F70A 2BR1A 1DV0A 4YJPA 3AV0A 2P2HA 3VUGA 3MW1A 4IBDA 3E8NA 2QD9A 3NNXA 2PVYA 4XOZA 4YZ9A 1PW2A 4YHTA 3HV6A 3F61A 1XXHE 4QMNA 2BPMA 2YZAA 1OFHA 4U45A 2A19B 3GCVA 5C8KA 3GC0A 2P55A 5A4TA 3AT3A 1WCCA 5AR8A 4O4BB 3UIXA 2VV9A 3UZRA 4ZLYA 4LJ7A 4BVUA 2X2MA 2VZ6A 5K3YA 4D1ZA 5CX9A 3G15A 4QMVA 2WTWA 1L2DA 4G6NA 2VIIA 1YOLA 4ID7A 4BZDA 7CATA 4UXQA 3HGIA 5ITXE 3OEZA 2C9OA 2KZUA 2F5SA 4FI1A 3K8ZA 4Z7HA 1CMKE 1YXUA 3FMMA 3P0MA 4AXEA 4I6FA 2BRMA 3J81S 2DNAA 3FQHA 1NVQA 2BHHA 4BWXA 4AWIA 5A4CA 4MD9E 3VRYA 1CDKA 5FP5A 1JLUE 4XG7A 2ZM4A 3JR4A 3R8VA 4QMMA 4ZZOA 2ZV8A 4G3CA 4ERWA 5H9BA 4FNZA 1W5SA 4B7FA 2R44A 4FV2A 3U6OA 5EFQA 3C58A 1KYIA 3RHKA 3QA0A 4O91A 1YHVA 3AMBA 2R0IA 3V3VA 3HMMA 3FZPA 5GJGA 2CJMA 1N33M 3DFCB 3LQ8A 4RPVA 3TJCA 2V0DA 2EKKA 4AA0A 2YCFA 1OIPA 3QUDA 2CRUA 4IAKA 3EFJA 3F5GA 5TF9A 2F2CB 2CSNA 5AM6A 3F2AA 4DFXE 4WNOA 4DGMA 4IE9A 5A4LA 2REIA 5F95A 4UMRA 4D4YA 2OFVA 1L1ZA 3C4FA 4GU6A 3KS8A 2Z02A 3W18A 3P7AA 2DWZB 2P4IA 4NKAA 3TKUA 5C4LA 1TVOA 3BBTB 5KMNA 1GL6A 4FNWA 4O0YA 2YFXA 4IIWA 1H1WA 4B7GA 4C58A 4RWLA 5TR6A 1JBPE 4BBFA 5HBJA 4R3RA 5J9YA 1PXNA 4TWPA 3D15A 3BWJA 4DR7M 2HL7A 2HYYA 3DOGA 3P7CA 3PXGA 4ZAUA 4TWNA 4F63A 2QCSA 3CTJA 2R3FA 4RIWB 2ZANA 4AG8A 4NIFB 1ZAEA 2XK4A 3S2PA 3U6CA 2XRWA 5I9YA 2Z2WA 4N6YA 4M69B 3FXZA 4Y8DA 4PDPA 2J0JA 4M97A 3S0OA 3TNQB 4UXLA 3M42A 2XNOA 3FMHA 3FSFA 1H1RA 3SXRA 1IXRC 2N35A 1E9HA 2Y20A 2JLDA 5CNOA 2HCKA 5J5TA 1QUTA 1H8FA 4QTDA 2C5XA 1XH6A 2FSTX 4UWYA 2BRBA 2R65A 3QFVA 4GUEA 3E9SA 4CT1A 1JOWB 1D0KA 4ALWA 3MVHA 4DH3A 4WKQA 2YHVA 3H9RA 5IREB 2PMNX 3U55A 3G9LX 5IH6A 1JPAA 3QHWA 2HAKA 2MR9A 5EHOA 3BLAA 3QWKA 4DH5A 3A8XA 5F4NA 5EYMA 1YRPA 2IW6A 3E21A 5E1EA 4ZY6A 2HW6A 1OL2A 3DK3A 4BTFA 3EL8A 3FZRA 4EHZA 1J7KA 3AFHA 3CF0A 3FC1X 5BNJA 4Q9SA 1FGKA 4X6RA 4CXAA 2Q2EB 1Y91A 4O7VA 5GIPE 3J27B 1VJYA 5K5XA 3IW5A 4YLLA 3SKCA 5L2QA 4R77A 3ODYX 3F6XA 4D2PA 3MFUA 2UVXA 1WBNA 3NBIA 4AW0A 3EZRA 5BR8M 3QALE 3K92A 4B3RM 5L6OA 2VTIA 2Z7RA 2EU9A 3COHA 2EO2A 4RFMA 3MMPA 3FY0A 2GNLA 2W9ZB 3B7QA 4EHEA 1OJLA 4GEOA 1L8QA 4BDCA 1GKIA 1A48A 3BU6A 1DGHB 2QHMA 3TT0A 3HVCA 3GFEA 4QYHA 1KE7A 2QG5A 4FNYA 4BDEA 2ACXA 3SMPA 1JKLA 4BBMA 3SXSA 3DKCA 2YNMD 1Z9XA 4ZTLA 2GNJA 3G33A 4G5PA 2LHGA 2ONLA 3K54A 2ZFYA 2XS0A 4FSYA 3AGLA 2JDOA 3HUCA 4FCWA 4JAJA 2RG6A 2XA4A 4J95A 3EQBA 4D1XA 2W1ZA 2I6LA 5BVOA 4FMQA 4NM5A 1PJJA 3BYUA 3MN3A 4YHFA 3QKLA 2QLQA 3AC4A 5J9ZA 2HY0A 3O71A 1CKIA 3NUYA 3LFBA 2QC6A 1IEPA 1YDRE 3E8CA 3TNWA 4I81A 3VN9A 4O84A 3LJ2A 2UV2A 4D2SA 5CTPA 2PK9A 3ZRMA 3QTQA 2GU8A 4J53A 2ESMA 4PP7A 4WUAA 2PE0A 3QTIA 2JITA 5BVWA 4ITJA 2XKEA 4EOLA 5EP1A 4HLQA 3FUXA 5DT3A 4BFMA 3B2TA 3Q2MA 4RA5A 4OTPA 4NU1A 4FVQA 4IVAA 1V0PA 1YQJA 2UW3A 3CXWA 3HMIA 4BICA 2CWBA 3A42A 2UW9A 3H30A 3NS9A 4LF4M 4JDKA 3AOXA 3PPKA 1V33A 3E62A 4MHAA 2ITUA 4BCGA 1Z6TA 4GJ2A 3NCZA 2IPXA 1YKRA 4JQ8A 1XH9A 4DV5M 4DR1M 5A6OA 4E4MA 3QD2B 4EKLA 1B38A 2DAIA 2OJFE 2BJWA 2VTHA 3UTOA 1SXJD 4L00A 1OL6A 2H8HA 3U6PA 4PCZA 4C02A 5ITQA 2HELA 3UJGA 4QNMA 1PXOA 1FOTA 4FTMA 1X8BA 5ACKA 4F08A 3QAME 3A98B 3CCNA 1FINA 2O01F 3JYAA 2R3NA 4FSRA 2CGUA 4PNIA 4MUQA 1ZYSA 2A1AB 5IA0A 2C6TA 3C4XA 4FEWA 2XIKA 1XWIA 2XARA 2HK5A 2ETMA 3OZ6A 4DA5A 4O7RA 1R7RA 3UC3A 5CXZA 5CF4A 4LRSA 4IW0A 4XRJA 4NRWA 2ITWA 3NW6A 3FMJA 3ZUUA 2XCHA 1SXJA 3AOEA 2Z4RA 3UPZA 4GKJM 3UZPA 3TIYA 4MX9A 4CIZA 3P79A 4HVIA 4DHZA 4GUBA 3LMHA 4DHIB 3OBJA 2X0PA 4BDFA 3W0OA 5TT7A 3W0FA 4HNIA 4YJVA 4PDYA 4CQEA 3RK9A 4WBBB 2FSLX 2ITTA 5HCZA 4FKRA 4M84A 2JDVA 4WT6A 3RFWA 3I04M 1PXMA 4MH0E 3O23A 4RX7A 2D7GA 3OW3A 5C1QB 4MXXA 2C5NA 1R2YA 4MXOA 3Q32A 3CJFA 5EH0A 3CD3A 4F99A 4OBOA 3GLHE 4N6ZA 2AEGA 3C4CA 4AFEA 3OROA 4DDIA 2GS7A 3O7LD 3TIZA 4IZ7A 5J1VA 1R39A 3MPAA 2DWMA 3T8OA 4W4XA 2JY5A 3JY9A 4AGDA 4F65A 4PD2A 4U41A 5KE0A 3AMAA 2P3GX 4PPBA 3W68A 2ETRA 3OFMA 5LCKA 4DT8A 1XMLA 3NWWA 1SM2A 1HNXM 5CLPA 1PKDA 2NYAA 3IECA 3PY3A 2JKKA 2CNUA 2YEXA 4IB1A 3BE9A 3E63A 3TPZA 4OTDA 2XKCA 1JB0F 1IBLM 2YN8A 4ASEA 4J8MA 3UMMA 4FE2A 3I5ZA 3QTZA 3L29A 3I4VA 4CZUA 2VX0A 5CI7A 3MA3A 2XKDA 5LVMA 4FKSA 4KS7A 2MH8A 4EH7A 3MVLA 2BDFA 1ZOEA 3HDNA 5K5NA 1YDTE 3U9NA 2H96A 4GC9A 3WBLA 4JL9A 4CKRA 5DFPA 4K8AA 3LXNA 1UU7A 2XK8A 4YSJA 3R7GA 5AAEA 3W67A 2XIXA 4H05A 3CD8A 4JBPA 3PG3A 1QAMA 4GVAA 2DUVA 4HGEA 3C4ZA 3GI3A 2R3JA 3CQEA 1SG9A 5FXQA 3OCBA 4TYIA 5BV3A 4TYHA 2HWOA 5ANDA 4DV6M 4FV9A 1IN4A 2F4VM 3G0FA 4J98A 3F69A 3JS2A 1S9JA 2QR7A 1BI7A 2WNTA 2I0HA 4A06A 5IUGA 1Y57A 3UG1A 3SAVA 4MKCA 5E8YA 4QDEA 1PYEA 2WMWA 4LG4A 4RVTA 3K9OA 3BOSA 4YJUA 1MRUA 3SW7A 3J7AS 3KRJA 3MY1A 3SATA 4R78A 3ULZA 2X7OA 4NOOB 3CLYA 3RCJA 3WZEA 3SYLA 2OIBA 5JQ5A 1F5QA 1OB3A 4FTRA 2V7OA 1K9AA 1M17A 5ANGA 4RBLA 2WB8A 4C2VA 4KS8A 4NWMA 3MB7A 4ZSEA 1YI6A 3DNDA 1RDQE 3CKXA 3KFUG 1CKJA 4F9YA 4NTSA 3GLIA 4CQGA 2Z8CA 1QDTA 3HKPA 2EXMA 4E7WA 3GT8A 2R7BA 3E8EA 5LVOA 4X3JA 4FWHA 5HLNA 3R21A 4X64M 4YMJA 1R0EA 3L1SA 4FCTA 3QZGA 4JVGA 4G17A 4QMTA 4XBOA 3HYHA 1W2DA 4FKJA 1PHKA 3BLRA 3HEGA 4IFCA 3A7HA 5B0XA 4TW9A 1XXHB 5DBXA 3AT4A 3U6DA 4TWOA 4CZTA 1HJPA 3MTFA 1GY3A 2CGVA 5DMZA 4HPTE 2Z7JA 2XNEA 4GSBA 5TOZA 1IY0A 4CFWA 3SRVA 4CISA 3GQLA 4WW0A 2VF7A 4E4NA 3KMUA 4JYAM 4BN1A 1OIZA 3T3VA 5JEBA 4FOBA 3BGQA 4MBLA 2YACA 4KLNA 2X8IA 1Z5MA 3KW6A 5CZHA 1XB2B 1HT2E 1JQJC 4S32A 3WI6A 1R6BX 5B2LA 4FJVA 3ZSHA 4C4IA 4BB4A 5ANEA 2QNJA 4FZAB 3KXEC 4IBBA 4QTEA 4O22A 4GH2A 2JFMA 3V51A 1PRYA 5CNNA 4QP9A 1ST4A 2C99A 4GRBA 1H27A 2VUWA 3ZQJA 2LVNC 2QOFA 4OTWA 4JG7A 4EOKA 1HCLA 3GCQA 4EJ7A 3HU2A 1BL7A 1QPCA 4O0VA 2WTJA 4DV2M 3V6RA 3ETAA 4F09A 2ZDUA 3WF5A 3D5VA 3TTJA 4F7NA 3C0IA 4UMQA 3N4TA 1WXQA 4BGHA 2R0UA 3QQHA 4TKSA 3E93A 2OFUA 3D14A 1SZMA 5L2SA 2QURA 5EP2A 2BZJA 2OQ4A 3BGZA 2NPQA 5BVNA 3SYKA 1XBCA 4DR4M 3RI1A 2C1BA 5CF6A 3CBLA 1G8JA 5GNKA 4X21A 3C0GA 4JV5M 1M7NA 2OIQA 3AQVA 1UNLA 3KL8A 3ZC6A 4HL4A 4I20A 5HI2A 2X2LA 2XNGA 5IUHA 1FBNA 3IG8A 1A5TA 4DR6M 3M1SA 2QPAA 5HIDA 1NA7A 4LMNA 2P2IA 3OP5A 3C3DA 5CT0A 4E4LA 4QOXA 2DAEA 3GP0A 2XEYA 5AR4A 3PNVA 1Q24A 3D5WA 5A4QA 4CKJA 4NM0A 1NY5A 2WD1A 4H3PA 5I3OA 4DBGB 4R3PA 2QO7A 2CNQA 3F7ZA 5FDPA 4DGNA 3S4QA 5HLPA 3KULB 5IA2A 4I23A 1OKZA 3FMLA 2ZOQA 3QGYA 4XS2A 2M5ZA 5I9XA 4NKSA 2BRGA 4FYNA 1F0QA 5AUUA 2BVAA 4XG3A 4DR5M 2XK3A 2WMAA 3QKKA 3ZMMA 4LF7M 3COIA 1U5RA 1ERKA 4FTUA 1WBTA 2VAGA 2AC5A 5DFLA 4RGJA 3LQQA 4IQ6A 5D7VA 4D2RA 3R6XA 1ZWSA 3CY3A 4G6OA 3HX4A 1G3NA 1V92A 4FEUA 2X4FA 3AKKA 1YHSA 5FQDC 4ASDA 3OWPA 2WKMA 4QYFA 2Y4IB 4IC8A 2WPAA 5EI8A 4JDJA 3DKFA 2P0CA 4FTCA 4Z8XA 5ITRA 2FB8A 3VUHA 4BI2A 3UDZA 3QF9A 3GPPA 2OG8A 1RW8A 1K3AA 3E46A 2O8YA 3EFKA 2JDRA 5AJQA 1TQMA 3NYVA 3OD6X 2UXDM 1YUBA 3A4OX 3FL4A 5CI6A 3SOAA 1OI9A 3P08A 3TEIA 3D5UA 4EH8A 4IVBA 4IADA 2XJ2A 3NYNA 4LJ6A 2ZMCA 4NIFA 2IZSA 3SV0A 3CKWA 4GYIA 4K0YA 3MA6A 4M69A 4XMOA 2W9FB 5HNIX 1G4AE 2WGJA 3PXFA 3BYOA 1AUAA 3G90X 5IH5A 5DGZA 4FGRA 4TYEA 1Q4LA 4Z6YA 2X0QA 2APLA 1BYGA 4G16A 2ZV7A 1TF0B 3EOCA 4IC7A 5IT9S 1RQQA 2DQ7X 1MJGM 3Q6UA 4NYEA 5M44A 1PKGA 4JJRA 3UQCA 4JI4M 4O6EA 4XEYA 2ZTDA 3UE4A 1YE9A 4MGZE 4JR7A 2PTKA 5E8TA 4FVPA 2WOUA 4IDVA 2V1CA 1IASA 1ZLTA 4AP7A 2PYWA 1HOWA 1NV8A 2BFXA 2WTDA 1IXSB 4PDGA 4OTGA 4BYIA 1DAYA 4YPDA 1G3IA 3GCPA 3AC5A 4QD6A 2F5NA 3TZMA 4DG2E 4ZOGA 4ZTNA 4EIWA 2VF8A 3TXOA 4P5ZA