1LTMA

Accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
320
structure length
309
Chain Sequence
EPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycosyltransferase
molecule keywords 36 KDA SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Accelerated X-ray structure elucidation of a 36 kDa muramidase/transglycosylase using wARP.
pubmed rcsb
source organism Escherichia coli
total genus 111
structure length 309
sequence length 320
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1ltmA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1ltmA02
1A4VA 1B7OA 1DI5A 1JTOL 3LHMA 5HNLA 1LZRA 2DBTA 1C10A 1F6SA 3J6KA 2Z37A 5KXZA 1HHLA 3RNXA 2AUBA 4DD1A 3SP3A 4HV2A 1FLQA 3TXEA 1GWDA 1BHZA 4H94A 4XJBA 3WVYA 3WL2A 1WQOA 4H9BA 3F6ZA 4NIJA 5II3A 1OUAA 4XJFA 4CGEA 4R0FA 1GFAA 3OK0A 1PS5A 3G3AB 1CJ8A 2W1YA 1WQMA 4NGVA 1IWZA 1LSMA 4HP0A 4XYYA 4ETAA 1XGRC 4PRQA 1YAQA 1YL1X 5AMYA 5LVIA 5KKJA 1KXYA 1F10A 2FYCA 1YILA 1B5YA 3AW7A 2ZWBA 3QY4A 4HPIA 1LSFA 4LT0A 5C6IA 4CJ2A 5KXWA 1IP2A 1FLWA 1IEEA 4KL7A 4O34A 1P2CC 1GAYA 2ZNWY 1FDLY 5DM9A 1LSYA 1FLUA 1IWTA 1LPIA 2H5ZA 1GE3A 1OUBA 4C3WA 1JEFA 2Z12A 4NSJA 4LYOA 4WG7A 3RW8A 5KXRA 3A6BY 5B1FA 1IP6A 2GV0A 2H9JA 1HERA 2ZNXY 5LAFA 1LSBA 3CB7A 5KXYA 3BKHA 1LYZA 3HBHA 1YAMA 4LYMA 3ZVQA 1MLCE 2FBDA 1DKKA 2I6ZA 1GF4A 3AZ6A 1NDMC 2DKVA 5EBHA 1UIHA 3RZ4A 2A7DA 4ET8A 4ZIXA 5LYZA 1XGUC 1HFXA 1UACY 1G7HC 1KXXA 1LMNA 4OW1A 1HSWA 1GFVA 1QTKA 3TXBA 2D91A 4WOAA 1B5WA 5LAGA 1LHIA 1RCMA 1GBYA 4MSTA 1LYYA 2EPEA 2FYDA 2MEAA 4H9FA 1GBOA 1ZMYL 4MCKA 1IOTA 3AZ5A 4IJ4A 1UBZA 2D4KA 1HMLA 1HEMA 4G4CA 1YQVY 5KKIA 5F9XA 4H92A 2CWIA 5APEA 4NG8A 5F14A 2HU3A 1GD6A 5APCA 5HQ1A 5IHGA 3WH1A 2CJLA 2F30A 3W6CA 2DQFC 9LYZA 1IP4A 3W3EA 4DD7A 3LYTA 4HTQA 2WARA 5I4YA 2Z18A 1LKRA 3A96A 1LMPA 1XSFA 1BQLY 2XBSA 1A2YC 2HU1A 1GFGA 2Q0MX 1C46A 3TXGA 4RW2A 1HEPA 1LZBA 4OWBA 2YBMA 4OWCA 1GFRA 1NQIA 4NGIA 4NWEA 5DL9A 5KXOA 3LYMA 1CKHA 1LJHA 1EQEA 1HEWA 1UIFA 3AZ7A 3MGWA 3WMKA 4R6CA 4ZFPA 4NGLA 1GF3A 5HLLA 1HEQA 1GF9A 2N5ZA 3W6AA 4XJHA 2YDGA 2D6BA 4XJGA 4N9RA 2YBNA 3TMVA 3WPLA 3WW6A 5F81A 5HMJA 1BB4A 3LYOA 2NWDX 3ATNA 1IC5Y 1SLYA 3WYHA 5J7CA 1LSPA 3A3RX 3M3UA 1LSZA 4Z41A 1LHLA 2A7FA 4LT3A 1B7LA 4HJZA 1C7PA 1G7JC 1QTEA 4Z3MA 1LJIA 1DXJA 3B0OA 2HEEA 1LZ8A 1JKBA 1CKGA 4PHIA 4YOPA 3WULA 4DC4A 1GFKA 1REZA 1JKCA 5M1YA 5FELA 1WVUA 4PRUA 1JJ0A 2HEBA 1NWGA 3LYZA 1VATA 6LYZA 1KXWA 2MECA 4QEQA 1LJNA 4WM6A 1ZV5L 4ETEA 3D3DA 4DYGA 1LJFA 2MEEA 2DQDY 1IR8A 3B72A 3EXDA 4H1PA 1YKZX 1N4FA 1D9UA 5KXPA 1JUGA 1V7SA 3T6UA 132LA 3VWOA 3FE0A 1B0DA 1IWXA 1G7MC 1JPOA 2DQJY 2EQLA 4XJIA 3TXKA 2LYOA 2MEGA 3A67Y 1WTNA 3A92A 5KXTA 3WUAA 4HTKA 4WLYA 135LA 1XEJA 1HFZA 4II8A 1UICA 4BADA 1G7LC 2CDSA 1GXXA 3E3DA 4TTDA 1W6ZA 5LA5A 3EMSA 4HTNA 1IWYA 1QIOA 1GF7A 2X0AA 1GXV2 3D9AC 4NGYA 1CKCA 6LYTA 1WVVA 7LYZA 1LYSA 4OOOA 1ZVYB 1UIAA 1CNSA 4WO6A 208LA 4FDYA 1CJ9A 1ALCA 1KIQC 3CT1A 1GE0A 2W1MA 1AM7A 1KIPC 4GCEA 4TSCA 4ETCA 3TXDA 1UA6Y 1IR7A 4W94A 4GN3A 1H6MA 1LJGA 4CHXA 1YIKA 3P68A 1VAUA 1YKYX 1XFPL 3QNGA 1FN5A 1GPQC 1ZVHL 3N9AA 5HMVA 1GB0A 1VDQA 1BWJA 1LZDA 4G49A 4H8YA 2BAAA 1LSAA 3OJPA 4KPMA 5DN4A 5B07A 2LHMA 3G3BB 4J7VA 4B4EA 4OWEA 2H9KA 1GEZA 1I20A 2G4PA 2Z19A 4YEOA 2BQAA 4WM3A 1IP3A 1UIEA 1GDWA 2B5ZA 4LGKA 5L3HA 1YAOA 1REXA 1IWUA 5C6JA 1GFEA 1LZEA 1LKSA 2DQCY 2I26L 4OOTA 2HEFA 4GLVA 4GCDA 2MEDA 1IIZA 2F4GA 4YM8A 3WPKA 207LA 5D5FA 3A90A 1D0KA 1LSDA 1HF4A 4WO9A 1VDPA 5LYMA 1HNLA 1JTPL 4HJVA 3K3TA 3P64A 5B05A 1JSEA 1MELL 1IX0A 2W1LA 3HFMY 4WL7A 5APDA 1PZYA 1WQNA 5APFA 4DDCA 2ZQ3A 4H90A 3A91A 3IJUA 3A8ZA 4LYCA 4B4IA 4H9AA 4BAFA 4Z46A 1JHLA 1O23A 4NGJA 2BQIA 3A34A 1OP9B 2HEDA 4N5RA 4G9SA 5JENB 1RI8B 1HSXA 1BVKC 2Z39A 1GB2A 1JISA 5I53A 2YBJA 193LA 4H8ZA 1LSEA 4GLAA 5E4PA 1VFBC 1NBYC 3WU7A 1REYA 2HECA 4N1CC 3TXHA 1B7NA 2VB1A 4KXIA 4XENA 3WPJA 1DZBX 1IP1A 1NF5A 4NHPA 4LZTA 4J1BA 1NHEA 1AT6A 3EO5A 5F16A 5ILCA 4NHSA 1XGTC 1T6VL 2BQJA 2LYZA 4DDAA 3IJVA 4UWVA 2BQHA 1DQJC 1OUJA 4PPOA 3W6BA 3AYQA 4QGZA 1GBXA 2Z38A 3ULRA 1JTTL 4W96A 4D9ZA 1IR9A 3FI7A 4NHQA 4DWXA 1LCNA 3RT5X 3TMWA 1LMOA 5I54A 5I4XA 1BWIA 3AGHA 1OUEA 2LZTA 1IY3A 1LHKA 1B5ZA 1IOQA 1LHHA 1IY4A 1IO5A 1WQQA 4I0CA 4L41A 1DI3A 2BQGA 2PC2A 2LZ2A 1IC4Y 2BQOA 4P2EA 1LZ6A 4CFPA 1GB5A 1LZSA 5FDJA 1IORA 5I5QA 3P4ZA 4OWAA 5B1GA 3A6CY 1IC7Y 2DQAA 4G4BA 1OUIA 1LJ3A 2BPUA 4AXTA 5K7OA 5KXNA 1J1PY 1LJEA 4ANRA 4H9EA 5FHWA 4QY9A 4QDNA 1HEOA 1D6PA 4N0JA 3TMXA 1QQYA 3CSZA 4IATA 3CT5A 1VEDA 4IASA 1DPXA 1QDTA 4LYZA 4NSHA 5A3ZA 1KIRC 1TBYA 4NY5A 1LOZA 3WUNA 154LA 3A94A 4PJ2C 4LFXA 1GFTA 4NG1A 3RU5A 4HV1A 1JIYA 2YVBA 1FLYA 1GB3A 2DQGY 4YEMA 3N9EA 1LZ9A 2EKSC 4NHIA 4TWSA 1BVXA 1I1ZA 1CJ7A 1V7TA 1DPWA 3P65A 1QDRA 4WM5A 1GB7A 2DQHY 1GFUA 5F9UA 1LSGA 1B7SA 3ZEKA 4C5FA 2DQEY 1AKIA 4NSIA 1W08A 4J0LA 3WXUA 4MR1A 5KXKA 1IVMA 3HBEX 4GN5C 3W6EA 1LHMA 3WUMA 4B1AA 1GF5A 4WMGA 1LZ1A 5FCPA 3AZ4A 1CKFA 1EQ5A 1E8LA 1DI4A 4GCCA 1I56A 5A3EA 1YKXX 2BQBA 4DD3A 1GAZA 5T3FA 5KXLA 4XN6A 2BQCA 1TAYA 2MEFA 3TXIA 1BB5A 3TMUA 1GB8A 3TXFA 4TSBA 3AB6A 4TX7A 1GF8A 5LINA 1AT5A 4LYTA 2ZYPA 5D5CA 4N8ZA 2BLYA 1UIBA 2C8PA 2BQEA 1F6RA 5LXWA 1WQRA 1HENA 1H87A 4RDSA 4WLXA 1LMAA 5FSTA 3T36A 1D6QA 2Z2EA 8LYZA 2D4JA 1LSCA 5KJ9A 4NGOA 1IP7A 2BQKA 1GE1A 4ETBA 1BWHA 3AJNA 4RLNA 4H8XA 1HMKA 4GCBA 2F2NA 1HFYA 1LAAA 4XADA 3W6DA 5L3IA 1GDXA 5IELA 4KT3A 1BB7A 2HEAA 1GFJA 2ZILA 5LA8A 4H93A 3W6FA 1LTMA 3LZTA 1QUTA 4BAPA 3AW6A 4ETDA 1IP5A 3J4GA 2BQLA 1B5VA 4G4HA 1CKDA 1LZNA 3WU9A 1JKAA 4WG1A 3WVXA 4ZEEA 1B5UA 5LYTA 3WW5A 5L9JA 2ZQ4A 1FBIX 1JSFA 4NWHA 1LZTA 1OUGA 4UWUA 4Z98A 4DT3A 1LYOA 4B49A 4NGZA 5B59A 1EL1A 3B0KA 1WTMA 4RW1A 4U3XB 1XEIA 4LT1A 1NMMA 3A93A 1C45A 153LA 3AGGG 2F4AA 1TCYA 4WLTA 4E3UA 1B7PA 1GB6A 1QSWA 1UC0A 1NKHA 4B4JA 1UIDA 2YBIA 134LA 1GBWA 1XGQC 1LZAA 1YL0X 2BQFA 3N9CA 5DLAA 1LHJA 1UIGA 1B2KA 1XEKA 2BLXA 1QUSA 2ZIJA 4NFVA 4PGJB 1RJCB 5LVJA 2XBRA 1EQ4A 2IHLA 4GCFA 1WQPA 1BB6A 1B7MA 3CSQA 2MEIA 1LZ4A 2BQDA 1QSAA 4DD0A 5E9RA 3WXTA 4H9CA 1Z55A 1LZCA 1UCOA 3QE8A 1GE2A 4EMNA 1CJ6A 2I25L 2C8OA 5I4WA 1D0MA 1XGPC 4UWNA 2RSCA 2BQMA 2EIZC 1JITA 1JJ1A 2YBLA 194LA 2CGIA 2YSSC 4HSFA 4M6DA 4BS7A 5HNCA 3LN2A 4N1EI 4HPEA 1GHLA 3AGIA 4B0DA 4H91A 4WM4A 5ILFA 1GFHA 2XJWA 1HC0A 4LFPA 4X3BA 2G4QA 1RE2A 1GF6A 2G4NA 1LSNA 3ATOA 1VDSA 1LJKA 2W1XA 5C6LA 1NDGC 3WU8A 5DN5A 2MEHA 3M18B 4DD9A 1YROA 2D4IA 3A3QA 4LYBA 4H9HA 4TUNA 1OUHA 1GBZA 1RFPA 5LVKA 4DDBA 4HJYA 5B06A 3CT0A 4YENA 1SQ2L 1FKVA 1IOCA 3A95A 1TEWA 4FJRA 4OWHA 5FEKA 1LJJA 4J1AA 4WLDA 4DD2A 3CSRA 4WM2A 1G7IC 3HBDA 5KY1A 1LZYA 133LA 5LVGA 5IDDA 4NGKA 1IWVA 3ZVQB 1IOSA 4NHTA 2FBBA 1JJ3A 1DKJA 1LMTA 1TDYA 2BQNA 1OQMA 1B5XA 3P66A 1NBZC 1B9OA 4LT2A 2ZYCA 1B7RA 1J1XY 2MEBA 4I8SA 4ET9A 5KXXA 4AGAA 1D0LA 4CFOA 4RLMA 1LJ4A 2IFFY 1GB9A 1GEVA 1LMCA 1GF0A 4XJDA 1OUCA 3B6LA 3EBAB 5KXMA 4EOFA 2HTXA 2XTHA 1BB3A 2ZIKA 2YBHA 3BKVA 3LZ2A 1LMQA 2LYMA 1GE4A 1AZFA 1LZGA 3TXJA 4YF2A 4M4OA 1JKDA 1LZ5A 3GXRA 4WM1A 4A7DA 5LVHA 1UUZC 2DQIY 3GXKA 3IWRA 4H9IA 4NSGA 4WL6A 1YANA 3CQLA 1REMA 1C43A 1OUDA 4NGWA 1T3PA 5LIOA 1HELA 1C08C 4NEBA 1F0WA 1B7QA 5KXSA 1FKQA 1JWRA 3B0IA 2Z2FA 1BGIA 1IWWA 3KAMA 4GN4A 4ML7A 1YAPA 1GBSA 1VDTA 1INUA 1OUFA 2Y8PA 2HUBA 1J1OY
chains in the Genus database with same CATH superfamily
1A4VA 4R7GA 5HNLA 1F6SA 4DQ5A 2DVWB 3FUXA 1T8GA 3U6SA 1PQMA 1GWDA 1NJFA 1WQOA 4NRWA 1L89A 1I94M 4XJFA 4CGEA 4R0FA 2L09A 3FRHA 4LGMA 5LMUM 1LSMA 1R6BX 180LA 1XGRC 1CTWA 1ZWNA 1L77A 1F10A 5H37D 5C6IA 2K0BX 148LE 1LSFA 2AHMA 5KXWA 1QQWA 1FLWA 4AI6A 1IEEA 1QS5A 2RGHA 4KL7A 4G6ZA 2ZNWY 1L06A 3JR4A 1GE3A 1QUHA 4C3WA 4LYOA 1VDLA 1IP6A 2GV0A 1L19A 1IN4A 4ZPUA 2LHCA 1L53A 3BKHA 3GUPA 1CV1A 3UJNA 3HBHA 1L1ZA 2B6YA 1MLCE 4DR6M 2Z8YM 3AZ6A 2B73A 1QZEA 5EBHA 3PFIA 3HHYA 1CU2A 1LI6A 1L64A 1DGHA 1UACY 1G7HC 4OW1A 1QTKA 2N35A 2QQ8A 2OEAX 1RCMA 4DV5M 1K28A 2FYDA 1DO2A 1Q02A 1L31A 1GBOA 1FNNA 4H9FA 2O7AA 1L46A 1L36A 2D4KA 3KFUG 174LA 1LW9A 2CWIA 2Q9EA 5F14A 1HQCA 5APCA 3WH1A 2F30A 185LA 2WARA 1L80A 3A96A 5IT9S 1KY1A 4OWBA 4OWCA 3KSXA 4HL4A 1GFRA 1LGXA 5DL9A 3K2RA 4I7KA 5KXOA 4ZFPA 3AZ7A 1UIFA 3U5ZA 3HHZA 4NGLA 5HLLA 3HT6A 2JXNA 2YDGA 3TMVA 1PQDA 1BB4A 2NWDX 1L20A 234LA 5J7CA 2J7OA 1G41A 1LSPA 3A98B 3VK8A 4Z41A 1LHLA 2A7FA 4LT3A 1DO0A 4Q7JA 1LI3A 3C83A 151LA 4MGHA 1SWZA 3G3VA 3B0OA 1CKGA 4YOPA 5M1YA 5FELA 1WVUA 3HTFA 2QPAA 4W58A 1C1KA 1L60A 2RGOA 4WM6A 1G59A 1IQPA 4W53A 4DYGA 4MGIE 1L2CA 1IR8A 2EO2A 4NC6A 3DOAA 8CATA 3GPYA 3VFDA 115LA 3L27A 1TR8A 1B0DA 1IWXA 1G7MC 4BLCA 1R4GA 1PQOA 4HTKA 3MHVC 1E32A 210LA 1L35A 4BADA 1GVNA 3J81S 1N36M 1L8QA 2CDSA 1L84A 3GLFA 1W6ZA 2R4EA 1P36A 1IWYA 4IIWA 4DV3M 2X0AA 1GXV2 6LYTA 1WVVA 1LYSA 3U6CA 1P5CA 1UIAA 208LA 5ITXE 188LA 3CDVA 1KIQC 4ETCA 1GE0A 1KIPC 4TSCA 3DNAA 4XK8F 1C60A 1VAUA 1XFPL 4R71A 1J5EM 1CUKA 3K92A 2OU0X 5B07A 5DN4A 3Q8GA 1L00A 2BAAA 4LF4M 1XHBA 3OJPA 3GRUA 4LZZA 4HEOA 1L18A 2B5ZA 4JN6A 3B7QA 235LA 4AW4A 1YAOA 5C6JA 1GFEA 3U61B 1EIJA 2DWZB 1KS3A 1L15A 2DQCY 2ANXA 2I26L 4OOTA 1NV9A 4AG6A 3EIEA 239LA 1GKIA 1CV4A 1D0KA 1L0KA 4L4UA 5B05A 1OFIA 1VEGA 1SXJD 2M5ZA 2QBYB 1JSEA 1MELL 1IX0A 2HHHM 5APDA 1QZMA 1PZYA 1SSWA 1WQNA 254LA 3A91A 3DN2A 3IJUA 2WSEF 1DYBA 1SWYA 1L93A 4H9AA 4BAFA 4Z46A 3CTWB 1JHLA 2Y0QA 4NGJA 2BQIA 1PJQA 4PCZA 1L61A 1LPYA 1L2BA 5JENB 1HSXA 1BVKC 2NTGA 5I53A 2LVAA 3E9SA 1LSEA 1MN3A 4L15A 3J7AS 1CU6A 2KRKA 2DWNA 3TXHA 1B7NA 2D7GA 5I14A 1L65A 3WPJA 4CIZA 3U6DA 4LF9M 3AOEA 3UMMA 3EO5A 3HU2A 1C7YA 248LA 2CHVA 1QT8A 3EMLA 4LJ5A 4DDAA 2RBQA 4UWVA 3ZCBB 2CRUA 1DQJC 1OUJA 3AYQA 4QGZA 4W96A 3FTCA 4NHQA 4DWXA 3TMWA 2O4WA 1OAIA 4ARPA 2H1RA 3TWKA 1L13A 3BBZA 4CFPA 127LA 1IC4Y 2LZ2A 3M6AA 2R45A 5I5QA 3FE3A 3P4ZA 3A6CY 1L97A 1IC7Y 4Z6YA 3SB8A 146LA 2R65A 158LA 2DNAA 3W0FA 3VW7A 1J1PY 2QCUA 1JR3E 3CSZA 1J7KA 3CT5A 1VEDA 1QDTA 1KIRC 1L87A 2CP8A 230LA 4NG1A 3CDRA 1JIYA 249LA 3HDFA 1GB3A 131LA 1LLHA 4NL4H 2EKSC 4EIWA 1NY6A 1XXHE 1T43A 5FTNA 1DYCA 1BVXA 3TWLA 2F5SA 1GFUA 1GL6A 3RZEA 2DQEY 4MR1A 1IVMA 4GN5C 4DR5M 1R2ZA 1IBKM 1LHMA 4B1AA 3FADA 4YY3M 1LZ1A 4WMGA 3H4JA 1EQ5A 1E8LA 1DI4A 1I56A 1YKXX 1LGWA 4DD3A 2HWJA 2JY5A 1TAYA 1YSYA 1L66A 4I7JA 3AB6A 1AT5A 1L1TA 255LA 2ZYPA 4N8ZA 2BLYA 2Q9DA 3RUNA 4JI6M 3M7GA 4GKJM 3GLIA 5LXWA 1L30A 5FSTA 1LMAA 3T36A 2Z2EA 1OAOC 4GC9A 1LSCA 5KJ9A 1YUBA 2BWBA 2UXBM 176LA 3FYCA 4RLNA 259LA 4H8XA 1HMKA 1C6NA 4LJ9A 4XADA 2MGWA 1L76A 3GUIA 1GFJA 2Z7JA 218LA 1C6CA 4IBIA 3CF2A 1LTMA 3LZTA 4ETDA 1IP5A 3M0EA 3SB7A 3WVXA 3WU9A 2DZLA 5L9JA 4DT3A 1LZTA 4UWUA 1HR0M 1IM2A 1AUAA 3A93A 1Q3BA 2CUZA 1L16A 1HT1E 4LJAA 1UC0A 1X37A 4L16A 5FLXS 2QB0B 4E97A 1LYEA 232LA 2YBIA 134LA 1L41A 209LA 1Z6TA 4GITA 1IY2A 2ZIJA 1XXHB 1AIPC 3KS4A 1C6KA 5LVJA 1P56A 1L44A 4LY6A 4DD0A 5E9RA 2CV0A 4D81A 1UCOA 3HUKA 1CJ6A 1L01A 145LA 5I4WA 3U6LA 3E46A 1XGPC 113LA 4DUYM 2KRUA 3AGIA 157LA 1LYGA 4B0DA 3GQ3A 2XJWA 2EKKA 1GF6A 3QYEA 2EA0A 1VDSA 2W1XA 195LA 1L42A 1D2WA 5DN5A 4DD9A 2D4IA 1Y8GA 4DR2M 1T8FA 4ARQA 2GQFA 2HL7A 3ZQJA 1IN8A 4LF7M 1OUHA 1GBZA 2X8AA 3GLHA 2V1CA 3CT0A 4YENA 1SQ2L 1FKVA 4G4OA 1IOCA 4DD2A 1HNWM 4NSRA 3DZDA 1BVSA 1IY1A 103LA 1IOSA 2FBBA 2F4VM 3GLFE 1DGHB 1B5XA 3RE8A 1J1XY 1D0LA 4CFOA 4RLMA 4MH0E 2UUBM 1G06A 3HU3A 3B6LA 4EOFA 2HTXA 2XTHA 2EJSA 3NBIA 1LMQA 3HH6A 1L55A 1JKDA 3GXRA 1NVMA 1UUZC 3GXKA 4H9IA 3HGIA 1L70A 4WL6A 120LA 4NGWA 1T3PA 177LA 3B89A 156LA 1L40A 2WZJA 4NEBA 1B7QA 3B0IA 4GN4A 3KOXE 1OUFA 1IXRC 2Y8PA 4B08A 2YFQA 1L91A 2DBTA 3U5ZB 4FWGA 4DD1A 2AUBA 1C6DA 1CU5A 3SP3A 1L08A 155LA 3C82A 3WVYA 3WL2A 4K5YA 4JI1M 4H9BA 3F6ZA 1VG5A 1Q3CA 1L12A 104LA 1PS5A 2KA6B 3CGWA 4XYYA 3AL0C 1VDDA 3SBAA 3GPPA 1KXYA 2FYCA 4HPIA 1B5YA 3AW7A 2ZWBA 4CJ2A 1IP2A 3C3DA 1L74A 1FDLY 1QAMA 1Z5BA 3FRIA 1P3QQ 3GUKA 5DM9A 1FLUA 3FUVA 1LPIA 4PT5A 1JB0F 4TUWA 1OUBA 1JEFA 5KXRA 5B1FA 3A46A 2H9JA 2ZNXY 1V33A 1SXJE 5EXTA 1PJSA 4JI0M 4FCTA 1LSBA 1YAMA 1L37A 1L43A 3ZVQA 2FBDA 1DKKA 5EQTA 3SMPA 2QZ4A 4ZIXA 2O5RA 2Z4SA 1LMNA 1HSWA 3GLFB 3SB5A 1NHBA 1LYYA 1ZMYL 1I4WA 1IOTA 3AZ5A 4IJ4A 181LA 1HEMA 5F9XA 4LJ7A 4EXMA 4NG8A 1PRBA 2HU3A 4GBRB 1GD6A 5HQ1A 3HJQA 1IY0A 1K3WA 3W6CA 1KW5A 9LYZA 4DD7A 2QSFX 4HTQA 1SG9A 2Z18A 1P37A 162LA 1L10A 1C46A 1HEPA 1L67A 2YBMA 1NQIA 1L85A 1N75A 1ZYTA 1L82A 3MGWA 4R6CA 2ZM6M 1GF3A 2C99A 2N5ZA 3W6AA 4XJHA 3SHGB 1KNIA 4GIPA 3FUTA 3FTDA 5F81A 5HMJA 1JR3D 4GHAA 3LYOA 4EPFA 3ATNA 3WYHA 5F3WA 2LC9A 1QTVA 1LSZA 3Q8XA 1C6GA 5IREB 1C6FA 2DHRA 2KNZA 3OE9A 1QTEA 1LJIA 1DXJA 1J1OY 1L45A 3C7YA 1JKBA 4DC4A 2MROB 2F5OA 1QSQA 2LCBA 2HEBA 1NWGA 1ZMUA 6LYZA 4JV5M 4QEQA 1LJNA 2EKFA 3D3DA 3HT9A 2DQDY 2C9OA 3FTEA 109LA 1L72A 4H1PA 3B9PA 2JY7A 1SXJB 1SX7A 2FNAA 3TXKA 3DN3A 2MEGA 3A67Y 3A92A 4NSOB 4FCWA 1C6BA 4D82A 4II8A 1I6SA 1G7LC 4M0WA 2KDLA 3E3DA 4DV2M 4TTDA 4HTNA 4XBOA 1L27A 4DR4M 1QIOA 3SB9A 2RAZX 3DN6A 3VDPA 4OOOA 5BR8M 260LA 1ALCA 1UFZA 1WHCA 3HWSA 219LA 1T6OA 3PXGA 4PDGA 2B6ZA 1LJGA 2OTZX 4CHXA 1YIKA 241LA 3P68A 1YKYX 3SB6A 4LDOA 3IG8A 2RAYX 3I04M 1W5TA 1ZVHL 3N9AA 5HMVA 1GB0A 1LZDA 4KPMA 3G3BB 4J7VA 4GRIA 4B3MM 1L95A 2H9KA 1I20A 3NY8A 4YEOA 3FTFA 3UONA 1L33A 4B3RM 2ANVA 4IBGA 3B74A 2XSZA 1IWUA 4LGYA 1D3MA 3C9PA 4LDEA 4GLVA 1SSYA 2MEDA 4GCDA 1IIZA 4BBAA 2UUCM 5D5FA 3A90A 4DQ7A 4WO9A 1G3IA 2DAMA 1HNLA 1JTPL 4HJVA 2A5YB 3P64A 3U60B 3HFMY 4WL7A 1CV5A 2W1LA 2F5PA 2ZQ3A 3GQ5A 130LA 4H90A 2B6WA 4LYCA 4W56A 4DKLA 1W5SA 1OP9B 4N5RA 4G9SA 2Z39A 2B75A 2YBJA 5E4PA 1NBYC 4N1CC 2VB1A 4XENA 1L21A 2DAKA 236LA 4LZTA 1G1WA 4J1BA 4I7QA 4WP2A 198LA 2V6ZM 3T15A 5ILCA 4NHSA 3J7BA 3HJ8A 1VEKA 1G0PA 2LYZA 2F2QA 3GLIB 4W51A 3J2PB 1T8AA 3GLHE 1QT7A 4GH9A 3SASA 2ZAOA 1GO5A 1BWIA 3AGHA 1JQUA 3L2AA 4LJ8A 2YNMD 2O79A 2JWSA 1L26A 1LHHA 1IY4A 1IO5A 1JTNA 3L64A 2BQGA 4P2EA 2BQOA 229LA 3W67A 2L2DA 1C64A 2F5QA 5DNYA 1CV0A 1TDHA 2A4TA 1WJ7A 3A42A 214LA 4B3SM 1L14A 3PNYA 1LJEA 4I5SA 4ANRA 215LA 126LA 1XNRM 4QDNA 1OKSA 2H5XA 1FJGM 1HNZM 1QQYA 4IASA 5A3ZA 4LZMA 2L7HA 3I51A 4NY5A 1LOZA 4LJ6A 1PQJA 217LA 1L75A 4S0WA 3RU5A 4HV1A 1QAOA 3G3WA 5EXPA 3ILKA 3N9EA 143LA 1LZ9A 5FSWA 2LBCA 2ZBKB 4I7SA 3CDOA 4AKIA 4TWSA 1I1ZA 1CJ7A 1V7TA 1DPWA 1QDRA 1GB7A 2DQHY 3GLGE 5C1BA 1B7SA 4LZJA 220LA 2G5GX 3C3EA 1XJTA 5L8RF 3AZ4A 1CKFA 4IBKA 1QYRA 2BQBA 1GAZA 1L17A 2JY6B 2OTYX 5KXLA 1QAQA 2OOBA 3TXIA 1BB5A 3TMUA 1GB8A 4TSBA 1DV0A 1XEPA 2ZTDA 1F6RA 1G4AE 4ARQB 3T6PA 1PM5A 1QTBA 1D6QA 245LA 8LYZA 3GLHB 3LCVB 4NGOA 3MK6A 2F2NA 4M9SA 170LA 2Z4RA 4LRSA 110LA 5IELA 5LA8A 2HEAA 147LA 3HTBA 4BAPA 4AG5A 4DV0M 1CKDA 1G0GA 4OO9A 4ZPXA 1NO1A 1B5UA 3WW5A 1HQYE 4CJ6A 2ZQ4A 1E94E 4NWHA 4B49A 3HH4A 5C18A 1EL1A 3B0KA 1TH3A 1QANA 4LDLA 4U3XB 2JZ1A 4KT0F 1XEIA 3SARA 1PGYA 3AGGG 2RBSA 1T6HA 1TCYA 2F4AA 4E3UA 258LA 5KPZA 199LA 238LA 2VIIA 2XFSA 3NWLA 2KW0A 3C8RA 4PGJB 2XBRA 1WQPA 1BB6A 1B7MA 2EUCA 1KSFX 2BQDA 2I7NA 1L02A 3GLGB 4H9CA 1GE2A 3BXWA 4PK0A 4MB7A 4GRVA 1ZMWA 1C6QA 3C7ZA 2EIZC 1CX6A 1JITA 4HSFA 1L96A 4BS7A 4X66M 1GHLA 4IBBA 1GJTA 4WM4A 5ILFA 3FA0A 2D7HA 3K9OA 1RE2A 4I7PA 1LJKA 1IBMM 4MM3B 1NDGC 3AJIB 2G3QA 3SFZA 3M18B 3SBBC 1YROA 1IXZA 4BB9A 3ZC7B 2HUKA 4H9HA 2B70A 4DDBA 2L6OA 3HUQA 4X64M 1N34M 3GQ4A 3GUMA 1ZMVA 2C9CA 3ODUA 1L32A 4EPIA 3A95A 1TEWA 4EKPA 1LJJA 4WLDA 173LA 3GRRA 3HBDA 2FS1A 1L63A 1LZYA 5LVGA 1IWVA 3ZVQB 4NHTA 172LA 1JJ3A 1DYFA 3HKPA 2RB1X 128LA 4ET9A 2ZYCA 1B7RA 4I8SA 1V92A 3GRYA 1L83A 261LA 4AGAA 1YE9A 1GEVA 2KNVA 4PJZA 4XJDA 5KXMA 2JP7A 1NV8A 4GKKM 3VKHA 1LZGA 3F9LA 3TXJA 3HU8A 1LZ5A 3IWRA 4I7RA 3QAKA 4DV4M 1REMA 1OUDA 2MH8A 1HELA 196LA 4YHHM 4ML7A 4RKUF 3C8SA 1VDTA 3KP0E 1B7OA 1JTOL 1XB2B 4CGYB 1LZRA 3J6KA 5KXZA 2J5YA 1HHLA 1OIPA 160LA 4HV2A 1BHZA 4H94A 2R18A 4PD2A 5DFLA 4LFAM 4JI3M 1S3SA 3U6EA 1OUAA 1C62A 1GFAA 3OK0A 1WQMA 1IWZA 3VDUA 4HP0A 4ETAA 2B72A 1DYAA 4PRQA 3SHFA 1YL1X 5AMYA 5LVIA 221LA 1D3JA 1GJSA 2JY8A 1YILA 1QTHA 1P2CC 3KVWA 2DENA 1LSYA 4JXJA 1IWTA 3KP1E 2H5ZA 1G8PA 1K82A 2Z12A 4NSJA 2XZFA 3RW8A 186LA 2KXEA 4IAPA 1HERA 5KXYA 2O25A 4I8OA 4GC5A 2L7IA 2OE4X 1LYZA 4LYMA 2RBOA 2CV2A 2I6ZA 4M0DA 3HUAA 1GF4A 1NDMC 2DKVA 3VK7A 1L81A 3C8QA 2LH0A 5LYZA 1XGUC 1HFXA 262LA 149LA 1KXXA 1GFVA 3A45A 184LA 1LYJA 4WOAA 5LAGA 4FW9A 4EKQA 4MSTA 1TLAA 2LVNC 2EPEA 2MEAA 3LQQA 1UBZA 4G4CA 1YQVY 5KKIA 1N78A 3SYLA 5IHGA 2CJLA 2E5LM 3W3EA 3LYTA 4AQNA 1N77A 4B3TM 3GUOA 2OU8A 1LKRA 1XSFA 1BQLY 4ITQA 2Q0MX 3TXGA 4RW2A 1LZBA 3SN6R 4NWEA 5E6JA 2RBNA 3LYMA 233LA 1CKHA 1EQEA 4D80A 1RU3A 1QUOA 1OWZA 1P2RA 3WMKA 2IGCA 1CVKA 3SAUA 1LYHA 1HEQA 1GF9A 3DMVA 3KDSE 1OFHA 1L99A 4XJGA 4DR3M 2D6BA 3WPLA 3WW6A 2FE8A 3HH5A 3BOSA 1IC5Y 1E9RA 2R46A 1L11A 1LYIA 1QT5A 250LA 1IXSA 5EP3A 3VKGA 2WSCF 1C7PA 4YX7C 1EPYA 4Z3MA 3AFHA 4DV1M 1REZA 3TL4X 1JKCA 3GP1A 3OTOM 4I7OA 1JJ0A 1P3NA 2OQ4A 107LA 240LA 3SMSA 1VATA 3CF6E 140LA 1ZV5L 3LZMA 4ETEA 1LJFA 2MEEA 2GNOA 1L90A 1JQJC 1D9UA 5KXPA 1JUGA 3T6UA 132LA 2DQJY 1JPOA 3SATA 2LYOA 2VQEM 4AZFA 1GABA 135LA 1XEJA 1UICA 1GXXA 4KODA 5LA5A 5JI2E 3D9AC 1NY5A 7LYZA 1CNSA 2O01F 4WO6A 5BPVA 4FDYA 1CJ9A 226LA 1AM7A 3TXDA 7CATA 1H6MA 3C81A 1GL7A 1P7SA 3QNGA 4FCVA 222LA 1L52A 191LA 4I7TA 1VDQA 1F4IA 1LSAA 4B4EA 2Y20A 1TDZA 2G4PA 2Z19A 2RRUA 2OE9X 4WM3A 1IP3A 2XGNA 4G4NA 2QP9X 1UIEA 1CU0A 1TF0B 2XQOA 3E4RA 3GULA 1L09A 1QUGA 1A5TA 4AKGA 4LF8M 2HEFA 2LTUA 3B7ZA 1C61A 2LVOC 3WPKA 2F5NA 2R6FA 2C5RA 3K3TA 4NXNM 2CHGA 1L28A 2WSFF 2BNKA 2YR0A 2NQ8C 1C6LA 2KZUA 2OO9A 2K9DA 3GRVA 5KPTA 216LA 3CF0A 1O23A 3OE0A 4MGKE 164LA 1C63A 1RI8B 2LXEA 2QARC 223LA 227LA 4H8ZA 4GLAA 4II7A 1VFBC 4CISA 3WU7A 1REYA 1XWIA 4B7HA 1XMQM 3F92A 4MGYE 2B3TA 1DZBX 1IP1A 4NHPA 4LG2A 1L51A 1NHEA 2R44A 3I4VA 1AT6A 3HH3A 5F16A 1XGTC 4QOZC 1T6VL 3IJVA 1QS9A 4G3OA 3W6BA 2DZOB 5DYGA 4B7FA 2K47A 2Z38A 3ULRA 1JTTL 1NSFA 4ARJA 2Q2EB 1IR9A 4D9ZA 3FI7A 4L8RC 2OE7X 3RT5X 1C6TA 1LMOA 4M9XA 1IN5A 1LHKA 4ARMA 1B5ZA 1IOQA 1WQQA 2UXCM 4L41A 2PC2A 1MX0A 4QNRA 5B1GA 1L69A 1PJTA 3U6QA 2DQAA 1OUIA 4G4BA 5IWAM 1LJ3A 5GKNA 4AXTA 5K7OA 4JYAM 5KXNA 3QAUA 2CWBA 4F2LA 4QY9A 5FHWA 1HEOA 4XGIA 1D6PA 3G3XA 4N0JA 4F1IA 3DMXA 4IATA 3TPZA 3EIHA 1SXJC 1DPXA 4NSHA 144LA 2OOAA 4W55A 3SAWA 1TBYA 1ZAEA 154LA 2DI0A 5EJCA 4LFXA 1C6EA 1TTEA 2CHQA 1FLYA 2DQGY 4YEMA 2BWEA 169LA 3L26A 1DGGA 200LA 3V2YA 3OE8A 4WM5A 1WGLA 5F9UA 5FTLA 3GLIE 1C6IA 1LSGA 2L78A 1OVHA 1CUQA 3ZEKA 4I81A 4C5FA 1AKIA 3F8VA 3HDEA 4NSIA 4J0LA 3WXUA 5KXKA 1L47A 2HKJA 1NNJA 211LA 3W6EA 4LFCM 231LA 5FCPA 2XSZD 2FFJA 1KW7A 3C7WA 2LNHC 5A3EA 1YLAA 1L07A 4DR1M 2LVQD 1OQYA 2C98A 2BQCA 3HU9A 1R7RA 3TXFA 112LA 1OWYA 4JI8M 3DA1A 1GF8A 5LINA 4LYTA 1UIBA 2V1UA 2BQEA 1HJPA 2VF8A 1HENA 3U6PA 4WLXA 171LA 246LA 2D4JA 3HT7A 152LA 4ETBA 3AJNA 1G1VA 1H6UA 1HFYA 3W6DA 2DAIA 4IBCA 4LJ4A 1GDXA 1WGNA 1L73A 4KT3A 1BB7A 1IFYA 2RB2X 1MJGM 1OTRA 1L29A 2UUAM 1QUTA 1L98A 5EP1A 4KLNA 4QNMA 4WW0A 3J4GA 2BQLA 1ZQ9A 1JKAA 2RB0X 118LA 5LYTA 1QTDA 3D4SA 4FWHA 5ITYA 1XMOM 1JSFA 1CU3A 1LYOA 1G71A 122LA 4NGZA 4LT1A 1NMMA 2DXIA 4WLTA 247LA 1QSWA 4P17A 1L79A 4B4JA 1UIDA 3N9CA 1XGQC 2BQFA 1L38A 1LHJA 1XEKA 1QUSA 4CHTB 5ITQA 1RJCB 4IBJA 4GCFA 2MEIA 1LZ4A 4B7GA 1QSAA 2MR9A 3NYAA 1VEJA 1Z55A 3DMZA 3QE8A 4R3DA 4JI4M 4OW0A 1G0MA 3IECA 2C8OA 4FD2A 2BQMA 4M6DA 141LA 5HNCA 3HHWA 5LMNM 3LN2A 4N1EI 2JNHA 4HPEA 5ITUA 3MMPA 4X3BA 2DKLA 4EKSA 4DR7M 2ZAMA 5C6LA 2MEHA 3TQSA 3A3QA 3T1YM 1L94A 2B7XA 4LYBA 1D2NA 2R62A 2F47A 1R2YA 1P64A 189LA 4W59A 4TUNA 3UK6A 5LVKA 1RFPA 5JI3E 139LA 2VF7A 3KOWE 4OWHA 159LA 2UU9M 3CSRA 192LA 1G7IC 1SX2A 1DYDA 1G0KA 5KY1A 133LA 2XF3A 5IDDA 4NGKA 1WIVA 111LA 1L54A 3P66A 1NBZC 1B9OA 3SAVA 3WHLA 3AKZA 3TE6A 1LWKA 2IFFY 1GB9A 1LMCA 3JR6A 3HJSA 1G07A 3CDTA 1BB3A 3GO8A 3BKVA 1L58A 2LYMA 4YF2A 1AZFA 4WM1A 1L56A 1WTHA 5LVHA 5EP4A 1T97A 2DQIY 1YANA 2ERCA 4OU7A 3DN1A 5KQDA 1UM8A 4IBEA 5LIOA 5KXSA 1FKQA 2Z2FA 1CV3A 2VQFM 3KAMA 1IN6A 1GBSA 1YAPA 2P5TA 2HUBA 1L68A 1DI5A 3LHMA 1NHWC 4KO8A 4I7LA 4JI5M 2R0IA 1C10A 2Z37A 3RNXA 1VQ1A 1FLQA 1LYDA 3TXEA 4XJBA 2JUJA 4RNAA 5II3A 4NIJA 2ZTCA 1LGUA 3DFZA 3G3AB 1CJ8A 4DV6M 161LA 2W1YA 4NGVA 1Z5AA 4L78A 1JTMA 2HULA 1IXSB 3K9PA 5EXXA 1YAQA 1QT6A 2CUUA 5KKJA 3SBJA 1OVKA 4LFBM 2RBRA 4LT0A 3QY4A 1OV7A 4GEWA 1L92A 1N32M 3W68A 251LA 4O34A 4Y28F 1GAYA 2XEPA 1MU5A 1DGFA 3HT8A 4WG7A 3T38A 3A6BY 5LAFA 3CB7A 1QT4A 4KHPM 4YXCA 201LA 2R4JA 1XC8A 1UIHA 3RZ4A 2A7DA 1L34A 2HCBA 4ET8A 3I01M 1L50A 3TXBA 2D91A 1B5WA 2DWMA 1LHIA 1GBYA 5KO3A 3LW5F 4MCKA 3CDQA 1HMLA 3GUNA 4H92A 5APEA 114LA 1L0JA 1C65A 1T3TA 3RFWA 4I7NA 1C6MA 1SXJA 2DQFC 4OVZA 1V34A 1IP4A 5I4YA 2M60A 1LMPA 4FVMA 2XBSA 4LCBA 190LA 1A2YC 2HU1A 1GFGA 3GUJA 2CV1A 1LV7A 2DAGA 1C66A 1OJLA 1LJHA 2CEAA 1HEWA 3KS8A 3LCUA 1L62A 4N9RA 175LA 2YBNA 1QT3A 1SLYA 1ZURA 3A3RX 3M3UA 1K3XA 138LA 4QHTA 1B7LA 4HJZA 1QVRA 1D2YA 1G7JC 3LQRA 1GLNA 2HEEA 1LZ8A 4PHIA 3WULA 3K2LA 1GFKA 4PRUA 2FOIC 3KOYE 3NBXX 1G0LA 3LYZA 1KXWA 2MECA 1NNUC 2CE7A 2LWXA 1TH4A 3ZH9B 2XFTA 4DUZM 3FUWA 3AV0A 2Z6BA 3B72A 3EXDA 3SYKA 2DWLA 1P2LA 1YKZX 5LZMA 1N4FA 1V7SA 3VWOA 3FE0A 3U60A 2EQLA 4XJIA 1PJIA 3PVSA 2BJVA 4NOOB 1WTNA 3WUAA 4EKRA 5KXTA 4WLYA 1HFZA 3PBLA 4L6V6 3IG5A 1B6IA 3EMSA 252LA 4NXMM 1GF7A 4NGYA 3NY9A 3FI5A 1CKCA 1QTZA 1ZVYB 1J09A 1C67A 2LHGA 4GCEA 1G0JA 3CT1A 2X4AA 2W1MA 2F32A 4HLQA 2NTHA 1UA6Y 4ARMB 1IR7A 3LVWA 1L49A 3LMMA 4GN3A 4W94A 3C58A 3HZJA 3V76A 4MGZE 4W52A 1FN5A 1GPQC 5DYIA 4QOSA 4G49A 1BWJA 4H8YA 167LA 2LHMA 1ORYB 5FTMA 206LA 102LA 2RBPA 2OPFA 3U6MA 1GEZA 4OWEA 2BQAA 119LA 129LA 1GDWA 4LGKA 5L3HA 4Z8XA 1REXA 3GPXA 1LZEA 187LA 1LKSA 5FTJA 1L57A 1L39A 1P46A 4W54A 1PQIA 2F4GA 4YM8A 207LA 1LSDA 3K8ZA 1HF4A 1VDPA 5LYMA 3JAMS 5KQ8A 4W57A 4X62M 125LA 1C6PA 3L28A 1G0QA 4OX9M 4AQYM 5APFA 123LA 4DDCA 1Z5CA 2LVPC 4REZA 4K0KM 3A8ZA 2DAEA 225LA 4B4IA 1C69A 3A34A 2HEDA 1E9SA 4G4QA 108LA 1GB2A 1JISA 193LA 3R8FA 257LA 2D7EA 4NRVA 1DGBA 2HECA 3R9XB 150LA 165LA 4KXIA 1NF5A 2G8LA 1CX7A 1LWGA 3QWLA 3KXEC 1DYEA 4W5WA 2BQJA 4WURA 4DAJA 2BQHA 2XH9A 2KHHA 1CUPA 1LI2A 3DKEX 5KPRA 4PPOA 2RKOA 1GBXA 2RH1A 2HUMA 3TWMA 2L4EA 1OV5A 256LA 1LCNA 4IJFA 166LA 3MJ5A 5I4XA 1OUEA 2LZTA 1IY3A 4I0CA 1L03A 1PJJA 1DI3A 2I7PA 5E26A 1LZ6A 3H4MA 3KW6A 5FTKA 2XZUA 1GB5A 1LZSA 3L2XA 3HY5A 4I7MA 1IORA 5FDJA 4OWAA 2APLA 1XJUA 2BPUA 3HU1A 3HWLA 4H9EA 1L04A 3TMXA 3FD9A 3V2WA 4LYZA 4EJ4A 3U61A 3IHPA 3WUNA 5IZ7D 3KOZE 3A94A 5EXSA 4PJ2C 1D3NA 1GFTA 253LA 3OE6A 3FYDA 163LA 1L05A 3B7NA 2YVBA 1QTCA 4DJHA 182LA 3QYBA 2QBYA 3E21A 4NHIA 4I4LA 3P65A 2L4FA 2DHYA 1XNQM 1N33M 3I4YA 2VDBB 2JA2A 1C6HA 4DV7M 3RGSA 137LA 1W08A 243LA 3HBEX 3WUMA 1GF5A 3D8BA 4GCCA 4GMQA 4LF5M 3PDSA 2QHOB 1IN7A 237LA 1Q39A 5T3FA 4XN6A 1L23A 1R5LA 2MEFA 1EFUB 2DZNB 1D3FA 4TX7A 5D5CA 1TGUA 1L88A 2C8PA 3GLGA 1WQRA 2B74A 1H87A 4RDSA 2J7NA 4DQJA 4DBGB 1IBLM 1IP7A 2BQKA 1GE1A 2KZSA 1BWHA 5ITXA 3L25A 4GCBA 3PNVA 168LA 1LAAA 5L3IA 1NJGA 1L86A 1WXQA 2ZILA 4PDIA 4H93A 3W6FA 3AW6A 3U6OA 1B5VA 4G4HA 3L29A 224LA 1LZNA 2W82A 1C6JA 4WG1A 4ZEEA 5ITTA 142LA 213LA 1FBIX 1HNXM 5I54A 1OUGA 4Z98A 2K6BA 4ARLA 2KEBA 3THGA 4FWDA 3DN0A 5B59A 3T1HM 1WTMA 4RW1A 5A2QS 153LA 1C45A 1B7PA 1GB6A 1NKHA 2C96A 1GBWA 5DLAA 1LZAA 1YL0X 7LZMA 1UIGA 2QENA 1B2KA 3UZUA 5EP2A 2BLXA 183LA 4NFVA 4A3VB 1L2DA 1NHGC 2JZ0A 4UN2B 1EQ4A 2IHLA 3CSQA 3WXTA 6LZMA 1Z59A 4P16A 3UGJA 1LZCA 3SC3A 2MJ5B 3JR5A 4G4RA 4EMNA 2B6TA 2I25L 4M9ZA 2Y21A 1D0MA 3AOGA 2Z3XA 1QSBA 2LZMA 2RSCA 4UWNA 1JJ1A 4IBDA 2YBLA 194LA 2CGIA 2YSSC 228LA 1KYIA 3GPUA 1L24A 3WHKA 1C6AA 4H91A 1GFHA 1HC0A 1P6YA 4LFPA 2G4QA 1L71A 1L48A 2G4NA 4JI2M 1LSNA 3ATOA 4RF1A 2Y0TA 3W0LB 3C80A 4IJEA 4YXAC 3WU8A 1OVJA 2YQZA 2OU9A 3HTGA 4IBFA 212LA 2XLJA 3HX3A 4HJYA 5B06A 3HHXA 3D8LA 2B6XA 3HTDA 2FH0A 4JI7M 1DYGA 2UXDM 4FJRA 5FEKA 3AOEC 3DN8A 2ZANA 4J1AA 3J80S 2CFOA 2HAKA 1CV6A 4WM2A 4AKHA 242LA 1C68A 1LYFA 3K1JA 4GHLA 1EE8A 4QHSA 4X65M 178LA 1D9WA 1DKJA 1LMTA 1TDYA 1KY0A 2BQNA 1OYUA 4LF6M 1OQMA 1QUDA 3J27B 4LT2A 2MEBA 5KXXA 205LA 4RF0A 1ZV1A 4LRTA 1LJ4A 1L22A 1GF0A 1OUCA 197LA 1L59A 3EBAB 3FUUA 1JR3A 2ZIKA 1KFVA 2YBHA 3LZ2A 4M4OA 3LVVA 1GE4A 2KNAA 4A7DA 3FKEA 1PQKA 4NSGA 1OIZA 2X49A 3KSJA 3CQLA 4OVZB 1C43A 2BJWA 3VLFB 1C08C 1HT2E 1F0WA 1TH2A 1JWRA 1XXHA 4NGIA 1BGIA 1WR1B 1IWWA 3DN4A 3RGPA 244LA 2QNJA 1INUA 5ITRA 1L25A 4S12A
chains in the Genus database with same CATH topology
1A4VA 5HNLA 1F6SA 4DQ5A 1T8GA 1PQMA 1GWDA 1WQOA 1L89A 4XJFA 4CGEA 4R0FA 1LSMA 180LA 1XGRC 1CTWA 1ZWNA 1L77A 1F10A 5C6IA 148LE 1LSFA 5KXWA 1FLWA 1IEEA 1QS5A 4KL7A 2ZNWY 1L06A 1GE3A 1QUHA 4C3WA 4LYOA 1IP6A 2GV0A 1L19A 4ZPUA 1L53A 3BKHA 3GUPA 1CV1A 3HBHA 2B6YA 1MLCE 3AZ6A 2B73A 5EBHA 1CU2A 1LI6A 1L64A 1UACY 1G7HC 4OW1A 1QTKA 2OEAX 1RCMA 1K28A 2FYDA 1L31A 1GBOA 4H9FA 2O7AA 1L46A 1L36A 2D4KA 174LA 1LW9A 2CWIA 2Q9EA 5F14A 5APCA 3WH1A 2F30A 185LA 2WARA 1L80A 3A96A 1KY1A 4OWBA 4OWCA 1GFRA 1LGXA 5DL9A 5KXOA 3K2RA 4I7KA 4ZFPA 3AZ7A 1UIFA 4NGLA 5HLLA 3HT6A 2YDGA 3TMVA 1PQDA 1BB4A 2NWDX 1L20A 234LA 5J7CA 1LSPA 4Z41A 1LHLA 2A7FA 4LT3A 3C83A 1LI3A 151LA 1SWZA 3G3VA 3B0OA 1CKGA 4YOPA 5M1YA 5FELA 1WVUA 3HTFA 4W58A 1L60A 4WM6A 4W53A 4DYGA 1IR8A 115LA 1B0DA 1IWXA 1G7MC 1PQOA 4HTKA 210LA 1L35A 4BADA 2CDSA 1L84A 1W6ZA 1P36A 1IWYA 2X0AA 1GXV2 6LYTA 1WVVA 1LYSA 1P5CA 1UIAA 208LA 188LA 3CDVA 1KIQC 4ETCA 1GE0A 1KIPC 4TSCA 3DNAA 1C60A 1VAUA 1XFPL 2OU0X 5B07A 5DN4A 1L00A 2BAAA 3OJPA 1L18A 2B5ZA 235LA 1YAOA 5C6JA 1GFEA 1KS3A 1L15A 2DQCY 2ANXA 2I26L 4OOTA 239LA 1L0KA 1CV4A 1D0KA 5B05A 1JSEA 1MELL 1IX0A 5APDA 1PZYA 1SSWA 1WQNA 254LA 3A91A 3DN2A 3IJUA 1DYBA 1SWYA 1L93A 4H9AA 4BAFA 4Z46A 1JHLA 4NGJA 2BQIA 1L61A 1LPYA 5JENB 1HSXA 1BVKC 2NTGA 5I53A 1LSEA 1CU6A 3TXHA 1B7NA 5I14A 1L65A 3WPJA 3EO5A 248LA 1QT8A 3EMLA 4DDAA 2RBQA 4UWVA 1DQJC 1OUJA 3AYQA 4QGZA 4W96A 4NHQA 4DWXA 3TMWA 2O4WA 4ARPA 1L13A 4CFPA 127LA 1IC4Y 2LZ2A 5I5QA 3P4ZA 3A6CY 1L97A 1IC7Y 3SB8A 146LA 158LA 3VW7A 1J1PY 3CSZA 3CT5A 1VEDA 1QDTA 1KIRC 1L87A 230LA 4NG1A 3CDRA 1JIYA 249LA 3HDFA 1GB3A 131LA 1LLHA 2EKSC 1DYCA 1BVXA 1GFUA 3RZEA 2DQEY 4MR1A 1IVMA 4GN5C 1LHMA 4B1AA 3FADA 4WMGA 1LZ1A 1EQ5A 1E8LA 1DI4A 1I56A 1YKXX 1LGWA 4DD3A 1TAYA 1L66A 4I7JA 3AB6A 1AT5A 2ZYPA 255LA 4N8ZA 2BLYA 2Q9DA 3RUNA 5LXWA 1L30A 5FSTA 1LMAA 3T36A 2Z2EA 1LSCA 5KJ9A 176LA 4RLNA 259LA 4H8XA 1HMKA 1C6NA 4XADA 1L76A 3GUIA 1GFJA 218LA 1C6CA 1LTMA 3LZTA 4ETDA 1IP5A 3SB7A 3WVXA 3WU9A 5L9JA 4DT3A 1LZTA 4UWUA 3A93A 1L16A 1UC0A 2QB0B 4E97A 1LYEA 232LA 2YBIA 134LA 1L41A 209LA 2ZIJA 1C6KA 5LVJA 1P56A 1L44A 4DD0A 5E9RA 1UCOA 3HUKA 1CJ6A 1L01A 145LA 5I4WA 1XGPC 113LA 3AGIA 157LA 1LYGA 4B0DA 2XJWA 1GF6A 1VDSA 2W1XA 195LA 1L42A 1D2WA 5DN5A 4DD9A 2D4IA 1T8FA 4ARQA 1OUHA 1GBZA 3CT0A 4YENA 1SQ2L 1FKVA 1IOCA 4DD2A 103LA 1IOSA 2FBBA 1B5XA 1J1XY 1D0LA 4CFOA 4RLMA 1G06A 3B6LA 4EOFA 2HTXA 2XTHA 1LMQA 3HH6A 1L55A 1JKDA 3GXRA 1UUZC 3GXKA 4H9IA 1L70A 4WL6A 120LA 4NGWA 1T3PA 177LA 156LA 1L40A 4NEBA 1B7QA 3B0IA 4GN4A 1OUFA 2Y8PA 1L91A 2DBTA 4DD1A 2AUBA 1C6DA 1CU5A 3SP3A 1L08A 155LA 3C82A 3WVYA 3WL2A 4K5YA 4H9BA 3F6ZA 1L12A 104LA 1PS5A 4XYYA 3SBAA 1KXYA 2FYCA 4HPIA 1B5YA 3AW7A 2ZWBA 4CJ2A 1IP2A 1L74A 1FDLY 3GUKA 5DM9A 1FLUA 1LPIA 1OUBA 1JEFA 5KXRA 5B1FA 2H9JA 2ZNXY 1LSBA 1YAMA 1L37A 1L43A 3ZVQA 2FBDA 1DKKA 4ZIXA 1LMNA 1HSWA 3SB5A 1NHBA 1LYYA 1ZMYL 1IOTA 3AZ5A 4IJ4A 181LA 1HEMA 5F9XA 4EXMA 4NG8A 2HU3A 4GBRB 1GD6A 5HQ1A 3W6CA 1KW5A 9LYZA 4DD7A 4HTQA 2Z18A 1P37A 162LA 1L10A 1C46A 1HEPA 1L67A 2YBMA 1NQIA 1L85A 1ZYTA 1L82A 3MGWA 4R6CA 1GF3A 2N5ZA 3W6AA 4XJHA 1KNIA 5F81A 5HMJA 3LYOA 4EPFA 3ATNA 3WYHA 2LC9A 1QTVA 1LSZA 1C6GA 1C6FA 3OE9A 1QTEA 1LJIA 1DXJA 1L45A 3C7YA 1JKBA 4DC4A 1QSQA 2LCBA 2HEBA 1NWGA 6LYZA 4QEQA 1LJNA 3D3DA 3HT9A 2DQDY 109LA 1L72A 4H1PA 1SX7A 3TXKA 3DN3A 2MEGA 3A67Y 3A92A 1C6BA 4II8A 1I6SA 1G7LC 3E3DA 4TTDA 4HTNA 1L27A 1QIOA 3SB9A 2RAZX 3DN6A 4OOOA 260LA 1ALCA 219LA 2B6ZA 1LJGA 2OTZX 4CHXA 1YIKA 241LA 3P68A 1YKYX 3SB6A 4LDOA 2RAYX 5HMVA 3N9AA 1ZVHL 1GB0A 1LZDA 4KPMA 3G3BB 4J7VA 2H9KA 1L95A 3NY8A 1I20A 4YEOA 3UONA 1L33A 2ANVA 1IWUA 1D3MA 4LDEA 4GLVA 1SSYA 2MEDA 4GCDA 1IIZA 3A90A 4DQ7A 4WO9A 1HNLA 1JTPL 4HJVA 3P64A 3HFMY 4WL7A 1CV5A 2W1LA 2ZQ3A 130LA 4H90A 2B6WA 4LYCA 4W56A 4DKLA 1OP9B 4N5RA 4G9SA 2Z39A 2B75A 2YBJA 5E4PA 1NBYC 4N1CC 2VB1A 4XENA 1L21A 236LA 198LA 4LZTA 1G1WA 4J1BA 4I7QA 5ILCA 4NHSA 1G0PA 2LYZA 2F2QA 4W51A 1T8AA 1QT7A 1BWIA 3AGHA 1JQUA 2O79A 1L26A 1LHHA 1IY4A 1IO5A 1JTNA 3L64A 2BQGA 4P2EA 2BQOA 229LA 1C64A 1CV0A 2A4TA 214LA 1L14A 1LJEA 4ANRA 215LA 126LA 4QDNA 1QQYA 4IASA 5A3ZA 4LZMA 4NY5A 1LOZA 1PQJA 217LA 1L75A 4S0WA 3RU5A 4HV1A 3G3WA 3N9EA 143LA 1LZ9A 4I7SA 3CDOA 4TWSA 1I1ZA 1CJ7A 1V7TA 1DPWA 1QDRA 1GB7A 2DQHY 1B7SA 220LA 1XJTA 3AZ4A 1CKFA 2BQBA 1GAZA 1L17A 2OTYX 5KXLA 3TXIA 1BB5A 3TMUA 1GB8A 4TSBA 1XEPA 1F6RA 4ARQB 1QTBA 1D6QA 245LA 8LYZA 4NGOA 2F2NA 170LA 110LA 5IELA 5LA8A 2HEAA 147LA 3HTBA 4BAPA 1CKDA 1G0GA 4OO9A 1B5UA 3WW5A 2ZQ4A 4NWHA 4B49A 3HH4A 1EL1A 3B0KA 4LDLA 4U3XB 1XEIA 3AGGG 2RBSA 1T6HA 1TCYA 2F4AA 4E3UA 258LA 199LA 238LA 3C8RA 4PGJB 2XBRA 1WQPA 1BB6A 1B7MA 2BQDA 1L02A 4H9CA 1GE2A 4PK0A 4GRVA 3C7ZA 1C6QA 4HSFA 1CX6A 1JITA 2EIZC 1L96A 4BS7A 1GHLA 4WM4A 5ILFA 3FA0A 1RE2A 4I7PA 1LJKA 1NDGC 3M18B 3SBBC 1YROA 2HUKA 4H9HA 2B70A 4DDBA 3HUQA 3GUMA 3ODUA 1L32A 4EPIA 3A95A 1TEWA 4EKPA 1LJJA 4WLDA 173LA 3HBDA 1L63A 1LZYA 5LVGA 1IWVA 3ZVQB 4NHTA 172LA 1JJ3A 1DYFA 2RB1X 128LA 4ET9A 2ZYCA 1B7RA 4I8SA 1L83A 261LA 4AGAA 1GEVA 4PJZA 4XJDA 5KXMA 3F9LA 1LZGA 3TXJA 3HU8A 1LZ5A 3IWRA 4I7RA 3QAKA 1REMA 1OUDA 1HELA 196LA 4ML7A 3C8SA 1VDTA 1B7OA 1JTOL 1LZRA 3J6KA 5KXZA 1HHLA 160LA 4HV2A 1BHZA 4H94A 1OUAA 1C62A 1GFAA 3OK0A 1WQMA 1IWZA 4HP0A 4ETAA 2B72A 1DYAA 4PRQA 1YL1X 5AMYA 5LVIA 221LA 1D3JA 1YILA 1QTHA 1P2CC 1LSYA 1IWTA 2H5ZA 2Z12A 4NSJA 3RW8A 186LA 4IAPA 1HERA 5KXYA 2OE4X 1LYZA 4LYMA 2RBOA 2I6ZA 3HUAA 1GF4A 1NDMC 2DKVA 1L81A 3C8QA 5LYZA 1XGUC 1HFXA 262LA 149LA 1KXXA 1GFVA 184LA 1LYJA 4WOAA 5LAGA 4EKQA 4MSTA 1TLAA 2EPEA 2MEAA 1UBZA 4G4CA 1YQVY 5KKIA 5IHGA 2CJLA 3W3EA 3LYTA 4AQNA 3GUOA 2OU8A 1LKRA 1XSFA 1BQLY 2Q0MX 3TXGA 4RW2A 1LZBA 3SN6R 4NWEA 2RBNA 3LYMA 233LA 1CKHA 1EQEA 3WMKA 1QUOA 1OWZA 1P2RA 2IGCA 1CVKA 1LYHA 3DMVA 1HEQA 1GF9A 1L99A 4XJGA 2D6BA 3WPLA 3WW6A 3HH5A 1IC5Y 1L11A 1LYIA 1QT5A 250LA 1C7PA 4YX7C 1EPYA 4Z3MA 1REZA 1JKCA 4I7OA 1JJ0A 1P3NA 107LA 240LA 1VATA 140LA 1ZV5L 3LZMA 4ETEA 1LJFA 2MEEA 1L90A 1D9UA 5KXPA 1JUGA 3T6UA 132LA 2DQJY 1JPOA 2LYOA 135LA 1XEJA 1UICA 1GXXA 5LA5A 3D9AC 7LYZA 1CNSA 4WO6A 4FDYA 1CJ9A 226LA 1AM7A 3TXDA 1H6MA 3C81A 1P7SA 3QNGA 222LA 1L52A 191LA 4I7TA 1VDQA 1LSAA 4B4EA 2G4PA 2Z19A 4WM3A 2OE9X 1IP3A 1UIEA 1CU0A 2XQOA 3GULA 1L09A 1QUGA 2HEFA 1C61A 3WPKA 3K3TA 1L28A 1C6LA 216LA 1O23A 3OE0A 164LA 1C63A 1RI8B 2QARC 223LA 227LA 4H8ZA 4GLAA 1VFBC 3WU7A 1REYA 1DZBX 1IP1A 4NHPA 1L51A 1NHEA 1AT6A 3HH3A 5F16A 1XGTC 1T6VL 3IJVA 1QS9A 3W6BA 2Z38A 3ULRA 1JTTL 4ARJA 4D9ZA 1IR9A 3FI7A 2OE7X 3RT5X 1C6TA 1LMOA 1LHKA 4ARMA 1B5ZA 1IOQA 1WQQA 4L41A 2PC2A 5B1GA 1L69A 2DQAA 4G4BA 1OUIA 1LJ3A 4AXTA 5K7OA 5KXNA 4QY9A 5FHWA 1HEOA 1D6PA 3G3XA 4N0JA 3DMXA 4IATA 1DPXA 4NSHA 144LA 4W55A 1TBYA 154LA 4LFXA 1C6EA 1FLYA 2DQGY 4YEMA 169LA 200LA 3V2YA 3OE8A 4WM5A 5F9UA 1LSGA 2L78A 1C6IA 1OVHA 1CUQA 3ZEKA 4C5FA 1AKIA 3F8VA 3HDEA 4NSIA 4J0LA 3WXUA 5KXKA 1L47A 211LA 3W6EA 231LA 5FCPA 1KW7A 3C7WA 5A3EA 1L07A 2BQCA 3HU9A 3TXFA 112LA 1OWYA 1GF8A 5LINA 4LYTA 1UIBA 2BQEA 1HENA 4WLXA 171LA 246LA 2D4JA 3HT7A 152LA 4ETBA 3AJNA 1G1VA 1HFYA 3W6DA 1GDXA 1L73A 4KT3A 1BB7A 2RB2X 1L29A 1QUTA 1L98A 3J4GA 2BQLA 1JKAA 2RB0X 118LA 5LYTA 1QTDA 3D4SA 1JSFA 1CU3A 1LYOA 122LA 4NGZA 4LT1A 1NMMA 4WLTA 247LA 1QSWA 1L79A 4B4JA 1UIDA 3N9CA 1XGQC 2BQFA 1L38A 1LHJA 1XEKA 1QUSA 1RJCB 4GCFA 2MEIA 1LZ4A 1QSAA 3NYAA 1Z55A 3DMZA 3QE8A 1G0MA 2C8OA 2BQMA 4M6DA 141LA 5HNCA 3LN2A 4N1EI 4HPEA 4X3BA 4EKSA 5C6LA 2MEHA 3A3QA 1L94A 4LYBA 2B7XA 2F47A 1P64A 189LA 4W59A 4TUNA 5LVKA 1RFPA 139LA 4OWHA 159LA 3CSRA 192LA 1G7IC 1SX2A 1DYDA 1G0KA 5KY1A 133LA 5IDDA 4NGKA 111LA 1L54A 3P66A 1NBZC 1B9OA 1LWKA 2IFFY 1GB9A 1LMCA 3JR6A 1G07A 3CDTA 1BB3A 3BKVA 1L58A 2LYMA 4YF2A 1AZFA 4WM1A 1L56A 1WTHA 5LVHA 1T97A 2DQIY 1YANA 3DN1A 5LIOA 5KXSA 1FKQA 2Z2FA 1CV3A 3KAMA 1YAPA 1GBSA 2HUBA 1L68A 1DI5A 3LHMA 3RNXA 4I7LA 1C10A 2Z37A 1FLQA 1LYDA 3TXEA 4XJBA 5II3A 4NIJA 1LGUA 3G3AB 1CJ8A 2W1YA 161LA 4NGVA 1JTMA 2HULA 1YAQA 1QT6A 2CUUA 5KKJA 1OVKA 2RBRA 4LT0A 3QY4A 1OV7A 1L92A 251LA 4O34A 1GAYA 3HT8A 4WG7A 3A6BY 5LAFA 3CB7A 1QT4A 4YXCA 201LA 1UIHA 3RZ4A 2A7DA 1L34A 4ET8A 1L50A 3TXBA 2D91A 1B5WA 1LHIA 1GBYA 4MCKA 3CDQA 1HMLA 3GUNA 4H92A 5APEA 114LA 1L0JA 1C65A 4I7NA 1C6MA 2DQFC 1IP4A 5I4YA 1LMPA 2XBSA 190LA 1A2YC 2HU1A 1GFGA 3GUJA 1C66A 1LJHA 1HEWA 1L62A 4N9RA 175LA 2YBNA 1QT3A 1SLYA 1ZURA 3A3RX 3M3UA 138LA 1B7LA 4HJZA 1D2YA 1G7JC 2HEEA 1LZ8A 4PHIA 3WULA 1GFKA 4PRUA 1G0LA 3LYZA 1KXWA 2MECA 2Z6BA 3B72A 3EXDA 1P2LA 5LZMA 1YKZX 1N4FA 1V7SA 3VWOA 3FE0A 4XJIA 2EQLA 1WTNA 5KXTA 3WUAA 4EKRA 4WLYA 1HFZA 3PBLA 1B6IA 3EMSA 252LA 1GF7A 4NGYA 3NY9A 3FI5A 1CKCA 1QTZA 1ZVYB 1C67A 4GCEA 1G0JA 3CT1A 2W1MA 2F32A 2NTHA 1UA6Y 4ARMB 1IR7A 1L49A 4W94A 4GN3A 4W52A 1FN5A 1GPQC 4H8YA 4G49A 1BWJA 167LA 2LHMA 2RBPA 206LA 102LA 4OWEA 1GEZA 2BQAA 119LA 129LA 1GDWA 4LGKA 5L3HA 1REXA 1LZEA 187LA 1LKSA 1L57A 1L39A 1P46A 4W54A 1PQIA 2F4GA 4YM8A 207LA 1LSDA 1HF4A 5LYMA 1VDPA 4W57A 125LA 1C6PA 1G0QA 5APFA 123LA 4DDCA 3A8ZA 225LA 4B4IA 1C69A 3A34A 2HEDA 108LA 1GB2A 1JISA 193LA 257LA 2HECA 150LA 165LA 4KXIA 1NF5A 1LWGA 1CX7A 1DYEA 2BQJA 4DAJA 2BQHA 1LI2A 1CUPA 3DKEX 4PPOA 1GBXA 2RH1A 2HUMA 256LA 1OV5A 1LCNA 166LA 5I4XA 1OUEA 2LZTA 1IY3A 4I0CA 1L03A 1DI3A 1LZ6A 4I7MA 1GB5A 1LZSA 3L2XA 5FDJA 1IORA 4OWAA 1XJUA 2BPUA 3HWLA 4H9EA 1L04A 3TMXA 3V2WA 4LYZA 4EJ4A 3WUNA 3A94A 4PJ2C 1D3NA 1GFTA 253LA 3OE6A 163LA 1L05A 2YVBA 1QTCA 4DJHA 182LA 4NHIA 3P65A 1C6HA 137LA 1W08A 243LA 3HBEX 3WUMA 1GF5A 4GCCA 3PDSA 237LA 5T3FA 4XN6A 1L23A 2MEFA 1D3FA 4TX7A 5D5CA 1L88A 2C8PA 1WQRA 2B74A 1H87A 4RDSA 4DQJA 1IP7A 2BQKA 1GE1A 1BWHA 4GCBA 168LA 1LAAA 5L3IA 1L86A 2ZILA 4H93A 3W6FA 3AW6A 1B5VA 4G4HA 224LA 1LZNA 1C6JA 4WG1A 4ZEEA 142LA 213LA 1FBIX 5I54A 1OUGA 4Z98A 4ARLA 3DN0A 5B59A 1WTMA 4RW1A 153LA 1C45A 1B7PA 1GB6A 1NKHA 1GBWA 5DLAA 1LZAA 1YL0X 7LZMA 1UIGA 1B2KA 2BLXA 183LA 4NFVA 1EQ4A 2IHLA 3CSQA 3WXTA 6LZMA 1LZCA 4EMNA 2B6TA 2I25L 1D0MA 2LZMA 4UWNA 1QSBA 2RSCA 5D5FA 1JJ1A 2YBLA 194LA 2CGIA 2YSSC 228LA 1L24A 1C6AA 4H91A 1GFHA 1HC0A 1P6YA 4LFPA 2G4QA 1L71A 1L48A 2G4NA 1LSNA 3ATOA 3C80A 4YXAC 3WU8A 1OVJA 2OU9A 3HTGA 212LA 4HJYA 5B06A 3HTDA 2B6XA 1DYGA 4FJRA 5FEKA 3DN8A 4J1AA 1CV6A 4WM2A 242LA 1C68A 1LYFA 178LA 1D9WA 2BQNA 1DKJA 1LMTA 1TDYA 1KY0A 1OYUA 1OQMA 1QUDA 4LT2A 2MEBA 5KXXA 205LA 1LJ4A 1L22A 1GF0A 1OUCA 197LA 1L59A 3EBAB 2ZIKA 2YBHA 3LZ2A 4M4OA 1GE4A 4A7DA 1PQKA 4NSGA 3CQLA 1C43A 1C08C 1F0WA 1JWRA 4NGIA 1BGIA 1IWWA 3DN4A 244LA 1INUA 1L25A 1J1OY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A4V A;  1B7O A;  1DI5 A;  1JTO L;  3LHM A;  5HNL A;  1LZR A;  2DBT A;  1C10 A;  1F6S A;  3J6K A;  2Z37 A;  5KXZ A;  1HHL A;  3RNX A;  2AUB A;  4DD1 A;  3SP3 A;  4HV2 A;  1FLQ A;  3TXE A;  1GWD A;  1BHZ A;  4H94 A;  4XJB A;  3WVY A;  3WL2 A;  1WQO A;  4H9B A;  3F6Z A;  4NIJ A;  5II3 A;  1OUA A;  4XJF A;  4CGE A;  4R0F A;  1GFA A;  3OK0 A;  1PS5 A;  3G3A B;  1CJ8 A;  2W1Y A;  1WQM A;  4NGV A;  1IWZ A;  1LSM A;  4HP0 A;  4XYY A;  4ETA A;  1XGR C;  4PRQ A;  1YAQ A;  1YL1 X;  5AMY A;  5LVI A;  5KKJ A;  1KXY A;  1F10 A;  2FYC A;  1YIL A;  1B5Y A;  3AW7 A;  2ZWB A;  3QY4 A;  4HPI A;  1LSF A;  4LT0 A;  5C6I A;  4CJ2 A;  5KXW A;  1IP2 A;  1FLW A;  1IEE A;  4KL7 A;  4O34 A;  1P2C C;  1GAY A;  2ZNW Y;  1FDL Y;  5DM9 A;  1LSY A;  1FLU A;  1IWT A;  1LPI A;  2H5Z A;  1GE3 A;  1OUB A;  4C3W A;  1JEF A;  2Z12 A;  4NSJ A;  4LYO A;  4WG7 A;  3RW8 A;  5KXR A;  3A6B Y;  5B1F A;  1IP6 A;  2GV0 A;  2H9J A;  1HER A;  2ZNX Y;  5LAF A;  1LSB A;  3CB7 A;  5KXY A;  3BKH A;  1LYZ A;  3HBH A;  1YAM A;  4LYM A;  3ZVQ A;  1MLC E;  2FBD A;  1DKK A;  2I6Z A;  1GF4 A;  3AZ6 A;  1NDM C;  2DKV A;  5EBH A;  1UIH A;  3RZ4 A;  2A7D A;  4ET8 A;  4ZIX A;  5LYZ A;  1XGU C;  1HFX A;  1UAC Y;  1G7H C;  1KXX A;  1LMN A;  4OW1 A;  1HSW A;  1GFV A;  1QTK A;  3TXB A;  2D91 A;  4WOA A;  1B5W A;  5LAG A;  1LHI A;  1RCM A;  1GBY A;  4MST A;  1LYY A;  2EPE A;  2FYD A;  2MEA A;  4H9F A;  1GBO A;  1ZMY L;  4MCK A;  1IOT A;  3AZ5 A;  4IJ4 A;  1UBZ A;  2D4K A;  1HML A;  1HEM A;  4G4C A;  1YQV Y;  5KKI A;  5F9X A;  4H92 A;  2CWI A;  5APE A;  4NG8 A;  5F14 A;  2HU3 A;  1GD6 A;  5APC A;  5HQ1 A;  5IHG A;  3WH1 A;  2CJL A;  2F30 A;  3W6C A;  2DQF C;  9LYZ A;  1IP4 A;  3W3E A;  4DD7 A;  3LYT A;  4HTQ A;  2WAR A;  5I4Y A;  2Z18 A;  1LKR A;  3A96 A;  1LMP A;  1XSF A;  1BQL Y;  2XBS A;  1A2Y C;  2HU1 A;  1GFG A;  2Q0M X;  1C46 A;  3TXG A;  4RW2 A;  1HEP A;  1LZB A;  4OWB A;  2YBM A;  4OWC A;  1GFR A;  1NQI A;  4NGI A;  4NWE A;  5DL9 A;  5KXO A;  3LYM A;  1CKH A;  1LJH A;  1EQE A;  1HEW A;  1UIF A;  3AZ7 A;  3MGW A;  3WMK A;  4R6C A;  4ZFP A;  4NGL A;  1GF3 A;  5HLL A;  1HEQ A;  1GF9 A;  2N5Z A;  3W6A A;  4XJH A;  2YDG A;  2D6B A;  4XJG A;  4N9R A;  2YBN A;  3TMV A;  3WPL A;  3WW6 A;  5F81 A;  5HMJ A;  1BB4 A;  3LYO A;  2NWD X;  3ATN A;  1IC5 Y;  1SLY A;  3WYH A;  5J7C A;  1LSP A;  3A3R X;  3M3U A;  1LSZ A;  4Z41 A;  1LHL A;  2A7F A;  4LT3 A;  1B7L A;  4HJZ A;  1C7P A;  1G7J C;  1QTE A;  4Z3M A;  1LJI A;  1DXJ A;  3B0O A;  2HEE A;  1LZ8 A;  1JKB A;  1CKG A;  4PHI A;  4YOP A;  3WUL A;  4DC4 A;  1GFK A;  1REZ A;  1JKC A;  5M1Y A;  5FEL A;  1WVU A;  4PRU A;  1JJ0 A;  2HEB A;  1NWG A;  3LYZ A;  1VAT A;  6LYZ A;  1KXW A;  2MEC A;  4QEQ A;  1LJN A;  4WM6 A;  1ZV5 L;  4ETE A;  3D3D A;  4DYG A;  1LJF A;  2MEE A;  2DQD Y;  1IR8 A;  3B72 A;  3EXD A;  4H1P A;  1YKZ X;  1N4F A;  1D9U A;  5KXP A;  1JUG A;  1V7S A;  3T6U A;  132L A;  3VWO A;  3FE0 A;  1B0D A;  1IWX A;  1G7M C;  1JPO A;  2DQJ Y;  2EQL A;  4XJI A;  3TXK A;  2LYO A;  2MEG A;  3A67 Y;  1WTN A;  3A92 A;  5KXT A;  3WUA A;  4HTK A;  4WLY A;  135L A;  1XEJ A;  1HFZ A;  4II8 A;  1UIC A;  4BAD A;  1G7L C;  2CDS A;  1GXX A;  3E3D A;  4TTD A;  1W6Z A;  5LA5 A;  3EMS A;  4HTN A;  1IWY A;  1QIO A;  1GF7 A;  2X0A A;  1GXV 2;  3D9A C;  4NGY A;  1CKC A;  6LYT A;  1WVV A;  7LYZ A;  1LYS A;  4OOO A;  1ZVY B;  1UIA A;  1CNS A;  4WO6 A;  208L A;  4FDY A;  1CJ9 A;  1ALC A;  1KIQ C;  3CT1 A;  1GE0 A;  2W1M A;  1AM7 A;  1KIP C;  4GCE A;  4TSC A;  4ETC A;  3TXD A;  1UA6 Y;  1IR7 A;  4W94 A;  4GN3 A;  1H6M A;  1LJG A;  4CHX A;  1YIK A;  3P68 A;  1VAU A;  1YKY X;  1XFP L;  3QNG A;  1FN5 A;  1GPQ C;  1ZVH L;  3N9A A;  5HMV A;  1GB0 A;  1VDQ A;  1BWJ A;  1LZD A;  4G49 A;  4H8Y A;  2BAA A;  1LSA A;  3OJP A;  4KPM A;  5DN4 A;  5B07 A;  2LHM A;  3G3B B;  4J7V A;  4B4E A;  4OWE A;  2H9K A;  1GEZ A;  1I20 A;  2G4P A;  2Z19 A;  4YEO A;  2BQA A;  4WM3 A;  1IP3 A;  1UIE A;  1GDW A;  2B5Z A;  4LGK A;  5L3H A;  1YAO A;  1REX A;  1IWU A;  5C6J A;  1GFE A;  1LZE A;  1LKS A;  2DQC Y;  2I26 L;  4OOT A;  2HEF A;  4GLV A;  4GCD A;  2MED A;  1IIZ A;  2F4G A;  4YM8 A;  3WPK A;  207L A;  5D5F A;  3A90 A;  1D0K A;  1LSD A;  1HF4 A;  4WO9 A;  1VDP A;  5LYM A;  1HNL A;  1JTP L;  4HJV A;  3K3T A;  3P64 A;  5B05 A;  1JSE A;  1MEL L;  1IX0 A;  2W1L A;  3HFM Y;  4WL7 A;  5APD A;  1PZY A;  1WQN A;  5APF A;  4DDC A;  2ZQ3 A;  4H90 A;  3A91 A;  3IJU A;  3A8Z A;  4LYC A;  4B4I A;  4H9A A;  4BAF A;  4Z46 A;  1JHL A;  1O23 A;  4NGJ A;  2BQI A;  3A34 A;  1OP9 B;  2HED A;  4N5R A;  4G9S A;  5JEN B;  1RI8 B;  1HSX A;  1BVK C;  2Z39 A;  1GB2 A;  1JIS A;  5I53 A;  2YBJ A;  193L A;  4H8Z A;  1LSE A;  4GLA A;  5E4P A;  1VFB C;  1NBY C;  3WU7 A;  1REY A;  2HEC A;  4N1C C;  3TXH A;  1B7N A;  2VB1 A;  4KXI A;  4XEN A;  3WPJ A;  1DZB X;  1IP1 A;  1NF5 A;  4NHP A;  4LZT A;  4J1B A;  1NHE A;  1AT6 A;  3EO5 A;  5F16 A;  5ILC A;  4NHS A;  1XGT C;  1T6V L;  2BQJ A;  2LYZ A;  4DDA A;  3IJV A;  4UWV A;  2BQH A;  1DQJ C;  1OUJ A;  4PPO A;  3W6B A;  3AYQ A;  4QGZ A;  1GBX A;  2Z38 A;  3ULR A;  1JTT L;  4W96 A;  4D9Z A;  1IR9 A;  3FI7 A;  4NHQ A;  4DWX A;  1LCN A;  3RT5 X;  3TMW A;  1LMO A;  5I54 A;  5I4X A;  1BWI A;  3AGH A;  1OUE A;  2LZT A;  1IY3 A;  1LHK A;  1B5Z A;  1IOQ A;  1LHH A;  1IY4 A;  1IO5 A;  1WQQ A;  4I0C A;  4L41 A;  1DI3 A;  2BQG A;  2PC2 A;  2LZ2 A;  1IC4 Y;  2BQO A;  4P2E A;  1LZ6 A;  4CFP A;  1GB5 A;  1LZS A;  5FDJ A;  1IOR A;  5I5Q A;  3P4Z A;  4OWA A;  5B1G A;  3A6C Y;  1IC7 Y;  2DQA A;  4G4B A;  1OUI A;  1LJ3 A;  2BPU A;  4AXT A;  5K7O A;  5KXN A;  1J1P Y;  1LJE A;  4ANR A;  4H9E A;  5FHW A;  4QY9 A;  4QDN A;  1HEO A;  1D6P A;  4N0J A;  3TMX A;  1QQY A;  3CSZ A;  4IAT A;  3CT5 A;  1VED A;  4IAS A;  1DPX A;  1QDT A;  4LYZ A;  4NSH A;  5A3Z A;  1KIR C;  1TBY A;  4NY5 A;  1LOZ A;  3WUN A;  154L A;  3A94 A;  4PJ2 C;  4LFX A;  1GFT A;  4NG1 A;  3RU5 A;  4HV1 A;  1JIY A;  2YVB A;  1FLY A;  1GB3 A;  2DQG Y;  4YEM A;  3N9E A;  1LZ9 A;  2EKS C;  4NHI A;  4TWS A;  1BVX A;  1I1Z A;  1CJ7 A;  1V7T A;  1DPW A;  3P65 A;  1QDR A;  4WM5 A;  1GB7 A;  2DQH Y;  1GFU A;  5F9U A;  1LSG A;  1B7S A;  3ZEK A;  4C5F A;  2DQE Y;  1AKI A;  4NSI A;  1W08 A;  4J0L A;  3WXU A;  4MR1 A;  5KXK A;  1IVM A;  3HBE X;  4GN5 C;  3W6E A;  1LHM A;  3WUM A;  4B1A A;  1GF5 A;  4WMG A;  1LZ1 A;  5FCP A;  3AZ4 A;  1CKF A;  1EQ5 A;  1E8L A;  1DI4 A;  4GCC A;  1I56 A;  5A3E A;  1YKX X;  2BQB A;  4DD3 A;  1GAZ A;  5T3F A;  5KXL A;  4XN6 A;  2BQC A;  1TAY A;  2MEF A;  3TXI A;  1BB5 A;  3TMU A;  1GB8 A;  3TXF A;  4TSB A;  3AB6 A;  4TX7 A;  1GF8 A;  5LIN A;  1AT5 A;  4LYT A;  2ZYP A;  5D5C A;  4N8Z A;  2BLY A;  1UIB A;  2C8P A;  2BQE A;  1F6R A;  5LXW A;  1WQR A;  1HEN A;  1H87 A;  4RDS A;  4WLX A;  1LMA A;  5FST A;  3T36 A;  1D6Q A;  2Z2E A;  8LYZ A;  2D4J A;  1LSC A;  5KJ9 A;  4NGO A;  1IP7 A;  2BQK A;  1GE1 A;  4ETB A;  1BWH A;  3AJN A;  4RLN A;  4H8X A;  1HMK A;  4GCB A;  2F2N A;  1HFY A;  1LAA A;  4XAD A;  3W6D A;  5L3I A;  1GDX A;  5IEL A;  4KT3 A;  1BB7 A;  2HEA A;  1GFJ A;  2ZIL A;  5LA8 A;  4H93 A;  3W6F A;  1LTM A;  3LZT A;  1QUT A;  4BAP A;  3AW6 A;  4ETD A;  1IP5 A;  3J4G A;  2BQL A;  1B5V A;  4G4H A;  1CKD A;  1LZN A;  3WU9 A;  1JKA A;  4WG1 A;  3WVX A;  4ZEE A;  1B5U A;  5LYT A;  3WW5 A;  5L9J A;  2ZQ4 A;  1FBI X;  1JSF A;  4NWH A;  1LZT A;  1OUG A;  4UWU A;  4Z98 A;  4DT3 A;  1LYO A;  4B49 A;  4NGZ A;  5B59 A;  1EL1 A;  3B0K A;  1WTM A;  4RW1 A;  4U3X B;  1XEI A;  4LT1 A;  1NMM A;  3A93 A;  1C45 A;  153L A;  3AGG G;  2F4A A;  1TCY A;  4WLT A;  4E3U A;  1B7P A;  1GB6 A;  1QSW A;  1UC0 A;  1NKH A;  4B4J A;  1UID A;  2YBI A;  134L A;  1GBW A;  1XGQ C;  1LZA A;  1YL0 X;  2BQF A;  3N9C A;  5DLA A;  1LHJ A;  1UIG A;  1B2K A;  1XEK A;  2BLX A;  1QUS A;  2ZIJ A;  4NFV A;  4PGJ B;  1RJC B;  5LVJ A;  2XBR A;  1EQ4 A;  2IHL A;  4GCF A;  1WQP A;  1BB6 A;  1B7M A;  3CSQ A;  2MEI A;  1LZ4 A;  2BQD A;  1QSA A;  4DD0 A;  5E9R A;  3WXT A;  4H9C A;  1Z55 A;  1LZC A;  1UCO A;  3QE8 A;  1GE2 A;  4EMN A;  1CJ6 A;  2I25 L;  2C8O A;  5I4W A;  1D0M A;  1XGP C;  4UWN A;  2RSC A;  2BQM A;  2EIZ C;  1JIT A;  1JJ1 A;  2YBL A;  194L A;  2CGI A;  2YSS C;  4HSF A;  4M6D A;  4BS7 A;  5HNC A;  3LN2 A;  4N1E I;  4HPE A;  1GHL A;  3AGI A;  4B0D A;  4H91 A;  4WM4 A;  5ILF A;  1GFH A;  2XJW A;  1HC0 A;  4LFP A;  4X3B A;  2G4Q A;  1RE2 A;  1GF6 A;  2G4N A;  1LSN A;  3ATO A;  1VDS A;  1LJK A;  2W1X A;  5C6L A;  1NDG C;  3WU8 A;  5DN5 A;  2MEH A;  3M18 B;  4DD9 A;  1YRO A;  2D4I A;  3A3Q A;  4LYB A;  4H9H A;  4TUN A;  1OUH A;  1GBZ A;  1RFP A;  5LVK A;  4DDB A;  4HJY A;  5B06 A;  3CT0 A;  4YEN A;  1SQ2 L;  1FKV A;  1IOC A;  3A95 A;  1TEW A;  4FJR A;  4OWH A;  5FEK A;  1LJJ A;  4J1A A;  4WLD A;  4DD2 A;  3CSR A;  4WM2 A;  1G7I C;  3HBD A;  5KY1 A;  1LZY A;  133L A;  5LVG A;  5IDD A;  4NGK A;  1IWV A;  3ZVQ B;  1IOS A;  4NHT A;  2FBB A;  1JJ3 A;  1DKJ A;  1LMT A;  1TDY A;  2BQN A;  1OQM A;  1B5X A;  3P66 A;  1NBZ C;  1B9O A;  4LT2 A;  2ZYC A;  1B7R A;  1J1X Y;  2MEB A;  4I8S A;  4ET9 A;  5KXX A;  4AGA A;  1D0L A;  4CFO A;  4RLM A;  1LJ4 A;  2IFF Y;  1GB9 A;  1GEV A;  1LMC A;  1GF0 A;  4XJD A;  1OUC A;  3B6L A;  3EBA B;  5KXM A;  4EOF A;  2HTX A;  2XTH A;  1BB3 A;  2ZIK A;  2YBH A;  3BKV A;  3LZ2 A;  1LMQ A;  2LYM A;  1GE4 A;  1AZF A;  1LZG A;  3TXJ A;  4YF2 A;  4M4O A;  1JKD A;  1LZ5 A;  3GXR A;  4WM1 A;  4A7D A;  5LVH A;  1UUZ C;  2DQI Y;  3GXK A;  3IWR A;  4H9I A;  4NSG A;  4WL6 A;  1YAN A;  3CQL A;  1REM A;  1C43 A;  1OUD A;  4NGW A;  1T3P A;  5LIO A;  1HEL A;  1C08 C;  4NEB A;  1F0W A;  1B7Q A;  5KXS A;  1FKQ A;  1JWR A;  3B0I A;  2Z2F A;  1BGI A;  1IWW A;  3KAM A;  4GN4 A;  4ML7 A;  1YAP A;  1GBS A;  1VDT A;  1INU A;  1OUF A;  2Y8P A;  2HUB A;  1J1O Y; 
#chains in the Genus database with same CATH topology
 1A4V A;  4R7G A;  5HNL A;  1F6S A;  4DQ5 A;  2DVW B;  3FUX A;  1T8G A;  3U6S A;  1PQM A;  1GWD A;  1NJF A;  1WQO A;  4NRW A;  1L89 A;  1I94 M;  4XJF A;  4CGE A;  4R0F A;  2L09 A;  3FRH A;  4LGM A;  5LMU M;  1LSM A;  1R6B X;  180L A;  1XGR C;  1CTW A;  1ZWN A;  1L77 A;  1F10 A;  5H37 D;  5C6I A;  2K0B X;  148L E;  1LSF A;  2AHM A;  5KXW A;  1QQW A;  1FLW A;  4AI6 A;  1IEE A;  1QS5 A;  2RGH A;  4KL7 A;  4G6Z A;  2ZNW Y;  1L06 A;  3JR4 A;  1GE3 A;  1QUH A;  4C3W A;  4LYO A;  1VDL A;  1IP6 A;  2GV0 A;  1L19 A;  1IN4 A;  4ZPU A;  2LHC A;  1L53 A;  3BKH A;  3GUP A;  1CV1 A;  3UJN A;  3HBH A;  1L1Z A;  2B6Y A;  1MLC E;  4DR6 M;  2Z8Y M;  3AZ6 A;  2B73 A;  1QZE A;  5EBH A;  3PFI A;  3HHY A;  1CU2 A;  1LI6 A;  1L64 A;  1DGH A;  1UAC Y;  1G7H C;  4OW1 A;  1QTK A;  2N35 A;  2QQ8 A;  2OEA X;  1RCM A;  4DV5 M;  1K28 A;  2FYD A;  1DO2 A;  1Q02 A;  1L31 A;  1GBO A;  1FNN A;  4H9F A;  2O7A A;  1L46 A;  1L36 A;  2D4K A;  3KFU G;  174L A;  1LW9 A;  2CWI A;  2Q9E A;  5F14 A;  1HQC A;  5APC A;  3WH1 A;  2F30 A;  185L A;  2WAR A;  1L80 A;  3A96 A;  5IT9 S;  1KY1 A;  4OWB A;  4OWC A;  3KSX A;  4HL4 A;  1GFR A;  1LGX A;  5DL9 A;  3K2R A;  4I7K A;  5KXO A;  4ZFP A;  3AZ7 A;  1UIF A;  3U5Z A;  3HHZ A;  4NGL A;  5HLL A;  3HT6 A;  2JXN A;  2YDG A;  3TMV A;  1PQD A;  1BB4 A;  2NWD X;  1L20 A;  234L A;  5J7C A;  2J7O A;  1G41 A;  1LSP A;  3A98 B;  3VK8 A;  4Z41 A;  1LHL A;  2A7F A;  4LT3 A;  1DO0 A;  4Q7J A;  1LI3 A;  3C83 A;  151L A;  4MGH A;  1SWZ A;  3G3V A;  3B0O A;  1CKG A;  4YOP A;  5M1Y A;  5FEL A;  1WVU A;  3HTF A;  2QPA A;  4W58 A;  1C1K A;  1L60 A;  2RGO A;  4WM6 A;  1G59 A;  1IQP A;  4W53 A;  4DYG A;  4MGI E;  1L2C A;  1IR8 A;  2EO2 A;  4NC6 A;  3DOA A;  8CAT A;  3GPY A;  3VFD A;  115L A;  3L27 A;  1TR8 A;  1B0D A;  1IWX A;  1G7M C;  4BLC A;  1R4G A;  1PQO A;  4HTK A;  3MHV C;  1E32 A;  210L A;  1L35 A;  4BAD A;  1GVN A;  3J81 S;  1N36 M;  1L8Q A;  2CDS A;  1L84 A;  3GLF A;  1W6Z A;  2R4E A;  1P36 A;  1IWY A;  4IIW A;  4DV3 M;  2X0A A;  1GXV 2;  6LYT A;  1WVV A;  1LYS A;  3U6C A;  1P5C A;  1UIA A;  208L A;  5ITX E;  188L A;  3CDV A;  1KIQ C;  4ETC A;  1GE0 A;  1KIP C;  4TSC A;  3DNA A;  4XK8 F;  1C60 A;  1VAU A;  1XFP L;  4R71 A;  1J5E M;  1CUK A;  3K92 A;  2OU0 X;  5B07 A;  5DN4 A;  3Q8G A;  1L00 A;  2BAA A;  4LF4 M;  1XHB A;  3OJP A;  3GRU A;  4LZZ A;  4HEO A;  1L18 A;  2B5Z A;  4JN6 A;  3B7Q A;  235L A;  4AW4 A;  1YAO A;  5C6J A;  1GFE A;  3U61 B;  1EIJ A;  2DWZ B;  1KS3 A;  1L15 A;  2DQC Y;  2ANX A;  2I26 L;  4OOT A;  1NV9 A;  4AG6 A;  3EIE A;  239L A;  1GKI A;  1CV4 A;  1D0K A;  1L0K A;  4L4U A;  5B05 A;  1OFI A;  1VEG A;  1SXJ D;  2M5Z A;  2QBY B;  1JSE A;  1MEL L;  1IX0 A;  2HHH M;  5APD A;  1QZM A;  1PZY A;  1SSW A;  1WQN A;  254L A;  3A91 A;  3DN2 A;  3IJU A;  2WSE F;  1DYB A;  1SWY A;  1L93 A;  4H9A A;  4BAF A;  4Z46 A;  3CTW B;  1JHL A;  2Y0Q A;  4NGJ A;  2BQI A;  1PJQ A;  4PCZ A;  1L61 A;  1LPY A;  1L2B A;  5JEN B;  1HSX A;  1BVK C;  2NTG A;  5I53 A;  2LVA A;  3E9S A;  1LSE A;  1MN3 A;  4L15 A;  3J7A S;  1CU6 A;  2KRK A;  2DWN A;  3TXH A;  1B7N A;  2D7G A;  5I14 A;  1L65 A;  3WPJ A;  4CIZ A;  3U6D A;  4LF9 M;  3AOE A;  3UMM A;  3EO5 A;  3HU2 A;  1C7Y A;  248L A;  2CHV A;  1QT8 A;  3EML A;  4LJ5 A;  4DDA A;  2RBQ A;  4UWV A;  3ZCB B;  2CRU A;  1DQJ C;  1OUJ A;  3AYQ A;  4QGZ A;  4W96 A;  3FTC A;  4NHQ A;  4DWX A;  3TMW A;  2O4W A;  1OAI A;  4ARP A;  2H1R A;  3TWK A;  1L13 A;  3BBZ A;  4CFP A;  127L A;  1IC4 Y;  2LZ2 A;  3M6A A;  2R45 A;  5I5Q A;  3FE3 A;  3P4Z A;  3A6C Y;  1L97 A;  1IC7 Y;  4Z6Y A;  3SB8 A;  146L A;  2R65 A;  158L A;  2DNA A;  3W0F A;  3VW7 A;  1J1P Y;  2QCU A;  1JR3 E;  3CSZ A;  1J7K A;  3CT5 A;  1VED A;  1QDT A;  1KIR C;  1L87 A;  2CP8 A;  230L A;  4NG1 A;  3CDR A;  1JIY A;  249L A;  3HDF A;  1GB3 A;  131L A;  1LLH A;  4NL4 H;  2EKS C;  4EIW A;  1NY6 A;  1XXH E;  1T43 A;  5FTN A;  1DYC A;  1BVX A;  3TWL A;  2F5S A;  1GFU A;  1GL6 A;  3RZE A;  2DQE Y;  4MR1 A;  1IVM A;  4GN5 C;  4DR5 M;  1R2Z A;  1IBK M;  1LHM A;  4B1A A;  3FAD A;  4YY3 M;  1LZ1 A;  4WMG A;  3H4J A;  1EQ5 A;  1E8L A;  1DI4 A;  1I56 A;  1YKX X;  1LGW A;  4DD3 A;  2HWJ A;  2JY5 A;  1TAY A;  1YSY A;  1L66 A;  4I7J A;  3AB6 A;  1AT5 A;  1L1T A;  255L A;  2ZYP A;  4N8Z A;  2BLY A;  2Q9D A;  3RUN A;  4JI6 M;  3M7G A;  4GKJ M;  3GLI A;  5LXW A;  1L30 A;  5FST A;  1LMA A;  3T36 A;  2Z2E A;  1OAO C;  4GC9 A;  1LSC A;  5KJ9 A;  1YUB A;  2BWB A;  2UXB M;  176L A;  3FYC A;  4RLN A;  259L A;  4H8X A;  1HMK A;  1C6N A;  4LJ9 A;  4XAD A;  2MGW A;  1L76 A;  3GUI A;  1GFJ A;  2Z7J A;  218L A;  1C6C A;  4IBI A;  3CF2 A;  1LTM A;  3LZT A;  4ETD A;  1IP5 A;  3M0E A;  3SB7 A;  3WVX A;  3WU9 A;  2DZL A;  5L9J A;  4DT3 A;  1LZT A;  4UWU A;  1HR0 M;  1IM2 A;  1AUA A;  3A93 A;  1Q3B A;  2CUZ A;  1L16 A;  1HT1 E;  4LJA A;  1UC0 A;  1X37 A;  4L16 A;  5FLX S;  2QB0 B;  4E97 A;  1LYE A;  232L A;  2YBI A;  134L A;  1L41 A;  209L A;  1Z6T A;  4GIT A;  1IY2 A;  2ZIJ A;  1XXH B;  1AIP C;  3KS4 A;  1C6K A;  5LVJ A;  1P56 A;  1L44 A;  4LY6 A;  4DD0 A;  5E9R A;  2CV0 A;  4D81 A;  1UCO A;  3HUK A;  1CJ6 A;  1L01 A;  145L A;  5I4W A;  3U6L A;  3E46 A;  1XGP C;  113L A;  4DUY M;  2KRU A;  3AGI A;  157L A;  1LYG A;  4B0D A;  3GQ3 A;  2XJW A;  2EKK A;  1GF6 A;  3QYE A;  2EA0 A;  1VDS A;  2W1X A;  195L A;  1L42 A;  1D2W A;  5DN5 A;  4DD9 A;  2D4I A;  1Y8G A;  4DR2 M;  1T8F A;  4ARQ A;  2GQF A;  2HL7 A;  3ZQJ A;  1IN8 A;  4LF7 M;  1OUH A;  1GBZ A;  2X8A A;  3GLH A;  2V1C A;  3CT0 A;  4YEN A;  1SQ2 L;  1FKV A;  4G4O A;  1IOC A;  4DD2 A;  1HNW M;  4NSR A;  3DZD A;  1BVS A;  1IY1 A;  103L A;  1IOS A;  2FBB A;  2F4V M;  3GLF E;  1DGH B;  1B5X A;  3RE8 A;  1J1X Y;  1D0L A;  4CFO A;  4RLM A;  4MH0 E;  2UUB M;  1G06 A;  3HU3 A;  3B6L A;  4EOF A;  2HTX A;  2XTH A;  2EJS A;  3NBI A;  1LMQ A;  3HH6 A;  1L55 A;  1JKD A;  3GXR A;  1NVM A;  1UUZ C;  3GXK A;  4H9I A;  3HGI A;  1L70 A;  4WL6 A;  120L A;  4NGW A;  1T3P A;  177L A;  3B89 A;  156L A;  1L40 A;  2WZJ A;  4NEB A;  1B7Q A;  3B0I A;  4GN4 A;  3KOX E;  1OUF A;  1IXR C;  2Y8P A;  4B08 A;  2YFQ A;  1L91 A;  2DBT A;  3U5Z B;  4FWG A;  4DD1 A;  2AUB A;  1C6D A;  1CU5 A;  3SP3 A;  1L08 A;  155L A;  3C82 A;  3WVY A;  3WL2 A;  4K5Y A;  4JI1 M;  4H9B A;  3F6Z A;  1VG5 A;  1Q3C A;  1L12 A;  104L A;  1PS5 A;  2KA6 B;  3CGW A;  4XYY A;  3AL0 C;  1VDD A;  3SBA A;  3GPP A;  1KXY A;  2FYC A;  4HPI A;  1B5Y A;  3AW7 A;  2ZWB A;  4CJ2 A;  1IP2 A;  3C3D A;  1L74 A;  1FDL Y;  1QAM A;  1Z5B A;  3FRI A;  1P3Q Q;  3GUK A;  5DM9 A;  1FLU A;  3FUV A;  1LPI A;  4PT5 A;  1JB0 F;  4TUW A;  1OUB A;  1JEF A;  5KXR A;  5B1F A;  3A46 A;  2H9J A;  2ZNX Y;  1V33 A;  1SXJ E;  5EXT A;  1PJS A;  4JI0 M;  4FCT A;  1LSB A;  1YAM A;  1L37 A;  1L43 A;  3ZVQ A;  2FBD A;  1DKK A;  5EQT A;  3SMP A;  2QZ4 A;  4ZIX A;  2O5R A;  2Z4S A;  1LMN A;  1HSW A;  3GLF B;  3SB5 A;  1NHB A;  1LYY A;  1ZMY L;  1I4W A;  1IOT A;  3AZ5 A;  4IJ4 A;  181L A;  1HEM A;  5F9X A;  4LJ7 A;  4EXM A;  4NG8 A;  1PRB A;  2HU3 A;  4GBR B;  1GD6 A;  5HQ1 A;  3HJQ A;  1IY0 A;  1K3W A;  3W6C A;  1KW5 A;  9LYZ A;  4DD7 A;  2QSF X;  4HTQ A;  1SG9 A;  2Z18 A;  1P37 A;  162L A;  1L10 A;  1C46 A;  1HEP A;  1L67 A;  2YBM A;  1NQI A;  1L85 A;  1N75 A;  1ZYT A;  1L82 A;  3MGW A;  4R6C A;  2ZM6 M;  1GF3 A;  2C99 A;  2N5Z A;  3W6A A;  4XJH A;  3SHG B;  1KNI A;  4GIP A;  3FUT A;  3FTD A;  5F81 A;  5HMJ A;  1JR3 D;  4GHA A;  3LYO A;  4EPF A;  3ATN A;  3WYH A;  5F3W A;  2LC9 A;  1QTV A;  1LSZ A;  3Q8X A;  1C6G A;  5IRE B;  1C6F A;  2DHR A;  2KNZ A;  3OE9 A;  1QTE A;  1LJI A;  1DXJ A;  1J1O Y;  1L45 A;  3C7Y A;  1JKB A;  4DC4 A;  2MRO B;  2F5O A;  1QSQ A;  2LCB A;  2HEB A;  1NWG A;  1ZMU A;  6LYZ A;  4JV5 M;  4QEQ A;  1LJN A;  2EKF A;  3D3D A;  3HT9 A;  2DQD Y;  2C9O A;  3FTE A;  109L A;  1L72 A;  4H1P A;  3B9P A;  2JY7 A;  1SXJ B;  1SX7 A;  2FNA A;  3TXK A;  3DN3 A;  2MEG A;  3A67 Y;  3A92 A;  4NSO B;  4FCW A;  1C6B A;  4D82 A;  4II8 A;  1I6S A;  1G7L C;  4M0W A;  2KDL A;  3E3D A;  4DV2 M;  4TTD A;  4HTN A;  4XBO A;  1L27 A;  4DR4 M;  1QIO A;  3SB9 A;  2RAZ X;  3DN6 A;  3VDP A;  4OOO A;  5BR8 M;  260L A;  1ALC A;  1UFZ A;  1WHC A;  3HWS A;  219L A;  1T6O A;  3PXG A;  4PDG A;  2B6Z A;  1LJG A;  2OTZ X;  4CHX A;  1YIK A;  241L A;  3P68 A;  1YKY X;  3SB6 A;  4LDO A;  3IG8 A;  2RAY X;  3I04 M;  1W5T A;  1ZVH L;  3N9A A;  5HMV A;  1GB0 A;  1LZD A;  4KPM A;  3G3B B;  4J7V A;  4GRI A;  4B3M M;  1L95 A;  2H9K A;  1I20 A;  3NY8 A;  4YEO A;  3FTF A;  3UON A;  1L33 A;  4B3R M;  2ANV A;  4IBG A;  3B74 A;  2XSZ A;  1IWU A;  4LGY A;  1D3M A;  3C9P A;  4LDE A;  4GLV A;  1SSY A;  2MED A;  4GCD A;  1IIZ A;  4BBA A;  2UUC M;  5D5F A;  3A90 A;  4DQ7 A;  4WO9 A;  1G3I A;  2DAM A;  1HNL A;  1JTP L;  4HJV A;  2A5Y B;  3P64 A;  3U60 B;  3HFM Y;  4WL7 A;  1CV5 A;  2W1L A;  2F5P A;  2ZQ3 A;  3GQ5 A;  130L A;  4H90 A;  2B6W A;  4LYC A;  4W56 A;  4DKL A;  1W5S A;  1OP9 B;  4N5R A;  4G9S A;  2Z39 A;  2B75 A;  2YBJ A;  5E4P A;  1NBY C;  4N1C C;  2VB1 A;  4XEN A;  1L21 A;  2DAK A;  236L A;  4LZT A;  1G1W A;  4J1B A;  4I7Q A;  4WP2 A;  198L A;  2V6Z M;  3T15 A;  5ILC A;  4NHS A;  3J7B A;  3HJ8 A;  1VEK A;  1G0P A;  2LYZ A;  2F2Q A;  3GLI B;  4W51 A;  3J2P B;  1T8A A;  3GLH E;  1QT7 A;  4GH9 A;  3SAS A;  2ZAO A;  1GO5 A;  1BWI A;  3AGH A;  1JQU A;  3L2A A;  4LJ8 A;  2YNM D;  2O79 A;  2JWS A;  1L26 A;  1LHH A;  1IY4 A;  1IO5 A;  1JTN A;  3L64 A;  2BQG A;  4P2E A;  2BQO A;  229L A;  3W67 A;  2L2D A;  1C64 A;  2F5Q A;  5DNY A;  1CV0 A;  1TDH A;  2A4T A;  1WJ7 A;  3A42 A;  214L A;  4B3S M;  1L14 A;  3PNY A;  1LJE A;  4I5S A;  4ANR A;  215L A;  126L A;  1XNR M;  4QDN A;  1OKS A;  2H5X A;  1FJG M;  1HNZ M;  1QQY A;  4IAS A;  5A3Z A;  4LZM A;  2L7H A;  3I51 A;  4NY5 A;  1LOZ A;  4LJ6 A;  1PQJ A;  217L A;  1L75 A;  4S0W A;  3RU5 A;  4HV1 A;  1QAO A;  3G3W A;  5EXP A;  3ILK A;  3N9E A;  143L A;  1LZ9 A;  5FSW A;  2LBC A;  2ZBK B;  4I7S A;  3CDO A;  4AKI A;  4TWS A;  1I1Z A;  1CJ7 A;  1V7T A;  1DPW A;  1QDR A;  1GB7 A;  2DQH Y;  3GLG E;  5C1B A;  1B7S A;  4LZJ A;  220L A;  2G5G X;  3C3E A;  1XJT A;  5L8R F;  3AZ4 A;  1CKF A;  4IBK A;  1QYR A;  2BQB A;  1GAZ A;  1L17 A;  2JY6 B;  2OTY X;  5KXL A;  1QAQ A;  2OOB A;  3TXI A;  1BB5 A;  3TMU A;  1GB8 A;  4TSB A;  1DV0 A;  1XEP A;  2ZTD A;  1F6R A;  1G4A E;  4ARQ B;  3T6P A;  1PM5 A;  1QTB A;  1D6Q A;  245L A;  8LYZ A;  3GLH B;  3LCV B;  4NGO A;  3MK6 A;  2F2N A;  4M9S A;  170L A;  2Z4R A;  4LRS A;  110L A;  5IEL A;  5LA8 A;  2HEA A;  147L A;  3HTB A;  4BAP A;  4AG5 A;  4DV0 M;  1CKD A;  1G0G A;  4OO9 A;  4ZPX A;  1NO1 A;  1B5U A;  3WW5 A;  1HQY E;  4CJ6 A;  2ZQ4 A;  1E94 E;  4NWH A;  4B49 A;  3HH4 A;  5C18 A;  1EL1 A;  3B0K A;  1TH3 A;  1QAN A;  4LDL A;  4U3X B;  2JZ1 A;  4KT0 F;  1XEI A;  3SAR A;  1PGY A;  3AGG G;  2RBS A;  1T6H A;  1TCY A;  2F4A A;  4E3U A;  258L A;  5KPZ A;  199L A;  238L A;  2VII A;  2XFS A;  3NWL A;  2KW0 A;  3C8R A;  4PGJ B;  2XBR A;  1WQP A;  1BB6 A;  1B7M A;  2EUC A;  1KSF X;  2BQD A;  2I7N A;  1L02 A;  3GLG B;  4H9C A;  1GE2 A;  3BXW A;  4PK0 A;  4MB7 A;  4GRV A;  1ZMW A;  1C6Q A;  3C7Z A;  2EIZ C;  1CX6 A;  1JIT A;  4HSF A;  1L96 A;  4BS7 A;  4X66 M;  1GHL A;  4IBB A;  1GJT A;  4WM4 A;  5ILF A;  3FA0 A;  2D7H A;  3K9O A;  1RE2 A;  4I7P A;  1LJK A;  1IBM M;  4MM3 B;  1NDG C;  3AJI B;  2G3Q A;  3SFZ A;  3M18 B;  3SBB C;  1YRO A;  1IXZ A;  4BB9 A;  3ZC7 B;  2HUK A;  4H9H A;  2B70 A;  4DDB A;  2L6O A;  3HUQ A;  4X64 M;  1N34 M;  3GQ4 A;  3GUM A;  1ZMV A;  2C9C A;  3ODU A;  1L32 A;  4EPI A;  3A95 A;  1TEW A;  4EKP A;  1LJJ A;  4WLD A;  173L A;  3GRR A;  3HBD A;  2FS1 A;  1L63 A;  1LZY A;  5LVG A;  1IWV A;  3ZVQ B;  4NHT A;  172L A;  1JJ3 A;  1DYF A;  3HKP A;  2RB1 X;  128L A;  4ET9 A;  2ZYC A;  1B7R A;  4I8S A;  1V92 A;  3GRY A;  1L83 A;  261L A;  4AGA A;  1YE9 A;  1GEV A;  2KNV A;  4PJZ A;  4XJD A;  5KXM A;  2JP7 A;  1NV8 A;  4GKK M;  3VKH A;  1LZG A;  3F9L A;  3TXJ A;  3HU8 A;  1LZ5 A;  3IWR A;  4I7R A;  3QAK A;  4DV4 M;  1REM A;  1OUD A;  2MH8 A;  1HEL A;  196L A;  4YHH M;  4ML7 A;  4RKU F;  3C8S A;  1VDT A;  3KP0 E;  1B7O A;  1JTO L;  1XB2 B;  4CGY B;  1LZR A;  3J6K A;  5KXZ A;  2J5Y A;  1HHL A;  1OIP A;  160L A;  4HV2 A;  1BHZ A;  4H94 A;  2R18 A;  4PD2 A;  5DFL A;  4LFA M;  4JI3 M;  1S3S A;  3U6E A;  1OUA A;  1C62 A;  1GFA A;  3OK0 A;  1WQM A;  1IWZ A;  3VDU A;  4HP0 A;  4ETA A;  2B72 A;  1DYA A;  4PRQ A;  3SHF A;  1YL1 X;  5AMY A;  5LVI A;  221L A;  1D3J A;  1GJS A;  2JY8 A;  1YIL A;  1QTH A;  1P2C C;  3KVW A;  2DEN A;  1LSY A;  4JXJ A;  1IWT A;  3KP1 E;  2H5Z A;  1G8P A;  1K82 A;  2Z12 A;  4NSJ A;  2XZF A;  3RW8 A;  186L A;  2KXE A;  4IAP A;  1HER A;  5KXY A;  2O25 A;  4I8O A;  4GC5 A;  2L7I A;  2OE4 X;  1LYZ A;  4LYM A;  2RBO A;  2CV2 A;  2I6Z A;  4M0D A;  3HUA A;  1GF4 A;  1NDM C;  2DKV A;  3VK7 A;  1L81 A;  3C8Q A;  2LH0 A;  5LYZ A;  1XGU C;  1HFX A;  262L A;  149L A;  1KXX A;  1GFV A;  3A45 A;  184L A;  1LYJ A;  4WOA A;  5LAG A;  4FW9 A;  4EKQ A;  4MST A;  1TLA A;  2LVN C;  2EPE A;  2MEA A;  3LQQ A;  1UBZ A;  4G4C A;  1YQV Y;  5KKI A;  1N78 A;  3SYL A;  5IHG A;  2CJL A;  2E5L M;  3W3E A;  3LYT A;  4AQN A;  1N77 A;  4B3T M;  3GUO A;  2OU8 A;  1LKR A;  1XSF A;  1BQL Y;  4ITQ A;  2Q0M X;  3TXG A;  4RW2 A;  1LZB A;  3SN6 R;  4NWE A;  5E6J A;  2RBN A;  3LYM A;  233L A;  1CKH A;  1EQE A;  4D80 A;  1RU3 A;  1QUO A;  1OWZ A;  1P2R A;  3WMK A;  2IGC A;  1CVK A;  3SAU A;  1LYH A;  1HEQ A;  1GF9 A;  3DMV A;  3KDS E;  1OFH A;  1L99 A;  4XJG A;  4DR3 M;  2D6B A;  3WPL A;  3WW6 A;  2FE8 A;  3HH5 A;  3BOS A;  1IC5 Y;  1E9R A;  2R46 A;  1L11 A;  1LYI A;  1QT5 A;  250L A;  1IXS A;  5EP3 A;  3VKG A;  2WSC F;  1C7P A;  4YX7 C;  1EPY A;  4Z3M A;  3AFH A;  4DV1 M;  1REZ A;  3TL4 X;  1JKC A;  3GP1 A;  3OTO M;  4I7O A;  1JJ0 A;  1P3N A;  2OQ4 A;  107L A;  240L A;  3SMS A;  1VAT A;  3CF6 E;  140L A;  1ZV5 L;  3LZM A;  4ETE A;  1LJF A;  2MEE A;  2GNO A;  1L90 A;  1JQJ C;  1D9U A;  5KXP A;  1JUG A;  3T6U A;  132L A;  2DQJ Y;  1JPO A;  3SAT A;  2LYO A;  2VQE M;  4AZF A;  1GAB A;  135L A;  1XEJ A;  1UIC A;  1GXX A;  4KOD A;  5LA5 A;  5JI2 E;  3D9A C;  1NY5 A;  7LYZ A;  1CNS A;  2O01 F;  4WO6 A;  5BPV A;  4FDY A;  1CJ9 A;  226L A;  1AM7 A;  3TXD A;  7CAT A;  1H6M A;  3C81 A;  1GL7 A;  1P7S A;  3QNG A;  4FCV A;  222L A;  1L52 A;  191L A;  4I7T A;  1VDQ A;  1F4I A;  1LSA A;  4B4E A;  2Y20 A;  1TDZ A;  2G4P A;  2Z19 A;  2RRU A;  2OE9 X;  4WM3 A;  1IP3 A;  2XGN A;  4G4N A;  2QP9 X;  1UIE A;  1CU0 A;  1TF0 B;  2XQO A;  3E4R A;  3GUL A;  1L09 A;  1QUG A;  1A5T A;  4AKG A;  4LF8 M;  2HEF A;  2LTU A;  3B7Z A;  1C61 A;  2LVO C;  3WPK A;  2F5N A;  2R6F A;  2C5R A;  3K3T A;  4NXN M;  2CHG A;  1L28 A;  2WSF F;  2BNK A;  2YR0 A;  2NQ8 C;  1C6L A;  2KZU A;  2OO9 A;  2K9D A;  3GRV A;  5KPT A;  216L A;  3CF0 A;  1O23 A;  3OE0 A;  4MGK E;  164L A;  1C63 A;  1RI8 B;  2LXE A;  2QAR C;  223L A;  227L A;  4H8Z A;  4GLA A;  4II7 A;  1VFB C;  4CIS A;  3WU7 A;  1REY A;  1XWI A;  4B7H A;  1XMQ M;  3F92 A;  4MGY E;  2B3T A;  1DZB X;  1IP1 A;  4NHP A;  4LG2 A;  1L51 A;  1NHE A;  2R44 A;  3I4V A;  1AT6 A;  3HH3 A;  5F16 A;  1XGT C;  4QOZ C;  1T6V L;  3IJV A;  1QS9 A;  4G3O A;  3W6B A;  2DZO B;  5DYG A;  4B7F A;  2K47 A;  2Z38 A;  3ULR A;  1JTT L;  1NSF A;  4ARJ A;  2Q2E B;  1IR9 A;  4D9Z A;  3FI7 A;  4L8R C;  2OE7 X;  3RT5 X;  1C6T A;  1LMO A;  4M9X A;  1IN5 A;  1LHK A;  4ARM A;  1B5Z A;  1IOQ A;  1WQQ A;  2UXC M;  4L41 A;  2PC2 A;  1MX0 A;  4QNR A;  5B1G A;  1L69 A;  1PJT A;  3U6Q A;  2DQA A;  1OUI A;  4G4B A;  5IWA M;  1LJ3 A;  5GKN A;  4AXT A;  5K7O A;  4JYA M;  5KXN A;  3QAU A;  2CWB A;  4F2L A;  4QY9 A;  5FHW A;  1HEO A;  4XGI A;  1D6P A;  3G3X A;  4N0J A;  4F1I A;  3DMX A;  4IAT A;  3TPZ A;  3EIH A;  1SXJ C;  1DPX A;  4NSH A;  144L A;  2OOA A;  4W55 A;  3SAW A;  1TBY A;  1ZAE A;  154L A;  2DI0 A;  5EJC A;  4LFX A;  1C6E A;  1TTE A;  2CHQ A;  1FLY A;  2DQG Y;  4YEM A;  2BWE A;  169L A;  3L26 A;  1DGG A;  200L A;  3V2Y A;  3OE8 A;  4WM5 A;  1WGL A;  5F9U A;  5FTL A;  3GLI E;  1C6I A;  1LSG A;  2L78 A;  1OVH A;  1CUQ A;  3ZEK A;  4I81 A;  4C5F A;  1AKI A;  3F8V A;  3HDE A;  4NSI A;  4J0L A;  3WXU A;  5KXK A;  1L47 A;  2HKJ A;  1NNJ A;  211L A;  3W6E A;  4LFC M;  231L A;  5FCP A;  2XSZ D;  2FFJ A;  1KW7 A;  3C7W A;  2LNH C;  5A3E A;  1YLA A;  1L07 A;  4DR1 M;  2LVQ D;  1OQY A;  2C98 A;  2BQC A;  3HU9 A;  1R7R A;  3TXF A;  112L A;  1OWY A;  4JI8 M;  3DA1 A;  1GF8 A;  5LIN A;  4LYT A;  1UIB A;  2V1U A;  2BQE A;  1HJP A;  2VF8 A;  1HEN A;  3U6P A;  4WLX A;  171L A;  246L A;  2D4J A;  3HT7 A;  152L A;  4ETB A;  3AJN A;  1G1V A;  1H6U A;  1HFY A;  3W6D A;  2DAI A;  4IBC A;  4LJ4 A;  1GDX A;  1WGN A;  1L73 A;  4KT3 A;  1BB7 A;  1IFY A;  2RB2 X;  1MJG M;  1OTR A;  1L29 A;  2UUA M;  1QUT A;  1L98 A;  5EP1 A;  4KLN A;  4QNM A;  4WW0 A;  3J4G A;  2BQL A;  1ZQ9 A;  1JKA A;  2RB0 X;  118L A;  5LYT A;  1QTD A;  3D4S A;  4FWH A;  5ITY A;  1XMO M;  1JSF A;  1CU3 A;  1LYO A;  1G71 A;  122L A;  4NGZ A;  4LT1 A;  1NMM A;  2DXI A;  4WLT A;  247L A;  1QSW A;  4P17 A;  1L79 A;  4B4J A;  1UID A;  3N9C A;  1XGQ C;  2BQF A;  1L38 A;  1LHJ A;  1XEK A;  1QUS A;  4CHT B;  5ITQ A;  1RJC B;  4IBJ A;  4GCF A;  2MEI A;  1LZ4 A;  4B7G A;  1QSA A;  2MR9 A;  3NYA A;  1VEJ A;  1Z55 A;  3DMZ A;  3QE8 A;  4R3D A;  4JI4 M;  4OW0 A;  1G0M A;  3IEC A;  2C8O A;  4FD2 A;  2BQM A;  4M6D A;  141L A;  5HNC A;  3HHW A;  5LMN M;  3LN2 A;  4N1E I;  2JNH A;  4HPE A;  5ITU A;  3MMP A;  4X3B A;  2DKL A;  4EKS A;  4DR7 M;  2ZAM A;  5C6L A;  2MEH A;  3TQS A;  3A3Q A;  3T1Y M;  1L94 A;  2B7X A;  4LYB A;  1D2N A;  2R62 A;  2F47 A;  1R2Y A;  1P64 A;  189L A;  4W59 A;  4TUN A;  3UK6 A;  5LVK A;  1RFP A;  5JI3 E;  139L A;  2VF7 A;  3KOW E;  4OWH A;  159L A;  2UU9 M;  3CSR A;  192L A;  1G7I C;  1SX2 A;  1DYD A;  1G0K A;  5KY1 A;  133L A;  2XF3 A;  5IDD A;  4NGK A;  1WIV A;  111L A;  1L54 A;  3P66 A;  1NBZ C;  1B9O A;  3SAV A;  3WHL A;  3AKZ A;  3TE6 A;  1LWK A;  2IFF Y;  1GB9 A;  1LMC A;  3JR6 A;  3HJS A;  1G07 A;  3CDT A;  1BB3 A;  3GO8 A;  3BKV A;  1L58 A;  2LYM A;  4YF2 A;  1AZF A;  4WM1 A;  1L56 A;  1WTH A;  5LVH A;  5EP4 A;  1T97 A;  2DQI Y;  1YAN A;  2ERC A;  4OU7 A;  3DN1 A;  5KQD A;  1UM8 A;  4IBE A;  5LIO A;  5KXS A;  1FKQ A;  2Z2F A;  1CV3 A;  2VQF M;  3KAM A;  1IN6 A;  1GBS A;  1YAP A;  2P5T A;  2HUB A;  1L68 A;  1DI5 A;  3LHM A;  1NHW C;  4KO8 A;  4I7L A;  4JI5 M;  2R0I A;  1C10 A;  2Z37 A;  3RNX A;  1VQ1 A;  1FLQ A;  1LYD A;  3TXE A;  4XJB A;  2JUJ A;  4RNA A;  5II3 A;  4NIJ A;  2ZTC A;  1LGU A;  3DFZ A;  3G3A B;  1CJ8 A;  4DV6 M;  161L A;  2W1Y A;  4NGV A;  1Z5A A;  4L78 A;  1JTM A;  2HUL A;  1IXS B;  3K9P A;  5EXX A;  1YAQ A;  1QT6 A;  2CUU A;  5KKJ A;  3SBJ A;  1OVK A;  4LFB M;  2RBR A;  4LT0 A;  3QY4 A;  1OV7 A;  4GEW A;  1L92 A;  1N32 M;  3W68 A;  251L A;  4O34 A;  4Y28 F;  1GAY A;  2XEP A;  1MU5 A;  1DGF A;  3HT8 A;  4WG7 A;  3T38 A;  3A6B Y;  5LAF A;  3CB7 A;  1QT4 A;  4KHP M;  4YXC A;  201L A;  2R4J A;  1XC8 A;  1UIH A;  3RZ4 A;  2A7D A;  1L34 A;  2HCB A;  4ET8 A;  3I01 M;  1L50 A;  3TXB A;  2D91 A;  1B5W A;  2DWM A;  1LHI A;  1GBY A;  5KO3 A;  3LW5 F;  4MCK A;  3CDQ A;  1HML A;  3GUN A;  4H92 A;  5APE A;  114L A;  1L0J A;  1C65 A;  1T3T A;  3RFW A;  4I7N A;  1C6M A;  1SXJ A;  2DQF C;  4OVZ A;  1V34 A;  1IP4 A;  5I4Y A;  2M60 A;  1LMP A;  4FVM A;  2XBS A;  4LCB A;  190L A;  1A2Y C;  2HU1 A;  1GFG A;  3GUJ A;  2CV1 A;  1LV7 A;  2DAG A;  1C66 A;  1OJL A;  1LJH A;  2CEA A;  1HEW A;  3KS8 A;  3LCU A;  1L62 A;  4N9R A;  175L A;  2YBN A;  1QT3 A;  1SLY A;  1ZUR A;  3A3R X;  3M3U A;  1K3X A;  138L A;  4QHT A;  1B7L A;  4HJZ A;  1QVR A;  1D2Y A;  1G7J C;  3LQR A;  1GLN A;  2HEE A;  1LZ8 A;  4PHI A;  3WUL A;  3K2L A;  1GFK A;  4PRU A;  2FOI C;  3KOY E;  3NBX X;  1G0L A;  3LYZ A;  1KXW A;  2MEC A;  1NNU C;  2CE7 A;  2LWX A;  1TH4 A;  3ZH9 B;  2XFT A;  4DUZ M;  3FUW A;  3AV0 A;  2Z6B A;  3B72 A;  3EXD A;  3SYK A;  2DWL A;  1P2L A;  1YKZ X;  5LZM A;  1N4F A;  1V7S A;  3VWO A;  3FE0 A;  3U60 A;  2EQL A;  4XJI A;  1PJI A;  3PVS A;  2BJV A;  4NOO B;  1WTN A;  3WUA A;  4EKR A;  5KXT A;  4WLY A;  1HFZ A;  3PBL A;  4L6V 6;  3IG5 A;  1B6I A;  3EMS A;  252L A;  4NXM M;  1GF7 A;  4NGY A;  3NY9 A;  3FI5 A;  1CKC A;  1QTZ A;  1ZVY B;  1J09 A;  1C67 A;  2LHG A;  4GCE A;  1G0J A;  3CT1 A;  2X4A A;  2W1M A;  2F32 A;  4HLQ A;  2NTH A;  1UA6 Y;  4ARM B;  1IR7 A;  3LVW A;  1L49 A;  3LMM A;  4GN3 A;  4W94 A;  3C58 A;  3HZJ A;  3V76 A;  4MGZ E;  4W52 A;  1FN5 A;  1GPQ C;  5DYI A;  4QOS A;  4G49 A;  1BWJ A;  4H8Y A;  167L A;  2LHM A;  1ORY B;  5FTM A;  206L A;  102L A;  2RBP A;  2OPF A;  3U6M A;  1GEZ A;  4OWE A;  2BQA A;  119L A;  129L A;  1GDW A;  4LGK A;  5L3H A;  4Z8X A;  1REX A;  3GPX A;  1LZE A;  187L A;  1LKS A;  5FTJ A;  1L57 A;  1L39 A;  1P46 A;  4W54 A;  1PQI A;  2F4G A;  4YM8 A;  207L A;  1LSD A;  3K8Z A;  1HF4 A;  1VDP A;  5LYM A;  3JAM S;  5KQ8 A;  4W57 A;  4X62 M;  125L A;  1C6P A;  3L28 A;  1G0Q A;  4OX9 M;  4AQY M;  5APF A;  123L A;  4DDC A;  1Z5C A;  2LVP C;  4REZ A;  4K0K M;  3A8Z A;  2DAE A;  225L A;  4B4I A;  1C69 A;  3A34 A;  2HED A;  1E9S A;  4G4Q A;  108L A;  1GB2 A;  1JIS A;  193L A;  3R8F A;  257L A;  2D7E A;  4NRV A;  1DGB A;  2HEC A;  3R9X B;  150L A;  165L A;  4KXI A;  1NF5 A;  2G8L A;  1CX7 A;  1LWG A;  3QWL A;  3KXE C;  1DYE A;  4W5W A;  2BQJ A;  4WUR A;  4DAJ A;  2BQH A;  2XH9 A;  2KHH A;  1CUP A;  1LI2 A;  3DKE X;  5KPR A;  4PPO A;  2RKO A;  1GBX A;  2RH1 A;  2HUM A;  3TWM A;  2L4E A;  1OV5 A;  256L A;  1LCN A;  4IJF A;  166L A;  3MJ5 A;  5I4X A;  1OUE A;  2LZT A;  1IY3 A;  4I0C A;  1L03 A;  1PJJ A;  1DI3 A;  2I7P A;  5E26 A;  1LZ6 A;  3H4M A;  3KW6 A;  5FTK A;  2XZU A;  1GB5 A;  1LZS A;  3L2X A;  3HY5 A;  4I7M A;  1IOR A;  5FDJ A;  4OWA A;  2APL A;  1XJU A;  2BPU A;  3HU1 A;  3HWL A;  4H9E A;  1L04 A;  3TMX A;  3FD9 A;  3V2W A;  4LYZ A;  4EJ4 A;  3U61 A;  3IHP A;  3WUN A;  5IZ7 D;  3KOZ E;  3A94 A;  5EXS A;  4PJ2 C;  1D3N A;  1GFT A;  253L A;  3OE6 A;  3FYD A;  163L A;  1L05 A;  3B7N A;  2YVB A;  1QTC A;  4DJH A;  182L A;  3QYB A;  2QBY A;  3E21 A;  4NHI A;  4I4L A;  3P65 A;  2L4F A;  2DHY A;  1XNQ M;  1N33 M;  3I4Y A;  2VDB B;  2JA2 A;  1C6H A;  4DV7 M;  3RGS A;  137L A;  1W08 A;  243L A;  3HBE X;  3WUM A;  1GF5 A;  3D8B A;  4GCC A;  4GMQ A;  4LF5 M;  3PDS A;  2QHO B;  1IN7 A;  237L A;  1Q39 A;  5T3F A;  4XN6 A;  1L23 A;  1R5L A;  2MEF A;  1EFU B;  2DZN B;  1D3F A;  4TX7 A;  5D5C A;  1TGU A;  1L88 A;  2C8P A;  3GLG A;  1WQR A;  2B74 A;  1H87 A;  4RDS A;  2J7N A;  4DQJ A;  4DBG B;  1IBL M;  1IP7 A;  2BQK A;  1GE1 A;  2KZS A;  1BWH A;  5ITX A;  3L25 A;  4GCB A;  3PNV A;  168L A;  1LAA A;  5L3I A;  1NJG A;  1L86 A;  1WXQ A;  2ZIL A;  4PDI A;  4H93 A;  3W6F A;  3AW6 A;  3U6O A;  1B5V A;  4G4H A;  3L29 A;  224L A;  1LZN A;  2W82 A;  1C6J A;  4WG1 A;  4ZEE A;  5ITT A;  142L A;  213L A;  1FBI X;  1HNX M;  5I54 A;  1OUG A;  4Z98 A;  2K6B A;  4ARL A;  2KEB A;  3THG A;  4FWD A;  3DN0 A;  5B59 A;  3T1H M;  1WTM A;  4RW1 A;  5A2Q S;  153L A;  1C45 A;  1B7P A;  1GB6 A;  1NKH A;  2C96 A;  1GBW A;  5DLA A;  1LZA A;  1YL0 X;  7LZM A;  1UIG A;  2QEN A;  1B2K A;  3UZU A;  5EP2 A;  2BLX A;  183L A;  4NFV A;  4A3V B;  1L2D A;  1NHG C;  2JZ0 A;  4UN2 B;  1EQ4 A;  2IHL A;  3CSQ A;  3WXT A;  6LZM A;  1Z59 A;  4P16 A;  3UGJ A;  1LZC A;  3SC3 A;  2MJ5 B;  3JR5 A;  4G4R A;  4EMN A;  2B6T A;  2I25 L;  4M9Z A;  2Y21 A;  1D0M A;  3AOG A;  2Z3X A;  1QSB A;  2LZM A;  2RSC A;  4UWN A;  1JJ1 A;  4IBD A;  2YBL A;  194L A;  2CGI A;  2YSS C;  228L A;  1KYI A;  3GPU A;  1L24 A;  3WHK A;  1C6A A;  4H91 A;  1GFH A;  1HC0 A;  1P6Y A;  4LFP A;  2G4Q A;  1L71 A;  1L48 A;  2G4N A;  4JI2 M;  1LSN A;  3ATO A;  4RF1 A;  2Y0T A;  3W0L B;  3C80 A;  4IJE A;  4YXA C;  3WU8 A;  1OVJ A;  2YQZ A;  2OU9 A;  3HTG A;  4IBF A;  212L A;  2XLJ A;  3HX3 A;  4HJY A;  5B06 A;  3HHX A;  3D8L A;  2B6X A;  3HTD A;  2FH0 A;  4JI7 M;  1DYG A;  2UXD M;  4FJR A;  5FEK A;  3AOE C;  3DN8 A;  2ZAN A;  4J1A A;  3J80 S;  2CFO A;  2HAK A;  1CV6 A;  4WM2 A;  4AKH A;  242L A;  1C68 A;  1LYF A;  3K1J A;  4GHL A;  1EE8 A;  4QHS A;  4X65 M;  178L A;  1D9W A;  1DKJ A;  1LMT A;  1TDY A;  1KY0 A;  2BQN A;  1OYU A;  4LF6 M;  1OQM A;  1QUD A;  3J27 B;  4LT2 A;  2MEB A;  5KXX A;  205L A;  4RF0 A;  1ZV1 A;  4LRT A;  1LJ4 A;  1L22 A;  1GF0 A;  1OUC A;  197L A;  1L59 A;  3EBA B;  3FUU A;  1JR3 A;  2ZIK A;  1KFV A;  2YBH A;  3LZ2 A;  4M4O A;  3LVV A;  1GE4 A;  2KNA A;  4A7D A;  3FKE A;  1PQK A;  4NSG A;  1OIZ A;  2X49 A;  3KSJ A;  3CQL A;  4OVZ B;  1C43 A;  2BJW A;  3VLF B;  1C08 C;  1HT2 E;  1F0W A;  1TH2 A;  1JWR A;  1XXH A;  4NGI A;  1BGI A;  1WR1 B;  1IWW A;  3DN4 A;  3RGP A;  244L A;  2QNJ A;  1INU A;  5ITR A;  1L25 A;  4S12 A; 
#chains in the Genus database with same CATH homology
 1A4V A;  5HNL A;  1F6S A;  4DQ5 A;  1T8G A;  1PQM A;  1GWD A;  1WQO A;  1L89 A;  4XJF A;  4CGE A;  4R0F A;  1LSM A;  180L A;  1XGR C;  1CTW A;  1ZWN A;  1L77 A;  1F10 A;  5C6I A;  148L E;  1LSF A;  5KXW A;  1FLW A;  1IEE A;  1QS5 A;  4KL7 A;  2ZNW Y;  1L06 A;  1GE3 A;  1QUH A;  4C3W A;  4LYO A;  1IP6 A;  2GV0 A;  1L19 A;  4ZPU A;  1L53 A;  3BKH A;  3GUP A;  1CV1 A;  3HBH A;  2B6Y A;  1MLC E;  3AZ6 A;  2B73 A;  5EBH A;  1CU2 A;  1LI6 A;  1L64 A;  1UAC Y;  1G7H C;  4OW1 A;  1QTK A;  2OEA X;  1RCM A;  1K28 A;  2FYD A;  1L31 A;  1GBO A;  4H9F A;  2O7A A;  1L46 A;  1L36 A;  2D4K A;  174L A;  1LW9 A;  2CWI A;  2Q9E A;  5F14 A;  5APC A;  3WH1 A;  2F30 A;  185L A;  2WAR A;  1L80 A;  3A96 A;  1KY1 A;  4OWB A;  4OWC A;  1GFR A;  1LGX A;  5DL9 A;  5KXO A;  3K2R A;  4I7K A;  4ZFP A;  3AZ7 A;  1UIF A;  4NGL A;  5HLL A;  3HT6 A;  2YDG A;  3TMV A;  1PQD A;  1BB4 A;  2NWD X;  1L20 A;  234L A;  5J7C A;  1LSP A;  4Z41 A;  1LHL A;  2A7F A;  4LT3 A;  3C83 A;  1LI3 A;  151L A;  1SWZ A;  3G3V A;  3B0O A;  1CKG A;  4YOP A;  5M1Y A;  5FEL A;  1WVU A;  3HTF A;  4W58 A;  1L60 A;  4WM6 A;  4W53 A;  4DYG A;  1IR8 A;  115L A;  1B0D A;  1IWX A;  1G7M C;  1PQO A;  4HTK A;  210L A;  1L35 A;  4BAD A;  2CDS A;  1L84 A;  1W6Z A;  1P36 A;  1IWY A;  2X0A A;  1GXV 2;  6LYT A;  1WVV A;  1LYS A;  1P5C A;  1UIA A;  208L A;  188L A;  3CDV A;  1KIQ C;  4ETC A;  1GE0 A;  1KIP C;  4TSC A;  3DNA A;  1C60 A;  1VAU A;  1XFP L;  2OU0 X;  5B07 A;  5DN4 A;  1L00 A;  2BAA A;  3OJP A;  1L18 A;  2B5Z A;  235L A;  1YAO A;  5C6J A;  1GFE A;  1KS3 A;  1L15 A;  2DQC Y;  2ANX A;  2I26 L;  4OOT A;  239L A;  1L0K A;  1CV4 A;  1D0K A;  5B05 A;  1JSE A;  1MEL L;  1IX0 A;  5APD A;  1PZY A;  1SSW A;  1WQN A;  254L A;  3A91 A;  3DN2 A;  3IJU A;  1DYB A;  1SWY A;  1L93 A;  4H9A A;  4BAF A;  4Z46 A;  1JHL A;  4NGJ A;  2BQI A;  1L61 A;  1LPY A;  5JEN B;  1HSX A;  1BVK C;  2NTG A;  5I53 A;  1LSE A;  1CU6 A;  3TXH A;  1B7N A;  5I14 A;  1L65 A;  3WPJ A;  3EO5 A;  248L A;  1QT8 A;  3EML A;  4DDA A;  2RBQ A;  4UWV A;  1DQJ C;  1OUJ A;  3AYQ A;  4QGZ A;  4W96 A;  4NHQ A;  4DWX A;  3TMW A;  2O4W A;  4ARP A;  1L13 A;  4CFP A;  127L A;  1IC4 Y;  2LZ2 A;  5I5Q A;  3P4Z A;  3A6C Y;  1L97 A;  1IC7 Y;  3SB8 A;  146L A;  158L A;  3VW7 A;  1J1P Y;  3CSZ A;  3CT5 A;  1VED A;  1QDT A;  1KIR C;  1L87 A;  230L A;  4NG1 A;  3CDR A;  1JIY A;  249L A;  3HDF A;  1GB3 A;  131L A;  1LLH A;  2EKS C;  1DYC A;  1BVX A;  1GFU A;  3RZE A;  2DQE Y;  4MR1 A;  1IVM A;  4GN5 C;  1LHM A;  4B1A A;  3FAD A;  4WMG A;  1LZ1 A;  1EQ5 A;  1E8L A;  1DI4 A;  1I56 A;  1YKX X;  1LGW A;  4DD3 A;  1TAY A;  1L66 A;  4I7J A;  3AB6 A;  1AT5 A;  2ZYP A;  255L A;  4N8Z A;  2BLY A;  2Q9D A;  3RUN A;  5LXW A;  1L30 A;  5FST A;  1LMA A;  3T36 A;  2Z2E A;  1LSC A;  5KJ9 A;  176L A;  4RLN A;  259L A;  4H8X A;  1HMK A;  1C6N A;  4XAD A;  1L76 A;  3GUI A;  1GFJ A;  218L A;  1C6C A;  1LTM A;  3LZT A;  4ETD A;  1IP5 A;  3SB7 A;  3WVX A;  3WU9 A;  5L9J A;  4DT3 A;  1LZT A;  4UWU A;  3A93 A;  1L16 A;  1UC0 A;  2QB0 B;  4E97 A;  1LYE A;  232L A;  2YBI A;  134L A;  1L41 A;  209L A;  2ZIJ A;  1C6K A;  5LVJ A;  1P56 A;  1L44 A;  4DD0 A;  5E9R A;  1UCO A;  3HUK A;  1CJ6 A;  1L01 A;  145L A;  5I4W A;  1XGP C;  113L A;  3AGI A;  157L A;  1LYG A;  4B0D A;  2XJW A;  1GF6 A;  1VDS A;  2W1X A;  195L A;  1L42 A;  1D2W A;  5DN5 A;  4DD9 A;  2D4I A;  1T8F A;  4ARQ A;  1OUH A;  1GBZ A;  3CT0 A;  4YEN A;  1SQ2 L;  1FKV A;  1IOC A;  4DD2 A;  103L A;  1IOS A;  2FBB A;  1B5X A;  1J1X Y;  1D0L A;  4CFO A;  4RLM A;  1G06 A;  3B6L A;  4EOF A;  2HTX A;  2XTH A;  1LMQ A;  3HH6 A;  1L55 A;  1JKD A;  3GXR A;  1UUZ C;  3GXK A;  4H9I A;  1L70 A;  4WL6 A;  120L A;  4NGW A;  1T3P A;  177L A;  156L A;  1L40 A;  4NEB A;  1B7Q A;  3B0I A;  4GN4 A;  1OUF A;  2Y8P A;  1L91 A;  2DBT A;  4DD1 A;  2AUB A;  1C6D A;  1CU5 A;  3SP3 A;  1L08 A;  155L A;  3C82 A;  3WVY A;  3WL2 A;  4K5Y A;  4H9B A;  3F6Z A;  1L12 A;  104L A;  1PS5 A;  4XYY A;  3SBA A;  1KXY A;  2FYC A;  4HPI A;  1B5Y A;  3AW7 A;  2ZWB A;  4CJ2 A;  1IP2 A;  1L74 A;  1FDL Y;  3GUK A;  5DM9 A;  1FLU A;  1LPI A;  1OUB A;  1JEF A;  5KXR A;  5B1F A;  2H9J A;  2ZNX Y;  1LSB A;  1YAM A;  1L37 A;  1L43 A;  3ZVQ A;  2FBD A;  1DKK A;  4ZIX A;  1LMN A;  1HSW A;  3SB5 A;  1NHB A;  1LYY A;  1ZMY L;  1IOT A;  3AZ5 A;  4IJ4 A;  181L A;  1HEM A;  5F9X A;  4EXM A;  4NG8 A;  2HU3 A;  4GBR B;  1GD6 A;  5HQ1 A;  3W6C A;  1KW5 A;  9LYZ A;  4DD7 A;  4HTQ A;  2Z18 A;  1P37 A;  162L A;  1L10 A;  1C46 A;  1HEP A;  1L67 A;  2YBM A;  1NQI A;  1L85 A;  1ZYT A;  1L82 A;  3MGW A;  4R6C A;  1GF3 A;  2N5Z A;  3W6A A;  4XJH A;  1KNI A;  5F81 A;  5HMJ A;  3LYO A;  4EPF A;  3ATN A;  3WYH A;  2LC9 A;  1QTV A;  1LSZ A;  1C6G A;  1C6F A;  3OE9 A;  1QTE A;  1LJI A;  1DXJ A;  1L45 A;  3C7Y A;  1JKB A;  4DC4 A;  1QSQ A;  2LCB A;  2HEB A;  1NWG A;  6LYZ A;  4QEQ A;  1LJN A;  3D3D A;  3HT9 A;  2DQD Y;  109L A;  1L72 A;  4H1P A;  1SX7 A;  3TXK A;  3DN3 A;  2MEG A;  3A67 Y;  3A92 A;  1C6B A;  4II8 A;  1I6S A;  1G7L C;  3E3D A;  4TTD A;  4HTN A;  1L27 A;  1QIO A;  3SB9 A;  2RAZ X;  3DN6 A;  4OOO A;  260L A;  1ALC A;  219L A;  2B6Z A;  1LJG A;  2OTZ X;  4CHX A;  1YIK A;  241L A;  3P68 A;  1YKY X;  3SB6 A;  4LDO A;  2RAY X;  5HMV A;  3N9A A;  1ZVH L;  1GB0 A;  1LZD A;  4KPM A;  3G3B B;  4J7V A;  2H9K A;  1L95 A;  3NY8 A;  1I20 A;  4YEO A;  3UON A;  1L33 A;  2ANV A;  1IWU A;  1D3M A;  4LDE A;  4GLV A;  1SSY A;  2MED A;  4GCD A;  1IIZ A;  3A90 A;  4DQ7 A;  4WO9 A;  1HNL A;  1JTP L;  4HJV A;  3P64 A;  3HFM Y;  4WL7 A;  1CV5 A;  2W1L A;  2ZQ3 A;  130L A;  4H90 A;  2B6W A;  4LYC A;  4W56 A;  4DKL A;  1OP9 B;  4N5R A;  4G9S A;  2Z39 A;  2B75 A;  2YBJ A;  5E4P A;  1NBY C;  4N1C C;  2VB1 A;  4XEN A;  1L21 A;  236L A;  198L A;  4LZT A;  1G1W A;  4J1B A;  4I7Q A;  5ILC A;  4NHS A;  1G0P A;  2LYZ A;  2F2Q A;  4W51 A;  1T8A A;  1QT7 A;  1BWI A;  3AGH A;  1JQU A;  2O79 A;  1L26 A;  1LHH A;  1IY4 A;  1IO5 A;  1JTN A;  3L64 A;  2BQG A;  4P2E A;  2BQO A;  229L A;  1C64 A;  1CV0 A;  2A4T A;  214L A;  1L14 A;  1LJE A;  4ANR A;  215L A;  126L A;  4QDN A;  1QQY A;  4IAS A;  5A3Z A;  4LZM A;  4NY5 A;  1LOZ A;  1PQJ A;  217L A;  1L75 A;  4S0W A;  3RU5 A;  4HV1 A;  3G3W A;  3N9E A;  143L A;  1LZ9 A;  4I7S A;  3CDO A;  4TWS A;  1I1Z A;  1CJ7 A;  1V7T A;  1DPW A;  1QDR A;  1GB7 A;  2DQH Y;  1B7S A;  220L A;  1XJT A;  3AZ4 A;  1CKF A;  2BQB A;  1GAZ A;  1L17 A;  2OTY X;  5KXL A;  3TXI A;  1BB5 A;  3TMU A;  1GB8 A;  4TSB A;  1XEP A;  1F6R A;  4ARQ B;  1QTB A;  1D6Q A;  245L A;  8LYZ A;  4NGO A;  2F2N A;  170L A;  110L A;  5IEL A;  5LA8 A;  2HEA A;  147L A;  3HTB A;  4BAP A;  1CKD A;  1G0G A;  4OO9 A;  1B5U A;  3WW5 A;  2ZQ4 A;  4NWH A;  4B49 A;  3HH4 A;  1EL1 A;  3B0K A;  4LDL A;  4U3X B;  1XEI A;  3AGG G;  2RBS A;  1T6H A;  1TCY A;  2F4A A;  4E3U A;  258L A;  199L A;  238L A;  3C8R A;  4PGJ B;  2XBR A;  1WQP A;  1BB6 A;  1B7M A;  2BQD A;  1L02 A;  4H9C A;  1GE2 A;  4PK0 A;  4GRV A;  3C7Z A;  1C6Q A;  4HSF A;  1CX6 A;  1JIT A;  2EIZ C;  1L96 A;  4BS7 A;  1GHL A;  4WM4 A;  5ILF A;  3FA0 A;  1RE2 A;  4I7P A;  1LJK A;  1NDG C;  3M18 B;  3SBB C;  1YRO A;  2HUK A;  4H9H A;  2B70 A;  4DDB A;  3HUQ A;  3GUM A;  3ODU A;  1L32 A;  4EPI A;  3A95 A;  1TEW A;  4EKP A;  1LJJ A;  4WLD A;  173L A;  3HBD A;  1L63 A;  1LZY A;  5LVG A;  1IWV A;  3ZVQ B;  4NHT A;  172L A;  1JJ3 A;  1DYF A;  2RB1 X;  128L A;  4ET9 A;  2ZYC A;  1B7R A;  4I8S A;  1L83 A;  261L A;  4AGA A;  1GEV A;  4PJZ A;  4XJD A;  5KXM A;  3F9L A;  1LZG A;  3TXJ A;  3HU8 A;  1LZ5 A;  3IWR A;  4I7R A;  3QAK A;  1REM A;  1OUD A;  1HEL A;  196L A;  4ML7 A;  3C8S A;  1VDT A;  1B7O A;  1JTO L;  1LZR A;  3J6K A;  5KXZ A;  1HHL A;  160L A;  4HV2 A;  1BHZ A;  4H94 A;  1OUA A;  1C62 A;  1GFA A;  3OK0 A;  1WQM A;  1IWZ A;  4HP0 A;  4ETA A;  2B72 A;  1DYA A;  4PRQ A;  1YL1 X;  5AMY A;  5LVI A;  221L A;  1D3J A;  1YIL A;  1QTH A;  1P2C C;  1LSY A;  1IWT A;  2H5Z A;  2Z12 A;  4NSJ A;  3RW8 A;  186L A;  4IAP A;  1HER A;  5KXY A;  2OE4 X;  1LYZ A;  4LYM A;  2RBO A;  2I6Z A;  3HUA A;  1GF4 A;  1NDM C;  2DKV A;  1L81 A;  3C8Q A;  5LYZ A;  1XGU C;  1HFX A;  262L A;  149L A;  1KXX A;  1GFV A;  184L A;  1LYJ A;  4WOA A;  5LAG A;  4EKQ A;  4MST A;  1TLA A;  2EPE A;  2MEA A;  1UBZ A;  4G4C A;  1YQV Y;  5KKI A;  5IHG A;  2CJL A;  3W3E A;  3LYT A;  4AQN A;  3GUO A;  2OU8 A;  1LKR A;  1XSF A;  1BQL Y;  2Q0M X;  3TXG A;  4RW2 A;  1LZB A;  3SN6 R;  4NWE A;  2RBN A;  3LYM A;  233L A;  1CKH A;  1EQE A;  3WMK A;  1QUO A;  1OWZ A;  1P2R A;  2IGC A;  1CVK A;  1LYH A;  3DMV A;  1HEQ A;  1GF9 A;  1L99 A;  4XJG A;  2D6B A;  3WPL A;  3WW6 A;  3HH5 A;  1IC5 Y;  1L11 A;  1LYI A;  1QT5 A;  250L A;  1C7P A;  4YX7 C;  1EPY A;  4Z3M A;  1REZ A;  1JKC A;  4I7O A;  1JJ0 A;  1P3N A;  107L A;  240L A;  1VAT A;  140L A;  1ZV5 L;  3LZM A;  4ETE A;  1LJF A;  2MEE A;  1L90 A;  1D9U A;  5KXP A;  1JUG A;  3T6U A;  132L A;  2DQJ Y;  1JPO A;  2LYO A;  135L A;  1XEJ A;  1UIC A;  1GXX A;  5LA5 A;  3D9A C;  7LYZ A;  1CNS A;  4WO6 A;  4FDY A;  1CJ9 A;  226L A;  1AM7 A;  3TXD A;  1H6M A;  3C81 A;  1P7S A;  3QNG A;  222L A;  1L52 A;  191L A;  4I7T A;  1VDQ A;  1LSA A;  4B4E A;  2G4P A;  2Z19 A;  4WM3 A;  2OE9 X;  1IP3 A;  1UIE A;  1CU0 A;  2XQO A;  3GUL A;  1L09 A;  1QUG A;  2HEF A;  1C61 A;  3WPK A;  3K3T A;  1L28 A;  1C6L A;  216L A;  1O23 A;  3OE0 A;  164L A;  1C63 A;  1RI8 B;  2QAR C;  223L A;  227L A;  4H8Z A;  4GLA A;  1VFB C;  3WU7 A;  1REY A;  1DZB X;  1IP1 A;  4NHP A;  1L51 A;  1NHE A;  1AT6 A;  3HH3 A;  5F16 A;  1XGT C;  1T6V L;  3IJV A;  1QS9 A;  3W6B A;  2Z38 A;  3ULR A;  1JTT L;  4ARJ A;  4D9Z A;  1IR9 A;  3FI7 A;  2OE7 X;  3RT5 X;  1C6T A;  1LMO A;  1LHK A;  4ARM A;  1B5Z A;  1IOQ A;  1WQQ A;  4L41 A;  2PC2 A;  5B1G A;  1L69 A;  2DQA A;  4G4B A;  1OUI A;  1LJ3 A;  4AXT A;  5K7O A;  5KXN A;  4QY9 A;  5FHW A;  1HEO A;  1D6P A;  3G3X A;  4N0J A;  3DMX A;  4IAT A;  1DPX A;  4NSH A;  144L A;  4W55 A;  1TBY A;  154L A;  4LFX A;  1C6E A;  1FLY A;  2DQG Y;  4YEM A;  169L A;  200L A;  3V2Y A;  3OE8 A;  4WM5 A;  5F9U A;  1LSG A;  2L78 A;  1C6I A;  1OVH A;  1CUQ A;  3ZEK A;  4C5F A;  1AKI A;  3F8V A;  3HDE A;  4NSI A;  4J0L A;  3WXU A;  5KXK A;  1L47 A;  211L A;  3W6E A;  231L A;  5FCP A;  1KW7 A;  3C7W A;  5A3E A;  1L07 A;  2BQC A;  3HU9 A;  3TXF A;  112L A;  1OWY A;  1GF8 A;  5LIN A;  4LYT A;  1UIB A;  2BQE A;  1HEN A;  4WLX A;  171L A;  246L A;  2D4J A;  3HT7 A;  152L A;  4ETB A;  3AJN A;  1G1V A;  1HFY A;  3W6D A;  1GDX A;  1L73 A;  4KT3 A;  1BB7 A;  2RB2 X;  1L29 A;  1QUT A;  1L98 A;  3J4G A;  2BQL A;  1JKA A;  2RB0 X;  118L A;  5LYT A;  1QTD A;  3D4S A;  1JSF A;  1CU3 A;  1LYO A;  122L A;  4NGZ A;  4LT1 A;  1NMM A;  4WLT A;  247L A;  1QSW A;  1L79 A;  4B4J A;  1UID A;  3N9C A;  1XGQ C;  2BQF A;  1L38 A;  1LHJ A;  1XEK A;  1QUS A;  1RJC B;  4GCF A;  2MEI A;  1LZ4 A;  1QSA A;  3NYA A;  1Z55 A;  3DMZ A;  3QE8 A;  1G0M A;  2C8O A;  2BQM A;  4M6D A;  141L A;  5HNC A;  3LN2 A;  4N1E I;  4HPE A;  4X3B A;  4EKS A;  5C6L A;  2MEH A;  3A3Q A;  1L94 A;  4LYB A;  2B7X A;  2F47 A;  1P64 A;  189L A;  4W59 A;  4TUN A;  5LVK A;  1RFP A;  139L A;  4OWH A;  159L A;  3CSR A;  192L A;  1G7I C;  1SX2 A;  1DYD A;  1G0K A;  5KY1 A;  133L A;  5IDD A;  4NGK A;  111L A;  1L54 A;  3P66 A;  1NBZ C;  1B9O A;  1LWK A;  2IFF Y;  1GB9 A;  1LMC A;  3JR6 A;  1G07 A;  3CDT A;  1BB3 A;  3BKV A;  1L58 A;  2LYM A;  4YF2 A;  1AZF A;  4WM1 A;  1L56 A;  1WTH A;  5LVH A;  1T97 A;  2DQI Y;  1YAN A;  3DN1 A;  5LIO A;  5KXS A;  1FKQ A;  2Z2F A;  1CV3 A;  3KAM A;  1YAP A;  1GBS A;  2HUB A;  1L68 A;  1DI5 A;  3LHM A;  3RNX A;  4I7L A;  1C10 A;  2Z37 A;  1FLQ A;  1LYD A;  3TXE A;  4XJB A;  5II3 A;  4NIJ A;  1LGU A;  3G3A B;  1CJ8 A;  2W1Y A;  161L A;  4NGV A;  1JTM A;  2HUL A;  1YAQ A;  1QT6 A;  2CUU A;  5KKJ A;  1OVK A;  2RBR A;  4LT0 A;  3QY4 A;  1OV7 A;  1L92 A;  251L A;  4O34 A;  1GAY A;  3HT8 A;  4WG7 A;  3A6B Y;  5LAF A;  3CB7 A;  1QT4 A;  4YXC A;  201L A;  1UIH A;  3RZ4 A;  2A7D A;  1L34 A;  4ET8 A;  1L50 A;  3TXB A;  2D91 A;  1B5W A;  1LHI A;  1GBY A;  4MCK A;  3CDQ A;  1HML A;  3GUN A;  4H92 A;  5APE A;  114L A;  1L0J A;  1C65 A;  4I7N A;  1C6M A;  2DQF C;  1IP4 A;  5I4Y A;  1LMP A;  2XBS A;  190L A;  1A2Y C;  2HU1 A;  1GFG A;  3GUJ A;  1C66 A;  1LJH A;  1HEW A;  1L62 A;  4N9R A;  175L A;  2YBN A;  1QT3 A;  1SLY A;  1ZUR A;  3A3R X;  3M3U A;  138L A;  1B7L A;  4HJZ A;  1D2Y A;  1G7J C;  2HEE A;  1LZ8 A;  4PHI A;  3WUL A;  1GFK A;  4PRU A;  1G0L A;  3LYZ A;  1KXW A;  2MEC A;  2Z6B A;  3B72 A;  3EXD A;  1P2L A;  5LZM A;  1YKZ X;  1N4F A;  1V7S A;  3VWO A;  3FE0 A;  4XJI A;  2EQL A;  1WTN A;  5KXT A;  3WUA A;  4EKR A;  4WLY A;  1HFZ A;  3PBL A;  1B6I A;  3EMS A;  252L A;  1GF7 A;  4NGY A;  3NY9 A;  3FI5 A;  1CKC A;  1QTZ A;  1ZVY B;  1C67 A;  4GCE A;  1G0J A;  3CT1 A;  2W1M A;  2F32 A;  2NTH A;  1UA6 Y;  4ARM B;  1IR7 A;  1L49 A;  4W94 A;  4GN3 A;  4W52 A;  1FN5 A;  1GPQ C;  4H8Y A;  4G49 A;  1BWJ A;  167L A;  2LHM A;  2RBP A;  206L A;  102L A;  4OWE A;  1GEZ A;  2BQA A;  119L A;  129L A;  1GDW A;  4LGK A;  5L3H A;  1REX A;  1LZE A;  187L A;  1LKS A;  1L57 A;  1L39 A;  1P46 A;  4W54 A;  1PQI A;  2F4G A;  4YM8 A;  207L A;  1LSD A;  1HF4 A;  5LYM A;  1VDP A;  4W57 A;  125L A;  1C6P A;  1G0Q A;  5APF A;  123L A;  4DDC A;  3A8Z A;  225L A;  4B4I A;  1C69 A;  3A34 A;  2HED A;  108L A;  1GB2 A;  1JIS A;  193L A;  257L A;  2HEC A;  150L A;  165L A;  4KXI A;  1NF5 A;  1LWG A;  1CX7 A;  1DYE A;  2BQJ A;  4DAJ A;  2BQH A;  1LI2 A;  1CUP A;  3DKE X;  4PPO A;  1GBX A;  2RH1 A;  2HUM A;  256L A;  1OV5 A;  1LCN A;  166L A;  5I4X A;  1OUE A;  2LZT A;  1IY3 A;  4I0C A;  1L03 A;  1DI3 A;  1LZ6 A;  4I7M A;  1GB5 A;  1LZS A;  3L2X A;  5FDJ A;  1IOR A;  4OWA A;  1XJU A;  2BPU A;  3HWL A;  4H9E A;  1L04 A;  3TMX A;  3V2W A;  4LYZ A;  4EJ4 A;  3WUN A;  3A94 A;  4PJ2 C;  1D3N A;  1GFT A;  253L A;  3OE6 A;  163L A;  1L05 A;  2YVB A;  1QTC A;  4DJH A;  182L A;  4NHI A;  3P65 A;  1C6H A;  137L A;  1W08 A;  243L A;  3HBE X;  3WUM A;  1GF5 A;  4GCC A;  3PDS A;  237L A;  5T3F A;  4XN6 A;  1L23 A;  2MEF A;  1D3F A;  4TX7 A;  5D5C A;  1L88 A;  2C8P A;  1WQR A;  2B74 A;  1H87 A;  4RDS A;  4DQJ A;  1IP7 A;  2BQK A;  1GE1 A;  1BWH A;  4GCB A;  168L A;  1LAA A;  5L3I A;  1L86 A;  2ZIL A;  4H93 A;  3W6F A;  3AW6 A;  1B5V A;  4G4H A;  224L A;  1LZN A;  1C6J A;  4WG1 A;  4ZEE A;  142L A;  213L A;  1FBI X;  5I54 A;  1OUG A;  4Z98 A;  4ARL A;  3DN0 A;  5B59 A;  1WTM A;  4RW1 A;  153L A;  1C45 A;  1B7P A;  1GB6 A;  1NKH A;  1GBW A;  5DLA A;  1LZA A;  1YL0 X;  7LZM A;  1UIG A;  1B2K A;  2BLX A;  183L A;  4NFV A;  1EQ4 A;  2IHL A;  3CSQ A;  3WXT A;  6LZM A;  1LZC A;  4EMN A;  2B6T A;  2I25 L;  1D0M A;  2LZM A;  4UWN A;  1QSB A;  2RSC A;  5D5F A;  1JJ1 A;  2YBL A;  194L A;  2CGI A;  2YSS C;  228L A;  1L24 A;  1C6A A;  4H91 A;  1GFH A;  1HC0 A;  1P6Y A;  4LFP A;  2G4Q A;  1L71 A;  1L48 A;  2G4N A;  1LSN A;  3ATO A;  3C80 A;  4YXA C;  3WU8 A;  1OVJ A;  2OU9 A;  3HTG A;  212L A;  4HJY A;  5B06 A;  3HTD A;  2B6X A;  1DYG A;  4FJR A;  5FEK A;  3DN8 A;  4J1A A;  1CV6 A;  4WM2 A;  242L A;  1C68 A;  1LYF A;  178L A;  1D9W A;  2BQN A;  1DKJ A;  1LMT A;  1TDY A;  1KY0 A;  1OYU A;  1OQM A;  1QUD A;  4LT2 A;  2MEB A;  5KXX A;  205L A;  1LJ4 A;  1L22 A;  1GF0 A;  1OUC A;  197L A;  1L59 A;  3EBA B;  2ZIK A;  2YBH A;  3LZ2 A;  4M4O A;  1GE4 A;  4A7D A;  1PQK A;  4NSG A;  3CQL A;  1C43 A;  1C08 C;  1F0W A;  1JWR A;  4NGI A;  1BGI A;  1IWW A;  3DN4 A;  244L A;  1INU A;  1L25 A;  1J1O Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...