3K2LA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
410
structure length
402
Chain Sequence
VDLGTENLYFMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPQKLLDASKRAKNFVSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Down Syndrome Kinases, DYRKs, Reveal Mechanisms of Kinase Activation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
total genus 118
structure length 402
sequence length 410
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k2lA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k2lA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k2lA02
4AZFA 3QAME 4LYNA 4NJDA 4FKWA 4JAIA 4WOVA 3GC8A 4FV5A 3K5UA 4C3FA 1TQMA 3TNWA 5GNKA 1YOJA 2UZOA 3OOMA 3WZEA 1JVPP 4CVAA 3QXOA 4FX3A 1PMVA 1R0EA 4HNFA 5M53A 3Q2MA 2C6KA 3Q4UA 4I6QA 5C4KA 4FVQA 2V55A 3O8UA 1YXVA 4LMNA 4WD5A 5HBEA 3DQXA 3R7OA 3RWPA 4BIEA 2UW3A 5CAOA 3CD3A 3VRZA 3BU6A 5CZIA 5C8NA 5EYDA 3FXZA 2J7TA 3F2AA 5J7HA 4NKAA 5CANA 3OF0A 5DT4A 3DKGA 3LHJA 3GXLA 4BHNA 4BR3A 3R8MA 4C34A 4D1SA 4X21A 3NW7A 4FKPA 5L8LA 4O22A 5GJGA 1PJKA 4AZSA 5AUZA 1APME 4S31A 3UOHA 4E73A 5HKMA 5EDRA 5LOHA 3AC8A 2GPHA 1DI8A 4E20A 5HICA 4J1RA 5LARA 2OH4A 3L9LA 3AG9A 4YZBA 3VS3A 2GNGA 2UW6A 1IAJA 3ERKA 2BPMA 3HX4A 4X6QC 4ANSA 4ZMEA 4ANBA 4X3FA 3BWFA 1OPLA 4A9SA 3I7CA 2EUFB 5L3AA 4AZTA 4JBOA 2WZJA 3UIBA 3DAJA 4MQ2A 4WNOA 3ZH8A 2C0TA 2IVTA 2W5AA 3FMJA 2B55A 3LQ8A 2R3FA 2JIVA 3RNYA 3VWAA 2OJ9A 5CSWA 3W2QA 4D58A 2BRNA 4DTKA 5AADA 4FTNA 5CF8A 1NA7A 3EN4A 3GCUA 5CWZA 2ONLA 4I0TA 4OGRA 2Y0AA 4BCMA 5I0BA 2R3MA 2XRWA 4XJ0A 5J9LA 2R0IA 3F88A 3L8SA 3AMBA 4IDTA 3L8PA 5HLPA 2A27A 5E8SA 3WF9A 3LQ5A 4EKLA 3Q4ZA 3FBVA 3KL8A 2PZ5A 4UALA 5EHLA 3HNGA 4ZSLA 2EXEA 1J1CA 1Y6BA 4J71A 5GIOE 5EYCA 1J1BA 4YLKA 3BCEA 3GI3A 4G6NA 4I20A 4RFYA 2UW9A 4I0RA 4C4GA 4QMZA 2IVSA 3E3BX 3V5PA 4Z3VA 2IW9A 3LM5A 3BKBA 2O8YA 4IWOA 3TDVA 3ZRKA 4C2VA 2UVYA 2J51A 4CKIA 3TZ8A 4QP2A 4MVFA 1WBVA 5HU9A 2P2IA 4KUJA 3ZUVA 4USEA 4YJRA 2YZAA 3HRBA 4JNWA 3VULA 1SZMA 5GJDA 2VTAA 3RAHA 4QMMA 1Y6AA 4CFXA 3TTIA 3HMNA 4RGJA 1BKXA 4L45A 4F4PA 5DR9A 3VW8A 3W2RA 4RWLA 4J8NA 4BGGA 4EHGA 3ZFXA 3ATTA 4QP9A 2WTKB 1NVQA 1V0OA 3NYVA 5IQDA 2PZIA 3AC2A 3DK3A 3Q4CA 4I5PA 4IW0A 4IX6A 2UZDA 3VBXA 4QMUA 5AM6A 2XNBA 4QQ5A 3R9DA 2Y6MA 3ELJA 2BIKB 4JX7A 4KBCA 3HMIA 3OD6X 4GT4A 4C02A 3KKVA 2VWYA 3MY0A 1YW2A 4IX4A 5AR4A 4M3QA 5J1WA 4AT3A 3VBYA 5F4NA 2WIPA 4IAYA 5E7RA 3TI1A 5GZ8A 3HEGA 4ZTSA 1ERKA 4FT0A 3W8LA 5A9UA 4UBAA 5E8YA 4TYJA 3O8PA 3DK7A 3BV2A 5CAPA 3KA0A 2CGXA 2IZUA 3U51A 4LGHA 3DNDA 4D1XA 1Q61A 4O7TA 1XH8A 3VC4A 3NIZA 2BZJA 4JS8A 3MESA 5IQGA 5EQEA 5HLNA 3ZUTA 2J0KA 3FC1X 5IPJA 4M97A 1Q4LA 3LJ0A 4IX3A 4FKGA 5DRDA 2ZDUA 3FY0A 3POOA 3QQGA 4O0VA 3A8WA 3QRTA 4FEUA 4O7LA 4O7WA 4I92A 4UWBA 4WUAA 4XOYA 4FBXA 2BAJA 2UZTA 3NRMA 3F61A 4TTHB 4QD6A 4LQMA 3LLAA 1WBOA 3KRRA 2YJRA 3II5A 3ODZX 4YGAA 2P3GX 2R4BA 3EQDA 3Q2JA 4ALWA 2ERZE 3TV6A 3TZ9A 2GMXA 1WCCA 5HO7A 3ODYX 3A4PA 4NIFB 5CU2A 2WQNA 3R9RA 2JAVA 4J8MA 2YCSA 4FSUA 3ROCA 3F82A 4FIHA 4FOCA 3HGKA 1MRVA 3LCDA 4EK5A 4KABA 4QP3A 1YHWA 4W4VA 5JSMA 1SNUA 2ZM1A 3BIZA 4R6VA 4BKZA 2QOIA 3WZUA 2Q0NA 2WTCA 3F66A 2C4GA 3R28A 3VF9A 2YAKA 2YM8A 2VTQA 4NCTC 4LOPA 4F99A 4D0XA 5CAQA 1Q8UA 3F3WA 4TWNA 1F3MC 2ZV2A 3QL8A 3HV5A 4AGCA 4E4MA 3Q53A 2YHVA 4BKYA 2X39A 1E1XA 3UO6A 1AGWA 4F9YA 2ITNA 4AUAA 4FKTA 4IVBA 2OKRA 2J0IA 5L6OA 4BN1A 1Q8WA 5DNRA 4PNIA 4CLIA 4UX9A 4LV5A 4FV8A 4I4FA 1NW1A 2CLXA 2YM3A 1M2QA 3LAUA 4PF4A 2YIXA 5FXSA 4CXAA 5GZAA 3UOJA 3COKA 2XZSA 5CF5A 4O96A 2UZVA 1OL2A 5CEPA 3FMLA 4FYNA 4QMWA 3C7QA 3PXFA 4NM0A 2R2PA 4WUNA 4ACGA 3L8XA 3MS9A 3S4QA 3EB0A 5IDPA 2RG5A 2C1AA 4QMOA 4R78A 3EZVA 1DAWA 3P5KA 3EZRA 3RPYA 3VBQA 3PY1A 3HYHA 3TNHA 3MVLA 4CYJA 4MCVA 2BRGA 2X81A 4U8ZA 3PIYA 3ZYAA 4C7TA 5AV3A 4P7EA 5IQHA 2ONLC 3G9LX 4E7WA 4F0GA 3LE6A 2X9EA 2VO7A 3UQGA 2JD5A 5IEYA 4BVUA 4HYSA 3ULZA 3MB7A 4CMOA 4E8AA 4EOQA 4FIJA 3KN6A 3MBLA 4EC8A 3QHWA 2VWXA 3UZTA 1YXTA 4F6SA 1H0WA 1M17A 1WMKA 2IJMA 3FPMA 1LR4A 2I0HA 3QFVA 3DKFA 4FK6A 4G9RA 4QNYA 2VGPA 2AC3A 3D14A 4EZ5A 2RG6A 1KWPA 1ZY5A 5BNJA 5AV1A 5L6WL 1OGUA 2QQ7A 2JC6A 4TYHA 2XA4A 4MNEB 3PXRA 5HZNA 5CT7A 2JDVA 2FYSA 4FUXA 3IOPA 1PKGA 3FXXA 4F0IA 4F6UA 3RAIA 4IB5A 4QTCA 2UVZA 4Z7GA 2VD5A 3KY2A 4FEVA 3ZEPA 4OTWA 4ACCA 4CZUA 3R7IA 4YZCA 3RI1A 4ERWA 4FODA 3PPZA 4GU9A 1XWSA 3P7BA 2VNYA 3F3ZA 4BDBA 2ERKA 2X2MA 2CJMA 1IASA 1QL6A 4LRJA 1JSUA 5CVHA 5E91A 3KFAA 4B8MA 4DEEA 2GFCA 2Z7QA 4Z7HA 2HY81 4RX5A 2YM7A 4H3PA 4BDKA 3NX8A 1JLUE 2GSFA 4D28A 3OCGA 4RC2A 2VTSA 3OW4A 3GCQA 4A9TA 3ANQA 4WNPA 3K54A 1ZOEA 4C62A 5M08A 4GCJA 4GUBA 2C5VA 4GKIA 5HX8A 4PL4A 4BDFA 4CV9A 4O2ZA 4FEQA 4DFYA 3W2CA 2VTHA 2OO8X 2PL0A 3KXMA 2RFEA 5BVWA 3UOLA 4F70A 3C5IA 4L53A 4NH1A 4CG8A 3AT3A 4LRKA 3MDYA 5ANJA 3HRCA 5BMMA 3V6SA 3ZLYA 1H24A 2XF0A 3IONA 3M2WA 4BCOA 4ENXA 4C59A 3OCBA 2C6DA 4FV4A 4N57A 3FMDA 1UWHA 5I3OA 5BX0A 2BRBA 4E4XA 3LJ1A 4CSVA 5L6PA 5L2WA 5AFVA 2W7XA 1XJDA 5HE2A 2YCFA 3PXZA 2XIZA 3I79A 3VIDA 3FLNC 3OT8A 2W96B 5FTOA 3LFCA 3RZBA 2Z7LA 4F1OA 4I21A 2X7GA 3VS6A 3RNIA 4DE4A 3JVRA 3O8TA 2FH9A 4M14A 3UNZA 4IEBA 4DH3A 4V0GB 5EYKA 3VBTA 3HECA 5K5XA 4AW5A 3LIJA 4O0RA 3AC3A 2UW5A 2XMYA 3MY1A 3BPRA 3V6RA 2C0IA 4JL9A 3WYXA 1CKPA 2CGVA 2XCHA 4H58A 3OXZA 3PFQA 3P79A 2XM8A 4QYGA 3HUCA 2EWAA 3BEGA 2F2CB 4IDVA 4KIKB 5J95A 2YIRA 5AX9A 3IG7A 3C4WA 4PL5A 1TKIA 2E9NA 2WOUA 4TRLA 2OJGA 5HBHA 2VGOA 3R63A 3QZFA 3QF9A 4S2ZA 3RPVA 3LCSA 2FGIA 4FKQA 5IA3A 4G3DA 3UNJA 3EQHA 4F9AA 1V1KA 3GCVA 4C4FA 1CMKE 1GNGA 2BTSA 4L01A 3UQCA 2AYPA 1IRKA 4CLJA 2JKKA 3EN9A 5LCKA 3VO3A 3I0QA 4MQ1A 5AWMA 5AA9A 3DJ5A 4X0MA 3HMOA 2BUJA 2XKCA 2XNGA 3F7ZA 3JYAA 1H1WA 3OXIA 3FI8A 3ALOA 1G5SA 2XNOA 3VF8A 2X6DA 5FBNC 3PWYA 4ZY4A 1DI9A 1G8SA 2VWBA 3C5UA 4JLCA 3OWLA 3CKWA 3JVSA 2BZHB 3MV5A 3TL8A 4IFCA 2R3KA 3KEXA 3D2IA 5EG3A 3QC4A 3ZFMA 4FSTA 4JDHA 3F5UA 2B9HA 3A7HA 5CEOA 3PDTA 2Y4PA 2OICA 1UU7A 5FXRA 5I9VA 1IAHA 2OZAA 3ZUUA 3UO5A 1YDRE 3QZIA 4S30A 3DB6A 1J3HA 3QCXA 4EJ7A 5HE3A 4GUEA 5CAUA 4ZTNA 1CTPE 5C8MA 3WYYA 4DFLA 3JR1A 3BYSA 4BTMA 4DH5A 3DS6A 4C33A 3R22A 5FTGA 5AIKA 4QMQA 4YJOA 5LXMA 3OXTA 3OS3A 3DXNA 4BHZA 4AZEA 3SAYA 4ACDA 3Q9ZA 1KV2A 3BBWA 4FV0A 5A4QA 4IVDA 4LUEA 4RIOA 2PVYA 3VJNA 3OZ6A 1BI8A 1PXIA 4NYEA 4HCUA 4BFMA 5HORA 4FA2A 3FLSA 3FZOA 4FKJA 3A99A 4R5SA 4PMSA 2RL5A 4UZDA 1BL6A 4ALUA 2BDWA 5H8EA 3VS2A 5JH6A 2GFSA 2GNFA 3KRJA 5DMZA 3PY3A 5M09A 3VQUA 3IGGA 3BWJA 3RP9A 5KMLA 3A7GA 1QPEA 4FG7A 1LP4A 4JQ8A 3LMIA 3L9PA 4LGGA 5F95A 4DEIA 4AOJA 3I6WA 5M4CA 1H1SA 2QCSA 3QRIA 1UVRA 4KIKA 1I09A 4IH8A 2QOBA 5DFPA 5KBQA 5JGDA 2PVLA 3AGLA 3UOKA 4G3CA 2WMTA 4EOJA 4NWMA 4R77A 4FKIA 4Y5HA 3QUPA 4XP0A 3QTWA 2VX3A 3E93A 4FSNA 4O0UA 4ZJVA 3FXWA 3P23A 3SDJA 4O6EA 4XG6A 2QKRA 4GIHA 3TIYA 2OJJA 4ZLYA 3I81A 2GCDA 1U5RA 3DKCA 3HA8A 3HRFA 1GIJA 3FKNA 3PTGA 3WILA 5KCVA 3FSKA 3DFCB 3LXKA 4A07A 3ANRA 4R8QA 3B8QA 4U80A 4JBVA 3QQUA 3SD0A 1SYKA 2WTKC 2XVDA 3BELA 5BYYA 2RF9A 5CEMA 3R7UA 2FSMX 4II5A 4I6BA 4IAZA 5FP5A 3RM6A 4JQEA 3HV7A 3UPXA 3B8RA 4O7RA 3R00A 4Y73A 3E8DA 3W18A 3NNVA 3N51A 3KXGA 5D9HA 2V7OA 3CGFA 3EYGA 1H4LA 3KCKA 3NPCA 2VX0A 2KTYA 4FKOA 4Z55A 4CKRA 3ZM4A 5AV4A 4IFGA 4KS8A 4ZOGA 2IWIA 3ZC6A 3QTSA 3P86A 4C37A 1OPJA 4BCFA 3PXQA 5J9ZA 4DG0E 2XK4A 2YACA 5EK7A 4XYFA 4BBMA 4IANA 2QO2A 3WF7A 3CY2A 1Q8YA 3RCDA 2C69A 1KUTA 2PTKA 4BDDA 2BKZA 2XKDA 5FBOA 4WG4A 5I9ZA 1BUHA 1WBNA 3C9WA 3NAYA 2JLDA 4K2RA 4NM3A 4UZHA 3SXSA 2WQEA 4EWQA 5J5SA 3WZJA 4HGTA 2CNVA 3BHTA 5CU3A 2R0UA 5KMNA 3FWQA 4G5JA 4F9BA 4KKHA 1Y8GA 2C0OA 5CENA 4C3PA 5E8UA 4K18A 5BVNA 4TL0A 2WTJA 3EOCA 1M7QA 5IF1A 1FPUA 2NO3A 2O64A 3NUYA 3U4WA 3E7OA 4JI9A 3QTQA 4Q9SA 2YDIA 4K1BA 2YIYA 2IW6A 4UMQA 2B54A 2CKOA 3OCSA 1JPAA 3H9OA 3PSCA 3QHRA 3KRLA 4RFMA 3TN8A 2C5NA 3IECA 5D41A 3ZMMA 2CKQA 3DAEA 3DJ7A 3T3VA 3DJ6A 2F7EE 2O5KA 3ET7A 3PRIA 4GFMA 1PHKA 3PJ8A 4G16A 5HO6A 2C6TA 4IC8A 5TO8A 1NT2A 2W1DA 2C6LA 4E93A 3CC6A 5CSPA 5KUPA 4ALVA 4USFA 2HZNA 4CTCA 2QU6A 4O7YA 1OL6A 4WRGA 4FOBA 3VS4A 5A4TA 4QTEA 4GU6A 5CSHA 5HHWA 5IMXA 2NPQA 4HOKA 5EQYA 1YOLA 4XP2A 3RWQA 2XEZA 4H3BA 4WHZA 4A4LA 4C4IA 3ZDIA 1RW8A 2BR1A 4YURA 4DLJA 3H4JA 4NKSA 4CFWA 3S1HA 3KVWA 2JKQA 3DOGA 4H1MA 4AACA 5T68A 4DCAA 3UVRA 2QODA 3GOKA 4CG9A 4O0SA 2QOCA 1IA8A 4L3JA 3MA6A 3TZMA 4HVSA 3OVVA 3QQLA 2VTOA 4OUCA 5HNIX 5AM7A 4OTFA 4MAOA 4GS6A 3UC4A 3PVGA 3QXPA 2PMLX 5EKNA 3KMUA 2FO0A 2ZOQA 4CMTA 2C68A 3FY2A 4IAFA 4XG7A 3LZBA 3P08A 3G90X 5BUJA 2JBPA 1Q62A 2OIQA 5LVPA 4NM5A 3D5UA 2PMOX 2A2AA 4EEVA 1XR1A 2WIHA 3ORMA 5HVJA 2X8EA 3PA4A 5J8IA 2IVVA 5EDPA 3W1FA 1ZAOA 4E6DA 3N9XA 4RWJA 3CTQA 4QPMA 4IIRA 3AMAA 1A9UA 2YAAA 3IKAA 3KMMA 3D5VA 3PJ1A 4LMUA 5C4LA 1MQBA 4YJUA 4C3RA 3EJ1A 4CQGA 3I0OA 1URCA 2EXMA 4GG5A 2YWPA 3MPMA 4MX9A 1XH5A 3ZO3A 1VYWA 4MXZA 4E4LA 1H27A 4H36A 5HIDA 3UVPA 3WE4A 3ZSIA 3KCFA 2ITZA 1Y91A 2WMWA 3DGKA 4FTCA 4JOAA 4C0TA 5F94A 5FGKA 3DXQA 4RQKA 4PQNA 1O6LA 4BBEA 3OMVA 2F57A 4EC9A 2UZWE 5HD4A 2XNNA 3MY5A 4U44A 3NNXA 3CXWA 4NW5A 3GC9A 1NY3A 4AFJA 3SXRA 4XEYA 1ZYCA 2W4JA 4DAWA 3G6GA 3V5JA 2REIA 4DFXE 2QLUA 3NUPA 4FTLA 3WF8A 4B0GA 3A7IA 2ETMA 2IZTA 3R7GA 2XCKA 4L43A 2UW0A 4I5MA 3E5AA 3MGYA 2CNQA 4DT8A 2OXXA 4DG3E 3ZXZA 3Q04A 5L4QA 3D83A 1PXPA 4BCQA 4M0YA 4QTAA 3QKKA 2DQ7X 5D10A 4QP1A 3QD2B 3GQIA 4GIIA 5EI8A 2ZM4A 3WOWA 5E1EA 4YTCA 4DBNA 4WO5A 1Q24A 4XG3A 4DGLC 3QQJA 2ZB1A 5ANKA 2J5FA 4UYNA 1GY3A 4RJ6A 3F7WA 2HY0A 4E26A 4GK4A 5AMNA 3LFFA 1BL7A 2E9OA 3OWKA 3LQ3A 3VN9A 4FKUA 3ZLWA 1W83A 2RGPA 2V22A 3DY7A 3DTWA 1WVWA 3PVUA 4M69B 4AOTA 4KA3A 4PRJA 1BI7A 4E6QA 3CS9A 5AA8A 5JZJA 2Z02A 1Z5MA 3TM0A 5CEKA 2V5QA 2X2LA 4QP8A 2PVRA 4ARKA 3FI3A 2C47A 4KBAA 2PVJA 3G15A 5IQCA 4FZDB 1ZZLA 2PMIA 4APPA 3EFWA 3EQIA 2W1EA 2JKOA 4D2WA 4G2FA 5FDXA 3OG7A 4FZ7A 2PVKA 5IH6A 4U43A 3MWUA 4OTQA 5EKOA 2Q0BA 3KGAA 4AG8A 4PUZA 1Q8TA 4HNIA 5KHXA 3BU3A 1UNHA 4BCJA 4F0FA 3MVJA 2C3LA 3MH0A 1UU9A 2WNTA 2J2IB 5C8KA 3C13A 4O7ZA 1QCFA 3DLZA 5D12A 4U40A 1X8BA 3R9HA 4IWDA 3GU6A 2G1TA 3E88A 3IW7A 4FZFB 5B0XA 4DH7A 4PPBA 3F5XA 4EH3A 1W84A 2J0MB 4D5HA 3FPQA 3QQKA 3U54A 3HV3A 2HWOA 3FYJX 4NUSA 3S2PA 3A2CA 2Z7RA 3QRUA 3WE8A 4ACMA 2WMSA 3OTUA 2QI8A 4YTFA 2O63A 2IPXA 3LW0A 3ORTA 4C4JA 4I24A 3NZ0A 4O82A 2GHMA 4BCNA 4P90A 3AD4A 5M4FA 3WI6A 3HA6A 2ZMDA 5CQUA 2UV2A 2O2UA 4RX7A 4D4RA 2YIQA 3NVKI 2XUUA 4H05A 2X7FA 4FR4A 3I5NA 1OKVA 2W1FA 3WARA 4CQEA 3H9RA 4D0WA 3KK8A 1OBGA 4YZNA 4O0XA 2CN8A 4V04A 5AP0A 3R9NA 3UTOA 4F65A 1FINA 3O7LD 5BYZA 1ZZ2A 2GTMA 4V01A 1YDSE 4AXAA 4DC2A 4EH4A 5KZ0A 2W17A 5DI1A 5CEQA 4DEHA 5J79A 3CKXA 3VHEA 2GS6A 3O71A 4OTGA 4Y95A 4XRJA 4O38A 2VV9A 3IDCA 4NIFA 5L2SA 2OGVA 2XJ1A 3R04A 4W8DA 4DHFA 3SVVA 3IW6A 1Q5KA 4FK3A 4FGBA 2F9GA 3UJGA 3C4XA 3PPKA 4BDIA 4EOLA 4U5JA 5TE0A 3BHHA 3QA0A 3ORKA 1FVTA 4FVPA 4AF3A 4AAAA 4KIPA 4AA0A 5I4NA 4XNEA 3HKOA 1PMUA 3BGPA 5HVYA 2EVAA 3GC7A 4EUUA 3Q9XA 4WKQA 4ANNA 5FEQA 4G34A 3UPZA 3NUNA 3AC4A 3TJDA 5ICPA 2ZDTA 3SOAA 3ZZEA 4C61A 4MTAA 5IUIA 2OIBA 3NCGA 3P7CA 4G6OA 3HP5A 5BVFA 5LWNA 3G33A 5LMAA 3Q6UA 2W1ZA 1EH4A 3PIZA 3RALA 4A9YA 4FVRA 3LPBA 4RVMA 4FSYA 3CD8A 3E7VA 4M8TA 1PMEA 2QG7A 3NNUA 2BAKA 4IB1A 4JR7A 2VUWA 4KKEA 4LRMA 4ZS4A 3DQWA 4UXQA 4ZJIA 4CFUA 1W0XC 3NSZA 2XIYA 2CGUA 4GK2A 4U7ZA 2XNPA 1I44A 3F9NA 4YTHA 2E9UA 5FM3A 1ZMVA 3GU7A 2C6MA 4QQJA 4L67A 4FF8A 4DH1A 4TZRA 3EN7A 2CNUA 3PSBA 3I7BA 4V0GA 3QZGA 4A9UA 3EQCA 1XQZA 3F6XA 1FGIA 4TNBA 5ETCA 4BI0A 4MD8E 3THBA 1OZ1A 2C6EA 3O50A 4FV7A 3V5TA 4AE6A 2ITWA 1YOMA 3R1YA 5AIRA 3SQQA 5JRQA 2OU7A 2FSTX 5AUXA 4YHTA 5KMIA 2I40A 3KF7A 4QMSA 2XNEA 4ONAA 1KOAA 1JBPE 2UZNA 5A54A 1WVYA 3CGOA 5DT3A 3LJ2A 5DHJA 5TR6A 3TZ7A 1IA9A 4XH6A 2CSNA 1ZMUA 1JAMA 2VTJA 2R3IA 1YVJA 4CZYB 4FIEA 1W82A 3IW8A 2Y4IB 2ESMA 2OSCA 4I4EA 4MD9E 3V8WA 2NNWB 1F5QA 4OTRA 3CQEA 2ITXA 2G15A 2W4KA 3KXXA 3BE2A 3FZ1A 3M1SA 3LCKA 3UVQA 1TQPA 2CPKE 3HLLA 3ZZWA 2YM5A 4Q5HA 4WG3A 5DE2A 5M4UA 5CS6A 5M56A 5M07A 3DDQA 3PJ2A 3QCYA 4IBMA 4AA4A 3FYKX 3QWKA 4RVKA 5KBRA 1H26A 3EQFA 4HZSA 3TNQB 4AWIA 1H25A 2PUPA 3E8NA 4DFNA 4J95A 1SMHA 3LLTA 4IWPA 4FV3A 4L3LA 3UO4A 4UB7A 2WMVA 3FKLA 2QR8A 3VUGA 4PWNA 4AGDA 5KHWA 4EH7A 4CYIA 4IZAA 4UY9A 5TF9A 2X4ZA 4NZWB 2OXDA 2PE1A 2VX1A 4D2PA 2R3NA 3GCSA 3IPHA 3MJ1A 2HXLA 4RWIA 1UWJA 3FHRA 4HYHA 3R7VA 5HO8A 2R3QA 4CD0A 5IMEA 4JDKA 5CLPA 3QRJA 4TYEA 3VUKA 5LMKC 4L7FA 4IVAA 4M67A 3ORZA 3CPCA 3K2LA 2YEXA 2X1NA 5ITAA 3NIEA 3WF5A 3RPRA 4X2GA 1H07A 2R64A 4EYJA 4EKKA 4YJSA 4C8BA 5E1SA 2BVAA 4EK3A 1VEBA 4PMMA 5HIEA 4FC0A 4X2FA 5EM7A 1P2AA 2BMCA 3QRKA 1YWNA 2G2HA 3MSSA 4BZNA 4B6LA 2R7BA 5EDQA 2PMNX 2X2KA 3MN3A 4MBJA 2B0QA 4CT1A 3KULA 2R3RA 2QKWB 1JKTA 4O84A 4GVAA 4FTJA 4WT6A 5B2MA 3BYOA 1UKIA 3LFAA 5AP4A 1GIIA 2QOKA 3Q5IA 3KK9A 4QMLA 3BYVA 4ITIA 5AX3A 2P55A 4EI4A 5AJQA 5KMOA 2HYYA 2I1MA 4MKCA 2XNMA 2A19B 4RC4A 4EOIA 4LM5A 2EB2A 4GKHA 4IB3A 5FWKK 5LVOA 4DCEA 5FQDC 2YWVA 2QHMA 3VUMA 4FTIA 2Y8OA 3MH2A 4FEWA 5KKRC 1U54A 5HTIA 5BYLA 2WTDA 4IZ7A 2CKPA 3LOKA 3GU5A 5IQBA 3KXHA 4I22A 2A1AB 3BYUA 3OWJA 4O0TA 1RQQA 2DS1A 4DA5A 4FE2A 2C5YA 3P78A 2IO6A 5EYMA 4ZY5A 4LGDA 3FE3A 4F9WA 2WFYA 3NW6A 4RLLA 4EHZA 4D2VA 1XH6A 4YMJA 3MFUA 1LEZA 4NTSA 1U54B 4GEOA 4R7BA 3A8XA 2B53A 4WNKA 4D9TA 2PYWA 4AQCA 1G3NA 4FTMA 3OP5A 3DDPA 4CMUA 4F7JA 1MUOA 3A62A 2YFXA 4FKRA 4BCIA 4RZWA 4NFNA 5HQ0A 5HBJA 3H10A 4D5KA 3D94A 3K3JA 2VTMA 4CV8A 3D5XA 5HTCA 2WMXA 3D15A 2YERA 4QPAA 3ROYA 1DS5A 3ZHPC 4BRXA 2PZYA 5JQ5A 3BLRA 3RHXA 3EN5A 1P14A 3RKBA 4I41A 3PRFA 3EL8A 4F09A 4XP3A 3R1QA 4IZ5A 2ZYBA 4FL3A 2B9IA 1UA2A 4YJVA 2VNWA 4ITJA 4QO9A 4I5HA 4UYAA 3ZO2A 4G6LA 4FTAA 3RINA 4NEUA 3CP9A 4M15A 2G9XA 3TJCA 4QMTA 1Z9XA 2UZBA 4ZTRA 2WB8A 3IO7A 5DPVA 2QURA 2JAMA 2R3OA 4CTBA 1QPCA 4FIIA 4ITHA 3U9NA 4QQTA 2OJIA 3EKNA 2X7OA 4JBQA 5I5ZA 5HD7A 1FOTA 4RJ3A 3AC1A 1B39A 2W1GA 3DCVA 5HCXA 3V5LA 4AW0A 3BEAA 5AR3A 5AAEA 5CSVA 4P5ZA 2JFLA 3FLWA 2BILB 5A4LA 4TY1A 2PE0A 4RJ4A 4O81A 1BYGA 4OTPA 1WBWA 4XG8A 5HG8A 4IMYA 5IEVA 2OIDA 1J7IA 3NYNA 3UDBA 5FDPA 4DGMA 2WPAA 4BWXA 2QC6A 2HK5A 1PXKA 1XKKA 3G0EA 2BZIB 3Q52A 4G17A 4AP7A 5IA0A 1W98A 2YISA 4EHEA 4O91A 1F0QA 2JITA 4KNBA 1OBDA 3B2WA 4QOXA 2F7ZE 4K33A 2UZLA 4DTBA 3PG1A 4ID7A 4N6ZA 3ACKA 5JFSA 3NYXA 5JRSA 3WIKA 1RDQE 3BI6A 4GT5A 3HP2A 4U79A 4DEBA 3PA3A 5IQAA 3N4UA 3MIAA 2RKUA 3VUDA 1ZYSA 4AA5A 4FV2A 5EI6A 1T46A 5I9WA 2QOFA 4P4CA 1L8TA 4XOZA 3O17A 2OFVA 3OTVA 4U41A 3ZRMA 3H30A 4QTBA 3QLFA 5AAFA 4CRLA 3MPAA 4RIXA 4MXCA 3LFBA 4EOMA 5CI7A 5M06A 5HESA 3OC1A 5CY3A 5CVGA 2J50A 2XM9A 1K3AA 3EQGA 5DBXA 2J4ZA 2YM4A 2EU9A 5I3RA 1RJBA 2QR7A 2R3GA 4QTDA 2WO6A 3W33A 4R1YA 4A06A 3D2KA 4KIOA 5FM2A 4C35A 4XS2A 3MVMA 3OEZA 1PXOA 2WEIA 1VJYA 3MJ2A 1H0VA 3MTFA 1ZOHA 3HAMA 3ZONA 4DN5A 1P4FA 3QCSA 4D2SA 2OJFE 4S32A 4GVJA 5IQIA 2QOHA 1Z57A 2BTRA 4E3CA 5FP6A 3BBTB 4EQUA 4IJ9A 3K5VA 4XHKB 5HG7A 4EOPA 5IA1A 4ORKA 5DGZA 3KN5A 4CZTA 4YUQA 2GS7A 2W5HA 1P5EA 1OITA 2YN8A 4IHPA 2FB8A 2O65A 3OT3A 5AUVA 1OI9A 5FRIA 5AP3A 3C4ZA 4FMQA 4AN3A 4BDCA 2R3PA 4FSWA 3PXYA 1OIYA 1H08A 2BDJA 1DM2A 1Q3DA 3KXZA 4RVTA 5J87A 4Y46A 4YHJA 2WQBA 3KRXA 5DR6A 2AUHA 1ZMWA 4TWOA 4DINA 3POZA 2JIIA 1O6KA 4EONA 4AGUA 1WFCA 3QU0A 5F1ZA 3MFRA 3HL7A 3BE9A 4BTFA 3RGFA 5CALA 1CKJA 3AC5A 1VR2A 3KRWA 4CT2A 4FZ6A 3R9OA 1PXMA 3PE2A 4FT9A 3QZHA 2XK7A 4D55A 4AS0A 3NMUF 1ZOGA 5HX6A 4TYIA 4XUFA 3SGCA 4N6YA 3AMYA 4J98A 3C4FA 2EXCX 2R3LA 4Q5EA 2OF2A 1NVRA 3ZFYA 3DBFA 3KREA 3UE4A 2YDJA 4ZIMA 1B6CB 4JX3A 1WZYA 3NR9A 1KE7A 2ZV9A 4B7TA 5H8BA 2P2HA 3GU8A 4HVDA 3DLSA 3QKMA 4FV9A 4J7BA 4XCUA 5ANOA 5HE0A 5CAVA 4J52A 5CZHA 4L52A 1SVHA 3GFWA 3G9NA 2ZVAA 2WQMA 1OMWA 3NUAA 1FGKA 2IG7A 3QTZA 3NUXA 4TW9A 2XKFA 3EFKA 4Z16A 3QCQA 2QONA 1DAYA 4IM2A 4O1OA 4JIKA 2QG5A 4LFIA 3U9CA 4ANOA 4FSQA 4QYHA 2YCQA 4EYMA 4TPTA 4LG4A 2NRUA 5J5TA 4FG9A 2PHKA 4ZSJA 4BIBA 3QLGA 4F7NA 3ZXTA 5K0XA 3F3TA 3HV6A 1YQJA 3GENA 3L9MA 2ITTA 4IVCA 3WBLA 4ZSAA 3ORNA 1ND4A 4FNYA 3L8VA 3R83A 3ORXA 3G2FA 4ANQA 1JKKA 2PZPA 3RBWA 2UZUE 2ITPA 3CPBA 5A6NA 2HWPA 3D7ZA 4GFGA 4AT4A 2WTIA 4CCBA 4U81A 3DA6A 2PE2A 3EIDA 1OIUA 3FQSA 5IQFA 2Y9QA 3U87A 4BDEA 4Q2AA 3QBNA 3OCTA 4J96A 5HIBA 2NP8A 2QHNA 3TNPC 3P7AA 3PWDA 3RZFA 3LXPA 3HDMA 2WGJA 5IH5A 2X0GA 3BHUA 4O27B 4K77A 4TKSA 3F5GA 1KV1A 4RA5A 2VTIA 4MNFA 5E8TA 2ITVA 3CJFA 2C3KA 4MXAA 4JG8A 3Q4TA 2E9PA 1YI6A 3SC1A 3SG8A 2WAJA 4BDAA 4QMXA 4HGSA 4KSPA 2GNHA 5HG9A 4AFEA 1MQ4A 1PW2A 3CY3A 4HYUA 5CVFA 2H9VA 4Y5QA 5IKWA 1XH7A 4YU2A 5HE1A 5ACKA 3PA5A 3NW5A 3R01A 2YZLA 5EFQA 3EQRA 5AEPA 4ACHA 4N0SA 4GW8A 4NCTA 2C6IA 3KULB 4RIXB 1CM8A 1GAGA 2JFMA 4BGQA 1YI4A 3V3VA 3LFQA 2BZKB 2BHEA 1OECA 3TUBA 4KAOA 4KRDA 4ASZA 4FKLA 5GHVA 3R8PA 3UODA 3KXNA 3E87A 4U97A 3D5WA 1U46A 1FMOE 2XIXA 3PG3A 4YTIA 5BVOA 2Y7JA 1PKDA 1UNLA 4PX6A 1K2PA 2W5BA 2WKMA 5ANGA 4I1ZA 3MYGA 4O7VA 2Y4IC 5KMKA 1FVRA 1XH9A 4EH9A 4EK8A 2PUUA 2PVNA 1XHAA 1M2PA 3MTLA 5DG5A 5C01A 3TG1A 4X6RA 3TV4A 4XG4A 3F2RA 5IISA 3A61A 3ZO1A 4NU1A 1OKWA 4BZDA 2J6MA 5KE0A 3V5WA 5AR5A 2VTTA 3P0MA 5EH0A 3C0HA 3LM0A 3OEFX 3QX2A 4J53A 3SV0A 3SA0A 2CKEA 2HZ4A 2X4FA 4CCUA 5L2IA 4UEUA 2WD1A 2CLQA 2ZJWA 3RAWA 3QD0A 4O7SA 1YKRA 2W06A 1JNKA 5DH3A 3O2MA 3QTIA 2PU8A 3DBEA 3NS9A 2J9MA 4HZRA 3UZRA 1UNGA 1R1WA 4EH6A 5CTPA 3JXWA 4H1JA 4OT5A 4KKGA 4RLKA 4ZAUA 4XLIA 1P4OA 4G3GA 4X2NA 3FLYA 3NWWA 5E90A 4BYIA 2F49A 4CFFA 5IZFA 4ZSGA 3GP0A 4FNXA 4NT4A 2GNIA 4NJ3A 5AUWA 3W2PA 1M14A 3ORPA 5EHYA 3QQHA 1HCLA 3QTRA 3MH1A 3QQFA 5IA2A 4RMZA 3QWJA 4RZVA 4BCGA 4ZY6A 3CSVA 3DNEA 1KE6A 4OTIA 3VBWA 3IDPA 5EOBA 4O86A 3L1SA 3PUPA 3CTHA 3FZSA 5DIAA 4F7SA 4FEXA 2X6EA 4ZK5A 3PPJA 4YNEA 4BCKA 4GJ3A 4QMVA 4WG5A 5J1VA 3TUCA 3GEQA 2FSOX 4BDGA 1R78A 4BZOA 3FMKA 3ZDUA 3ALNA 3FMMA 4LV8A 4QRCA 3OUNB 3U55A 5L8KA 3LCTA 3HV4A 3ZM9A 4PY1A 2OBJA 2ZB0A 4GSBA 5H9BA 4AU8A 5DN3A 4BDJA 2ZV7A 5C03A 3CLYA 1Y8YA 5AP2A 3I6UA 4YLLA 4ANLA 3V5QA 5E8VA 5DWRA 4MYGA 5BUIA 3GU4A 3UIUA 4O2PA 4WSYA 2XK3A 4HVHA 4PPCA 3T8OA 5GINE 3ENMA 4JR3A 4PP9A 3ZBFA 2C3JA 2J0JA 2BKKA 2QO7A 4IWQA 3D7TB 5AR2A 1H1PA 3VVHA 3DKOA 4XV2A 3ID6C 3EQBA 4OBPA 4V05A 3NUUA 4B9DA 1KSWA 4O83A 2P33A 3PZEA 4GFOA 5AAGA 5AP1A 2LAVA 4D1ZA 3JS2A 2B7AA 5C27A 2VO6A 4J99A 3Q3BA 3SHEA 3EWHA 4XG9A 4DG2E 2A4LA 4O1PA 2ZAZA 3CEKA 3U6IA 1Q3WA 4TYGA 1YHVA 2CCIA 4FTOA 3H0ZA 2E9VA 4GT3A 2HW6A 2OK1A 4DEGA 4YJPA 5KO1A 4IX5A 4AX8A 1IG1A 3QD3A 3R71A 4ZZOA 3BRBA 1JSVA 3BHVA 2GNLA 5ETFA 4G1WA 3V8TA 4C4HA 2PY3A 1GIHA 3JY9A 3NDMA 3Q32A 4X3FC 1FVVA 4LOQA 4S34A 3ZRLA 4BF2A 5BVDA 4M84A 4WIHA 3HZTA 4U6RA 5CXZA 1PXJA 4A4OA 1OL1A 4UV0A 4ZTMA 3FLQA 5DA3A 4E5BA 4QT1A 3BLHA 2ETKA 2J5EA 4YO4A 4LL5A 4NW6A 3COMA 2X8DA 4BGHA 3VUHA 3R8LA 3C50A 3PZHA 4NM7A 3W10A 4APCA 3TWJA 4EOKA 5F9EA 1OM1A 4P2KA 4B99A 4YNOA 4JDJA 3PIXA 2J0LA 4MXOA 1HCKA 4PNKA 4I6FA 3I5ZA 3U6HA 3R2YA 1OVEA 4IB0A 4ZMFA 3VS0A 2CN5A 4RRVA 5E8XA 3TKIA 3DU8A 2I7QA 3EL7A 1NVSA 3FZPA 4FL1A 3QTUA 3QD4A 3GBZA 3V04A 4YZMA 3ZOSA 3LKMA 4GJ2A 3NGAA 2BCJA 4OTHA 2RFNA 3GB2A 3SRVB 3OFMA 5HCZA 2HZ0A 3FMHA 4MWHA 4FSRA 4B4LA 1SVEA 4JJRA 3U8WA 3IW4A 3T9IA 4IAKA 4P5QA 5DOSA 4IAIA 4FV1A 3SXFA 3NUSA 1K9AA 4D2TA 3RCJA 4K8AA 4WNMA 5EHOA 4OAUC 4WSQA 2XKEA 1OUYA 3W32A 2R3JA 2WTVA 3G6HA 4ENYA 2QOLA 5JT2A 3KU2A 2W9ZB 4BCHA 5LVNA 3A4OX 4JAJA 3H3CA 1MRYA 4YR8A 5HLWA 4BWKA 1E9HA 2OZOA 1A06A 4AT5A 2GQSA 4F1TA 3D7TA 2XIKA 3C51A 4F64A 4PMPA 1M52A 3DBCA 4QMYA 4AZWA 1J91A 4JG7A 4W8EA 2OW3A 4EOOA 4LL0A 5IQEA 4WRSA 2Y6OA 2OXYA 1BX6A 1Y57A 5DRBA 2OH0E 3BGZA 2PULA 5B7VA 4S33A 3E8CA 3ETAA 4OLIA 4RA4A 5JFVA 1PRYA 4D4YA 3AQVA 3AGMA 3GCPA 2ZMCA 4H39A 4UMTA 5ANDA 1M2RA 3VBVA 4IC7A 3H9FA 2Z8CA 1H28A 3ORIA 4GH2A 5ETIA 5KZIA 3ZTXA 2WELA 5I9XA 2FVDA 4FV6A 5C1QB 4U3YA 3ZSHA 5HVKA 2XH5A 3RK9A 2VN9A 4PTEA 4ZP5A 5K3YA 1PYXA 4GL9A 1XBAA 2PK9A 3EHAA 4MHAA 2Z2WA 3EH9A 5HOAA 4FYOA 5KNJA 4FNZA 1V0BA 2RFDA 3OUKA 1L3RE 2OF4A 2JEDA 3P9JA 2QOOA 3S3IA 3I4BA 4YSJA 1PMNA 2F2UA 1Q41A 4BCPA 3LMGA 4YZ9A 3E3PA 5AR8A 2OLCA 3OWPA 2W1CA 2JDTA 4MD7E 1YXXA 2JDOA 3BLQA 3NLBA 3FI2A 4IE9A 4K6ZA 4BDHA 3F5PA 3GNIB 2PUNA 3TKUA 5JKGA 4MK0A 4X3FB 4X2KA 5AR7A 1OIQA 3LFSA 3DT1A 4N4SA 3C1XA 3GQLA 4QYFA 2QLQA 4L3PA 4YBJA 3OW3A 3EKKA 5CU4A 4EH2A 1WBPA 3GOPA 2OZAB 2XS0A 3E62A 3Q5ZA 4ERKA 1R39A 2HOGA 3A7FA 3F69A 2WU6A 1VYZA 4K9YA 1UKHA 2P4IA 3CJGA 1KOBA 2QOQA 2JBOA 5CNNA 1TQIA 2DWBA 4M7IA 4FIGA 2WQOA 2RSVA 2YLEA 5A3XA 3UG1A 1JKSA 3DAKA 5EOLA 3R2BA 1PY5A 2BRMA 1W8CA 3QYWA 3HDNA 5I9YA 2XK6A 5GJFA 4DTAA 2W1HA 3ITZA 5EM8A 2B9FA 2JKMA 4LUDA 2HCKA 2I0EA 1WVXA 3KVXA 4EQMA 5CF4A 4L6QA 2XIRA 3R0TA 4IACA 2WTWA 4AN9A 4DBXA 4C57A 2BFYA 2XYNA 3NAXA 1LUFA 3R73A 3FC2A 1G8AA 4KBKA 2I0VA 3AXWA 4A4XA 4C58A 1YXUA 1JSTA 2XEYA 3BU5A 3C0GA 2IZSA 4BL1A 4Q9ZA 4YHFA 2YCRA 3UC3A 2H6DA 4BWPA 1J7UA 2XJ0A 5FTQA 3E64A 4E6AA 3EFJA 3L9NA 4ZS0A 5C26A 4EJNA 4HYIA 2AC5A 3R30A 5HCYA 3W2SA 3TNIA 4ASXA 1WAKA 5DT0A 2F4JA 4FSMA 4L44A 4YPDA 4FIFA 1AQ1A 4UMUA 3FL5A 2HW7A 3UIMA 3ZEWA 3T9TA 4JVGA 2VRXA 5JZNA 4PL3A 4QP6A 3DXPA 2VTNA 2W05A 4O7NA 4GK3A 3VUIA 4D4SA 4W9WA 5E8ZA 2BIYA 1H1QA 2C6OA 4XRLA 4F7LA 4RIWB 2VO3A 3FZTA 3QUEA 5B2KA 3VRYA 2QNJA 5T6KA 3PVWA 4D2RA 3NYOA 2YITA 4RQVA 5TT7A 3W2OA 4HGLA 4FNWA 4QMPA 1CDKA 5LQFA 4C36A 4TYHB 1ZRZA 3H0YA 3UG2A 3TDWA 4GG7A 4BB4A 1HOWA 4JRVA 3M11A 4MEDA 3V51A 5HNBA 1TVOA 3QYZA 4LI5A 5CX9A 5BUEA 4F08A 4GMYA 2G2IA 5AP7A 2VTRA 5AUTA 3SX9A 2VTPA 3BQRA 4PTCA 4ASEA 4DFZE 3UQFA 5IA5A 4OAVB 3BZ3A 2H96A 3C4CA 4X2JA 2RFSA 1JOWB 2BFXA 5EI2A 4EHVA 3C4EA 4AZVA 4CNHA 1STCE 3GGFA 2WOTA 4MXXA 3OBGA 4W4WA 4Z9LA 5G1XA 5TKDA 3VQHA 3MH3A 3WZDA 4KB8A 2EB3A 2R3HA 3O51A 4GYGA 1XBCA 4EL9A 4EOSA 5A4CA 2Q83A 3QGYA 2X9FA 3MI9A 3R21A 5GZ9A 3FL4A 4QPSA 3SW4A 4DFBA 3Q60A 2JGZA 1YRPA 2X8IA 2I6LA 4IXPA 1GZNA 2WMAA 4C4EA 4D4VA 5G6VA 4U9AA 4HPTE 1PYEA 3PP0A 3U6JA 2QD9A 3ATSA 5LVLA 3RK5A 3FV8A 4OBQA 2P0CA 4MWIA 2A0CX 3PJCA 2VWIA 2CGWA 5K0KA 4DT9A 4W4XA 3S00A 5HTBA 4YC3A 3CBLA 4FKVA 2GDOA 5EM5A 4GRBA 2JDSA 2C1BA 2UZEA 4JQ7A 4L8MA 5FLFA 4C2WA 4E5AX 4AW2A 2Z60A 3FMNA 4LOOA 4W9XA 4DEDA 3I60A 1UV5A 3I1AA 5B2LA 3MB6A 4HVGA 5A46A 3PYYA 2IZRA 4FTKA 4H3QA 3ZCLA 4RVLA 4XMOA 1VZOA 3BV3A 4PP7A 4QYEA 4R5YA 4TNDA 5H3QA 3BHYA 4MBIA 5CSXA 2XBJA 3RVGA 3W16A 3COHA 4ANMA 5BMSA 5JQ8A 3FUPA 4D9UA 3G5DA 5K9IA 3OHTA 3OY1A 5LWMA 5DEWA 2R9SA 4OR5A 3MPTA 5CU0A 2I0YA 5L8JA 1OIRA 4K11A 5CT0A 5HG5A 3UGCA 4DF3A 2PWLA 3DFAA 4FTTA 1FMKA 2E2BA 2B52A 4PDPA 4UMRA 4ZEGA 2NRYA 3PLSA 4BKJA 3UZPA 3VHKA 2GU8A 3MW1A 4ZZNA 1Q99A 3FJQE 5CEIA 2VWZA 3UNKA 3LMHA 2PSQA 3QX4A 4ZSEA 4XG2A 5L2QA 4EK6A 2WMBA 1XO2B 1E1VA 1URWA 4ASDA 2XK9A 5LCJA 3ENHA 1FQ1B 4QP7A 5KX8A 3DV3A 3IDBA 3AD5A 3MFSA 3EN6A 4KWPA 5EW8A 4L00A 2CCHA 2YIWA 5LMBA 3BGQA 4GV1A 4R7IA 4F1MA 3GT8A 2DYLA 5D7VA 4FT7A 2UVXA 4ZXTA 3TTJA 5E8WA 2IN6A 5K5NA 4EWHA 5D7AA 5DLSA 2BHHA 1OL5A 1ZYLA 5A14A 3IW5A 3CIKA 2UW4A 3V01A 2C5OA 1KE5A 5CXHA 5BQ0A 1U5QA 5CYIA 2J90A 3FQEA 2XJ2A 3DZQA 2ETRA 4WBBB 4CFVA 5JGBA 4L7SA 5M57A 3O96A 3SRVA 4YP8A 3F3UA 2XB7A 4AOIA 4Y83A 3LFDA 4AW1A 1AD5A 3LCOA 3TKHA 5IG1A 4QNAA 3OOGA 2YLFA 3DTCA 4A9RA 4EBWA 5DEYA 4I93A 4E6CA 3Q9YA 5CASA 2JIUA 4PTGA 2C30A 2OI4X 5HI2A 4KD1A 1UU3A 1PXNA 4DITA 5FEDA 4HCVA 4UWYA 4OT6A 4Y8DA 4KS7A 2W1IA 1JQHA 4R7HA 4DH8A 3RMFA 2PVMA 4EORA 2XYUA 1UU8A 4WBOA 4G5PA 4C38A 1KE8A 2BROA 4USDA 3D9VA 2V0DA 5CI6A 5CF6A 3FEGA 3O7LB 4L68A 1OL7A 1MRUA 3S95A 4EH5A 5E9EA 2O3PA 1IEPA 5H2UA 5D11A 4NSTA 4DEAA 1SVGA 1BLXA 4XBUA 5CU6A 4UMPA 5KMMA 4U3ZA 3LFNA 4FTQA 5ANIA 3V8SA 4OW8A 2PVFA 1V0PA 1S9JA 5AV2A 1S9IA 4YJTA 3P4KA 1GZOA 4CFNA 4RJ8A 4L9IA 2HIWA 3Q6WA 4J97A 2G2FA 1GZKA 2XBAA 4RIYA 5HEZA 3NVMB 4BY9E 2ITQA 1REKA 2BALA 3F2NA 3NNWA 5HGIA 4FT5A 3SW7A 2VTLA 3E63A 3REPA 5JK3A 1CSNA 4QQCA 5CNOA 3RJCA 4O6LA 2QVSE 4O0WA 3VJOA 3RAKA 3P1AA 3RHKA 2XK8A 4RSSA 4N70A 4ZTLA 4RIYB 1OPKA 4YBKA 1OKYA 1MP8A 4IAAA 2SRCA 4RT7A 4CEGA 1W7HA 3R02A 1ZXEA 4IADA 4OTDA 5EQPA 5A6OA 3FZRA 3UIXA 3HMPA 4PDOA 4XV3A 4Y85A 5M44A 4E5WA 5M51A 3M42A 2CDZA 5EW3A 2WXVA 1YWRA 3NCZA 3OBJA 2HAKA 3FLZA 4QYYA 3KQ7A 5BVEA 3AOXA 1H8FA 5ANEA 4AN2A 3ACJA 1SM2A 3KF4A 3E8EA 3OY3A 3ULIA 5GIPE 4KINA 4DGNA 1O9UA 2R7IA 1M7NA 4XBRA 4M0ZA 5AP5A 1U59A 2GHGA 4K0YA 4MF0A 4RC3A 2HZIA 3UP2A 3WZKA 5JFXA 2C5XA 3QUDA 3QKLA 3QC9A 4FKSA 1REJA 4TXCA 4O21A 1YDTE 4I3ZA 2Z7SA 3CQUA 4IM0A 2WU7A 3AT4A 2VWWA 3DK6A 3DPKA 1RE8A 4BYJA 4W4YA 4EBVA 5AUUA 2W9FB 4JBPA 4YLJA 4TWCA 3KC3A 3S0OA 4BICA 1GOLA 4EK4A 4UXLA 3CTJA 4I23A 4BTKA 2FUMA 4YJNA 5ACBC 4BC6A 3COIA 4IZYA 2PVHA 4L46A 2GS2A 3R1NA 3IOKA 4FI1A 4FTUA 4MF1A 3EQPA 2XP2A 4YJQA 5J9YA 3QA8A 3DZOA 4AGWA 4IM3A 4BBFA 2W99B 4ZZMA 3TEIA 5L2TA 2F7XE 4I5CA 5DYJA 2YABA 4PDSA 4RPVA 5BVKA 1OB3A 2OFUA 3FAAA 1QPDA 1R3CA 2UUEA 3IGOA 4U45A 4R3CA 3F3VA 4XV9A 4B8LA 4FGRA 2VAGA 4RWKA 2PUIA 1JKLA 5IDNA 1QMZA 3ZSGA 2ACXA 5IH4A 3C0IA 3GVUA 3TIZA 3VW6A 4BI2A 2VWUA 1ATPE 1WBSA 3W8QA 3W55A 2WMUA 1GZ8A 3ZS5A 2IVUA 3T3UA 3ZBXA 3EYHA 3DB8A 3A7JA 4TWPA 2H34A 3GFEA 5FEEA 4EQCA 3ZLXA 3N4VA 3BQCA 4YC6A 2QO9A 2WHBA 3PVBA 4CFMA 2CMWA 3FQHA 2ITUA 4JIAA 4RIWA 3FHIA 2O0UA 5LMKA 3JPVA 4JG6A 3HUBA 3MFTA 4HGEA 4ZLZA 5JMSA 4R3RA 3R8UA 3D4QA 4F9CA 3HMMA 1ZARA 4EUTA 5FUTA 4JRNA 4YC8A 4RX9A 2GTNA 3TT0A 4BI1A 4KIQA 2VO0A 3VS1A 2BDFA 4HVIA 5FG8A 1J7LA 1Q97A 3VS7A 4CRSA 3SG9A 1YXSA 4MBLA 4UWCA 3DBDA 4NL0A 3FSFA 3ORLA 5K4JA 2HENA 3MIYA 1KE9A 2UW7A 3G0FA 4IJPA 3G51A 4ZTQA 4BIDA 1NXKA 5C9CA 3Q96A 3SOCA 2PPQA 3ZC5A 4G31A 4FICA 5IA4A 1XH4A 2ZM3A 2YDKA 4G3FA 5CQWA 1BMKA 3RTPA 2PZRA 4M68A 3LXLA 4FG8A 4RJ5A 2WMQA 3FKOA 2YM6A 4EZ7A 3RM7A 3D0EA 2WEVA 3QGWA 4FUYA 4HCTA 4DGOA 3VNTA 2DUVA 3EFLA 4Y72A 3DBQA 4OBOA 4MH7A 5I9UA 3R7EA 3BX5A 4TN6A 5HNGA 4RG0A 4KRCA 4QP4A 4YSMA 4RJ7A 2HELA 2B4SB 2YJSA 3HVCA 3JY0A 4O0YA 4RFZA 1O6YA 2BAQA 4TT7A 2VWVA 1LEWA 1LPUA 3LXNA 5J7BA 3FMEA 3QALE 3R7YA 2UW8A 3FDNA 3K3IA 3O23A 1ZY4A 3PXKA 3WF6A 5LVMA 1FBNA 2H8HA 5M4IA 1XBBA 4KSQA 5DVRA 3AD6A 2CHLA 3VAPA 3TCPA 4R1VA 3A60A 1WBTA 3SLSA 4U42A 1OKZA 3PJ3A 3CE3A 5F20A 4XX9A 4HJOA 4HPUE 3SKCA 5KKRB 2QU5A 4CKJA 4PDYA 2ZV8A 3TUDA 3UP7A 2G01A 3PP1A 3CQWA 2V62A 4JDIA 5E4HA 4QMNA 1IR3A 3R8ZA 4M66A 3IS5A 4FL2A 4I94A 2V7AA 3CR0A 4IQ6A 4DYMA 3CCNA 5E92A 1GJOA 1ZLTA 1ZYJA 4JXFA 4DLIA 2GQRA 3O0GA 4M12A 5K4IA 3HAVA 3OROA 2OWBA 2VZ6A 5AUYA 4ZTHA 3ZO4A 5JGAA 4RBLA 3MVHA 1H01A 2HXQA 3UMWA 2GHLA 1PXLA 3VS5A 2R5TA 2YA9A 3IQ7A 1R0PA 3MA3A 5JFWA 4G9CA 4L42A 3LFEA 3WIGA 3RPSA 5IUHA 2GNJA 2B9JA 3E92A 4YZDA 1CKIA 2KULA 3N4TA 2W0JA 4ZJJA 3QTXA 4X7QA 4PMTA 4PV0A 1H1RA 5M55A 5T3QA 3AT2A 3IK3A 3BYMA 2IW8A 3KMWA 3GC0A 5AV0A 3ZLSA 4I6HA 1PF8A 4FZAB 4AE9A 1YI3A 3R8VA 2WMRA 1A48A 3TXOA 4E1ZA 4G3EA 4EH8A 1B38A 1H00A 3UYTA 1YWVA 2B1PA 5IEXA 3PSDA 5EM6A 5KMJA 2OG8A 1SNXA 2BRHA 3PE1A 4U0IA 3TV7A 4M13A 3TACA 3U4UA 5TOZA 5LJJA 4NFMA 1ZWSA 4XV1A 1OUKA 3UYSA 5IU2A 1Q8ZA 2C3IB 2ITOA 4E4NA 4I0SA 3RPOA 2FA2A 3PLAE 4MXYA 2JDRA 4NK9A 3LVPA 5JEBA 4ZLOA 5AP6A 5JN2A 4DFUA 5DR2A 4A7CA 2VU3A 3EMGA 3KB7A 2FSLX 4M69A 1QPJA 3GUBA 4HW7A 3R6XA 4UN0C 4YPSA 1T45A 4RX8A 3JUHA 5FD2A 1YHSA 4XLVA 4F6WA 2GQGA 2RIOA 3NEWA 4WA9A 4X3JA 3UBDA 4JT3A 3B2TA 3Q9WA 4FTRA 4EZ3A 5HU3A 5IUGA 4CGAA 4FT3A 1ZYDA 2LGCA 4PPAA 3FI4A 1U4DA 2XRUA 5ETAA 5FXQA 4YO6A 3ZU7A 3RK7A 4R3PA 4FSZA 4GYIA 3UMXA 2W4OA 5A4EA 3VUTA 1JWHA 4NTTA 3PY0A 5BPYA 2ITYA 4MNEA 4F63A 5D1JA 5H8GA 4BTJA 5EW9A 4DGGA 3R1SA
chains in the Genus database with same CATH superfamily
4AZFA 3QAME 4AW4A 4LYNA 4NJDA 4FKWA 4JAIA 4WOVA 1SG9A 3GC8A 4FV5A 3K5UA 4X62M 4C3FA 1TQMA 3TNWA 2CEAA 5GNKA 1YOJA 2UZOA 3OOMA 3WZEA 1JVPP 4CVAA 3QXOA 2IEWA 4FX3A 1PMVA 1R0EA 4HNFA 5M53A 3Q2MA 2C6KA 3Q4UA 4I6QA 5C4KA 4FVQA 2V55A 3O8UA 1C7YA 1YXVA 4LMNA 4WD5A 1Q39A 5HBEA 4IJFA 3DQXA 4MGKE 3R7OA 3RWPA 2UW3A 4BIEA 5CAOA 3CD3A 3VRZA 4MGYE 3FD9A 3BU6A 3GLIB 5CZIA 5EYDA 5C8NA 3AKJA 2LVPC 1YLAA 3FXZA 2J7TA 3MK6A 3F2AA 5J7HA 4NKAA 5CANA 3J27B 4II7A 4IIWA 3OF0A 5DT4A 3DKGA 4QNRA 5EP2A 5ITRA 3LHJA 2JWSA 3GXLA 4BHNA 1Z6TA 4BR3A 3R8MA 4C34A 1VDLA 4D1SA 4X21A 3NW7A 3U60B 4FKPA 5L8LA 4O22A 4DR2M 5GJGA 1PJKA 3VK7A 4AZSA 5AUZA 1APME 4PDGA 3TPZA 4S31A 3UOHA 4E73A 5HKMA 3AKLA 5EDRA 5FLXS 5LOHA 3AC8A 3LVWA 2GPHA 1DI8A 4E20A 5HICA 4J1RA 5LARA 2OH4A 3L9LA 3AG9A 4YZBA 3FUTA 1XMQM 3VS3A 2GNGA 2UW6A 1IAJA 3ERKA 2BPMA 3HX4A 4X6QC 4ANSA 3KIOC 4ANBA 4ZMEA 4X3FA 3BWFA 2R62A 1OPLA 4A9SA 3I7CA 1PJIA 2EUFB 5L3AA 4AZTA 3BXWA 4JBOA 2WZJA 3UIBA 3DAJA 4MQ2A 3I51A 4WNOA 3ZH8A 2C0TA 2IVTA 2W5AA 3FMJA 2B55A 3LQ8A 2R3FA 2JIVA 3RNYA 3VWAA 2OJ9A 5CSWA 3W2QA 4D58A 2BRNA 4DTKA 5AADA 4FTNA 5CF8A 1NA7A 3EN4A 3GCUA 5CWZA 3IG8A 2ONLA 4I0TA 4OGRA 2Y0AA 4BCMA 5I0BA 5DYIA 2R3MA 2XRWA 4XJ0A 5J9LA 2R0IA 3F88A 3L8SA 5KPZA 2JA2A 3AMBA 4IDTA 3L8PA 1IN5A 5HLPA 4IBDA 2A27A 5E8SA 3WF9A 3LQ5A 5JQ8A 4EKLA 3FUXA 3Q4ZA 3FBVA 3KL8A 2PZ5A 3KOYE 2XAOA 4UALA 4NC6A 4K0KM 1OTRA 3HNGA 5EHLA 4ZSLA 4JMQA 1ZQ9A 2EXEA 3FRIA 1J1CA 1Y6BA 1L1ZA 4J71A 1J1BA 5EYCA 5GIOE 4YLKA 3BCEA 3GI3A 5LMNM 4G6NA 4I20A 2DXIA 4RFYA 2UW9A 4I0RA 4C4GA 4QMZA 5IT9S 2IVSA 3E3BX 3V5PA 4Z3VA 2IW9A 3LM5A 3BKBA 2O8YA 4IWOA 3TDVA 1HT1E 3ZRKA 2Z3XA 4BB9A 2UVYA 3AOGA 4C2VA 2J51A 4CKIA 3TZ8A 4QP2A 4MVFA 1WBVA 5HU9A 3L27A 2P2IA 4KUJA 3KW6A 3ZUVA 4USEA 4YJRA 2YZAA 3HRBA 4JNWA 3VULA 1SZMA 5GJDA 2VTAA 3GLIA 3RAHA 4QMMA 1Y6AA 4CFXA 3TTIA 3HMNA 4RGJA 1BKXA 4L45A 4F4PA 4JI2M 5DR9A 3VW8A 3W2RA 1JQJC 4RWLA 1EFUB 4J8NA 4BGGA 3GPPA 3ZFXA 4EHGA 4QP9A 2WTKB 1NVQA 1V0OA 3NYVA 5IQDA 2XAMA 2ZBKB 2PZIA 3AC2A 4GH9A 3DK3A 3Q4CA 4I5PA 3DZDA 4IW0A 4IX6A 2UZDA 3VBXA 3GRRA 5JI3E 4QMUA 5AM6A 2XNBA 4QQ5A 3R9DA 2Y6MA 3ELJA 2BIKB 4JX7A 4KBCA 3HMIA 3OD6X 2XALA 4JI0M 3GLFB 4GT4A 3AFHA 4C02A 4TUWA 2VWYA 3KKVA 1YW2A 4KO8A 3F92A 3MY0A 4IX4A 4M3QA 5AR4A 5J1WA 4AT3A 3VBYA 5F4NA 2WIPA 4IAYA 5E7RA 3TI1A 5GZ8A 1F4IA 3HEGA 4ZTSA 4X66M 1ERKA 4FWGA 4FT0A 4UBAA 3W8LA 5E8YA 4TYJA 3O8PA 3DK7A 3BV2A 5CAPA 3HHYA 2CGXA 2IZUA 3KA0A 4LGHA 3DNDA 3U51A 1Q61A 4D1XA 3BL9A 4O7TA 3ZH9B 1XH8A 3VC4A 3NIZA 3MMPA 2BZJA 4JS8A 3MESA 5IQGA 5EQEA 1TTEA 2EO2A 1C1KA 5HLNA 3ZUTA 4DBGB 2J0KA 3FC1X 5IPJA 4A3VB 1TF0B 4M97A 1NJGA 1Q4LA 3LJ0A 4IX3A 2K0BX 4FKGA 3KS4A 5DRDA 2ZDUA 3FY0A 3POOA 2JZ0A 3QQGA 4O0VA 3A8WA 3QRTA 4FEUA 4O7LA 4O7WA 4I92A 4UWBA 4WUAA 4XOYA 4FBXA 2QENA 2BAJA 2UZTA 3F61A 3NRMA 4TTHB 2FE8A 4QD6A 4LQMA 3LLAA 1WBOA 2C9CA 3KRRA 2YJRA 3II5A 3ODZX 3P7BA 4YGAA 2P3GX 2R4BA 3EQDA 3Q2JA 1E94E 4ALWA 2CHGA 2ERZE 3TV6A 3TZ9A 2GMXA 1WCCA 5HO7A 3ODYX 2HL7A 3A4PA 4NIFB 5CU2A 2WQNA 1V34A 2JAVA 3R9RA 4J8MA 5ITXA 2YCSA 4FSUA 3ROCA 3F82A 1ST0A 4B7HA 2R65A 4FIHA 4GKJM 4FOCA 3HGKA 4LF8M 1MRVA 3LCDA 4L8RC 4EK5A 2HKJA 3SHGB 4KABA 4QP3A 1YHWA 4MM3B 4W4VA 1SNUA 4B7GA 2ZM1A 3BIZA 2N35A 2QOIA 4R6VA 3WZUA 4BKZA 2EUCA 4JI6M 2Q0NA 2WTCA 3F66A 2C4GA 3R28A 4LJ6A 3VF9A 2YAKA 2YM8A 2VTQA 4NCTC 4LOPA 4F99A 4D0XA 5CAQA 1Q8UA 2LWXA 3F3WA 4TWNA 1F3MC 2ZV2A 3QL8A 3HV5A 4AGCA 4E4MA 3Q53A 2YHVA 4BKYA 2X39A 1E1XA 3UO6A 2OQ4A 1AGWA 4F9YA 2ITNA 3VFDA 4AUAA 4FKTA 4IVBA 2C98A 2J0IA 2OKRA 5L6OA 4BN1A 1Q8WA 5DNRA 4X65M 4PNIA 4CLIA 4UX9A 4LV5A 4FV8A 4I4FA 2EKKA 2KNAA 1NW1A 4IBGA 2CLXA 2YM3A 1M2QA 3LAUA 4PF4A 3GLFA 2YIXA 5FXSA 4CXAA 5GZAA 3UOJA 3COKA 1IY2A 2XZSA 3V76A 4O96A 5CF5A 3KP0E 1OL2A 3UZUA 2UZVA 4IBEA 5CEPA 3FMLA 4FYNA 4QMWA 4O4FA 3C7QA 3PXFA 4NM0A 2R2PA 4WUNA 4ACGA 3L8XA 3MS9A 3S4QA 3EB0A 5ITUA 2RG5A 2C1AA 4QMOA 5IDPA 4R78A 3EZVA 1DAWA 3P5KA 2QZ4A 4IBBA 3EZRA 3RPYA 3VBQA 4D80A 1A5TA 3PY1A 1OJLA 3HYHA 3KFUG 3TNHA 3MVLA 4CYJA 4MCVA 2BRGA 2X81A 1Z5CA 4U8ZA 3PIYA 3SFZA 1L2BA 3ZYAA 2D7EA 4C7TA 3I04M 5AV3A 4P7EA 5IQHA 4AXFA 2ONLC 3G9LX 4E7WA 4F0GA 3LE6A 2X9EA 2VO7A 3UQGA 2JD5A 5IEYA 2YR0A 3LMMA 4BVUA 4HYSA 3ULZA 4MB7A 3MB7A 4CMOA 4E8AA 4EOQA 4FIJA 4DV4M 3KN6A 3MBLA 4EC8A 4M0WA 3QHWA 2VWXA 3UZTA 3L28A 1YXTA 4F6SA 1H0WA 1M17A 1WMKA 2IJMA 3FPMA 1QDRA 1LR4A 4QOSA 3UDZA 2I0HA 2X0QA 3QFVA 3DKFA 4FK6A 4G9RA 4LCBA 2ZTDA 2AC3A 2VGPA 4QNYA 3D14A 4EZ5A 2RG6A 1KWPA 1ZY5A 5BNJA 4LJ8A 2DHRA 5AV1A 1OGUA 2QQ7A 5L6WL 2JC6A 2X49A 4TYHA 2XA4A 3U61B 3V5LA 4MNEB 3PXRA 5HZNA 1GO5A 5CT7A 1LV7A 2JDVA 2FYSA 4FUXA 3IOPA 2FH0A 1PKGA 5DFLA 3FXXA 4F0IA 4F6UA 3RAIA 4IB5A 4QTCA 2UVZA 4Z7GA 3UK6A 2VD5A 4O4CA 3HWSA 2KXEA 3KY2A 1DO2A 5A2QS 2XFTA 3ZEPA 4FEVA 4OTWA 4ACCA 1XC8A 4CZUA 3R7IA 4YZCA 3RI1A 4ERWA 4FODA 1Z59A 3PPZA 4GU9A 3PVSA 1XWSA 3J80S 2VNYA 3WHKA 2ERKA 2X2MA 2CJMA 1UM8A 1IASA 1QL6A 1JSUA 3F3ZA 4LRJA 3KFAA 5CVHA 5E91A 3FUWA 5KQ8A 2GFCA 1ZAEA 2Z7QA 4DEEA 4Z7HA 2HY81 3UJNA 4RX5A 2YM7A 2C9OA 4H3PA 4BDKA 3NX8A 1JLUE 2GSFA 4D28A 5JSMA 3OCGA 4RC2A 2VTSA 3OW4A 3GCQA 3VKGA 4A9TA 3ANQA 4WNPA 3K54A 1ZOEA 4C62A 5M08A 4GCJA 4GUBA 5FTKA 2C5VA 4GKIA 5HX8A 4PL4A 4BDFA 4CV9A 4O2ZA 4FEQA 2WSCF 4DFYA 3W2CA 2VTHA 1UFZA 2OO8X 2PL0A 3KXMA 2RFEA 5BVWA 3UOLA 4F70A 3C5IA 4L53A 4NH1A 4CG8A 3AT3A 2KNZA 3RGPA 4LRKA 3MDYA 4NRVA 3HRCA 5ANJA 5BMMA 3V6SA 3ZLYA 3U6SA 3FTEA 1H24A 4PDIA 2XF0A 3IONA 3M2WA 1IXSA 4BCOA 4C59A 3OCBA 2C6DA 4ENXA 4FV4A 3GRVA 3R8FA 3FMDA 1UWHA 5I3OA 5BX0A 4N57A 1XB2B 2F5SA 2BRBA 4E4XA 4NOOB 3T1YM 3LJ1A 4CSVA 5L6PA 5L2WA 5AFVA 2W7XA 1XJDA 5HE2A 2OPFA 2YCFA 3PXZA 2XIZA 3I79A 3VIDA 3FLNC 3OT8A 2W96B 5FTOA 3LFCA 3RZBA 2Z7LA 4F1OA 2Y20A 4DR4M 4I21A 2X7GA 4KLNA 3VS6A 3RNIA 4DE4A 3JVRA 3O8TA 4I8OA 2FH9A 4M14A 3UNZA 4IEBA 4DH3A 4V0GB 5EYKA 3VBTA 3HECA 5K5XA 2F5QA 4JI4M 3LIJA 4O0RA 3AC3A 1GKIA 2UW5A 2XMYA 3BPRA 3MY1A 2C0IA 4JL9A 3V6RA 3WYXA 2UXDM 4DHJA 3PUFC 1CKPA 2CGVA 2XCHA 4H58A 2R4EA 3OXZA 2ZANA 3PFQA 3P79A 2XM8A 4QYGA 3HUCA 2EWAA 3BEGA 3IHPA 2F2CB 4IDVA 4KIKB 2YIRA 5J95A 5AX9A 3IG7A 3C4WA 2R46A 4PL5A 1TKIA 2E9NA 2WOUA 3D8BA 4TRLA 2OJGA 5HBHA 2VGOA 3R63A 3QZFA 3QF9A 4S2ZA 3RPVA 3LCSA 2FGIA 4FKQA 5IA3A 4G3DA 1NHWC 4R7GA 3EQHA 3UNJA 4F9AA 1V1KA 3GCVA 2VQFM 4C4FA 1CMKE 1GNGA 2BTSA 4L01A 3UQCA 2AYPA 1IRKA 4CLJA 4B7FA 2JKKA 3EN9A 2LHCA 5LCKA 3VO3A 3I0QA 4MQ1A 5AWMA 3SAVA 5AA9A 3DJ5A 4X0MA 1DGBA 3HMOA 1T6OA 2BUJA 2XKCA 2XNGA 3F7ZA 1H1WA 3JYAA 3OXIA 3FI8A 3ALOA 1NHGC 2KRUA 1G5SA 2XNOA 3VF8A 2X6DA 5FBNC 3KSXA 3PWYA 4ZY4A 4BJJA 1DI9A 1G8SA 2VWBA 3C5UA 4JLCA 3OWLA 3CKWA 3JVSA 2BZHB 3MV5A 3TL8A 4IFCA 2R3KA 3KEXA 3D2IA 5EG3A 3QC4A 3ZFMA 4FSTA 4JDHA 4G6ZA 2B9HA 3HZJA 3A7HA 3F5UA 5CEOA 3NFFB 2Y4PA 3VLFB 2OICA 1UU7A 5FXRA 5I9VA 1IBKM 2CFOA 1IAHA 1N34M 2OZAA 4DHIB 3ZUUA 3UO5A 1YDRE 3QZIA 4S30A 3DB6A 1J3HA 3QCXA 3L2AA 4EJ7A 5HE3A 2BJVA 3MJ5A 1NNJA 4GUEA 2M5ZA 4ZTNA 1CTPE 5C8MA 3PNYA 3WYYA 4DFLA 5CAUA 3JR1A 3BYSA 4BTMA 4DH5A 3DS6A 4C33A 3R22A 5FTGA 4DR3M 5AIKA 4QMQA 4YJOA 5LXMA 3OXTA 3OS3A 3DXNA 4BHZA 4AZEA 3SAYA 4ACDA 3Q9ZA 2QSFX 1KV2A 3BBWA 4FV0A 5A4QA 4IVDA 4LUEA 2CHQA 4RIOA 2PVYA 2XANA 3VJNA 3OZ6A 1BI8A 1PXIA 4NYEA 2J5YA 4HCUA 4BFMA 5HORA 4FA2A 3FLSA 3FZOA 4FKJA 2EJSA 2G5GX 3A99A 1MU5A 1AUAA 4PMSA 4R5SA 2RL5A 4UZDA 1BL6A 4ALUA 2BDWA 5H8EA 3VS2A 5JH6A 2GFSA 2GNFA 3KRJA 5DMZA 3GLFE 3PY3A 3VK8A 4DV0M 5M09A 3VQUA 3IGGA 3BWJA 3RP9A 5KMLA 3A7GA 1QPEA 3W0FA 1DGFA 4QNMA 3KXEC 4LGMA 2K6BA 1LP4A 4FG7A 4JQ8A 3L9PA 4Q7JA 5F9EA 4LGGA 5F95A 3LMIA 4DEIA 4AOJA 3I6WA 5M4CA 1H1SA 1TR8A 2QCSA 3QRIA 1UVRA 4KIKA 3L29A 4ITQA 2JY7A 1I09A 4IH8A 2QOBA 5DFPA 5KBQA 5JGDA 2PVLA 5FTMA 4DR5M 3AGLA 3UOKA 4G3CA 2WMTA 1HNZM 4EOJA 1R2ZA 4NWMA 4R77A 4BBAA 4FKIA 4Y5HA 3QUPA 4XP0A 5KO3A 3QTWA 2VX3A 4YY3M 2C5RA 4IBFA 3E93A 4FSNA 4O0UA 4ZJVA 3FXWA 3P23A 1NJFA 3SDJA 4AXDA 4O6EA 4XG6A 2QKRA 4GIHA 3TIYA 2OJJA 4ZLYA 3I81A 2GCDA 1U5RA 2J7NA 3DKCA 3HA8A 3HRFA 4DUZM 1GIJA 3FKNA 3PTGA 3WILA 5KCVA 3FSKA 1IXSB 3DFCB 4I4LA 3LXKA 4A07A 3ANRA 1G8JA 4R8QA 3B8QA 4U80A 3UQFA 4JBVA 3QQUA 3SD0A 1SYKA 2WTKC 2XVDA 4EH4A 3BELA 5BYYA 2RF9A 5CEMA 4B3SM 2LTUA 3R7UA 4F2LA 2H5XA 2FSMX 4I6BA 4IAZA 4II5A 2LVNC 3HV7A 4JQEA 3B8RA 5FP5A 3R00A 4Y73A 3UPXA 4O7RA 3E8DA 3W18A 4CISA 3NNVA 3N51A 3KXGA 5D9HA 2V7OA 3CGFA 4B08A 3EYGA 1H4LA 3KCKA 3NPCA 2VX0A 2KTYA 3DA1A 4FKOA 4Z55A 3ZM4A 4CKRA 5AV4A 4IFGA 4KS8A 4ZOGA 2IWIA 3ZC6A 3QTSA 3P86A 4QEBA 3C58A 4C37A 1OPJA 4BCFA 3PXQA 5J9ZA 4DG0E 3AKZA 2XK4A 2YACA 5EK7A 2R6FA 4XYFA 4BBMA 1R6BX 4IANA 2QO2A 3WF7A 3CY2A 3NWLA 1Z5BA 1Q8YA 3KOZE 3GQ5A 3RCDA 1N32M 2C69A 2PTKA 2DAIA 2BKZA 2XKDA 5FBOA 4WG4A 4BDDA 5I9ZA 1BUHA 1WBNA 3C9WA 3NAYA 2JLDA 4K2RA 4NM3A 4UZHA 3SXSA 2WQEA 4EWQA 5J5SA 3I4VA 3WZJA 4AG6A 4HGTA 2CNVA 1GJTA 3BHTA 5CU3A 2R0UA 5KMNA 3FWQA 4G5JA 4F9BA 4KKHA 1Y8GA 2C0OA 5CENA 4C3PA 5E8UA 2O01F 5FTLA 3SASA 4K18A 5BVNA 1IXRC 4TL0A 2WTJA 3EOCA 4I5SA 1M7QA 5IF1A 2FFJA 2ZM6M 1FPUA 2NO3A 2O64A 3NUYA 3U4WA 1VDDA 3E7OA 3QTQA 4JI9A 4Q9SA 2YDIA 4K1BA 2YIYA 2IW6A 4UMQA 2B54A 4BDBA 2CKOA 3OCSA 1JPAA 3H9OA 3PSCA 3QHRA 1L1TA 3KRLA 4FD2A 4RFMA 1Q3CA 3TN8A 2C5NA 3IECA 5D41A 3T38A 3ZMMA 2CKQA 3DAEA 3DJ7A 4LDTA 4BJJB 3T3VA 3DJ6A 2F7EE 2O5KA 3ET7A 3PRIA 4GFMA 5ITQA 1PHKA 3PJ8A 4G16A 5HO6A 2C6TA 4IC8A 5TO8A 1NT2A 2W1DA 1TH2A 2C6LA 3PNVA 4E93A 3CC6A 5CSPA 5KUPA 4ALVA 4USFA 2HZNA 4CTCA 2QU6A 5BMSA 1OL6A 4WRGA 4O7YA 4FOBA 3C9PA 2HCBA 3Q8GA 4GU6A 5CSHA 5HHWA 3VS4A 4QTEA 5A4TA 5IMXA 2NPQA 4G4RA 4HOKA 5EQYA 2LBCA 1YOLA 4XP2A 3RWQA 2XEZA 4H3BA 4WHZA 4A4LA 4C4IA 3ZDIA 3BLAA 1RW8A 2BR1A 4B3MM 4YURA 4DLJA 1TH4A 3H4JA 4NKSA 4CFWA 3S1HA 3KVWA 2JKQA 3DOGA 4H1MA 4AACA 5T68A 5C1BA 3GLGB 4DCAA 3UVRA 4YU2A 1EIJA 2QODA 3GOKA 2ZFYA 5C18A 4O0SA 2QOCA 1IA8A 4L3JA 3MA6A 3TZMA 4HVSA 4CG9A 2HHHM 3OVVA 3QQLA 2VTOA 4OUCA 5HNIX 3GRUA 5ITTA 5AM7A 4OTFA 3VONA 4MAOA 1V92A 4GS6A 3UC4A 3PVGA 3QXPA 2PMLX 5EKNA 3KMUA 2FO0A 2ZOQA 4CMTA 4NSOB 2KNVA 2C68A 3FY2A 4XBOA 4IAFA 4XG7A 3LZBA 3P08A 1IFYA 3G90X 1TZDA 5BUJA 1I94M 2JBPA 1Q62A 2OIQA 4DHZA 5LVPA 1IY1A 4NM5A 5EXPA 3D5UA 2PMOX 2A2AA 4EEVA 1XR1A 2WIHA 3E21A 3ORMA 2XARA 5HVJA 2X8EA 3PA4A 5J8IA 2IVVA 5EDPA 3W1FA 1QZEA 1ZAOA 4DV2M 4E6DA 3VKHA 3N9XA 4RWJA 3CTQA 4QPMA 4IIRA 3AMAA 1A9UA 2YAAA 3IKAA 3KMMA 3D5VA 3PJ1A 4LMUA 5C4LA 1MQBA 4YJUA 4C3RA 3EJ1A 4CQGA 3I0OA 1URCA 2EXMA 4GG5A 2YWPA 3MPMA 4MX9A 1XH5A 3ZO3A 1VYWA 4MXZA 4E4LA 1H27A 3VDUA 4H36A 5HIDA 3UVPA 3WE4A 3ZSIA 3KCFA 2ITZA 1Y91A 2WMWA 3DGKA 4FTCA 4JOAA 4C0TA 5F94A 5FGKA 3DXQA 4RQKA 1V33A 4PQNA 2LVAA 1O6LA 3OMVA 2F57A 4BBEA 4EC9A 2UZWE 5HD4A 2XNNA 3MY5A 2VF8A 3NNXA 4U44A 3W0OA 3CXWA 4NW5A 2RGHA 5E26A 1NY3A 3GC9A 4AFJA 3SXRA 4XEYA 1ZYCA 3HX3A 2W4JA 3G6GA 3V5JA 4DAWA 2REIA 3GPUA 4DFXE 2QLUA 2DHYA 3NUPA 4FTLA 3WF8A 4B0GA 4QDVA 3A7IA 3HY5A 2ETMA 2IZTA 2XCKA 3R7GA 1GVNA 4L43A 2UW0A 4I5MA 3SMPA 3E5AA 3MGYA 2CNQA 4DT8A 1G71A 2OXXA 3ZXZA 3Q04A 4DG3E 5L4QA 1GABA 3D83A 1PXPA 4BCQA 4M0YA 4QTAA 3QKKA 4LF6M 2DQ7X 5D10A 4QP1A 3QD2B 3GQIA 4GIIA 5EI8A 2ZM4A 3WOWA 3SBJA 5E1EA 4YTCA 4DBNA 4WO5A 1Q24A 4XG3A 4DGLC 3RGSA 1J5EM 3QQJA 2ZB1A 5ANKA 2J5FA 4UYNA 1GY3A 4RJ6A 3F7WA 2HY0A 4E26A 4GK4A 5AMNA 3LFFA 1BL7A 2E9OA 3OWKA 3LQ3A 3VN9A 4FKUA 3ZLWA 1W83A 2RGPA 2V22A 3DTWA 3DY7A 1WVWA 1K3XA 3PVUA 4M69B 4AOTA 4KA3A 4PRJA 1BI7A 4E6QA 3CS9A 5AA8A 3C3EA 2XSZD 2B3TA 1Z5MA 5JZJA 2Z02A 5CEKA 3TM0A 2V5QA 2X2LA 4QP8A 2PVRA 4ARKA 4GHLA 2C47A 2O5RA 2PVJA 3FI3A 1NO1A 4KBAA 3G15A 5IQCA 4FZDB 1ZZLA 2PMIA 1OQYA 4APPA 3EFWA 3EQIA 2W1EA 2JKOA 4D2WA 1J7KA 4G2FA 5FDXA 3OG7A 4FZ7A 2PVKA 5IH6A 4U43A 1N75A 3FTFA 3MWUA 2Q0BA 3KGAA 4OTQA 4PUZA 5EKOA 1Q8TA 4HNIA 4AG8A 4BC6A 5KHXA 3BU3A 1UNHA 4BCJA 1L2DA 3MVJA 4F0FA 1D0MA 2C3LA 3MH0A 2MR9A 2XGNA 1UU9A 2WNTA 2J2IB 5C8KA 3C13A 4O7ZA 1PM5A 1QCFA 3DLZA 5D12A 4U40A 1X8BA 3R9HA 1VEJA 4IWDA 3GU6A 2OO9A 2G1TA 3E88A 3IW7A 4FZFB 5B0XA 4PPBA 3F5XA 4DH7A 3U6MA 4EH3A 1W84A 2J0MB 2XEPA 4D5HA 3FPQA 1NSFA 3QQKA 5BV3A 3U54A 3HV3A 2HWOA 3FYJX 4NUSA 3S2PA 3A2CA 2Z7RA 3QRUA 3WE8A 4ACMA 2WMSA 3OTUA 2QI8A 4B8MA 2O63A 4YTFA 2IPXA 3RM6A 3LW0A 3ORTA 4C4JA 2CWBA 4I24A 3NZ0A 4O82A 2GHMA 3HGIA 4BCNA 4P90A 3AD4A 5M4FA 3GLGA 3WI6A 3HA6A 2ZMDA 5CQUA 2UV2A 2O2UA 4RX7A 4D4RA 2YIQA 3NVKI 2XUUA 4H05A 2HWJA 2X7FA 2VDBB 3I5NA 1OKVA 4FR4A 2W1FA 3WARA 4CQEA 3H9RA 3UGJA 4D0WA 3KK8A 1OBGA 4YZNA 4O0XA 2CN8A 4V04A 5AP0A 3R9NA 3UTOA 3SAUA 4F65A 1FINA 3O7LD 5BYZA 2L2DA 1ZZ2A 2GNOA 2ZTCA 1YDSE 5F3WA 2GTMA 4DR1M 4V01A 4AXAA 4DC2A 5KZ0A 2W17A 5DI1A 5CEQA 4DEHA 5J79A 3CKXA 1PJJA 2GS6A 3O71A 3VHEA 1QYRA 4LFAM 4OTGA 4Y95A 3HJSA 4XK8F 4O38A 2VV9A 3IDCA 5L8RF 4NIFA 4XRJA 5L2SA 2OGVA 2XJ1A 3R04A 4W8DA 3M6AA 4DHFA 3SVVA 3IW6A 1Q5KA 4FK3A 4GC5A 4FGBA 4D81A 2F9GA 3UJGA 3C4XA 3PPKA 4BDIA 4EOLA 4U5JA 5TE0A 1XXHE 3CTWB 3BHHA 3QA0A 3ORKA 1FVTA 4FVPA 4AF3A 1FJGM 2V1UA 4KIPA 4AAAA 4AA0A 5I4NA 4XNEA 3HKOA 1PMUA 3BGPA 5HVYA 1PJTA 2EVAA 4L16A 3GC7A 4EUUA 3Q9XA 4WKQA 2P5TA 4Y28F 4G34A 5FEQA 4ANNA 1N78A 3UPZA 2C96A 1IXZA 3NUNA 3FRHA 3AC4A 2CNUA 3TJDA 5ICPA 2ZDTA 3SOAA 1W2DA 1JB0F 1KYIA 3TWMA 4MTAA 2OIBA 5IUIA 3ZZEA 4C61A 4RNAA 3NCGA 3AJIB 3P7CA 3HP5A 4G6OA 5BVFA 5LWNA 4EK8A 3G33A 5LMAA 4IJEA 3Q6UA 2W1ZA 1EH4A 3W0MA 2JP7A 3PIZA 3RALA 4A9YA 4FVRA 3LPBA 4RVMA 4FSYA 3CD8A 3E7VA 4M8TA 2QCUA 1PMEA 2QG7A 3NNUA 2BAKA 4IB1A 4JR7A 5IWAM 2VUWA 1BVSA 4KKEA 4LRMA 1Q02A 4ZS4A 3DQWA 4UXQA 3QYBA 4ZJIA 4CFUA 1W0XC 3NSZA 2XIYA 3HJQA 2CGUA 4GK2A 4U7ZA 4BLCA 2XNPA 1I44A 3F9NA 4YTHA 2E9UA 5FM3A 1ZMVA 3GU7A 2C6MA 4QQJA 4L67A 1VQ1A 3U61A 4FF8A 3EN7A 4TZRA 4DH1A 1EE8A 2F5NA 3I7BA 3PSBA 3VDPA 4IBJA 3QZGA 4V0GA 4A9UA 3PXGA 1XQZA 3EQCA 1FGIA 3F6XA 4TNBA 5ETCA 4BI0A 2J7OA 4MD8E 3THBA 1OZ1A 2C6EA 3O50A 2LNHC 4FV7A