1LTMA

Accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
320
structure length
309
Chain Sequence
b'EPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 36 KDA SOLUBLE LYTIC TRANSGLYCOSYLASE
molecule tags Glycosyltransferase
source organism Escherichia coli
publication title Accelerated X-ray structure elucidation of a 36 kDa muramidase/transglycosylase using wARP.
pubmed rcsb
total genus 111
structure length 309
sequence length 320
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1ltmA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1ltmA02
5F16A 1HF4A 2MECA 1GB5A 3A3QA 4H9EA 1HELA 5HLLA 3WULA 4NGZA 4XN6A 1TBYA 3W6AA 2H9JA 1BB5A 4GCEA 5KXWA 1CJ9A 1GBXA 1IWZA 3LN2A 4WG1A 5D5CA 1C43A 2DKVA 4XJBA 3HFMY 2BQEA 4YEOA 4M6DA 1FKQA 3P66A 1BWHA 4DD3A 2CGIA 1QTEA 4NGWA 1NDMC 1KIRC 1GBWA 1REMA 4WOAA 1G7JC 3SP3A 2Z12A 3W3EA 3B6LA 4LYTA 5LA8A 2BPUA 3D9AC 1YILA 4L41A 1CJ6A 4W94A 4DD2A 1LMOA 2HUBA 1HMLA 4BAFA 4NGYA 1QDTA 1YAMA 4XYYA 4LYMA 1KXYA 1GXXA 1GFKA 1LSDA 1AZFA 1SQ2L 1WQOA 1YKZX 1LJJA 2H9KA 1GF6A 1GWDA 1PZYA 2HEDA 4NIJA 5ILCA 5HQ1A 1HENA 1CKHA 3CT5A 1OQMA 2Z19A 4O34A 1HSXA 2Y8PA 4ETEA 1FLWA 1IP5A 1LKRA 1BWJA 4H9FA 4LT1A 3LYOA 4R0FA 5FHWA 2MEDA 4CFPA 1JITA 5I4YA 2LYOA 1CJ8A 4B4EA 2HU3A 4LYZA 4TTDA 4GCCA 3ZEKA 1Z55A 2GV0A 5DM9A 3TXDA 3B0IA 5DLAA 1NWGA 1AT6A 4U3XB 1JIYA 1JJ1A 1JEFA 1LZTA 5J7CA 1LZCA 1P2CC 1OUJA 5I5QA 4Z46A 1YL1X 2XBSA 4HJZA 4TSCA 5B06A 1LMQA 2A7DA 3ATNA 2YBNA 3OJPA 5FCPA 1XSFA 4G4CA 4I0CA 4LYCA 5E9RA 1VEDA 4RW2A 3A90A 4WMGA 5LYZA 3TXGA 3EMSA 5LVHA 2DQIY 3WU7A 4NHSA 1WQQA 1LZEA 4IJ4A 1FKVA 3A91A 2A7FA 4PHIA 2LYZA 1BB7A 4N1EI 3TXKA 5HMVA 1AT5A 3TXHA 1V7SA 3CSZA 5KXMA 1IO5A 1LHMA 3HBDA 3VWOA 4DC4A 1WTMA 1GEZA 1LZDA 1B7QA 4HPIA 2CWIA 3N9AA 4ET8A 1BWIA 2HU1A 1JKBA 4RDSA 1GF0A 5LINA 1WQMA 4NFVA 1GPQC 2Z2FA 3A67Y 1LZBA 3B0OA 4ETBA 2H5ZA 1LOZA 4MR1A 1QSWA 5E4PA 2W1LA 4B4IA 1LAAA 2ZQ4A 2DQFC 1FLQA 4HTNA 4DWXA 4WL7A 3D3DA 1EQ5A 2I25L 1GFJA 1JHLA 2MEEA 4H9BA 1BB6A 5FSTA 3RT5X 1LHKA 2D4KA 2X0AA 4C3WA 5HNCA 4N5RA 5KXTA 3A95A 4I8SA 1B5WA 4A7DA 6LYTA 3W6BA 5F14A 3TXIA 3QNGA 1GAYA 2DQCY 3IJVA 4UWUA 1OUGA 1CNSA 5LVJA 4HTQA 1GE4A 1GBOA 4GLVA 1V7TA 1JPOA 1CKFA 4PRQA 4ZEEA 4ETCA 1LJ3A 1GE1A 4HV2A 2W1MA 1G7HC 3TMWA 4PPOA 4W96A 1UA6Y 1OUCA 1LMAA 1LZ8A 4X3BA 4WLTA 3RU5A 1HEMA 4DYGA 3A6BY 4YM8A 1B5VA 3BKHA 4N8ZA 4LT0A 2DQJY 1YKYX 4C5FA 1UUZC 4ET9A 2ZYPA 1J1XY 4LFPA 4RLMA 1WVUA 2FYCA 3E3DA 4NGKA 1LZ1A 4LYOA 4HJVA 4WM3A 1DQJC 1F6RA 5B05A 4KXIA 3RW8A 3WH1A 1IR7A 4OOTA 1KXXA 3HBHA 3EO5A 4B4JA 1GBYA 1GB0A 2Z2EA 1IIZA 1WVVA 4H93A 1IY3A 3N9EA 5D5FA 3AB6A 1DI4A 1GFRA 1LJHA 1ZV5L 1HNLA 1B0DA 1DXJA 1NKHA 3FI7A 4XJFA 1GAZA 5II3A 4IATA 1ALCA 3A3RX 4WM2A 4R6CA 1VDTA 1NMMA 1IWUA 1JKDA 1B7RA 4G4BA 1UIFA 3TMXA 5KXLA 2N5ZA 4M4OA 1GFUA 1UACY 1XGPC 4GN5C 4UWNA 5DN5A 1B5XA 1HHLA 5KXXA 3TMUA 2XJWA 1LSZA 2HEFA 3CT1A 1RFPA 3WPKA 1IWWA 3MGWA 1IP2A 1HEQA 1D0KA 4GCDA 4DDBA 4TWSA 4TSBA 1B7MA 1AM7A 3TXJA 4WG7A 3A96A 1GF4A 2F4AA 4HSFA 3W6DA 1W6ZA 1A4VA 4XJGA 1GFEA 4Z98A 2BQIA 2EIZC 1BVKC 1RCMA 1DPXA 1VDPA 1QQYA 1IR8A 5FDJA 4NHQA 4J1AA 3AGHA 1JISA 1LYZA 3CSRA 4NGIA 1OUDA 1T3PA 5L3IA 1GDWA 1GFAA 4NWHA 4P2EA 1DZBX 2BLYA 1D0LA 1GE2A 4PGJB 2YBLA 153LA 194LA 1LJFA 1NHEA 5HNLA 4E3UA 1F0WA 4J1BA 4N1CC 1TAYA 2BQOA 2DQGY 4CHXA 1J1OY 4DDAA 1LJGA 1IVMA 4ETDA 2BLXA 4XJDA 2ZYCA 1IP1A 1LHHA 4ML7A 1EL1A 1QTKA 1UIDA 3J6KA 1C7PA 5K7OA 5F9XA 2BQGA 4WM4A 1C45A 5DN4A 5B07A 4B0DA 1LJ4A 1OUBA 1YIKA 3A94A 1LSYA 4GLAA 3ULRA 5KXRA 1LSBA 1F6SA 3CB7A 1GE0A 2DQHY 2HEBA 1XGRC 3TXEA 1LSFA 3OK0A 1NF5A 3LZ2A 1AKIA 1B5ZA 1LJIA 3WUNA 1DPWA 1XFPL 1NBZC 4Z41A 5KXZA 1D0MA 1BB3A 4H8YA 2MEIA 134LA 4Z3MA 1REZA 2YDGA 2Z39A 3A92A 3AYQA 1OP9B 1LSEA 3EBAB 2AUBA 5APCA 1O23A 4LGKA 1JSEA 3TMVA 4CGEA 1IC4Y 3WMKA 5I4XA 4G49A 5LAFA 4DD7A 5A3ZA 1D6QA 4RW1A 1IWTA 4DD1A 5KKJA 2RSCA 1B2KA 4WLXA 1JSFA 3QE8A 3WL2A 1IORA 3AZ5A 1UIAA 2C8PA 4QGZA 4H9HA 1QSAA 1TCYA 1VFBC 1LTMA 1IC7Y 1GBSA 1VDSA 3ZVQA 4DD9A 1LZSA 1HMKA 5APEA 3QY4A 5KXKA 2LZ2A 2W1XA 3T6UA 3W6CA 4EOFA 4IASA 1HFYA 4BS7A 2FYDA 3GXRA 1XGQC 3BKVA 1BVXA 9LYZA 4DT3A 1REYA 2NWDX 4H9AA 4LFXA 1H87A 2B5ZA 2YBJA 1LYSA 4WLDA 1RI8B 1LSAA 1MELL 4ANRA 1GF3A 1LKSA 4XADA 1LHLA 3LYMA 2IHLA 5LYMA 4KL7A 1IY4A 2BQFA 4B49A 5KXNA 4NHPA 2YVBA 1YAOA 2F4GA 1C08C 3WUMA 1VATA 3A8ZA 2DBTA 1FBIX 3AW6A 1QIOA 5EBHA 1GF8A 1NBYC 2G4PA 3P4ZA 1LZGA 3LHMA 4MSTA 3TXBA 1IP7A 3ATOA 5IHGA 4J0LA 1IOCA 4HV1A 5I54A 1WTNA 1PS5A 1BGIA 3WXUA 1LZ9A 4WLYA 1A2YC 1ZVHL 2LYMA 2HECA 1IX0A 3WPLA 1GXV2 1HSWA 1GDXA 1LSMA 4BAPA 3A34A 3IJUA 2BQBA 1LMTA 1KIPC 1XEJA 5IDDA 4D9ZA 4HTKA 5APDA 1XGTC 4GN3A 1FN5A 3W6EA 2F30A 3FE0A 3WXTA 3CT0A 5KXYA 1LJNA 2LHMA 2I26L 2VB1A 3T36A 3N9CA 1CJ7A 1WQPA 1CKGA 2BQAA 4LT2A 1XEIA 4XENA 1LJKA 1LMCA 4NSGA 1HERA 4NGJA 1LCNA 1LZ6A 5F81A 3AW7A 1CKCA 1TEWA 4BADA 1N4FA 1LHIA 1B7LA 2D91A 8LYZA 1LZYA 4TUNA 1IP4A 5I53A 4NSIA 5KXPA 1G7LC 4J7VA 1B7PA 1NQIA 3P68A 4LYBA 2Z38A 2HEAA 1DI3A 1YL0X 4ZFPA 1JTTL 3CSQA 2YBIA 1UICA 1JTOL 1LYOA 1VAUA 2MEGA 4N9RA 5LVIA 3WYHA 1B7NA 3RZ4A 1FLYA 1XGUC 2F2NA 2MEFA 4HP0A 1IC5Y 2WARA 1B5YA 3WUAA 1KIQC 1EQ4A 3G3BB 5HMJA 4FJRA 4NEBA 4OWHA 135LA 1OUAA 2Q0MX 1YANA 2D6BA 1GB7A 1NDGC 4PJ2C 5LIOA 2BQNA 2FBBA 4NHIA 1GFVA 1B9OA 2DQAA 2CDSA 2ZILA 3M3UA 1JWRA 1HFXA 2BQMA 4NHTA 3WU9A 5A3EA 1GB3A 4QY9A 2BQLA 1UBZA 1B7SA 1JKCA 1LYYA 1LZRA 4B1AA 7LYZA 1SLYA 3AGIA 1UC0A 1QDRA 5LVKA 1YQVY 5KKIA 1DKKA 3P64A 3AZ7A 3F6ZA 1KXWA 4H94A 4LT3A 3AZ4A 1UCOA 4NGVA 4DDCA 4NG8A 1JUGA 4FDYA 2LZTA 4H8XA 4NY5A 3W6FA 1GFGA 1GD6A 2YSSC 2DQEY 5F9UA 5C6JA 4YENA 5L3HA 1JJ0A 4AGAA 3WU8A 4UWVA 3ZVQB 5LXWA 1DI5A 1C46A 1TDYA 1IWXA 1HFZA 1YROA 2YBHA 4OWAA 1J1PY 1I20A 4H9CA 4NSHA 4WO9A 4AXTA 1OUIA 3LZTA 5JENB 3KAMA 1GEVA 4CFOA 1ZVYB 3J4GA 1JTPL 1B7OA 1MLCE 4NG1A 1ZMYL 1LSCA 4HJYA 1LZ4A 3CQLA 3M18B 4ZIXA 2EQLA 1GF9A 2D4JA 1GF5A 4CJ2A 5C6LA 3K3TA 4H92A 1REXA 208LA 3A93A 4WL6A 4QDNA 1RJCB 2BQHA 2EPEA 1IWVA 4MCKA 3WVYA 3WW5A 1HEWA 2PC2A 1GF7A 3WW6A 1GBZA 4WM6A 1UIBA 1LZNA 2MEBA 1WQNA 4N0JA 1D6PA 4H1PA 1OUHA 1I56A 1BHZA 4OWEA 1EQEA 3AZ6A 3HBEX 4NWEA 2BQKA 2ZNWY 132LA 4DD0A 2D4IA 1IOQA 1LSPA 1LSGA 1YAPA 3G3AB 4NGOA 4ETAA 1G7IC 1OUFA 5KXSA 3WVXA 1LSNA 1XEKA 4G4HA 1HEOA 3WPJA 5ILFA 4H91A 2HTXA 2ZWBA 1F10A 2G4NA 4RLNA 1LHJA 1GE3A 1UIHA 4NSJA 1HEPA 1IOTA 1IWYA 2ZNXY 1GB9A 1IEEA 3P65A 4YOPA 4OWCA 133LA 5KJ9A 1IP3A 4HPEA 3A6CY 4GCBA 5DL9A 1JJ3A 193LA 2IFFY 3RNXA 6LYZA 1CKDA 1IR9A 1WQRA 1LJEA 1GFTA 1B5UA 1LMPA 1LZAA 1GFHA 4OW1A 4H90A 1QUTA 1VDQA 3B72A 2XBRA 5FEKA 2ZIKA 1DKJA 1LPIA 4H8ZA 3GXKA 4H9IA 3LYTA 4KPMA 3TXFA 5I4WA 5M1YA 1OUEA 5APFA 5IELA 1GB2A 2DQDY 5FELA 1T6VL 1C10A 5C6IA 5B1GA 1BQLY 3AJNA 5LYTA 1JKAA 1YKXX 1LZ5A 2EKSC 3IWRA 3EXDA 4WM5A 2W1YA 2MEHA 1LMNA 5B59A 1I1ZA 1FDLY 2BQCA 2MEAA 2XTHA 1QUSA 5KXOA 2YBMA 2FBDA 3LYZA 4QEQA 4YEMA 1D9UA 4YF2A 1E8LA 2BQDA 1HC0A 4TX7A 2HEEA 1UIGA 2ZQ3A 2Z37A 2G4QA 5KY1A 4XJHA 5LVGA 4PRUA 1H6MA 5LA5A 5T3FA 4GCFA 2ZIJA 3AGGG 5LAGA 4NGLA 4KT3A 2C8OA 1YAQA 1GB8A 1UIEA 2I6ZA 1IOSA 4II8A 1GHLA 1W08A 1BB4A 3B0KA 4OWBA 4OOOA 207LA 4GN4A 1RE2A 1IP6A 4EMNA 5L9JA 1G7MC 4WO6A 2BAAA 2Z18A 5B1FA 4WM1A 1INUA 154LA 4G9SA 5AMYA 1GB6A 2CJLA 4LZTA 1FLUA 4XJIA 2BQJA
chains in the Genus database with same CATH superfamily
3GRRA 4GHLA 1GB5A 1HELA 3DN8A 3SAVA 1JQJC 2Y21A 3SN6R 1CJ9A 1IWZA 3D4SA 3MJ5A 4I7QA 1C43A 3HFMY 2OO9A 3HTBA 1QYRA 1VEGA 3IHPA 2C96A 4FW9A 1CUQA 1KIRC 1GBWA 224LA 3SAUA 3IG8A 3SP3A 177LA 4GEWA 188LA 4AI6A 2L2DA 2HUBA 4BAFA 4NGYA 3CF0A 195LA 4LYMA 3HU3A 1LSDA 4DD0A 2HUMA 3E46A 1HENA 1CKHA 1L06A 3CT5A 1HQCA 2Z19A 4LJ5A 3AV0A 1IN5A 3LYOA 5FHWA 1QT4A 4DR2M 2LYOA 2HU3A 5EXPA 4LYZA 3ZEKA 1G0MA 3TXDA 1G0JA 3B0IA 3L25A 4U3XB 1JIYA 1JJ1A 2GQFA 152LA 1JB0F 2BNKA 1YL1X 2XBSA 4RNAA 3HU8A 3ZQJA 5FCPA 4CGYB 4LYCA 4AQNA 5E9RA 4WMGA 2XLJA 2ANXA 1WQQA 3U5ZA 3A91A 1Q3CA 2CHQA 1KW7A 1VG5A 4ZPUA 1LHMA 1OV5A 4HPIA 4ET8A 2C99A 1QAQA 3K9OA 1WQMA 4NFVA 3A67Y 3GLHE 3GPYA 1L1ZA 1QSWA 5E4PA 4G3OA 4FCVA 4QHSA 2DQFC 1L0JA 1V92A 1C6LA 1GFJA 1JHLA 4IAPA 1L26A 3FTDA 1JTNA 4YXCA 3HZJA 2KNZA 1L46A 231LA 235LA 1L39A 6LYTA 3EIHA 4IBGA 3W6BA 1T43A 3QNGA 1GAYA 4GMQA 2UXDM 2DQCY 1TTEA 3KOWE 1OUGA 1QTCA 1T8AA 1V7TA 1JPOA 4ETCA 1L42A 2JUJA 1GE1A 2X8AA 1NNJA 4OO9A 3TMWA 4W96A 1IN8A 3VKGA 1P2RA 1L50A 2RB0X 3BKHA 3GUOA 254LA 4N8ZA 2VIIA 4C5FA 4IBCA 3GLGB 2FYCA 4DUZM 1LZ1A 4AKIA 3RGPA 1OFIA 4WM3A 4FVMA 3UGJA 2WSCF 222LA 1LGUA 1IIZA 1WVVA 1IY3A 2KHHA 5L8RF 5D5FA 3KP1E 4EIWA 1LJHA 1B0DA 4I7PA 3FI7A 2RGOA 255LA 4MGYE 4I7KA 1NMMA 1JKDA 1L96A 1UIFA 2JP7A 155LA 2X4AA 4M4OA 1HNWM 1XGPC 4UWNA 1B5XA 3BXWA 2XJWA 4IJFA 4G6ZA 3MGWA 2Z4SA 1HEQA 1C68A 1D0KA 1GJTA 4WG7A 1Z5CA 3Q8XA 1T6HA 3OE6A 3W6DA 6LZMA 184LA 1XHBA 3CDQA 4Z98A 1BVKC 3NBIA 2C9OA 1DPXA 2CV2A 1VDPA 2YNMD 1QQYA 4GRVA 187LA 4DV3M 3F9LA 1PGYA 3M0EA 4J1AA 3KVWA 3AGHA 2RBRA 1LYZA 4CIZA 3TWKA 1OUDA 2K6BA 2O4WA 3ZC7B 2LHCA 4NWHA 4G4RA 2BLYA 2DAEA 4B3TM 5FTLA 194LA 2YR0A 1F0WA 4N1CC 5E6JA 3DN2A 4DDAA 1IVMA 1QTHA 1R6BX 1C6IA 2KRUA 1KFVA 4Y28F 1EL1A 1UIDA 2VF7A 1C45A 1C6HA 1GLNA 1LJ4A 1L55A 1LSBA 1SXJA 2F5SA 1GE0A 1DGFA 2Y20A 4MM3B 3HGIA 4AKHA 1I6SA 1NF5A 1AKIA 1LJIA 1XFPL 1D0MA 1BB3A 4H8YA 3A92A 4X66M 1OP9B 3EBAB 5APCA 4LGKA 2UXBM 3WMKA 4GC9A 1QUHA 4DBGB 1ZURA 3QE8A 3WL2A 4H9HA 3FUWA 1TCYA 1VFBC 1LTMA 1HR0M 5KQDA 1GBSA 1PQDA 2RH1A 1HMKA 3U5ZB 1C6BA 3QY4A 2YQZA 4DV7M 2LZ2A 3T6UA 3W6CA 2JA2A 2O79A 1HFYA 4I7JA 4MGZE 1ORYB 1K28A 3BKVA 3B89A 1REYA 4X64M 5KO3A 4LFXA 1P3QQ 3B74A 3VW7A 3ZH9B 1DGHA 1C67A 1LSAA 1RI8B 3HTGA 1LKSA 3B7QA 5BPVA 4KL7A 4NHPA 4LF7M 1YAOA 1NO1A 3AW6A 1NBYC 1L14A 3TXBA 2ZM6M 4AQYM 4J0LA 4HV1A 4JI0M 4X62M 200LA 4NXNM 1WTNA 1L44A 3HUKA 3HTFA 1L53A 4WLYA 1ZVHL 249LA 3KDSE 2C5RA 4DR6M 1OWYA 2B70A 3IJUA 2BQBA 1LMTA 5IDDA 1LI6A 5APDA 1XGTC 2CFOA 3W6EA 2F30A 241LA 144LA 4LDOA 2JY6B 3N9CA 1XEIA 1N33M 1LCNA 5F81A 1SXJD 4I7SA 2D7GA 3SB8A 4DJHA 3AL0C 4F2LA 3G3XA 1NQIA 4PCZA 3CSQA 3B7ZA 1T8GA 5BR8M 1L07A 1ZMVA 2F2NA 3NYAA 3SATA 4HP0A 2XEPA 3KXEC 1PJSA 1TDZA 1QSQA 3WUAA 1YSYA 1L02A 5HMJA 4DR1M 2HULA 4FJRA 4OWHA 1OUAA 4LGYA 1L35A 1NDGC 1L0KA 2BQNA 1C6EA 1L68A 217LA 1JWRA 1HFXA 3QAKA 4NHTA 5A3EA 1OVHA 1GB3A 4QY9A 2BQLA 145LA 4B1AA 1B7SA 1JKCA 3T1HM 1NV9A 3KOYE 3L2AA 1L49A 3GUJA 3AZ4A 5IZ7D 4NOOB 1R2ZA 4QNRA 1JUGA 3W6FA 2CUZA 2YSSC 3A45A 5F9UA 1PJIA 3ZVQB 1NHGC 1YROA 1I20A 4H9CA 4WO9A 3EIEA 1IBMM 3DMVA 2OOBA 3HJ8A 3KAMA 4HLQA 1B7OA 1LSCA 3M18B 3CQLA 2D4JA 1REXA 1GVNA 3F8VA 4QDNA 2R4EA 1RJCB 2BQHA 1L45A 3AFHA 1JTMA 1GBZA 2LVAA 2MEBA 1TF0B 1WQNA 1L99A 3GLIA 4CJ6A 2KA6B 1QT7A 2B74A 1OYUA 3HBEX 2RGHA 2BQKA 2ZNWY 132LA 1LSGA 3HHXA 2R44A 1G7IC 2HAKA 4LFCM 2CP8A 1LSNA 1DYAA 4LJ7A 2G4NA 4X65M 1LHJA 1UIHA 1L09A 1VAUA 1HEPA 1V34A 2O5RA 5A2QS 1L73A 261LA 4KO8A 4YOPA 133LA 1KY1A 4HPEA 5EP2A 5DL9A 4R71A 1JJ3A 3PVSA 2IFFY 4Z6YA 2QPAA 1IR9A 1LJEA 1WXQA 1Q39A 1GFHA 220LA 4CHTB 1K3WA 1VDQA 4JI5M 1LPIA 3LMMA 1DO0A 5IELA 4GITA 4AZFA 3JR5A 5B1GA 1L77A 3AJNA 1JKAA 3IWRA 4JI2M 1FNNA 2MEHA 4LDEA 3SMSA 2DKLA 256LA 2MEAA 196LA 1HQYE 3AOEC 4YEMA 4LJ9A 4MH0E 4FCWA 4TX7A 3A98B 1D3NA 3T15A 5LA5A 2LVOC 3AGGG 5FLXS 2A5YB 1UIEA 126LA 4AG5A 141LA 2I6ZA 1D2WA 1NSFA 122LA 4A3VB 1D2YA 1LV7A 3FYDA 2G5GX 3PDSA 207LA 4YXAC 3U6MA 2DAGA 3SASA 1CU5A 1PQMA 1LYGA 4G9SA 1GB6A 245LA 1FLUA 1C6QA 3AKZA 3C8QA 5F16A 3BOSA 150LA 4H9EA 5I14A 3WULA 3FKEA 3HHZA 2LZMA 1QTDA 5KXWA 1HJPA 4WG1A 2Z3XA 2JY5A 5D5CA 3V2WA 1K3XA 4XJBA 4M6DA 3D8LA 1FKQA 1QS5A 1ZMWA 3LCUA 2R6FA 3GLGE 218LA 1L69A 4NGWA 1NDMC 4WOAA 1C1KA 4DQ7A 1G8PA 4DD2A 3HU2A 1HMLA 2OU8A 1QDTA 2UUCM 1XJTA 2F5NA 1GFKA 1SQ2L 1YKZX 1LJJA 1GF6A 1PZYA 4NIJA 1XJUA 1L22A 259LA 4Q7JA 209LA 172LA 1NY5A 4IIWA 1DYFA 1C63A 1OFHA 1BWJA 1IP5A 1LKRA 3HT8A 4H9FA 4LT1A 4JN6A 2D7EA 4TTDA 4GCCA 175LA 1Z55A 3KSXA 1N75A 2GV0A 3GUPA 1NWGA 1LZTA 5J7CA 1IXSB 3DA1A 1OUJA 4Z46A 4M0DA 1XXHE 1J5EM 239LA 1L03A 1DYGA 4HJZA 2YBNA 5JI2E 4IBIA 5LYZA 3HU1A 4NHSA 7CATA 113LA 3NY8A 1MU5A 2A7FA 3KW6A 1LYHA 4PHIA 3TXKA 1CX6A 2EA0A 3QYEA 4DC4A 1GEZA 3KS8A 1LZDA 1G0KA 1JKBA 2LHGA 4RDSA 1GF0A 4G4NA 4HL4A 4IBFA 1SSWA 248LA 1JR3E 2NTHA 1QTBA 2Z2FA 3E21A 173LA 1L43A 2W1LA 4B4IA 3KSJA 1L91A 4DWXA 1L70A 3OE0A 3D3DA 1EQ5A 1GO5A 2KZUA 2OPFA 2MEEA 1IY0A 1BB6A 3RT5X 2JWSA 3F92A 3A95A 3W0FA 1L19A 5E26A 4B3MM 163LA 5F14A 3GLFB 4W51A 1L98A 4GLVA 1CKFA 251LA 4HV2A 4LF6M 5EP3A 4ARJA 1C6KA 2CE7A 1UA6Y 1LMAA 1VEKA 1TDHA 3RU5A 3FYCA 1HEMA 4DYGA 1CV5A 4LT0A 2ZAMA 1XNRM 1OVJA 2DQJY 3FTEA 4RLMA 2UUBM 2KNAA 4LZJA 4NGKA 2DNAA 4HJVA 1KYIA 1DQJC 2W82A 114LA 3RW8A 229LA 2CHGA 4OOTA 3HBHA 2QP9X 3EO5A 1VDDA 1GBYA 1A5TA 3ILKA 4L16A 3N9EA 2EJSA 3AB6A 2FS1A 1DI4A 1CUKA 4JV5M 3A3RX 1VDTA 1IWUA 4LF8M 3L64A 185LA 3TMXA 1LGXA 1V33A 1QZMA 2XFSA 3J81S 4LF9M 3OE8A 5DN5A 7LZMA 4DR5M 4GN5C 3C80A 5KXXA 1P7SA 3L29A 1LSZA 2R4JA 1XXHB 1G3IA 1IP2A 1IWWA 1L37A 3DKEX 2UXCM 4TWSA 4TSBA 237LA 2V1CA 1AM7A 3UJNA 1L38A 3A96A 3HKPA 2DI0A 2CV1A 2F4AA 3B7NA 1A4VA 3DMZA 4XJGA 4JYAM 3U60A 2APLA 1RCMA 3BBZA 2JNHA 3G3WA 1LYDA 5ITXE 4I7LA 4NHQA 1H6UA 170LA 1SXJC 1WGNA 4JXJA 2F5QA 1T3PA 4EKQA 1ZV1A 5L3IA 1SWYA 3UONA 2HCBA 5ITUA 4PGJB 153LA 5HNLA 4E3UA 2Q9EA 1TAYA 2BQOA 3GUMA 1L20A 1LJGA 3TPZA 186LA 2R65A 2BLXA 234LA 2ZYCA 3I4YA 1QTKA 2BWEA 3J6KA 1C6PA 1SX2A 2Y0QA 4WM4A 1OUBA 1I94M 1P46A 3A94A 4GLAA 1F6SA 1L62A 3CB7A 2HEBA 1N77A 228LA 129LA 3DN1A 1E94E 1L2DA 1DPWA 3DN0A 1D9WA 1NBZC 1WTHA 4XK8F 1LI2A 4W55A 4D81A 4Z41A 1L92A 3SYLA 134LA 3IG5A 4DAJA 1WIVA 2DENA 3AJIB 2AUBA 2B75A 1O23A 3TMVA 2KNVA 4DV0M 174LA 1L13A 1JR3A 5A3ZA 4GHAA 4RW1A 2QZ4A 1IWTA 4W59A 4DD1A 1B2KA 4PDIA 4D80A 1UIAA 2H5XA 1CTWA 2LTUA 2DWMA 149LA 2LWXA 3ZVQA 4DD9A 3HHYA 225LA 5EXSA 3CF2A 4S0WA 1R7RA 2ZTCA 1L21A 4R7GA 3KS4A 1CU0A 3GXRA 1PQKA 1XGQC 1BVXA 166LA 2B5ZA 4CISA 1MELL 3R9XB 3GPXA 3LYMA 2EUCA 1PJTA 4W53A 2FNAA 4AG6A 1C08C 221LA 2F4GA 3WUMA 2MROB 2XH9A 4MSTA 1L11A 1L80A 1IP7A 3ATOA 3J7AS 4NC6A 3HWSA 4Z8XA 1BGIA 1L10A 3WPLA 2L6OA 3QAUA 212LA 180LA 1LSMA 3A34A 1KIPC 1IN7A 2XF3A 1FN5A 1L65A 3CT0A 4JI6M 4GKKM 1LJNA 2VB1A 123LA 2I26L 1CU3A 3U6OA 3ODUA 1CKGA 2CHVA 4LT2A 1LMCA 4NSGA 1HERA 3RE8A 2EO2A 1NJFA 2F4VM 1X37A 8LYZA 4NSIA 3P68A 1L71A 183LA 4BBAA 1DI3A 3K8ZA 4IBDA 1JTOL 3QWLA 3SHGB 3FRHA 1QAMA 1LYOA 3CF6E 1B7NA 2MEGA 1C6TA 1B5YA 1E9RA 3M6AA 2LVNC 1EQ4A 1L51A 5EJCA 2OU0X 1CX7A 5KQ8A 2D6BA 4EKPA 1DGHB 1EIJA 5H37D 2DAMA 4NHIA 2R46A 2ZILA 3M3UA 4L8RC 3GRUA 2BQMA 1L90A 2KEBA 3GUKA 1UBZA 1R5LA 1UC0A 1YQVY 3UMMA 3GLFE 1DKKA 3P64A 1KXWA 4H94A 1LI3A 4DDCA 4AKGA 167LA 4NY5A 1GFGA 1GD6A 219LA 125LA 164LA 2DQEY 2Z7JA 5C6JA 4YENA 2XFTA 1JJ0A 1OVKA 1Y8GA 1DI5A 1J1PY 1L28A 142LA 3C9PA 3LZTA 1ZVYB 3J4GA 4NG1A 3PNVA 2XSZD 4YHHM 1LZ4A 2EQLA 1GF9A 3K2RA 1GF5A 3GPUA 3K3TA 4WL6A 3A93A 2EPEA 2FFJA 3WW5A 4ARQB 1R2YA 3LVVA 2I7NA 1HEWA 4ARQA 3VK7A 1LZNA 110LA 2RBQA 4N0JA 3VKHA 1D6PA 3U6QA 1C69A 3E4RA 2CEAA 1OV7A 1I56A 3HUAA 3AZ6A 3LQQA 4RF1A 1L84A 1LSPA 1YAPA 1DYDA 3G3AB 4NGOA 4WW0A 3R8FA 4DV5M 4EXMA 2G3QA 4W56A 4G4HA 3B9PA 1NV8A 1HEOA 1XEKA 3DN4A 3DN6A 4H91A 4QOSA 2P5TA 4RLNA 5EQTA 2OE9X 1IOTA 1IXSA 1IWYA 2Z4RA 4D82A 1L2BA 4OWCA 211LA 1LYFA 5ITQA 193LA 3RNXA 4GBRB 2QBYB 4DV4M 1GFTA 1B5UA 1L74A 4OW1A 2B7XA 197LA 3FD9A 4KLNA 4B3RM 4H8ZA 2KDLA 1WGLA 1R4GA 1XC8A 2DQDY 2MGWA 1D3FA 5FELA 2VDBB 4OW0A 1C64A 1T6VL 1C10A 1BQLY 4NSOB 1HNXM 4DR3M 3U61B 189LA 5B59A 1I1ZA 3FA0A 2YBMA 4QEQA 2BQDA 2HEEA 2CWBA 2Z37A 1N78A 1KY0A 246LA 5LVGA 5T3FA 5LAGA 4NGLA 1YAQA 4I7OA 3DFZA 2Q9DA 1GHLA 3JR4A 1BB4A 4EJ4A 148LE 4LFBM 2QB0B 4WO6A 2Z18A 154LA 1SXJE 3C8SA 4LZTA 4XJIA 1L16A 4W54A 1HF4A 2MECA 1IBKM 4NXMM 2RAYX 2L78A 1DYBA 4XN6A 4MB7A 1TBYA 2H9JA 4GCEA 1TR8A 1IN6A 2DHRA 1GBXA 2MR9A 1LWGA 1L30A 4YEOA 1VEJA 1L24A 1W5TA 4DD3A 3SYKA 4OU7A 1G7JC 250LA 2Z12A 3W3EA 3B6LA 4LYTA 4W52A 4W94A 1CJ6A 2RB2X 1LMOA 1G1WA 1Z6TA 1L93A 3SB6A 104LA 1YAMA 4K0KM 4XYYA 4F1IA 1WQOA 1AZFA 1C6NA 2H9KA 1RU3A 2HEDA 1GJSA 5HQ1A 1G07A 4O34A 3G3VA 1HSXA 2H1RA 4IBBA 4ETEA 2QQ8A 3NBXX 4CFPA 1CJ8A 4GC5A 5ITTA 2OU9A 1P37A 3FTFA 3L27A 3M7GA 214LA 1AT6A 4GRIA 1IY1A 3C3EA 1LZCA 2RBSA 2B72A 3L26A 4GKJM 3GQ4A 1GKIA 3OJPA 1XSFA 1G0PA 4G4CA 4I0CA 1C65A 3TXGA 4WP2A 4RW2A 1SWZA 1C6GA 2DQIY 4IJ4A 5F3WA 4LJAA 1BB7A 1AIPC 5HMVA 1L29A 3TXHA 1V7SA 5IWAM 5KXMA 2G8LA 4LF4M 143LA 4PT5A 1L66A 4PK0A 1WTMA 1OJLA 3VDUA 1B7QA 226LA 2CWIA 2XQOA 3N9AA 4TUWA 1L64A 2BJVA 1GPQC 1QSBA 147LA 1LZBA 3B0OA 156LA 2H5ZA 1LOZA 1D3MA 1LAAA 2ZQ4A 118LA 165LA 1FLQA 227LA 1L36A 4WL7A 3Q8GA 2I25L 4H9BA 1CUPA 4FCTA 1LHKA 2D4KA 4C3WA 1LYIA 5HNCA 236LA 1MN3A 4N5RA 5KXTA 4I8SA 1B5WA 4A7DA 1L81A 4W5WA 1QAOA 3FUTA 2OE7X 3C8RA 2FOIC 4UWUA 3GULA 3NWLA 1CNSA 1P6YA 4WURA 5LVJA 4ZEEA 1T8FA 1L04A 1L05A 1L48A 4PPOA 1OIPA 4RKUF 4OVZA 3K1JA 4I7RA 3HT9A 4YM8A 1B5VA 1EFUB 1YKYX 1OWZA 2JXNA 1G1VA 4ET9A 1J1XY 4LFPA 1YUBA 1D2NA 4LYOA 1EPYA 3L28A 1MX0A 1F6RA 244LA 5B05A 198LA 1TH3A 4MGIE 3WH1A 1IR7A 1KXXA 3FADA 2KZSA 5EP1A 2ZANA 1OTRA 4H93A 128LA 4DV2M 1GFRA 1ZV5L 4XJFA 1NKHA 3T1YM 4I7TA 3I4VA 1JQUA 1QUOA 107LA 2B3TA 4G4BA 1KNIA 2QENA 5KXLA 3PBLA 1C6AA 2N5ZA 4ARLA 1GFUA 2J7OA 1L72A 3AOEA 2HEFA 3CT1A 2DZNB 1RFPA 1QT5A 3WPKA 4GCDA 131LA 1L79A 1W5SA 1W6ZA 1GFEA 2BQIA 1L87A 2F47A 1L67A 1G59A 3JR6A 1L01A 2L7IA 3K2LA 1NHBA 3GUIA 1GDWA 1GFAA 1L12A 1DZBX 4M9XA 3VFDA 1D0LA 1GE2A 2YBLA 1NHEA 3IECA 1TGUA 1NNUC 4ARMB 4ARMA 151LA 2DQGY 2LCBA 4ETDA 4OX9M 4XJDA 4FWDA 4G4OA 3PXGA 191LA 5F9XA 2RRUA 3C81A 1YIKA 1LSYA 3ULRA 1HT1E 2LXEA 2EKKA 2Y0TA 169LA 5DYIA 243LA 1N34M 1XGRC 1PJQA 2Z8YM 3OK0A 4I7MA 3HH6A 5KXZA 3RZEA 1REZA 2YDGA 2Z39A 1GL6A 3AYQA 1L40A 3GQ3A 1J09A 111LA 4CGEA 2K9DA 160LA 1IC4Y 5I4XA 5KPTA 4G49A 1CV4A 1P56A 1NHWC 5KKJA 4WLXA 1JSFA 1IORA 2C98A 3U6EA 3GRYA 1QSAA 130LA 2OE4X 3RUNA 2W1XA 4EOFA 2FYDA 1SG9A 3FE3A 9LYZA 4DT3A 1CV3A 2M5ZA 5EP4A 119LA 2NWDX 1L61A 4H9AA 2ZBKB 1LYSA 2L09A 1L83A 206LA 1GF3A 1L63A 4QOZC 2LC9A 5EXXA 5DYGA 2IHLA 5LYMA 1I4WA 127LA 4B49A 3SBAA 5KXNA 2YVBA 1DV0A 2FH0A 2L4EA 2DBTA 1FBIX 1QIOA 1GF8A 2G4PA 3P4ZA 1LZGA 3LHMA 2RBNA 1K82A 240LA 1IOCA 5EXTA 190LA 2DZOB 1L47A 2JZ1A 1A2YC 3KFUG 2HECA 215LA 1GXV2 1L54A 1E9SA 1YE9A 1PM5A 1CU2A 1GDXA 3C58A 2QSFX 1F4IA 2DWZB 1XEJA 4D9ZA 4HTKA 2CUUA 1P64A 4GN3A 1C6DA 2GNOA 1L25A 3WXTA 1SX7A 5KXYA 3T36A 4DQ5A 2LH0A 4XENA 1DYCA 3VLFB 4NGJA 3HH4A 1OAOC 1LZ6A 2O01F 3AW7A 3EMLA 1CKCA 1TEWA 1N4FA 4KODA 1B7LA 3FUVA 3FRIA 1LZYA 3AOGA 5I53A 4MGHA 4J7VA 1IBLM 2HEAA 4LY6A 1JTTL 103LA 4ZFPA 1EE8A 5LVIA 2MEFA 2WARA 3TL4X 1KIQC 3G3BB 2B6XA 2XZUA 4NEBA 3V76A 1WJ7A 3ZCBB 1JR3D 1YANA 2Q0MX 1GFVA 115LA 1B9OA 2X49A 3QYBA 1ZQ9A 3WU9A 1DO2A 1OIZA 1LZRA 7LYZA 4QHTA 3AGIA 3AZ7A 1DGBA 1ZYTA 4LT3A 3U6PA 1SXJB 4EKSA 216LA 4NG8A 4FDYA 4H8XA 3KOZE 2VF8A 2LVPC 5L3HA 1PQJA 3WU8A 2YBHA 137LA 1C46A 3LZMA 3U61A 1LWKA 4NSHA 1IXZA 1L1TA 5DNYA 1WR1B 1MJGM 1ZMYL 4CJ2A 2OEAX 205LA 5C6LA 2VQFM 2R62A 2DXIA 1L27A 1L41A 4MCKA 3WVYA 3I01M 1UFZA 4WM6A 223LA 3GRVA 2FE8A 1QS9A 2V6ZM 4H1PA 2L4FA 3HY5A 1BHZA 1D3JA 1PJJA 4OWEA 4NWEA 1N32M 1L18A 4G4QA 2O25A 2D4IA 1IOQA 4LJ6A 1OUFA 2WZJA 4R3DA 1ZAEA 3WVXA 2WSEF 2HTXA 2RKOA 2ZWBA 233LA 4NSJA 1DYEA 2ZNXY 1IEEA 1HNZM 1GB9A 3P65A 5KJ9A 2N35A 1IXRC 192LA 5IREB 2K0BX 1WQRA 1LMPA 3HH3A 1QUTA 3CDOA 1BVSA 3B72A 2XBRA 1VQ1A 3HUQA 1TLAA 5I4WA 5M1YA 3SB7A 2A4TA 5APFA 5KPRA 2F5PA 5C6IA 5LYTA 2DWNA 1YKXX 3EXDA 4WM5A 2W1YA 1LMNA 2ZTDA 2EKFA 2BQCA 2XTHA 3CDTA 1E8LA 1D9UA 199LA 2ZQ3A 1UIGA 2C9CA 2G4QA 1WHCA 1H6MA 5FTJA 3RGSA 1PRBA 2ZIJA 4GCFA 3HDFA 3U6CA 2C8OA 4DQJA 2K47A 1GB8A 4KHPM 102LA 4EPFA 1IOSA 171LA 3C82A 4II8A 1W08A 3HX3A 3V2YA 4E97A 3B0KA 3DN3A 1QT6A 4OOOA 4OWBA 257LA 2B73A 1RE2A 4EMNA 1L82A 4LZZA 2BAAA 5B1FA 4WM1A 4PD2A 4DV6M 1NVMA 161LA 3SFZA 1L86A 3A3QA 2MH8A 5HLLA 1ZWNA 4NGZA 4NL4H 3PNYA 3MMPA 5ITXA 3W6AA 1BB5A 1L00A 1YLAA 3LN2A 2DKVA 2BQEA 3P66A 1BWHA 1LGWA 3J7BA 2KW0A 2CGIA 4LJ4A 1QTEA 2F32A 1P3NA 1REMA 3KOXE 5LA8A 2BPUA 3D9AC 1YILA 1Q3BA 4L41A 1XEPA 4ITQA 3HWLA 2F2QA 3GLHA 1KXYA 1GXXA 2DWLA 1GWDA 5ILCA 2BWBA 3SMPA 1OQMA 139LA 3H4MA 1L32A 1LYEA 2Y8PA 1FLWA 5ITYA 4R0FA 1XMQM 1L34A 2MEDA 3I04M 2DAKA 1CU6A 1JITA 1L31A 5I4YA 4B4EA 4JI7M 2AHMA 1QT3A 1VDLA 4M9SA 3FUUA 3SAWA 1L33A 3DNAA 5DM9A 5DLAA 3K9PA 5C18A 1JEFA 1SSYA 1P2CC 5I5QA 4P17A 2R45A 2JY7A 2LNHC 4TSCA 5B06A 1LMQA 2A7DA 3ATNA 2OOAA 1QUGA 1IN4A 4AW4A 2CV0A 3C7WA 1VEDA 3A90A 4MGKE 253LA 3EMSA 2ANVA 5LVHA 3WU7A 3C3DA 3MHVC 1T6OA 1FJGM 1LZEA 1FKVA 1LPYA 1C6MA 4IBEA 2LYZA 4N1EI 2CRUA 1AT5A 4GH9A 2HHHM 3VDPA 1PQIA 3CSZA 1G4AE 1IO5A 3HBDA 4YX7C 3VWOA 2D7HA 230LA 2Z6BA 1T97A 1BWIA 2HU1A 1ZMUA 5LINA 2R18A 4II7A 4B7FA 4EKRA 2E5LM 4I8OA 2B6ZA 4ETBA 2RBPA 4MR1A 4JI8M 3SBJA 1IQPA 1XWIA 1LLHA 4HTNA 3GLIB 3U6LA 5KPZA 4I4LA 5FSTA 4B3SM 2X0AA 4B7GA 1XB2B 2DHYA 3W68A 1L75A 2BJWA 4B7HA 2I7PA 1C6FA 2V1UA 3TXIA 3HH5A 238LA 3IJVA 3T38A 4HTQA 2XGNA 1GBOA 4JI4M 1GE4A 158LA 3WYHA 4PRQA 1L58A 1G06A 1LJ3A 4ARPA 1L88A 2W1MA 1G7HC 1OUCA 1LZ8A 4X3BA 4WLTA 4LFAM 3A6BY 178LA 262LA 1G71A 4DR4M 1UUZC 2ZYPA 2NQ8C 4LJ8A 1WVUA 1QUDA 3LCVB 3E3DA 3C7YA 4W58A 1XXHA 1CV1A 4DKLA 5FSWA 3WHLA 1C62A 1Z5BA 4KXIA 4LCBA 4B4JA 1GB0A 260LA 2Z2EA 210LA 3J80S 1HNLA 1DXJA 1T3TA 3FUXA 2VQEM 1GAZA 4W57A 5II3A 4IATA 1ALCA 3I51A 1AUAA 4R6CA 4WM2A 2F5OA 1L8QA 2HUKA 1B7RA 5FTKA 213LA 2RBOA 4IBKA 3GUNA 1UACY 4FWHA 1HHLA 252LA 3TMUA 3GLGA 3UZUA 1IM2A 2OTZX 1XMOM 2HL7A 5C1BA 2IGCA 4DDBA 2JY8A 146LA 1B7MA 3TXJA 1GF4A 4KT0F 4HSFA 5FTMA 1E32A 2RAZX 2EIZC 4IBJA 5JI3E 1IR8A 3SC3A 4IJEA 5FDJA 3HU9A 4L15A 1JISA 1L08A 4M9ZA 3CSRA 4NGIA 4P2EA 1QTVA 2QNJA 4M0WA 3PFIA 1P36A 1LJFA 4ZPXA 1P2LA 4J1BA 1S3SA 1L94A 3GPPA 4CHXA 1J1OY 3HDEA 1C66A 1IFYA 1IP1A 3FI5A 3CDVA 1LHHA 4ML7A 5K7OA 1C7PA 2BQGA 5DN4A 5B07A 3K92A 3LVWA 112LA 4B0DA 4REZA 2DVWB 5KXRA 3TWLA 2B6YA 4LF5M 2DAIA 2DQHY 1C6CA 3U60B 1G0LA 3TXEA 2UU9M 3W0LB 1LSFA 108LA 3LZ2A 1B5ZA 3WUNA 2MJ5B 2MEIA 4Z3MA 1TH2A 1QZEA 4I81A 2NTGA 1GL7A 3THGA 3C7ZA 4L6V6 1LSEA 2M60A 1L97A 2XZFA 1JSEA 1GABA 1IY2A 2HWJA 5LAFA 4DD7A 2XSZA 3J27B 2QBYA 4I7NA 3GLIE 1D6QA 5GKNA 2B6TA 3MK6A 3U6SA 1L59A 8CATA 2RSCA 3W67A 3AZ5A 1L17A 4QGZA 2C8PA 4BLCA 3HT7A 3SB5A 1IC7Y 1VDSA 3CTWB 3SARA 1LZSA 5APEA 1PQOA 5KXKA 3GP1A 4YY3M 3GLFA 4IASA 4BS7A 1L60A 2DZLA 2JZ0A 1OAIA 1H87A 4FD2A 3DOAA 2YBJA 1J7KA 4WLDA 4ANRA 4XADA 1LHLA 1Z5AA 3A46A 1QT8A 1IY4A 2BQFA 3VK8A 1VATA 3A8ZA 2LBCA 4LZMA 5EBHA 4L4UA 1UM8A 4LG2A 5IHGA 4BB9A 5I54A 3L2XA 1PS5A 3E9SA 1KW5A 4K5YA 2QARC 3WXUA 1LZ9A 1N36M 2LYMA 1OQYA 1IX0A 4JI3M 120LA 3HJSA 4L78A 1HSWA 1L15A 1L95A 3DMXA 1OKSA 4EPIA 4BAPA 1C7YA 3FE0A 3TQSA 3JAMS 3FTCA 1LYJA 2LHMA 1CJ7A 1WQPA 2BQAA 3A42A 1LJKA 2ERCA 1C61A 2J5YA 1NY6A 4BADA 232LA 1KS3A 1LHIA 3RFWA 2D91A 5IT9S 4TUNA 201LA 2ZAOA 1IP4A 4RF0A 1C60A 5KXPA 1G7LC 1B7PA 3T6PA 4LYBA 2Z38A 1YL0X 2O7AA 3TE6A 1L76A 2YBIA 3CDRA 1UICA 3RZ4A 1FLYA 1XGUC 1IC5Y 4LRTA 4UN2B 1B6IA 1L52A 1Z59A 3OE9A 135LA 2LVQD 3C83A 5FTNA 138LA 1G0GA 1GB7A 4PJ2C 1L89A 5LIOA 4XBOA 1KSFX 2FBBA 2DQAA 2CDSA 4B08A 1C6JA 4DUYM 1LYYA 1G41A 4PJZA 1SLYA 5DFLA 1QQWA 1QDRA 2UUAM 2OTYX 5LVKA 5KKIA 3F6ZA 1XNQM 1UCOA 4NGVA 2WSFF 1NJGA 2LZTA 1QVRA 5LZMA 4AGAA 4UWVA 5LXWA 4DV1M 1CV0A 2B6WA 4OWAA 1TDYA 4HEOA 1IWXA 1HFZA 3HTDA 4AXTA 3CGWA 3HJQA 1OUIA 5JENB 1GEVA 4CFOA 1JTPL 1MLCE 4HJYA 3U6DA 3SB9A 4ZIXA 3H4JA 1Q02A 4GIPA 4H92A 208LA 3LQRA 1DGGA 168LA 1IWVA 1P5CA 2PC2A 1GF7A 3WW6A 159LA 1UIBA 2Q2EB 3UK6A 3OTOM 2HKJA 1OUHA 3J2PB 4NSRA 3GLHB 1EQEA 1L57A 3LW5F 5LMNM 4FWGA 4ETAA 4I5SA 258LA 5KXSA 247LA 3SHFA 2J7NA 3WPJA 3TWMA 5ILFA 3GO8A 2R0IA 4OVZB 1F10A 1GE3A 4DR7M 4NRWA 1IP3A 3A6CY 4GCBA 1CV6A 2OQ4A 6LYZA 4JI1M 162LA 1CKDA 176LA 1L23A 1LZAA 4P16A 4H90A 5LMUM 3HHWA 3NY9A 5FEKA 2ZIKA 4LGMA 1DKJA 4S12A 3DZDA 3GXKA 3LYTA 2RB1X 4H9IA 4KPMA 2KXEA 3TXFA 3D8BA 4PDGA 182LA 1OUEA 1GB2A 242LA 1L2CA 140LA 1HT2E 5ITRA 4LRSA 157LA 1LZ5A 2EKSC 1L85A 1FDLY 4QNMA 5KXOA 2QHOB 1QUSA 3KP0E 1G0QA 2L7HA 2FBDA 3LYZA 2KRKA 3SBBC 4YF2A 1HC0A 1QANA 2QCUA 3WHKA 109LA 2YFQA 5KY1A 4XJHA 4PRUA 3HT6A 4LDLA 1TH4A 4KT3A 3GQ5A 1L56A 4NRVA 4GN4A 1IP6A 1CVKA 5L9JA 1G7MC 1QTZA 1LW9A 1INUA 5AMYA 4XGIA 2CJLA 181LA 4N9RA 2BQJA
chains in the Genus database with same CATH topology
1GB5A 1HELA 3DN8A 3SN6R 1CJ9A 1IWZA 3D4SA 4I7QA 1C43A 3HFMY 3HTBA 1CUQA 1KIRC 1GBWA 224LA 3SP3A 177LA 188LA 2HUBA 4BAFA 4NGYA 195LA 4LYMA 1LSDA 4DD0A 2HUMA 1HENA 1L06A 1CKHA 3CT5A 2Z19A 3LYOA 5FHWA 1QT4A 2LYOA 2HU3A 4LYZA 3ZEKA 1G0MA 3TXDA 1G0JA 3B0IA 4U3XB 1JIYA 1JJ1A 152LA 1YL1X 2XBSA 3HU8A 5FCPA 4LYCA 4AQNA 5E9RA 4WMGA 2ANXA 1WQQA 3A91A 1KW7A 4ZPUA 1LHMA 1OV5A 4HPIA 4ET8A 1WQMA 4NFVA 3A67Y 1QSWA 5E4PA 2DQFC 1L0JA 1C6LA 1GFJA 1JHLA 4IAPA 1L26A 1JTNA 4YXCA 1L46A 231LA 235LA 1L39A 6LYTA 3W6BA 3QNGA 1GAYA 2DQCY 1OUGA 1QTCA 1T8AA 1V7TA 1JPOA 4ETCA 1L42A 1GE1A 4OO9A 3TMWA 4W96A 1P2RA 3BKHA 1L50A 2RB0X 3GUOA 4N8ZA 254LA 4C5FA 2FYCA 1LZ1A 4WM3A 222LA 1LGUA 1IIZA 1WVVA 1IY3A 5D5FA 1LJHA 1B0DA 4I7PA 3FI7A 255LA 4I7KA 1NMMA 1JKDA 1L96A 1UIFA 155LA 4M4OA 1XGPC 4UWNA 1B5XA 2XJWA 3MGWA 1HEQA 1C68A 1D0KA 4WG7A 1T6HA 3OE6A 3W6DA 6LZMA 184LA 3CDQA 4Z98A 1BVKC 1DPXA 1VDPA 1QQYA 4GRVA 187LA 3F9LA 4J1AA 3AGHA 2RBRA 1LYZA 1OUDA 2O4WA 4NWHA 2BLYA 194LA 1F0WA 4N1CC 3DN2A 4DDAA 1IVMA 1QTHA 1C6IA 1EL1A 1UIDA 1C45A 1C6HA 1LJ4A 1L55A 1LSBA 1GE0A 1I6SA 1NF5A 1AKIA 1LJIA 1XFPL 1D0MA 1BB3A 4H8YA 3A92A 1OP9B 3EBAB 5APCA 4LGKA 3WMKA 1QUHA 1ZURA 3QE8A 3WL2A 4H9HA 1TCYA 1VFBC 1LTMA 1GBSA 1PQDA 2RH1A 1HMKA 1C6BA 3QY4A 2LZ2A 3T6UA 3W6CA 2O79A 1HFYA 4I7JA 1K28A 3BKVA 1REYA 4LFXA 3VW7A 1RI8B 3HTGA 1C67A 1LSAA 1LKSA 4KL7A 4NHPA 1YAOA 3AW6A 1NBYC 1L14A 3TXBA 4J0LA 4HV1A 200LA 1WTNA 1L44A 3HUKA 3HTFA 1L53A 4WLYA 1ZVHL 249LA 1OWYA 2B70A 3IJUA 2BQBA 1LMTA 5IDDA 1LI6A 5APDA 1XGTC 3W6EA 2F30A 241LA 144LA 4LDOA 3N9CA 1XEIA 1LCNA 5F81A 4I7SA 3SB8A 4DJHA 3G3XA 1NQIA 3CSQA 1T8GA 1L07A 2F2NA 3NYAA 4HP0A 1QSQA 3WUAA 1L02A 5HMJA 2HULA 4FJRA 4OWHA 1OUAA 1L35A 1NDGC 1L0KA 2BQNA 1C6EA 1L68A 217LA 1JWRA 1HFXA 3QAKA 4NHTA 5A3EA 1OVHA 1GB3A 4QY9A 2BQLA 145LA 4B1AA 1B7SA 1JKCA 1L49A 3GUJA 3AZ4A 1JUGA 3W6FA 2YSSC 5F9UA 3ZVQB 1YROA 1I20A 4H9CA 4WO9A 3DMVA 3KAMA 1B7OA 1LSCA 3M18B 3CQLA 2D4JA 1REXA 3F8VA 4QDNA 1RJCB 2BQHA 1L45A 1JTMA 1GBZA 2MEBA 1WQNA 1L99A 1QT7A 2B74A 1OYUA 3HBEX 2BQKA 2ZNWY 132LA 1LSGA 1G7IC 1LSNA 1DYAA 2G4NA 1LHJA 1UIHA 1L09A 261LA 1HEPA 1L73A 4YOPA 133LA 1KY1A 4HPEA 5DL9A 1JJ3A 2IFFY 1IR9A 1LJEA 220LA 1GFHA 1VDQA 1LPIA 5IELA 5B1GA 1L77A 3AJNA 1JKAA 3IWRA 2MEHA 4LDEA 256LA 2MEAA 196LA 4YEMA 4TX7A 1D3NA 5LA5A 3AGGG 1UIEA 126LA 141LA 2I6ZA 1D2WA 122LA 1D2YA 3PDSA 207LA 4YXAC 1CU5A 1PQMA 1LYGA 4G9SA 1GB6A 245LA 1C6QA 3C8QA 1FLUA 5F16A 150LA 4H9EA 5I14A 3WULA 2LZMA 1QTDA 5KXWA 4WG1A 5D5CA 3V2WA 4XJBA 4M6DA 1QS5A 1FKQA 218LA 1L69A 4NGWA 1NDMC 4WOAA 4DQ7A 4DD2A 1HMLA 2OU8A 1QDTA 1XJTA 1GFKA 1SQ2L 1YKZX 1LJJA 1GF6A 1PZYA 4NIJA 1XJUA 1L22A 259LA 209LA 172LA 1DYFA 1C63A 1IP5A 1LKRA 1BWJA 3HT8A 4H9FA 4LT1A 4TTDA 4GCCA 175LA 1Z55A 2GV0A 3GUPA 1NWGA 1LZTA 5J7CA 1OUJA 4Z46A 239LA 1L03A 1DYGA 4HJZA 2YBNA 5LYZA 4NHSA 113LA 3NY8A 2A7FA 1LYHA 4PHIA 3TXKA 1CX6A 4DC4A 1GEZA 1LZDA 1G0KA 1JKBA 4RDSA 1GF0A 1SSWA 248LA 2NTHA 2Z2FA 1QTBA 173LA 1L43A 2W1LA 4B4IA 1L91A 4DWXA 1L70A 3OE0A 3D3DA 1EQ5A 2MEEA 1BB6A 3RT5X 3A95A 1L19A 163LA 5F14A 4W51A 1L98A 4GLVA 1CKFA 251LA 4HV2A 4ARJA 1C6KA 1UA6Y 1LMAA 3RU5A 1HEMA 4DYGA 1CV5A 4LT0A 1OVJA 2DQJY 4RLMA 4NGKA 4HJVA 1DQJC 114LA 3RW8A 229LA 4OOTA 3HBHA 3EO5A 1GBYA 3N9EA 3AB6A 1DI4A 3A3RX 1VDTA 1IWUA 3L64A 185LA 3TMXA 1LGXA 3OE8A 5DN5A 7LZMA 4GN5C 3C80A 5KXXA 1P7SA 1LSZA 1IWWA 1IP2A 1L37A 3DKEX 4TWSA 4TSBA 237LA 1AM7A 1L38A 3A96A 2F4AA 1A4VA 3DMZA 4XJGA 1RCMA 3G3WA 1LYDA 4I7LA 4NHQA 170LA 1T3PA 4EKQA 5L3IA 1SWYA 3UONA 4PGJB 153LA 5HNLA 4E3UA 2Q9EA 1TAYA 2BQOA 3GUMA 1L20A 1LJGA 186LA 2BLXA 234LA 2ZYCA 1QTKA 3J6KA 1C6PA 1SX2A 4WM4A 1OUBA 3A94A 1P46A 4GLAA 1F6SA 1L62A 3CB7A 2HEBA 228LA 129LA 3DN1A 1DPWA 3DN0A 1D9WA 1NBZC 1WTHA 1LI2A 4W55A 4Z41A 1L92A 134LA 4DAJA 2AUBA 2B75A 1O23A 3TMVA 174LA 1L13A 5A3ZA 4RW1A 1IWTA 4W59A 4DD1A 1B2KA 1UIAA 1CTWA 149LA 3ZVQA 4DD9A 225LA 4S0WA 1L21A 1CU0A 3GXRA 1PQKA 1XGQC 1BVXA 166LA 2B5ZA 1MELL 3LYMA 4W53A 221LA 1C08C 2F4GA 3WUMA 4MSTA 1L11A 1L80A 1IP7A 3ATOA 1BGIA 1L10A 3WPLA 212LA 180LA 1LSMA 3A34A 1KIPC 1FN5A 1L65A 3CT0A 1LJNA 2VB1A 123LA 2I26L 1CU3A 4LT2A 1CKGA 3ODUA 1LMCA 4NSGA 1HERA 8LYZA 4NSIA 3P68A 1L71A 183LA 1DI3A 1VAUA 1JTOL 1LYOA 2MEGA 4N9RA 3WYHA 1B7NA 1C6TA 1B5YA 1EQ4A 1L51A 2OU0X 1CX7A 2D6BA 4EKPA 4NHIA 2ZILA 3M3UA 2BQMA 1L90A 3GUKA 1UBZA 1UC0A 1YQVY 1DKKA 3P64A 1KXWA 4H94A 1LI3A 4DDCA 167LA 4NY5A 1GFGA 1GD6A 219LA 125LA 164LA 2DQEY 5C6JA 4YENA 1JJ0A 1OVKA 1DI5A 1J1PY 1L28A 142LA 3LZTA 1ZVYB 3J4GA 4NG1A 1LZ4A 2EQLA 1GF9A 3K2RA 1GF5A 3K3TA 4WL6A 3A93A 2EPEA 3WW5A 4ARQB 1HEWA 4ARQA 1LZNA 110LA 2RBQA 4N0JA 1D6PA 1C69A 1OV7A 1I56A 3HUAA 3AZ6A 1L84A 1LSPA 1YAPA 1DYDA 3G3AB 4NGOA 4EXMA 4W56A 4G4HA 1XEKA 1HEOA 3DN4A 3DN6A 4H91A 4RLNA 2OE9X 1IOTA 1IWYA 4OWCA 211LA 1LYFA 193LA 3RNXA 4GBRB 1GFTA 1B5UA 1L74A 4OW1A 2B7XA 197LA 4H8ZA 2DQDY 1D3FA 5FELA 1C64A 1T6VL 1C10A 1BQLY 189LA 5B59A 1I1ZA 3FA0A 2YBMA 4QEQA 2BQDA 2HEEA 2Z37A 1KY0A 246LA 5LVGA 5T3FA 5LAGA 4NGLA 1YAQA 4I7OA 2Q9DA 1GHLA 1BB4A 4EJ4A 148LE 2QB0B 4WO6A 2Z18A 154LA 4LZTA 3C8SA 4XJIA 4W54A 1L16A 1HF4A 2MECA 2RAYX 2L78A 1DYBA 4XN6A 1TBYA 2H9JA 4GCEA 1GBXA 1LWGA 1L30A 4YEOA 1L24A 4DD3A 1G7JC 250LA 2Z12A 3W3EA 3B6LA 4LYTA 4W52A 4W94A 1CJ6A 2RB2X 1LMOA 1G1WA 1L93A 3SB6A 104LA 1YAMA 4XYYA 1WQOA 1AZFA 1C6NA 2H9KA 2HEDA 5HQ1A 1G07A 4O34A 3G3VA 1HSXA 4ETEA 4CFPA 1CJ8A 2OU9A 1P37A 214LA 1AT6A 1LZCA 2RBSA 2B72A 3OJPA 1XSFA 1G0PA 4G4CA 4I0CA 1C65A 3TXGA 4RW2A 1SWZA 1C6GA 2DQIY 4IJ4A 1BB7A 5HMVA 1L29A 3TXHA 1V7SA 5KXMA 143LA 4PK0A 1L66A 1WTMA 1B7QA 226LA 2CWIA 2XQOA 3N9AA 1L64A 1GPQC 1QSBA 147LA 1LZBA 3B0OA 156LA 2H5ZA 1LOZA 1D3MA 1LAAA 2ZQ4A 118LA 165LA 1FLQA 227LA 1L36A 4WL7A 2I25L 4H9BA 1CUPA 1LHKA 2D4KA 4C3WA 1LYIA 5HNCA 236LA 4N5RA 5KXTA 4I8SA 1B5WA 4A7DA 1L81A 2OE7X 3C8RA 4UWUA 3GULA 1CNSA 1P6YA 5LVJA 4ZEEA 1T8FA 1L04A 1L05A 1L48A 4PPOA 4I7RA 3HT9A 4YM8A 1B5VA 1YKYX 1OWZA 1G1VA 4ET9A 1J1XY 4LFPA 4LYOA 1EPYA 1F6RA 244LA 5B05A 198LA 3WH1A 1IR7A 1KXXA 3FADA 4H93A 128LA 1GFRA 1ZV5L 4XJFA 1NKHA 4I7TA 1JQUA 1QUOA 107LA 4G4BA 1KNIA 5KXLA 3PBLA 1C6AA 2N5ZA 4ARLA 1GFUA 1L72A 2HEFA 3CT1A 1RFPA 1QT5A 3WPKA 4GCDA 131LA 1L79A 1W6ZA 1GFEA 2BQIA 1L87A 2F47A 1L67A 3JR6A 1L01A 1NHBA 3GUIA 1GDWA 1GFAA 1L12A 1DZBX 1D0LA 1GE2A 2YBLA 1NHEA 4ARMB 4ARMA 151LA 2DQGY 2LCBA 4ETDA 4XJDA 191LA 5F9XA 3C81A 1YIKA 1LSYA 3ULRA 169LA 243LA 1XGRC 3OK0A 4I7MA 3HH6A 5KXZA 3RZEA 1REZA 2YDGA 2Z39A 3AYQA 1L40A 111LA 4CGEA 160LA 1IC4Y 5I4XA 4G49A 1CV4A 1P56A 5KKJA 4WLXA 1JSFA 1IORA 1QSAA 130LA 2OE4X 3RUNA 2W1XA 4EOFA 2FYDA 9LYZA 4DT3A 1CV3A 2NWDX 119LA 4H9AA 1L61A 1LYSA 1L83A 206LA 1GF3A 1L63A 2LC9A 5LYMA 2IHLA 127LA 4B49A 3SBAA 5KXNA 2YVBA 2DBTA 1FBIX 1QIOA 1GF8A 2G4PA 3P4ZA 1LZGA 3LHMA 2RBNA 240LA 1IOCA 190LA 1L47A 1A2YC 2HECA 215LA 1GXV2 1L54A 1CU2A 1GDXA 1XEJA 4D9ZA 4HTKA 2CUUA 1P64A 4GN3A 1C6DA 1L25A 3WXTA 1SX7A 5KXYA 3T36A 4DQ5A 4XENA 1DYCA 4NGJA 3HH4A 1LZ6A 3AW7A 3EMLA 1CKCA 1TEWA 1N4FA 1B7LA 1LZYA 5I53A 4J7VA 2HEAA 4ZFPA 1JTTL 103LA 5LVIA 2MEFA 2WARA 1KIQC 3G3BB 2B6XA 4NEBA 2Q0MX 1YANA 1GFVA 115LA 1B9OA 3WU9A 1LZRA 7LYZA 3AGIA 3AZ7A 4LT3A 1ZYTA 4EKSA 216LA 4NG8A 4FDYA 4H8XA 5L3HA 1PQJA 3WU8A 2YBHA 137LA 1C46A 3LZMA 1LWKA 4NSHA 1ZMYL 4CJ2A 2OEAX 205LA 5C6LA 1L27A 1L41A 4MCKA 3WVYA 4WM6A 223LA 1QS9A 4H1PA 1D3JA 1BHZA 4OWEA 4NWEA 1L18A 2D4IA 1IOQA 1OUFA 3WVXA 2HTXA 2ZWBA 233LA 4NSJA 1DYEA 2ZNXY 1GB9A 1IEEA 3P65A 5KJ9A 192LA 1WQRA 1LMPA 3HH3A 1QUTA 3CDOA 3B72A 2XBRA 3HUQA 1TLAA 5I4WA 5M1YA 3SB7A 2A4TA 5APFA 5C6IA 5LYTA 1YKXX 3EXDA 4WM5A 2W1YA 1LMNA 2BQCA 2XTHA 3CDTA 1E8LA 1D9UA 199LA 2ZQ3A 1UIGA 2G4QA 1H6MA 4GCFA 2ZIJA 3HDFA 2C8OA 4DQJA 1GB8A 102LA 4EPFA 1IOSA 171LA 3C82A 4II8A 1W08A 4E97A 3V2YA 4OWBA 3B0KA 4OOOA 1QT6A 3DN3A 257LA 2B73A 1RE2A 4EMNA 1L82A 2BAAA 5B1FA 4WM1A 161LA 1L86A 3A3QA 5HLLA 1ZWNA 4NGZA 3W6AA 1BB5A 1L00A 3LN2A 2DKVA 2BQEA 3P66A 1BWHA 1LGWA 2CGIA 1QTEA 2F32A 1P3NA 1REMA 5LA8A 2BPUA 3D9AC 1YILA 4L41A 1XEPA 3HWLA 2F2QA 1KXYA 1GXXA 1GWDA 5ILCA 1OQMA 139LA 1L32A 1LYEA 2Y8PA 1FLWA 4R0FA 1L34A 2MEDA 1JITA 1CU6A 1L31A 5I4YA 4B4EA 1QT3A 1L33A 3DNAA 5DM9A 5DLAA 1JEFA 1SSYA 1P2CC 5I5QA 4TSCA 5B06A 1LMQA 2A7DA 3ATNA 1QUGA 3C7WA 1VEDA 3A90A 253LA 3EMSA 2ANVA 5LVHA 3WU7A 1LZEA 1FKVA 1LPYA 1C6MA 2LYZA 4N1EI 1AT5A 3CSZA 1PQIA 1IO5A 3HBDA 4YX7C 3VWOA 230LA 2Z6BA 1T97A 1BWIA 2HU1A 5LINA 4EKRA 2B6ZA 4ETBA 2RBPA 4MR1A 1LLHA 4HTNA 5FSTA 2X0AA 1L75A 1C6FA 3TXIA 3HH5A 238LA 3IJVA 4HTQA 1GE4A 1GBOA 158LA 4PRQA 1L58A 1G06A 1LJ3A 4ARPA 1L88A 2W1MA 1G7HC 1OUCA 1LZ8A 4X3BA 4WLTA 3A6BY 178LA 262LA 1UUZC 2ZYPA 1WVUA 1QUDA 3E3DA 3C7YA 4W58A 1CV1A 4DKLA 1C62A 4KXIA 4B4JA 1GB0A 260LA 2Z2EA 210LA 1HNLA 1DXJA 1GAZA 4W57A 5II3A 4IATA 1ALCA 4WM2A 4R6CA 2HUKA 1B7RA 213LA 2RBOA 3GUNA 1UACY 1HHLA 252LA 3TMUA 2OTZX 2IGCA 4DDBA 146LA 1B7MA 3TXJA 1GF4A 4HSFA 2RAZX 2EIZC 1IR8A 5FDJA 3HU9A 1JISA 1L08A 3CSRA 4NGIA 4P2EA 1QTVA 1P36A 1LJFA 1P2LA 4J1BA 1L94A 4CHXA 1J1OY 3HDEA 1C66A 3FI5A 1IP1A 3CDVA 1LHHA 4ML7A 5K7OA 1C7PA 2BQGA 5DN4A 5B07A 4B0DA 5KXRA 112LA 2B6YA 2DQHY 1C6CA 1G0LA 3TXEA 1LSFA 108LA 3LZ2A 1B5ZA 3WUNA 2MEIA 4Z3MA 2NTGA 3C7ZA 1LSEA 1L97A 1JSEA 5LAFA 4DD7A 4I7NA 1D6QA 2B6TA 1L59A 2RSCA 3AZ5A 1L17A 4QGZA 2C8PA 3HT7A 3SB5A 1IC7Y 1VDSA 1LZSA 5APEA 1PQOA 5KXKA 4IASA 4BS7A 1L60A 1H87A 2YBJA 4WLDA 4ANRA 4XADA 1LHLA 1QT8A 1IY4A 2BQFA 1VATA 3A8ZA 4LZMA 5EBHA 5IHGA 5I54A 3L2XA 1PS5A 1KW5A 4K5YA 2QARC 3WXUA 1LZ9A 2LYMA 1IX0A 120LA 1HSWA 1L15A 1L95A 4EPIA 3DMXA 4BAPA 3FE0A 2LHMA 1LYJA 1CJ7A 1WQPA 2BQAA 1LJKA 1C61A 4BADA 232LA 1KS3A 1LHIA 2D91A 4TUNA 201LA 1IP4A 1C60A 5KXPA 1G7LC 1B7PA 4LYBA 2Z38A 1YL0X 2O7AA 1L76A 2YBIA 3CDRA 1UICA 3RZ4A 1FLYA 1XGUC 1IC5Y 1B6IA 1L52A 3OE9A 135LA 3C83A 138LA 1G0GA 1GB7A 4PJ2C 1L89A 5LIOA 2FBBA 2DQAA 2CDSA 1C6JA 1LYYA 4PJZA 1SLYA 1QDRA 5LVKA 2OTYX 5KKIA 3F6ZA 4NGVA 1UCOA 2LZTA 5LZMA 4AGAA 4UWVA 5LXWA 1CV0A 2B6WA 4OWAA 1TDYA 1IWXA 1HFZA 3HTDA 4AXTA 1OUIA 5JENB 1GEVA 4CFOA 1JTPL 1MLCE 4HJYA 3SB9A 4ZIXA 4H92A 208LA 168LA 1IWVA 1P5CA 2PC2A 1GF7A 3WW6A 159LA 1UIBA 1OUHA 1EQEA 1L57A 4ETAA 258LA 5KXSA 247LA 3WPJA 5ILFA 1F10A 1GE3A 1IP3A 3A6CY 4GCBA 1CV6A 6LYZA 162LA 1CKDA 176LA 1L23A 1LZAA 4H90A 3NY9A 5FEKA 2ZIKA 1DKJA 3GXKA 4H9IA 3LYTA 2RB1X 4KPMA 3TXFA 182LA 1OUEA 1GB2A 242LA 140LA 157LA 1LZ5A 2EKSC 1L85A 1FDLY 5KXOA 1QUSA 2FBDA 1G0QA 3SBBC 3LYZA 4YF2A 1HC0A 109LA 5KY1A 4XJHA 4PRUA 3HT6A 4LDLA 4KT3A 1L56A 4GN4A 1IP6A 1CVKA 5L9JA 1G7MC 1QTZA 1LW9A 1INUA 5AMYA 2CJLA 181LA 2BQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F16 A;  1HF4 A;  2MEC A;  1GB5 A;  3A3Q A;  4H9E A;  1HEL A;  5HLL A;  3WUL A;  4NGZ A;  4XN6 A;  1TBY A;  3W6A A;  2H9J A;  1BB5 A;  4GCE A;  5KXW A;  1CJ9 A;  1GBX A;  1IWZ A;  3LN2 A;  4WG1 A;  5D5C A;  1C43 A;  2DKV A;  4XJB A;  3HFM Y;  2BQE A;  4YEO A;  4M6D A;  1FKQ A;  3P66 A;  1BWH A;  4DD3 A;  2CGI A;  1QTE A;  4NGW A;  1NDM C;  1KIR C;  1GBW A;  1REM A;  4WOA A;  1G7J C;  3SP3 A;  2Z12 A;  3W3E A;  3B6L A;  4LYT A;  5LA8 A;  2BPU A;  3D9A C;  1YIL A;  4L41 A;  1CJ6 A;  4W94 A;  4DD2 A;  1LMO A;  2HUB A;  1HML A;  4BAF A;  4NGY A;  1QDT A;  1YAM A;  4XYY A;  4LYM A;  1KXY A;  1GXX A;  1GFK A;  1LSD A;  1AZF A;  1SQ2 L;  1WQO A;  1YKZ X;  1LJJ A;  2H9K A;  1GF6 A;  1GWD A;  1PZY A;  2HED A;  4NIJ A;  5ILC A;  5HQ1 A;  1HEN A;  1CKH A;  3CT5 A;  1OQM A;  2Z19 A;  4O34 A;  1HSX A;  2Y8P A;  4ETE A;  1FLW A;  1IP5 A;  1LKR A;  1BWJ A;  4H9F A;  4LT1 A;  3LYO A;  4R0F A;  5FHW A;  2MED A;  4CFP A;  1JIT A;  5I4Y A;  2LYO A;  1CJ8 A;  4B4E A;  2HU3 A;  4LYZ A;  4TTD A;  4GCC A;  3ZEK A;  1Z55 A;  2GV0 A;  5DM9 A;  3TXD A;  3B0I A;  5DLA A;  1NWG A;  1AT6 A;  4U3X B;  1JIY A;  1JJ1 A;  1JEF A;  1LZT A;  5J7C A;  1LZC A;  1P2C C;  1OUJ A;  5I5Q A;  4Z46 A;  1YL1 X;  2XBS A;  4HJZ A;  4TSC A;  5B06 A;  1LMQ A;  2A7D A;  3ATN A;  2YBN A;  3OJP A;  5FCP A;  1XSF A;  4G4C A;  4I0C A;  4LYC A;  5E9R A;  1VED A;  4RW2 A;  3A90 A;  4WMG A;  5LYZ A;  3TXG A;  3EMS A;  5LVH A;  2DQI Y;  3WU7 A;  4NHS A;  1WQQ A;  1LZE A;  4IJ4 A;  1FKV A;  3A91 A;  2A7F A;  4PHI A;  2LYZ A;  1BB7 A;  4N1E I;  3TXK A;  5HMV A;  1AT5 A;  3TXH A;  1V7S A;  3CSZ A;  5KXM A;  1IO5 A;  1LHM A;  3HBD A;  3VWO A;  4DC4 A;  1WTM A;  1GEZ A;  1LZD A;  1B7Q A;  4HPI A;  2CWI A;  3N9A A;  4ET8 A;  1BWI A;  2HU1 A;  1JKB A;  4RDS A;  1GF0 A;  5LIN A;  1WQM A;  4NFV A;  1GPQ C;  2Z2F A;  3A67 Y;  1LZB A;  3B0O A;  4ETB A;  2H5Z A;  1LOZ A;  4MR1 A;  1QSW A;  5E4P A;  2W1L A;  4B4I A;  1LAA A;  2ZQ4 A;  2DQF C;  1FLQ A;  4HTN A;  4DWX A;  4WL7 A;  3D3D A;  1EQ5 A;  2I25 L;  1GFJ A;  1JHL A;  2MEE A;  4H9B A;  1BB6 A;  5FST A;  3RT5 X;  1LHK A;  2D4K A;  2X0A A;  4C3W A;  5HNC A;  4N5R A;  5KXT A;  3A95 A;  4I8S A;  1B5W A;  4A7D A;  6LYT A;  3W6B A;  5F14 A;  3TXI A;  3QNG A;  1GAY A;  2DQC Y;  3IJV A;  4UWU A;  1OUG A;  1CNS A;  5LVJ A;  4HTQ A;  1GE4 A;  1GBO A;  4GLV A;  1V7T A;  1JPO A;  1CKF A;  4PRQ A;  4ZEE A;  4ETC A;  1LJ3 A;  1GE1 A;  4HV2 A;  2W1M A;  1G7H C;  3TMW A;  4PPO A;  4W96 A;  1UA6 Y;  1OUC A;  1LMA A;  1LZ8 A;  4X3B A;  4WLT A;  3RU5 A;  1HEM A;  4DYG A;  3A6B Y;  4YM8 A;  1B5V A;  3BKH A;  4N8Z A;  4LT0 A;  2DQJ Y;  1YKY X;  4C5F A;  1UUZ C;  4ET9 A;  2ZYP A;  1J1X Y;  4LFP A;  4RLM A;  1WVU A;  2FYC A;  3E3D A;  4NGK A;  1LZ1 A;  4LYO A;  4HJV A;  4WM3 A;  1DQJ C;  1F6R A;  5B05 A;  4KXI A;  3RW8 A;  3WH1 A;  1IR7 A;  4OOT A;  1KXX A;  3HBH A;  3EO5 A;  4B4J A;  1GBY A;  1GB0 A;  2Z2E A;  1IIZ A;  1WVV A;  4H93 A;  1IY3 A;  3N9E A;  5D5F A;  3AB6 A;  1DI4 A;  1GFR A;  1LJH A;  1ZV5 L;  1HNL A;  1B0D A;  1DXJ A;  1NKH A;  3FI7 A;  4XJF A;  1GAZ A;  5II3 A;  4IAT A;  1ALC A;  3A3R X;  4WM2 A;  4R6C A;  1VDT A;  1NMM A;  1IWU A;  1JKD A;  1B7R A;  4G4B A;  1UIF A;  3TMX A;  5KXL A;  2N5Z A;  4M4O A;  1GFU A;  1UAC Y;  1XGP C;  4GN5 C;  4UWN A;  5DN5 A;  1B5X A;  1HHL A;  5KXX A;  3TMU A;  2XJW A;  1LSZ A;  2HEF A;  3CT1 A;  1RFP A;  3WPK A;  1IWW A;  3MGW A;  1IP2 A;  1HEQ A;  1D0K A;  4GCD A;  4DDB A;  4TWS A;  4TSB A;  1B7M A;  1AM7 A;  3TXJ A;  4WG7 A;  3A96 A;  1GF4 A;  2F4A A;  4HSF A;  3W6D A;  1W6Z A;  1A4V A;  4XJG A;  1GFE A;  4Z98 A;  2BQI A;  2EIZ C;  1BVK C;  1RCM A;  1DPX A;  1VDP A;  1QQY A;  1IR8 A;  5FDJ A;  4NHQ A;  4J1A A;  3AGH A;  1JIS A;  1LYZ A;  3CSR A;  4NGI A;  1OUD A;  1T3P A;  5L3I A;  1GDW A;  1GFA A;  4NWH A;  4P2E A;  1DZB X;  2BLY A;  1D0L A;  1GE2 A;  4PGJ B;  2YBL A;  153L A;  194L A;  1LJF A;  1NHE A;  5HNL A;  4E3U A;  1F0W A;  4J1B A;  4N1C C;  1TAY A;  2BQO A;  2DQG Y;  4CHX A;  1J1O Y;  4DDA A;  1LJG A;  1IVM A;  4ETD A;  2BLX A;  4XJD A;  2ZYC A;  1IP1 A;  1LHH A;  4ML7 A;  1EL1 A;  1QTK A;  1UID A;  3J6K A;  1C7P A;  5K7O A;  5F9X A;  2BQG A;  4WM4 A;  1C45 A;  5DN4 A;  5B07 A;  4B0D A;  1LJ4 A;  1OUB A;  1YIK A;  3A94 A;  1LSY A;  4GLA A;  3ULR A;  5KXR A;  1LSB A;  1F6S A;  3CB7 A;  1GE0 A;  2DQH Y;  2HEB A;  1XGR C;  3TXE A;  1LSF A;  3OK0 A;  1NF5 A;  3LZ2 A;  1AKI A;  1B5Z A;  1LJI A;  3WUN A;  1DPW A;  1XFP L;  1NBZ C;  4Z41 A;  5KXZ A;  1D0M A;  1BB3 A;  4H8Y A;  2MEI A;  134L A;  4Z3M A;  1REZ A;  2YDG A;  2Z39 A;  3A92 A;  3AYQ A;  1OP9 B;  1LSE A;  3EBA B;  2AUB A;  5APC A;  1O23 A;  4LGK A;  1JSE A;  3TMV A;  4CGE A;  1IC4 Y;  3WMK A;  5I4X A;  4G49 A;  5LAF A;  4DD7 A;  5A3Z A;  1D6Q A;  4RW1 A;  1IWT A;  4DD1 A;  5KKJ A;  2RSC A;  1B2K A;  4WLX A;  1JSF A;  3QE8 A;  3WL2 A;  1IOR A;  3AZ5 A;  1UIA A;  2C8P A;  4QGZ A;  4H9H A;  1QSA A;  1TCY A;  1VFB C;  1LTM A;  1IC7 Y;  1GBS A;  1VDS A;  3ZVQ A;  4DD9 A;  1LZS A;  1HMK A;  5APE A;  3QY4 A;  5KXK A;  2LZ2 A;  2W1X A;  3T6U A;  3W6C A;  4EOF A;  4IAS A;  1HFY A;  4BS7 A;  2FYD A;  3GXR A;  1XGQ C;  3BKV A;  1BVX A;  9LYZ A;  4DT3 A;  1REY A;  2NWD X;  4H9A A;  4LFX A;  1H87 A;  2B5Z A;  2YBJ A;  1LYS A;  4WLD A;  1RI8 B;  1LSA A;  1MEL L;  4ANR A;  1GF3 A;  1LKS A;  4XAD A;  1LHL A;  3LYM A;  2IHL A;  5LYM A;  4KL7 A;  1IY4 A;  2BQF A;  4B49 A;  5KXN A;  4NHP A;  2YVB A;  1YAO A;  2F4G A;  1C08 C;  3WUM A;  1VAT A;  3A8Z A;  2DBT A;  1FBI X;  3AW6 A;  1QIO A;  5EBH A;  1GF8 A;  1NBY C;  2G4P A;  3P4Z A;  1LZG A;  3LHM A;  4MST A;  3TXB A;  1IP7 A;  3ATO A;  5IHG A;  4J0L A;  1IOC A;  4HV1 A;  5I54 A;  1WTN A;  1PS5 A;  1BGI A;  3WXU A;  1LZ9 A;  4WLY A;  1A2Y C;  1ZVH L;  2LYM A;  2HEC A;  1IX0 A;  3WPL A;  1GXV 2;  1HSW A;  1GDX A;  1LSM A;  4BAP A;  3A34 A;  3IJU A;  2BQB A;  1LMT A;  1KIP C;  1XEJ A;  5IDD A;  4D9Z A;  4HTK A;  5APD A;  1XGT C;  4GN3 A;  1FN5 A;  3W6E A;  2F30 A;  3FE0 A;  3WXT A;  3CT0 A;  5KXY A;  1LJN A;  2LHM A;  2I26 L;  2VB1 A;  3T36 A;  3N9C A;  1CJ7 A;  1WQP A;  1CKG A;  2BQA A;  4LT2 A;  1XEI A;  4XEN A;  1LJK A;  1LMC A;  4NSG A;  1HER A;  4NGJ A;  1LCN A;  1LZ6 A;  5F81 A;  3AW7 A;  1CKC A;  1TEW A;  4BAD A;  1N4F A;  1LHI A;  1B7L A;  2D91 A;  8LYZ A;  1LZY A;  4TUN A;  1IP4 A;  5I53 A;  4NSI A;  5KXP A;  1G7L C;  4J7V A;  1B7P A;  1NQI A;  3P68 A;  4LYB A;  2Z38 A;  2HEA A;  1DI3 A;  1YL0 X;  4ZFP A;  1JTT L;  3CSQ A;  2YBI A;  1UIC A;  1JTO L;  1LYO A;  1VAU A;  2MEG A;  4N9R A;  5LVI A;  3WYH A;  1B7N A;  3RZ4 A;  1FLY A;  1XGU C;  2F2N A;  2MEF A;  4HP0 A;  1IC5 Y;  2WAR A;  1B5Y A;  3WUA A;  1KIQ C;  1EQ4 A;  3G3B B;  5HMJ A;  4FJR A;  4NEB A;  4OWH A;  135L A;  1OUA A;  2Q0M X;  1YAN A;  2D6B A;  1GB7 A;  1NDG C;  4PJ2 C;  5LIO A;  2BQN A;  2FBB A;  4NHI A;  1GFV A;  1B9O A;  2DQA A;  2CDS A;  2ZIL A;  3M3U A;  1JWR A;  1HFX A;  2BQM A;  4NHT A;  3WU9 A;  5A3E A;  1GB3 A;  4QY9 A;  2BQL A;  1UBZ A;  1B7S A;  1JKC A;  1LYY A;  1LZR A;  4B1A A;  7LYZ A;  1SLY A;  3AGI A;  1UC0 A;  1QDR A;  5LVK A;  1YQV Y;  5KKI A;  1DKK A;  3P64 A;  3AZ7 A;  3F6Z A;  1KXW A;  4H94 A;  4LT3 A;  3AZ4 A;  1UCO A;  4NGV A;  4DDC A;  4NG8 A;  1JUG A;  4FDY A;  2LZT A;  4H8X A;  4NY5 A;  3W6F A;  1GFG A;  1GD6 A;  2YSS C;  2DQE Y;  5F9U A;  5C6J A;  4YEN A;  5L3H A;  1JJ0 A;  4AGA A;  3WU8 A;  4UWV A;  3ZVQ B;  5LXW A;  1DI5 A;  1C46 A;  1TDY A;  1IWX A;  1HFZ A;  1YRO A;  2YBH A;  4OWA A;  1J1P Y;  1I20 A;  4H9C A;  4NSH A;  4WO9 A;  4AXT A;  1OUI A;  3LZT A;  5JEN B;  3KAM A;  1GEV A;  4CFO A;  1ZVY B;  3J4G A;  1JTP L;  1B7O A;  1MLC E;  4NG1 A;  1ZMY L;  1LSC A;  4HJY A;  1LZ4 A;  3CQL A;  3M18 B;  4ZIX A;  2EQL A;  1GF9 A;  2D4J A;  1GF5 A;  4CJ2 A;  5C6L A;  3K3T A;  4H92 A;  1REX A;  208L A;  3A93 A;  4WL6 A;  4QDN A;  1RJC B;  2BQH A;  2EPE A;  1IWV A;  4MCK A;  3WVY A;  3WW5 A;  1HEW A;  2PC2 A;  1GF7 A;  3WW6 A;  1GBZ A;  4WM6 A;  1UIB A;  1LZN A;  2MEB A;  1WQN A;  4N0J A;  1D6P A;  4H1P A;  1OUH A;  1I56 A;  1BHZ A;  4OWE A;  1EQE A;  3AZ6 A;  3HBE X;  4NWE A;  2BQK A;  2ZNW Y;  132L A;  4DD0 A;  2D4I A;  1IOQ A;  1LSP A;  1LSG A;  1YAP A;  3G3A B;  4NGO A;  4ETA A;  1G7I C;  1OUF A;  5KXS A;  3WVX A;  1LSN A;  1XEK A;  4G4H A;  1HEO A;  3WPJ A;  5ILF A;  4H91 A;  2HTX A;  2ZWB A;  1F10 A;  2G4N A;  4RLN A;  1LHJ A;  1GE3 A;  1UIH A;  4NSJ A;  1HEP A;  1IOT A;  1IWY A;  2ZNX Y;  1GB9 A;  1IEE A;  3P65 A;  4YOP A;  4OWC A;  133L A;  5KJ9 A;  1IP3 A;  4HPE A;  3A6C Y;  4GCB A;  5DL9 A;  1JJ3 A;  193L A;  2IFF Y;  3RNX A;  6LYZ A;  1CKD A;  1IR9 A;  1WQR A;  1LJE A;  1GFT A;  1B5U A;  1LMP A;  1LZA A;  1GFH A;  4OW1 A;  4H90 A;  1QUT A;  1VDQ A;  3B72 A;  2XBR A;  5FEK A;  2ZIK A;  1DKJ A;  1LPI A;  4H8Z A;  3GXK A;  4H9I A;  3LYT A;  4KPM A;  3TXF A;  5I4W A;  5M1Y A;  1OUE A;  5APF A;  5IEL A;  1GB2 A;  2DQD Y;  5FEL A;  1T6V L;  1C10 A;  5C6I A;  5B1G A;  1BQL Y;  3AJN A;  5LYT A;  1JKA A;  1YKX X;  1LZ5 A;  2EKS C;  3IWR A;  3EXD A;  4WM5 A;  2W1Y A;  2MEH A;  1LMN A;  5B59 A;  1I1Z A;  1FDL Y;  2BQC A;  2MEA A;  2XTH A;  1QUS A;  5KXO A;  2YBM A;  2FBD A;  3LYZ A;  4QEQ A;  4YEM A;  1D9U A;  4YF2 A;  1E8L A;  2BQD A;  1HC0 A;  4TX7 A;  2HEE A;  1UIG A;  2ZQ3 A;  2Z37 A;  2G4Q A;  5KY1 A;  4XJH A;  5LVG A;  4PRU A;  1H6M A;  5LA5 A;  5T3F A;  4GCF A;  2ZIJ A;  3AGG G;  5LAG A;  4NGL A;  4KT3 A;  2C8O A;  1YAQ A;  1GB8 A;  1UIE A;  2I6Z A;  1IOS A;  4II8 A;  1GHL A;  1W08 A;  1BB4 A;  3B0K A;  4OWB A;  4OOO A;  207L A;  4GN4 A;  1RE2 A;  1IP6 A;  4EMN A;  5L9J A;  1G7M C;  4WO6 A;  2BAA A;  2Z18 A;  5B1F A;  4WM1 A;  1INU A;  154L A;  4G9S A;  5AMY A;  1GB6 A;  2CJL A;  4LZT A;  1FLU A;  4XJI A;  2BQJ A; 
#chains in the Genus database with same CATH topology
 3GRR A;  4GHL A;  1GB5 A;  1HEL A;  3DN8 A;  3SAV A;  1JQJ C;  2Y21 A;  3SN6 R;  1CJ9 A;  1IWZ A;  3D4S A;  3MJ5 A;  4I7Q A;  1C43 A;  3HFM Y;  2OO9 A;  3HTB A;  1QYR A;  1VEG A;  3IHP A;  2C96 A;  4FW9 A;  1CUQ A;  1KIR C;  1GBW A;  224L A;  3SAU A;  3IG8 A;  3SP3 A;  177L A;  4GEW A;  188L A;  4AI6 A;  2L2D A;  2HUB A;  4BAF A;  4NGY A;  3CF0 A;  195L A;  4LYM A;  3HU3 A;  1LSD A;  4DD0 A;  2HUM A;  3E46 A;  1HEN A;  1CKH A;  1L06 A;  3CT5 A;  1HQC A;  2Z19 A;  4LJ5 A;  3AV0 A;  1IN5 A;  3LYO A;  5FHW A;  1QT4 A;  4DR2 M;  2LYO A;  2HU3 A;  5EXP A;  4LYZ A;  3ZEK A;  1G0M A;  3TXD A;  1G0J A;  3B0I A;  3L25 A;  4U3X B;  1JIY A;  1JJ1 A;  2GQF A;  152L A;  1JB0 F;  2BNK A;  1YL1 X;  2XBS A;  4RNA A;  3HU8 A;  3ZQJ A;  5FCP A;  4CGY B;  4LYC A;  4AQN A;  5E9R A;  4WMG A;  2XLJ A;  2ANX A;  1WQQ A;  3U5Z A;  3A91 A;  1Q3C A;  2CHQ A;  1KW7 A;  1VG5 A;  4ZPU A;  1LHM A;  1OV5 A;  4HPI A;  4ET8 A;  2C99 A;  1QAQ A;  3K9O A;  1WQM A;  4NFV A;  3A67 Y;  3GLH E;  3GPY A;  1L1Z A;  1QSW A;  5E4P A;  4G3O A;  4FCV A;  4QHS A;  2DQF C;  1L0J A;  1V92 A;  1C6L A;  1GFJ A;  1JHL A;  4IAP A;  1L26 A;  3FTD A;  1JTN A;  4YXC A;  3HZJ A;  2KNZ A;  1L46 A;  231L A;  235L A;  1L39 A;  6LYT A;  3EIH A;  4IBG A;  3W6B A;  1T43 A;  3QNG A;  1GAY A;  4GMQ A;  2UXD M;  2DQC Y;  1TTE A;  3KOW E;  1OUG A;  1QTC A;  1T8A A;  1V7T A;  1JPO A;  4ETC A;  1L42 A;  2JUJ A;  1GE1 A;  2X8A A;  1NNJ A;  4OO9 A;  3TMW A;  4W96 A;  1IN8 A;  3VKG A;  1P2R A;  1L50 A;  2RB0 X;  3BKH A;  3GUO A;  254L A;  4N8Z A;  2VII A;  4C5F A;  4IBC A;  3GLG B;  2FYC A;  4DUZ M;  1LZ1 A;  4AKI A;  3RGP A;  1OFI A;  4WM3 A;  4FVM A;  3UGJ A;  2WSC F;  222L A;  1LGU A;  1IIZ A;  1WVV A;  1IY3 A;  2KHH A;  5L8R F;  5D5F A;  3KP1 E;  4EIW A;  1LJH A;  1B0D A;  4I7P A;  3FI7 A;  2RGO A;  255L A;  4MGY E;  4I7K A;  1NMM A;  1JKD A;  1L96 A;  1UIF A;  2JP7 A;  155L A;  2X4A A;  4M4O A;  1HNW M;  1XGP C;  4UWN A;  1B5X A;  3BXW A;  2XJW A;  4IJF A;  4G6Z A;  3MGW A;  2Z4S A;  1HEQ A;  1C68 A;  1D0K A;  1GJT A;  4WG7 A;  1Z5C A;  3Q8X A;  1T6H A;  3OE6 A;  3W6D A;  6LZM A;  184L A;  1XHB A;  3CDQ A;  4Z98 A;  1BVK C;  3NBI A;  2C9O A;  1DPX A;  2CV2 A;  1VDP A;  2YNM D;  1QQY A;  4GRV A;  187L A;  4DV3 M;  3F9L A;  1PGY A;  3M0E A;  4J1A A;  3KVW A;  3AGH A;  2RBR A;  1LYZ A;  4CIZ A;  3TWK A;  1OUD A;  2K6B A;  2O4W A;  3ZC7 B;  2LHC A;  4NWH A;  4G4R A;  2BLY A;  2DAE A;  4B3T M;  5FTL A;  194L A;  2YR0 A;  1F0W A;  4N1C C;  5E6J A;  3DN2 A;  4DDA A;  1IVM A;  1QTH A;  1R6B X;  1C6I A;  2KRU A;  1KFV A;  4Y28 F;  1EL1 A;  1UID A;  2VF7 A;  1C45 A;  1C6H A;  1GLN A;  1LJ4 A;  1L55 A;  1LSB A;  1SXJ A;  2F5S A;  1GE0 A;  1DGF A;  2Y20 A;  4MM3 B;  3HGI A;  4AKH A;  1I6S A;  1NF5 A;  1AKI A;  1LJI A;  1XFP L;  1D0M A;  1BB3 A;  4H8Y A;  3A92 A;  4X66 M;  1OP9 B;  3EBA B;  5APC A;  4LGK A;  2UXB M;  3WMK A;  4GC9 A;  1QUH A;  4DBG B;  1ZUR A;  3QE8 A;  3WL2 A;  4H9H A;  3FUW A;  1TCY A;  1VFB C;  1LTM A;  1HR0 M;  5KQD A;  1GBS A;  1PQD A;  2RH1 A;  1HMK A;  3U5Z B;  1C6B A;  3QY4 A;  2YQZ A;  4DV7 M;  2LZ2 A;  3T6U A;  3W6C A;  2JA2 A;  2O79 A;  1HFY A;  4I7J A;  4MGZ E;  1ORY B;  1K28 A;  3BKV A;  3B89 A;  1REY A;  4X64 M;  5KO3 A;  4LFX A;  1P3Q Q;  3B74 A;  3VW7 A;  3ZH9 B;  1DGH A;  1C67 A;  1LSA A;  1RI8 B;  3HTG A;  1LKS A;  3B7Q A;  5BPV A;  4KL7 A;  4NHP A;  4LF7 M;  1YAO A;  1NO1 A;  3AW6 A;  1NBY C;  1L14 A;  3TXB A;  2ZM6 M;  4AQY M;  4J0L A;  4HV1 A;  4JI0 M;  4X62 M;  200L A;  4NXN M;  1WTN A;  1L44 A;  3HUK A;  3HTF A;  1L53 A;  4WLY A;  1ZVH L;  249L A;  3KDS E;  2C5R A;  4DR6 M;  1OWY A;  2B70 A;  3IJU A;  2BQB A;  1LMT A;  5IDD A;  1LI6 A;  5APD A;  1XGT C;  2CFO A;  3W6E A;  2F30 A;  241L A;  144L A;  4LDO A;  2JY6 B;  3N9C A;  1XEI A;  1N33 M;  1LCN A;  5F81 A;  1SXJ D;  4I7S A;  2D7G A;  3SB8 A;  4DJH A;  3AL0 C;  4F2L A;  3G3X A;  1NQI A;  4PCZ A;  3CSQ A;  3B7Z A;  1T8G A;  5BR8 M;  1L07 A;  1ZMV A;  2F2N A;  3NYA A;  3SAT A;  4HP0 A;  2XEP A;  3KXE C;  1PJS A;  1TDZ A;  1QSQ A;  3WUA A;  1YSY A;  1L02 A;  5HMJ A;  4DR1 M;  2HUL A;  4FJR A;  4OWH A;  1OUA A;  4LGY A;  1L35 A;  1NDG C;  1L0K A;  2BQN A;  1C6E A;  1L68 A;  217L A;  1JWR A;  1HFX A;  3QAK A;  4NHT A;  5A3E A;  1OVH A;  1GB3 A;  4QY9 A;  2BQL A;  145L A;  4B1A A;  1B7S A;  1JKC A;  3T1H M;  1NV9 A;  3KOY E;  3L2A A;  1L49 A;  3GUJ A;  3AZ4 A;  5IZ7 D;  4NOO B;  1R2Z A;  4QNR A;  1JUG A;  3W6F A;  2CUZ A;  2YSS C;  3A45 A;  5F9U A;  1PJI A;  3ZVQ B;  1NHG C;  1YRO A;  1I20 A;  4H9C A;  4WO9 A;  3EIE A;  1IBM M;  3DMV A;  2OOB A;  3HJ8 A;  3KAM A;  4HLQ A;  1B7O A;  1LSC A;  3M18 B;  3CQL A;  2D4J A;  1REX A;  1GVN A;  3F8V A;  4QDN A;  2R4E A;  1RJC B;  2BQH A;  1L45 A;  3AFH A;  1JTM A;  1GBZ A;  2LVA A;  2MEB A;  1TF0 B;  1WQN A;  1L99 A;  3GLI A;  4CJ6 A;  2KA6 B;  1QT7 A;  2B74 A;  1OYU A;  3HBE X;  2RGH A;  2BQK A;  2ZNW Y;  132L A;  1LSG A;  3HHX A;  2R44 A;  1G7I C;  2HAK A;  4LFC M;  2CP8 A;  1LSN A;  1DYA A;  4LJ7 A;  2G4N A;  4X65 M;  1LHJ A;  1UIH A;  1L09 A;  1VAU A;  1HEP A;  1V34 A;  2O5R A;  5A2Q S;  1L73 A;  261L A;  4KO8 A;  4YOP A;  133L A;  1KY1 A;  4HPE A;  5EP2 A;  5DL9 A;  4R71 A;  1JJ3 A;  3PVS A;  2IFF Y;  4Z6Y A;  2QPA A;  1IR9 A;  1LJE A;  1WXQ A;  1Q39 A;  1GFH A;  220L A;  4CHT B;  1K3W A;  1VDQ A;  4JI5 M;  1LPI A;  3LMM A;  1DO0 A;  5IEL A;  4GIT A;  4AZF A;  3JR5 A;  5B1G A;  1L77 A;  3AJN A;  1JKA A;  3IWR A;  4JI2 M;  1FNN A;  2MEH A;  4LDE A;  3SMS A;  2DKL A;  256L A;  2MEA A;  196L A;  1HQY E;  3AOE C;  4YEM A;  4LJ9 A;  4MH0 E;  4FCW A;  4TX7 A;  3A98 B;  1D3N A;  3T15 A;  5LA5 A;  2LVO C;  3AGG G;  5FLX S;  2A5Y B;  1UIE A;  126L A;  4AG5 A;  141L A;  2I6Z A;  1D2W A;  1NSF A;  122L A;  4A3V B;  1D2Y A;  1LV7 A;  3FYD A;  2G5G X;  3PDS A;  207L A;  4YXA C;  3U6M A;  2DAG A;  3SAS A;  1CU5 A;  1PQM A;  1LYG A;  4G9S A;  1GB6 A;  245L A;  1FLU A;  1C6Q A;  3AKZ A;  3C8Q A;  5F16 A;  3BOS A;  150L A;  4H9E A;  5I14 A;  3WUL A;  3FKE A;  3HHZ A;  2LZM A;  1QTD A;  5KXW A;  1HJP A;  4WG1 A;  2Z3X A;  2JY5 A;  5D5C A;  3V2W A;  1K3X A;  4XJB A;  4M6D A;  3D8L A;  1FKQ A;  1QS5 A;  1ZMW A;  3LCU A;  2R6F A;  3GLG E;  218L A;  1L69 A;  4NGW A;  1NDM C;  4WOA A;  1C1K A;  4DQ7 A;  1G8P A;  4DD2 A;  3HU2 A;  1HML A;  2OU8 A;  1QDT A;  2UUC M;  1XJT A;  2F5N A;  1GFK A;  1SQ2 L;  1YKZ X;  1LJJ A;  1GF6 A;  1PZY A;  4NIJ A;  1XJU A;  1L22 A;  259L A;  4Q7J A;  209L A;  172L A;  1NY5 A;  4IIW A;  1DYF A;  1C63 A;  1OFH A;  1BWJ A;  1IP5 A;  1LKR A;  3HT8 A;  4H9F A;  4LT1 A;  4JN6 A;  2D7E A;  4TTD A;  4GCC A;  175L A;  1Z55 A;  3KSX A;  1N75 A;  2GV0 A;  3GUP A;  1NWG A;  1LZT A;  5J7C A;  1IXS B;  3DA1 A;  1OUJ A;  4Z46 A;  4M0D A;  1XXH E;  1J5E M;  239L A;  1L03 A;  1DYG A;  4HJZ A;  2YBN A;  5JI2 E;  4IBI A;  5LYZ A;  3HU1 A;  4NHS A;  7CAT A;  113L A;  3NY8 A;  1MU5 A;  2A7F A;  3KW6 A;  1LYH A;  4PHI A;  3TXK A;  1CX6 A;  2EA0 A;  3QYE A;  4DC4 A;  1GEZ A;  3KS8 A;  1LZD A;  1G0K A;  1JKB A;  2LHG A;  4RDS A;  1GF0 A;  4G4N A;  4HL4 A;  4IBF A;  1SSW A;  248L A;  1JR3 E;  2NTH A;  1QTB A;  2Z2F A;  3E21 A;  173L A;  1L43 A;  2W1L A;  4B4I A;  3KSJ A;  1L91 A;  4DWX A;  1L70 A;  3OE0 A;  3D3D A;  1EQ5 A;  1GO5 A;  2KZU A;  2OPF A;  2MEE A;  1IY0 A;  1BB6 A;  3RT5 X;  2JWS A;  3F92 A;  3A95 A;  3W0F A;  1L19 A;  5E26 A;  4B3M M;  163L A;  5F14 A;  3GLF B;  4W51 A;  1L98 A;  4GLV A;  1CKF A;  251L A;  4HV2 A;  4LF6 M;  5EP3 A;  4ARJ A;  1C6K A;  2CE7 A;  1UA6 Y;  1LMA A;  1VEK A;  1TDH A;  3RU5 A;  3FYC A;  1HEM A;  4DYG A;  1CV5 A;  4LT0 A;  2ZAM A;  1XNR M;  1OVJ A;  2DQJ Y;  3FTE A;  4RLM A;  2UUB M;  2KNA A;  4LZJ A;  4NGK A;  2DNA A;  4HJV A;  1KYI A;  1DQJ C;  2W82 A;  114L A;  3RW8 A;  229L A;  2CHG A;  4OOT A;  3HBH A;  2QP9 X;  3EO5 A;  1VDD A;  1GBY A;  1A5T A;  3ILK A;  4L16 A;  3N9E A;  2EJS A;  3AB6 A;  2FS1 A;  1DI4 A;  1CUK A;  4JV5 M;  3A3R X;  1VDT A;  1IWU A;  4LF8 M;  3L64 A;  185L A;  3TMX A;  1LGX A;  1V33 A;  1QZM A;  2XFS A;  3J81 S;  4LF9 M;  3OE8 A;  5DN5 A;  7LZM A;  4DR5 M;  4GN5 C;  3C80 A;  5KXX A;  1P7S A;  3L29 A;  1LSZ A;  2R4J A;  1XXH B;  1G3I A;  1IP2 A;  1IWW A;  1L37 A;  3DKE X;  2UXC M;  4TWS A;  4TSB A;  237L A;  2V1C A;  1AM7 A;  3UJN A;  1L38 A;  3A96 A;  3HKP A;  2DI0 A;  2CV1 A;  2F4A A;  3B7N A;  1A4V A;  3DMZ A;  4XJG A;  4JYA M;  3U60 A;  2APL A;  1RCM A;  3BBZ A;  2JNH A;  3G3W A;  1LYD A;  5ITX E;  4I7L A;  4NHQ A;  1H6U A;  170L A;  1SXJ C;  1WGN A;  4JXJ A;  2F5Q A;  1T3P A;  4EKQ A;  1ZV1 A;  5L3I A;  1SWY A;  3UON A;  2HCB A;  5ITU A;  4PGJ B;  153L A;  5HNL A;  4E3U A;  2Q9E A;  1TAY A;  2BQO A;  3GUM A;  1L20 A;  1LJG A;  3TPZ A;  186L A;  2R65 A;  2BLX A;  234L A;  2ZYC A;  3I4Y A;  1QTK A;  2BWE A;  3J6K A;  1C6P A;  1SX2 A;  2Y0Q A;  4WM4 A;  1OUB A;  1I94 M;  1P46 A;  3A94 A;  4GLA A;  1F6S A;  1L62 A;  3CB7 A;  2HEB A;  1N77 A;  228L A;  129L A;  3DN1 A;  1E94 E;  1L2D A;  1DPW A;  3DN0 A;  1D9W A;  1NBZ C;  1WTH A;  4XK8 F;  1LI2 A;  4W55 A;  4D81 A;  4Z41 A;  1L92 A;  3SYL A;  134L A;  3IG5 A;  4DAJ A;  1WIV A;  2DEN A;  3AJI B;  2AUB A;  2B75 A;  1O23 A;  3TMV A;  2KNV A;  4DV0 M;  174L A;  1L13 A;  1JR3 A;  5A3Z A;  4GHA A;  4RW1 A;  2QZ4 A;  1IWT A;  4W59 A;  4DD1 A;  1B2K A;  4PDI A;  4D80 A;  1UIA A;  2H5X A;  1CTW A;  2LTU A;  2DWM A;  149L A;  2LWX A;  3ZVQ A;  4DD9 A;  3HHY A;  225L A;  5EXS A;  3CF2 A;  4S0W A;  1R7R A;  2ZTC A;  1L21 A;  4R7G A;  3KS4 A;  1CU0 A;  3GXR A;  1PQK A;  1XGQ C;  1BVX A;  166L A;  2B5Z A;  4CIS A;  1MEL L;  3R9X B;  3GPX A;  3LYM A;  2EUC A;  1PJT A;  4W53 A;  2FNA A;  4AG6 A;  1C08 C;  221L A;  2F4G A;  3WUM A;  2MRO B;  2XH9 A;  4MST A;  1L11 A;  1L80 A;  1IP7 A;  3ATO A;  3J7A S;  4NC6 A;  3HWS A;  4Z8X A;  1BGI A;  1L10 A;  3WPL A;  2L6O A;  3QAU A;  212L A;  180L A;  1LSM A;  3A34 A;  1KIP C;  1IN7 A;  2XF3 A;  1FN5 A;  1L65 A;  3CT0 A;  4JI6 M;  4GKK M;  1LJN A;  2VB1 A;  123L A;  2I26 L;  1CU3 A;  3U6O A;  3ODU A;  1CKG A;  2CHV A;  4LT2 A;  1LMC A;  4NSG A;  1HER A;  3RE8 A;  2EO2 A;  1NJF A;  2F4V M;  1X37 A;  8LYZ A;  4NSI A;  3P68 A;  1L71 A;  183L A;  4BBA A;  1DI3 A;  3K8Z A;  4IBD A;  1JTO L;  3QWL A;  3SHG B;  3FRH A;  1QAM A;  1LYO A;  3CF6 E;  1B7N A;  2MEG A;  1C6T A;  1B5Y A;  1E9R A;  3M6A A;  2LVN C;  1EQ4 A;  1L51 A;  5EJC A;  2OU0 X;  1CX7 A;  5KQ8 A;  2D6B A;  4EKP A;  1DGH B;  1EIJ A;  5H37 D;  2DAM A;  4NHI A;  2R46 A;  2ZIL A;  3M3U A;  4L8R C;  3GRU A;  2BQM A;  1L90 A;  2KEB A;  3GUK A;  1UBZ A;  1R5L A;  1UC0 A;  1YQV Y;  3UMM A;  3GLF E;  1DKK A;  3P64 A;  1KXW A;  4H94 A;  1LI3 A;  4DDC A;  4AKG A;  167L A;  4NY5 A;  1GFG A;  1GD6 A;  219L A;  125L A;  164L A;  2DQE Y;  2Z7J A;  5C6J A;  4YEN A;  2XFT A;  1JJ0 A;  1OVK A;  1Y8G A;  1DI5 A;  1J1P Y;  1L28 A;  142L A;  3C9P A;  3LZT A;  1ZVY B;  3J4G A;  4NG1 A;  3PNV A;  2XSZ D;  4YHH M;  1LZ4 A;  2EQL A;  1GF9 A;  3K2R A;  1GF5 A;  3GPU A;  3K3T A;  4WL6 A;  3A93 A;  2EPE A;  2FFJ A;  3WW5 A;  4ARQ B;  1R2Y A;  3LVV A;  2I7N A;  1HEW A;  4ARQ A;  3VK7 A;  1LZN A;  110L A;  2RBQ A;  4N0J A;  3VKH A;  1D6P A;  3U6Q A;  1C69 A;  3E4R A;  2CEA A;  1OV7 A;  1I56 A;  3HUA A;  3AZ6 A;  3LQQ A;  4RF1 A;  1L84 A;  1LSP A;  1YAP A;  1DYD A;  3G3A B;  4NGO A;  4WW0 A;  3R8F A;  4DV5 M;  4EXM A;  2G3Q A;  4W56 A;  4G4H A;  3B9P A;  1NV8 A;  1HEO A;  1XEK A;  3DN4 A;  3DN6 A;  4H91 A;  4QOS A;  2P5T A;  4RLN A;  5EQT A;  2OE9 X;  1IOT A;  1IXS A;  1IWY A;  2Z4R A;  4D82 A;  1L2B A;  4OWC A;  211L A;  1LYF A;  5ITQ A;  193L A;  3RNX A;  4GBR B;  2QBY B;  4DV4 M;  1GFT A;  1B5U A;  1L74 A;  4OW1 A;  2B7X A;  197L A;  3FD9 A;  4KLN A;  4B3R M;  4H8Z A;  2KDL A;  1WGL A;  1R4G A;  1XC8 A;  2DQD Y;  2MGW A;  1D3F A;  5FEL A;  2VDB B;  4OW0 A;  1C64 A;  1T6V L;  1C10 A;  1BQL Y;  4NSO B;  1HNX M;  4DR3 M;  3U61 B;  189L A;  5B59 A;  1I1Z A;  3FA0 A;  2YBM A;  4QEQ A;  2BQD A;  2HEE A;  2CWB A;  2Z37 A;  1N78 A;  1KY0 A;  246L A;  5LVG A;  5T3F A;  5LAG A;  4NGL A;  1YAQ A;  4I7O A;  3DFZ A;  2Q9D A;  1GHL A;  3JR4 A;  1BB4 A;  4EJ4 A;  148L E;  4LFB M;  2QB0 B;  4WO6 A;  2Z18 A;  154L A;  1SXJ E;  3C8S A;  4LZT A;  4XJI A;  1L16 A;  4W54 A;  1HF4 A;  2MEC A;  1IBK M;  4NXM M;  2RAY X;  2L78 A;  1DYB A;  4XN6 A;  4MB7 A;  1TBY A;  2H9J A;  4GCE A;  1TR8 A;  1IN6 A;  2DHR A;  1GBX A;  2MR9 A;  1LWG A;  1L30 A;  4YEO A;  1VEJ A;  1L24 A;  1W5T A;  4DD3 A;  3SYK A;  4OU7 A;  1G7J C;  250L A;  2Z12 A;  3W3E A;  3B6L A;  4LYT A;  4W52 A;  4W94 A;  1CJ6 A;  2RB2 X;  1LMO A;  1G1W A;  1Z6T A;  1L93 A;  3SB6 A;  104L A;  1YAM A;  4K0K M;  4XYY A;  4F1I A;  1WQO A;  1AZF A;  1C6N A;  2H9K A;  1RU3 A;  2HED A;  1GJS A;  5HQ1 A;  1G07 A;  4O34 A;  3G3V A;  1HSX A;  2H1R A;  4IBB A;  4ETE A;  2QQ8 A;  3NBX X;  4CFP A;  1CJ8 A;  4GC5 A;  5ITT A;  2OU9 A;  1P37 A;  3FTF A;  3L27 A;  3M7G A;  214L A;  1AT6 A;  4GRI A;  1IY1 A;  3C3E A;  1LZC A;  2RBS A;  2B72 A;  3L26 A;  4GKJ M;  3GQ4 A;  1GKI A;  3OJP A;  1XSF A;  1G0P A;  4G4C A;  4I0C A;  1C65 A;  3TXG A;  4WP2 A;  4RW2 A;  1SWZ A;  1C6G A;  2DQI Y;  4IJ4 A;  5F3W A;  4LJA A;  1BB7 A;  1AIP C;  5HMV A;  1L29 A;  3TXH A;  1V7S A;  5IWA M;  5KXM A;  2G8L A;  4LF4 M;  143L A;  4PT5 A;  1L66 A;  4PK0 A;  1WTM A;  1OJL A;  3VDU A;  1B7Q A;  226L A;  2CWI A;  2XQO A;  3N9A A;  4TUW A;  1L64 A;  2BJV A;  1GPQ C;  1QSB A;  147L A;  1LZB A;  3B0O A;  156L A;  2H5Z A;  1LOZ A;  1D3M A;  1LAA A;  2ZQ4 A;  118L A;  165L A;  1FLQ A;  227L A;  1L36 A;  4WL7 A;  3Q8G A;  2I25 L;  4H9B A;  1CUP A;  4FCT A;  1LHK A;  2D4K A;  4C3W A;  1LYI A;  5HNC A;  236L A;  1MN3 A;  4N5R A;  5KXT A;  4I8S A;  1B5W A;  4A7D A;  1L81 A;  4W5W A;  1QAO A;  3FUT A;  2OE7 X;  3C8R A;  2FOI C;  4UWU A;  3GUL A;  3NWL A;  1CNS A;  1P6Y A;  4WUR A;  5LVJ A;  4ZEE A;  1T8F A;  1L04 A;  1L05 A;  1L48 A;  4PPO A;  1OIP A;  4RKU F;  4OVZ A;  3K1J A;  4I7R A;  3HT9 A;  4YM8 A;  1B5V A;  1EFU B;  1YKY X;  1OWZ A;  2JXN A;  1G1V A;  4ET9 A;  1J1X Y;  4LFP A;  1YUB A;  1D2N A;  4LYO A;  1EPY A;  3L28 A;  1MX0 A;  1F6R A;  244L A;  5B05 A;  198L A;  1TH3 A;  4MGI E;  3WH1 A;  1IR7 A;  1KXX A;  3FAD A;  2KZS A;  5EP1 A;  2ZAN A;  1OTR A;  4H93 A;  128L A;  4DV2 M;  1GFR A;  1ZV5 L;  4XJF A;  1NKH A;  3T1Y M;  4I7T A;  3I4V A;  1JQU A;  1QUO A;  107L A;  2B3T A;  4G4B A;  1KNI A;  2QEN A;  5KXL A;  3PBL A;  1C6A A;  2N5Z A;  4ARL A;  1GFU A;  2J7O A;  1L72 A;  3AOE A;  2HEF A;  3CT1 A;  2DZN B;  1RFP A;  1QT5 A;  3WPK A;  4GCD A;  131L A;  1L79 A;  1W5S A;  1W6Z A;  1GFE A;  2BQI A;  1L87 A;  2F47 A;  1L67 A;  1G59 A;  3JR6 A;  1L01 A;  2L7I A;  3K2L A;  1NHB A;  3GUI A;  1GDW A;  1GFA A;  1L12 A;  1DZB X;  4M9X A;  3VFD A;  1D0L A;  1GE2 A;  2YBL A;  1NHE A;  3IEC A;  1TGU A;  1NNU C;  4ARM B;  4ARM A;  151L A;  2DQG Y;  2LCB A;  4ETD A;  4OX9 M;  4XJD A;  4FWD A;  4G4O A;  3PXG A;  191L A;  5F9X A;  2RRU A;  3C81 A;  1YIK A;  1LSY A;  3ULR A;  1HT1 E;  2LXE A;  2EKK A;  2Y0T A;  169L A;  5DYI A;  243L A;  1N34 M;  1XGR C;  1PJQ A;  2Z8Y M;  3OK0 A;  4I7M A;  3HH6 A;  5KXZ A;  3RZE A;  1REZ A;  2YDG A;  2Z39 A;  1GL6 A;  3AYQ A;  1L40 A;  3GQ3 A;  1J09 A;  111L A;  4CGE A;  2K9D A;  160L A;  1IC4 Y;  5I4X A;  5KPT A;  4G49 A;  1CV4 A;  1P56 A;  1NHW C;  5KKJ A;  4WLX A;  1JSF A;  1IOR A;  2C98 A;  3U6E A;  3GRY A;  1QSA A;  130L A;  2OE4 X;  3RUN A;  2W1X A;  4EOF A;  2FYD A;  1SG9 A;  3FE3 A;  9LYZ A;  4DT3 A;  1CV3 A;  2M5Z A;  5EP4 A;  119L A;  2NWD X;  1L61 A;  4H9A A;  2ZBK B;  1LYS A;  2L09 A;  1L83 A;  206L A;  1GF3 A;  1L63 A;  4QOZ C;  2LC9 A;  5EXX A;  5DYG A;  2IHL A;  5LYM A;  1I4W A;  127L A;  4B49 A;  3SBA A;  5KXN A;  2YVB A;  1DV0 A;  2FH0 A;  2L4E A;  2DBT A;  1FBI X;  1QIO A;  1GF8 A;  2G4P A;  3P4Z A;  1LZG A;  3LHM A;  2RBN A;  1K82 A;  240L A;  1IOC A;  5EXT A;  190L A;  2DZO B;  1L47 A;  2JZ1 A;  1A2Y C;  3KFU G;  2HEC A;  215L A;  1GXV 2;  1L54 A;  1E9S A;  1YE9 A;  1PM5 A;  1CU2 A;  1GDX A;  3C58 A;  2QSF X;  1F4I A;  2DWZ B;  1XEJ A;  4D9Z A;  4HTK A;  2CUU A;  1P64 A;  4GN3 A;  1C6D A;  2GNO A;  1L25 A;  3WXT A;  1SX7 A;  5KXY A;  3T36 A;  4DQ5 A;  2LH0 A;  4XEN A;  1DYC A;  3VLF B;  4NGJ A;  3HH4 A;  1OAO C;  1LZ6 A;  2O01 F;  3AW7 A;  3EML A;  1CKC A;  1TEW A;  1N4F A;  4KOD A;  1B7L A;  3FUV A;  3FRI A;  1LZY A;  3AOG A;  5I53 A;  4MGH A;  4J7V A;  1IBL M;  2HEA A;  4LY6 A;  1JTT L;  103L A;  4ZFP A;  1EE8 A;  5LVI A;  2MEF A;  2WAR A;  3TL4 X;  1KIQ C;  3G3B B;  2B6X A;  2XZU A;  4NEB A;  3V76 A;  1WJ7 A;  3ZCB B;  1JR3 D;  1YAN A;  2Q0M X;  1GFV A;  115L A;  1B9O A;  2X49 A;  3QYB A;  1ZQ9 A;  3WU9 A;  1DO2 A;  1OIZ A;  1LZR A;  7LYZ A;  4QHT A;  3AGI A;  3AZ7 A;  1DGB A;  1ZYT A;  4LT3 A;  3U6P A;  1SXJ B;  4EKS A;  216L A;  4NG8 A;  4FDY A;  4H8X A;  3KOZ E;  2VF8 A;  2LVP C;  5L3H A;  1PQJ A;  3WU8 A;  2YBH A;  137L A;  1C46 A;  3LZM A;  3U61 A;  1LWK A;  4NSH A;  1IXZ A;  1L1T A;  5DNY A;  1WR1 B;  1MJG M;  1ZMY L;  4CJ2 A;  2OEA X;  205L A;  5C6L A;  2VQF M;  2R62 A;  2DXI A;  1L27 A;  1L41 A;  4MCK A;  3WVY A;  3I01 M;  1UFZ A;  4WM6 A;  223L A;  3GRV A;  2FE8 A;  1QS9 A;  2V6Z M;  4H1P A;  2L4F A;  3HY5 A;  1BHZ A;  1D3J A;  1PJJ A;  4OWE A;  4NWE A;  1N32 M;  1L18 A;  4G4Q A;  2O25 A;  2D4I A;  1IOQ A;  4LJ6 A;  1OUF A;  2WZJ A;  4R3D A;  1ZAE A;  3WVX A;  2WSE F;  2HTX A;  2RKO A;  2ZWB A;  233L A;  4NSJ A;  1DYE A;  2ZNX Y;  1IEE A;  1HNZ M;  1GB9 A;  3P65 A;  5KJ9 A;  2N35 A;  1IXR C;  192L A;  5IRE B;  2K0B X;  1WQR A;  1LMP A;  3HH3 A;  1QUT A;  3CDO A;  1BVS A;  3B72 A;  2XBR A;  1VQ1 A;  3HUQ A;  1TLA A;  5I4W A;  5M1Y A;  3SB7 A;  2A4T A;  5APF A;  5KPR A;  2F5P A;  5C6I A;  5LYT A;  2DWN A;  1YKX X;  3EXD A;  4WM5 A;  2W1Y A;  1LMN A;  2ZTD A;  2EKF A;  2BQC A;  2XTH A;  3CDT A;  1E8L A;  1D9U A;  199L A;  2ZQ3 A;  1UIG A;  2C9C A;  2G4Q A;  1WHC A;  1H6M A;  5FTJ A;  3RGS A;  1PRB A;  2ZIJ A;  4GCF A;  3HDF A;  3U6C A;  2C8O A;  4DQJ A;  2K47 A;  1GB8 A;  4KHP M;  102L A;  4EPF A;  1IOS A;  171L A;  3C82 A;  4II8 A;  1W08 A;  3HX3 A;  3V2Y A;  4E97 A;  3B0K A;  3DN3 A;  1QT6 A;  4OOO A;  4OWB A;  257L A;  2B73 A;  1RE2 A;  4EMN A;  1L82 A;  4LZZ A;  2BAA A;  5B1F A;  4WM1 A;  4PD2 A;  4DV6 M;  1NVM A;  161L A;  3SFZ A;  1L86 A;  3A3Q A;  2MH8 A;  5HLL A;  1ZWN A;  4NGZ A;  4NL4 H;  3PNY A;  3MMP A;  5ITX A;  3W6A A;  1BB5 A;  1L00 A;  1YLA A;  3LN2 A;  2DKV A;  2BQE A;  3P66 A;  1BWH A;  1LGW A;  3J7B A;  2KW0 A;  2CGI A;  4LJ4 A;  1QTE A;  2F32 A;  1P3N A;  1REM A;  3KOX E;  5LA8 A;  2BPU A;  3D9A C;  1YIL A;  1Q3B A;  4L41 A;  1XEP A;  4ITQ A;  3HWL A;  2F2Q A;  3GLH A;  1KXY A;  1GXX A;  2DWL A;  1GWD A;  5ILC A;  2BWB A;  3SMP A;  1OQM A;  139L A;  3H4M A;  1L32 A;  1LYE A;  2Y8P A;  1FLW A;  5ITY A;  4R0F A;  1XMQ M;  1L34 A;  2MED A;  3I04 M;  2DAK A;  1CU6 A;  1JIT A;  1L31 A;  5I4Y A;  4B4E A;  4JI7 M;  2AHM A;  1QT3 A;  1VDL A;  4M9S A;  3FUU A;  3SAW A;  1L33 A;  3DNA A;  5DM9 A;  5DLA A;  3K9P A;  5C18 A;  1JEF A;  1SSY A;  1P2C C;  5I5Q A;  4P17 A;  2R45 A;  2JY7 A;  2LNH C;  4TSC A;  5B06 A;  1LMQ A;  2A7D A;  3ATN A;  2OOA A;  1QUG A;  1IN4 A;  4AW4 A;  2CV0 A;  3C7W A;  1VED A;  3A90 A;  4MGK E;  253L A;  3EMS A;  2ANV A;  5LVH A;  3WU7 A;  3C3D A;  3MHV C;  1T6O A;  1FJG M;  1LZE A;  1FKV A;  1LPY A;  1C6M A;  4IBE A;  2LYZ A;  4N1E I;  2CRU A;  1AT5 A;  4GH9 A;  2HHH M;  3VDP A;  1PQI A;  3CSZ A;  1G4A E;  1IO5 A;  3HBD A;  4YX7 C;  3VWO A;  2D7H A;  230L A;  2Z6B A;  1T97 A;  1BWI A;  2HU1 A;  1ZMU A;  5LIN A;  2R18 A;  4II7 A;  4B7F A;  4EKR A;  2E5L M;  4I8O A;  2B6Z A;  4ETB A;  2RBP A;  4MR1 A;  4JI8 M;  3SBJ A;  1IQP A;  1XWI A;  1LLH A;  4HTN A;  3GLI B;  3U6L A;  5KPZ A;  4I4L A;  5FST A;  4B3S M;  2X0A A;  4B7G A;  1XB2 B;  2DHY A;  3W68 A;  1L75 A;  2BJW A;  4B7H A;  2I7P A;  1C6F A;  2V1U A;  3TXI A;  3HH5 A;  238L A;  3IJV A;  3T38 A;  4HTQ A;  2XGN A;  1GBO A;  4JI4 M;  1GE4 A;  158L A;  3WYH A;  4PRQ A;  1L58 A;  1G06 A;  1LJ3 A;  4ARP A;  1L88 A;  2W1M A;  1G7H C;  1OUC A;  1LZ8 A;  4X3B A;  4WLT A;  4LFA M;  3A6B Y;  178L A;  262L A;  1G71 A;  4DR4 M;  1UUZ C;  2ZYP A;  2NQ8 C;  4LJ8 A;  1WVU A;  1QUD A;  3LCV B;  3E3D A;  3C7Y A;  4W58 A;  1XXH A;  1CV1 A;  4DKL A;  5FSW A;  3WHL A;  1C62 A;  1Z5B A;  4KXI A;  4LCB A;  4B4J A;  1GB0 A;  260L A;  2Z2E A;  210L A;  3J80 S;  1HNL A;  1DXJ A;  1T3T A;  3FUX A;  2VQE M;  1GAZ A;  4W57 A;  5II3 A;  4IAT A;  1ALC A;  3I51 A;  1AUA A;  4R6C A;  4WM2 A;  2F5O A;  1L8Q A;  2HUK A;  1B7R A;  5FTK A;  213L A;  2RBO A;  4IBK A;  3GUN A;  1UAC Y;  4FWH A;  1HHL A;  252L A;  3TMU A;  3GLG A;  3UZU A;  1IM2 A;  2OTZ X;  1XMO M;  2HL7 A;  5C1B A;  2IGC A;  4DDB A;  2JY8 A;  146L A;  1B7M A;  3TXJ A;  1GF4 A;  4KT0 F;  4HSF A;  5FTM A;  1E32 A;  2RAZ X;  2EIZ C;  4IBJ A;  5JI3 E;  1IR8 A;  3SC3 A;  4IJE A;  5FDJ A;  3HU9 A;  4L15 A;  1JIS A;  1L08 A;  4M9Z A;  3CSR A;  4NGI A;  4P2E A;  1QTV A;  2QNJ A;  4M0W A;  3PFI A;  1P36 A;  1LJF A;  4ZPX A;  1P2L A;  4J1B A;  1S3S A;  1L94 A;  3GPP A;  4CHX A;  1J1O Y;  3HDE A;  1C66 A;  1IFY A;  1IP1 A;  3FI5 A;  3CDV A;  1LHH A;  4ML7 A;  5K7O A;  1C7P A;  2BQG A;  5DN4 A;  5B07 A;  3K92 A;  3LVW A;  112L A;  4B0D A;  4REZ A;  2DVW B;  5KXR A;  3TWL A;  2B6Y A;  4LF5 M;  2DAI A;  2DQH Y;  1C6C A;  3U60 B;  1G0L A;  3TXE A;  2UU9 M;  3W0L B;  1LSF A;  108L A;  3LZ2 A;  1B5Z A;  3WUN A;  2MJ5 B;  2MEI A;  4Z3M A;  1TH2 A;  1QZE A;  4I81 A;  2NTG A;  1GL7 A;  3THG A;  3C7Z A;  4L6V 6;  1LSE A;  2M60 A;  1L97 A;  2XZF A;  1JSE A;  1GAB A;  1IY2 A;  2HWJ A;  5LAF A;  4DD7 A;  2XSZ A;  3J27 B;  2QBY A;  4I7N A;  3GLI E;  1D6Q A;  5GKN A;  2B6T A;  3MK6 A;  3U6S A;  1L59 A;  8CAT A;  2RSC A;  3W67 A;  3AZ5 A;  1L17 A;  4QGZ A;  2C8P A;  4BLC A;  3HT7 A;  3SB5 A;  1IC7 Y;  1VDS A;  3CTW B;  3SAR A;  1LZS A;  5APE A;  1PQO A;  5KXK A;  3GP1 A;  4YY3 M;  3GLF A;  4IAS A;  4BS7 A;  1L60 A;  2DZL A;  2JZ0 A;  1OAI A;  1H87 A;  4FD2 A;  3DOA A;  2YBJ A;  1J7K A;  4WLD A;  4ANR A;  4XAD A;  1LHL A;  1Z5A A;  3A46 A;  1QT8 A;  1IY4 A;  2BQF A;  3VK8 A;  1VAT A;  3A8Z A;  2LBC A;  4LZM A;  5EBH A;  4L4U A;  1UM8 A;  4LG2 A;  5IHG A;  4BB9 A;  5I54 A;  3L2X A;  1PS5 A;  3E9S A;  1KW5 A;  4K5Y A;  2QAR C;  3WXU A;  1LZ9 A;  1N36 M;  2LYM A;  1OQY A;  1IX0 A;  4JI3 M;  120L A;  3HJS A;  4L78 A;  1HSW A;  1L15 A;  1L95 A;  3DMX A;  1OKS A;  4EPI A;  4BAP A;  1C7Y A;  3FE0 A;  3TQS A;  3JAM S;  3FTC A;  1LYJ A;  2LHM A;  1CJ7 A;  1WQP A;  2BQA A;  3A42 A;  1LJK A;  2ERC A;  1C61 A;  2J5Y A;  1NY6 A;  4BAD A;  232L A;  1KS3 A;  1LHI A;  3RFW A;  2D91 A;  5IT9 S;  4TUN A;  201L A;  2ZAO A;  1IP4 A;  4RF0 A;  1C60 A;  5KXP A;  1G7L C;  1B7P A;  3T6P A;  4LYB A;  2Z38 A;  1YL0 X;  2O7A A;  3TE6 A;  1L76 A;  2YBI A;  3CDR A;  1UIC A;  3RZ4 A;  1FLY A;  1XGU C;  1IC5 Y;  4LRT A;  4UN2 B;  1B6I A;  1L52 A;  1Z59 A;  3OE9 A;  135L A;  2LVQ D;  3C83 A;  5FTN A;  138L A;  1G0G A;  1GB7 A;  4PJ2 C;  1L89 A;  5LIO A;  4XBO A;  1KSF X;  2FBB A;  2DQA A;  2CDS A;  4B08 A;  1C6J A;  4DUY M;  1LYY A;  1G41 A;  4PJZ A;  1SLY A;  5DFL A;  1QQW A;  1QDR A;  2UUA M;  2OTY X;  5LVK A;  5KKI A;  3F6Z A;  1XNQ M;  1UCO A;  4NGV A;  2WSF F;  1NJG A;  2LZT A;  1QVR A;  5LZM A;  4AGA A;  4UWV A;  5LXW A;  4DV1 M;  1CV0 A;  2B6W A;  4OWA A;  1TDY A;  4HEO A;  1IWX A;  1HFZ A;  3HTD A;  4AXT A;  3CGW A;  3HJQ A;  1OUI A;  5JEN B;  1GEV A;  4CFO A;  1JTP L;  1MLC E;  4HJY A;  3U6D A;  3SB9 A;  4ZIX A;  3H4J A;  1Q02 A;  4GIP A;  4H92 A;  208L A;  3LQR A;  1DGG A;  168L A;  1IWV A;  1P5C A;  2PC2 A;  1GF7 A;  3WW6 A;  159L A;  1UIB A;  2Q2E B;  3UK6 A;  3OTO M;  2HKJ A;  1OUH A;  3J2P B;  4NSR A;  3GLH B;  1EQE A;  1L57 A;  3LW5 F;  5LMN M;  4FWG A;  4ETA A;  4I5S A;  258L A;  5KXS A;  247L A;  3SHF A;  2J7N A;  3WPJ A;  3TWM A;  5ILF A;  3GO8 A;  2R0I A;  4OVZ B;  1F10 A;  1GE3 A;  4DR7 M;  4NRW A;  1IP3 A;  3A6C Y;  4GCB A;  1CV6 A;  2OQ4 A;  6LYZ A;  4JI1 M;  162L A;  1CKD A;  176L A;  1L23 A;  1LZA A;  4P16 A;  4H90 A;  5LMU M;  3HHW A;  3NY9 A;  5FEK A;  2ZIK A;  4LGM A;  1DKJ A;  4S12 A;  3DZD A;  3GXK A;  3LYT A;  2RB1 X;  4H9I A;  4KPM A;  2KXE A;  3TXF A;  3D8B A;  4PDG A;  182L A;  1OUE A;  1GB2 A;  242L A;  1L2C A;  140L A;  1HT2 E;  5ITR A;  4LRS A;  157L A;  1LZ5 A;  2EKS C;  1L85 A;  1FDL Y;  4QNM A;  5KXO A;  2QHO B;  1QUS A;  3KP0 E;  1G0Q A;  2L7H A;  2FBD A;  3LYZ A;  2KRK A;  3SBB C;  4YF2 A;  1HC0 A;  1QAN A;  2QCU A;  3WHK A;  109L A;  2YFQ A;  5KY1 A;  4XJH A;  4PRU A;  3HT6 A;  4LDL A;  1TH4 A;  4KT3 A;  3GQ5 A;  1L56 A;  4NRV A;  4GN4 A;  1IP6 A;  1CVK A;  5L9J A;  1G7M C;  1QTZ A;  1LW9 A;  1INU A;  5AMY A;  4XGI A;  2CJL A;  181L A;  4N9R A;  2BQJ A; 
#chains in the Genus database with same CATH homology
 1GB5 A;  1HEL A;  3DN8 A;  3SN6 R;  1CJ9 A;  1IWZ A;  3D4S A;  4I7Q A;  1C43 A;  3HFM Y;  3HTB A;  1CUQ A;  1KIR C;  1GBW A;  224L A;  3SP3 A;  177L A;  188L A;  2HUB A;  4BAF A;  4NGY A;  195L A;  4LYM A;  1LSD A;  4DD0 A;  2HUM A;  1HEN A;  1L06 A;  1CKH A;  3CT5 A;  2Z19 A;  3LYO A;  5FHW A;  1QT4 A;  2LYO A;  2HU3 A;  4LYZ A;  3ZEK A;  1G0M A;  3TXD A;  1G0J A;  3B0I A;  4U3X B;  1JIY A;  1JJ1 A;  152L A;  1YL1 X;  2XBS A;  3HU8 A;  5FCP A;  4LYC A;  4AQN A;  5E9R A;  4WMG A;  2ANX A;  1WQQ A;  3A91 A;  1KW7 A;  4ZPU A;  1LHM A;  1OV5 A;  4HPI A;  4ET8 A;  1WQM A;  4NFV A;  3A67 Y;  1QSW A;  5E4P A;  2DQF C;  1L0J A;  1C6L A;  1GFJ A;  1JHL A;  4IAP A;  1L26 A;  1JTN A;  4YXC A;  1L46 A;  231L A;  235L A;  1L39 A;  6LYT A;  3W6B A;  3QNG A;  1GAY A;  2DQC Y;  1OUG A;  1QTC A;  1T8A A;  1V7T A;  1JPO A;  4ETC A;  1L42 A;  1GE1 A;  4OO9 A;  3TMW A;  4W96 A;  1P2R A;  3BKH A;  1L50 A;  2RB0 X;  3GUO A;  4N8Z A;  254L A;  4C5F A;  2FYC A;  1LZ1 A;  4WM3 A;  222L A;  1LGU A;  1IIZ A;  1WVV A;  1IY3 A;  5D5F A;  1LJH A;  1B0D A;  4I7P A;  3FI7 A;  255L A;  4I7K A;  1NMM A;  1JKD A;  1L96 A;  1UIF A;  155L A;  4M4O A;  1XGP C;  4UWN A;  1B5X A;  2XJW A;  3MGW A;  1HEQ A;  1C68 A;  1D0K A;  4WG7 A;  1T6H A;  3OE6 A;  3W6D A;  6LZM A;  184L A;  3CDQ A;  4Z98 A;  1BVK C;  1DPX A;  1VDP A;  1QQY A;  4GRV A;  187L A;  3F9L A;  4J1A A;  3AGH A;  2RBR A;  1LYZ A;  1OUD A;  2O4W A;  4NWH A;  2BLY A;  194L A;  1F0W A;  4N1C C;  3DN2 A;  4DDA A;  1IVM A;  1QTH A;  1C6I A;  1EL1 A;  1UID A;  1C45 A;  1C6H A;  1LJ4 A;  1L55 A;  1LSB A;  1GE0 A;  1I6S A;  1NF5 A;  1AKI A;  1LJI A;  1XFP L;  1D0M A;  1BB3 A;  4H8Y A;  3A92 A;  1OP9 B;  3EBA B;  5APC A;  4LGK A;  3WMK A;  1QUH A;  1ZUR A;  3QE8 A;  3WL2 A;  4H9H A;  1TCY A;  1VFB C;  1LTM A;  1GBS A;  1PQD A;  2RH1 A;  1HMK A;  1C6B A;  3QY4 A;  2LZ2 A;  3T6U A;  3W6C A;  2O79 A;  1HFY A;  4I7J A;  1K28 A;  3BKV A;  1REY A;  4LFX A;  3VW7 A;  1RI8 B;  3HTG A;  1C67 A;  1LSA A;  1LKS A;  4KL7 A;  4NHP A;  1YAO A;  3AW6 A;  1NBY C;  1L14 A;  3TXB A;  4J0L A;  4HV1 A;  200L A;  1WTN A;  1L44 A;  3HUK A;  3HTF A;  1L53 A;  4WLY A;  1ZVH L;  249L A;  1OWY A;  2B70 A;  3IJU A;  2BQB A;  1LMT A;  5IDD A;  1LI6 A;  5APD A;  1XGT C;  3W6E A;  2F30 A;  241L A;  144L A;  4LDO A;  3N9C A;  1XEI A;  1LCN A;  5F81 A;  4I7S A;  3SB8 A;  4DJH A;  3G3X A;  1NQI A;  3CSQ A;  1T8G A;  1L07 A;  2F2N A;  3NYA A;  4HP0 A;  1QSQ A;  3WUA A;  1L02 A;  5HMJ A;  2HUL A;  4FJR A;  4OWH A;  1OUA A;  1L35 A;  1NDG C;  1L0K A;  2BQN A;  1C6E A;  1L68 A;  217L A;  1JWR A;  1HFX A;  3QAK A;  4NHT A;  5A3E A;  1OVH A;  1GB3 A;  4QY9 A;  2BQL A;  145L A;  4B1A A;  1B7S A;  1JKC A;  1L49 A;  3GUJ A;  3AZ4 A;  1JUG A;  3W6F A;  2YSS C;  5F9U A;  3ZVQ B;  1YRO A;  1I20 A;  4H9C A;  4WO9 A;  3DMV A;  3KAM A;  1B7O A;  1LSC A;  3M18 B;  3CQL A;  2D4J A;  1REX A;  3F8V A;  4QDN A;  1RJC B;  2BQH A;  1L45 A;  1JTM A;  1GBZ A;  2MEB A;  1WQN A;  1L99 A;  1QT7 A;  2B74 A;  1OYU A;  3HBE X;  2BQK A;  2ZNW Y;  132L A;  1LSG A;  1G7I C;  1LSN A;  1DYA A;  2G4N A;  1LHJ A;  1UIH A;  1L09 A;  261L A;  1HEP A;  1L73 A;  4YOP A;  133L A;  1KY1 A;  4HPE A;  5DL9 A;  1JJ3 A;  2IFF Y;  1IR9 A;  1LJE A;  220L A;  1GFH A;  1VDQ A;  1LPI A;  5IEL A;  5B1G A;  1L77 A;  3AJN A;  1JKA A;  3IWR A;  2MEH A;  4LDE A;  256L A;  2MEA A;  196L A;  4YEM A;  4TX7 A;  1D3N A;  5LA5 A;  3AGG G;  1UIE A;  126L A;  141L A;  2I6Z A;  1D2W A;  122L A;  1D2Y A;  3PDS A;  207L A;  4YXA C;  1CU5 A;  1PQM A;  1LYG A;  4G9S A;  1GB6 A;  245L A;  1C6Q A;  3C8Q A;  1FLU A;  5F16 A;  150L A;  4H9E A;  5I14 A;  3WUL A;  2LZM A;  1QTD A;  5KXW A;  4WG1 A;  5D5C A;  3V2W A;  4XJB A;  4M6D A;  1QS5 A;  1FKQ A;  218L A;  1L69 A;  4NGW A;  1NDM C;  4WOA A;  4DQ7 A;  4DD2 A;  1HML A;  2OU8 A;  1QDT A;  1XJT A;  1GFK A;  1SQ2 L;  1YKZ X;  1LJJ A;  1GF6 A;  1PZY A;  4NIJ A;  1XJU A;  1L22 A;  259L A;  209L A;  172L A;  1DYF A;  1C63 A;  1IP5 A;  1LKR A;  1BWJ A;  3HT8 A;  4H9F A;  4LT1 A;  4TTD A;  4GCC A;  175L A;  1Z55 A;  2GV0 A;  3GUP A;  1NWG A;  1LZT A;  5J7C A;  1OUJ A;  4Z46 A;  239L A;  1L03 A;  1DYG A;  4HJZ A;  2YBN A;  5LYZ A;  4NHS A;  113L A;  3NY8 A;  2A7F A;  1LYH A;  4PHI A;  3TXK A;  1CX6 A;  4DC4 A;  1GEZ A;  1LZD A;  1G0K A;  1JKB A;  4RDS A;  1GF0 A;  1SSW A;  248L A;  2NTH A;  2Z2F A;  1QTB A;  173L A;  1L43 A;  2W1L A;  4B4I A;  1L91 A;  4DWX A;  1L70 A;  3OE0 A;  3D3D A;  1EQ5 A;  2MEE A;  1BB6 A;  3RT5 X;  3A95 A;  1L19 A;  163L A;  5F14 A;  4W51 A;  1L98 A;  4GLV A;  1CKF A;  251L A;  4HV2 A;  4ARJ A;  1C6K A;  1UA6 Y;  1LMA A;  3RU5 A;  1HEM A;  4DYG A;  1CV5 A;  4LT0 A;  1OVJ A;  2DQJ Y;  4RLM A;  4NGK A;  4HJV A;  1DQJ C;  114L A;  3RW8 A;  229L A;  4OOT A;  3HBH A;  3EO5 A;  1GBY A;  3N9E A;  3AB6 A;  1DI4 A;  3A3R X;  1VDT A;  1IWU A;  3L64 A;  185L A;  3TMX A;  1LGX A;  3OE8 A;  5DN5 A;  7LZM A;  4GN5 C;  3C80 A;  5KXX A;  1P7S A;  1LSZ A;  1IWW A;  1IP2 A;  1L37 A;  3DKE X;  4TWS A;  4TSB A;  237L A;  1AM7 A;  1L38 A;  3A96 A;  2F4A A;  1A4V A;  3DMZ A;  4XJG A;  1RCM A;  3G3W A;  1LYD A;  4I7L A;  4NHQ A;  170L A;  1T3P A;  4EKQ A;  5L3I A;  1SWY A;  3UON A;  4PGJ B;  153L A;  5HNL A;  4E3U A;  2Q9E A;  1TAY A;  2BQO A;  3GUM A;  1L20 A;  1LJG A;  186L A;  2BLX A;  234L A;  2ZYC A;  1QTK A;  3J6K A;  1C6P A;  1SX2 A;  4WM4 A;  1OUB A;  3A94 A;  1P46 A;  4GLA A;  1F6S A;  1L62 A;  3CB7 A;  2HEB A;  228L A;  129L A;  3DN1 A;  1DPW A;  3DN0 A;  1D9W A;  1NBZ C;  1WTH A;  1LI2 A;  4W55 A;  4Z41 A;  1L92 A;  134L A;  4DAJ A;  2AUB A;  2B75 A;  1O23 A;  3TMV A;  174L A;  1L13 A;  5A3Z A;  4RW1 A;  1IWT A;  4W59 A;  4DD1 A;  1B2K A;  1UIA A;  1CTW A;  149L A;  3ZVQ A;  4DD9 A;  225L A;  4S0W A;  1L21 A;  1CU0 A;  3GXR A;  1PQK A;  1XGQ C;  1BVX A;  166L A;  2B5Z A;  1MEL L;  3LYM A;  4W53 A;  221L A;  1C08 C;  2F4G A;  3WUM A;  4MST A;  1L11 A;  1L80 A;  1IP7 A;  3ATO A;  1BGI A;  1L10 A;  3WPL A;  212L A;  180L A;  1LSM A;  3A34 A;  1KIP C;  1FN5 A;  1L65 A;  3CT0 A;  1LJN A;  2VB1 A;  123L A;  2I26 L;  1CU3 A;  4LT2 A;  1CKG A;  3ODU A;  1LMC A;  4NSG A;  1HER A;  8LYZ A;  4NSI A;  3P68 A;  1L71 A;  183L A;  1DI3 A;  1VAU A;  1JTO L;  1LYO A;  2MEG A;  4N9R A;  3WYH A;  1B7N A;  1C6T A;  1B5Y A;  1EQ4 A;  1L51 A;  2OU0 X;  1CX7 A;  2D6B A;  4EKP A;  4NHI A;  2ZIL A;  3M3U A;  2BQM A;  1L90 A;  3GUK A;  1UBZ A;  1UC0 A;  1YQV Y;  1DKK A;  3P64 A;  1KXW A;  4H94 A;  1LI3 A;  4DDC A;  167L A;  4NY5 A;  1GFG A;  1GD6 A;  219L A;  125L A;  164L A;  2DQE Y;  5C6J A;  4YEN A;  1JJ0 A;  1OVK A;  1DI5 A;  1J1P Y;  1L28 A;  142L A;  3LZT A;  1ZVY B;  3J4G A;  4NG1 A;  1LZ4 A;  2EQL A;  1GF9 A;  3K2R A;  1GF5 A;  3K3T A;  4WL6 A;  3A93 A;  2EPE A;  3WW5 A;  4ARQ B;  1HEW A;  4ARQ A;  1LZN A;  110L A;  2RBQ A;  4N0J A;  1D6P A;  1C69 A;  1OV7 A;  1I56 A;  3HUA A;  3AZ6 A;  1L84 A;  1LSP A;  1YAP A;  1DYD A;  3G3A B;  4NGO A;  4EXM A;  4W56 A;  4G4H A;  1XEK A;  1HEO A;  3DN4 A;  3DN6 A;  4H91 A;  4RLN A;  2OE9 X;  1IOT A;  1IWY A;  4OWC A;  211L A;  1LYF A;  193L A;  3RNX A;  4GBR B;  1GFT A;  1B5U A;  1L74 A;  4OW1 A;  2B7X A;  197L A;  4H8Z A;  2DQD Y;  1D3F A;  5FEL A;  1C64 A;  1T6V L;  1C10 A;  1BQL Y;  189L A;  5B59 A;  1I1Z A;  3FA0 A;  2YBM A;  4QEQ A;  2BQD A;  2HEE A;  2Z37 A;  1KY0 A;  246L A;  5LVG A;  5T3F A;  5LAG A;  4NGL A;  1YAQ A;  4I7O A;  2Q9D A;  1GHL A;  1BB4 A;  4EJ4 A;  148L E;  2QB0 B;  4WO6 A;  2Z18 A;  154L A;  4LZT A;  3C8S A;  4XJI A;  4W54 A;  1L16 A;  1HF4 A;  2MEC A;  2RAY X;  2L78 A;  1DYB A;  4XN6 A;  1TBY A;  2H9J A;  4GCE A;  1GBX A;  1LWG A;  1L30 A;  4YEO A;  1L24 A;  4DD3 A;  1G7J C;  250L A;  2Z12 A;  3W3E A;  3B6L A;  4LYT A;  4W52 A;  4W94 A;  1CJ6 A;  2RB2 X;  1LMO A;  1G1W A;  1L93 A;  3SB6 A;  104L A;  1YAM A;  4XYY A;  1WQO A;  1AZF A;  1C6N A;  2H9K A;  2HED A;  5HQ1 A;  1G07 A;  4O34 A;  3G3V A;  1HSX A;  4ETE A;  4CFP A;  1CJ8 A;  2OU9 A;  1P37 A;  214L A;  1AT6 A;  1LZC A;  2RBS A;  2B72 A;  3OJP A;  1XSF A;  1G0P A;  4G4C A;  4I0C A;  1C65 A;  3TXG A;  4RW2 A;  1SWZ A;  1C6G A;  2DQI Y;  4IJ4 A;  1BB7 A;  5HMV A;  1L29 A;  3TXH A;  1V7S A;  5KXM A;  143L A;  4PK0 A;  1L66 A;  1WTM A;  1B7Q A;  226L A;  2CWI A;  2XQO A;  3N9A A;  1L64 A;  1GPQ C;  1QSB A;  147L A;  1LZB A;  3B0O A;  156L A;  2H5Z A;  1LOZ A;  1D3M A;  1LAA A;  2ZQ4 A;  118L A;  165L A;  1FLQ A;  227L A;  1L36 A;  4WL7 A;  2I25 L;  4H9B A;  1CUP A;  1LHK A;  2D4K A;  4C3W A;  1LYI A;  5HNC A;  236L A;  4N5R A;  5KXT A;  4I8S A;  1B5W A;  4A7D A;  1L81 A;  2OE7 X;  3C8R A;  4UWU A;  3GUL A;  1CNS A;  1P6Y A;  5LVJ A;  4ZEE A;  1T8F A;  1L04 A;  1L05 A;  1L48 A;  4PPO A;  4I7R A;  3HT9 A;  4YM8 A;  1B5V A;  1YKY X;  1OWZ A;  1G1V A;  4ET9 A;  1J1X Y;  4LFP A;  4LYO A;  1EPY A;  1F6R A;  244L A;  5B05 A;  198L A;  3WH1 A;  1IR7 A;  1KXX A;  3FAD A;  4H93 A;  128L A;  1GFR A;  1ZV5 L;  4XJF A;  1NKH A;  4I7T A;  1JQU A;  1QUO A;  107L A;  4G4B A;  1KNI A;  5KXL A;  3PBL A;  1C6A A;  2N5Z A;  4ARL A;  1GFU A;  1L72 A;  2HEF A;  3CT1 A;  1RFP A;  1QT5 A;  3WPK A;  4GCD A;  131L A;  1L79 A;  1W6Z A;  1GFE A;  2BQI A;  1L87 A;  2F47 A;  1L67 A;  3JR6 A;  1L01 A;  1NHB A;  3GUI A;  1GDW A;  1GFA A;  1L12 A;  1DZB X;  1D0L A;  1GE2 A;  2YBL A;  1NHE A;  4ARM B;  4ARM A;  151L A;  2DQG Y;  2LCB A;  4ETD A;  4XJD A;  191L A;  5F9X A;  3C81 A;  1YIK A;  1LSY A;  3ULR A;  169L A;  243L A;  1XGR C;  3OK0 A;  4I7M A;  3HH6 A;  5KXZ A;  3RZE A;  1REZ A;  2YDG A;  2Z39 A;  3AYQ A;  1L40 A;  111L A;  4CGE A;  160L A;  1IC4 Y;  5I4X A;  4G49 A;  1CV4 A;  1P56 A;  5KKJ A;  4WLX A;  1JSF A;  1IOR A;  1QSA A;  130L A;  2OE4 X;  3RUN A;  2W1X A;  4EOF A;  2FYD A;  9LYZ A;  4DT3 A;  1CV3 A;  2NWD X;  119L A;  4H9A A;  1L61 A;  1LYS A;  1L83 A;  206L A;  1GF3 A;  1L63 A;  2LC9 A;  5LYM A;  2IHL A;  127L A;  4B49 A;  3SBA A;  5KXN A;  2YVB A;  2DBT A;  1FBI X;  1QIO A;  1GF8 A;  2G4P A;  3P4Z A;  1LZG A;  3LHM A;  2RBN A;  240L A;  1IOC A;  190L A;  1L47 A;  1A2Y C;  2HEC A;  215L A;  1GXV 2;  1L54 A;  1CU2 A;  1GDX A;  1XEJ A;  4D9Z A;  4HTK A;  2CUU A;  1P64 A;  4GN3 A;  1C6D A;  1L25 A;  3WXT A;  1SX7 A;  5KXY A;  3T36 A;  4DQ5 A;  4XEN A;  1DYC A;  4NGJ A;  3HH4 A;  1LZ6 A;  3AW7 A;  3EML A;  1CKC A;  1TEW A;  1N4F A;  1B7L A;  1LZY A;  5I53 A;  4J7V A;  2HEA A;  4ZFP A;  1JTT L;  103L A;  5LVI A;  2MEF A;  2WAR A;  1KIQ C;  3G3B B;  2B6X A;  4NEB A;  2Q0M X;  1YAN A;  1GFV A;  115L A;  1B9O A;  3WU9 A;  1LZR A;  7LYZ A;  3AGI A;  3AZ7 A;  4LT3 A;  1ZYT A;  4EKS A;  216L A;  4NG8 A;  4FDY A;  4H8X A;  5L3H A;  1PQJ A;  3WU8 A;  2YBH A;  137L A;  1C46 A;  3LZM A;  1LWK A;  4NSH A;  1ZMY L;  4CJ2 A;  2OEA X;  205L A;  5C6L A;  1L27 A;  1L41 A;  4MCK A;  3WVY A;  4WM6 A;  223L A;  1QS9 A;  4H1P A;  1D3J A;  1BHZ A;  4OWE A;  4NWE A;  1L18 A;  2D4I A;  1IOQ A;  1OUF A;  3WVX A;  2HTX A;  2ZWB A;  233L A;  4NSJ A;  1DYE A;  2ZNX Y;  1GB9 A;  1IEE A;  3P65 A;  5KJ9 A;  192L A;  1WQR A;  1LMP A;  3HH3 A;  1QUT A;  3CDO A;  3B72 A;  2XBR A;  3HUQ A;  1TLA A;  5I4W A;  5M1Y A;  3SB7 A;  2A4T A;  5APF A;  5C6I A;  5LYT A;  1YKX X;  3EXD A;  4WM5 A;  2W1Y A;  1LMN A;  2BQC A;  2XTH A;  3CDT A;  1E8L A;  1D9U A;  199L A;  2ZQ3 A;  1UIG A;  2G4Q A;  1H6M A;  4GCF A;  2ZIJ A;  3HDF A;  2C8O A;  4DQJ A;  1GB8 A;  102L A;  4EPF A;  1IOS A;  171L A;  3C82 A;  4II8 A;  1W08 A;  4E97 A;  3V2Y A;  4OWB A;  3B0K A;  4OOO A;  1QT6 A;  3DN3 A;  257L A;  2B73 A;  1RE2 A;  4EMN A;  1L82 A;  2BAA A;  5B1F A;  4WM1 A;  161L A;  1L86 A;  3A3Q A;  5HLL A;  1ZWN A;  4NGZ A;  3W6A A;  1BB5 A;  1L00 A;  3LN2 A;  2DKV A;  2BQE A;  3P66 A;  1BWH A;  1LGW A;  2CGI A;  1QTE A;  2F32 A;  1P3N A;  1REM A;  5LA8 A;  2BPU A;  3D9A C;  1YIL A;  4L41 A;  1XEP A;  3HWL A;  2F2Q A;  1KXY A;  1GXX A;  1GWD A;  5ILC A;  1OQM A;  139L A;  1L32 A;  1LYE A;  2Y8P A;  1FLW A;  4R0F A;  1L34 A;  2MED A;  1JIT A;  1CU6 A;  1L31 A;  5I4Y A;  4B4E A;  1QT3 A;  1L33 A;  3DNA A;  5DM9 A;  5DLA A;  1JEF A;  1SSY A;  1P2C C;  5I5Q A;  4TSC A;  5B06 A;  1LMQ A;  2A7D A;  3ATN A;  1QUG A;  3C7W A;  1VED A;  3A90 A;  253L A;  3EMS A;  2ANV A;  5LVH A;  3WU7 A;  1LZE A;  1FKV A;  1LPY A;  1C6M A;  2LYZ A;  4N1E I;  1AT5 A;  3CSZ A;  1PQI A;  1IO5 A;  3HBD A;  4YX7 C;  3VWO A;  230L A;  2Z6B A;  1T97 A;  1BWI A;  2HU1 A;  5LIN A;  4EKR A;  2B6Z A;  4ETB A;  2RBP A;  4MR1 A;  1LLH A;  4HTN A;  5FST A;  2X0A A;  1L75 A;  1C6F A;  3TXI A;  3HH5 A;  238L A;  3IJV A;  4HTQ A;  1GE4 A;  1GBO A;  158L A;  4PRQ A;  1L58 A;  1G06 A;  1LJ3 A;  4ARP A;  1L88 A;  2W1M A;  1G7H C;  1OUC A;  1LZ8 A;  4X3B A;  4WLT A;  3A6B Y;  178L A;  262L A;  1UUZ C;  2ZYP A;  1WVU A;  1QUD A;  3E3D A;  3C7Y A;  4W58 A;  1CV1 A;  4DKL A;  1C62 A;  4KXI A;  4B4J A;  1GB0 A;  260L A;  2Z2E A;  210L A;  1HNL A;  1DXJ A;  1GAZ A;  4W57 A;  5II3 A;  4IAT A;  1ALC A;  4WM2 A;  4R6C A;  2HUK A;  1B7R A;  213L A;  2RBO A;  3GUN A;  1UAC Y;  1HHL A;  252L A;  3TMU A;  2OTZ X;  2IGC A;  4DDB A;  146L A;  1B7M A;  3TXJ A;  1GF4 A;  4HSF A;  2RAZ X;  2EIZ C;  1IR8 A;  5FDJ A;  3HU9 A;  1JIS A;  1L08 A;  3CSR A;  4NGI A;  4P2E A;  1QTV A;  1P36 A;  1LJF A;  1P2L A;  4J1B A;  1L94 A;  4CHX A;  1J1O Y;  3HDE A;  1C66 A;  3FI5 A;  1IP1 A;  3CDV A;  1LHH A;  4ML7 A;  5K7O A;  1C7P A;  2BQG A;  5DN4 A;  5B07 A;  4B0D A;  5KXR A;  112L A;  2B6Y A;  2DQH Y;  1C6C A;  1G0L A;  3TXE A;  1LSF A;  108L A;  3LZ2 A;  1B5Z A;  3WUN A;  2MEI A;  4Z3M A;  2NTG A;  3C7Z A;  1LSE A;  1L97 A;  1JSE A;  5LAF A;  4DD7 A;  4I7N A;  1D6Q A;  2B6T A;  1L59 A;  2RSC A;  3AZ5 A;  1L17 A;  4QGZ A;  2C8P A;  3HT7 A;  3SB5 A;  1IC7 Y;  1VDS A;  1LZS A;  5APE A;  1PQO A;  5KXK A;  4IAS A;  4BS7 A;  1L60 A;  1H87 A;  2YBJ A;  4WLD A;  4ANR A;  4XAD A;  1LHL A;  1QT8 A;  1IY4 A;  2BQF A;  1VAT A;  3A8Z A;  4LZM A;  5EBH A;  5IHG A;  5I54 A;  3L2X A;  1PS5 A;  1KW5 A;  4K5Y A;  2QAR C;  3WXU A;  1LZ9 A;  2LYM A;  1IX0 A;  120L A;  1HSW A;  1L15 A;  1L95 A;  4EPI A;  3DMX A;  4BAP A;  3FE0 A;  2LHM A;  1LYJ A;  1CJ7 A;  1WQP A;  2BQA A;  1LJK A;  1C61 A;  4BAD A;  232L A;  1KS3 A;  1LHI A;  2D91 A;  4TUN A;  201L A;  1IP4 A;  1C60 A;  5KXP A;  1G7L C;  1B7P A;  4LYB A;  2Z38 A;  1YL0 X;  2O7A A;  1L76 A;  2YBI A;  3CDR A;  1UIC A;  3RZ4 A;  1FLY A;  1XGU C;  1IC5 Y;  1B6I A;  1L52 A;  3OE9 A;  135L A;  3C83 A;  138L A;  1G0G A;  1GB7 A;  4PJ2 C;  1L89 A;  5LIO A;  2FBB A;  2DQA A;  2CDS A;  1C6J A;  1LYY A;  4PJZ A;  1SLY A;  1QDR A;  5LVK A;  2OTY X;  5KKI A;  3F6Z A;  4NGV A;  1UCO A;  2LZT A;  5LZM A;  4AGA A;  4UWV A;  5LXW A;  1CV0 A;  2B6W A;  4OWA A;  1TDY A;  1IWX A;  1HFZ A;  3HTD A;  4AXT A;  1OUI A;  5JEN B;  1GEV A;  4CFO A;  1JTP L;  1MLC E;  4HJY A;  3SB9 A;  4ZIX A;  4H92 A;  208L A;  168L A;  1IWV A;  1P5C A;  2PC2 A;  1GF7 A;  3WW6 A;  159L A;  1UIB A;  1OUH A;  1EQE A;  1L57 A;  4ETA A;  258L A;  5KXS A;  247L A;  3WPJ A;  5ILF A;  1F10 A;  1GE3 A;  1IP3 A;  3A6C Y;  4GCB A;  1CV6 A;  6LYZ A;  162L A;  1CKD A;  176L A;  1L23 A;  1LZA A;  4H90 A;  3NY9 A;  5FEK A;  2ZIK A;  1DKJ A;  3GXK A;  4H9I A;  3LYT A;  2RB1 X;  4KPM A;  3TXF A;  182L A;  1OUE A;  1GB2 A;  242L A;  140L A;  157L A;  1LZ5 A;  2EKS C;  1L85 A;  1FDL Y;  5KXO A;  1QUS A;  2FBD A;  1G0Q A;  3SBB C;  3LYZ A;  4YF2 A;  1HC0 A;  109L A;  5KY1 A;  4XJH A;  4PRU A;  3HT6 A;  4LDL A;  4KT3 A;  1L56 A;  4GN4 A;  1IP6 A;  1CVK A;  5L9J A;  1G7M C;  1QTZ A;  1LW9 A;  1INU A;  5AMY A;  2CJL A;  181L A;  2BQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...