3K2LA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
410
structure length
402
Chain Sequence
b'VDLGTENLYFMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPQKLLDASKRAKNFVSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Structures of Down Syndrome Kinases, DYRKs, Reveal Mechanisms of Kinase Activation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 402
sequence length 410
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k2lA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k2lA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k2lA02
3UPXA 4FV9A 1R1WA 2J6MA 3E8EA 5GJGA 4O22A 5FBOA 5LCKA 2G2IA 3QA8A 5AR8A 2E9NA 2G2FA 3E8CA 2UW8A 4I94A 4KAOA 4IW0A 3QYZA 3IK3A 2WEIA 4JQ8A 2B9FA 3VBVA 4ERKA 3R1YA 1FMOE 4U44A 2WGJA 3NUNA 4EH4A 1LEZA 5C1QB 2JKMA 4XG3A 3RPOA 4B4LA 4IMYA 3EIDA 4BB4A 3BU3A 4EJNA 5HX8A 4ACMA 3MFSA 4G6LA 3NNVA 4LV5A 3F7ZA 4FYNA 4K2RA 4MD8E 3C0GA 3MH0A 3P7AA 4NT4A 3PPZA 1Y8YA 4P4CA 4S32A 3F3TA 5FBNC 5BX0A 3FMLA 3QX4A 2YLEA 4FX3A 1LEWA 1UU9A 2C5OA 4NK9A 1IA8A 2ZOQA 5CF6A 3FDNA 5AV1A 5DRBA 5M4FA 5EYMA 3HECA 3O8UA 4G6OA 4KKGA 3U4WA 2JAMA 4DITA 5HZNA 3KREA 3KXXA 4FV1A 2GQRA 3IECA 4BIEA 3UMXA 3WF5A 3ZO3A 3BHTA 2V5QA 3CEKA 4BWPA 1O9UA 4OLIA 4UB7A 3VVHA 2FO0A 3R21A 2REIA 4F0GA 3C50A 3KF7A 5K9IA 2C68A 4L7FA 2QKWB 3DAKA 4IX4A 2R3IA 4U81A 3N9XA 4CYJA 5HBJA 3PVWA 4DBXA 4ZTQA 5EK7A 4AA0A 1WBVA 2RF9A 5A6NA 4PTGA 3MY5A 4FIGA 5L6OA 3UVPA 2ZDTA 5HNIX 3BGQA 3CXWA 4ZTSA 4D9UA 3MVHA 1MUOA 5E92A 2PZ5A 2Z7SA 5GJFA 2J0MB 4EOMA 1QMZA 3N4VA 4MCVA 3A7IA 2KTYA 4O84A 3QXOA 3KB7A 4JBQA 2CN5A 4B8MA 2XJ1A 3EZVA 3COKA 1PXIA 5HLPA 5AV3A 3QQHA 4E1ZA 1TQPA 3QKKA 3ZFYA 5CEOA 2X8IA 4JX7A 2VTRA 3W55A 3KMWA 2XNGA 4FSQA 1YW2A 3VBXA 4UXLA 4EK5A 4UMUA 5HLNA 3TDWA 2WTDA 3A62A 4CEGA 4AOTA 2UZLA 4MXCA 5L2SA 4LRMA 5AAGA 2JFMA 1PXOA 4IC7A 4EK8A 2F2CB 4IVBA 2GTNA 4FTTA 3R7YA 4C33A 4D1SA 4F08A 5CALA 4JR7A 2SRCA 1U4DA 1VJYA 1QPJA 1PXLA 3L9PA 4F4PA 3GOKA 4X6QC 3WZJA 2WU6A 3VHKA 3HVCA 5AADA 4M84A 2OFUA 3FMJA 2Z7QA 3QQUA 4CKIA 3TNPC 1Y8GA 3DBQA 5AFVA 2JDRA 3GU5A 4WBOA 2W4JA 3CPCA 4RJ4A 2QHMA 5K5NA 4F1MA 1YHVA 5JH6A 1CM8A 5CSXA 5M44A 1TVOA 4OTGA 4RIOA 3BE9A 3R28A 5CVHA 3NS9A 1R39A 4RVTA 2QVSE 4NCTC 4USDA 5AM6A 4M66A 4ITJA 4PNKA 3TV7A 5IEYA 1OM1A 4BC6A 3EWHA 3W32A 3BHYA 5BVFA 2R3RA 5L2TA 2ERZE 3MPAA 4EOIA 2YCSA 3DK6A 4QP8A 4U9AA 3BCEA 2YITA 4I93A 1ZWSA 2NP8A 2C0IA 5EQEA 2CSNA 1A48A 4EK3A 1CTPE 3HMNA 4QYHA 3Q2JA 4MD7E 1BL6A 3P1AA 1V0PA 3KCFA 4D4VA 4A4OA 5KMIA 4GU6A 4FTJA 4YJPA 2HZ4A 2A27A 3ZSGA 3ZBXA 1OECA 3LXNA 5JGAA 4U97A 1ZYJA 4HVIA 1W83A 4E8AA 2X81A 5LVPA 2YCRA 4RIWB 3QKMA 1SNXA 2Z60A 3RM6A 3A4OX 3O17A 3HUBA 4RJ8A 3TTJA 4BHNA 3C4FA 2BRMA 1H1WA 3ORXA 4I6BA 3Q9WA 4E5AX 5C9CA 2UZDA 1UKHA 4M0ZA 4RQVA 4FKJA 1ZMUA 4DEEA 5KHWA 4CGAA 2VU3A 2XIXA 5C26A 1WVWA 4KIKA 5CZHA 4RFMA 3P5KA 5GIPE 3PUPA 2VWYA 3G6HA 4OBOA 4GKIA 1BYGA 4JG6A 4WUNA 5H2UA 4O82A 4FTRA 4EOJA 3D7TA 3FMEA 4MTAA 4O86A 4KRCA 3EN6A 3KK9A 1ZRZA 4O0VA 5J79A 3BHHA 4BR3A 5GZ8A 3PVBA 5EW9A 4JI9A 5I9XA 2DWBA 3IDPA 1ZZLA 4XLIA 1OIUA 2EXMA 2HAKA 4ACCA 4EWQA 2UVYA 1VYZA 2YABA 4FSTA 1GJOA 4DGOA 4DYMA 3QLGA 1SMHA 3KFAA 5EDPA 4QMQA 2X4FA 2OJ9A 3JVSA 4YP8A 5M4CA 4YJNA 4AE6A 5EHLA 4C58A 3BYOA 1Z5MA 4BIDA 1H07A 3QTQA 3CPBA 2RG5A 3WZKA 3MB7A 2QNJA 4XS2A 4D2RA 2XNOA 4BWKA 4O2PA 5EYDA 4C4JA 3F3ZA 5IQBA 1OBGA 1PXJA 3B2WA 3BU6A 4XG8A 4L46A 2F2UA 3ZEPA 5ANDA 2X0GA 5I9ZA 4F0FA 2YDJA 5LMAA 2BRGA 4NSTA 3SXFA 3PJ8A 5TF9A 1FVTA 2OJIA 3O0GA 4GFGA 2ERKA 4QMOA 2CMWA 4RJ5A 4KIQA 5HX6A 4XRLA 2ETMA 2BAQA 4OTQA 4LM5A 2PWLA 3EYHA 3UC3A 4N6ZA 5D7VA 3C4XA 4YPSA 4M14A 4EORA 1LUFA 4ZSAA 1R0PA 3DFAA 4U0IA 3IW7A 4FI1A 4BICA 3COIA 1UKIA 3COMA 4ZY5A 5EYCA 1YI4A 3LFCA 2QOKA 4IAIA 4IACA 4NFMA 4F7NA 3JVRA 2PVMA 5CF8A 3LQ3A 3R6XA 2I0VA 4KA3A 5DNRA 5FP5A 3R9DA 4AZWA 5IF1A 2QOBA 1BLXA 3A2CA 4EH7A 5HU9A 3PLAE 4L44A 3CKWA 4GT3A 5LOHA 3KEXA 2GCDA 5B2KA 4Y83A 2W5AA 3OCSA 4PPAA 4MNFA 1ZYDA 4S33A 5LARA 3QD4A 5DFPA 4F7JA 2FVDA 4NM5A 4TRLA 4NZWB 1ZY4A 3F7WA 1P4FA 3K5VA 1OIYA 5CX9A 4CFNA 4IX6A 3DKOA 2CGXA 4F09A 5CF5A 4H36A 1H27A 3C13A 5ACBC 1UNLA 5KX8A 2OK1A 3BLQA 4EHVA 3EQPA 3VBTA 1J1CA 3VBWA 2J7TA 4F63A 3H9FA 1S9IA 2W1HA 3KA0A 3Q9ZA 4MXAA 4K11A 1HCKA 5GJDA 4EYJA 1BI7A 2O8YA 5HO7A 5H8GA 2FB8A 4CG9A 3WZDA 2IO6A 2PUIA 4RX7A 2VN9A 2BR1A 4IZ7A 3U55A 2BFXA 3C4WA 3FJQE 4I5CA 4YSMA 4FL2A 4F1TA 4E6DA 3ULIA 5B2LA 3SG9A 3ZC5A 5C8NA 4O83A 3UG1A 1M52A 4H39A 2PULA 2H8HA 2QOQA 2W1CA 3DK3A 3JY9A 2WQEA 4FVRA 5CS6A 2PVKA 4CXAA 5AIKA 4K8AA 1KSWA 4M15A 2G15A 2ONLC 5BQ0A 4LOPA 4YJVA 2VWBA 3QRUA 3QCQA 3CKXA 4RBLA 3W2SA 4W8EA 2CNUA 2PVYA 4XV9A 4PP7A 4GEOA 3OCBA 4M67A 4WNOA 3BHUA 4B99A 5A4EA 2V22A 3O7LD 3QQFA 2FSLX 4ZJIA 3UOKA 2G2HA 3RPSA 3C51A 1ZOHA 3S95A 3LCTA 1KE7A 4I5HA 1OGUA 2XK3A 3MYGA 4UWCA 4J95A 5HIDA 2VX0A 3QL8A 4EZ7A 3DAJA 1V0OA 4RWLA 2BZJA 1PY5A 2CJMA 3MY1A 3PTGA 1XH4A 2RFSA 3H30A 4G16A 4NJ3A 4KBKA 4MQ1A 4UXQA 3F2NA 5H3QA 4XG6A 3V6SA 4AA4A 4IZYA 4CT1A 3VNTA 3RNYA 4AS0A 3GGFA 4O0YA 5EI2A 4PL5A 3QYWA 1CKPA 3BV2A 2CGVA 5CYIA 4XOYA 2IN6A 4GFOA 3R9OA 5GIOE 4GYIA 4CLIA 4JG8A 4ZTHA 2WMSA 3TEIA 3NUUA 4RC3A 2OG8A 3VULA 3VS6A 4O81A 3HDNA 4DH3A 4QMMA 3GT8A 2IG7A 3MA3A 4U42A 3JY0A 4MVFA 4RA5A 3SA0A 5LVNA 4X7QA 2JEDA 4HGEA 4RFZA 4R3RA 3LKMA 2HW7A 3UYSA 2JKKA 4HGLA 3Q32A 5IKWA 5FG8A 3PA4A 3HP2A 3V8TA 2DUVA 3FKLA 3OY3A 3IW5A 1Z9XA 2XEYA 3FLQA 3TNHA 3E93A 3LCKA 3FXXA 5DR9A 3A7HA 4M69B 1ZOGA 4QPMA 4OTHA 3NYOA 3DBDA 4XBRA 4ALWA 3QFVA 4DFYA 3ORKA 3UBDA 3MPMA 4S31A 3HRCA 1XBBA 3HDMA 3PVUA 3VC4A 3R01A 4O7RA 1BUHA 5EW8A 3LMHA 1R0EA 4D4SA 3KVWA 4YJSA 3AC5A 2GHMA 3RP9A 4BCIA 1YDTE 5GINE 4YJTA 3DS6A 4CNHA 5JFVA 4G3DA 4NIFB 4L53A 5AP6A 3TT0A 5CLPA 5DN3A 2XM9A 4BCGA 3FL5A 3TKUA 1A06A 2PMLX 4TT7A 5HVYA 4G1WA 5H9BA 2XF0A 3KY2A 3OXZA 2J5FA 4MBIA 4UMPA 1PXNA 3F5PA 4O7VA 3THBA 3PP0A 3C4CA 3QUDA 2YFXA 2NRUA 3KRRA 1Q8UA 3WE4A 4Q9ZA 2E9UA 4Q9SA 3BYMA 5IA4A 4RQKA 2BZKB 3ACKA 3AT3A 3UOLA 4BGQA 1X8BA 3KXNA 2P55A 3K54A 4FKRA 5FEEA 3PXRA 3W2QA 3F6XA 4UMTA 4XG2A 3KXHA 2R3OA 3RK9A 5HVKA 4G31A 4WG3A 3FZSA 3VS1A 4TYHB 5DWRA 3BBTB 5EW3A 2LAVA 3CGFA 4IZAA 4XLVA 3U9NA 4EI4A 5IQHA 3OWLA 3HGKA 4MEDA 2ZM3A 2JDVA 5AR7A 5JFXA 3ZOSA 4F99A 3DKCA 3F66A 2Z8CA 1IASA 2DYLA 5K0KA 5T3QA 3AGLA 1FQ1B 4JL9A 4GH2A 5FTOA 4BKJA 3UVQA 2HY0A 2YJSA 5JQ8A 2ACXA 3GOPA 3GU7A 4MNEB 5E8SA 2W1GA 1T45A 5A46A 1GY3A 3ATSA 3TZ9A 4CCUA 4D0XA 2ZYBA 4HNFA 3UG2A 3PRFA 4EONA 3HV3A 3QCXA 4Z9LA 4N6YA 4OAUC 2IZTA 3ENMA 4O21A 3OCTA 5H8EA 3TL8A 4ANOA 3ACJA 3E87A 4G9RA 4C59A 2XIZA 4BZNA 2VTIA 5BYYA 4EH2A 3QQKA 4NEUA 2FSMX 2BKKA 2WTKC 4U3ZA 3AXWA 5C27A 4QTEA 4V05A 1VR2A 4R7IA 2X2LA 4J8NA 3ANRA 3RI1A 1SVHA 3ZS5A 2XUUA 3R30A 3IS5A 4C4IA 4AX8A 4DEDA 4EOOA 4I6HA 5AR5A 2OW3A 4M3QA 3FUPA 1KOAA 4QT1A 4MXOA 4BDAA 4E6QA 2XNMA 3N4TA 4IVCA 4M8TA 5LCJA 4L43A 3QQJA 4CFUA 4WO5A 5GZ9A 4IE9A 4IM3A 2X7OA 1FGIA 4GCJA 3UIMA 4AW2A 4RIWA 3TJCA 2XKDA 4UYAA 3DKGA 2JC6A 3QF9A 4D1ZA 1B6CB 4IJPA 2J9MA 2PZRA 3FY0A 4JLCA 3VUIA 4YZ9A 5LWNA 5JRQA 3ZM9A 3CIKA 4G34A 3MJ2A 2X2KA 3R22A 3QQLA 4AXAA 1FMKA 4QMYA 3HUCA 4BGGA 5M51A 4DG0E 4FV8A 2YHVA 4BCKA 2YDIA 4Y72A 5EG3A 1L8TA 4V01A 2JDOA 4Z7GA 2KULA 4IAZA 4P5ZA 5D10A 4BIBA 3VBYA 4TZRA 1J7UA 3L8VA 4M97A 4GG5A 4K9YA 4BRXA 1H4LA 5KZ0A 4K1BA 4BCHA 4JBOA 2W0JA 1E1XA 1Y91A 3AQVA 3L8SA 3Q6UA 5HE1A 4RX5A 3CC6A 2PMOX 3D15A 3D2KA 5B7VA 4L7SA 2WPAA 3U87A 1KE6A 1OL1A 3FMMA 5I4NA 3I81A 3WOWA 3C0IA 1WAKA 2AYPA 2XK9A 2C6OA 2ZJWA 4JOAA 4O38A 1YOMA 5HEZA 3NNUA 3TCPA 3V5PA 2ZV8A 2R7BA 4FG9A 5TOZA 3DB8A 4YZDA 2WU7A 2X9EA 5LQFA 3QWJA 5DT3A 1YWVA 1UVRA 2QO2A 5FTGA 2XYUA 3ZBFA 2PVFA 5B2MA 1W84A 3EQGA 4JAIA 5A54A 5IH6A 1ZLTA 2WZJA 2C3IB 3EL7A 4ALUA 5M53A 2VTNA 4YTFA 4RA4A 4I0SA 4FNYA 3UODA 4OAVB 5I9YA 3BI6A 3GC7A 2J2IB 4GYGA 4G9CA 4DCAA 3NUXA 1JOWB 4FK6A 4FV3A 4HYSA 3HA8A 3WYYA 5JK3A 5IQCA 3QCYA 5IA1A 1DM2A 1TQIA 1IG1A 4XMOA 4E4XA 4U3YA 4LGHA 2UZWE 3HMMA 3V3VA 3G51A 4TNBA 4PP9A 5AP7A 3NUAA 3HMIA 3QRJA 5AV4A 4I22A 4RVKA 5TR6A 4C61A 2G9XA 3H9RA 3O50A 4BDHA 3POOA 3R7EA 1WCCA 3AT2A 4MKCA 4KIOA 4CMUA 4B9DA 4KB8A 3ZRMA 4DH8A 4QMZA 1NW1A 4KS7A 3DXQA 4R8QA 3PXYA 2OIDA 4H3PA 4D5HA 2C6TA 3NWWA 3I79A 1YDRE 4WG5A 3UIBA 5LMKA 2OF2A 2V0DA 2XZSA 4F9WA 1YOLA 5AUUA 4GKHA 4AA5A 4JVGA 4U7ZA 2XRWA 3RALA 4YTIA 5EQPA 2PMNX 3TDVA 4ZMFA 1PW2A 4M13A 3GCVA 4FR4A 4X2FA 4XG4A 2UW6A 3Q9YA 4IFGA 3A7JA 4MXZA 2YLFA 3E62A 4ITIA 1LP4A 4DFLA 4NWMA 5CI7A 2QURA 4EQUA 5KBQA 3HLLA 2IVVA 3K2LA 1JNKA 2YM5A 3KU2A 5ETCA 3UP7A 4E3CA 5KMLA 3QTWA 2BTRA 3DPKA 3EYGA 2IW6A 4U40A 4KINA 4ANNA 4YMJA 4BCJA 4L3JA 5L4QA 1YRPA 3LAUA 3VS5A 4F70A 3ZUTA 3FZTA 4YO4A 1WBWA 3QTUA 3PJ3A 3MA6A 3D7ZA 3OEZA 2BILB 2QD9A 3FHRA 2XIKA 4JDHA 5ICPA 5IDPA 1PKGA 3W2CA 2ITPA 1REKA 1OL5A 4F1OA 2YAAA 1OL7A 4IVDA 4LOOA 4RWKA 4XHKB 3W18A 4HVDA 3S00A 1OL2A 2QI8A 4NTTA 4KUJA 3AC1A 2EWAA 3R0TA 5CT7A 4I21A 3RZFA 4RIXB 4J7BA 3VRYA 5F9EA 4QOXA 4IADA 4WSQA 2R3LA 3L1SA 2JDTA 4GUEA 5D9HA 3LFQA 4PDYA 4RWIA 3DZQA 1A9UA 3QQGA 3HAMA 2J5EA 4AW0A 2PYWA 2WQOA 3S2PA 5LJJA 4AT3A 3WBLA 2OSCA 3NYXA 5AR4A 3KKVA 3LFFA 4H3QA 2P2IA 3NZ0A 5CVGA 3LFBA 4RJ3A 4E4NA 5ITAA 2R64A 4ZY4A 3PJ1A 3S3IA 5IQFA 3NCZA 3O7LB 4ANLA 3OBJA 5HNGA 4EHGA 2OZAB 3PG1A 5CXZA 5EM7A 3U6HA 5CENA 4QNAA 5JZNA 3FXWA 2ITVA 5BUEA 4EOPA 3Q3BA 3GU6A 3R7GA 5AP5A 4BWXA 3CSVA 2W1EA 2W4OA 1IAJA 3V8WA 2Z7RA 3JUHA 3OEFX 3D2IA 4RPVA 3UOJA 4ZTLA 3H0ZA 3IW4A 4G17A 2VGPA 4IAAA 4AACA 4GVJA 5G6VA 4L8MA 4F7LA 2JGZA 2GS2A 4DA5A 5L8KA 2C3KA 1ZMWA 3ERKA 4ZOGA 4KBCA 3UNJA 4C4HA 4AGCA 2H9VA 1J1BA 1K2PA 3W2RA 2WTVA 4FZ7A 5TO8A 5FP6A 2XMYA 2HY81 2XP2A 2C30A 3DJ5A 4M69A 1WFCA 4FV6A 3FZPA 3G0FA 4BBMA 3ODYX 2IVUA 3DJ7A 3U9CA 3EQDA 4BDDA 4B0GA 5IEXA 5DYJA 4R5YA 2PVNA 3EFKA 2IZSA 3FLYA 4BCFA 2VX3A 3C1XA 1E1VA 2C5NA 1OKVA 3Q4CA 2Y8OA 3QCSA 2BZHB 2WTIA 4L6QA 1DS5A 1M2PA 3OTVA 4QMPA 3EMGA 4XG9A 1IEPA 4DH1A 4NIFA 4D2WA 1O6YA 4RX8A 4O6LA 4RIYB 3LW0A 4UY9A 5E1EA 5T68A 5H8BA 2WHBA 2YM3A 2YM4A 4U45A 5HE2A 3TWJA 3VF8A 3LLTA 2PSQA 1PF8A 4BDFA 4FF8A 1Q62A 4RMZA 3QLFA 1W8CA 3VUHA 3MY0A 2YZLA 4ANBA 3ZRKA 2QOOA 2DQ7X 3TV4A 4DGLC 3BPRA 3IQ7A 1WBPA 5E8ZA 4FYOA 5FXQA 4AFJA 2CNVA 1AD5A 2VD5A 1OPLA 4C2VA 4ORKA 2I7QA 1M14A 4FGRA 3OCGA 4E26A 4RVLA 4EL9A 2XIYA 2GHGA 1Q8ZA 3R2YA 4YTCA 2GPHA 2JBPA 4FBXA 4BCQA 3HNGA 3HX4A 3KMUA 2BRNA 2CGWA 4RX9A 4HPTE 2RL5A 4L9IA 5IISA 4FZDB 5FXSA 2RFEA 4HGTA 1GZNA 3FKNA 3OBGA 3HP5A 4TYHA 5DMZA 3TACA 2OICA 4FTNA 3IO7A 4XCUA 3GP0A 3CQUA 3DCVA 3DBCA 4F65A 3FQSA 5FXRA 4O7YA 5FWKK 5FDPA 4P5QA 3ULZA 4A4LA 3EQRA 3DBFA 3HV6A 2C0OA 4BDKA 4FTLA 4I6FA 4MNEA 4HGSA 3E63A 4XBUA 5FRIA 4XX9A 3JR1A 2O0UA 2J51A 2R3QA 5EH0A 3QWKA 4PDSA 1U5RA 4PV0A 3RWQA 2VTSA 4NM3A 4RJ7A 5JGDA 3PXQA 3IW8A 4LYNA 1W0XC 3WZEA 4DFNA 4BYJA 3I6WA 3RINA 3WIGA 2X2MA 3ITZA 3IKAA 3QTXA 4RC4A 2PZIA 4FSNA 4O7NA 5IA0A 3V8SA 2FSOX 4W4WA 3U6JA 5DR6A 3CY2A 2JAVA 2ITYA 5M06A 1GZ8A 5JEBA 3UC4A 3PA5A 4CD0A 4I1ZA 5M09A 5HVJA 4CG8A 5EFQA 1UA2A 3ZO4A 5IG1A 3U54A 5E8WA 2WMRA 1ZYSA 3QC9A 5FD2A 3VUGA 3L8XA 4L68A 3NR9A 2Y4IC 2J0JA 5DOSA 5KMNA 3LVPA 1JSVA 2WQBA 3ZUUA 3SRVB 2YEXA 3MBLA 3QC4A 3WYXA 3VS2A 4YC6A 5LXMA 3B2TA 4N4SA 3F2RA 3IW6A 4AN9A 3O8TA 2W1DA 4WNPA 1Y6BA 4BDBA 1R3CA 2I6LA 4FTIA 2ZM1A 3FKOA 4DGGA 3RAIA 4FNXA 3PDTA 3CD8A 4QMVA 4X2JA 2PZYA 3NIEA 4F6WA 2OLCA 3ROCA 1OKYA 2J0LA 4BN1A 3BWFA 3PRIA 3TZ7A 2R3PA 2ETKA 4ZZNA 3Q6WA 3CGOA 3TKHA 2RG6A 2IWIA 2JDSA 3CP9A 4O6EA 5G1XA 4WT6A 5C4KA 3WI6A 4JAJA 3UQGA 2WTCA 4FICA 5HTBA 3I0QA 3MDYA 3TTIA 2X6EA 3SW4A 3QTRA 5TT7A 2QU5A 1SNUA 3DB6A 5GHVA 2PUNA 3GCSA 1NXKA 2FH9A 4FKVA 4II5A 4NM7A 4YHFA 3DLZA 2XH5A 5FM2A 1H1QA 1G3NA 2QLUA 5F95A 1YHSA 3A7FA 5CSPA 2OWBA 2CCHA 1M2RA 2YDKA 4PL3A 1OI9A 4IDVA 4DTKA 2WMTA 2PUPA 4E73A 3E3PA 2BDJA 5CU4A 2ZVAA 5DVRA 3I7BA 3S0OA 2OXYA 2O2UA 3W8QA 5IH4A 3BE2A 5IQDA 3AMAA 1KOBA 5KMKA 3BHVA 2X7FA 4GVAA 3U8WA 3TUDA 3FWQA 4H1JA 4JBPA 3RJCA 5BPYA 4AT4A 4XOZA 3R8VA 2C5XA 2UVXA 3P4KA 4NL0A 4W4XA 5LMKC 4IM0A 4XJ0A 4C36A 5DPVA 3MS9A 4I0RA 3ZEWA 1XQZA 3LJ2A 3R8PA 5CSVA 2BHHA 4FG7A 4L67A 4QMWA 4YTHA 3U51A 3KXMA 4DEBA 5BVDA 1WBSA 5GZAA 4FEVA 1URWA 3AD6A 2WQMA 5HG7A 4DHFA 3H0YA 1VZOA 2WIHA 4J52A 5ANGA 3F3WA 1JSUA 3M1SA 3P0MA 5HLWA 2UW5A 4USEA 3HV7A 4H58A 1PKDA 2FUMA 3PE1A 2BPMA 4QYFA 5CU3A 2C3LA 4FKWA 5EM6A 4FIIA 2QOHA 3I60A 2ZB1A 4AAAA 3ZLYA 5BMMA 1WBOA 4AW1A 5ANJA 3TJDA 3HZTA 2YA9A 1RQQA 1SM2A 2I0HA 3A60A 4ONAA 2HXLA 3EN9A 4YUQA 4FV7A 4IB0A 4BFMA 3UZTA 4FV5A 4BI1A 2WMQA 3NYNA 4F9YA 3CBLA 3OROA 4TY1A 2OF4A 5HNBA 4D2TA 3G9NA 3OWKA 3GXLA 2VWUA 3OVVA 5ANKA 5F4NA 3VS3A 1JKLA 1XH6A 3OWJA 4FOCA 3ALNA 4R5SA 5DR2A 2OIQA 2QG7A 5FQDC 2VTPA 3EN7A 2P3GX 1R78A 1BI8A 3SVVA 1ZYLA 4KWPA 4NFNA 5EI8A 3O51A 2G01A 2OXDA 2C1BA 4DN5A 2O64A 4O7LA 5KMJA 3G90X 3IONA 2ZMDA 4I23A 4MXXA 5HQ0A 3PSCA 2C6MA 2QONA 1GZOA 3S4QA 3ETAA 2C6IA 2GQGA 5AP4A 1F3MC 4O7WA 3ZUVA 5JFSA 3VW8A 5AP3A 3MJ1A 1XKKA 1YI6A 2R9SA 3MIAA 3QAME 4FG8A 4FSYA 4DGMA 3E8NA 2W1ZA 4F9BA 3VBQA 2WTJA 4ITHA 3ZSHA 3F5GA 4GU9A 3E92A 3DNEA 1XHAA 3IGOA 3EKKA 3O23A 5EOBA 2G1TA 4OTPA 2EU9A 5ETAA 1Y57A 2W17A 2HWOA 3E3BX 3PXFA 2XVDA 4Q5EA 2XEZA 3JS2A 2F57A 3BGZA 2NO3A 4RIXA 2X8DA 2O3PA 1P4OA 4IB3A 2WKMA 1CDKA 5HICA 3UIXA 2BMCA 2C47A 3V04A 2JITA 2B54A 3QZHA 1KE5A 5KKRB 3UZPA 2Y0AA 1B39A 4IEBA 4CSVA 2XNBA 3CE3A 3W16A 2WQNA 4U41A 3SXSA 4AZTA 3NAXA 2BAKA 2GFCA 4UALA 3QA0A 2CKPA 5CAUA 2BZIB 2X6DA 2GTMA 4QD6A 4TXCA 3SX9A 5CEPA 4KKEA 5ANEA 3GU8A 2PVRA 4JDJA 4I5PA 2W06A 4FIJA 3CTHA 3W33A 3TUBA 4QQCA 4FK3A 5J9LA 2ITQA 2QOIA 2OZAA 4H1MA 4LUDA 4A06A 1QL6A 1MQ4A 3CTQA 2E9VA 2VX1A 3GUBA 2PK9A 3OF0A 1Z57A 4KIPA 1Q8YA 5JGBA 4J53A 3PWYA 3KF4A 3DV3A 4IANA 4PRJA 4CYIA 5KCVA 3FPQA 2UZTA 3KMMA 4EK6A 4BTKA 1DI9A 3CJFA 5D1JA 2XB7A 2OKRA 1OIRA 1Q24A 2WOUA 4GW8A 4J71A 4BDGA 4Q2AA 4MHAA 5J95A 4AG8A 5K5XA 2R4BA 5AJQA 3BV3A 3N4UA 2RFNA 4FKUA 1S9JA 3QKLA 3TXOA 3P78A 3NCGA 4DFZE 3F9NA 3C5IA 3G33A 5AV2A 5IUHA 5E4HA 3FYJX 3R00A 2PVHA 1OITA 4B7TA 4OT5A 4FIEA 4XP3A 2C4GA 2VO0A 2GDOA 2P4IA 3MTLA 3NRMA 2R0IA 3RKBA 4A7CA 4QYGA 3RPVA 5I5ZA 5DT4A 4FKGA 4FEWA 4DT8A 4ZSEA 4Y95A 4FEXA 5ANOA 2QO9A 4YJUA 4E4MA 1RJBA 3OWPA 2WNTA 4OR5A 2JKOA 3C9WA 4QMTA 3TZMA 1H08A 2ZM4A 5CT0A 2VWXA 3TM0A 3VF9A 3ZU7A 3HMPA 3DDQA 2EUFB 3E7OA 2F4JA 5IZFA 4RIYA 3V5LA 4CV8A 4KBAA 4IVAA 4R77A 3F88A 1H1SA 4I24A 5HG9A 3RHKA 4FVQA 3FXZA 3JPVA 2ETRA 2W1IA 4EH8A 1I44A 2FYSA 1STCE 4QMSA 5KZIA 5B0XA 3F5UA 1GIIA 2IZUA 1UWHA 2XA4A 3DQWA 3SXRA 2CKOA 1RDQE 3BU5A 4W4YA 5CU2A 3OMVA 4BCMA 3MFUA 2VAGA 1O6LA 3Q4TA 3RTPA 2PL0A 2WMBA 3Q04A 3OFMA 4H3BA 3RCJA 3UQFA 1ZZ2A 3QD0A 3OY1A 3F3VA 4HVSA 3BEGA 3PZEA 3ZO1A 4KNBA 1SVGA 3Q9XA 5CWZA 5A3XA 3C4EA 3NIZA 3K3IA 5KUPA 4E5BA 3FZOA 4JRVA 3NLBA 4TPTA 5AUTA 5FTQA 3UP2A 4RLKA 4K6ZA 5CQWA 1IRKA 4E93A 3KGAA 4GS6A 5JKGA 4WD5A 1UWJA 3P7CA 4AZFA 4QP7A 3R9HA 2A1AB 5I3RA 3RM7A 1JAMA 4XUFA 4Y46A 3BIZA 1LPUA 4IBMA 4PNIA 5LVLA 4YR8A 3BEAA 1FPUA 3CQWA 3DBEA 3MB6A 3EHAA 4XP2A 4FEUA 5D7AA 5FEQA 4CQGA 2Z2WA 2OJJA 4P2KA 2HYYA 4IX5A 4LMNA 5K3YA 2WMAA 4AOJA 3SOAA 5IPJA 1KE9A 2C5VA 3GNIB 2YERA 1MRUA 3GI3A 3QD2B 3QUEA 5TE0A 5BVOA 4I4FA 3WE8A 2B55A 4AZEA 2HZNA 4N57A 4R1VA 2R3JA 1Q4LA 2IJMA 2PMIA 3POZA 4FKTA 4GIIA 1K3AA 5C4LA 2QQ7A 2CCIA 4JIKA 4X21A 5HBEA 2QR7A 4E20A 3F82A 2C6EA 3FV8A 3V5TA 2CNQA 3ORPA 3R8MA 4OBPA 4AT5A 3W2PA 4DLJA 4YURA 2IVTA 3ZO2A 5L8LA 3F61A 4HCTA 4FA2A 3R63A 3G0EA 4FT3A 5EDQA 4EHZA 1JKSA 3R02A 3MN3A 3R71A 4MWHA 4M7IA 4LFIA 4LUEA 1BMKA 1OKZA 3EN4A 5EDRA 4FT7A 4CZTA 3QHWA 2NNWB 4L01A 1DI8A 5IMXA 3ZM4A 2BIKB 2V7AA 3SRVA 4TNDA 4G3EA 5C03A 1WBNA 4F9AA 3LXKA 4WRSA 3OD6X 3LQ8A 2F9GA 3MV5A 4FIFA 1URCA 2Y7JA 1JLUE 4XYFA 4NJDA 5KMMA 4NKAA 2C69A 4HW7A 2VTOA 4PTCA 2XKCA 1NY3A 3M11A 4ASEA 3Q52A 4BCNA 2WXVA 3PY1A 4FVPA 4IAKA 4EYMA 2GNGA 4ZLZA 3D5VA 4LI5A 2W5HA 5CY3A 4BVUA 2F49A 2B1PA 4GK2A 2HELA 4AQCA 1Y6AA 4D4YA 3VIDA 2YZAA 1LR4A 4TTHB 4TKSA 4RRVA 1KV2A 4G5JA 2OJFE 3E7VA 4MBLA 3Q5IA 4FV2A 3BYVA 3LFAA 1QCFA 4RGJA 4X2GA 3G15A 2A19B 2JIUA 4FMQA 1NVQA 3ZH8A 2H34A 3WILA 3UO4A 3KRWA 4EKKA 4LQMA 2XBJA 5AUYA 3EQCA 4Y85A 3UDBA 4A9TA 4DAWA 5J5SA 2PE1A 2NRYA 2R3GA 2XBAA 2YIXA 2YM6A 5DHJA 5BVEA 2VRXA 2IW8A 3L9LA 5HU3A 1ATPE 4RC2A 4I5MA 3OP5A 4J99A 1AGWA 2XK8A 4JNWA 5EKOA 1J7IA 4XG7A 5CTPA 4ANSA 4ZTMA 3SHEA 1G8AA 2BKZA 4R3CA 4YNOA 3QHRA 4NCTA 5HIEA 4LL5A 3DFCB 4UYNA 2GS7A 4R7BA 4DFBA 3NMUF 2UW7A 4F7SA 1OKWA 3P7BA 2A2AA 4WHZA 5EQYA 1XH9A 2J4ZA 4E6AA 2GNFA 3M2WA 1U5QA 3ID6C 3SLSA 4WNKA 3LM0A 4QNYA 3BYSA 1XH7A 4C02A 4D2PA 2ZV2A 2XM8A 1XWSA 2J0KA 4GT4A 3FHIA 3FSFA 2Y6OA 4A9SA 4J96A 3TIYA 3HL7A 2W05A 2VWZA 4DEAA 4OTDA 3DT1A 2ESMA 5JRSA 2FA2A 4QMLA 3VHEA 4ANMA 4DBNA 4OW8A 3M42A 4QQTA 1KV1A 4CV9A 2XKFA 4DCEA 2BHEA 5AMNA 2BDWA 3R7OA 1Q97A 3W2OA 4F6SA 2YWVA 3BKBA 5CEIA 3CD3A 1E9HA 5J1VA 2QOCA 3QZGA 3ORMA 5I9UA 2BAJA 4J98A 4C2WA 3GEQA 1M17A 4WBBB 4DH5A 5M57A 2VGOA 3G2FA 4FOBA 3BLHA 2X1NA 4DGNA 4GRBA 3RK7A 3HKOA 5E8UA 5K4JA 4FKOA 2OGVA 4Y8DA 3DJ6A 4CRSA 4FEQA 1APME 3MH3A 4FTKA 5CVFA 3ZSIA 3OXIA 1B38A 2W96B 3FBVA 3F5XA 4OTFA 5CU0A 2ZDUA 2CKEA 4O2ZA 3IOKA 4EK4A 4FSWA 4WOVA 3D0EA 5HE0A 4C8BA 4DC2A 4EH5A 4QPAA 3DXPA 5IA5A 3RK5A 4C3FA 1XO2B 4I0TA 4XNEA 3MPTA 4FL1A 4JBVA 2HZ0A 2OH4A 3FLWA 4PDOA 5BYZA 2UZEA 3LM5A 4TWNA 4CFMA 1UV5A 4FIHA 2HZIA 4IC8A 3SQQA 4AFEA 1CMKE 3HMOA 4O1OA 4IB5A 3A8WA 5AA9A 2PHKA 4PL4A 5BVNA 2J50A 4FTMA 3OW3A 4RSSA 2VO3A 3HA6A 4HCVA 4HYHA 5HO6A 5CEQA 2NPQA 2UW9A 1OVEA 3MVMA 2PY3A 3KN6A 2EB3A 2X7GA 3AC3A 3IPHA 3RPYA 3AC4A 5E8TA 4B6LA 3OG7A 4O7SA 3WARA 3UZRA 3D5WA 3C4ZA 3FEGA 3V5QA 4BDIA 3AD5A 4YGAA 1EH4A 3ZZWA 2EVAA 1M7NA 2JIIA 3VN9A 4A9RA 3DGKA 2YM7A 4FKSA 4C4GA 3G6GA 4E4LA 3DTWA 5AP2A 4G2FA 1PMEA 4X3FB 2XKEA 4FKIA 3FQHA 4ZSLA 3LCOA 3I5ZA 1MRVA 4Y73A 4BGHA 4DF3A 5IQIA 3R83A 2CN8A 3P79A 3TNIA 4YJRA 3LHJA 3Q60A 4WUAA 4DEHA 4MWIA 3UQCA 2W99B 3VUKA 1ZOEA 4UN0C 3HRFA 5J9YA 3UOHA 4ASXA 1U59A 4YU2A 1J3HA 5BYLA 1YWNA 5J7HA 3DZOA 4O0WA 3LMGA 1IR3A 3KULB 4IM2A 3QRKA 5CAVA 1J7LA 4DEIA 3T8OA 2C0TA 2OIBA 3FMDA 4O0TA 2P2HA 4YNEA 5HBHA 4ZEGA 3PE2A 3WF7A 2W5BA 5EM5A 3HRBA 2YACA 4L3PA 2RIOA 4FZAB 4FC0A 1RW8A 4M0YA 4NTSA 4EZ3A 4K0YA 3UTOA 2R7IA 2ZMCA 4XV3A 5AR3A 3VW6A 5HHWA 1WMKA 4Z3VA 4QP6A 1V1KA 1F5QA 5HKMA 4PWNA 3PA3A 1DAWA 2CGUA 4K77A 2F7ZE 1WBTA 3Q5ZA 4L3LA 5FGKA 3CJGA 2QLQA 4A4XA 3PPJA 5C01A 2HXQA 2VTLA 4AZVA 3UNKA 2YCQA 2GMXA 3FYKX 4HYIA 5AIRA 4C34A 3I1AA 3Q4UA 3ZLSA 2GNIA 3U4UA 1SYKA 3SGCA 5IQEA 3IOPA 2ZB0A 3NW7A 1FVVA 5M55A 3VS7A 2UZNA 4CTBA 4G5PA 1H28A 4QTDA 1Q41A 4OTIA 5CSWA 2AC3A 1ZXEA 4EOSA 4RWJA 1W82A 5AM7A 1VEBA 3DQXA 4CCBA 4AOIA 3LE6A 3QD3A 2R3FA 4GIHA 3R9NA 3NGAA 3MH1A 4O91A 4CMOA 4JQEA 4MYGA 4MH7A 4LMUA 3UNZA 1MQBA 4OT6A 4QTCA 3GFWA 5DGZA 3TNWA 4ZZOA 4IAFA 2ONLA 4TYIA 5EYKA 1G8SA 4ZP5A 5DLSA 2XIRA 4PUZA 4Y5QA 4GJ2A 2QR8A 2YIWA 3VO3A 4KRDA 2BFYA 4JJRA 4JXFA 4GT5A 4YHJA 3FAAA 2R3NA 3RMFA 4V0GB 4UWYA 1UU7A 2UW4A 4NU1A 3SOCA 4CLJA 1P14A 2X4ZA 3OT3A 4ZLOA 4NYEA 2C6DA 3I0OA 5HD4A 1H01A 1GZKA 1ZY5A 3B8RA 3PZHA 3RPRA 3UPZA 3FI4A 4C35A 5A4QA 2VTTA 4E6CA 3EFLA 1XBCA 1MRYA 2GSFA 2VTJA 3IG7A 3R8UA 1L3RE 5CAPA 4W8DA 4IIRA 1W98A 4LL0A 4FNWA 5HORA 5IH5A 2FSTX 2J0IA 2JIVA 5HG5A 4Q5HA 3LPBA 3WZUA 5EM8A 4ASDA 2OJGA 3DAEA 2ZV9A 2VWWA 5KMOA 3EFJA 3II5A 1TQMA 1XBAA 3ODZX 3JYAA 2F7XE 2OZOA 3GU4A 1FVRA 2OI4X 3AT4A 3LFNA 4S30A 4X0MA 4AN3A 3HAVA 3QZFA 3VJNA 2Z02A 3F2AA 4DTBA 5M4UA 3G9LX 5I3OA 4ZY6A 3ZCLA 3LJ1A 4AW5A 1IAHA 3U6IA 4TWOA 4U6RA 4O0XA 1TKIA 2CDZA 3D14A 4MD9E 4AF3A 2ITUA 1XH8A 3FSKA 2UVZA 1GAGA 4ZXTA 1GNGA 3RHXA 4D1XA 5CXHA 4UMRA 5E8YA 3W10A 5JN2A 4G3GA 3MVLA 1CKJA 2GS6A 2BVAA 2YIYA 5BMSA 1YI3A 4Y5HA 2E9PA 5C8MA 4ID7A 2RKUA 1Q3WA 3CS9A 3EFWA 4HZSA 3QRTA 3EKNA 1BX6A 4CKRA 3FL4A 4NKSA 4I4EA 2OU7A 3PIZA 4DG3E 2HENA 4WNMA 5DEYA 2R0UA 1OPKA 3AC8A 4RFYA 3D5XA 2IVSA 4ANQA 4APPA 5JZJA 2OBJA 4UWBA 5L6PA 3TV6A 4BKYA 4N70A 1IA9A 3LCSA 3E88A 2CLXA 3UVRA 1FGKA 4DINA 4RZVA 1PHKA 4FE2A 1Q8TA 1ZYCA 4U8ZA 5CU6A 3RBWA 1PMVA 2J90A 5JT2A 2WAJA 3MFRA 1PMNA 2WFYA 3AG9A 4LOQA 4MAOA 1H00A 3EQFA 2DS1A 4BI0A 4QMUA 2EB2A 4FSUA 4FKLA 2BUJA 2X39A 2R5TA 2WIPA 4NH1A 4C38A 4L42A 4YPDA 3I5NA 3S1HA 4HZRA 4NM0A 4ARKA 2GNLA 3P86A 1YXTA 4FGBA 3DU8A 4IXPA 5E90A 4ZJJA 1FBNA 5AX9A 2UV2A 4CMTA 1JQHA 4ACGA 5L8JA 4PMPA 3BLRA 3LIJA 5E91A 3TKIA 4ZTRA 4BZDA 3NX8A 4YLJA 4AUAA 2OFVA 2XRUA 5J5TA 1J91A 4O0RA 4ZIMA 3FLSA 4YJQA 3DLSA 4F6UA 2VZ6A 4IB1A 2A4LA 1OL6A 3V5WA 4CFWA 4XV2A 4ENYA 3FE3A 4D58A 3R04A 5DBXA 2B4SB 4CTCA 2P33A 1KWPA 4TL0A 4MK0A 4WG4A 3AD4A 3DK7A 4NW5A 4YO6A 5EHOA 3FLZA 2Q0BA 3FMHA 5HD7A 4J8MA 2JFLA 2HIWA 2AC5A 3FZ1A 4LRKA 2JBOA 4R78A 1UU3A 4YZCA 3ZLWA 5HOAA 4MF1A 2I0YA 4ALVA 2VTQA 5ANIA 2PZPA 3ZZEA 4HCUA 4MF0A 4JR3A 3JXWA 3PY0A 4YC8A 4F0IA 3ATTA 4FV4A 1H1RA 2OO8X 2RSVA 4S2ZA 4C0TA 3UO5A 5IQGA 3BRBA 4AE9A 3QTIA 3R8LA 3OUKA 2X8EA 4YC3A 1H1PA 3AMBA 4LRJA 4YLLA 1M2QA 1JBPE 2XJ2A 1U54B 4D2SA 2HK5A 3PXZA 1UNGA 2RFDA 5CNOA 4G3FA 3G5DA 4GV1A 3VRZA 1QPCA 3VUMA 4MX9A 4IWDA 5F20A 5CQUA 1YWRA 3NDMA 3PPKA 2Y9QA 4EC9A 4ZSGA 5F94A 3O96A 1WVXA 3VQHA 3QXPA 5HE3A 4ZS0A 1NA7A 2W9ZB 3RAWA 3WF6A 4W9WA 5M4IA 5J1WA 3VQUA 3ZFXA 2Y4IB 3UJGA 3V51A 2WMUA 4C7TA 4U79A 3W8LA 3NVKI 4C57A 2C1AA 4TYJA 3HV4A 2QU6A 2AUHA 2ITTA 3ZHPC 2V62A 2VTMA 3R8ZA 4I41A 3H9OA 2BRHA 4OTWA 4BTJA 4USFA 5E8XA 2QG5A 1JPAA 3GCQA 4XRJA 2WMWA 3CR0A 3R7UA 2O65A 3GENA 4UX9A 4F9CA 3KK8A 3ZTXA 4ENXA 1Q8WA 3MWUA 5AAEA 4X6RA 5IUGA 4O1PA 2W4KA 1KE8A 1REJA 1YXSA 3IDCA 4QTBA 3T9IA 5IA2A 4BTMA 2QODA 5EKNA 2UZOA 4PPBA 3BQCA 2IZRA 5F1ZA 4LV8A 4AGDA 3QBNA 2CKQA 1YXVA 1YHWA 3A99A 3SV0A 4LGGA 2PE0A 4S34A 3BYUA 4BHZA 4M12A 3EQIA 3RAKA 1HOWA 2HOGA 3Q96A 3NW5A 3PP1A 4IDTA 3LJ0A 2QHNA 4EBWA 4OGRA 2PVJA 2C5YA 3GCUA 5KKRC 1OB3A 1H24A 3NSZA 3PWDA 2XK6A 3DKFA 4BF2A 5DG5A 4FNZA 3FZRA 2VTHA 4DH7A 4I3ZA 3V01A 4CZUA 4WSYA 5K4IA 1OIQA 5IDNA 4O0UA 4QPSA 4QP3A 5ACKA 1XR1A 2XK7A 4O96A 3OOMA 4RJ6A 4BDEA 2B0QA 3LXLA 2QO7A 3R2BA 5IUIA 4Z16A 4XEYA 2GFSA 3MW1A 4UMQA 3FI2A 5J7BA 5FLFA 3AOXA 3ZONA 4RVMA 2VWVA 1H25A 3NUYA 4AGWA 3CQEA 4R3PA 2ZAZA 3R7IA 4X3JA 5K0XA 3PIYA 3PJ2A 4DG2E 3KL8A 3E64A 3ZDUA 2QCSA 3OHTA 5IA3A 3DTCA 1I09A 1M7QA 3LFSA 4KSPA 2HW6A 2C6KA 4X3FA 2CHLA 2ITOA 4I6QA 4G3CA 2WELA 2IW9A 3DNDA 4QQ5A 4D28A 1GIJA 4RT7A 4C4FA 1ZMVA 2O63A 5AUWA 3QALE 2WMXA 1HCLA 1YKRA 3I7CA 3PSDA 1F0QA 2Q0NA 4HPUE 4IJ9A 4K18A 2B52A 3LFDA 3PG3A 4PMMA 3K5UA 3LLAA 4CFFA 2WTWA 3RAHA 3QGYA 4WA9A 5IMEA 2XCHA 3OUNB 4JDKA 1UNHA 2UZUE 3DA6A 3R7VA 3KULA 4FTUA 3TZ8A 1K9AA 2YJRA 3BWJA 3NPCA 2R3MA 1YVJA 3ORZA 4C62A 3ZXZA 3FC1X 3MESA 1RE8A 4EBVA 3TUCA 1PJKA 3R1QA 2CPKE 5D11A 4ASZA 2BDFA 5CAQA 4CRLA 5CASA 3MVJA 4QP1A 3ZXTA 4NW6A 3GVUA 1KUTA 3NNWA 2CLQA 3T3UA 3ROYA 3UE4A 4AZSA 3D83A 5HESA 4APCA 1JVPP 3UIUA 5E9EA 3O8PA 3ZLXA 4A07A 3KXGA 2PVLA 3PY3A 4JT3A 5HG8A 4PMSA 3MTFA 3VS4A 4X2KA 4BDJA 5A6OA 5E7RA 2GQSA 3FMNA 4DE4A 4FTAA 2JD5A 5AUVA 3C7QA 3LQ5A 3OXTA 4IWOA 5E8VA 5AUZA 5HTIA 1VYWA 3PFQA 1YOJA 2BTSA 2ITXA 3ZFMA 4YHTA 3KQ7A 3P23A 4IZ5A 5AEPA 1OUKA 4XV1A 5D41A 4D5KA 4K33A 2EXEA 4ZTNA 5L2WA 3PVGA 1FOTA 4BKZA 4IFCA 4EOQA 4DLIA 2B9JA 4RG0A 2QOLA 2ITZA 4Z55A 3F3UA 3DY7A 2P0CA 4BDCA 4FSMA 4AN2A 3AGMA 4KS8A 4MBJA 5TKDA 3H10A 3IGGA 2UZBA 4V0GA 5IQAA 1SVEA 2W1FA 3BQRA 3WIKA 4B8LA 2B9HA 4ACHA 2OXXA 1PMUA 2C6LA 2PE2A 1NVSA 5HGIA 5A4CA 4BCPA 3A4PA 4FV0A 3NW6A 4ERWA 3KRLA 4QP2A 4EJ7A 3R1SA 4FTQA 3NUSA 4GMYA 4RZWA 4CT2A 4QQJA 4EOKA 4C37A 3Q2MA 3ZMMA 3NEWA 5M07A 4L00A 2BIYA 4I20A 3GC9A 2A0CX 4FZFB 4YZMA 4CZYB 1FINA 4WRGA 2GNJA 2JKQA 3ZRLA 3A7GA 1YDSE 2WOTA 3LMIA 2UW0A 4PMTA 5HCZA 3EZRA 4YSJA 3LOKA 1G5SA 4U43A 5AP1A 4GUBA 5L3AA 4DFXE 4EC8A 2XNEA 3L8PA 4DEGA 4Z7HA 1OPJA 1NVRA 2YAKA 4EKLA 3KRJA 5GNKA 5FM3A 4C3RA 5BUIA 3RZBA 1OMWA 5CEKA 2Z7LA 1H0WA 4BI2A 4HJOA 3EOCA 1W7HA 3KCKA 4EUUA 2ITWA 4QYEA 3T3VA 2I1MA 4D0WA 3HYHA 3H4JA 1ZAOA 3O2MA 2YISA 1QPDA 2GU8A 5CSHA 3ORTA 4TN6A 3FMKA 4GL9A 3L9MA 4KD1A 4ZLYA 4DFUA 3FC2A 2VV9A 5CF4A 4FKQA 4ZAUA 2E9OA 2PU8A 2PUUA 3D9VA 3LFEA 3E5AA 5DE2A 3QGWA 4C4EA 4PF4A 3D5UA 3Q53A 3BGPA 3PIXA 3D94A 3QZIA 5AA8A 4FSZA 3V5JA 2B9IA 4JG7A 1BL7A 2LGCA 5A9UA 1BKXA 2VUWA 3PJCA 4EH3A 5IU2A 1O6KA 5BVKA 3AC2A 4EH6A 2QC6A 2XK4A 2QOFA 2RGPA 5HO8A 1CKIA 2X9FA 1JKKA 4W4VA 3UGCA 4D4RA 5I9VA 4ZK5A 3CTJA 3KRXA 3GQLA 5IEVA 3TI1A 3W1FA 4EZ5A 3ELJA 2YWPA 2GHLA 1V0BA 5DEWA 3R73A 4FUXA 4V04A 3RVGA 3VUTA 4EH9A 2HCKA 4YBJA 5AX3A 2WO6A 2BRBA 1PYEA 5JMSA 2VWIA 3OC1A 1MP8A 3OS3A 3NVMB 4QO9A 1PRYA 3GC8A 3QTZA 4FT9A 1JKTA 5DIAA 4IWQA 1GIHA 3TNQB 4CQEA 5AAFA 2ITNA 4FUYA 4TWPA 3RGFA 5KO1A 2R2PA 4EEVA 5M08A 4MXYA 3SW7A 3I6UA 4TYEA 2PPQA 4ZZMA 1Q5KA 1H26A 5CZIA 3EQBA 3NNXA 4UZDA 2H96A 2VNWA 4BTFA 2GNHA 3FY2A 5DT0A 3GQIA 3H3CA 2B7AA 4FODA 3UMWA 4DT9A 5AV0A 3B8QA 2IPXA 3EJ1A 4L45A 4FT0A 5LWMA 4D9TA 3P9JA 5LMBA 4QMXA 4D2VA 5DA3A 4LG4A 1PXKA 4D55A 4O7TA 3VWAA 4R7HA 4CVAA 2EXCX 4OTRA 2XJ0A 5EOLA 4JX3A 5C8KA 3ORLA 4TW9A 4YZNA 4MQ2A 5JFWA 3R9RA 1H8FA 1WZYA 2I40A 5FEDA 3TIZA 4ZMEA 4H05A 4EHEA 5KHXA 3DOGA 3ORNA 1ND4A 4L52A 3IDBA 4KABA 1U54A 5CI6A 1JSTA 2FGIA 4BZOA 4QP4A 4CFVA 3GC0A 3FLNC 4R6VA 4UBAA 4BCOA 4F64A 3KN5A 1DAYA 2WTKB 4UV0A 2UZVA 3SKCA 1YXUA 5BUJA 3F69A 4KIKB 4YJOA 3QTSA 2QKRA 4FZ6A 2XNNA 3COHA 3CCNA 1OZ1A 3OZ6A 4EQMA 4I92A 3Q4ZA 3SDJA 3VJOA 4IX3A 4O7ZA 4ACDA 4KSQA 3UO6A 3HEGA 1Q99A 3C5UA 4U80A 4HVHA 5E1SA 3D7TB 2PTKA 3EN5A 4WIHA 4CKJA 4PDPA 5DH3A 4BY9E 4O0SA 3ZYAA 1P2AA 2VO7A 4AGUA 4U5JA 1PXMA 2XNPA 5I0BA 2Y6MA 3ALOA 2O5KA 2YIQA 4GFMA 4W9XA 3ZC6A 5LVMA 2V7OA 4JDIA 4RLLA 4QYYA 4PQNA 5AR2A 5HI2A 5KNJA 3HV5A 3O71A 4J1RA 3GCPA 5J9ZA 4EWHA 4C3PA 3N51A 3VAPA 2JLDA 5HTCA 2R3HA 3MFTA 5EHYA 4FSRA 2YN8A 3QX2A 4M68A 3BX5A 5A4TA 5M56A 3CLYA 4QMNA 5A4LA 4IAYA 4YZBA 4HOKA 4GK4A 3MH2A 3R1NA 4A9YA 4AU8A 3OTUA 4TWCA 5KE0A 4HVGA 1H0VA 3ET7A 4X3FC 5HIBA 3PSBA 2UW3A 4JRNA 1P5EA 4OUCA 5A14A 1CSNA 3BBWA 4KKHA 4A9UA 3FQEA 3SC1A 1PXPA 3LZBA 3P08A 4FTOA 5DI1A 1AQ1A 3TG1A 2Y4PA 3RWPA 1XJDA 3CY3A 2BROA 4JIAA 2XYNA 3OW4A 5D12A 3SAYA 3FI8A 4DTAA 3AMYA 3VUDA 5FDXA 5JSMA 3EQHA 1WVYA 3QRIA 2WEVA 4QP9A 2XCKA 3UYTA 3BELA 2R3KA 2W9FB 3QU0A 3NAYA 2VO6A 3MIYA 4PTEA 4X2NA 3DDPA 3WF9A 4GG7A 1YQJA 4AP7A 2BCJA 3NYVA 1U46A 4FL3A 2WB8A 4PY1A 3OT8A 3GBZA 3REPA 2E2BA 3RNIA 4CFXA 4FTCA 3I4BA 3TN8A 4EOLA 3NUPA 5AUXA 2ZV7A 2HWPA 3FPMA 2I0EA 3OOGA 1UU8A 3KXZA 1PYXA 3EL8A 4AWIA 5ETIA 3LCDA 4IH8A 2B53A 3PYYA 4JQ7A 1SZMA 4WKQA 3FI3A 5KBRA 5AP0A 5HCXA 3ZDIA 3SG8A 3KVXA 1T46A 4IHPA 3A8XA 4R1YA 4TYGA 4XH6A 2YIRA 3SD0A 4LGDA 5LVOA 3C0HA 5ETFA 4GSBA 4PX6A 4YBKA 5L6WL 4IWPA 4BBFA 5CANA 5AWMA 4BL1A 4OBQA 4GJ3A 3E8DA 4FT5A 3V6RA 2YM8A 5CEMA 3ANQA 4EQCA 3D4QA 5JQ5A 5CNNA 5J87A 1JWHA 2UUEA 2W7XA 3PXKA 3KC3A 4GK3A 1GOLA 5HCYA 2YCFA 4J97A 3DXNA 5CAOA 1YXXA 4NUSA 1QPEA 4ZJVA 4JS8A 2OH0E 1ERKA 3MGYA 4QTAA 4UEUA 4YLKA 1NT2A 5EI6A 2Q83A 5J8IA 5L2QA 4E5WA 1Q3DA 4QRCA 2H6DA 5T6KA 3EB0A 5BVWA 4N0SA 2V55A 3LXPA 4P7EA 4BBEA 2WMVA 4P90A 2WD1A 4EUTA 3BZ3A 5I9WA 2C3JA 5DRDA 1OUYA 2BALA 2VNYA 4E7WA 3EH9A 4G6NA 3RCDA 4UZHA 3GFEA 4PPCA 2F7EE 4HNIA 3T9TA 4HYUA 5FUTA 2XS0A 3GB2A 3PLSA 3ENHA 5L2IA 3WF8A 2VTAA 5BNJA 3MSSA 1OBDA 4ZS4A 3QUPA 1XH5A 4BYIA 1Q61A 3MI9A 3A61A 3ORIA 4IQ6A 4O27B 3K3JA 4FKPA 4XP0A 3VS0A 4ZSJA 1ZARA 3L9NA
chains in the Genus database with same CATH superfamily
1MN3A 5LCKA 2E9NA 2G2FA 2UW8A 4IW0A 3VBVA 4ERKA 1FMOE 4U44A 3BU3A 4EJNA 4K2RA 3C0GA 4S32A 3F3TA 3FMLA 2YLEA 4FX3A 2C5OA 2ZOQA 2QZ4A 1C7YA 5AV1A 3HECA 3IECA 1XNRM 3ZO3A 3DZDA 3CEKA 4F0GA 3C50A 2Z4SA 4IX4A 4U81A 3PVWA 4DBXA 4HEOA 2RF9A 4PTGA 5DYGA 3UVPA 4LF8M 3CF6E 4D9UA 3BOSA 1QMZA 4KT0F 2KTYA 1PXIA 3QQHA 1OQYA 1TQPA 5CEOA 3KMWA 1YW2A 3VBXA 5L2SA 5AAGA 2F2CB 4MGHA 4C33A 1U4DA 4DHZA 1QPJA 3L9PA 4F4PA 1D0MA 2UUBM 3VHKA 4LG2A 3AKKA 2JDRA 2QHMA 2KHHA 1TVOA 4OTGA 4RIOA 3BE9A 3R28A 4USDA 4M66A 4PNKA 3TV7A 1OM1A 3W32A 3BHYA 5BVFA 2R3RA 4EOIA 3DK6A 4FCWA 1CTPE 4QYHA 3GLIE 3KCFA 4D4VA 2LNHC 4A4OA 4GU6A 1GL6A 2HZ4A 5JGAA 4HVIA 4RIWB 1SNXA 2DZOB 2D7HA 4RJ8A 3C4FA 1H1WA 3Q9WA 4M0ZA 4RQVA 1ZMUA 5C26A 4KIKA 4RFMA 5E6JA 3P5KA 5GIPE 4OBOA 2QP9X 5H2UA 4WUNA 2DENA 4KRCA 3EN6A 5J79A 3PVBA 5EW9A 4JI9A 5I9XA 2UVYA 4UN2B 1GJOA 4DGOA 2OJ9A 3KOYE 3QTQA 3WZKA 3MB7A 4XS2A 4BWKA 4O2PA 2LHGA 1R2ZA 5IQBA 4XG8A 5ANDA 5I9ZA 4F0FA 4NSTA 5TF9A 4O4DA 2OJIA 4MM3B 4N6ZA 5D7VA 3C4XA 4U0IA 3DFAA 4FW9A 4FI1A 1UKIA 2H1RA 4ZY5A 4X64M 3JVRA 5CF8A 3L25A 5DNRA 3R9DA 4AZWA 2QOBA 3A2CA 5HU9A 4FWGA 4GT3A 2W5AA 2CGXA 1H27A 5KPZA 4F63A 3KA0A 1S9IA 3Q9ZA 1HCKA 5H8GA 5LMUM 2IO6A 4RX7A 2VN9A 4YSMA 4O83A 1DGFA 2H8HA 5CS6A 3JY9A 2MR9A 1KSWA 3QRUA 2XSZA 4W8EA 4GEOA 4G6ZA 2CV1A 3BHUA 4ZJIA 3O7LD 2FSLX 3S95A 3LCTA 2XK3A 4EZ7A 3QL8A 3DAJA 2R18A 1V0OA 3MY1A 3PTGA 3VIDA 3H30A 1T3TA 4CT1A 5EI2A 5IREB 4GFOA 4CLIA 4JG8A 2OG8A 1OKSA 4U42A 4MVFA 1PJQA 2JEDA 4HGEA 3LKMA 2HW7A 3Q32A 1IFYA 2JZ0A 3FKLA 2XEYA 1UFZA 2JY5A 3E93A 5DR9A 4M69B 1ZOGA 4XBRA 4ALWA 3QFVA 3ORKA 2Y21A 4D4SA 3KVWA 4BCIA 4L53A 5AP6A 4DV4M 5CLPA 2XM9A 4BCGA 1E9SA 3U61B 5ITUA 4G1WA 2AEGA 1HT1E 2YFXA 2NRUA 1Q8UA 3ACKA 3AT3A 3UOLA 4BGQA 2P55A 3F6XA 4UMTA 3KXHA 2G8LA 4G31A 4WG3A 3FZSA 4IZAA 2R44A 4XLVA 3OWLA 5JFXA 5AR7A 1G8JA 1FQ1B 4JL9A 5FTOA 3UVQA 2HY0A 2YJSA 5JQ8A 1T45A 4D0XA 2ZYBA 1NJGA 3HV3A 4OAUC 4O21A 3E87A 2OOAA 2XIZA 4Z8XA 5BYYA 3QQKA 4QTEA 4EOOA 1KOAA 4IE9A 4GCJA 3UIMA 4AW2A 4RIWA 4UYAA 3DKGA 4D1ZA 4LDTA 3FY0A 3CIKA 4AXAA 1FMKA 5M51A 2JDOA 3AKJA 5D10A 1VEJA 3VBYA 1NY6A 3L8VA 4GG5A 2W0JA 5HE1A 2BJWA 3D15A 1KE6A 3I81A 2C6OA 2ZJWA 3NNUA 5TOZA 2WU7A 2X9EA 4WP2A 5JI3E 4G4NA 1YWVA 2QO2A 3EQGA 5A54A 3EL7A 5M53A 4JV5M 1G41A 3BI6A 4GYGA 4G9CA 3NUXA 2K9DA 4GC5A 5IQCA 3QCYA 4E4XA 4LGHA 3HMMA 3V3VA 3G51A 2GNOA 3L28A 3NUAA 5TR6A 3H9RA 2ZFYA 3POOA 2KZSA 4QMZA 4KS7A 1YDRE 2OF2A 1YOLA 4JVGA 4U7ZA 5BPVA 3BLAA 1PW2A 4ZMFA 4XG4A 4MXZA 4EQUA 4ITIA 1LP4A 2J5YA 4KINA 4L3JA 3LAUA 1L2BA 3FZTA 3QTUA 3PJ3A 3MA6A 2VQEM 4AW4A 5DFLA 2QD9A 5ICPA 5IDPA 1REKA 4HVDA 2YAAA 4IVDA 4RWKA 4NTTA 2EWAA 4RIXB 3VRYA 4QOXA 4IADA 4WSQA 2R3LA 4DV3M 4RWIA 3QQGA 3H4MA 3HAMA 2J5EA 2PYWA 3C58A 1IN5A 3LMMA 3WBLA 2OSCA 5AR4A 3KKVA 5CVGA 5ITAA 2R64A 3S3IA 4ANLA 3PG1A 5KQDA 3FXWA 2ITVA 3R7GA 3CSVA 2W4OA 3JUHA 3OEFX 4ZTLA 3IW4A 4G17A 2VGPA 4IAAA 4X65M 4AGCA 3U6PA 3W2RA 5TO8A 4MGYE 4M69A 4FV6A 3G0FA 2E5LM 4BBMA 3DJ7A 5IEXA 3I4VA 2XARA 2DAEA 3C1XA 2C5NA 3QCSA 4L6QA 1DS5A 1M2PA 3EMGA 4XG9A 1GKIA 4O6LA 5E1EA 2FNAA 4I81A 3U61A 3HHWA 3TWJA 2JZ1A 4RMZA 3MY0A 3ZRKA 3GRUA 5EXXA 2CNVA 4RVLA 2CGWA 4L9IA 4LJ7A 3GQ5A 4HGTA 3IO7A 3GP0A 3CQUA 4R71A 2UUCM 4P5QA 3EQRA 3DBFA 3HV6A 3HHXA 4FTLA 4HGSA 3E63A 5EH0A 3TQSA 2LVNC 1U5RA 3IW8A 4CIZA 3I6WA 3RINA 4RC4A 4FSNA 4O7NA 5IA0A 2FSOX 3U6JA 5FTKA 3CY2A 5M06A 3UC4A 5M09A 4I1ZA 3ZO4A 2WMRA 3L8XA 3SYLA 3LVPA 3U6OA 3WYXA 3VS2A 3IW6A 2MGWA 4WNPA 4FTIA 3RAIA 4FNXA 3PDTA 3CD8A 4QMVA 3ROCA 2DWNA 4BN1A 3PRIA 4ZZNA 3TWKA 2IWIA 3WI6A 4JAJA 3SW4A 2DAGA 3DB6A 2XH5A 1YHSA 5CSPA 2CV2A 2OWBA 2CCHA 4E73A 3I7BA 2O2UA 3W8QA 1KOBA 2X7FA 4GVAA 4JBPA 2K47A 1TR8A 4C36A 3MS9A 1XQZA 4L67A 3KXMA 5GZAA 5HG7A 2WQMA 4DHFA 2UW5A 3PE1A 5M4FA 4AAAA 3ZLYA 3DOAA 4AW1A 5ANJA 3TJDA 1RQQA 4FV7A 4FV5A 2R4EA 1QDRA 3CBLA 3OROA 4TY1A 5HNBA 4D2TA 1MU5A 3GXLA 3OVVA 5ANKA 3VS3A 3OWJA 5DR2A 3SVVA 5EI8A 4DN5A 2C1BA 3IONA 5HQ0A 2C6MA 2C6IA 2GQGA 4O7WA 5AP3A 2Y20A 3MJ1A 4FG8A 3E8NA 4F9BA 4II7A 3ZSHA 3E92A 3DNEA 1XHAA 5EOBA 3PXFA 2XVDA 3JS2A 2NO3A 4RIXA 1P4OA 5HICA 2C47A 3QZHA 2XNBA 3SXSA 3AL0C 1W5SA 4QD6A 4TXCA 4KKEA 5ANEA 4I5PA 3CTHA 3TUBA 4QQCA 4A06A 1QL6A 1MQ4A 3GUBA 5JGBA 4ITQA 1GABA 4CYIA 1DI9A 5D1JA 1OIRA 4J71A 5J95A 4MHAA 3N4UA 1NO1A 3P78A 3G33A 1N32M 5IUHA 4CHTB 2PVHA 1OITA 4B7TA 4FIEA 2VO0A 3RKBA 1GJSA 4FEXA 5ANOA 1DGHB 3OWPA 3TM0A 2VWXA 3J2PB 3GPXA 3E7OA 3V5LA 4CV8A 4M9XA 1L2CA 4I24A 5HG9A 4FVQA 1I44A 5B0XA 1N36M 1GIIA 1UWHA 4CISA 2LWXA 3BU5A 4W4YA 3OMVA 1O6LA 2GQFA 2PL0A 3QD0A 1Z5AA 4GC9A 1NY5A 3BEGA 3ZO1A 4KNBA 5CWZA 3NIZA 3K3IA 5KUPA 3FZOA 5AUTA 5FTQA 3KGAA 5JKGA 4WD5A 1UWJA 4QP7A 1JAMA 1HJPA 4Y46A 3DBEA 3MB6A 5FEQA 3JR4A 3GNIB 2YERA 3GI3A 3WE8A 1EFUB 4GIIA 1K3AA 2CCIA 4E20A 5HBEA 3R8MA 3W2PA 3ZO2A 3F61A 5EDQA 3R71A 4LFIA 4LUEA 1BMKA 4FT7A 4CZTA 2NNWB 4TNDA 3LXKA 2BWBA 5IWAM 2Y7JA 4NJDA 5KMMA 3Q52A 4ZLZA 3PY1A 4IAKA 4EYMA 2GNGA 1D0KA 4D4YA 1JB0F 2OJFE 3E7VA 4FV2A 4GRIA 3LFAA 4RGJA 1QCFA 1NVQA 3UO4A 2XBJA 3L9LA 5EKOA 3BL9A 5CTPA 4ZTMA 4ANSA 2BKZA 3QHRA 3DFCB 3NMUF 2GS7A 1YUBA 2A2AA 2F5QA 4AAYA 3LM0A 3BYSA 4D2PA 2ZV2A 2XM8A 4GT4A 3FHIA 3FSFA 2Y6OA 4A9SA 4J96A 2VWZA 3DT1A 2L7HA 2FA2A 4DCEA 5AMNA 3BKBA 5CEIA 5I9UA 3ORMA 2BAJA 1DO2A 1GLNA 4C2WA 3GEQA 1M17A 4GRBA 1WIVA 5K4JA 3MH3A 5ITXE 1B38A 3FBVA 5CU0A 2ZDUA 1R7RA 5HE0A 3RK5A 3MPTA 1VDLA 5AA9A 5BVNA 3ZH9B 3OW3A 2EB3A 3RPYA 3UZRA 3D5WA 3V5QA 5BV3A 3ZZWA 2EVAA 2JIIA 4A9RA 2YM7A 4C4GA 3G6GA 4X3FB 1MRVA 3R83A 3SMSA 3Q60A 3SATA 4ASXA 3DZOA 5CAVA 4DEIA 3WF7A 4ZEGA 3HRBA 3A42A 4K0YA 3VW6A 1XNQM 5AR3A 1WMKA 4QP6A 1XWIA 4K77A 2F7ZE 4L3LA 5FGKA 2FFJA 2GMXA 3FYKX 4HYIA 5AIRA 1XXHE 2GNIA 1R2YA 2ZB0A 1ZXEA 4CCBA 3MH1A 4JQEA 4PDGA 3UNZA 2EKKA 3GFWA 3TNWA 2ONLA 1G8SA 1DGHA 4FVMA 3VO3A 3W0PA 4KRDA 3FAAA 2LVPC 4B3TM 3I0OA 2C98A 3FI4A 2VTTA 1XBCA 3R8UA 4LGMA 5CAPA 1W98A 5IH5A 2J0IA 2JIVA 5HG5A 3LPBA 2QSFX 3TE6A 2ZV9A 2DAIA 3EFJA 1TQMA 4GITA 3JYAA 3GU4A 3LFNA 4LJ8A 4X0MA 5M4UA 3G9LX 3ZCLA 4O0XA 2JY6B 5C18A 3GLHE 2ITUA 2UVZA 1GAGA 4ZXTA 1GNGA 3RHXA 4G3GA 2GS6A 5BMSA 5C1BA 1YI3A 2E9PA 3CS9A 3EKNA 4I4EA 4WNMA 4JI8M 1HQCA 3D8BA 3AC8A 4RFYA 1IM2A 5JZJA 3E88A 2CLXA 1PHKA 5CU6A 4LOQA 3AG9A 4JI7M 4QMUA 3I5NA 5L8JA 4PMPA 3TKIA 3NX8A 4AUAA 2JP7A 4O0RA 4ZIMA 2Z7JA 3V5WA 4D58A 5DBXA 2P33A 3FMHA 2JBOA 3ZLWA 2Z3XA 5ANIA 3SAVA 4HCUA 4YC8A 4F0IA 3ATTA 5KO3A 1H1PA 3AMBA 4YLLA 2XJ2A 1U54B 5EJCA 2HK5A 2RFDA 5F20A 2LXEA 3PPKA 3O96A 4ZS0A 5J1WA 3VQUA 3R8FA 2VTMA 1N78A 2BRHA 4BTJA 4USFA 3CR0A 3R7UA 3GENA 4UX9A 4F9CA 1REJA 3T9IA 5IA2A 4Y28F 2QODA 1K3WA 2UZOA 3QBNA 3SV0A 4B7GA 4DUZM 2PE0A 3Q96A 3NW5A 1W2CA 4EBWA 5KKRC 1OB3A 2XK6A 3V01A 3QWLA 4WSYA 4QPSA 4QP3A 2XK7A 4O96A 3FI2A 3E64A 3SFZA 3OHTA 4KSPA 4X3FA 2IW9A 4QQ5A 4C4FA 1ZMVA 5BUEA 3PSDA 3HU1A 4CFFA 2XCHA 3OUNB 4JDKA 4S12A 3R7VA 3TZ8A 2UZUE 2EUCA 3NPCA 2R46A 2R3MA 1Z5BA 3TUCA 1PJTA 4ASZA 2ZBKB 5CASA 3M7GA 3MVJA 4NW6A 3NNWA 2CLQA 4AZSA 3O8PA 2G3QA 3KXGA 3UDSA 4JT3A 4PMSA 3VS4A 5A6OA 2GQSA 4FTAA 3LQ5A 5AUZA 4IWOA 5HTIA 3PFQA 1YOJA 2ITXA 3FTEA 3KQ7A 4IZ5A 3GLFE 4XV1A 4D5KA 3PVGA 4IFCA 4EOQA 4RG0A 2K6BA 2L4EA 4KS8A 2UZBA 2CV0A 2V1UA 1NVSA 5HGIA 2XLJA 4FJVA 3A4PA 4FV0A 4D80A 3NW6A 4EJ7A 3NUSA 3NBXX 4CT2A 4QQJA 4L00A 3GC9A 4FZFB 4YZMA 4L6V6 4WRGA 3LMIA 2RRUA 5HCZA 3AKZA 5AP1A 4GUBA 1OPJA 4AG5A 4C3RA 4HJOA 3KCKA 4EUUA 3T3VA 3H4JA 3PFYA 4KD1A 3FC2A 2VV9A 2PUUA 3LFEA 3QGWA 4PF4A 3Q53A 3BGPA 3D94A 3V5JA 4JG7A 1BL7A 1BKXA 5IU2A 4EH6A 2X9FA 4W4VA 5I9VA 4ZK5A 5EQTA 3KRXA 4EZ5A 1V0BA 3R73A 3VUTA 3FRHA 3OC1A 4FT9A 3TNQB 4EEVA 4MXYA 3SW7A 3EQBA 4UZDA 4BTFA 2VNWA 2IPXA 5LWMA 3P9JA 4LG4A 4D55A 2F5SA 2XJ0A 4JX3A 3U60B 5JFWA 5KHXA 2CHVA 3ORNA 1ND4A 4L52A 1U54A 1JSTA 2FGIA 3GC0A 4R6VA 2UZVA 5BUJA 3QTSA 4KSQA 1IN8A 4IBBA 4HVHA 4NC6A 4WIHA 4PDPA 5DH3A 4BY9E 1SXJB 4O0SA 3ZYAA 2O5KA 5KNJA 3GCPA 5J9ZA 4EWHA 3N51A 2AHMA 5HTCA 1EIJA 2YN8A 5M56A 3CLYA 4A9YA 3ET7A 5HIBA 3PSBA 4OUCA 5A14A 4KKHA 3FQEA 4FTOA 3CY3A 5JSMA 5FDXA 1WVYA 2WEVA 3W67A 3UYTA 4PTEA 4B3RM 3MIYA 4AP7A 3NYVA 4FL3A 4PY1A 3OT8A 2E2BA 4CFXA 3I4BA 4EOLA 2Q2EB 5AUXA 3M6AA 2I0EA 3LCDA 4WKQA 5HCXA 3A8XA 4XH6A 4LGDA 5LVOA 3J7AS 4NXNM 4GSBA 4BBFA 4BL1A 3E8DA 3V6RA 4EQCA 4DR4M 5CNNA 4GK3A 1GOLA 4J97A 3DXNA 5EXSA 4OX9M 4JI6M 4E5WA 4AKGA 3EB0A 4M0WA 4N0SA 4P7EA 2WD1A 3BZ3A 5DRDA 3GFEA 4PPCA 2F7EE 2XS0A 3GB2A 5L2IA 3WF8A 2VTAA 4ZS4A 2PUIA 3MI9A 3A61A 3K3JA 4ZSJA 3UPXA 4O22A 3UK6A 2G2IA 3QA8A 4I94A 4KAOA 3QYZA 2WEIA 3R1YA 2WGJA 3NUNA 4EH4A 5C1QB 4XG3A 2DHRA 5HX8A 4G6LA 4MD8E 5FBNC 3QX4A 8CATA 1LEWA 4NK9A 3J27B 3FDNA 5EYMA 4KKGA 4G6OA 4BIEA 3BHTA 4BWPA 1R6BX 4OLIA 3EIEA 4LFAM 4L7FA 3N9XA 4ZTQA 3FUVA 1HNXM 4AA0A 3KXEC 2ZDTA 3BGQA 5E92A 5GJFA 2J0MB 4EOMA 3N4VA 4MCVA 4O84A 3QXOA 3KB7A 4LFBM 5HLPA 4E1ZA 3ZFYA 4JX7A 3W55A 4CEGA 4MXCA 2JFMA 3R7YA 2GTNA 4FTTA 5CALA 2SRCA 4DR7M 3WZJA 3FMJA 4IBKA 5AFVA 1YSYA 3T15A 5K5NA 4JI5M 1CM8A 4RVTA 4ITJA 2DWMA 4BC6A 3EWHA 3HY5A 2NP8A 2KNVA 5EQEA 1A48A 4EK3A 3HMNA 1TZDA 3Q2JA 4MD7E 3GP1A 5DNYA 1OECA 3U60A 4E8AA 2Z60A 3RM6A 3TTJA 2BRMA 5C9CA 1PJSA 4CGAA 2VU3A 1WVWA 3PUPA 2DI0A 4O82A 4FTRA 4EOJA 3FMEA 1SXJA 5GZ8A 2DWBA 3IDPA 1OIUA 2EXMA 2HAKA 4EWQA 2YABA 1VYZA 4FSTA 2VDBB 3JVSA 3CPBA 2XNOA 5EYDA 3F3ZA 1OBGA 4L46A 2F2UA 2X0PA 5LMAA 2BRGA 3A46A 1FVTA 4QMOA 2CMWA 4RJ5A 2ETMA 2XEPA 3UC3A 1TH4A 4BICA 3COIA 4KO8A 3COMA 4IAIA 4IACA 4F7NA 2PVMA 2I0VA 5FP5A 3PLAE 4L44A 5LOHA 3KEXA 2GCDA 5B2KA 4Y83A 1EE8A 3QD4A 5DFPA 2IF8A 1ZY4A 4NZWB 1P4FA 3UGJA 3DKOA 4F09A 1PJJA 1UNLA 5ACBC 5KX8A 4GIPA 2ZAMA 2J7TA 1R4GA 4MXAA 4K11A 2RGOA 4EYJA 1BI7A 4REZA 3WZDA 4RNAA 4IZ7A 3PNVA 3C4WA 3FJQE 4F1TA 4FL2A 3SG9A 3ULIA 5C8NA 2PULA 4IJEA 4FVRA 2WQEA 3C3DA 2G15A 2ONLC 4KLNA 4RBLA 4GKKM 3W2SA 4PP7A 1XC8A 3OCBA 4M67A 4B99A 1LTMA 2G2HA 1KE7A 4UWCA 5HIDA 4RWLA 4G16A 4XK8F 5H3QA 4IZYA 3VNTA 3RNYA 3QYWA 3KOZE 2Y0QA 4RC3A 4QMMA 4RA5A 3SA0A 5LVNA 4X7QA 4RFZA 1YE9A 3UYSA 5IKWA 3PA4A 4I8OA 3IW5A 1Z9XA 3FLQA 4MGIE 1I4WA 3LCKA 3SMPA 4QPMA 4OTHA 3NYOA 3DBDA 1KFVA 3PXGA 3HRCA 4O7RA 3RFWA 4G3DA 4LJ9A 3TT0A 5DN3A 5EXPA 5HVYA 2O25A 3KY2A 3OXZA 4O7VA 3THBA 3PP0A 3QUDA 4Q9ZA 2E9UA 3BYMA 5IA4A 3K54A 4FKRA 3JR5A 5FEEA 3PXRA 2R3OA 4X62M 3VS1A 5EW3A 2C99A 3CGFA 2XZUA 4EI4A 3HGKA 2JDVA 3ZOSA 3DKCA 2Z8CA 5T3QA 4BKJA 3J80S 3GU7A 1N77A 2W1GA 1GY3A 3TZ9A 4CCUA 4EONA 2IZTA 3OCTA 1NNUC 2VTIA 4EH2A 3LVVA 2FSMX 2WTKC 3AXWA 1VR2A 4R7IA 1WXQA 3ANRA 2XUUA 3R30A 3IS5A 4DEDA 4I6HA 2XNMA 2KNAA 4WO5A 3B74A 4IJPA 4LF5M 2J9MA 2PZRA 4YZ9A 2HL7A 4LZJA 3MJ2A 1V92A 3T1HM 4QMYA 4DG0E 5EG3A 1L8TA 4P5ZA 4M97A 4BRXA 3MMPA 2F5OA 1NVMA 4BCHA 4JBOA 3Q6UA 1E1XA 3L8SA 4W5WA 2PMOX 3FMMA 4ANRA 3WOWA 2AYPA 1YOMA 3TCPA 2R7BA 3DB8A 5LQFA 3QWJA 1UVRA 3IG8A 2XYUA 5B2MA 4JAIA 2C3IB 2VTNA 4YTFA 4I0SA 4FNYA 2J2IB 4FK6A 4FV3A 5IA1A 4U3YA 4TNBA 5AP7A 3HMIA 4I22A 4O4EA 4MKCA 3AT2A 4KIOA 3DXQA 4D5HA 3UIBA 5LMKA 2V0DA 4F9WA 5AUUA 4AA5A 5EQPA 3TDVA 4FR4A 4X2FA 2UW6A 3Q9YA 3E62A 3K2LA 1JNKA 2YM5A 3KU2A 3UP7A 3QTWA 4QOZC 3DPKA 2IW6A 3B9PA 4ANNA 4BCJA 5L4QA 3VS5A 4F70A 3ZUTA 1WBWA 3FHRA 3W2CA 2ITPA 4LOOA 4XHKB 4A3VB 4BLCA 2J7OA 2WQOA 5LJJA 1Q3CA 3LFFA 2P2IA 4RJ3A 4E4NA 1OTRA 5IQFA 3O7LB 4EHGA 3GLGB 2M5ZA 3U6HA 4EOPA 3Q3BA 5AP5A 4BWXA 1DV0A 2W1EA 1IAJA 3V8WA 3UOJA 3D2IA 4GVJA 4F7LA 3UNJA 3W0NA 3Q8XA 2WTVA 5FP6A 2XP2A 3GPUA 3DJ5A 1WFCA 3FZPA 1IN7A 3U9CA 4XGIA 4BDDA 4B0GA 4R5YA 2VX3A 4MB7A 1OKVA 2Y8OA 4QMPA 1IEPA 4DH1A 3E9SA 3LW0A 5T68A 2YM3A 2YM4A 4BDFA 4FF8A 2QCUA 2YZLA 2QOOA 2DQ7X 3BPRA 1WBPA 5FXQA 4FYOA 1AD5A 1M14A 4YTCA 2GPHA 4BCQA 4FBXA 1XMOM 2BRNA 4RX9A 5IISA 1GZNA 4JYAM 2OICA 4FTNA 4HL4A 3DCVA 4F65A 5FDPA 2C0OA 4I6FA 2J51A 1QAMA 3QWKA 4PDSA 4PV0A 5JGDA 3PXQA 4LYNA 1W0XC 4G4QA 4BYJA 2X2MA 1IY0A 2JAVA 2ITYA 3PA5A 4CD0A 1UA2A 5FD2A 4L68A 3NR9A 3QC4A 2AQXA 4YC6A 4BDBA 2I6LA 4DGGA 5ITTA 2PZYA 5H37D 2RG6A 2JDSA 3CP9A 4O6EA 3MDYA 1SNUA 1QANA 4NM7A 3DLZA 1G3NA 2QLUA 5F95A 3WHKA 2YDKA 3E3PA 5CU4A 3TMOA 4QNRA 4R3DA 3HX3A 3FWQA 5BPYA 4XOZA 3R8VA 4NL0A 4W4XA 2R4JA 5DPVA 1H6UA 3R8PA 5CSVA 3U51A 4DEBA 5BVDA 1WBSA 3TWMA 1URWA 3AD6A 3H0YA 1VZOA 2WIHA 5HLWA 4H58A 1PKDA 5CU3A 3I60A 2ZB1A 2YA9A 5LMNM 3A60A 2HXLA 3EN9A 4YUQA 4R7GA 2OF4A 3PUFC 3OWKA 5FQDC 4RF1A 1ZYLA 3G90X 2QONA 3ETAA 5JFSA 3VW8A 1YI6A 3MIAA 3QAME 4DGMA 1IN4A 4GU9A 3IGOA 4FCVA 2EU9A 3E3BX 4Q5EA 2XEZA 3HU3A 3KSJA 3V04A 2JITA 3UZPA 4CSVA 3W16A 3HWSA 2WQNA 2BAKA 1SG9A 4LRSA 5CAUA 2X6DA 3SX9A 3W68A 5CEPA 2W06A 4L15A 3GLGA 2ITQA 1A5TA 4H1MA 4KIPA 2PK9A 1Q8YA 3PWYA 4IANA 4PRJA 3KMMA 2WOUA 2RFNA 4FKUA 5L8RF 3QKLA 3C5IA 5E4HA 3FYJX 3R00A 4NXMM 2R45A 2P4IA 3RPVA 2QO9A 2JKOA 1H08A 2EUFB 2F4JA 4KBAA 2ETRA 4EH8A 2FYSA 4QMSA 3F5UA 2IZUA 4NOOB 3MFUA 3RTPA 3UQFA 3Q04A 1ZZ2A 3F3VA 4HVSA 3FTCA 5A3XA 3HJQA 4JRVA 3NLBA 1Z6TA 3UP2A 4RLKA 4E93A 4YHHM 1DGBA 5I3RA 4XUFA 3KP1E 4PNIA 5LVLA 3CQWA 4XP2A 4FEUA 4CQGA 2OJJA 2WMAA 5TE0A 5BVOA 2F5PA 1L1ZA 4IBFA 1Q4LA 2IJMA 3POZA 4FKTA 2QQ7A 2CNQA 3ORPA 4OBPA 4YURA 4FWHA 4HCTA 5L8LA 3G0EA 4FT3A 1ZQ9A 4IBJA 3MN3A 3R02A 4MWHA 4M7IA 3EN4A 1DI8A 3MV5A 4FIFA 1G8PA 1SXJC 2OQ4A 2VTOA 1NY3A 3M11A 3B7ZA 2YR0A 2W5HA 5CY3A 2F49A 1Y6AA 1LR4A 1KV2A 3Q5IA 3ZH8A 2H34A 5J5SA 3EQCA 3UDBA 4A9TA 4DAWA 5DHJA 5HX6A 2KZUA 1ATPE 1J7IA 3OP5A 4J99A 2XK8A 4PCZA 3SHEA 4YNOA 2UW7A 4F7SA 1OKWA 3P7BA 2ZTCA 1GJTA 3KDSE 3ID6C 4QNYA 1WJ7A 4JI4M 1N34M 2J0KA 3TIYA 3HL7A 2W05A 1QZEA 4ANMA 2ESMA 4QMLA 4QQTA 2JNHA 4CV9A 2XKFA 4F6SA 2YWVA 2QOCA 3QZGA 4WBBB 2DXIA 4FRFA 3BLHA 1K82A 4I4LA 4FKOA 2OGVA 4Y8DA 3DJ6A 1W2FA 4FEQA 5CVFA 2KXEA 4O2ZA 4EK4A 4FSWA 5DYIA 4C8BA 3W0SA 1QVRA 4XNEA 3FLWA 2OH4A 4L78A 5BYZA 2HZIA 4AFEA 4O1OA 4IB5A 2PHKA 4PL4A 4FTMA 2VO3A 2NPQA 2UW9A 1IXSB 1OVEA 3AC3A 3AC4A 4O7SA 3WARA