3K2LA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
410
structure length
402
Chain Sequence
VDLGTENLYFMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPQKLLDASKRAKNFVSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Down Syndrome Kinases, DYRKs, Reveal Mechanisms of Kinase Activation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
total genus 118
structure length 402
sequence length 410
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k2lA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k2lA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k2lA02
3V01A 5AIKA 4D9TA 3HRBA 1URCA 3ELJA 4J96A 3WBLA 5DNRA 3W10A 3JVSA 4GUBA 4HOKA 1UNLA 2VTSA 4H39A 5D11A 5HEZA 1WBNA 4IFGA 1SVGA 2B1PA 4GK2A 3VBYA 3A2CA 3KEXA 3MY5A 4YPDA 4QQ5A 3PDTA 5FXRA 3ZRLA 1H24A 4GS6A 3CQUA 4ASDA 3HRCA 4ZJVA 4M0YA 5BVDA 1PXJA 1GIJA 4RLLA 5HBJA 3Q5ZA 3TG1A 5L3AA 3QZIA 4BCOA 4OAUC 3OROA 4UB7A 1OUYA 3U8WA 2BALA 3O7LB 3VHEA 4PTEA 2VTPA 4A4LA 2B0QA 3NIZA 4WIHA 1H0WA 2OJGA 3R71A 1PMVA 2JBOA 4FT5A 4BDFA 4U9AA 3AOXA 2ZMDA 3DGKA 3F3ZA 4FKTA 2O5KA 3DXPA 4AN2A 3QZHA 4F9AA 4FOBA 2ONLA 4RC3A 4GVAA 4JBQA 2PPQA 2JIIA 5CAVA 1M7QA 2I6LA 2IVTA 3GU6A 4X6QC 2X81A 5AJQA 4O91A 4HVDA 4R3RA 1LUFA 2B55A 3EYGA 3NW6A 4A9YA 4FEWA 3E62A 4CMTA 3UIBA 3KRJA 3R1SA 4G9CA 3POZA 4PPAA 4XP2A 5HIBA 3Q4UA 4L42A 1R39A 2C3LA 3EL8A 4O0UA 3ULZA 5IH4A 3Q2JA 3U54A 3O0GA 4YJNA 4F9WA 3EKNA 3P78A 2GNFA 1Q5KA 5CEOA 2OF2A 5DPVA 1PXOA 4YLKA 4OTQA 1PXKA 4HGEA 3P86A 3HNGA 4OTHA 3OXIA 5FBOA 3SV0A 5IA5A 2QOCA 5LVLA 4K8AA 4O22A 4CRSA 5AADA 1U54A 4ZTHA 2QU6A 4FIGA 2BIYA 3PXQA 2YIYA 3DDQA 4QMVA 3AGLA 1NXKA 4AXAA 1DM2A 4IADA 2UW8A 4O96A 3VN9A 4FTTA 3QXPA 1RDQE 4IX3A 3NNUA 2XM8A 4RX5A 4YSMA 4UWCA 2RKUA 4EKLA 4IWDA 4FV1A 5E8UA 4EOKA 4ZTMA 3DB8A 3NEWA 3IOKA 3WYYA 4OR5A 4OTGA 5DN3A 1IAJA 4UWBA 1REKA 3QTIA 3PJ8A 4DFZE 4O83A 5TOZA 3WIGA 4JBOA 4K9YA 1NA7A 3CGOA 3ZO1A 2GQGA 3D2IA 3LFBA 4CZTA 4PQNA 4LGHA 5AM7A 4DEIA 3KF7A 4R5YA 5GJGA 3VUIA 2JDOA 4XP0A 3RBWA 4JT3A 3ZLYA 4BYJA 5JFSA 1XJDA 3QD0A 4AGDA 3BGZA 4L53A 4YZMA 1YHSA 1UNHA 5JZJA 3LLAA 3QZGA 1OI9A 2G1TA 3E93A 3FI2A 2BILB 2HW7A 4AZFA 3OUKA 3QKKA 5D10A 1OZ1A 3LJ1A 4Y46A 2PK9A 2X4ZA 3VS7A 2RIOA 3IW7A 2OGVA 4QP7A 3WYXA 5LMBA 1OKWA 3ZEWA 3HDNA 4C3PA 5EI6A 2XYNA 4TY1A 3HLLA 2ITYA 2W1FA 3DTCA 2ZDTA 2OO8X 3Q4TA 4EK6A 3VJOA 2E9VA 5ANEA 5AP2A 4XV2A 4FTQA 2W7XA 3PXYA 3QTUA 3A7GA 4YZ9A 4BRXA 5KUPA 4ALVA 3N4VA 5ETFA 1GZ8A 2YCQA 3DTWA 3NAYA 4I6BA 3EZRA 4DG2E 3RK7A 2BDWA 2XJ0A 1QMZA 3QX4A 4EONA 4JAIA 3UMXA 2XKEA 2B9IA 3IK3A 3ZRKA 4BICA 4PV0A 2VTNA 3HL7A 4JX7A 4R1YA 2CCIA 3UMWA 3MIYA 4YC6A 4B7TA 2XNMA 4MD9E 2R7IA 4CFFA 4DN5A 2AC3A 3QRKA 4R1VA 4E8AA 3BLRA 3IDCA 3NNXA 1YI4A 5M56A 4AWIA 5BPYA 2JKKA 3W33A 3T3UA 3QA0A 4BCQA 4APPA 5AP7A 5D1JA 5AX9A 5HO6A 5HGIA 4GFOA 4S30A 3RPSA 3MDYA 2QNJA 5EG3A 3S95A 3H9OA 2WEVA 3OG7A 1Y57A 4K33A 4YZCA 4USEA 3H10A 1GZKA 5T3QA 2FSTX 3QRUA 3GC7A 3E8CA 3C4CA 3H0YA 3PSDA 4AE9A 1J3HA 5CSHA 5LMKC 5IA2A 5T68A 1XH7A 4FODA 4IZYA 4CQGA 2ZM3A 1Q61A 3WILA 3FMMA 3G0EA 4HYIA 3MB6A 4IVBA 4V05A 5B0XA 4RWLA 3MBLA 5L2QA 3TUCA 3RM7A 1U59A 1OPJA 3ZTXA 2IVVA 2PU8A 2GTNA 4BCFA 5FTGA 4DFBA 4A9RA 4UWYA 4BWXA 3HAMA 4GL9A 4C4EA 3BRBA 2KTYA 4FMQA 2VUWA 5FEEA 3RAWA 3R04A 3FXXA 5CU0A 4KSQA 4Y85A 3QHRA 3P0MA 4JLCA 3PRIA 2ITNA 2VWBA 2NRYA 2GNIA 4MQ1A 5HCYA 2QOFA 4L8MA 4BI1A 3MA6A 2ZV2A 4O0YA 5BMSA 3PPKA 3CJFA 3ORTA 2QOHA 4KIQA 2XEZA 3P4KA 4FSTA 2P4IA 1H1WA 5HLWA 4I21A 2OJ9A 4IAKA 2UVXA 3BWFA 3RZFA 1M2QA 2XIKA 2WIHA 3D5XA 3BU5A 4USFA 3NWWA 2VWWA 4I5HA 2JKOA 5AIRA 4F08A 3W16A 4BDCA 3VS3A 2PE0A 4QRCA 3SVVA 4AZEA 4ZTQA 3PIXA 1GZOA 4A06A 1MQBA 3NUXA 4TTHB 1JSVA 4RT7A 3ALOA 4FNYA 4KNBA 5CEQA 2XH5A 5C1QB 4I0SA 4Y5HA 3R9OA 3R22A 4IWPA 2V62A 2RFNA 4O1PA 4TYJA 1DI9A 3IONA 3VBQA 4FG8A 4V04A 4QYGA 3BZ3A 4HCVA 3CTHA 3G90X 2R3LA 2FGIA 2V0DA 3R6XA 4ZY6A 3TKHA 4NM7A 3GUBA 4FSWA 4BB4A 2IVUA 1ZYSA 2GNJA 3AT3A 1Y8YA 3W2SA 1OM1A 2WNTA 4DEHA 4UYAA 2R3NA 3MW1A 5EW8A 2AC5A 2E9OA 4YO4A 1UWJA 1JKLA 3F7ZA 4JR3A 5CF8A 3G9NA 5IPJA 2VTIA 2IWIA 5TKDA 2VU3A 1Q8TA 3EQFA 1JSUA 4X2JA 2YZLA 2PUUA 3QQUA 1H25A 4EK5A 3VBTA 3BYMA 3KRLA 2QQ7A 3RVGA 2X0GA 4QMOA 5J9YA 3FLNC 3I0QA 5AEPA 3CQEA 3MIAA 2QOLA 1H1RA 3JXWA 4KRDA 5K5NA 3FSKA 3L8XA 5D41A 3WF5A 3KF4A 5IQCA 5AP4A 5EKOA 3ZM9A 2W5HA 3R7OA 5CF5A 4XG8A 4TL0A 3ORNA 3QQLA 3Q53A 2BRHA 4D0XA 4EKKA 4I6QA 3HMIA 4J52A 4Y72A 4LRKA 3HV3A 2PMLX 1J1BA 3G15A 3UP2A 3WZUA 3SKCA 4ZZNA 4OTDA 2ZV8A 3V8WA 4UBAA 4FX3A 3OY3A 3FKNA 4EWQA 1KE5A 4E6DA 4O7VA 1AGWA 4UXLA 2C1BA 3HV6A 1YI6A 3LFEA 3F82A 4IZ7A 2AUHA 4I3ZA 3PA3A 4EZ5A 4EOIA 3D7TB 3PJ1A 3QQKA 4WRSA 1B38A 2Q0NA 2GHLA 2PSQA 3R21A 4MBLA 2O0UA 4L6QA 2VTHA 4QQJA 4G6LA 4O7RA 1CKJA 2WZJA 3CSVA 5LCKA 2YCSA 2XS0A 3MWUA 1PKDA 5JFWA 1OIYA 4YLJA 5K9IA 2GS6A 4M84A 1KUTA 3ACKA 4FKOA 4EL9A 2WOTA 3G5DA 1CDKA 4BN1A 1SVEA 2VZ6A 2Y4IB 4F0IA 4IB5A 2WMWA 2WQBA 3PWYA 5FEDA 2OXYA 5CAPA 3RK9A 3PJ2A 4IVAA 1UA2A 4FVPA 2BKKA 3O17A 3TV6A 2X2KA 2XK9A 2BRMA 2ETKA 3FQSA 2NPQA 3GFEA 4U44A 4BIBA 4C38A 4E20A 4DBXA 3MH3A 5FG8A 5EM5A 3SXRA 3GOKA 2C3KA 3QQFA 4HYHA 5CTPA 5FXSA 2UW5A 3E3PA 3V5QA 3VS4A 4CT2A 4UN0C 1BI7A 3MV5A 3ZCLA 3BHTA 2VWXA 3HMNA 2IVSA 3OZ6A 3Q9WA 4F99A 4YZNA 4BWPA 5I9UA 3PXZA 4LYNA 3CQWA 3UPZA 3LMHA 4OTFA 1L8TA 3QTZA 4IZ5A 4TWCA 4ZZOA 4YJQA 2QKWB 4LL5A 1K2PA 5HLPA 3BYOA 4YBKA 4BC6A 2VO3A 4IM2A 3PA4A 4JR7A 3ODZX 1YXSA 1JWHA 3OS3A 1ZOHA 4I0TA 5HI2A 1YXXA 3KCKA 1H1QA 5JK3A 3FUPA 3M11A 3IDPA 2Q0BA 4CCUA 5I3OA 3R8PA 4ANOA 2XJ1A 1BKXA 1ZARA 1WBTA 4EOSA 4F63A 2FSOX 5LARA 4O81A 5IEYA 3E88A 5HU3A 2JGZA 4EHVA 2E2BA 3U6HA 3VJNA 3UQCA 3EQCA 2YWPA 3D5VA 1XH9A 5DVRA 2ETRA 4QNYA 2J0LA 3WZEA 3BKBA 2ITZA 3UC3A 3VULA 3DDPA 3IS5A 3CD8A 4QT1A 4NM0A 3QZFA 3LFAA 4G16A 4LUEA 3EN9A 4PNIA 2G15A 1OBGA 1GZNA 5FLFA 1OL7A 3GENA 3O51A 4FIFA 4GT4A 3A8XA 1FGIA 4NTTA 5HG8A 5AUXA 4WSQA 2YM4A 2YM6A 4LG4A 5FTQA 3RPOA 4FT0A 5JKGA 5BQ0A 3MPTA 3GU7A 3AT2A 3H9RA 3UVQA 4AU8A 1OIQA 4DCAA 5C4KA 2OIDA 4DT9A 3Q60A 4EQMA 3FLZA 4J95A 3PG3A 4AGUA 2DS1A 2GDOA 3I1AA 4QMTA 4NW5A 2Y0AA 4IFCA 3NSZA 2GHGA 3OW3A 3ZOSA 4EOJA 2BZKB 3D2KA 3K3JA 4MXXA 4DGNA 2PWLA 1NVRA 3GEQA 3OTVA 4FIJA 3TIZA 1XR1A 3EQIA 3PWDA 4HPUE 5LVMA 1PW2A 1AQ1A 1R0EA 1W83A 2W96B 5M08A 3D4QA 3KRRA 3MVLA 2BAKA 3U6JA 3DZQA 1OL6A 1Y6AA 4BKZA 3F66A 2JLDA 1W8CA 4R7BA 3ORZA 3NYNA 3P7AA 4Z7GA 4H58A 3VUDA 2J5EA 4EBWA 2J5FA 5AP1A 4OBPA 2YCRA 4HGLA 2E9UA 4ZJIA 3IQ7A 3GGFA 5TO8A 2YDKA 3JY0A 3V3VA 4O82A 1J1CA 3GCVA 2YLEA 4G3GA 2XYUA 4UX9A 4AQCA 2DYLA 4PL3A 2YACA 2BROA 4GW8A 3ET7A 5DR6A 3UJGA 1OGUA 4C4IA 5KMKA 4EI4A 3FBVA 2BAJA 4R8QA 3HGKA 4KKHA 2VGPA 4NIFB 5E1SA 5G1XA 4UMQA 4XV3A 5JQ8A 4NU1A 4O1OA 2JFMA 4CFNA 4KIOA 2O8YA 1U4DA 2F4JA 3DB6A 3R8ZA 1H08A 2XNOA 3GCUA 4GK4A 4B6LA 2R3HA 3EIDA 4J97A 1M2RA 3O8TA 3Q6WA 3QD4A 4FTIA 3TTJA 3W2CA 5IMEA 4BDBA 3UOJA 2EB3A 3O2MA 2UVYA 2A19B 4PMTA 4QP9A 4GV1A 4NIFA 1KWPA 4XG2A 3FYJX 1BMKA 3ERKA 1O6YA 4PF4A 4AA4A 1H26A 3P79A 4QMPA 4RC2A 4WBOA 2C5VA 3PVWA 2PVNA 2C6OA 5KKRC 2PVKA 2GS2A 1V0OA 4MEDA 4FKPA 1E1VA 4GU6A 4FR4A 1J7LA 3HV7A 5AP0A 4J99A 4O27B 4E5BA 5J5SA 2Z02A 1MP8A 2Z7RA 2CLXA 3FKOA 4QOXA 4EORA 2E9PA 2QONA 4IJPA 2VTOA 5EOLA 5IDPA 2QURA 3ZYAA 5CQUA 1MRYA 3PY0A 4NUSA 3EQRA 3DFAA 4FV0A 4GH2A 4WNOA 5ANDA 3V6SA 2YWVA 3CR0A 1ZXEA 5D12A 5J87A 2PMIA 3ZC6A 2G2IA 2LGCA 2WELA 3G33A 3MSSA 2C3IB 2YJRA 3EL7A 1LEZA 1YDRE 2BKZA 4EYJA 3GC0A 4JI9A 4YJTA 5L6PA 4GIIA 3C4WA 1WAKA 2XZSA 3ZO4A 3MH0A 4F6WA 2BZHB 3UOHA 1ZOGA 3DPKA 2VNWA 3QQGA 3DOGA 5CF4A 1H1PA 4O6LA 5E8WA 1L3RE 3TT0A 3TZ9A 3W8QA 4E73A 2YEXA 2B4SB 3RWQA 4DFYA 4K18A 1A06A 5HTIA 1T46A 3NVKI 4V0GA 4B4LA 3BYVA 5I5ZA 4EH2A 2V7OA 2YAKA 5LOHA 2VO6A 3I4BA 3LW0A 4XRLA 3TNQB 3K5UA 3AMAA 5DEWA 4C4GA 5M06A 1Z9XA 5IG1A 3DY7A 4QP2A 2C47A 4XV9A 4DITA 2QOQA 4QPMA 2ZV7A 4L43A 4C02A 4F7SA 5LVNA 1ZYCA 5F95A 3LQ8A 3WZJA 2BFXA 3D7TA 3F88A 1J91A 2PVYA 2HK5A 3ORIA 5D7VA 2WXVA 2XNPA 1KE8A 3EN4A 4G3FA 3LMGA 2CDZA 3IKAA 4OBQA 2V5QA 1TQMA 2GCDA 3ENMA 2UVZA 4KWPA 5KMOA 4RMZA 5LMAA 3L9LA 3ZSGA 1JAMA 3COHA 3EQPA 4GG7A 3FPQA 2J0JA 4FI1A 4IACA 3E8NA 5FDXA 2OXXA 4IW0A 5GHVA 5J9LA 3B8RA 5JRSA 5E1EA 1M14A 1WMKA 2ITXA 1JPAA 5AR7A 3RMFA 4IC8A 4WNPA 2WU6A 4MNFA 4FVQA 3V04A 5ANIA 3EQGA 3KFAA 4S33A 2NO3A 4QP1A 3GU4A 2JDTA 3ZBXA 4DGLC 3GXLA 3TWJA 3R8UA 5B7VA 3UZTA 4F6UA 4FL1A 2QG5A 3P7CA 2W06A 4YZDA 5FM2A 3U87A 3UVPA 3DXQA 4BY9E 3SDJA 5M07A 3JVRA 3PSCA 4AZTA 4FYOA 4BCMA 4OGRA 1Q8UA 3MGYA 4U41A 5A4TA 3B2TA 3QQHA 4EC8A 4A9SA 3ZLSA 1WFCA 3COKA 4BCHA 4IXPA 4AFJA 5E8YA 3UG2A 4EOLA 4IX4A 4YHJA 1DS5A 3HAVA 5CU4A 1W84A 2HYYA 4MXAA 1G3NA 5EYCA 4G1WA 3OCGA 2A27A 3DNDA 4ZJJA 3SXFA 1NY3A 3VVHA 2XNEA 4YP8A 4RQKA 2ZMCA 1HOWA 5EYMA 2C5YA 4BDHA 4WO5A 3TNIA 4V01A 1Q8WA 1XKKA 3S00A 3TJDA 3E7VA 4NEUA 3PP0A 5TR6A 5A4LA 2C0TA 5CF6A 1GAGA 4ZP5A 1XWSA 4MXCA 2ZAZA 4JQ8A 5CYIA 5BX0A 4AFEA 2QO7A 5KZ0A 2JD5A 3FI4A 5BVEA 3ZM4A 2VTLA 3NUAA 4IAZA 5I3RA 4ZTNA 5HO8A 2CKOA 4QYYA 5AR4A 5HVYA 4C58A 2VTQA 3FMLA 2QHNA 2VX0A 4K1BA 3CCNA 4C62A 5CU2A 3A7JA 1OL2A 2XK6A 4FK3A 2WMQA 4C2WA 4QP6A 1OBDA 2JC6A 4C4HA 3MJ2A 3NYXA 3G51A 4P4CA 2J0KA 4L46A 5EDRA 3TN8A 4IX6A 4NZWB 4EK3A 4BTKA 4O7NA 3E87A 2JDRA 5AA8A 4FL3A 2X39A 3HMPA 5HICA 3R30A 3W2OA 2CCHA 4NM3A 1V0BA 4RWKA 1SNXA 3TCPA 2W5BA 3ZUUA 3DK7A 4DBNA 5HNIX 1KOAA 4Q5EA 4R3CA 4UV0A 3ZMMA 4AF3A 3AMYA 5AAFA 2FO0A 4R3PA 4AS0A 5EHOA 5L2SA 3KREA 2W1GA 3EFJA 4IM3A 3WZDA 3RHKA 5BVFA 3LXLA 3FZPA 4BDKA 2R3GA 4OAVB 3BIZA 2YHVA 1Q3DA 4RPVA 2FUMA 4C61A 3FZ1A 1PMNA 3FLSA 2WMAA 4FKSA 4IBMA 4D9UA 1ZYDA 2VTTA 3FWQA 4X2KA 3DNEA 4ZAUA 4ZY4A 2ZB0A 4QPSA 1QPJA 5CLPA 4FICA 4Q5HA 1R0PA 3LFSA 3JUHA 5HO7A 2XK7A 3O23A 4YBJA 3EMGA 4FT3A 2WTVA 2YIRA 4XNEA 2UZDA 3FMHA 4FKGA 1OKVA 3P9JA 3FE3A 4GVJA 4EBVA 5EKNA 3BI6A 5K4JA 2H8HA 5L6OA 5LXMA 5IQHA 2B9JA 3JPVA 2R64A 5ACKA 2PTKA 1OVEA 1FINA 4FZ6A 3VUTA 4CTBA 2YA9A 3UQGA 2NNWB 4NFMA 1BX6A 2YM8A 3ZO2A 1JSTA 2R3QA 5E8ZA 4X3JA 2GNLA 2FSMX 4QTBA 1H27A 2GSFA 3UDBA 4R7HA 3OY1A 4DYMA 3Q9ZA 4D2TA 5LCJA 4DEBA 3PE2A 4W4VA 2VWYA 3R28A 1PMEA 4WUNA 3RPRA 2F57A 3GB2A 1W98A 5B2LA 3DJ5A 2X7OA 4V0GB 1ZMWA 2G9XA 4F6SA 1F0QA 3TZ7A 2IZRA 2Z8CA 3D7ZA 3LFFA 3QAME 3L8SA 4F9CA 4MBJA 4FSMA 1XBAA 2RGPA 5JFXA 2J50A 3Q6UA 3UP7A 1PJKA 3FMNA 3VUMA 4RIYA 5LVOA 2ZM1A 5J1WA 3EJ1A 4FTUA 5K0KA 4PDYA 3AQVA 4H36A 5CSPA 5DIAA 4AW5A 3B8QA 3E7OA 4UMRA 4O38A 4I41A 4GMYA 1UU8A 3KMUA 5AWMA 4MYGA 2Q83A 2QLQA 5CEPA 5H2UA 5CSWA 3FHRA 5J95A 3NPCA 4WNKA 2UW3A 4YTHA 3I81A 3SLSA 5AUZA 5IA1A 2F2CB 2BRGA 5EDPA 4EJ7A 3JY9A 4EHGA 4RIWB 4FTNA 5E8VA 4O0XA 3TTIA 2P55A 2JKMA 4PL4A 2R3IA 3VUHA 3NW7A 3FEGA 3K2LA 3QD3A 5HVJA 4JBVA 4I6HA 4JRNA 4YJRA 2ITWA 2HY0A 3R7IA 2XIYA 3DKCA 4G9RA 5EK7A 4RZVA 2Y4IC 4AN3A 3ZZEA 4KSPA 4GSBA 4XUFA 4I5MA 4DLIA 3W55A 1WBVA 3HA8A 5M4FA 3AMBA 4OTPA 3U6IA 4YURA 4QNAA 4A07A 4FTKA 3TUBA 3Q5IA 5K0XA 1JKSA 3BV2A 1V0PA 4DEGA 5DT4A 3LJ0A 5DE2A 3IW5A 4UY9A 4BZDA 4EC9A 3PA5A 4HGTA 4ZMEA 3KU2A 4C3RA 3F3WA 2J0IA 4KABA 1YOJA 5HTBA 4I5CA 2HOGA 4F4PA 2VX1A 2QI8A 2XF0A 2VWZA 2HENA 3AGMA 4GK3A 3DFCB 3OVVA 4NM5A 3UYSA 2XCKA 4BF2A 4BBMA 3ID6C 2R3JA 4ZIMA 3R7YA 1CSNA 3MTLA 4TWNA 3RP9A 1DAYA 4M8TA 2J7TA 3SW4A 3HRFA 3PJ3A 4DH1A 3V5JA 4FA2A 2XNBA 4CT1A 3R00A 5CU6A 4ERKA 3MS9A 3VS0A 2BTSA 4IH8A 4IJ9A 4AG8A 3KCFA 4FSRA 3U9CA 3UG1A 4ERWA 3DAJA 1PF8A 2HZ4A 2PVFA 1XO2B 3OCBA 4P5QA 1VR2A 3PZHA 3QGYA 4LOOA 5A9UA 3E3BX 4FNZA 5GIOE 2W1HA 4YHFA 2I40A 4J98A 3VBXA 4AT5A 4TYGA 2ITVA 3R02A 4W4YA 2C0OA 4EOMA 4P5ZA 5L2TA 3CPCA 1ND4A 4QYHA 3PRFA 3OCSA 4KS7A 2RSVA 1J7UA 3I5NA 2VWVA 3D14A 3WF9A 5CANA 1OIUA 3UZPA 2HW6A 2GFCA 3GC8A 3TUDA 2W1ZA 5C26A 5HE1A 3FYKX 5L2WA 5DFPA 2HWPA 1OPLA 3ZZWA 4I93A 1U54B 3Q32A 3C4XA 3UGCA 2YDIA 3EWHA 5C4LA 1CKIA 4NL0A 5L8KA 1UNGA 4FTCA 3F9NA 4MQ2A 3SXSA 1A48A 2XBJA 2JKQA 2WTJA 2GPHA 3ZSIA 3K3IA 4C4JA 3QKLA 4HGSA 4RX9A 5C8NA 2YLFA 4IVDA 4L01A 3S0OA 3KRWA 4FKQA 1TKIA 4LMUA 3R7GA 3W1FA 4QMSA 4YR8A 3EN6A 3TI1A 4YLLA 2H9VA 4CFUA 2EXCX 3BPRA 4B9DA 5E9EA 2C0IA 3MH1A 3RCDA 3GBZA 5CT0A 2EUFB 2Z60A 2R3PA 3CC6A 3FJQE 1YRPA 1KOBA 5G6VA 2R9SA 5CASA 1QPCA 3PXFA 2X8DA 3HYHA 3F3UA 4FG9A 4IX5A 4UXQA 5GJFA 4GRBA 4Y73A 4JAJA 3W2RA 2R7BA 1YXVA 2UZBA 4DF3A 2WHBA 4NKAA 4C59A 2DQ7X 3L9MA 3QTWA 4M7IA 3KRXA 3E8EA 3BYSA 3IO7A 4AX8A 4J71A 2UZEA 1SZMA 4M66A 3LQ3A 3KULA 4RJ6A 2ERZE 4DG3E 4MCVA 4BKJA 4D28A 3DKOA 3QF9A 4FC0A 2QR8A 4FKUA 3VWAA 4EK8A 4WT6A 2HZIA 3NCZA 5HCXA 3V51A 3F3TA 3NUSA 3G0FA 4GFGA 4X7QA 4AOJA 3S1HA 4IE9A 3UBDA 4RFZA 4L68A 4S2ZA 5AV1A 2WFYA 4JQ7A 5DT3A 2XP2A 4YHTA 4DG0E 3C50A 2WIPA 3FY2A 4IC7A 3UO6A 4G3EA 1VJYA 2C68A 1E9HA 3SAYA 4NJ3A 4D55A 1OMWA 3I79A 3KXXA 4E3CA 1I09A 4HYSA 1Q4LA 2BAQA 3R01A 3IW8A 3COMA 5HVKA 3R7UA 3NAXA 4AOTA 1X8BA 4AAAA 3KXNA 4ITJA 4D2RA 4EHZA 3LKMA 3AD6A 3ROCA 1DI8A 1M17A 2CGWA 4UYNA 4U97A 3QBNA 5FM3A 4GT5A 5DH3A 4ZLYA 3WARA 4DEDA 3FKLA 3C4EA 3A60A 4E6AA 4DE4A 4Y95A 1WVWA 3I6WA 4WG3A 4F7LA 5AV2A 5ICPA 2UZVA 1OUKA 2WAJA 5JN2A 3QLGA 4IB3A 3FI8A 4DT8A 3GCQA 3LCKA 3OT8A 3C0GA 3FY0A 2R3KA 3ZONA 2I7QA 2GFSA 4R5SA 3WF7A 2X7GA 1UKIA 5CAOA 3SQQA 3DA6A 1YHVA 3BEAA 2O2UA 3KK9A 4HW7A 3QTSA 1IA8A 1LPUA 2XM9A 5E7RA 4QD6A 1YI3A 4X3FB 4DFLA 1G8SA 4U3YA 2HWOA 2V55A 3RJCA 5IA3A 3U55A 2CN8A 5GZ9A 5E91A 4ZXTA 2O63A 4YTFA 3OEZA 4LQMA 3PP1A 2CNUA 2R0IA 2GMXA 4HNIA 3NLBA 4HCTA 5M4IA 1U5QA 2PVHA 4J8NA 5CVFA 4EEVA 1UWHA 4U3ZA 4IEBA 4MHAA 3CP9A 2C6EA 3UOLA 3FXWA 3LFCA 5F1ZA 3EN5A 1MRVA 3N4UA 4F64A 3FL5A 1STCE 4ZLZA 4ANBA 2HXQA 4MWIA 3DLSA 4MNEB 4UMTA 4RVLA 3L1SA 1LP4A 5CS6A 2WTWA 3LOKA 3OOGA 3OUNB 2RG5A 4YTIA 1LR4A 3AXWA 3TJCA 3K5VA 4FV8A 3ROYA 3AC8A 2OBJA 2UV2A 2W9FB 5A4EA 4CG9A 2OIBA 5AP6A 3V8TA 4DTAA 3R83A 3ZRMA 4ORKA 2AYPA 5AAGA 3SC1A 2I0VA 2PMOX 3PSBA 4HNFA 4QMNA 5H9BA 5EYKA 4MF1A 3KVWA 4WNMA 3HZTA 4ZSJA 2WMXA 4RIXB 5HIEA 2QOBA 3ZO3A 1W7HA 4BTJA 2OICA 4XMOA 4I20A 1CKPA 4NT4A 5J79A 5IMXA 4E4LA 3PUPA 4FEQA 5IQBA 5CZHA 1RW8A 1YOMA 2BZJA 2GHMA 5H8BA 2PE1A 3LZBA 4XJ0A 5FXQA 3P7BA 4IMYA 1CTPE 4OT6A 4JG6A 4EZ7A 4DTBA 1APME 5I9WA 2IPXA 4F1MA 4M13A 3R1YA 3MFTA 5IQGA 5J1VA 3TNWA 3PZEA 3H30A 4M69A 3BHUA 4PX6A 1Y8GA 3ZXTA 3R8LA 4ALWA 2CKQA 4QMUA 3OMVA 4RIXA 5CI6A 1IRKA 3KN5A 3PY3A 2BDJA 3AC1A 3MESA 3E5AA 3BQRA 4R77A 3BHVA 4CFMA 3WOWA 4TYEA 4BCGA 5HHWA 5IUHA 2ONLC 5E92A 2JEDA 1PYXA 4M12A 2ITTA 4K77A 4KBAA 4U79A 4ZSGA 3VO3A 2ERKA 4FZFB 4ANNA 3NCGA 4FGRA 3BCEA 1M2PA 3DQWA 4NTSA 3W2QA 4FSQA 4G5PA 3PVBA 3CEKA 3HMOA 4PTCA 2W99B 5DRDA 4PNKA 3UTOA 5BYYA 3L8PA 2WMVA 3D83A 5KZIA 4ZS0A 2CPKE 1KSWA 4Z9LA 3IW6A 1PYEA 2XA4A 3IW4A 5L2IA 2WKMA 5IU2A 3K54A 4AUAA 4KIPA 2IG7A 3I6UA 2JDSA 3R1NA 4XCUA 3FXZA 2QHMA 5ANGA 4E4XA 4FEXA 4RJ4A 3PPZA 3TACA 3KULB 4CYJA 4O7SA 2BHEA 3RZBA 4ANMA 2WD1A 4X0MA 2OF4A 3BV3A 5DR9A 4ZY5A 4ZLOA 4EH3A 2XBAA 4FTAA 4RGJA 4IVCA 1JOWB 4GKHA 5IDNA 3CIKA 4JVGA 1JKKA 4X21A 3F2NA 5HORA 1F5QA 3AC2A 3QA8A 3C0IA 4IAIA 4LOQA 3UYTA 4Z55A 2P0CA 2G2HA 5IUGA 4L44A 4O2PA 3TM0A 1SM2A 4U7ZA 3AG9A 4QTDA 2JAVA 4KD1A 4RVKA 5HCZA 3TZMA 4H3QA 2GU8A 2GNHA 2YN8A 3FLQA 4FE2A 5BVNA 2YERA 4ITIA 3NDMA 1GY3A 4KKEA 2C6IA 2YM7A 3BHHA 4D1ZA 1KE9A 3QALE 3QTXA 3LM5A 1R1WA 4O7ZA 3V5PA 3SX9A 2ITUA 5FP5A 4CLIA 3W2PA 5IF1A 3UIXA 1WBWA 4BCIA 2UZTA 3ORMA 3SRVB 3OOMA 3ZUTA 3DK6A 4TXCA 2H6DA 3T9IA 4AZSA 2CGXA 4BR3A 3ATSA 4EK4A 5I9VA 4G3CA 4GIHA 3RKBA 3GC9A 2XNNA 4B8LA 2R3MA 3PTGA 2QD9A 4PDOA 1R78A 5LWNA 2X7FA 2HELA 4QQTA 3ZFYA 1ZY5A 3OHTA 4BGQA 3O50A 4U40A 4FTOA 4W4XA 3LXNA 2X8EA 2ETMA 1QPEA 3VF8A 1WBOA 5DEYA 4DA5A 2HAKA 4TZRA 4U42A 3R9RA 4TKSA 3FLWA 3F2AA 1SYKA 3I7BA 2VTMA 3DS6A 2F9GA 2Z2WA 1YOLA 4BKYA 3OD6X 4PMSA 2BIKB 2QO2A 3B2WA 3Q9XA 4RIYB 1UVRA 3P1AA 4M0ZA 2R2PA 1WCCA 4LOPA 4AACA 3A7FA 1PXLA 3BE2A 4I4EA 3UVRA 4AT3A 3NR9A 1MRUA 2RFEA 3VRYA 2GNGA 2UZUE 2C69A 1O6KA 4JBPA 4ACCA 3A8WA 3LPBA 4QTCA 4XLVA 3RAKA 2PYWA 1YDTE 4RFMA 2YIWA 2BDFA 2YM5A 4GKIA 4IB1A 5EM6A 4OTIA 3DV3A 4XP3A 4ZTSA 4DGMA 5HD7A 4L52A 4CMUA 4Q9ZA 2PVJA 3VS1A 3VS6A 4I22A 5J8IA 3DJ7A 2YDJA 4TYIA 2A2AA 3F5GA 3S4QA 1BL7A 2W05A 3GU8A 4IHPA 1IG1A 5EQYA 3DBDA 4YZBA 3WE4A 2XIRA 4RWJA 2LAVA 4C57A 3UE4A 5FEQA 3V8SA 1JVPP 2QOOA 4N70A 5AV4A 4PP9A 4U0IA 1O9UA 1UKHA 4AP7A 5BNJA 4IB0A 1ZOEA 4NW6A 5L8JA 4QMXA 5DYJA 3QRJA 4FSZA 5IQDA 2B53A 5CEIA 5BUJA 5GZAA 4BCKA 2C5XA 1IEPA 2YISA 5HE2A 5EM8A 4CZYB 1ERKA 4MXYA 2B9HA 4D2SA 3RHXA 4DHFA 5IEXA 4RWIA 4PMPA 3VAPA 3RNYA 3ZDUA 1Q62A 3QLFA 4CGAA 5KBRA 3BELA 4RX8A 4PP7A 2UW4A 3F61A 3G6HA 4E93A 3EKKA 3VS2A 4RQVA 4TYHA 4ZMFA 2VTJA 3HUBA 3P5KA 1AD5A 4MTAA 5ETCA 5FBNC 4AW1A 2YJSA 2IW8A 2XK8A 4G6OA 4DH5A 3E63A 4YNOA 4FKIA 2J6MA 5LWMA 3FQHA 2WTCA 5LMKA 5CT7A 1FVRA 5EW3A 3LVPA 3F2RA 1FQ1B 3OXTA 2X9FA 4ASXA 4W8EA 1G8AA 3I0OA 2XIZA 3OTUA 5HNBA 5M4UA 5ANKA 2QOKA 2UW6A 3A62A 4O86A 1J7IA 4J1RA 4HJOA 4TNBA 2W4JA 2QO9A 4KKGA 4D4VA 4E6QA 2J90A 2X4FA 5ETIA 2WO6A 5EM7A 4RA5A 5TF9A 3SG9A 5CY3A 3MH2A 3G2FA 5M44A 4HYUA 5I4NA 3THBA 4C2VA 2R0UA 2VO0A 4PRJA 4D0WA 4E26A 5IH5A 3L9NA 3FL4A 5DA3A 2VWIA 2C4GA 3KK8A 3SG8A 3HP2A 3ZLXA 4E7WA 1YQJA 2OU7A 3NYVA 5DBXA 2PE2A 1FVVA 2W0JA 4WD5A 3PXRA 3ZBFA 3WIKA 1FBNA 3HA6A 4IDVA 2ESMA 4AZWA 5CEKA 1ZZ2A 2B54A 4M3QA 1JLUE 3QKMA 3OCTA 2VX3A 3F7WA 3PVUA 3OBGA 5J7HA 5EDQA 4HCUA 5KMLA 3U51A 4K2RA 1YVJA 4CKJA 4G6NA 4H3BA 1URWA 4RLKA 4D2VA 3FC1X 1OIRA 4M14A 2Y4PA 2RFSA 2XCHA 3UO4A 4FKVA 3ENHA 4DFNA 4O21A 4FT9A 1FPUA 2IZTA 4RIOA 4MXZA 2VRXA 3D9VA 2OLCA 3R9NA 3EFKA 3HDMA 4R7IA 3VQUA 4ZK5A 4A4XA 5D7AA 3POOA 5IUIA 3RM6A 3ZU7A 4ZZMA 4BDIA 3TKUA 4QMLA 5DWRA 2WMBA 2Y9QA 3VBWA 4FV9A 3RPVA 4O0VA 4RVTA 5K3YA 4FV7A 3QQJA 2H96A 1NVQA 3WF8A 3V5TA 2WGJA 4FTMA 2ITQA 4X2NA 1H07A 4G5JA 4B99A 3EFWA 3EB0A 4W9XA 3UPXA 3SA0A 3KVXA 3CPBA 3KMWA 3TL8A 3ORXA 4IAYA 1PXMA 2REIA 2XB7A 3VRZA 3SHEA 4DFXE 5HBHA 2RF9A 4GYIA 4JDHA 2YM3A 4XG6A 1PXNA 4P90A 1OB3A 3MVMA 4FUYA 3AD4A 2WMSA 3C51A 4GFMA 2CN5A 2W4KA 5FQDC 5JSMA 5KKRB 4RX7A 3L9PA 4YJUA 4P2KA 3BGPA 3F69A 1W82A 2QCSA 3GCSA 4A4OA 4XH6A 1OKZA 3MY0A 2IN6A 1OITA 5AAEA 2OJJA 4F1OA 4FKRA 3I5ZA 4BDAA 1RJBA 3II5A 4FSUA 3C9WA 3FLYA 4IQ6A 4TPTA 4BGHA 5ANJA 4TWOA 4FL2A 3U9NA 1M52A 3Q9YA 4QMZA 3UZRA 3T8OA 2VD5A 2XKDA 3LFDA 2BHHA 4FIEA 3VQHA 4QYEA 4ASEA 2J0MB 4HPTE 1P4FA 5DI1A 4KINA 2RFDA 3QCXA 4N6ZA 2DWBA 5E8TA 4E1ZA 3P23A 4H1MA 2J9MA 2OI4X 3E92A 5HLNA 4RRVA 5L8LA 3QFVA 3CE3A 3EQBA 5TE0A 3LCTA 4F7JA 5AR2A 4CEGA 4OT5A 4NH1A 2X9EA 4TNDA 4LFIA 5KMNA 1FMKA 4FNWA 4GUEA 3UODA 1YWVA 1FVTA 4ZS4A 1XH8A 3ALNA 4LL0A 1XBBA 3EH9A 1HCLA 4UZDA 4DGOA 1RE8A 5AR5A 2PZIA 5FGKA 4MKCA 4FK6A 2YIXA 3UO5A 3TXOA 3NUNA 2W1DA 3P08A 3C4FA 3PIZA 2XRUA 3SW7A 4JG7A 4YPSA 4YU2A 2FB8A 4Y83A 3ANRA 5HOAA 2IW6A 5EYDA 1P5EA 2QVSE 1YW2A 2ZDUA 3MB7A 4GT3A 5GJDA 3GFWA 2XK4A 5CNOA 4XYFA 4DINA 5I9ZA 4BI2A 3CLYA 4FNXA 4NWMA 3OWPA 5M57A 5CVGA 3EHAA 2PVRA 3NNWA 3GNIB 5EHLA 4LV5A 2OKRA 2Z7SA 3SOCA 1ZLTA 4B8MA 4CXAA 3ATTA 2FVDA 3UIUA 3OP5A 4I94A 4YSJA 4GYGA 2ZV9A 5FWKK 5HG5A 2OG8A 2IZUA 4EH7A 5JGDA 4TWPA 4KBCA 2W1CA 3PVGA 4LMNA 4A9TA 4AZVA 4II5A 2OFVA 5C01A 3QU0A 4FOCA 4I0RA 3PLAE 4FKWA 4G2FA 4YNEA 1GIIA 4ACDA 2ZJWA 4F70A 2PHKA 4CV8A 5JFVA 3V5WA 3BGQA 4D2WA 4BL1A 5IISA 3MFRA 3QYZA 3SGCA 2C5NA 3NIEA 4R78A 1Q8YA 2PVLA 4AW2A 1Y6BA 2JAMA 5E8SA 4Z7HA 2OW3A 4RZWA 3WZKA 3JYAA 4BZOA 3LFQA 1XH6A 1ZYLA 3MN3A 5HKMA 4AA0A 1H28A 4OBOA 3NUYA 2A0CX 4E4MA 1PMUA 1DAWA 3UC4A 5DG5A 3E8DA 3MA3A 5FTOA 3RINA 3VW6A 4APCA 4C33A 5HTCA 2PVMA 3E64A 3FDNA 3CJGA 1Q24A 2W4OA 4ZTRA 4WKQA 3COIA 4LGDA 4NSTA 2UZNA 3CKWA 1SNUA 2OZOA 3FV8A 1LEWA 3LM0A 4L9IA 3OWLA 4QQCA 3TKIA 4M69B 2OJIA 3Q04A 2JDVA 1BYGA 3DCVA 4JDJA 4ZEGA 1JBPE 1RQQA 3SD0A 1UU7A 1IASA 3QD2B 3R73A 1VYZA 4WHZA 2RG6A 2J2IB 4XG7A 5KBQA 3A61A 3R8MA 4LM5A 1VZOA 1PHKA 5CENA 3UOKA 4E5WA 2QLUA 3QCSA 3L8VA 4AW0A 4WRGA 4C4FA 2R4BA 5DRBA 2O3PA 5FP6A 2GTMA 4I5PA 4U45A 4D2PA 4F9BA 4FVRA 2ZOQA 1KV2A 4JOAA 1Y91A 3QWKA 2E9NA 5A6OA 3QRTA 5AUUA 5F94A 4QP4A 5HBEA 3PFQA 4PPCA 2CKEA 3LLTA 4PUZA 5KMMA 5CXHA 4EUTA 2BR1A 3AD5A 3DLZA 2X8IA 3KKVA 4HZRA 2A1AB 3IOPA 3N9XA 1ZWSA 3KMMA 3RAHA 4U81A 4ENXA 3LMIA 5BVOA 5CSXA 3O7LD 2BRBA 3Q4ZA 4X2FA 5L4QA 4L7SA 4BIEA 4FG7A 4CQEA 4DLJA 5EQPA 3VNTA 3NYOA 5C03A 2UZLA 4XX9A 4KB8A 3D94A 2WMTA 3EZVA 3BBWA 4RJ7A 3NX8A 3TDWA 4DFUA 4E6CA 4FV5A 2WTKB 2I0HA 4EOOA 4LV8A 4EH8A 1TQIA 4WG5A 5J7BA 5K4IA 3C1XA 2QKRA 3KXHA 5JZNA 4K11A 1S9JA 3DAEA 4YMJA 2IO6A 2XNGA 3F5PA 3OFMA 4JNWA 4KAOA 4ZTLA 2W1IA 1BLXA 2VGOA 1UV5A 2PZPA 3TIYA 3BWJA 1Z5MA 4Y5QA 3RPYA 2WPAA 2PZ5A 1W0XC 5LQFA 2EXEA 2XEYA 2BVAA 3N4TA 3RNIA 3QUDA 5AA9A 4G17A 2IZSA 3ZH8A 4CV9A 3NRMA 4CFVA 5M4CA 4X2GA 2OJFE 5M09A 5AX3A 3T3VA 3ZSHA 4CFWA 3CTQA 1IAHA 3HECA 4ID7A 5JEBA 4MX9A 5M53A 3QX2A 5AP3A 1HCKA 5GIPE 1KE6A 1ZMUA 4IAAA 4S31A 4O0RA 4BCPA 4U6RA 3S2PA 3MFSA 4WG4A 4MF0A 4NCTA 5AUYA 4XV1A 4J53A 4C3FA 4K0YA 2YCFA 1H0VA 2Y7JA 4P7EA 2QOIA 5AFVA 3ETAA 1ZZLA 1KV1A 2W5AA 3M2WA 4L00A 4YJVA 4F09A 1P4OA 2FSLX 3VBVA 5ITAA 3C5IA 2J4ZA 2ITPA 3UQFA 1JKTA 2J51A 3CKXA 4D5KA 3NMUF 3A7IA 3MPAA 5CVHA 3R9DA 2CHLA 4BFMA 1XBCA 4S34A 3QWJA 4PPBA 3RWPA 1IR3A 5FRIA 3D5UA 3DQXA 4FBXA 4EJNA 1GIHA 4YGAA 3PXKA 3DKFA 3MVJA 3QUPA 5KHXA 5EI2A 5BVKA 5C8KA 4FEUA 5I9YA 3LQ5A 4IAFA 1E1XA 1H8FA 4NJDA 4IIRA 3DKGA 2CNVA 5HX6A 3GQLA 1SVHA 4AGWA 3BQCA 4FYNA 4WBBB 5BUIA 4JX3A 2OH4A 5KMJA 1G5SA 2QR7A 1GJOA 4XRJA 4X3FA 1OL1A 3CTJA 3GOPA 1P2AA 5L6WL 5ETAA 2VTAA 4CFXA 5IA4A 2PUNA 5KHWA 1OKYA 4USDA 2KULA 3R8VA 2GS7A 5H8GA 3FZSA 1FOTA 4BCNA 4U43A 3UNZA 4FTLA 2YFXA 3TEIA 3RK5A 2Z7QA 4FUXA 2V22A 4QO9A 4ENYA 2OH0E 4EQCA 2HXLA 3FHIA 3U4WA 2DUVA 2VNYA 3NNVA 4BCJA 4CCBA 3PPJA 2VAGA 4DAWA 1XH4A 5DLSA 4H05A 5CNNA 2IJMA 4MNEA 5B2MA 3C5UA 1ZYJA 4IDTA 2CSNA 5D9HA 2F7XE 3ODYX 2B7AA 3ULIA 3ZFXA 5E90A 5HG7A 4L3LA 5GNKA 1BI8A 2UW0A 2B52A 4QP8A 3MVHA 3D0EA 5EFQA 4AOIA 4BGGA 4HZSA 3U4UA 3FMDA 5HG9A 4BIDA 4RJ5A 5EOBA 3RTPA 5A4CA 5J9ZA 2PZRA 4F0FA 2OIQA 2ZM4A 2C6MA 3IGGA 3ZDIA 2EB2A 1Q97A 3QHWA 4ACMA 4O0SA 1YXUA 3C0HA 1OL5A 2OZAA 4KIKA 4RC4A 4RSSA 4BHZA 4HVHA 2W17A 3N51A 4I23A 1I44A 2R3RA 4D4SA 2Z7LA 4FIHA 3PIYA 5F9EA 2VO7A 2XRWA 3CD3A 4FTRA 5EW9A 4MBIA 1PKGA 4QTAA 4F65A 5TT7A 2YIQA 1KE7A 4J7BA 4XBUA 4BBEA 3IGOA 5HQ0A 4C8BA 5BMMA 4U8ZA 2HCKA 4FT7A 4H1JA 4QMMA 3PY1A 4MWHA 2V7AA 3GP0A 4AE6A 4UEUA 4L67A 4D1XA 3KQ7A 2UZOA 2WEIA 3KC3A 4GG5A 4NCTC 5KX8A 3NGAA 4I1ZA 2VV9A 3F5XA 4RVMA 5DOSA 3W32A 4EH6A 3DU8A 4CKRA 1ZAOA 3HUCA 1H1SA 1WVXA 1PY5A 3RALA 1Z57A 4BHNA 5H3QA 5IEVA 4YC8A 3V5LA 4CMOA 5AR3A 4I4FA 4PWNA 4BDJA 3UNKA 1JNKA 4MD7E 1F3MC 4DEEA 4RG0A 3QTQA 2XKCA 3QTRA 1U5RA 3MY1A 2C6KA 3S3IA 3R1QA 1XQZA 5BUEA 3NUPA 3O96A 4BYIA 1WBPA 2JIUA 1YKRA 3BEGA 4ANSA 4D4RA 3JR1A 4MK0A 2R3FA 4XG3A 1WBSA 4JRVA 4JL9A 4NKSA 3UIMA 4BVUA 4BTFA 4DH3A 3BU6A 2HZNA 4L7FA 3T9TA 2XK3A 1ZMVA 4D5HA 3FPMA 4UZHA 3CGFA 1BL6A 4ASZA 3LIJA 1CMKE 4BDEA 4FSYA 4AT4A 2R3OA 2BFYA 4A9UA 5EQEA 2C1AA 2WTKC 3ANQA 3I60A 3PE1A 5DHJA 5K5XA 3VW8A 1YHWA 4QP3A 2PUIA 5J5TA 3ITZA 3D5WA 2C30A 2NP8A 3DBQA 3R2YA 4GEOA 4LRMA 5AUWA 2X1NA 2CKPA 2RL5A 4TW9A 2H34A 4AA5A 3DK3A 3DBFA 4M68A 1GNGA 2BUJA 2BZIB 5EHYA 4M67A 4NFNA 1H4LA 2WB8A 4FV2A 3EOCA 4W4WA 3ZEPA 5IZFA 2PULA 4G31A 2O64A 3GI3A 1R3CA 2UW9A 1PXPA 3D15A 4I92A 4J8MA 3LXPA 4JDIA 5F4NA 4N4SA 4BTMA 2YITA 3QCQA 3HX4A 5HX8A 3VUKA 1WZYA 4JQEA 2VTRA 3QC4A 4YTCA 5T6KA 4XOZA 5AV0A 3CBLA 4MVFA 5H8EA 3OC1A 3DT1A 3A4OX 4YUQA 1O6LA 5CALA 2WU7A 1IA9A 4PTGA 5AV3A 1H01A 4PL5A 4C7TA 4ZOGA 3GU5A 2SRCA 4LUDA 3ZC5A 4BWKA 4DTKA 3Q3BA 3R7VA 1V1KA 4EH4A 2OK1A 2I1MA 2HZ0A 3TNHA 3OWJA 4JIKA 3KN6A 4CSVA 3BLHA 2C5OA 4D1SA 2JFLA 4W9WA 1UU9A 3LJ2A 4GJ3A 3OBJA 2EU9A 4Q9SA 3H9FA 3FC2A 1MUOA 1VYWA 3ORKA 4PY1A 3KGAA 1B39A 3PJCA 2EVAA 3FMKA 4WUAA 5C9CA 5JGBA 3O71A 4I24A 3OW4A 2XUUA 2FH9A 4X3FC 3Q2MA 3WI6A 4F1TA 3RGFA 3WE8A 5AUTA 4JIAA 4KA3A 3QYWA 4YJPA 5A54A 4U80A 3ORPA 3H3CA 4JDKA 5DGZA 4C34A 4L3JA 5CXZA 3PLSA 4E4NA 4HVIA 4DH7A 3O8UA 5BVWA 4CLJA 4TN6A 2WMRA 3FZRA 4FTJA 2GQSA 3F5UA 3HV4A 4O7TA 4MAOA 4U5JA 2CMWA 4O7LA 3MJ1A 3NS9A 4O7YA 5KO1A 2WTDA 4KRCA 5E4HA 3KXMA 3BBTB 4C36A 4O2ZA 3BYUA 5I0BA 5KE0A 3R63A 4A7CA 3FAAA 2X6DA 2FYSA 4IANA 3REPA 4CZUA 4EOQA 2XMYA 3AC4A 3A4PA 5EH0A 3RAIA 4ANLA 4LI5A 3LFNA 2CLQA 1A9UA 4JJRA 2W9ZB 3CS9A 3R9HA 4NYEA 2W1EA 4ZSAA 5AP5A 1YDSE 3EQHA 3F3VA 4RA4A 4BZNA 4O7WA 3EFLA 2JITA 3WF6A 1EH4A 2ITOA 4C37A 3ORLA 1K3AA 4HVSA 1BUHA 5IKWA 1CM8A 2JIVA 3QCYA 3DZOA 2I0EA 2QG7A 2EWAA 4F7NA 4M97A 1TVOA 2WQNA 3AC3A 1M7NA 1OECA 4XEYA 4O84A 3FZOA 3QXOA 4WA9A 5F20A 3SOAA 4HVGA 5BYLA 2C3JA 5JGAA 4TYHB 2BPMA 5IQFA 5CSVA 4EH5A 4WSYA 4EWHA 5HU9A 3NVMB 3QRIA 5E8XA 2YZAA 4FIIA 1REJA 1OPKA 4LRJA 4YJSA 2WQMA 4ZSLA 4RJ8A 1WVYA 4NK9A 3A99A 4AN9A 1VEBA 1Q8ZA 1Q99A 1QPDA 3ZS5A 5B2KA 3G9LX 3I7CA 3O8PA 4QMQA 2X6EA 4OW8A 3LCDA 2OSCA 3HEGA 3OWKA 3NZ0A 4G3DA 3DXNA 4MXOA 4DH8A 4Z3VA 3JS2A 2B9FA 4O0WA 4Q2AA 4BDGA 4UMUA 3ZFMA 2ACXA 5A4QA 3BHYA 1T45A 4OUCA 2G2FA 2P3GX 3R2BA 4KS8A 2XVDA 1S9IA 5FD2A 3QGWA 5CI7A 3NUUA 4ALUA 5DT0A 4C0TA 4OTRA 3LXKA 4M15A 2OFUA 4ANQA 1PRYA 5EI8A 4GCJA 5CWZA 2JBPA 4WOVA 3MPMA 5HD4A 3CY2A 2BMCA 2ZYBA 1ATPE 2F7ZE 3QC9A 5HIDA 3TZ8A 4DCEA 2FA2A 3BE9A 4TT7A 4IWOA 3KB7A 3M42A 3ZHPC 5A3XA 1H00A 4QMWA 1K9AA 2XKFA 4MD8E 4BBFA 4KIKB 3HMMA 5A14A 4DEAA 1U46A 4D4YA 1SMHA 2PMNX 3MTFA 3VF9A 1UU3A 3FMEA 3TDVA 5AM6A 5IA0A 2Y6OA 5I9XA 4ITHA 5GINE 1PXIA 2VWUA 4QPAA 5ACBC 4O6EA 3VHKA 5JRQA 5IQIA 4CG8A 2X2LA 3TV7A 5JT2A 4XG4A 4EOPA 3BX5A 4LGGA 3KXGA 4IM0A 2Y6MA 4K6ZA 3MYGA 3CXWA 4XS2A 5JMSA 4ACGA 4OLIA 4I6FA 5KNJA 4CRLA 4RBLA 2F7EE 3FZTA 1FGKA 2A4LA 3BU3A 4RJ3A 5CU3A 4CYIA 4CVAA 4G34A 4YC3A 1NVSA 1P14A 4YJOA 2BRNA 5HE0A 4FGBA 4MH7A 3FMJA 3Q96A 4F9YA 3PYYA 4L3PA 5A46A 4FZAB 4QMYA 4YO6A 4S32A 2HIWA 3RI1A 1NT2A 4OTWA 1GOLA 3HP5A 4XG9A 3H0ZA 4EZ3A 2HY81 3PG1A 3V6RA 4EQUA 3F6XA 3RCJA 5IQAA 5JH6A 1QCFA 3AT4A 4TRLA 3VS5A 5HE3A 3HVCA 1YWNA 2QU5A 3VC4A 4QYFA 4IZAA 4FZ7A 4GU9A 2CGVA 2WOUA 1Q3WA 2WQEA 2X2MA 4XBRA 2C6DA 1ZY4A 2OWBA 2O65A 3VIDA 4XHKB 4FF8A 3DBCA 3IECA 3MFUA 2WMUA 5CEMA 2IW9A 3FQEA 4AGCA 2PY3A 3EQDA 3OT3A 4GJ2A 4Y8DA 3ZXZA 4C35A 4QTEA 3NW5A 3AC5A 4XLIA 4PDPA 4FEVA 4KUJA 3TV4A 2C6TA 3HKOA 1NW1A 1XH5A 2CNQA 3H4JA 2CGUA 2F2UA 5CX9A 5CAUA 4BI0A 4CKIA 5FUTA 4EUUA 5LJJA 3SRVA 5IH6A 2PZYA 2UUEA 2BCJA 3C7QA 4PMMA 4JXFA 3GVUA 5M51A 4RIWA 5LVPA 1ZRZA 2F49A 4JG8A 3DJ6A 2NRUA 4L45A 3C4ZA 2G01A 3C13A 2R5TA 2PL0A 5CQWA 4DGGA 4FKLA 4UMPA 5HZNA 5A6NA 2GQRA 2EXMA 4PDSA 2WTIA 3LHJA 3DBEA 2WQOA 2Y8OA 3LE6A 5HESA 5CZIA 2XIXA 3R7EA 3G6GA 2YAAA 3IPHA 3OXZA 3GCPA 4UALA 2VN9A 4FV3A 4E5AX 4FZDB 4ARKA 1QL6A 2P2HA 3KXZA 3LCOA 4FV4A 4O0TA 3Q4CA 4XOYA 5ANOA 2YABA 5HNGA 2UW7A 1XHAA 4CD0A 2QC6A 1B6CB 2UZWE 2ZB1A 4CTCA 5IQEA 3FSFA 3OF0A 3CY3A 2QODA 5CAQA 3EN7A 4FKJA 4B0GA 4N0SA 2I0YA 5DR2A 3W18A 4N6YA 3KY2A 2C6LA 3BLQA 3ACJA 3QL8A 5M55A 4EH9A 4EHEA 2ZVAA 4FSNA 3UNJA 3QUEA 4JS8A 4D58A 4Z16A 4X6RA 4IWQA 5JQ5A 5AMNA 2BTRA 3GQIA 3FI3A 2CJMA 1FMOE 2XJ2A 4F0GA 3MI9A 5DMZA 3DAKA 3A7HA 3KA0A 3Q52A 2P2IA 4H3PA 1Q41A 1TQPA 3KL8A 3R0TA 4N57A 5BYZA 4RFYA 3OEFX 5AUVA 4EYMA 4CNHA 4DC2A 4FV6A 5KMIA 3LCSA 4KBKA 4R6VA 2OZAB 5GZ8A 2P33A 5C27A 2OXDA 3EYHA 1MQ4A 4ONAA 2PUPA 3M1SA 3TNPC 3ZLWA 5C8MA 1YXTA 1JQHA 3IG7A 3IDBA 4ZSEA 5AR8A 4BDDA 3LAUA 1YWRA 3W8LA 3GT8A 3VUGA 4ACHA 5FDPA 4W8DA 5KCVA 3ZUVA 3HV5A
chains in the Genus database with same CATH superfamily
3V01A 3BXWA 5AIKA 4D9TA 3HRBA 1URCA 3ELJA 4J96A 3WBLA 5DNRA 1WJ7A 3JVSA 3W10A 4F1TA 4GUBA 4HOKA 1XMMA 1UNLA 1TDHA 2VTSA 4H39A 5D11A 5HEZA 1WBNA 4IFGA 1SVGA 2B1PA 1PJQA 4GK2A 3VBYA 3A2CA 4L8RC 5HTCA 2X0PA 3KEXA 3MY5A 4YPDA 4QQ5A 3PDTA 5FXRA 4BBAA 1H24A 4GS6A 3ZRLA 1N78A 1L1TA 3CQUA 4ASDA 3HRCA 3U6SA 4M0YA 4ZJVA 5BVDA 1PXJA 2Y0QA 3CTWB 1GIJA 4RLLA 5HBJA 3Q5ZA 4NXNM 3TG1A 3QZIA 4BCOA 5L3AA 3FD9A 3UJNA 1OUYA 3OROA 2BALA 3O7LB 4FRFA 4UB7A 4PTEA 3U8WA 3VHEA 2JY6B 2VTPA 4A4LA 2B0QA 3NIZA 4WIHA 4HLQA 1H0WA 2OJGA 3FTFA 1PMVA 2JBOA 3R71A 4FT5A 4U9AA 3AOXA 5EP2A 2ZMDA 3DGKA 3F3ZA 4FKTA 4BDFA 2O5KA 2F4VM 3DXPA 4AN2A 3QZHA 5KO3A 4F9AA 4FOBA 2ONLA 2CFOA 1J7KA 4GVAA 4JBQA 4RC3A 1Z5AA 4AKHA 1M7QA 2JIIA 4AG5A 2I6LA 2IVTA 5CAVA 3GU6A 1PRBA 2X81A 4X6QC 2XSZA 5AJQA 4O91A 4HVDA 4R3RA 1LUFA 1NJFA 2B55A 3EYGA 3NW6A 3GLFA 3E62A 4A9YA 4CMTA 3UIBA 3KRJA 3R1SA 4G9CA 3POZA 4PPAA 4XP2A 5HIBA 3Q4UA 4L42A 1R39A 2C3LA 3EL8A 4O0UA 3ULZA 5IH4A 3Q2JA 3U54A 3O0GA 4YJNA 4F9WA 3EKNA 3P78A 2GNFA 1Q5KA 5CEOA 2OF2A 5DPVA 4IJFA 1G41A 1PXOA 4YLKA 3HY5A 4OTQA 1PXKA 4HGEA 3P86A 3HNGA 4OTHA 3OXIA 5FBOA 4LJ8A 4M9ZA 5IA5A 3SV0A 2QOCA 5LVLA 4K8AA 4CJ6A 4O22A 4CRSA 5AADA 1U54A 4ZTHA 3JAMS 3ILKA 5FTLA 2QU6A 4GC5A 2DZOB 2L09A 4JI8M 3SC3A 2BIYA 2YIYA 3PXQA 3DDQA 4FIGA 4QMVA 3AGLA 4B3TM 3WI6A 1NXKA 4AXAA 1DM2A 4IADA 2UW8A 4O96A 3VN9A 4FTTA 3QXPA 1RDQE 1QAQA 4IX3A 2R62A 4DV2M 4G4OA 1N33M 2XM8A 3NNUA 4UWCA 2RKUA 4YSMA 4IWDA 4FV1A 5E8UA 5ITTA 4EKLA 4EOKA 2KNAA 4ZTMA 3DB8A 1H6UA 4KLNA 3IOKA 3NEWA 3WYYA 4WP2A 4OR5A 4OTGA 4R7GA 5DN3A 1IAJA 4UWBA 1REKA 3QTIA 3PJ8A 1IN8A 4DFZE 4O83A 5TOZA 3WIGA 3SATA 4JBOA 4K9YA 1NA7A 3CGOA 3ZO1A 1K82A 4ITQA 2GQGA 3D2IA 3LFBA 4CZTA 1R7RA 4PQNA 4LGHA 5AM7A 4DEIA 3KF7A 4R5YA 5GJGA 3VUIA 2JDOA 4XP0A 3RBWA 4JT3A 3ZLYA 4BYJA 5JFSA 1E94E 1XJDA 3QD0A 4AGDA 3BGZA 4L53A 4YZMA 1YHSA 1UNHA 5JZJA 2R46A 3LLAA 3QZGA 1OI9A 2G1TA 3E93A 3FI2A 1G59A 2BILB 4AZFA 2HW7A 3OUKA 4DV4M 3QKKA 5D10A 1OZ1A 2CE7A 3LJ1A 4Y46A 2PK9A 2X4ZA 3VS7A 3KOZE 2RIOA 3IW7A 2OGVA 4QP7A 3WYXA 5LMBA 1OKWA 3ZEWA 3HDNA 3I04M 4C3PA 4G6ZA 5EI6A 2XYNA 4TY1A 5EP4A 3HLLA 2ITYA 2W1FA 3DTCA 4F2LA 3B74A 2OO8X 1QUSA 2ZDTA 3Q4TA 4EK6A 3VJOA 2E9VA 5ANEA 5AP2A 4XV2A 2A5YB 2W7XA 3PXYA 3QTUA 3A7GA 4FTQA 4YZ9A 1I4WA 4ALVA 4BRXA 5ETFA 5KUPA 1GZ8A 2YCQA 3DTWA 3NAYA 4I6BA 3EZRA 4DG2E 3RK7A 2BDWA 4MM3B 2JA2A 4DUZM 2XJ0A 1QMZA 1RU3A 3QX4A 4JAIA 5EXPA 3UMXA 2QBYA 2B9IA 2XKEA 3IK3A 3ZRKA 3HU3A 4JI5M 4BICA 4PV0A 1CUKA 2VTNA 3HL7A 4JX7A 4R1YA 2CCIA 2ZBKB 3UMWA 3MIYA 3TYKA 4YC6A 3B89A 4B7TA 2XNMA 4MD9E 2R7IA 4CFFA 4DN5A 2AC3A 3QRKA 4R1VA 4E8AA 3BLRA 3IDCA 3NNXA 1YI4A 5M56A 4AWIA 5BPYA 2JKKA 3W33A 3T3UA 4G4RA 3QA0A 4APPA 3DA1A 5D1JA 5AP7A 5AX9A 5HO6A 4BCQA 5HGIA 4GFOA 4S30A 3RPSA 1R6BX 3MDYA 2QNJA 5EG3A 3S95A 3H9OA 3QYEA 2WEVA 3OG7A 1Y57A 4K33A 4YZCA 4USEA 3H10A 1GZKA 5T3QA 2FSTX 4I6LA 3QRUA 4X66M 3E8CA 3C4CA 3GC7A 3H0YA 3PSDA 1J3HA 5CSHA 4AE9A 5LMKC 5IA2A 5T68A 1XH7A 4JYAM 4FODA 4IZYA 4CQGA 3M7GA 2ZM3A 3KS8A 1Q61A 3FMMA 3G0EA 4HYIA 1IBMM 3MB6A 4IVBA 4V05A 4RF1A 4RWLA 3MBLA 5B0XA 5L2QA 3RM7A 3TUCA 1U59A 1MN3A 2NYAA 1OPJA 3ZTXA 2J5YA 2IVVA 2PU8A 2GTNA 4BCFA 5FTGA 4DFBA 4A9RA 4UWYA 4BWXA 1GVNA 3HAMA 1QDRA 4GL9A 4C4EA 4QDVA 3BRBA 2KTYA 4FMQA 2VUWA 3ZC7B 5FEEA 3R04A 3RAWA 3FXXA 5CU0A 4KSQA 4Y85A 2DXIA 3QHRA 4OAUC 3P0MA 3LVWA 4JLCA 3PRIA 2ITNA 2VWBA 2NRYA 2ZFYA 2GNIA 4MQ1A 5HCYA 2QOFA 4L8MA 4BI1A 3MA6A 5IWAM 2ZV2A 4O0YA 5BMSA 3E4RA 3PPKA 2UUCM 3CJFA 3ORTA 2QOHA 4KIQA 2DAEA 3J80S 2XEZA 3P4KA 2MROB 4FSTA 5E6JA 2P4IA 1H1WA 5HLWA 4I21A 2OJ9A 4IAKA 4OVZB 2UVXA 3BWFA 1TGUA 3RZFA 1M2QA 2XIKA 2WIHA 3D5XA 3BU5A 3QWLA 4USFA 3NWWA 2VWWA 4I5HA 2JKOA 5AIRA 4F08A 3J2PB 3W16A 4BDCA 3VS3A 2PE0A 4HEOA 4QRCA 3W0PA 3SVVA 1VEJA 4I5SA 1N34M 4ZTQA 1IFYA 4AZEA 3PIXA 3N4VA 1GZOA 4A06A 1OGYA 1MQBA 3NUXA 4TTHB 3AOEA 3U6PA 1JSVA 4RT7A 3ALOA 2FNAA 4FNYA 4KNBA 3AFHA 5CEQA 4OAVB 2XH5A 5C1QB 4I0SA 4Y5HA 3R9OA 3R22A 4IWPA 2V62A 2RFNA 4O1PA 4TYJA 1DI9A 3IONA 3VBQA 4FG8A 4V04A 4QYGA 3BZ3A 4HCVA 3CTHA 3G90X 1MJGM 2R3LA 2FGIA 2V0DA 3R6XA 4ZY6A 3TKHA 4NM7A 5IT9S 3GUBA 4FSWA 2IVUA 1ZYSA 2GNJA 3AT3A 4BB4A 1Y8YA 3W2SA 4FCVA 1OM1A 2WNTA 4DEHA 4UYAA 2R3NA 3MW1A 5EW8A 1NVMA 2AC5A 2E9OA 4YO4A 3HHWA 1UWJA 1JKLA 3F7ZA 4JR3A 5CF8A 3G9NA 5IPJA 3AV0A 3GRVA 2VTIA 3UDZA 2IWIA 5TKDA 2VU3A 1Q8TA 3TPZA 1JSUA 3EQFA 4X2JA 3GLIB 2YZLA 2NQ8C 1HNWM 1H25A 2PUUA 3QQUA 4EK5A 3VBTA 3BYMA 3KRLA 2QQ7A 4D82A 3RVGA 2X0GA 1HT1E 4QMOA 5J9YA 3FLNC 3I0QA 5AEPA 3CQEA 2QZ4A 3OTOM 2QOLA 3MIAA 1H1RA 3JXWA 4KRDA 3THGA 5K5NA 3FSKA 3GP1A 3L8XA 5D41A 3WF5A 3KF4A 2RGHA 5AP4A 5IQCA 2LH0A 5EKOA 3ZM9A 2W5HA 3R7OA 5CF5A 4XG8A 1G8JA 4TL0A 3ORNA 4LJ9A 2XF3A 2BRHA 3Q53A 3QQLA 4LY6A 4L16A 4D0XA 4EKKA 4I6QA 3HMIA 3HJ8A 4J52A 4Y72A 1NV9A 2C5RA 3HV3A 2PMLX 1J1BA 4LRKA 3G15A 3UP2A 3WZUA 3SKCA 5ITRA 2XAOA 4AXEA 4LGMA 4OTDA 4ZZNA 2ZV8A 4DV3M 3V8WA 4UBAA 3UZUA 3OY3A 3FKNA 4FX3A 4EWQA 2DAKA 3FUWA 2J7NA 1KE5A 4E6DA 4O7VA 1AGWA 4UXLA 2C1BA 1OFHA 2DI0A 1YI6A 3HV6A 3LFEA 3F82A 1PJTA 2AUHA 4I3ZA 3PA3A 4IZ7A 4EOIA 3GQ3A 3D7TB 3PJ1A 3QQKA 1B38A 4WRSA 2Q0NA 2GHLA 2PSQA 3R21A 4MBLA 2O0UA 4L6QA 1C1KA 1T6OA 2VTHA 4QQJA 2W82A 4G6LA 3W0OA 2QBYB 2KHHA 5ITUA 4O7RA 2WZJA 3VLFB 1CKJA 3CSVA 5LCKA 2YCSA 4AKIA 2XS0A 3MWUA 1PKDA 5JFWA 4M0WA 2F5OA 1OIYA 4YLJA 5K9IA 2C96A 1OIZA 2GS6A 4M84A 1KUTA 3ACKA 4FKOA 2Y21A 4EL9A 2WOTA 3G5DA 1CDKA 4BN1A 1SVEA 5C18A 2VZ6A 5JI3E 2Y4IB 5KQDA 2CHQA 4F0IA 4IB5A 2WMWA 2WQBA 3PWYA 5FEDA 1GL7A 2ZANA 2OXYA 5CAPA 3RK9A 3PJ2A 2YFQA 4IVAA 1UA2A 4FVPA 2BKKA 3O17A 3TV6A 2X2KA 2XK9A 2BRMA 2ETKA 2MGWA 3FQSA 2NPQA 3GFEA 3QAUA 4U44A 1VG5A 5FTKA 4BIBA 3MH3A 5FG8A 4C38A 4E20A 5EM5A 3SXRA 3GOKA 2C3KA 3QQFA 4HYHA 5CTPA 5FXSA 2UW5A 3E3PA 3V5QA 3VS4A 4CT2A 4UN0C 1BI7A 3MV5A 3C3DA 2I7NA 1IBKM 3ZCLA 3BHTA 2VWXA 2LTUA 3HMNA 2IVSA 3OZ6A 3Q9WA 4F99A 4QDEA 4YZNA 4BWPA 5I9UA 3PXZA 4LYNA 3CQWA 5BVFA 3UPZA 3LMHA 4OTFA 1L8TA 3QTZA 2DHYA 3FTCA 4IZ5A 2YNMD 4TWCA 4ZZOA 4YJQA 2QKWB 4LL5A 1K2PA 5HLPA 3BYOA 4YBKA 4BC6A 2VO3A 4IM2A 3PA4A 4JR7A 2EKKA 3ODZX 2KXEA 1YXSA 1JWHA 3OS3A 1ZOHA 3AKZA 4I0TA 1Q02A 5HI2A 2O01F 4QOSA 4R71A 1YXXA 3KCKA 1H1QA 5JK3A 2ZAMA 5EJCA 3FUPA 3M11A 3IDPA 2Q0BA 4CCUA 5I3OA 3R8PA 4ANOA 2WSFF 1BKXA 1ZARA 1WBTA 2XJ1A 1WGLA 2FSOX 5LARA 4EOSA 4F1IA 4F63A 2QPAA 4MGKE 3RGSA 5IEYA 3E88A 3NWLA 3KIOC 4MGZE 5HU3A 2CV1A 2JGZA 4EHVA 2E2BA 3U6HA 3VJNA 4LRSA 4LZJA 2YWPA 3EQCA 3UQCA 4REZA 1XH9A 4LF9M 3D5VA 5DVRA 4OVZA 3KP0E 2ETRA 2J0LA 4QNYA 3WZEA 3BKBA 2ITZA 3UC3A 3VULA 3DDPA 3IS5A 3CD8A 4CGYB 4QT1A 4NM0A 3QZFA 3LFAA 4G16A 4IBKA 4JI0M 3EN9A 4LUEA 4PNIA 2G15A 4LF7M 1GZNA 3U61B 5FLFA 1OL7A 3GENA 3O51A 4FIFA 4GT4A 1XC8A 4GC9A 3A8XA 1FGIA 4NTTA 5HG8A 5AUXA 4WSQA 4DHZA 2JZ1A 2LBCA 2YM4A 2X0QA 2R65A 4LCBA 2ZM6M 2YM6A 4LG4A 4FT0A 5FTQA 3RPOA 5JKGA 5BQ0A 3MPTA 3GU7A 3AT2A 3H9RA 3UVQA 4AU8A 1OIQA 4DCAA 1UM8A 5C4KA 1ST0A 2OIDA 3LW5F 4DT9A 3Q60A 4EQMA 3FLZA 4J95A 2Z8YM 3PG3A 3U61A 4AGUA 2DS1A 2GDOA 3I1AA 4QMTA 4NW5A 2G5GX 4GHLA 2Y0AA 4IFCA 3NSZA 2GHGA 3OW3A 3ZOSA 4EOJA 2BZKB 3D2KA 3K3JA 4MXXA 4DGNA 2PWLA 1NVRA 3GEQA 3OTVA 2DWLA 4FIJA 3TIZA 1XR1A 3EQIA 3PWDA 4HPUE 5LVMA 1PW2A 1AQ1A 1R0EA 1W83A 2W96B 5M08A 3D4QA 3KRRA 3MVLA 2BAKA 3U6JA 3GLIE 3DZQA 1OL6A 1Y6AA 4BKZA 3F66A 2JLDA 1W8CA 4R7BA 5FTMA 3ORZA 3NYNA 3P7AA 4Z7GA 4H58A 3VUDA 2N35A 2J5EA 4EBWA 2J5FA 5AP1A 3B7NA 4OBPA 2YCRA 4HGLA 2E9UA 4ZJIA 3IQ7A 3GGFA 3VK7A 2DAMA 2YDKA 3JY0A 5TO8A 3V3VA 4O82A 1QQWA 1J1CA 3GCVA 2YLEA 1V33A 4G3GA 2XYUA 4UX9A 4AQCA 2DYLA 4PL3A 1V34A 2YACA 2BROA 4GW8A 3ET7A 5DR6A 3UJGA 1OGUA 2QHOB 4C4IA 5KMKA 1PJIA 3FBVA 2BAJA 4R8QA 3J7AS 1IM2A 3HGKA 2VGPA 4KKHA 4NIFB 5E1SA 1OAIA 4UMQA 4XV3A 5G1XA 5JQ8A 4NU1A 1V92A 2JY8A 2JFMA 4O1OA 4KIOA 4CFNA 2O8YA 1U4DA 2F4JA 3DB6A 3R8ZA 1H08A 2XNOA 3GCUA 4GK4A 4B6LA 4IJEA 2WSEF 2R3HA 3EIDA 4J97A 1IXSA 4HL4A 4PCZA 1M2RA 3O8TA 3Q6WA 3QD4A 4FTIA 3TTJA 3W2CA 5IMEA 4BDBA 3UOJA 2EB3A 3O2MA 2UVYA 3U6LA 2A19B 4PMTA 4QP9A 2KNZA 4GV1A 4NIFA 1KWPA 4XG2A 3FYJX 1BMKA 3ERKA 1O6YA 4PF4A 2QCUA 4AA4A 4GRIA 1H26A 3P79A 4QMPA 4RC2A 4WBOA 2C5VA 3PVWA 2PVNA 2C6OA 5KKRC 2PVKA 2GS2A 1V0OA 4MEDA 4FKPA 1E1VA 4GU6A 2ZAOA 2OOAA 4FR4A 1J7LA 3HV7A 5AP0A 4J99A 4O27B 4E5BA 5J5SA 2JY5A 1MP8A 2Z02A 1SXJC 2Z7RA 2CLXA 3FKOA 4QOXA 4EORA 2E9PA 2QONA 4IJPA 2VTOA 4KHPM 5EOLA 5IDPA 2QURA 3ZYAA 5CQUA 1MRYA 3PY0A 4NUSA 3DFAA 3EQRA 4FV0A 4GH2A 4WNOA 5ANDA 3V6SA 2YWVA 3CR0A 1ZXEA 5D12A 1T43A 5J87A 2PMIA 3ZC6A 2G2IA 2LGCA 2WELA 3G33A 3MSSA 2CEAA 2C3IB 2YJRA 3EL7A 1LEZA 4GH9A 1YDRE 2BKZA 2BWEA 1EE8A 4EYJA 3GC0A 4JI9A 3EIEA 4YJTA 5L6PA 3K1JA 3C4WA 4GIIA 1WAKA 2XZSA 3ZO4A 3MH0A 4F6WA 2XARA 2BZHB 3UOHA 1TH3A 1ZOGA 3DPKA 2VNWA 3QQGA 3DOGA 5CF4A 1H1PA 4O6LA 2DWNA 1L3RE 5E8WA 3TT0A 3TZ9A 3W8QA 4E73A 2YEXA 2B4SB 3RWQA 4DFYA 4YMJA 5DYIA 4K18A 1A06A 5HTIA 1T46A 3NVKI 4LGYA 4V0GA 4B4LA 4G4QA 3BYVA 5I5ZA 4EH2A 3GLGB 4B3MM 2V7OA 2YAKA 5LOHA 2VO6A 3I4BA 3LW0A 3KS4A 3IG8A 4XRLA 3TNQB 3K5UA 3AMAA 5DEWA 4C4GA 5M06A 1Z9XA 5IG1A 3DY7A 3RFWA 2KZUA 2C47A 2X8AA 4QP2A 2DZNB 4XV9A 4DITA 2QOQA 4QPMA 2ZV7A 4L43A 4C02A 4PDGA 4F7SA 1ZYCA 5LVNA 2F5QA 5F95A 3LQ8A 3WZJA 2BFXA 3D7TA 3F88A 1J91A 1ORYB 2PVYA 2HK5A 3ORIA 5D7VA 2WXVA 2XNPA 1KE8A 3EN4A 4G3FA 2BJVA 3LMGA 2CDZA 3IKAA 4OBQA 2V5QA 1TQMA 2GCDA 4AXFA 3GPXA 2UVZA 3ENMA 4KWPA 4RMZA 5KMOA 3U5ZA 5LMAA 3L9LA 3ZSGA 1JAMA 3D8LA 3COHA 3EQPA 4GG7A 2J0JA 4FI1A 4IACA 3E8NA 5FDXA 2OXXA 4IW0A 5GHVA 3LCUA 5J9LA 3B8RA 5JRSA 5E1EA 1M14A 1WMKA 2ITXA 1JPAA 5AR7A 3RMFA 4IC8A 4WNPA 2WU6A 4MNFA 4FVQA 3V04A 5ANIA 3EQGA 3KFAA 4S33A 1N32M 2NO3A 4QP1A 5LMUM 3GU4A 2JDTA 3ZBXA 4DGLC 4GMQA 3ZCBB 3GXLA 3R8UA 2CUZA 3TWJA 5B7VA 3UZTA 4F6UA 4FL1A 2MH8A 2QG5A 2W06A 3P7CA 4YZDA 5FM2A 3U87A 3UVPA 4DFNA 3SDJA 3DXQA 5M07A 4BY9E 3JVRA 3PSCA 4AZTA 4FYOA 1GJSA 4BCMA 4OGRA 1R2ZA 1Q8UA 3MGYA 4U41A 5A4TA 1QANA 1DGFA 1GJTA 3B2TA 3QQHA 4EC8A 4A9SA 3ZLSA 1WFCA 3COKA 4BCHA 4IXPA 4AFJA 5E8YA 3UG2A 4EOLA 4IX4A 1OAOC 4YHJA 1DS5A 3HAVA 5CU4A 1W84A 2HYYA 4MXAA 1G3NA 1YE9A 5EYCA 4G1WA 3OCGA 1TZDA 2A27A 3DNDA 4NRWA 4ZJJA 3SXFA 1NY3A 3VVHA 2XNEA 4YP8A 4RQKA 3V76A 1HOWA 2ZMCA 1DGBA 2C5YA 5EYMA 4WO5A 3TNIA 4BDHA 4V01A 3LCVB 1Q8WA 1XKKA 3S00A 3TJDA 3E7VA 4NEUA 3PP0A 5TR6A 5A4LA 2C0TA 3T38A 5CF6A 1GAGA 4ZP5A 5C1BA 1XWSA 5IZ7D 4MXCA 2ZAZA 4JQ8A 4GHAA 5CYIA 5BX0A 1DGHA 4AFEA 2QO7A 5KZ0A 1SXJA 5EP3A 2JD5A 3FI4A 5BVEA 3ZM4A 2VTLA 3NUAA 4IAZA 4JN6A 4ZTNA 5HO8A 5I3RA 2CKOA 4QYYA 5AR4A 5HVYA 1DGGA 4C58A 2VTQA 3FMLA 2QHNA 4S12A 2VX0A 3CCNA 4K1BA 2O5RA 4C62A 5CU2A 3A7JA 1OL2A 2XK6A 4FK3A 4O4CA 2WMQA 4C2WA 4QP6A 1OBDA 2JC6A 4C4HA 3MJ2A 3NYXA 3G51A 4P4CA 2J0KA 4L46A 5EDRA 3TN8A 4RX5A 4IX6A 4NZWB 3KOYE 3WE8A 4BTKA 3E87A 2JDRA 4EK3A 5AA8A 4O7NA 4FL3A 4AI6A 2X39A 1S3SA 3HMPA 3R30A 3SYLA 5HICA 1D0LA 4O4BB 3W2OA 2CCHA 4NM3A 1V0BA 4RWKA 1K3WA 1SNXA 4LJAA 3TCPA 2W5BA 3ZUUA 3DK7A 4DBNA 5HNIX 2XSZD 1KOAA 4Q5EA 4R3CA 4UV0A 3ZMMA 4AF3A 3AMYA 5AAFA 2FO0A 4R3PA 4AS0A 5EHOA 5L2SA 3KREA 2W1GA 2QSFX 3EFJA 4IM3A 3RHKA 3WZDA 3LXLA 3R9XB 3FZPA 3GLIA 3MMPA 2R3GA 3BIZA 2YHVA 4BDKA 1Q3DA 4RPVA 2FUMA 4C61A 3FZ1A 1PMNA 3FLSA 2WMAA 4FKSA 4IBMA 4D9UA 1ZYDA 2VTTA 3FWQA 4X2KA 3DNEA 4ZAUA 4ZY4A 2ZB0A 4QPSA 1QPJA 4DV7M 4FICA 5CLPA 4Q5HA 1R0PA 3LFSA 3JUHA 5HO7A 2XK7A 3O23A 4YBJA 3EMGA 1Z5BA 2WTVA 2YIRA 4FT3A 4XNEA 2UZDA 1XXHE 3FMHA 4FKGA 1OKVA 3P9JA 3FE3A 4GVJA 4EBVA 3LQQA 3BI6A 4I81A 2H8HA 5EKNA 5K4JA 5L6OA 1EFUB 2B9JA 3JPVA 2R64A 5ACKA 2PTKA 1OVEA 5IQHA 1FINA 4FZ6A 3VUTA 4CTBA 2YA9A 3UQGA 2NNWB 2DNAA 5IREB 4NFMA 1BX6A 2YM8A 3ZO2A 1JSTA 2R3QA 4LJ7A 5E8ZA 4X3JA 5AUTA 2GNLA 5FTJA 2FSMX 4M9XA 3SMSA 1H27A 4QTBA 2GSFA 3UDBA 4R7HA 3OY1A 4DYMA 3Q9ZA 4D2TA 5LCJA 4DEBA 3PE2A 2FS1A 4W4VA 2VWYA 2OQ4A 3R28A 1PMEA 4WUNA 3RPRA 2F57A 3GB2A 1W98A 5B2LA 3VONA 3DJ5A 2X7OA 4V0GB 1ZMWA 2G9XA 3M6AA 4F6SA 1OBGA 1F0QA 3TZ7A 2IZRA 2Z8CA 3D7ZA 3LFFA 3QAME 3L8SA 1LV7A 5LXMA 4F9CA 4MBJA 4FSMA 1XBAA 2RGPA 5JFXA 3SHFA 2J50A 3Q6UA 3UP7A 3VDPA 1PJKA 3FMNA 3VUMA 4RIYA 5LVOA 3F92A 2ZM1A 5J1WA 3EJ1A 4FTUA 5K0KA 4PDYA 3AQVA 4H36A 5CSPA 5DIAA 4AW5A 3B8QA 4DG3E 3E7OA 4UMRA 4O38A 2KRUA 4I41A 3GLHB 4GMYA 1UU8A 3KMUA 5AWMA 4MYGA 2Q83A 2QLQA 5CEPA 4DBGB 5H2UA 2K9DA 5CSWA 3FHRA 2K0BX 5J95A 3NPCA 1KSFX 2UW3A 4WNKA 3I81A 4YTHA 3SLSA 5AUZA 5IA1A 3KSJA 2F2CB 2BRGA 3HHYA 5EDPA 4EJ7A 3JY9A 4EHGA 4RIWB 4FTNA 5E8VA 4O0XA 3TTIA 2P55A 4NC6A 2JKMA 2R3IA 4PL4A 3NW7A 3VUHA 1I94M 3FEGA 3K2LA 3QD3A 5HVJA 4JBVA 4I6HA 4JRNA 4YJRA 5BR8M 2HY0A 2ITWA 3R7IA 2XIYA 2R44A 3DKCA 4G9RA 5EK7A 4RZVA 2Y4IC 4AN3A 3ZZEA 4GIPA 1QYRA 4DV6M 4GSBA 4KSPA 3UMMA 4XUFA 4I5MA 4DLIA 3W55A 1WBVA 3HA8A 2BJWA 5M4FA 1UFZA 3C9PA 3AMBA 4OTPA 3R8FA 4I8OA 3U6IA 4YURA 4QNAA 4A07A 4FTKA 3TUBA 3Q5IA 5K0XA 1JKSA 3BV2A 1V0PA 4DEGA 5DT4A 3BLAA 1N77A 3DZDA 3LJ0A 5DE2A 2EJSA 3IW5A 4UY9A 4BZDA 4EC9A 3PA5A 4HGTA 1QZEA 4ZMEA 3KU2A 4C3RA 3F3WA 3KW6A 2J0IA 1YOJA 4KABA 2K6BA 4I5CA 5HTBA 2HOGA 4F4PA 3UZRA 2VX1A 3FUVA 2XLJA 2QI8A 2XF0A 2VWZA 2HENA 3AGMA 4GK3A 3DFCB 3OVVA 4NM5A 3UYSA 2XCKA 3GLGA 4BF2A 4BBMA 2R3JA 3ID6C 4ZIMA 3R7YA 2GNOA 1CSNA 3MTLA 4TWNA 3RP9A 1DAYA 4M8TA 2J7TA 3SW4A 3HRFA 3PJ3A 4DH1A 3V5JA 3PFYA 4FA2A 1IN6A 2XNBA 3R00A 5CU6A 4CT1A 2R6FA 3MS9A 3VS0A 3JR4A 2BTSA 4IH8A 4IJ9A 4AG8A 3KCFA 4FSRA 3VFDA 3U9CA 1GKIA 3UG1A 4ERWA 1PF8A 2HZ4A 2PVFA 3DAJA 1XO2B 3OCBA 4P5QA 1VR2A 3PZHA 3QGYA 1XB2B 4FWGA 4LOOA 2L4FA 4IBJA 3E3BX 4FNZA 5GIOE 3PNVA 3HU2A 3U6CA 2W1HA 4RF0A 4YHFA 2I40A 4J98A 3VBXA 4AT5A 2J7OA 4TYGA 2ITVA 3R02A 4W4YA 2C0OA 4EOMA 4P5ZA 5L2TA 3CPCA 1ND4A 4QYHA 3TWKA 3PRFA 3GRUA 5FDPA 3OCSA 1IBLM 2RSVA 4KS7A 1J7UA 4BB9A 2VWVA 3D14A 3I5NA 3WF9A 1OIUA 5CANA 2HHHM 3UZPA 1HQCA 2GFCA 2HW6A 2F5SA 3GC8A 2W1ZA 3TUDA 5C26A