3K2LA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
410
structure length
402
Chain Sequence
VDLGTENLYFMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPQKLLDASKRAKNFVSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Structures of Down Syndrome Kinases, DYRKs, Reveal Mechanisms of Kinase Activation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 402
sequence length 410
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k2lA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k2lA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k2lA02
2UZDA 4G17A 4KB8A 4QP3A 1OZ1A 4FEWA 1JVPP 3LFQA 4RC3A 4U45A 3ZEPA 4BZDA 3LMHA 1YQJA 4W4XA 5DHJA 2R0UA 3KREA 2XMYA 4QMWA 1H1WA 2Q83A 4IM2A 4FT0A 3RP9A 3VN9A 2W1CA 2VWXA 3D15A 4BCIA 4DEBA 3NUXA 1YHWA 3FLZA 3SW7A 2PL0A 2I0EA 5HO7A 1SVHA 3MVLA 4BIDA 1GAGA 3CIKA 2UW6A 4MD8E 4DH3A 1F0QA 2PULA 3HLLA 4DE4A 3RAHA 3QTSA 4XG4A 4R8QA 5HE3A 4PUZA 4YJOA 3OWKA 1CKIA 5E8TA 3ENHA 4QMQA 2QOFA 3BLQA 3IGGA 3F61A 1DM2A 1XH6A 4AAAA 1GIHA 3A61A 2BZJA 3I4BA 3NCGA 4K77A 3EN7A 4O2PA 3OZ6A 4GU6A 4ZTLA 3GU6A 4MTAA 3SXSA 3FPMA 2W1EA 2LAVA 2XK7A 4A7CA 3BBWA 2CPKE 3LCOA 2UVYA 2VV9A 1NXKA 5AAFA 2ITUA 4O1OA 2BRBA 3KVXA 5HE1A 5AV4A 2C5XA 5E90A 1Y8YA 2J9MA 2ZV7A 3QYWA 4DAWA 3WF8A 3UP2A 2VWYA 4K1BA 3N9XA 4RVMA 2VZ6A 4FV9A 3TZ8A 3JYAA 4FV1A 4OR5A 2YIYA 5FXRA 2SRCA 3SG9A 4KIPA 3FHRA 3KQ7A 5HNIX 4LOPA 5IQDA 2QR8A 4PF4A 3MDYA 2YM5A 4KIQA 3CGFA 4CTBA 4ZTMA 3RTPA 4K18A 5EYMA 4MAOA 3LXNA 2OJFE 3LMGA 4J95A 3QHRA 3BGPA 4I3ZA 1RJBA 5LMBA 3E8EA 2GS2A 1BI8A 2XP2A 4IB5A 5A14A 1YW2A 5GZ8A 3KVWA 3ID6C 3QZFA 3DQWA 4J96A 5L2IA 2YJSA 5HG5A 4FV5A 2IO6A 4AW0A 1ZYDA 2QG7A 4LUEA 4G3EA 3QQHA 3DBCA 3GC7A 2VO3A 4R1VA 5IU2A 2JGZA 4JT3A 2OJGA 1W8CA 1WBPA 3MVMA 4I6FA 3DK3A 1WZYA 4USEA 5KMJA 4C3PA 3O0GA 2B53A 5CLPA 1XWSA 3Q52A 4GYIA 4EC8A 5HVYA 4FMQA 4M69B 4RA4A 3K3IA 4GG7A 3PDTA 4DF3A 1ZYCA 3EKKA 4FTTA 4KIKB 4MNFA 2YCRA 4F1MA 3DLSA 2VX0A 4AWIA 5DWRA 3FAAA 3R8PA 1T46A 1KV2A 3QRIA 2RGPA 4PTEA 5AR5A 4BICA 4DGMA 4IC8A 5LXMA 1PW2A 4X21A 3I60A 4RIWA 3RWQA 3LFEA 4CV9A 5CSPA 1SYKA 4LV5A 3WYXA 4BTKA 4W4YA 4W4VA 4EONA 5KMNA 4FTQA 4I5PA 1IRKA 2XJ1A 1U54A 4RZVA 3FZPA 4TN6A 3ZRLA 1PY5A 4M12A 2B54A 2W9FB 2YEXA 4R5YA 4WIHA 3KEXA 1OKWA 2VO7A 5EHYA 1R0EA 2WXVA 1SVEA 3Q4UA 1K3AA 4FICA 4UZDA 4EJNA 3Q6WA 4A9TA 4G5JA 1LP4A 3HP2A 3WF7A 4LYNA 3UIMA 4DH7A 3U6JA 3AC2A 5LARA 5TR6A 4AW1A 4BGQA 4EL9A 1J91A 3EB0A 3KN5A 3WARA 2CNVA 2CHLA 2XNOA 2R3LA 3PJ8A 5JT2A 3QXOA 3E88A 1NVQA 4F70A 3OS3A 2QG5A 3ZRKA 3U4UA 1PMNA 3DQXA 1YHVA 3RMFA 5J5SA 3VUKA 3L8XA 3QLFA 4AT3A 1YXVA 1ZOHA 3LKMA 5IUHA 4LFIA 3KB7A 2GS6A 4J53A 4KWPA 4W8EA 5BUJA 2QOIA 3OROA 4TYJA 5M08A 1VEBA 4S33A 2I6LA 3CQUA 4FIGA 1KE8A 4JG7A 5H3QA 2YIRA 3SXFA 2ITXA 3V8SA 1M7QA 3VAPA 4F6WA 2DUVA 2Y4IB 2VNYA 4KBCA 4UYAA 4C59A 5CNOA 2CKOA 2KULA 3KULA 3UZRA 3F66A 1YOLA 2H9VA 2UZBA 3MIYA 4X6QC 3NUSA 2F7XE 2E9OA 4N70A 5HU9A 2XK4A 3DS6A 4LRMA 3VBTA 5HTBA 2GTMA 2QONA 2X9FA 3T8OA 3TNIA 4BDFA 1O9UA 4W9XA 5IA5A 3GGFA 4L3JA 4I94A 1O6LA 4UB7A 4NFMA 5CENA 1M2QA 2WNTA 4X2KA 4BC6A 4EEVA 2XM8A 3PP1A 4ANQA 4JDKA 4BTMA 5BNJA 2PWLA 3QTIA 4RQVA 2XK9A 1YI3A 5F94A 3O96A 4PX6A 2C69A 4EUUA 4O27B 3FZ1A 4O7YA 4EOPA 3SD0A 1H1SA 5GJGA 4TWCA 1OPLA 2ZV9A 2WHBA 1H07A 4YJUA 3BPRA 1ZARA 3UIXA 2PUPA 4BF2A 5IQIA 4RIXA 4RPVA 2RIOA 3LMIA 4HNFA 2C6EA 2UZUE 3PE2A 4OTQA 3H3CA 4QNYA 2GU8A 4D1XA 2C5YA 5AWMA 4M15A 3R00A 4DEEA 3VS3A 2VRXA 4E3CA 3NVMB 3VJNA 4NJ3A 4U5JA 1H25A 4NCTA 5KHXA 2YIXA 3RBWA 3CE3A 3KGAA 3NRMA 2OFVA 4BHNA 3H30A 3AC5A 4J99A 3PXZA 4GW8A 4BTFA 4YC8A 5A9UA 4CLIA 4FTAA 1VR2A 3R2BA 2C3IB 3DA6A 3QKMA 3LQ3A 3ZO2A 2Q0BA 3D14A 4Q5EA 2J0MB 5JRSA 5DMZA 3COIA 3JY9A 2BRMA 4V04A 3EQGA 3SHEA 3QC4A 4DH1A 3PRIA 2WFYA 1Q8ZA 4R7HA 4O0TA 4XG3A 2QOCA 4FSTA 5AP3A 1PXPA 2W1GA 5AR7A 5FM3A 4H58A 3UOKA 4RLKA 3TN8A 3W2RA 2ZB0A 1GOLA 4PY1A 3NVKI 3P7CA 4YJSA 1YWRA 2F2CB 4AA0A 5C1QB 3NS9A 3ZM9A 2YHVA 4ANBA 1XH4A 4D4YA 4BWKA 3Q9WA 4D1SA 2ITVA 2OH4A 2WAJA 2B9IA 5CSHA 5AP4A 1OIRA 1TQPA 2W5HA 5EOBA 3OEFX 3GBZA 3S2PA 1ZRZA 4EH3A 5EDRA 3KMWA 1NVRA 4EK3A 3HEGA 1A06A 2ZOQA 4FV4A 5DT0A 5HO8A 3COMA 2BALA 3MI9A 3GOKA 3G5DA 2PY3A 3NLBA 4FK6A 4RT7A 1WBTA 3PY1A 5HGIA 3RHXA 3V6RA 5FD2A 4ACCA 4EQCA 3D4QA 2VTJA 3IDBA 4M8TA 3TNQB 4FUXA 3VJOA 4F0GA 1KUTA 4OTWA 4QMVA 4GSBA 2VTQA 3NUPA 5A4EA 1M2PA 4I20A 4RWKA 5CVHA 4FKJA 3RPVA 5EI2A 4HVHA 4AFEA 1XO2B 1DAYA 3WE4A 3IW4A 4FT7A 4DH8A 4C2VA 2C47A 3BELA 4EWHA 3DBQA 4LGDA 3UG2A 2YJRA 3IW5A 3CJFA 4FZ6A 4M3QA 4L42A 2QR7A 4P7EA 5CU6A 2YFXA 4UALA 4X2JA 3ATSA 4H1MA 1XKKA 4C4HA 3Q5ZA 4WRSA 1MP8A 3RZBA 3AMAA 5D7AA 2C0OA 2XK6A 4ZSEA 3LCSA 2FO0A 3ENMA 5F1ZA 2PMLX 3DU8A 3DZQA 3RK5A 5FM2A 2XM9A 1Q99A 4QMZA 5IH6A 3FYKX 3DXPA 1WAKA 4YJVA 2PU8A 3C13A 3HZTA 2IVTA 4WT6A 3VBWA 4I92A 3QQJA 1Q4LA 3ORMA 3KMMA 3PA5A 4PL3A 2W1ZA 4GMYA 4RJ8A 4E5WA 4GS6A 4RC4A 4FKGA 4X3FC 3EMGA 2NO3A 3DKOA 3V3VA 3Q96A 5H8EA 1PXJA 4QPSA 4QMOA 3HA8A 1KOBA 1OL5A 5EQPA 1GZ8A 5E8SA 4ZP5A 5AAGA 4OAUC 2B1PA 2BAJA 2XKCA 4WO5A 3MA3A 4TWOA 5HE2A 3EN5A 3BLRA 4MNEB 3LXPA 4C37A 4CMUA 1QPCA 1Z5MA 2F49A 3ZLWA 4BI0A 3CTJA 3A7IA 3BHYA 3TL8A 3WZEA 4L8MA 3ALNA 3FWQA 4G1WA 4BDGA 3ULIA 3DAJA 5C4LA 4XG8A 5L6OA 1FINA 3D7ZA 3TKHA 4AT5A 2QO9A 1UU3A 1RDQE 3BLHA 1P4OA 1F5QA 2OH0E 5KKRB 1CKJA 2W96B 1GJOA 5BMSA 4C3FA 3CEKA 4MEDA 4E73A 1R39A 5EW9A 5J9LA 2W4OA 5KMOA 3KCFA 5TO8A 1JSTA 3ZDUA 3KF7A 4DCAA 4CXAA 1GZKA 2JKOA 4C3RA 2YM8A 1VYWA 2ZM1A 3C50A 3R9NA 5KBRA 4R7IA 4J52A 3FLWA 3CGOA 3HDMA 3D2IA 4JBPA 1JKSA 1Q61A 3A7GA 4EH9A 2YERA 1UKIA 5BQ0A 2JKKA 2WTVA 1PKGA 4O7SA 4K33A 5I5ZA 4P90A 5AEPA 3F3TA 1QCFA 3R1NA 3E62A 2PK9A 4L67A 5EH0A 3G0FA 3QU0A 4J71A 4DT8A 4ZMFA 3ZTXA 3EQIA 2PVLA 3OOGA 4OUCA 3FMDA 4O0SA 2GNJA 3BIZA 4QMYA 5AJQA 4ZZNA 4RJ7A 1WVXA 5FEEA 4E1ZA 2YZLA 3QGYA 2GNIA 4I5CA 4MD9E 4CFVA 3COKA 3ZUVA 4KABA 1OBGA 3HUBA 4QMUA 2HIWA 4XS2A 2QOLA 4ZSJA 4RC2A 3ZEWA 3NPCA 5DNRA 2F7EE 3NMUF 4BCNA 4FIEA 1B6CB 4OGRA 5DFPA 5IEVA 5K0XA 1FQ1B 2ITQA 5EM6A 1W84A 2P4IA 2VTHA 3LFBA 3NYXA 5TF9A 5A46A 3HV5A 4IXPA 2A4LA 2HYYA 3AD6A 4FNZA 5JGDA 4FZ7A 3QCYA 4FR4A 4EH4A 5F9EA 2JDTA 1YXSA 2PVFA 1LR4A 3KY2A 4JX3A 2OFUA 4R1YA 3R7OA 4ZJJA 4YLKA 4RFZA 3ZXTA 5L3AA 3R8ZA 3NYOA 3GU8A 3HYHA 4USFA 3SOAA 2XRWA 3P9JA 4ZIMA 3VS6A 3MH1A 3AT2A 4CFMA 5HIDA 1CSNA 1W82A 3VUIA 2IZSA 2VO0A 5B2MA 4QTAA 4XLIA 3JPVA 4WNKA 5BYYA 1ZMWA 3O51A 2OICA 4UBAA 2VX3A 1V1KA 4RVKA 4A4XA 2R64A 4MXYA 5AUVA 3LCDA 4J8NA 3PJ1A 5HVKA 4TTHB 2P3GX 4DCEA 3F2NA 2Y6OA 3MB6A 4Z16A 3QBNA 3LAUA 4BDAA 4R3RA 4AGWA 4EZ3A 3D5WA 4R5SA 3FXXA 2P33A 1B39A 2G9XA 1K9AA 3L1SA 5T3QA 2CCIA 3LW0A 3HP5A 5AFVA 2WB8A 5KMIA 2X9EA 3MN3A 4HPTE 4G6OA 4BBEA 4YHTA 4ZMEA 3QZIA 4WSQA 3EYHA 3NYNA 2YIQA 4JDJA 4QMLA 5CNNA 4D2SA 3KU2A 4BY9E 4GK3A 4K0YA 2GMXA 2X6DA 3HMOA 2REIA 3LJ0A 2HZNA 3NW5A 4MBIA 4L46A 2C0IA 2WGJA 4XG7A 2WELA 4Y73A 3TUBA 4JQ7A 4BIBA 1T45A 1XH5A 3G2FA 3QQGA 4F7LA 3R8LA 3OUNB 1MQBA 2OU7A 1MRYA 4FKLA 4JIAA 4DG2E 5B2KA 4G3DA 4U44A 5FQDC 4D2WA 3ZU7A 1OBDA 5CALA 3CBLA 4UXQA 1W0XC 5LWNA 4ANLA 2QLQA 1OL1A 3DT1A 4C8BA 1YXTA 5GJDA 4BCMA 1TKIA 4LG4A 3ZC5A 4D55A 3FQHA 4XP2A 1R1WA 4QPAA 4EOJA 2JFLA 1W83A 3LM5A 5CEQA 4RFMA 3ZBFA 2OZAB 4KKGA 3L8PA 2DYLA 4U97A 5LMAA 1PMUA 4JOAA 3IDPA 3ORTA 3QTRA 2NNWB 3VO3A 3F5GA 1IEPA 2EVAA 3W8QA 3WF5A 4XRJA 3KCKA 2C6DA 5DR9A 4XP0A 3RHKA 4NSTA 3LLTA 5BVDA 4L00A 4F63A 2QU5A 4N6YA 4DLIA 2BFYA 2NPQA 3EFWA 3ORPA 3NUYA 4RWIA 5IPJA 4QMXA 3GU5A 2HK5A 5I3RA 3WOWA 2PE1A 4IFGA 4GKHA 3R0TA 1OKVA 2IWIA 4HCVA 3FEGA 5BYZA 2GHGA 3AD5A 3LXLA 4KBAA 3V6SA 3MFSA 4NFNA 5AUXA 1ND4A 4FX3A 3OP5A 2GCDA 3R28A 5FDXA 2Q0NA 3FI4A 1IA8A 3O8UA 2HWPA 4JQEA 2XZSA 4C62A 2C5NA 2VWVA 1STCE 4IDTA 4U7ZA 4O7LA 3QKKA 4DH5A 4Z55A 3FXWA 3EIDA 3QQUA 3EN4A 3RI1A 3DZOA 3UPXA 4AACA 5IDPA 3TV4A 4CKJA 5CXZA 3MIAA 3QD2B 4PP7A 1ZYLA 2C30A 3BRBA 3CR0A 4M67A 2C1BA 4HNIA 3ZLSA 2WTJA 3TJCA 5CAOA 2HZ0A 3OVVA 3Q04A 1ZY5A 4X6RA 4DEGA 3UNKA 1I44A 3QA0A 2GHLA 2Z7RA 4YNOA 3DBEA 4HJOA 5J9YA 4EHGA 2QQ7A 2ITNA 4FTCA 1RW8A 3W2PA 3F3UA 2CKPA 3DKGA 3DK6A 3I7CA 3LCTA 3C0GA 3W10A 1IA9A 3VHEA 5M4FA 3ELJA 3HVCA 3TXOA 4QQ5A 4R7BA 2O64A 4CFFA 1MRVA 2WMQA 4RG0A 2OF2A 4Y72A 5BUEA 5IQEA 2CGUA 2GDOA 2W05A 3G9NA 3QD3A 2W4KA 2E9VA 4FT5A 4FV7A 4IANA 2CLXA 2R9SA 4N6ZA 5AR4A 1BX6A 1OPKA 2WMWA 3I6UA 3T9TA 1PXLA 3FY2A 4P5ZA 3VWAA 3R2YA 4MVFA 3GU7A 4E5BA 2WMVA 5FBOA 3ZS5A 5L8JA 1PXIA 2IG7A 2F57A 2ERZE 2ETRA 2W7XA 1H08A 1LEZA 2J50A 5CSVA 3ZHPC 3GCSA 3EHAA 4M69A 5HO6A 4O7RA 3DJ7A 3OOMA 4P2KA 4RBLA 3RJCA 4CT2A 5JFWA 4NUSA 2XNGA 1PXNA 2IZTA 4AA4A 4Y46A 2JC6A 2XIXA 2H96A 2V5QA 4IVDA 2C6KA 1RQQA 2QO7A 4NK9A 3HMNA 5IG1A 2WTIA 2WTKB 3OHTA 3PJ2A 3PSBA 5LVOA 3PIYA 4NTTA 3TZMA 4G9RA 4XYFA 4C4FA 3NCZA 1YXUA 2PE2A 2ZV8A 4E6DA 1Y91A 5HIBA 4ZS0A 5LCJA 3EZRA 3H9OA 4GT3A 4IJPA 2IZUA 3AT3A 3K54A 4Y8DA 4DA5A 5BVFA 4UX9A 2EU9A 4EOLA 5HICA 4YO4A 3C4WA 5DT3A 3R01A 4YR8A 3PP0A 3ZDIA 5E9EA 1UU9A 4EHVA 2CMWA 4QTCA 3LVPA 4C2WA 5FTGA 4F9BA 2HY0A 2IN6A 3LJ1A 4AZTA 5M09A 3NNVA 3R63A 4EBVA 3Q3BA 3PY0A 2X8IA 4IE9A 3B2WA 2QNJA 4MCVA 3L8SA 4QP8A 4QRCA 4NTSA 4EQUA 4NKSA 2J4ZA 4C34A 2ITTA 2X4ZA 3R83A 5CF8A 3IECA 3PLSA 4CNHA 3DTWA 3BE9A 2UW5A 3QF9A 2G1TA 4QO9A 1JPAA 4IVAA 3ZM4A 4O91A 5AX3A 4ENYA 5LMKA 3NW7A 1U5RA 5JKGA 2BIKB 2ITZA 3UNZA 3E7OA 1IAHA 3FUPA 2NP8A 3DK7A 3AGMA 4FKWA 5J87A 4HYUA 4PDOA 3A7JA 2NRUA 3EQCA 4WG3A 4ACGA 4G34A 2UUEA 4YTIA 5M55A 3TTIA 2YWVA 3PPKA 4B4LA 3MTLA 4O83A 3Q4CA 4GK2A 4QP1A 1ZOEA 4Z3VA 1WBWA 2CSNA 3CD3A 2W5BA 1WBOA 4HZSA 2B0QA 1WCCA 5B0XA 4IZYA 1U4DA 3E3PA 3NAXA 3ZFXA 3RNYA 3EJ1A 4JRNA 1LPUA 3SG8A 4PDPA 4FG7A 3IPHA 3WE8A 5ITAA 3KXNA 4L68A 5HG8A 3QAME 4Y5HA 2QOHA 4E6CA 2PUIA 2Z7QA 2WQMA 4YC6A 4ZAUA 5IH4A 2VU3A 2QLUA 3AGLA 1BL6A 5CZHA 3UTOA 4ALUA 1PYXA 4FOCA 1EH4A 1Y6AA 3TV7A 3W8LA 3VBYA 3EN6A 2ZYBA 4IX4A 4BKYA 3R04A 2XIRA 3ETAA 5DA3A 4CSVA 4QOXA 5AUZA 3BWJA 2BHHA 5C9CA 2X81A 4A4OA 4BVUA 2EB3A 5HE0A 4DGLC 4MBLA 3ZC6A 4DBXA 4JDIA 2PZRA 4GCJA 1JKTA 5BUIA 4HVSA 5HCXA 4TYGA 5CEIA 1UNHA 3DNDA 4GUBA 5E1SA 4WG5A 5C8KA 2HW6A 3IK3A 5AV1A 4ZY6A 5IQAA 2XKDA 3O71A 1CM8A 3HMIA 3VF9A 4ZY4A 4AFJA 4MQ2A 4UXLA 4WNPA 2WMAA 4ACDA 4FEUA 1TQMA 2O3PA 3FC2A 3ZSHA 2J51A 2EUFB 3TNHA 4BDEA 5JZJA 5K5NA 5BYLA 4RQKA 4D0WA 5AIRA 1YWVA 3NNWA 1JAMA 2UZNA 1XQZA 4PDYA 1FGKA 5AA8A 4ZTRA 3TV6A 3NDMA 1UV5A 2XNMA 2V7OA 3PJCA 3NAYA 4G2FA 5IA4A 1XH8A 5IQFA 4AW5A 3RWPA 4L9IA 2UW0A 5EI8A 5IMEA 2YITA 3NUAA 3PE1A 4MKCA 1GZNA 2FGIA 3PIXA 2F2UA 4FKVA 3H0YA 3SQQA 4BKZA 1SMHA 3TZ9A 2HZIA 4HYHA 4CZUA 4YLJA 5JN2A 3JVRA 5C01A 2VO6A 3NGAA 1ZLTA 5L6WL 4DFLA 4UYNA 5C26A 3JY0A 1XHAA 4BKJA 3POZA 4DT9A 5A54A 2ONLC 2OGVA 3LFNA 3P1AA 4GV1A 3R22A 4DEDA 2BROA 4I22A 3FKOA 2NRYA 4FEQA 4FZDB 3PA4A 3V5QA 2PHKA 4FG9A 1KSWA 4PTGA 4HCTA 5ANJA 4BGGA 4IMYA 4ALVA 4JG6A 3I81A 4C4GA 4R77A 5LVLA 2B4SB 2P2HA 2WMRA 3BEGA 1W98A 3KK8A 4O0VA 4BL1A 3P5KA 4GL9A 3FSKA 3IO7A 3HAMA 3I1AA 3M2WA 4XUFA 4NH1A 3VS7A 1J7LA 3ZONA 4FEVA 1WBSA 2UZVA 3KC3A 2VN9A 2CGXA 1NW1A 4NKAA 5M07A 2IW6A 4KS7A 3VUTA 3FI3A 4XOZA 1I09A 1JKKA 4H3BA 1UKHA 2IJMA 3A8XA 3NX8A 4N0SA 4QP9A 3EQFA 4RA5A 1OUKA 2VWUA 3FL4A 4FSYA 2RG5A 5HQ0A 3ANRA 4RX8A 3Q9ZA 4IW0A 3ORKA 3ORIA 5DVRA 3DKFA 4A07A 5CAQA 5LVNA 3UQFA 4ZOGA 1JNKA 3MSSA 4S34A 3P23A 5K0KA 5IA0A 1J7IA 2PMIA 4KBKA 3B8QA 4D5HA 4RWLA 2GQSA 3TNWA 4RLLA 1Q5KA 1YWNA 2GPHA 4I41A 5HIEA 3OTVA 4EBWA 5A6NA 4EWQA 3S4QA 2BRGA 5FTOA 4ORKA 2JBOA 3MA6A 4KA3A 4JNWA 3SRVA 4AU8A 4IB1A 2I0VA 4EH6A 4PPCA 3EH9A 4FUYA 2C3LA 3EN9A 1GZOA 2B9JA 4LM5A 2Y9QA 3PWDA 3R1SA 4UEUA 5JGBA 3KL8A 2B9FA 4EKKA 5AP0A 2R0IA 3DGKA 3HV4A 4I6QA 2W17A 3ZLYA 4FE2A 2GS7A 5EYDA 2DS1A 5IUIA 1SM2A 4IVBA 3Q60A 5C27A 3HA6A 2A27A 3PIZA 2HENA 3VRYA 3W18A 5KNJA 4O86A 1ATPE 1SZMA 2OJ9A 2BRHA 3IDCA 4GFGA 5AR2A 1G8SA 3JS2A 3WIGA 3A99A 4BB4A 4F6SA 3ZCLA 1M14A 4ERWA 2RFDA 3OCBA 1JQHA 1W7HA 5EW8A 4KIOA 1YKRA 2JFMA 4Y85A 2BPMA 3AC8A 2UZWE 3LZBA 4QYGA 4GKIA 4GG5A 5D10A 2ESMA 5ANOA 3CSVA 2BILB 3C4EA 4K2RA 1P4FA 5CAUA 3PRFA 4NIFB 2WMUA 5EM7A 3QWKA 4EI4A 5AIKA 5L2SA 3ROYA 2YM4A 3CTHA 4FL1A 1UU8A 4YGAA 2CNUA 1XBAA 2OZOA 4IB0A 4KKEA 4LL0A 4J97A 2GSFA 2WMTA 4JDHA 4GJ3A 1NY3A 5M51A 1ZOGA 1GIIA 2PVRA 4BDBA 1Z57A 2FSOX 5D9HA 4W4WA 5F95A 3V5PA 4DGOA 1XBBA 2ITWA 1XH7A 2BDFA 2ERKA 4L7FA 4G6NA 4YHJA 4I24A 5DGZA 3UVRA 4KAOA 5A4CA 4JXFA 3BGQA 2Y7JA 5E7RA 5HZNA 5GZ9A 4YBJA 2WO6A 4IVCA 2VTAA 3GOPA 4OW8A 2W1IA 3RPRA 2BKKA 2QOQA 3Q9YA 4M0ZA 3HAVA 4FVPA 4U81A 4D2PA 5J5TA 5ETIA 4II5A 3GFWA 5CT0A 4I4FA 4ARKA 4EC9A 4EH5A 2UZEA 2PVNA 4EUTA 4U41A 5DG5A 4F08A 4JBVA 4FGRA 4M66A 3I6WA 2GNGA 1OGUA 4IX3A 2C1AA 2JITA 5AP1A 3TT0A 3GVUA 5GHVA 4FTLA 4D2RA 3EQHA 5AV3A 3R71A 2P0CA 4LOQA 5FG8A 3Q2JA 3E8DA 1URWA 4IH8A 1JSUA 3OCSA 1PMEA 4WOVA 1A48A 2WD1A 5KE0A 3AQVA 3AC3A 2PZPA 1YXXA 3F3WA 3MS9A 4D5KA 2V55A 3OF0A 4GH2A 5I4NA 5BVEA 1L3RE 3OWJA 5BPYA 4EOIA 4F7SA 3C5UA 1F3MC 4IFCA 3FMLA 5AM6A 5L2QA 2XUUA 3H0ZA 2J6MA 3HUCA 4C57A 5FEDA 3UZPA 4E26A 4JR7A 3N4VA 4HCUA 5C8NA 4XV3A 2XYNA 3BWFA 4I93A 4I21A 3RAWA 3UMXA 5EI6A 4TY1A 5ACBC 2FUMA 3A8WA 2HXQA 3OXTA 4EOOA 2R4BA 5J1WA 4ACMA 4GIIA 3U51A 4JBOA 4JX7A 2BZHB 1J3HA 4A9UA 4L45A 4NYEA 3VS2A 3BU3A 3EYGA 1OL7A 3VW6A 1H27A 1ZYJA 3CXWA 4PMMA 5E8ZA 2EB2A 4PV0A 2VTOA 3IG7A 4FKPA 3F69A 4IHPA 2RL5A 5GINE 1QPDA 4RJ4A 4EK6A 5B7VA 2WPAA 3TJDA 3QX4A 4EOMA 4RIYA 5IEYA 1KE7A 4GUEA 3ORNA 4ERKA 4D9UA 4HGSA 5HNBA 4IZ5A 5FWKK 1ZY4A 1U5QA 5AUUA 4WHZA 3U54A 4LI5A 4YTCA 1OMWA 4O0YA 3FMKA 4NEUA 4ZJIA 5FXSA 5CQWA 5HKMA 3RALA 1PMVA 2YCFA 3QZHA 4EK5A 4K11A 1HCLA 4XMOA 2X7GA 5HBEA 3BQRA 3RM6A 1YI4A 2A2AA 3FZRA 3V8WA 4YU2A 1ERKA 3UE4A 5L2WA 3VBVA 4TYHB 3WF6A 2AC5A 2YLEA 4F99A 2W5AA 3V8TA 2B9HA 1WBNA 4FV0A 4OTPA 4PQNA 4F1TA 1JBPE 5CF6A 4DTAA 2HZ4A 4MXAA 2BDJA 2J2IB 4C4JA 4EOKA 4HZRA 2OIQA 1PXKA 2Y4PA 1GY3A 1U54B 4C7TA 1WVYA 5CI7A 5CY3A 3KXHA 4OTFA 3S3IA 4C61A 2R3FA 4CMOA 4YZDA 2F4JA 3DCVA 3I7BA 3UC3A 4FIHA 3A7FA 2IZRA 2JDOA 4MD7E 4RVLA 3BZ3A 1BYGA 2PZYA 4CZTA 5AUTA 4DEIA 4QD6A 5FUTA 4RWJA 4WBOA 1FVTA 1Y57A 4QTEA 2QHNA 5I9XA 3F3VA 3H9FA 4JS8A 4NCTC 5L8LA 5DYJA 3AG9A 2XKEA 3TACA 4EYJA 2CNQA 1OIQA 5HVJA 5IKWA 3SW4A 2VTLA 2EXCX 5JFVA 2WTWA 3CY3A 4QYFA 5M4UA 4JI9A 4RJ3A 4WNOA 1O6YA 5HNGA 5HD7A 1Q41A 4CYJA 2OK1A 3OXIA 4F0IA 3AC1A 1PYEA 3E87A 3GCPA 2A1AB 4YTFA 3FZOA 4QMPA 2B7AA 4X2FA 4OBOA 5HCYA 4L3PA 3C4ZA 4UZHA 3GT8A 4F7NA 4APPA 3FE3A 4UMUA 3Q4TA 3F5PA 1IR3A 4FKUA 4EH8A 3VUHA 1OUYA 4UMQA 3U9NA 4EOQA 2C3KA 2HWOA 3GXLA 2PVYA 5KMMA 3R7IA 3QGWA 4OT6A 5IA2A 4AGCA 2GFCA 2JDSA 3EQDA 3PVBA 4IQ6A 4X3FB 3RM7A 4FTUA 4L3LA 4YZ9A 5E8UA 2OXYA 4WKQA 2R2PA 3E92A 5CAVA 4O7ZA 4HPUE 4G3CA 3Q53A 3LJ2A 4M68A 4OT5A 2A19B 2WOUA 4W8DA 4FVRA 4FTOA 4LQMA 2GNFA 3M42A 1V0OA 3IOKA 4DFBA 3GQLA 4BCKA 3QA8A 4KNBA 4L01A 4E4NA 5K9IA 3R7GA 4A06A 3FBVA 3KRLA 4IX6A 1H01A 4G6LA 4USDA 3TKUA 4ONAA 3VW8A 4BDIA 3ZSIA 3SKCA 2QC6A 2AC3A 3RCDA 2C6IA 2X7OA 3EZVA 3TIYA 1FVVA 4IC7A 3ZFMA 5L6PA 1ZYSA 4FEXA 4CG9A 1OKZA 3W2CA 3NEWA 3TG1A 4MF0A 5AP6A 3P08A 3EL7A 4IWPA 2OXXA 5IMXA 2O0UA 2VAGA 1KV1A 3F2RA 3CC6A 5LVPA 3TUDA 5B2LA 4TKSA 3LCKA 4OAVB 3WZKA 4I6HA 5EHLA 3KRXA 2W1HA 3MW1A 2FSMX 3FMEA 4MWIA 5C4KA 2BMCA 5AADA 1ZZLA 4F9WA 3I79A 3B2TA 2GTNA 4L6QA 4AF3A 4DEHA 2YCSA 5HBJA 2PYWA 5IQBA 1Q8UA 4IAKA 4L43A 3R7YA 3PTGA 4OTRA 3JVSA 4YJQA 4OTHA 2BIYA 2PZ5A 3EWHA 4HGLA 5JFSA 1AQ1A 1Q3WA 4ACHA 4YPSA 3SOCA 3ALOA 2OW3A 3Q4ZA 4I1ZA 4YP8A 4BDKA 4YPDA 3FSFA 4JQ8A 2I0YA 4O0UA 4YJRA 4YC3A 2J0KA 3QYZA 5D11A 3ZO1A 5AR3A 3REPA 1OM1A 1OKYA 4L53A 4WA9A 4CVAA 2XF0A 2Y0AA 3QFVA 4XP3A 2C3JA 5AP5A 5A3XA 5AP2A 2BHEA 3OW4A 4O38A 1UU7A 3MY5A 4KS8A 1SNUA 1OI9A 2BRNA 2YACA 1FMOE 2YM7A 3QTXA 3OBJA 4TNBA 5BMMA 5FDPA 3UDBA 1L8TA 4PTCA 4D2TA 1KOAA 1JKLA 3MBLA 3QCSA 3U8WA 3H4JA 4GVJA 4FNXA 4DC2A 3G9LX 4FG8A 3C9WA 4GT4A 5CASA 3OC1A 2KTYA 5DLSA 2HAKA 4R3CA 4U42A 4AE6A 5BX0A 4QQJA 5C8MA 1JSVA 5AX9A 4BIEA 4Q9ZA 2QOKA 3GENA 4FK3A 1AGWA 2R7IA 4TT7A 4E4LA 5M4CA 3WZDA 3MFRA 3PYYA 2GHMA 2JAVA 4Q2AA 4CFUA 3QRUA 3KXZA 3QUPA 4JAIA 4O81A 4OTGA 3HECA 3MH2A 1AD5A 1A9UA 2WTDA 3IGOA 2WMXA 3SXRA 1ZMUA 4ZSAA 5JSMA 3WZUA 5HU3A 3HV6A 4O1PA 3RAKA 3U55A 5E4HA 4I0RA 4AGDA 2C6OA 3PUPA 1JWHA 3K2LA 3MGYA 4AX8A 2X1NA 3UYTA 4UMRA 2ZM3A 3ZBXA 3M1SA 5I9ZA 2EXMA 4FYOA 3U6IA 3N51A 3VUGA 5EQYA 3U9CA 1Z9XA 3FI8A 4FTKA 4AQCA 3A7HA 1UVRA 4X0MA 2J90A 3G6HA 3LPBA 3QQLA 4ZXTA 2V0DA 2Z2WA 4ZEGA 4MF1A 4V0GB 5E1EA 2VTNA 1URCA 3L8VA 5CF5A 4YNEA 3R9RA 2F7ZE 2VWWA 3N4UA 2XNBA 3A2CA 3FZSA 4I5HA 5AAEA 4R3PA 5CU2A 4MYGA 4JJRA 4AN9A 5JMSA 3KK9A 4QMSA 1SNXA 2XS0A 3I0QA 5H8BA 3BI6A 4RX5A 1Y6BA 3AT4A 4F1OA 4E5AX 2CLQA 3VVHA 2OJIA 4DFYA 3W2OA 3EQRA 4EYMA 1CTPE 4I0TA 5DIAA 1Y8GA 2R3OA 3QRTA 1U46A 3D94A 3DLZA 3D5XA 3P79A 2R3HA 2W4JA 3PFQA 4FKIA 2HOGA 1IAJA 4FIJA 3D7TB 4N4SA 4X7QA 5G6VA 4AZWA 2BR1A 3GI3A 5G1XA 2I40A 1VYZA 3GEQA 4CMTA 4FNWA 4M14A 3TDVA 2Z7SA 3NUNA 3PVGA 3SLSA 2RSVA 3R02A 5CT7A 5E8WA 3CY2A 2W9ZB 4IWDA 4HGTA 4CG8A 4AZVA 3IS5A 3NIEA 2VWIA 3T3UA 4BCGA 4CCUA 4RRVA 5BVKA 1O6KA 5FRIA 4GIHA 3ZOSA 4XBRA 1WMKA 2V22A 3E93A 4FSNA 4XRLA 3V5JA 1P14A 2CDZA 3NNUA 1QMZA 4NM7A 5I0BA 1H1QA 3WF9A 4EH7A 4TPTA 3GC9A 3LE6A 3ODZX 4KIKA 4RFYA 4IWOA 3AMBA 5EDPA 3W55A 3OFMA 4KD1A 4BDJA 3ZO3A 2BAQA 3BHHA 4UWCA 4XLVA 3PXQA 4E4MA 5JEBA 4BWXA 4I5MA 1Q97A 5DBXA 1B38A 3UOLA 4JIKA 4FKTA 4LUDA 4U0IA 3VULA 2XIKA 3UJGA 3ZH8A 4QQCA 5ANDA 4ZZOA 3GC0A 3FL5A 4C4IA 2UV2A 3NZ0A 3PVUA 3VBXA 4AE9A 5AV2A 5J79A 5M06A 5DEWA 3BBTB 3LXKA 4TRLA 3PWYA 2WMBA 5FTQA 4B99A 5IQCA 3R8VA 3R9DA 4PMPA 2XB7A 2C6TA 3TDWA 4DHFA 4A4LA 1YOJA 2VWZA 2GQRA 1FGIA 5CU4A 2Z7LA 2HY81 3VUMA 3VQUA 4RJ5A 4RJ6A 3NWWA 4DFUA 1FPUA 4ANNA 1P5EA 3SGCA 4FL2A 2FA2A 4F09A 3F5UA 1Q8TA 2Z60A 4IAFA 4IEBA 5FBNC 3R6XA 4BYJA 4ITIA 1BMKA 4D4SA 4QPMA 4LRKA 4APCA 4LGGA 3O7LB 2P2IA 5IQHA 4CZYB 2CCHA 1ZWSA 2ACXA 2PZIA 5AUWA 4NM3A 4NJDA 3MVHA 3F7WA 3W2SA 3BQCA 1KE9A 1H0WA 2OSCA 2P55A 4JVGA 1UA2A 4MHAA 2ITYA 2IVSA 1K2PA 3DPKA 3K5UA 3Q2MA 4OTIA 4E8AA 3PVWA 4FC0A 3BYMA 3OWLA 3HL7A 4B8MA 4BDHA 3F2AA 4JL9A 4J8MA 3D9VA 4BCJA 4PNKA 4IIRA 1FOTA 3R7UA 3LLAA 1OL2A 4AA5A 3S1HA 3EFJA 3QRJA 3R9HA 4FSZA 2FB8A 4DBNA 3NNXA 2G15A 3MPTA 4NIFA 3PSCA 3GQIA 4ZSLA 2ZVAA 2JIUA 1OIYA 3FKLA 3CQEA 4ZTQA 5HD4A 3Q32A 3FDNA 3AXWA 3EL8A 3L9NA 4TL0A 5KCVA 3SDJA 5A4TA 3ZFYA 3C51A 2YAKA 5IUGA 3W2QA 3KKVA 4UY9A 5EM8A 1SVGA 1WFCA 2UVZA 4UV0A 3C4XA 4MBJA 2QHMA 4MXOA 3NIZA 2ZM4A 3VF8A 2E9NA 5EK7A 4QP4A 3C5IA 4TYIA 3KRRA 1P2AA 2HELA 3KXXA 3W16A 2CKQA 2XJ0A 4R78A 3UP7A 3BHVA 5DT4A 2G2HA 5EFQA 3LIJA 5L8KA 1CKPA 4DLJA 2HCKA 3MJ2A 5IH5A 4EK8A 3T9IA 3BYOA 2I1MA 2JIIA 4KRDA 4CCBA 4JLCA 1BL7A 4LRJA 3QKLA 4H39A 5GNKA 4FV6A 3M11A 4FSUA 2B52A 2ZJWA 1G8AA 5HORA 5KO1A 3IOPA 1WBVA 2X2LA 2XH5A 4U3YA 4WNMA 5LVMA 1PKDA 5TT7A 4HVGA 5ACKA 3S00A 3ATTA 1KWPA 2E2BA 2VX1A 2ZDTA 3PPZA 4BYIA 4H05A 4N57A 4AW2A 3LQ5A 4E93A 1UWHA 2JAMA 2OKRA 3BKBA 1U59A 1E1VA 4ITJA 4XCUA 3U87A 3BGZA 3R9OA 2JKQA 2ZB1A 2GNHA 4AOTA 4FL3A 2IVVA 2DQ7X 3ACKA 3UYSA 3KMUA 4IM3A 2RF9A 4QT1A 4MXXA 2GFSA 4F9AA 3F6XA 4O96A 4FZFB 4BN1A 3D5VA 3ERKA 5DRDA 3FC1X 2JIVA 3VS1A 3UIBA 3A62A 4JG8A 5KUPA 3P86A 3ZXZA 2PE0A 4CFWA 2BZIB 2PUUA 3QLGA 5KZIA 3QTWA 3FQSA 4PP9A 2YLFA 2R3MA 2RFNA 1R0PA 1Q24A 4QTBA 3QQKA 5EHOA 4D1ZA 5J7HA 2CKEA 4AOJA 1FBNA 4YUQA 2R3JA 5E8VA 4BGHA 5IQGA 4G31A 1OVEA 2XK8A 5CSXA 5LMKC 5DR6A 2OLCA 3II5A 4YZMA 4WSYA 3MFTA 2UVXA 4AOIA 3DXQA 2C6LA 5EYCA 5J8IA 4AZSA 4AP7A 3OMVA 4MH7A 2PVKA 4MWHA 4Z9LA 4F4PA 5GIOE 4XBUA 3RPYA 2Y4IC 2BTRA 1HOWA 5TOZA 5M57A 1YHSA 2UW7A 1BI7A 2XJ2A 3AD4A 3OW3A 4ITHA 5FGKA 3F7ZA 4D0XA 1FVRA 2R3NA 3FXZA 4DEAA 4FKOA 3BCEA 2PVJA 4FBXA 4HW7A 1YRPA 2HW7A 2JD5A 3UOHA 3ZRMA 4DGGA 4NWMA 3RPOA 4ZLYA 2YN8A 4J98A 2OG8A 3O17A 4TYHA 3C1XA 1E9HA 2R3PA 5HLWA 5CX9A 4ANOA 2BZKB 3FHIA 5JH6A 3RK7A 2OO8X 3QTUA 3TWJA 4O0WA 4DTBA 4R6VA 3DB8A 2H34A 5DI1A 4G5PA 3UVPA 2JKMA 4MNEA 1H24A 2VTIA 1BUHA 4H1JA 2RFEA 4IAAA 4XH6A 4CRSA 5CEMA 1MRUA 3FYJX 3W33A 4AN2A 4W9WA 2QOOA 4FKQA 1JOWB 2FH9A 2ZMCA 5BVWA 4ZTNA 4ZSGA 3UG1A 2VGOA 1QL6A 2XIZA 2UZOA 2X8DA 2V7AA 2VTSA 4O0XA 4FTNA 3UMWA 4Z7HA 3LFDA 5AV0A 4F6UA 2VWBA 5ETCA 1H1PA 3FV8A 4IAZA 3PZHA 3F3ZA 4QQTA 2PVHA 4Z7GA 1OIUA 3JR1A 3GCQA 4O82A 4YJTA 5CI6A 2XIYA 5ANIA 5T68A 3V01A 5HG7A 4YSMA 4B0GA 1QPEA 1LEWA 3EOCA 3LFCA 1DI8A 4ASXA 3VHKA 4C02A 1APME 4Y5QA 2Y8OA 4F9CA 2O5KA 1CMKE 3D0EA 3C4CA 2ZAZA 4D4VA 2J5FA 3TI1A 2JEDA 3KXGA 3IW6A 3LFAA 2WTCA 4PL4A 3TEIA 3ZLXA 4ANSA 1LUFA 3VS5A 2J5EA 3DAEA 4F65A 5J7BA 1DI9A 3ZO4A 2RKUA 3FZTA 4IDVA 4AS0A 4CLJA 4DYMA 2WQEA 3S0OA 2XKFA 4L44A 3TNPC 4UMPA 4B6LA 4EOSA 4XV1A 3GNIB 5FXQA 3D83A 4C4EA 2UW4A 4X3FA 3R7EA 1NT2A 4BR3A 2EWAA 1QPJA 4ALWA 3KRJA 4QP7A 2UZTA 5EW3A 5I9YA 2ETKA 3E64A 1H1RA 2BDWA 1H28A 4PMTA 4AG8A 5CF4A 2AYPA 4Y95A 5CQUA 3T3VA 2WU7A 4FSQA 3NW6A 4V05A 2GNLA 4RGJA 2PVMA 3QCXA 4TNDA 4ANMA 5KZ0A 3PLAE 5CVGA 3MB7A 2YDKA 3BHTA 4CKIA 4CEGA 3VNTA 3HMMA 3P78A 4JRVA 3SC1A 3DTCA 3H10A 3UOJA 3QZGA 2QOBA 3PZEA 3DKCA 5EYKA 3Q9XA 4RSSA 3K3JA 2YM3A 1OPJA 2XNPA 4FI1A 4FTIA 4GK4A 1ZMVA 2VGPA 5DPVA 1YDTE 2IW9A 5ETFA 5A4QA 4IB3A 3KFAA 5GJFA 2VTPA 1XBCA 1PXMA 3HDNA 4WBBB 5IISA 4P4CA 2R3KA 2CGWA 3MVJA 4XX9A 4DN5A 3L9LA 2XBAA 2BUJA 3DJ5A 3MH0A 2O63A 4C35A 1KE5A 1YDRE 3A4PA 2WU6A 1OITA 4HYIA 3SA0A 3JXWA 3DDQA 4CRLA 5E91A 2OXDA 2BVAA 2V62A 3QL8A 1M7NA 5JZNA 3AC4A 2X0GA 3I5NA 4NW5A 2WQBA 1FMKA 2WMSA 3ZMMA 1HCKA 1M17A 1Q8WA 3CD8A 3CKXA 1H00A 3BU6A 4I23A 4BBFA 3TUCA 4CGAA 3LHJA 4G16A 2RG6A 4C33A 2WQOA 4IJ9A 3R1YA 4O0RA 4S32A 4XOYA 2I0HA 3QUEA 3PPJA 3R30A 3OD6X 3NR9A 3TCPA 4IZAA 3E7VA 1XH9A 5ANEA 4IX5A 2RFSA 4BRXA 4D9TA 5K3YA 1REJA 3VUDA 4NW6A 4FTRA 3O50A 5HTCA 5H2UA 1J7UA 2VTTA 1JLUE 4XNEA 4H3QA 4I0SA 4IBMA 1V0PA 3O2MA 1BKXA 4OBQA 3VS0A 3UZTA 4M0YA 3TIZA 2X2KA 4K8AA 4PRJA 3MWUA 3R21A 5JQ8A 1S9JA 3QHWA 5KKRC 2VNWA 4AGUA 4XHKB 3MV5A 2W06A 2WIHA 5FP6A 5HHWA 3FPQA 3G90X 4RX9A 4IWQA 3LOKA 4XJ0A 5EDQA 3QWJA 3R8MA 4F9YA 3VBQA 3UQGA 2Z8CA 2PPQA 1M2RA 4ZLOA 2J7TA 2OZAA 3LQ8A 4DFZE 4FKRA 4CQEA 4HOKA 1YVJA 5EG3A 5LWMA 4MXZA 5T6KA 5D7VA 4TWNA 3COHA 3QTZA 4D2VA 2YM6A 3L9PA 2PMNX 4XG2A 4A9SA 5HCZA 3MYGA 4RIWB 4O21A 4YTHA 4J7BA 5AM7A 1H26A 3GP0A 3V04A 4DFXE 3GC8A 2R3RA 4U6RA 5JK3A 3C4FA 4YJNA 2XVDA 2QD9A 2X4FA 4EHZA 2LGCA 4YBKA 4K6ZA 2F9GA 2JDRA 4RZWA 1OECA 4GFMA 5J95A 5CXHA 4JR3A 4BZOA 4ZTSA 4UN0C 5DH3A 5HX6A 5IZFA 5FEQA 2DWBA 4MX9A 2XNNA 4ENXA 5E92A 5CEOA 5JGAA 3GCVA 1DAWA 5I9VA 4LL5A 4GJ2A 1NA7A 4LV8A 3H9RA 4EORA 4M97A 4V0GA 5DR2A 5AR8A 4U9AA 3SRVB 3HGKA 4KKHA 1OL6A 1TQIA 1YI6A 1R78A 1REKA 5CYIA 3UODA 4DTKA 5BVOA 4E6AA 4D58A 4FA2A 4GVAA 4NL0A 3QALE 3G33A 4ASZA 3F5XA 1MQ4A 3FLYA 3MESA 2OI4X 4FV8A 5D1JA 5K5XA 3OCGA 5TE0A 3R7VA 5J1VA 4XG6A 4FT9A 1UWJA 2X7FA 4KINA 5HI2A 3B8RA 4F64A 4M13A 3KULB 4H3PA 4PPBA 4PNIA 3KN6A 4E4XA 1H8FA 3MJ1A 3AOXA 3LFFA 2QU6A 3P7AA 5AP7A 5H9BA 4EZ7A 4FGBA 2BFXA 4XV2A 4XG9A 3D7TA 5JQ5A 3MPMA 4G3FA 3ITZA 4NU1A 3DAKA 3F9NA 3A4OX 3OXZA 3PXFA 2UW8A 3UPZA 5HG9A 2C5OA 4D28A 3P4KA 4NM0A 5D12A 4GYGA 3MPAA 4ZS4A 5JRQA 5M4IA 2WEIA 3FLQA 2XCKA 3POOA 1V0BA 2E9PA 4LMUA 4C58A 4QNAA 5DE2A 3QXPA 3JUHA 3UGCA 2FSLX 2CGVA 4EZ5A 4IM0A 4QP2A 5L2TA 4B8LA 1J1CA 2C4GA 5DN3A 3WYYA 4U3ZA 2CJMA 4NZWB 3C0IA 1NVSA 4IZ7A 3OUKA 4RIXB 3LM0A 4A9YA 2UW9A 2ETMA 5IF1A 5LQFA 5CWZA 5ANKA 2OIDA 3C0HA 3IKAA 3G51A 3O8PA 1DS5A 4AZEA 3IQ7A 5KMLA 5LOHA 3BX5A 3UC4A 4KSQA 5D41A 4ASDA 2ZMDA 3FMHA 3MY1A 4XV9A 3ORXA 4ZZMA 3IW8A 5F4NA 3CQWA 3RKBA 1Q3DA 4BDDA 3OCTA 5CSWA 2IW8A 3Q5IA 4LOOA 5CTPA 4CTCA 1IASA 4S30A 3UO4A 3UVQA 4S31A 2G2IA 5AA9A 2WEVA 4IADA 4NM5A 5LCKA 1XJDA 3QCQA 4FIFA 5ANGA 4BZNA 1WVWA 3BE2A 4EJ7A 3SAYA 4O84A 2ITOA 5TKDA 5L4QA 3EKNA 4QMMA 3DB6A 3EQBA 2YISA 4DG3E 1E1XA 2R3GA 4AT4A 4HVIA 4EHEA 3DJ6A 4CFXA 3OY1A 4BCFA 5BVNA 2AUHA 4CFNA 3HMPA 3IW7A 5GZAA 2XRUA 3QUDA 5E8XA 4O7VA 2FYSA 3FKNA 5CAPA 4YURA 3HRBA 3VQHA 1H0VA 2XNEA 2QODA 5E8YA 2FVDA 2R7BA 2UZLA 4QTDA 5I3OA 3HV7A 5I9UA 4KUJA 2YDJA 4O6EA 4WUAA 1IG1A 3D2KA 4O2ZA 3VIDA 5EKNA 4A9RA 4D4RA 4Q9SA 4RIOA 3BU5A 4EH2A 2G2FA 5FP5A 3RINA 3TM0A 3SV0A 2VD5A 3WZJA 5HLNA 1RE8A 3GB2A 1YDSE 3DV3A 3K5VA 4FKSA 5CVFA 5EM5A 3TKIA 5EKOA 2XEYA 4EK4A 2BAKA 3NUUA 4DGNA 3OT8A 3P0MA 1H4LA 3FI2A 5IA3A 2G01A 3DDPA 3KXMA 4U80A 5GIPE 4I4EA 1UNGA 2JDVA 3DXNA 3RAIA 4QYEA 1PF8A 4F0FA 3GU4A 1ZZ2A 4FF8A 4ZLZA 3BYUA 5HBHA 3OT3A 4YZNA 2QURA 2QVSE 4TWPA 5ETAA 4RIYB 2UW3A 2QO2A 3E8CA 2XK3A 4QYYA 2J0JA 5M53A 2CN5A 4G3GA 4FV3A 3E5AA 4G9CA 3TZ7A 4J1RA 1M52A 3C7QA 5KMKA 4WG4A 3KA0A 4BBMA 3MTFA 2H6DA 4GEOA 1VJYA 3BV3A 4AZFA 3R8UA 1UNLA 4PMSA 1R3CA 3E3BX 3FLSA 3CS9A 3UIUA 4OLIA 4FTJA 3ZSGA 3W32A 4B7TA 4TW9A 3TTJA 2I7QA 2C0TA 3NSZA 4O22A 4TYEA 4B9DA 4DG0E 3NYVA 3V5WA 5M56A 4PWNA 3BYVA 3F82A 4MK0A 2BCJA 3G15A 4BFMA 4CKRA 2VTRA 4WUNA 3U4WA 2JBPA 4FTMA 2XA4A 5HESA 2YWPA 2OJJA 4FSRA 3ORLA 4GT5A 3ZYAA 4KRCA 4X2NA 2X2MA 3I5ZA 3DBFA 4CT1A 4YSJA 2X8EA 3O8TA 5H8GA 4MXCA 3OWPA 3V5TA 5KX8A 5CS6A 4XEYA 5CEPA 2XBJA 3BV2A 3MH3A 4ZTHA 3D5UA 5AUYA 1X8BA 3ULZA 4BI1A 2W1FA 5IDNA 1OB3A 1VZOA 1ZXEA 2CN8A 2ZDUA 3QQFA 3HKOA 3PA3A 2HXLA 3QX2A 4X2GA 3RVGA 3CPBA 4QMTA 3E63A 5DOSA 4E20A 1KE6A 1PJKA 3UQCA 1CDKA 2ITPA 3FMJA 3KRWA 4UMTA 4C36A 2R5TA 2OF4A 4M84A 3ODYX 4YO6A 3FLNC 2WTKC 3RZFA 2ZV2A 3PXKA 3HRCA 3DFAA 3G0EA 2XEZA 4O6LA 1PRYA 4V01A 4FNYA 3PG1A 2Z02A 3WILA 4F7JA 2C68A 2YABA 4C0TA 5KHWA 5CU0A 3CTQA 4BHZA 3LFSA 5LJJA 3WI6A 4WRGA 4UWYA 5JFXA 4ZJVA 3Q6UA 3CKWA 4C38A 4BWPA 2J0IA 2OWBA 4MQ1A 2WIPA 2BTSA 3V5LA 2VUWA 3OBGA 4RMZA 2WKMA 5I9WA 2OBJA 4IACA 4DINA 2YDIA 4O7TA 3QC9A 3ORZA 2J0LA 2WOTA 4FSWA 1YOMA 1J1BA 2QKRA 4CD0A 2EXEA 4S2ZA 3CLYA 4EKLA 3OEZA 2PSQA 3PXYA 3PY3A 3G6GA 3FMNA 3O23A 3ZZEA 5EQEA 3R73A 3EFKA 3RK9A 3PJ3A 1GNGA 3A60A 3CCNA 3PG3A 2C5VA 4RX7A 5DRBA 4U40A 4CQGA 3WBLA 4ZY5A 5A4LA 4FYNA 1PXOA 4M7IA 4AXAA 4YZCA 2YAAA 2IVUA 2VTMA 4IAIA 4AUAA 5HTIA 2YZAA 4JBQA 3ROCA 4YLLA 3GFEA 4P5QA 3RCJA 5FLFA 3DY7A 3UO5A 1G5SA 2C6MA 2O2UA 3CJGA 2XYUA 4FIIA 3UNJA 2W1DA 3DOGA 5IEXA 3CP9A 4BCOA 5K4IA 4H36A 3THBA 3V51A 2GQGA 5M44A 2W0JA 3HRFA 4QP6A 4U8ZA 1Q8YA 1TVOA 3QTQA 4GRBA 3RNIA 4JAJA 4U79A 4E7WA 3HNGA 4HVDA 1GIJA 3ET7A 3W1FA 2B55A 3U6HA 4WD5A 2O8YA 2R3IA 4QMNA 1MUOA 2YA9A 5A6OA 3BYSA 3OY3A 3EQPA 2H8HA 3PXRA 2E9UA 1G3NA 2YIWA 3HV3A 4RVTA 4DFNA 5DEYA 3ZUUA 3OTUA 4CYIA 4Y83A 4O7NA 5CZIA 4FVQA 1XR1A 4UWBA 3UBDA 4GFOA 2QKWB 4K9YA 4BDCA 2ONLA 4PPAA 3AMYA 3EFLA 3ACJA 4QYHA 3MFUA 5IA1A 3N4TA 3FY0A 3RGFA 4GU9A 3ZZWA 4OBPA 5CANA 3KF4A 4PDSA 4HYSA 4BCQA 4CV8A 5HX8A 5J9ZA 3FMMA 4U43A 2O65A 3GUBA 4LMNA 4YJPA 4AN3A 4ASEA 4BTJA 3ANQA 3QRKA 3VS4A 5EOLA 4BCHA 4HGEA 4FV2A 5ICPA 2IPXA 5HLPA 4X3JA 1PHKA 2XCHA 3BEAA 5HOAA 5F20A 4FOBA 3QD4A 2WZJA 2W99B 2X6EA 3DFCB 3QD0A 4Q5HA 4YHFA 2R3QA 3UO6A 5KBQA 3FQEA 1S9IA 4L7SA 2PMOX 4KSPA 3VRZA 4OTDA 3MY0A 4IAYA 4LGHA 2FSTX 3CPCA 4FZAB 4NT4A 4PL5A 2JLDA 2QI8A 4YZBA 3SVVA 3OG7A 2X39A 3FJQE 4FODA 2WQNA 3BHUA 3E8NA 3L9MA 3R1QA 4FSMA 3DNEA 2Y6MA 4O7WA 3RPSA 3F88A 4ZK5A 4L52A 4DITA 5AMNA 5C03A 3S95A 1BLXA 3SX9A 3VC4A 2YCQA 4BI2A 4FT3A 5HEZA 3HX4A 4TXCA 3GCUA 3WIKA 3I0OA 4BCPA 3IONA 2QCSA 5K4JA 2PTKA 1ZAOA 3ZUTA 4YMJA 2BKZA 3P7BA 5CEKA 2OIBA 3O7LD 3PSDA 2PUNA 4ID7A 3DBDA 4TZRA 1Q62A 4E6QA 2A0CX 4EQMA 4I6BA 5CU3A
chains in the Genus database with same CATH superfamily
4G17A 4KB8A 4QP3A 4RC3A 3ZEPA 4U45A 1YQJA 1E32A 1HT1E 4IM2A 4FT0A 3RP9A 2W1CA 4DEBA 4BCIA 2PL0A 1SVHA 3CIKA 4F78A 3HLLA 4S12A 4PUZA 4YJOA 2QOFA 2DAMA 1XH6A 4DV5M 1GIHA 1E9SA 3I4BA 2BZJA 1VDDA 4O2PA 4MTAA 3FPMA 2W1EA 2XK7A 2CPKE 2ITUA 3U61A 2BRBA 1GL6A 3QYWA 3UP2A 2VZ6A 3TZ8A 4KIPA 3FHRA 5HNIX 4LOPA 3MDYA 2YM5A 4KIQA 4CTBA 4ZTMA 3RTPA 3LMGA 3QHRA 1BI8A 2XP2A 5GZ8A 3ID6C 4QEBA 3GLHB 4J96A 1PM5A 5HG5A 2QG7A 1W8CA 2B53A 5CLPA 4EC8A 2L4EA 3K3IA 4KIKB 5FTKA 4LJ5A 4AWIA 3R8PA 5LXMA 4BICA 4X21A 3RWQA 3LFEA 1SYKA 4W4VA 5KMNA 4I5PA 2XJ1A 4RZVA 4TN6A 2DZNB 2W9FB 3KEXA 2WXVA 1K3AA 3Q6WA 4MH0E 3HP2A 4DH7A 3AC2A 5TR6A 3VONA 2CNVA 3PJ8A 1NVQA 3ZRKA 1PMNA 1R5LA 3RMFA 3L8XA 4AT3A 1YXVA 5IUHA 4LFIA 1ZQ9A 2QOIA 4TYJA 2I6LA 4FIGA 1KE8A 2ITXA 3VAPA 4F6WA 2H1RA 4KBCA 4C59A 5CNOA 3UZRA 3F66A 2UZBA 3MIYA 2F7XE 1TDZA 4LRMA 1IXSA 5IA5A 5EXPA 4I94A 1O6LA 4UB7A 1M2QA 4EEVA 4ANQA 1YI3A 5F94A 3SD0A 4TWCA 2WHBA 4YJUA 5IQIA 2RIOA 3LMIA 2C6EA 2UZUE 4OTQA 2GU8A 2C5YA 1H25A 5EP3A 4JI7M 2OFVA 4BTFA 3PXZA 1L2CA 4FTAA 1VR2A 3R2BA 2C3IB 3TL4X 5DMZA 3COIA 3SHEA 3QC4A 2V1UA 2W1GA 4H58A 1OIPA 4YJSA 2F2CB 3NS9A 4ANBA 4D4YA 2C9OA 2XARA 2ITVA 5CSHA 3OEFX 4EK3A 1A06A 2ZOQA 3COMA 2BALA 3G5DA 4RT7A 3D4QA 1KUTA 4FUXA 4QMVA 2W82A 4GSBA 1ZV1A 3WE4A 3IW4A 3I51A 3GLIB 3IW5A 5CU6A 4UALA 4X2JA 3Q5ZA 4WRSA 3AMAA 5D7AA 2J5YA 2XK6A 3LCSA 5F1ZA 2PMLX 3DU8A 1VEKA 3RK5A 3FYKX 3C13A 3VBWA 3QQJA 4RJ8A 2NO3A 1PXJA 4QPSA 1OL5A 4ZP5A 1N33M 2B1PA 2BAJA 4TWOA 3LXPA 4C37A 3ZLWA 3TL8A 4L8MA 5L6OA 4AT5A 1RDQE 4F2LA 1GJOA 4MEDA 1R39A 5J9LA 5KMOA 3KCFA 3ZDUA 3KF7A 4CXAA 2ZM1A 3C50A 4Z8XA 4J52A 3D2IA 3UMMA 1JKSA 2V6ZM 2WTVA 5AEPA 5EH0A 3QU0A 3ZTXA 3OOGA 1WVXA 4E1ZA 2GNIA 4MD9E 3COKA 4QNRA 4QMUA 4RC2A 4BCNA 5DFPA 5K0XA 3HV5A 2A4LA 1JR3E 4ZJJA 4YLKA 4Y28F 4USFA 3KP1E 3P9JA 3J7AS 2EO2A 1KYIA 5BR8M 1W82A 3VUIA 2IZSA 4WNKA 5BYYA 4UBAA 1V1KA 4A4XA 2QBYB 4MXYA 2GNOA 2P3GX 3M6AA 2G9XA 3SAWA 5DYIA 3LW0A 3HP5A 5AFVA 3FD9A 1OGYA 4JDJA 4QMLA 5H37D 3LJ0A 2REIA 4MBIA 2WELA 4Y73A 3PVSA 4DG2E 5B2KA 4D2WA 3ZU7A 1TH4A 4XP2A 1W83A 2R62A 3ZBFA 3L8PA 2NNWB 2C6DA 4NSTA 2XLJA 2BFYA 3EFWA 3GU5A 2HK5A 4GKHA 3R0TA 1OKVA 3FEGA 5FLXS 5FDXA 2X0OA 2DAKA 4C62A 2XZSA 4O7LA 2VWVA 3QKKA 4DH5A 4Z55A 3RI1A 4AACA 3TV4A 2F5SA 1J09A 4PP7A 3QD2B 1ZYLA 2C30A 3BRBA 3ZLSA 3OVVA 3Q04A 4ZPXA 4DEGA 3UNKA 1I44A 3QA0A 3R9XB 3DBEA 4EHGA 2ITNA 4FTCA 1OIZA 2CKPA 4DHJA 3LCTA 3W10A 3TXOA 4R7BA 2HHHM 4CFFA 4RG0A 2GDOA 3G9NA 4FV7A 5AR4A 2DVWB 1OPKA 3I6UA 3T9TA 1PXLA 4P5ZA 4MVFA 4E5BA 1LEZA 2J50A 3ZHPC 4O7RA 1T6OA 3DJ7A 2XNGA 4AA4A 5HU3A 3UDSA 2JC6A 3B7QA 2XIXA 2C6KA 1RQQA 3HY5A 2WTKB 5LVOA 4RNAA 4NTTA 2YNMD 4XYFA 4AI6A 1YXUA 2PE2A 3UK6A 4IJPA 2IZUA 4EOLA 2QCUA 3PP0A 5E9EA 4EHVA 2CMWA 2HY0A 3Q3BA 4IE9A 4NTSA 4AAYA 2ITTA 3IECA 3DTWA 3QF9A 4O91A 5AX3A 5LMKA 2BIKB 2ITZA 1P3QQ 2NP8A 4PDOA 4O4EA 1Z6TA 3A7JA 3HU3A 4G34A 5M55A 4GK2A 4IBKA 2B0QA 4GIPA 1WCCA 5B0XA 3NAXA 3EJ1A 4JRNA 3IPHA 4IBCA 2Z7QA 2WQMA 4YC6A 5IH4A 2VU3A 1BL6A 1PYXA 4FOCA 3VBYA 3EN6A 4YHHM 3R04A 5DA3A 4A4OA 2BHHA 5C9CA 4BVUA 4MBLA 3ZC6A 3VK7A 3RFWA 2PZRA 5BUIA 5HCXA 4TYGA 1UNHA 3DNDA 4GUBA 5C8KA 2HW6A 3GLGA 2WMAA 4FEUA 3FC2A 2J51A 4BDEA 4RQKA 5AIRA 1YWVA 5AA8A 4ZTRA 5IA4A 5IQFA 3NAYA 2KZSA 3SQQA 2FGIA 3H0YA 4CZUA 4YLJA 1ZLTA 4DFLA 4BKJA 3KP0E 1OAOC 3FKOA 2DHYA 1KSWA 2JA2A 4HCTA 3BL7A 3I81A 4C4GA 5LVLA 2P2HA 2WMRA 3M2WA 4NH1A 2UZVA 4NL4H 2CFOA 2IJMA 3A8XA 3EQFA 1OUKA 1Q02A 4M9ZA 3ANRA 4RX8A 5DVRA 1JNKA 3MSSA 4S34A 3P23A 4D5HA 5KQ8A 1N34M 4EWQA 2BRGA 3MA6A 4JNWA 2I0VA 3HGIA 4PPCA 4FUYA 1GZOA 2CHGA 4UEUA 5JGBA 2B9FA 5AP0A 2W17A 4QOSA 2DS1A 1SM2A 4NRVA 3Q60A 5C27A 1L2BA 2HENA 4GFGA 2BRHA 5AR2A 3WIGA 1M14A 3OCBA 1YKRA 2JFMA 2BPMA 3LZBA 3FRHA 2BILB 3C4EA 4K2RA 4NIFB 1TR8A 2YM4A 3CTHA 3DZDA 2CNUA 1XBAA 4IB0A 4KKEA 2GSFA 4JDHA 4GJ3A 5M51A 4Z6YA 4W4WA 1XBBA 4I24A 3UVRA 3L25A 2WO6A 2VTAA 3GOPA 4OW8A 2W1IA 3RPRA 4PDIA 3GRUA 4EH5A 4EC9A 4F08A 4FGRA 2PVNA 3VDUA 3GVUA 4FTLA 4D2RA 3EQHA 5FG8A 1A48A 3F3WA 5LMUM 1HNXM 4FRFA 1NNJA 3C5UA 1F3MC 4IFCA 1IN7A 2J6MA 3U61B 4I21A 2G5GX 3RAWA 2FUMA 2R4BA 3PXGA 2BZHB 4L45A 3VS2A 5BPVA 3CXWA 2RL5A 4RJ4A 2WPAA 5GKNA 4EOMA 5IEYA 4DUYM 5FWKK 1ZY4A 5AUUA 4NEUA 5CQWA 2XSZD 3V8WA 5L2IA 4TYHB 1WBNA 4D80A 5CF6A 2J2IB 2OIQA 2Y4PA 1GY3A 3TWLA 4C7TA 1WVYA 4CMOA 3DCVA 3I7BA 4FIHA 2IZRA 4RVLA 3BZ3A 2PZYA 5AUTA 4QD6A 4RWJA 1FVTA 4QTEA 2QHNA 2C9CA 2FH0A 2XKEA 2CNQA 5IKWA 3SW4A 3U5ZB 5JFVA 4QYFA 5M4UA 5HNGA 4CYJA 2OK1A 2A1AB 2B7AA 4X2FA 4OBOA 3GT8A 3FE3A 4UMUA 4FKUA 4DV2M 3VUHA 3U9NA 4EOQA 3FTEA 2PVYA 5KMMA 3R7IA 2L6OA 3U6LA 5IA2A 5CAVA 4AQYM 3Q53A 3LJ2A 1QQWA 4FVRA 4FTOA 1SXJC 4LQMA 2GNFA 3M42A 1V0OA 3IOKA 3GQLA 4KNBA 3FBVA 3KRLA 4IX6A 4BDIA 3AKKA 2QC6A 1FVVA 3ZFMA 4FEXA 4CG9A 3P08A 3EL7A 5IMXA 1KV1A 4OAVB 4I6HA 2WSCF 5EHLA 2W1HA 3MW1A 2FSMX 4MWIA 2Z7JA 5JI3E 2BMCA 5AADA 3B2TA 2GTNA 4DEHA 3P5JC 4YJQA 4II7A 4DHZA 1D0KA 3ALOA 3Q4ZA 3FSFA 4JQ8A 2Y0QA 3REPA 2XF0A 5AP2A 3MY5A 2R45A 3UDZA 4TNBA 3MBLA 4HL4A 5CASA 3OC1A 5DLSA 5BX0A 5C8MA 5AX9A 1SXJD 5M4CA 1YE9A 3SXRA 2WMXA 4ZSAA 3U55A 4I0RA 3UYTA 4LJAA 4FYOA 3U6IA 4AQCA 3LPBA 3G6HA 3QQLA 1URCA 3R9RA 3N4UA 3A2CA 5AAEA 1GJTA 2X49A 1SNXA 2XS0A 2CLQA 2XZFA 1CTPE 1Y8GA 1U46A 3P79A 1VEJA 1IAJA 4N4SA 4X7QA 2CUZA 1VYZA 4CMTA 2Z7SA 3NUNA 2RSVA 5CT7A 2W9ZB 4HGTA 5BVKA 1O6KA 4GIHA 2JNHA 3V5JA 5I0BA 1QMZA 2DKLA 4EH7A 3W55A 3AMBA 4KD1A 4XLVA 4I5MA 2MJ5B 4LUDA 2HWJA 3CTWB 2WSFF 4ZZOA 5J79A 5M06A 5DEWA 5IQCA 4IBGA 4PMPA 3TDWA 1FGIA 2Z7LA 2HY81 3VUMA 3AKLA 4RJ6A 3A98B 1Q8TA 1I4WA 3R6XA 4ITIA 4LRKA 4APCA 2ACXA 4I6LA 3EIEA 5DFLA 2OSCA 2P55A 4JVGA 2LXEA 4XBOA 1K2PA 3Q2MA 3OWLA 3HL7A 4B8MA 4BDHA 3F2AA 4JL9A 4FSZA 1MJGM 2ZVAA 1OIYA 4ZTQA 3FDNA 4TL0A 3SDJA 3KKVA 1SVGA 2K9DA 2ZM4A 2HELA 3W16A 2CKQA 2XJ0A 4R78A 3UP7A 3BHVA 2BJWA 3MJ2A 4EK8A 3BYOA 4H39A 4NC6A 2B52A 2M5ZA 4WNMA 4LGYA 5LVMA 1PKDA 3S00A 1KWPA 4AW2A 3LQ5A 1UWHA 2JAMA 2CV1A 3BKBA 3KS4A 3R9OA 4AOTA 4FL3A 2IVVA 2NQ8C 4K0KM 4LFCM 3VS1A 2Q2EB 3A62A 4JG8A 3P86A 1QZMA 3QTWA 5EHOA 5J7HA 5E8VA 5IQGA 2F5OA 4YZMA 4AOIA 3JR4A 5EYCA 2BWEA 5M57A 2XJ2A 3OW3A 4ITHA 1FVRA 3GPYA 3UOHA 2OG8A 3C1XA 1IBMM 5JH6A 3RK7A 4O0WA 3LW5F 2H34A 1H24A 3GLGE 4H1JA 1MRUA 1JOWB 3UG1A 3HKPA 1QL6A 2VTSA 4FTNA 1SG9A 2VWBA 5ETCA 3F3ZA 4QQTA 4Z7GA 2C96A 4O82A 1K3XA 2XIYA 5T68A 3EOCA 1DI8A 2L7IA 5ITYA 4F9CA 3AKJA 3TI1A 3LFAA 4F65A 1DI9A 3ZO4A 4IDVA 4LY6A 4C4EA 3R7EA 4FW9A 4F1IA 4QP7A 3E64A 1TDHA 1YLAA 4PMTA 1OTRA 4Y95A 4V05A 2GNLA 2PVMA 1HT2E 4TNDA 5KZ0A 3P78A 4JRVA 3UOJA 5EYKA 4RSSA 3AFHA 5DPVA 1XBCA 3NWLA 3DJ5A 4C35A 3A4PA 3GLGB 2X0GA 3I5NA 1Q8WA 2AEGA 3CD8A 3CKXA 4BBFA 2RG6A 4IJ9A 4XOYA 3R30A 3OD6X 4IZAA 5ANEA 5K3YA 5HTCA 5H2UA 1JLUE 4IBMA 4OBQA 4B7FA 3FPQA 3G90X 4IWQA 2J7TA 4DFZE 4CQEA 5LWMA 5D7VA 4TWNA 3L9PA 4XG2A 4J7BA 3GP0A 4U6RA 3C4FA 4EHZA 2QD9A 4YBKA 3DFZA 5J95A 4UN0C 1L2DA 2XNNA 3BOSA 3H9RA 3W0QA 3HGKA 1TQIA 4E6AA 4D58A 3QALE 3G33A 1MQ4A 4FV8A 5K5XA 3OCGA 3R7VA 1H8FA 4FCWA 4FGBA 4ITQA 4XV2A 3D7TA 3MPMA 3DAKA 3PXFA 3UPZA 2H5XA 4D28A 4ZS4A 5JRQA 2WEIA 4C58A 3JUHA 4EZ5A 2RRUA 2OOBA 4U3ZA 3RE8A 1NVSA 3GLFA 4RIXB 5IF1A 2OIDA 4AZEA 3IQ7A 3AOEA 4KSQA 3C58A 5F4NA 1IASA 4S30A 3UO4A 4NSOB 3SMPA 4LGMA 4BZNA 3J7BA 4QMMA 2YISA 3OY1A 4CFNA 3QUDA 2FYSA 4YURA 3HRBA 1H0VA 2XNEA 5E8YA 2FVDA 2R7BA 2UZLA 4X66M 4WUAA 3D2KA 5EKNA 2VD5A 3DV3A 4GEWA 2XEYA 4EK4A 4I4EA 4FCTA 2JDVA 3GU4A 4B08A 4QYYA 4DUZM 3C7QA 4WG4A 1VJYA 4AZFA 1R3CA 3FLSA 3ZSGA 3W32A 4MK0A 2VTRA 3IG5A 2JBPA 4GT5A 2OJJA 4X2NA 3DBFA 4CT1A 5H8GA 4MXCA 1NJGA 2XBJA 4ZTHA 1XMQM 2W1FA 3HKOA 1CDKA 4C36A 2R5TA 3HHZA 1JR3D 2WTKC 2DAIA 3PXKA 3HRCA 3DFAA 1PJIA 2JUJA 3PG1A 2YABA 5LJJA 4WRGA 2KHHA 4ZJVA 4MQ1A 2D7HA 3V5LA 2VUWA 4RMZA 2WKMA 4IACA 4LF6M 4O7TA 4FSWA 2WOTA 1NJFA 5BV3A 4CD0A 2EXEA 3FMNA 4O4CA 3CCNA 5DRBA 4U40A 4ZY5A 4FYNA 4M7IA 2IVUA 2YZAA 4YLLA 3DOGA 2VDBB 3V51A 2W0JA 4U8ZA 1Q8YA 4HVDA 3W1FA 3U6HA 1MUOA 2YA9A 3EQPA 2H8HA 3KIOC 1BVSA 4O7NA 1XR1A 3UBDA 4MUQA 3ACJA 3ZZWA 4OBPA 3NFGB 4HYSA 3HX3A 5J9ZA 2O65A 3ANQA 3VS4A 5EOLA 4BCHA 5HOAA 5F20A 4FOBA 2WZJA 4Q5HA 4YHFA 3FQEA 1OQYA 4L7SA 4OTDA 4LGHA 3CPCA 4FZAB 4YZBA 2ZM6M 3OG7A 3FJQE 3L9MA 2Y6MA 3F88A 4ZK5A 3ZC7B 4BI2A 4FT3A 3I0OA 3IONA 5K4JA 1ZAOA 3ZUTA 2APLA 3P7BA 5CEKA 3PSDA 3NFFB 2UZDA 1OZ1A 3LFQA 4BZDA 5DHJA 2R0UA 3MHVC 2XMYA 3NUXA 2I0EA 5HO7A 3W0SA 2UW6A 2PULA 3QTSA 4R8QA 2DWNA 5HE3A 4QMQA 2G8LA 3A61A 3EN7A 1V34A 3OZ6A 3SXSA 2Z8YM 3LCOA 5EP1A 5AAFA 4O1OA 5AV4A 5E90A 4DAWA 3WF8A 4RVMA 3JYAA 2YIYA 5FXRA 5IQDA 2QR8A 1PJJA 4K18A 3C9PA 4I3ZA 4IJEA 3E8EA 2GS2A 3J81S 4LUEA 4G3EA 3DBCA 4R1VA 2OJGA 4I6FA 1WBPA 3DK3A 3O0GA 4RA4A 3PDTA 4DF3A 1ZYCA 4DR7M 3FAAA 3QRIA 5AR5A 2RGPA 1PW2A 4B3TM 4EONA 4FTQA 1IRKA 1U54A 3GPXA 3ZRLA 4R5YA 4M12A 2B54A 4UZDA 3WF7A 3U6JA 5LARA 1J91A 2XNOA 1IN5A 2R3LA 5JT2A 2GQFA 3E88A 4F70A 3OS3A 3U4UA 4J53A 2GS6A 4KWPA 2UXDM 1VEBA 3CQUA 4JG7A 3V8SA 2DUVA 2Y4IB 4UYAA 2CKOA 3KULA 4MGYE 3KDSE 5HU9A 2E9OA 3DS6A 5HTBA 1O9UA 2EJSA 1G8JA 5CENA 2WNTA 2PWLA 2MGWA 3FZ1A 4RF0A 3BPRA 1QANA 2PUPA 5EJCA 5AWMA 3R00A 3VS3A 4NJ3A 5KHXA 3RBWA 3AC5A 4YC8A 5A9UA 3D14A 4JN6A 2J0MB 3PNVA 4DH1A 1Q8ZA 4XG3A 4DDGA 1PXPA 5FM3A 3UOKA 3W2RA 2ZB0A 1GOLA 4PY1A 3P7CA 4D1SA 2WAJA 3H4MA 5EOBA 2FS1A 4EH3A 3KMWA 3HEGA 5DT0A 2XZUA 4FK6A 3V6RA 3RHXA 4EQCA 2VTJA 4M8TA 4F0GA 4OTWA 3NUPA 5A4EA 3RPVA 5EI2A 4AFEA 1XO2B 3BELA 4M3QA 3CJFA 4FZ6A 4P7EA 2YFXA 1D0LA 2Y0TA 1XKKA 4ZSEA 3ENMA 1Q99A 3MK6A 3HU1A 4WT6A 4I92A 1Q4LA 3ORMA 3T6PA 4FKGA 3EMGA 3DKOA 3HA8A 1GZ8A 5E8SA 2XKCA 3EN5A 2ZTCA 3CTJA 3A7IA 3KOXE 3FWQA 4BDGA 3ULIA 3D7ZA 5KKRB 4C3FA 3CEKA 4E73A 2W4OA 5IREB 1GZKA 3HDMA 4JBPA 1Q61A 4EH9A 4DR5M 2YERA 1PKGA 4O7SA 1QCFA 2AHMA 4M0DA 4L67A 3G0FA 4J71A 4ZMFA 2PVLA 3FMDA 4LJ7A 2GNJA 3BIZA 2OQ4A 2D7EA 3HUBA 2QOLA 1Z59A 5DNRA 4FIEA 1FQ1B 2ITQA 1W84A 2VTHA 1X37A 4IXPA 2HYYA 5JGDA 4FZ7A 2VQFM 5F9EA 2PVFA 3KY2A 4R1YA 3R7OA 1XB2B 3R8ZA 3NYOA 3GU8A 3HYHA 2XRWA 4I8OA 5HIDA 1ZMWA 4MGIE 4RVKA 4JXJA 5AUVA 4J8NA 3FUVA 3TWMA 4DCEA 3F2NA 3MB6A 4Z16A 3QBNA 4R3RA 4AGWA 3D5WA 4R5SA 2CCIA 4XGIA 5KMIA 2X9EA 3MN3A 4G6OA 4LJ4A 4YHTA 3QZIA 4WSQA 3EYHA 3NYNA 4XG7A 3TUBA 4BIBA 2LVAA 2OU7A 2KEBA 4FKLA 3QAUA 4U44A 5FQDC 1W0XC 3DT1A 2HL7A 1TKIA 4LG4A 4EOJA 3FQHA 3GLFE 3LM5A 4RFMA 1D2NA 4U97A 1DGBA 2EVAA 3W8QA 4XRJA 4XP0A 3KOYE 5BVDA 4L00A 4QMXA 2PE1A 4GKKM 4HCVA 1HNWM 4AG6A 2N35A 3V6SA 1FNNA 3FI4A 4DV3M 3QQUA 3EN4A 5IDPA 2C1BA 4IBJA 1Z5CA 2WTJA 1S3SA 2QQ7A 3DKGA 4A3VB 3ELJA 2O25A 2O64A 1MRVA 4Y72A 2W4KA 4I5SA 2R9SA 3R2YA 3GU7A 2WMVA 3ZS5A 5L8JA 2IG7A 2ERZE 3GLFB 3EHAA 3OOMA 4RBLA 5JFWA 4NUSA 4IVDA 2V5QA 3HMNA 4BB9A 5IG1A 2WTIA 3PIYA 1IQPA 4ZS0A 5LCJA 3AT3A 4Y8DA 2RGOA 1UU9A 4QTCA 3LVPA 2IN6A 4AZTA 4MM3B 5M09A 3NNVA 3R63A 3PY0A 3L8SA 4QP8A 4JI5M 4C34A 2X4ZA 5CF8A 4CNHA 2UW5A 4L8RC 3NW7A 4LF9M 2NRUA 2UUEA 4YTIA 3PPKA 4B4LA 3MTLA 4O83A 2CSNA 3CD3A 4IZYA 1LPUA 4PDPA 4OW0A 5ITAA 3KXNA 4Y5HA 4E6CA 4ZAUA 2QLUA 4ALUA 5EXSA 1Y6AA 3TV7A 3W8LA 3ETAA 3BWJA 2EB3A 5HE0A 1DGHA 3IK3A 4ZY6A 2XKDA 3O71A 4UXLA 1LV7A 4WNPA 1TQMA 2O3PA 2LVOC 3TNHA 5JZJA 5BYLA 1JAMA 3TV6A 1UV5A 3THGA 4AW5A 2Y20A 2OOAA 4BKZA 1SMHA 3JVRA 5C01A 5L6WL 3JY0A 3POZA 2RKOA 3LFNA 3P1AA 4FZDB 3PA4A 3V5QA 3TMOA 1DO0A 4G4OA 1W98A 3GLIA 3IO7A 3IG8A 3ZONA 4FEVA 2VN9A 1NW1A 4NKAA 5M07A 3VUTA 3FI3A 1JKKA 4FJVA 3NX8A 4LZJA 2CRUA 2RG5A 4IW0A 4A07A 5CAQA 4ZOGA 3A45A 5K0KA 5IA0A 1J7IA 2PMIA 5EXXA 2GQSA 3TNWA 5A6NA 2XEPA 4IB1A 4EH6A 1IXZA 2C3LA 3EN9A 3R1SA 3WHKA 4EKKA 2R0IA 1DGFA 4O86A 2OJ9A 1NHWC 2I7PA 4F6SA 4ERWA 4AW4A 4QYGA 4GKIA 5D10A 2R65A 5ANOA 5CAUA 3PRFA 5EM7A 3QWKA 3R8FA 1UU8A 2BWBA 1ZOGA 1Z57A 5F95A 4DGOA 2KRUA 2ITWA 1XH7A 2BDFA 2ERKA 4L7FA 4YHJA 5A4CA 4JXFA 3BGQA 2Y7JA 5GZ9A 4IVCA 2QOQA 4M0ZA 5J5TA 2UZEA 4U41A 4JBVA 3I6WA 4IX3A 3Q8XA 5GHVA 3R71A 4LOQA 3Q2JA 1JSUA 4WOVA 1PMEA 1YXXA 1L3RE 3OWJA 4F7SA 4XK8F 3N4VA 5C8NA 4XV3A 1N32M 3BWFA 4TY1A 3A8WA 4EOOA 5J1WA 4ACMA 4GIIA 4JBOA 4A9UA 1ZYJA 4PMMA 1GO5A 4DR1M 4PV0A 2VTOA 4IHPA 4FKPA 5B7VA 3W0FA 3TJDA 4DR6M 1N75A 4ERKA 5HNBA 1U5QA 1LTMA 3U54A 4YTCA 1OMWA 5E26A 5FXSA 2KNZA 5HKMA 1PMVA 3QZHA 4K11A 1HCLA 4XMOA 2X7GA 3RM6A 3UE4A 4OTPA 1JBPE 4HZRA 1U54B 4KT0F 3KXHA 4OTFA 4YZDA 3BLAA 4MD7E 4AXFA 5L8RF 1Y57A 4LF7M 3H9FA 5DYJA 4GC5A 2VTLA 4JI9A 4WNOA 3L29A 1Q41A 1JQJC 4QMPA 5HCYA 4L3PA 4APPA 1IR3A 2KDLA 2DWMA 4EH8A 4UMQA 2R4EA 4OT6A 4AGCA 2GFCA 4X3FB 2OXYA 2R2PA 3E92A 4M68A 3SFZA 4GMQA 4BCKA 4E4NA 4A06A 3KW6A 1H01A 3SKCA 2AC3A 2X7OA 2XGNA 1TGUA 4IWPA 4TKSA 3LCKA 3FMEA 5C4KA 2UUBM 5IT9S 2F5PA 1ZZLA 3I79A 1NV8A 4L6QA 2YCSA 2PYWA 4L43A 3R7YA 3PTGA 3JVSA 1MN3A 2PZ5A 5JFSA 4ACHA 4YPSA 3SOCA 4YP8A 4YPDA 2I0YA 4O0UA 2J0KA 3QYZA 5D11A 1OM1A 3QFVA 5ITQA 5A3XA 3I4VA 3OW4A 1OI9A 3OBJA 5FDPA 1NNUC 3U8WA 4GVJA 3C9WA 2KTYA 4R3CA 4AE6A 4QQJA 1AGWA 2R7IA 4E4LA 3WZDA 4O81A 4JAIA 4OTGA 1A9UA 3IGOA 5JSMA 5E4HA 2JXNA 2C6OA 3MGYA 4AX8A 2X1NA 2ZM3A 3ZBXA 5I9ZA 3N51A 1Z9XA 3FI8A 3A7HA 4ZMEA 4ZXTA 4M9XA 3LCVB 2V0DA 2Z2WA 3L8VA 4R3PA 4JJRA 5JMSA 3GP1A 3KK9A 2JP7A 4QMSA 3I0QA 3BI6A 1QDTA 1Y6BA 4F1OA 3W2OA 2X0QA 1IY2A 2R3OA 3QRTA 4FKIA 4FIJA 5G6VA 5G1XA 3PVGA 3R02A 5E8WA 3LVWA 3IS5A 3NIEA 2VWIA 4BCGA 4CCUA 3ZOSA 1P14A 2CDZA 4NM7A 3WF9A 4TPTA 4IWOA 3KSJA 3T38A 5EDPA 3ZO3A 3BHHA 4REZA 3PXQA 5DBXA 1TZDA 3ZH8A 4QQCA 5ANDA 1QAOA 3FL5A 4C4IA 2UV2A 3PVUA 3VBXA 4AE9A 4B99A 2WMBA 5FTQA 3R8VA 2C6TA 2VWZA 5CU4A 3GRRA 5A2QS 4ANNA 4FL2A 3F5UA 2Z60A 4IEBA 5FBNC 4BYJA 3O7LB 2P2IA 5IQHA 1ZWSA 4DV0M 4L15A 1KE9A 4JI1M 4JV5M 4MHAA 4E8AA 3PVWA 4FC0A 3BYMA 4NOOB 4BCJA 4IIRA 1OL2A 3QRJA 1DV0A 4DBNA 4NIFA 3GQIA 4YY3M 3AXWA 3EL8A 3L9NA 3B74A 1W2DA 1WFCA 2UVZA 4UV0A 3C4XA 2YFQA 2QHMA 3VF8A 5EK7A 3KRRA 3KXXA 2G2HA 5EFQA 1N36M