1LTMA

Accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
320
structure length
309
Chain Sequence
b'EPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 36 KDA SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Accelerated X-ray structure elucidation of a 36 kDa muramidase/transglycosylase using wARP.
pubmed rcsb
source organism Escherichia coli
molecule tags Glycosyltransferase
total genus 111
structure length 309
sequence length 320
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1ltmA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1ltmA02
3WXUA 4IASA 1NKHA 1UCOA 1XEKA 2BPUA 4LYCA 2Z2FA 1NWGA 207LA 2BQDA 2BQFA 1INUA 5B1FA 4TX7A 1QIOA 1RFPA 1BHZA 1JTTL 1UIEA 2H5ZA 3GXRA 1QTEA 1GD6A 1KXWA 4WM1A 5B06A 4XJBA 4CFOA 1B5ZA 5LA5A 134LA 1LMQA 3AGIA 1JKCA 1SLYA 2YBNA 2DQGY 1AZFA 1LZCA 2YVBA 3QNGA 4G9SA 3T6UA 1YIKA 1LZRA 4NGOA 3B0IA 1N4FA 3A92A 1QUSA 2G4PA 3MGWA 2DKVA 4GLVA 4CHXA 3AGGG 4NGYA 1OUEA 1YKZX 3G3BB 1DQJC 3WPKA 5HQ1A 1LJEA 1HF4A 2ZNXY 1C43A 5KKIA 4WLDA 2EKSC 4NSJA 3ZVQA 1FN5A 4ETEA 2N5ZA 1HFZA 1IWXA 4NSIA 1LZ1A 3WU8A 1OUDA 2MEEA 1D0KA 4HJYA 4PRUA 1MELL 1JIYA 5I4XA 1GB7A 4WG1A 4EMNA 1DKKA 2LZTA 1REZA 2IHLA 3B0KA 2LYMA 2BQGA 3CT5A 1VDTA 2C8OA 1LHKA 4ML7A 3W6EA 4LT2A 1IP5A 3W6AA 1IR9A 4YEOA 4G49A 3P65A 4G4BA 1KXYA 1WQRA 4QY9A 3HBDA 4KL7A 3P68A 4WM5A 1LJIA 2BQHA 3D3DA 3BKHA 5T3FA 4H9IA 5F14A 4W94A 1UIHA 3TXIA 3CQLA 6LYTA 1OP9B 2FBBA 1I1ZA 3RW8A 1GB8A 4WOAA 2HEAA 3IJUA 2F4GA 4DD9A 5C6LA 2ZIJA 5KXXA 1D0LA 5B05A 4GN4A 1QDTA 1IC4Y 1GF7A 1REYA 3B0OA 1IR8A 1HEWA 1LJHA 1IWUA 1NQIA 4GCCA 4XADA 4PRQA 2Z2EA 7LYZA 4N9RA 5AMYA 1IORA 4HPEA 2HU1A 3QY4A 1GEZA 1YQVY 1IR7A 1HEOA 1FKVA 4E3UA 2YBMA 1IIZA 1FLQA 1QQYA 4XN6A 4HJZA 1NMMA 5LYZA 1IP1A 1BQLY 1GBWA 2BLXA 5KXYA 4LT0A 1LYZA 1A2YC 1PZYA 3TXDA 4WLXA 4WM6A 3TXJA 1EL1A 1OQMA 2BQJA 4NG1A 4OWBA 2D91A 1WQQA 1GF0A 1OUIA 1PS5A 4NHQA 3WPLA 5B07A 1GPQC 1OUGA 4UWVA 5APFA 5LA8A 5L3HA 2F2NA 1IEEA 3CSQA 3WMKA 1H6MA 2C8PA 1GAZA 1LJ3A 2W1LA 1GBZA 2G4NA 3LN2A 4LFXA 4ZFPA 1I56A 3OK0A 4Z46A 1DI3A 5I4YA 1RCMA 5LXWA 5FCPA 1VFBC 1Z55A 1LSBA 2MEIA 1ZVHL 4R0FA 1E8LA 1LYSA 3WULA 5LYMA 3P4ZA 4O34A 4XJHA 1TAYA 4WLYA 5LAGA 2CGIA 3T36A 5KXTA 4M4OA 3TXEA 1NBZC 2BQBA 3IWRA 4ZEEA 1NDMC 1QTKA 1LZTA 3CB7A 1GE0A 4DD1A 3RZ4A 1QUTA 5LINA 5D5FA 1GWDA 4N1CC 1J1OY 1JHLA 1LPIA 1YL0X 2MEFA 3EXDA 2ZIKA 4UWUA 2HEEA 1CKCA 1JISA 1TDYA 5LVGA 1ZVYB 2BAAA 2Z37A 3TXFA 1JTOL 1VDPA 1GHLA 1QSWA 4NY5A 1OUCA 3IJVA 1LJFA 1ZMYL 4HTKA 1GFKA 5KXMA 5II3A 1IWVA 1OUJA 3EBAB 4QGZA 5DN4A 5I53A 1LSAA 1GE3A 3TMWA 1YAPA 1B7OA 1KIQC 3BKVA 4HV1A 1F10A 3A6BY 5LVKA 1BGIA 1B5VA 1IP3A 3RU5A 1DI4A 3M3UA 1B7SA 4BAFA 8LYZA 4MCKA 1LZSA 2BQEA 1G7HC 5B1GA 1EQEA 1GF4A 1LHHA 2B5ZA 3FI7A 4EOFA 1LSCA 2HUBA 3FE0A 1XGUC 1LZ8A 2LYZA 5APEA 1AT6A 3EMSA 1JUGA 5KKJA 4J1BA 1GXV2 4XYYA 5HMVA 1LZEA 1BWHA 1KXXA 3TMUA 1W08A 1GFHA 4DDAA 1GB5A 2DQCY 2DBTA 5L3IA 1WQOA 5APCA 208LA 5IDDA 193LA 5IELA 4OWHA 4OOTA 3A93A 4H8XA 2AUBA 3F6ZA 1CJ8A 4H9EA 1UIDA 4LZTA 4HJVA 5HLLA 1JSEA 5FHWA 1HEQA 4H90A 1GE1A 4RDSA 3ATNA 1JJ3A 1LZAA 1F6RA 194LA 1XGPC 1MLCE 1JKDA 1FKQA 4WM3A 4WO6A 1J1XY 4L41A 4NGZA 5FELA 1LHLA 2MEGA 4H9BA 4YEMA 1IWWA 1CJ6A 1IY4A 1GFVA 4R6CA 1B5WA 4FDYA 2HTXA 1LMPA 3E3DA 2H9JA 1SQ2L 5J7CA 2Z18A 4ZIXA 2A7FA 4DC4A 1IC7Y 5I4WA 3EO5A 4DWXA 4H1PA 1KIPC 1GDWA 1LSPA 4H93A 2HECA 135LA 4NSGA 4BAPA 1XGTC 2XTHA 1BB7A 1UA6Y 4GN3A 1VDSA 3LHMA 3LYTA 3WUNA 4NGJA 4NHIA 2MEHA 4LYTA 1IO5A 3HFMY 4HV2A 1ZV5L 1JJ1A 5KJ9A 5ILCA 1I20A 5A3ZA 4HPIA 5KXWA 4J1AA 4WMGA 2BQOA 1BB4A 1D6QA 4PPOA 1IOTA 2DQHY 1RJCB 4GCEA 4WO9A 4BS7A 5K7OA 2I25L 1GFGA 1LSGA 4XJIA 3ULRA 4NG8A 4TTDA 4N8ZA 133LA 2HU3A 1BWJA 2D4JA 2ZWBA 1GFTA 3K3TA 1F6SA 4CGEA 1GB3A 5KXZA 4FJRA 1IWZA 1JPOA 1HFYA 5E4PA 4J0LA 2BQCA 5KXPA 1FLYA 2DQAA 2GV0A 3W6BA 1CKFA 1KIRC 1YKXX 1B0DA 4XENA 1TBYA 1LHIA 6LYZA 2DQJY 3LZTA 4NEBA 4H9AA 1JITA 1LMNA 1GAYA 3AZ6A 3AJNA 1YAOA 1IP4A 1DPXA 3D9AC 5KXSA 1WVUA 4ANRA 1FLWA 1JTPL 1LKRA 1LOZA 1G7LC 1GBXA 2BQKA 1QDRA 3CSRA 1GF3A 1B5YA 5APDA 5IHGA 3M18B 4H9FA 4PHIA 3TXBA 1B5XA 1HC0A 1GFJA 5C6JA 4D9ZA 1D0MA 5HMJA 5EBHA 5KXKA 1GXXA 5KXOA 4MR1A 1LJJA 1EQ5A 4XJDA 2W1XA 1LSNA 1BB3A 4ETDA 5JENB 1UIAA 1UUZC 1WTMA 4DT3A 1FLUA 2I6ZA 4NHPA 5DLAA 1LZDA 1HSXA 1IVMA 1GB2A 5KY1A 4UWNA 2ZILA 1LMCA 1C7PA 1GFAA 1LZ4A 2WARA 2YBLA 4II8A 4C5FA 4TSBA 4TWSA 3RNXA 4B1AA 4C3WA 1LZBA 4GCBA 3W6DA 1REXA 4DDBA 1LAAA 5I54A 1B7QA 2PC2A 5LVIA 1F0WA 2BQAA 2LHMA 4RLMA 1LKSA 1J1PY 4B49A 4LT3A 2F30A 4J7VA 1C45A 1CNSA 3AW7A 5C6IA 5DM9A 4HTQA 4B4JA 4G4HA 1QSAA 4NGIA 4OWAA 4P2EA 4B0DA 1JWRA 1XEIA 3A34A 1XSFA 1HERA 1D9UA 1OUBA 3WW5A 1W6ZA 1JKAA 2A7DA 3A67Y 5LAFA 1VEDA 2DQDY 3G3AB 5F16A 1DI5A 2BQNA 1GB9A 3WVXA 1GF8A 3KAMA 2MEDA 4QEQA 1LSDA 2DQIY 1NBYC 2YDGA 4X3BA 1AKIA 1G7IC 1JSFA 1LYYA 1DXJA 154LA 4OWEA 5F81A 4IATA 1LTMA 1LZYA 2CWIA 2BQLA 1B9OA 2D6BA 5I5QA 1OUFA 2DQFC 1BWIA 3A3RX 2I26L 3A96A 1GF5A 3AGHA 1GB6A 4YOPA 3W6CA 2FYDA 1GEVA 1IC5Y 1IX0A 1LHJA 4NWEA 1REMA 1HMLA 1LZ5A 2D4KA 1JKBA 1AM7A 4KXIA 5DL9A 1UACY 1C46A 1CJ7A 4LYBA 4G4CA 4DD7A 1IP7A 3A94A 4N5RA 4NGLA 4LFPA 3WVYA 4DYGA 2D4IA 3LYZA 4CJ2A 1D6PA 5DN5A 4A7DA 1GBSA 1BB5A 4H8YA 1B7MA 5LVHA 5KXNA 4IJ4A 2BLYA 4KT3A 1HELA 3P64A 4N0JA 5D5CA 3A91A 1CKGA 1LJ4A 3WU7A 153LA 3N9AA 1HMKA 1T3PA 4M6DA 2XBRA 4Z41A 4XJFA 5LVJA 132LA 1UC0A 4H9HA 5A3EA 2FYCA 5HNCA 1GBYA 2Z12A 2ZQ3A 3W3EA 4HP0A 4Z3MA 1NDGC 4U3XB 1LMAA 1LMTA 2NWDX 1GF6A 5FEKA 4YM8A 1YILA 2HEBA 3CT0A 2EIZC 4DD0A 3WU9A 4ET9A 1LJGA 5L9JA 4HTNA 1B7PA 2LZ2A 1IOCA 1HSWA 4W96A 1GBOA 5LYTA 1NF5A 4LYOA 4H94A 1O23A 3WH1A 4NWHA 1ALCA 1WQPA 1H87A 4KPMA 5F9XA 2MEBA 3SP3A 1A4VA 1BB6A 1WQNA 2BQMA 1YAQA 1YROA 4DD2A 5M1YA 4BADA 4H91A 4B4EA 4WLTA 5LIOA 1UBZA 3WYHA 1AT5A 4YF2A 4NGVA 1LSMA 4QDNA 2H9KA 3ZEKA 1CJ9A 1LSEA 2IFFY 3P66A 1CKHA 2EPEA 1G7JC 3RT5X 4ETCA 2CJLA 2W1MA 1B7RA 4PGJB 1LZNA 2G4QA 1RI8B 3VWOA 2X0AA 2ZYCA 1IY3A 4AGAA 1IWYA 4MSTA 1DKJA 2Z39A 1XEJA 1CKDA 3CSZA 1B5UA 2YBHA 5FSTA 3HBEX 3TXGA 3AW6A 3J4GA 2ZYPA 3HBHA 1VATA 4RW1A 1BVXA 1LHMA 3LYMA 4HSFA 4NIJA 4NHSA 3TMVA 3AB6A 4GCFA 3TXHA 1YAMA 1IP6A 3OJPA 1YANA 1IP2A 1BVKC 3AZ7A 4NGKA 3WUMA 4WM2A 1LZ6A 1HNLA 4N1EI 3ATOA 1V7SA 1HEMA 1XGQC 1GFEA 1IOQA 1DZBX 1YL1X 3GXKA 4GLAA 3AZ5A 3A95A 4WG7A 4WM4A 3AZ4A 1RE2A 1GE2A 1FBIX 3B72A 4ETAA 4H9CA 1GFUA 1YKYX 1IWTA 4XJGA 3LYOA 2VB1A 2MECA 1VAUA 3AYQA 1HHLA 4OOOA 4TSCA 3TXKA 3WL2A 5KXLA 3WXTA 1OUAA 1UIBA 2Y8PA 1LZGA 2LYOA 2XJWA 1UIFA 3A6CY 1IOSA 3N9EA 1JJ0A 3LZ2A 1LMOA 1LSZA 1WQMA 2ZNWY 4RW2A 1B7NA 4WL7A 1OUHA 4NFVA 2HEFA 2YBJA 4AXTA 1C10A 5ILFA 2Q0MX 1TEWA 3TMXA 4OW1A 1NHEA 4LYZA 1T6VL 3B6LA 2ZQ4A 2XBSA 3WW6A 1DPWA 4GN5C 1JEFA 4GCDA 4TUNA 1GF9A 3ZVQB 1LSFA 1C08C 1HFXA 1GE4A 1VDQA 3A3QA 4DD3A 1EQ4A 4NGWA 4LGKA 3W6FA 1P2CC 1LJKA 1V7TA 1LYOA 4RLNA 1WTNA 1LSYA 1UIGA 4H8ZA 1LZ9A 1TCYA 4NSHA 4LYMA 1LCNA 1B7LA 1FDLY 1HENA 4H92A 4NHTA 4CFPA 3J6KA 5HNLA 4I8SA 2FBDA 4B4IA 2Z19A 4WL6A 2YSSC 2EQLA 1B2KA 3N9CA 4OWCA 1GDXA 2BQIA 2RSCA 1UICA 5KXRA 9LYZA 2HEDA 3A90A 4ETBA 2W1YA 3A8ZA 1HEPA 4I0CA 4DDCA 3QE8A 5E9RA 4PJ2C 5F9UA 1GFRA 1LJNA 2DQEY 2YBIA 1XGRC 2F4AA 2MEAA 4YENA 1GB0A 1WVVA 2CDSA 1G7MC 4Z98A 3WPJA 4ET8A 2Z38A 1XFPL 4LT1A 5B59A 3WUAA 5FDJA 3CT1A
chains in the Genus database with same CATH superfamily
4OVZA 3WXUA 2JP7A 4IASA 2Z2FA 1NWGA 3HH4A 1JTTL 4I7MA 1GD6A 1PJJA 3CDQA 3U6PA 1L53A 2DQGY 1SWYA 3QNGA 1YIKA 1SXJB 1L54A 3OE8A 1LZRA 1N4FA 3MGWA 1LI2A 3SATA 249LA 3AGGG 2KZUA 201LA 4JI7M 3H4JA 5F3WA 3ZVQA 3D8BA 3HHZA 3C81A 4IBGA 1SX7A 4ETEA 1HFZA 1IWXA 3WU8A 4PJZA 4GRVA 1YSYA 4HJYA 1JIYA 1YE9A 102LA 3EIEA 1G4AE 3U61A 1DKKA 3CT5A 2C8OA 1GJSA 4ML7A 3HZJA 4YEOA 1L37A 2CUUA 1QZMA 2NTHA 2L4FA 260LA 3KOZE 3UGJA 3HTGA 3P68A 1LJIA 5T3FA 3MJ5A 4H9IA 3HU8A 1OP9B 3RW8A 1IBMM 4WOAA 221LA 1HNXM 219LA 1CUKA 5KXXA 4QNMA 1D0LA 5ITRA 4B3MM 1REYA 1IN7A 3B0OA 2HUKA 1L93A 1LJHA 1IWUA 4GCCA 4XADA 1T8GA 230LA 4PRQA 1L22A 5AMYA 4HPEA 111LA 2DXIA 4FWDA 1GEZA 3B7ZA 4AQYM 1FLQA 1QQYA 3NY9A 1TGUA 1G1VA 1IP1A 2BLXA 1GBWA 3F8VA 5KXYA 211LA 4WM6A 3TXJA 2DVWB 3I01M 1L05A 1L80A 1OQMA 4NG1A 4RF1A 1GF0A 4UWVA 5L3HA 2NQ8C 1G71A 2F2NA 1IEEA 3U60B 2ZM6M 1RU3A 2O7AA 2LNHC 189LA 4LFXA 4EKRA 2JZ0A 4ZFPA 3OK0A 1DI3A 5I4YA 2YFQA 1JR3E 1Z55A 1LSBA 255LA 3GUOA 2MEIA 5A2QS 4Q7JA 4R0FA 182LA 236LA 1OV7A 5LAGA 5KQDA 4BBAA 1XJUA 1GE0A 4LGMA 3SASA 1QT3A 1JHLA 4UWUA 2HEEA 5LVGA 1VDPA 4DQ7A 3E46A 1R5LA 4HTKA 3CTWB 1GFKA 3IG8A 5KXMA 1OUJA 3EBAB 5I53A 5ITQA 1F10A 2CUZA 3AOEA 3TWLA 2J7OA 4MCKA 1LZSA 3Q8XA 1LHHA 3FI7A 1LSCA 2B72A 5IREB 1L43A 4J1BA 5KKJA 1LZEA 1L59A 3AV0A 252LA 2L7HA 4F1IA 1WQOA 3RZEA 5E6JA 5IDDA 193LA 1HNWM 1IN4A 1L92A 3A93A 3F6ZA 4L16A 4EXMA 4E97A 4ARJA 3OTOM 2N35A 4WO6A 1G41A 4GC5A 3J80S 1JKDA 1YUBA 1MLCE 1DGHB 4NL4H 4YEMA 2CE7A 3PDSA 3RGSA 4I7TA 3SFZA 1L21A 2D7HA 1HT2E 1L95A 1G07A 4XBOA 2UUAM 3A42A 3GLGA 1ZURA 3EO5A 1GDWA 2KEBA 2HECA 1IBLM 3SB8A 1L10A 3WHKA 2RB2X 4IBEA 2UXBM 3SBAA 3HFMY 4HV2A 5KJ9A 1ZV5L 3V2WA 1L47A 3HX3A 4FW9A 4WMGA 2BQOA 4PPOA 2DQHY 4BS7A 3FADA 1DYFA 1LSGA 4JV5M 3K3TA 2YR0A 1KY1A 4CGEA 1T6OA 1L64A 1HFYA 2B6XA 130LA 3FD9A 3HGIA 8CATA 4X66M 2EO2A 1NV8A 2KZSA 6LYZA 3LZTA 4L6V6 4NEBA 4H9AA 3A46A 1YAOA 4IIWA 4LDEA 1WVUA 4ANRA 3J2PB 2BQKA 1LOZA 3CSRA 3FYDA 3M18B 4PK0A 4I7RA 3TXBA 3SYKA 5KXOA 1LJJA 2APLA 1CX7A 4BLCA 1BB3A 5JENB 1I94M 2OQ4A 3DMVA 2J5YA 2RBPA 5DLAA 4NHPA 1HSXA 4KODA 2LTUA 1DYAA 1GFAA 2YBLA 1QSQA 3RNXA 1L2CA 4ARQB 1LZBA 254LA 3KS4A 5LMUM 5EP4A 3W6DA 2PC2A 2LHMA 4B49A 4LT3A 1L18A 4J7VA 3GLFB 3LCVB 1BVSA 4NGIA 4LF9M 1JWRA 1XEIA 5KPRA 2ZANA 1D9UA 1OUBA 4L15A 3GPYA 1VEDA 2DQDY 2IGCA 3GPXA 3G3AB 2O4WA 4AW4A 1L61A 1Z5CA 2DQIY 1NBYC 2QP9X 1LYYA 1IXSA 4OWEA 3L28A 2G8LA 137LA 1CU6A 4PT5A 1B9OA 2D6BA 4XGIA 4B7HA 3AGHA 2FYDA 1QTDA 1GEVA 1IX0A 2R6FA 5EP1A 3HU3A 2D4KA 2MR9A 2O25A 3QYBA 2C99A 4LFPA 3WVYA 3CDVA 4DYGA 5DNYA 1D6PA 3UMMA 1BB5A 5LVHA 3J81S 1C65A 2BLYA 1CKGA 1L02A 1LJ4A 2R46A 5DYGA 4Z41A 173LA 2QB0B 1ORYB 2O5RA 1GBYA 1TLAA 1WHCA 2Z12A 4IBDA 2ZQ3A 1E9RA 4HP0A 3VK8A 4U3XB 1LMAA 2NWDX 3FTFA 1GF6A 4YM8A 1NNJA 2X49A 3U6SA 4HEOA 3W0LB 1QT6A 1B7PA 5FTLA 1L2DA 1L79A 3GP1A 4EJ4A 4W96A 2CFOA 5EQTA 1NF5A 2DWZB 1GL7A 229LA 1L83A 2WSCF 2DHYA 1A4VA 1P6YA 2J7NA 1WQNA 3T1HM 1G0PA 2L6OA 3FKEA 1UBZA 1AT5A 1OTRA 3K9OA 186LA 2H9KA 5FTKA 1CJ9A 3ZEKA 1G7JC 2DAKA 3ODUA 3HJQA 1L2BA 3VWOA 2X0AA 1KY0A 1VEGA 1IWYA 4MSTA 2Z39A 1B5UA 4NC6A 3HY5A 2P5TA 195LA 1G06A 3AB6A 3TXHA 2K6BA 199LA 1LW9A 1D2WA 1YANA 2B6TA 1L90A 4W56A 4NGKA 2EA0A 3D8LA 158LA 1LZ6A 3QYEA 129LA 4KO8A 4N1EI 1IXZA 4BB9A 1GFEA 4A3VB 1DZBX 1YL1X 1LYJA 1XMQM 3AZ4A 1GE2A 1FBIX 4OVZB 159LA 4H9CA 2G3QA 4XJGA 2JUJA 2WZJA 3LYOA 3AYQA 4OOOA 161LA 3U5ZA 1UIBA 3NBXX 4CISA 3A6CY 2QPAA 3N9EA 4P17A 4RW2A 4WL7A 1YLAA 3C3EA 3B7NA 3FYCA 1LYDA 2YBJA 4AXTA 1C10A 2XGNA 198LA 1PQOA 3B6LA 3KOWE 2XZUA 3ZVQB 4TUNA 1GF9A 1Z59A 3PXGA 239LA 3KS8A 3DN8A 4IBKA 1V7TA 4UN2B 3U61B 1L58A 1LSYA 4NSHA 4LYMA 1B7LA 2BNKA 4CFPA 4NHTA 3C8SA 3J6KA 4DV6M 1L51A 2Z19A 4WL6A 2KDLA 1EE8A 1B2KA 2B3TA 3KXEC 2KW0A 1P36A 4YX7C 2BQIA 5KXRA 2HEDA 1I6SA 3A8ZA 3BOSA 5I54A 1GFRA 2YBIA 1XGRC 2MEAA 4LZZA 1XFPL 4DV0M 1KW7A 1LI6A 1NKHA 1UCOA 3OE9A 1OVJA 2BQDA 2BQFA 5B1FA 4TX7A 4M0DA 1QIOA 1BHZA 1UIEA 1JQUA 1QTEA 1HQCA 5LA5A 5B06A 4XJBA 1MU5A 3AGIA 1SLYA 2YVBA 4PDGA 2F5QA 4G9SA 2DKLA 4NGOA 2C96A 2G4PA 4CHXA 4NGYA 1OUEA 2RH1A 3WPKA 1DQJC 1HNZM 2ZNXY 5KKIA 1L42A 4WLDA 4NSJA 3HT7A 1FN5A 1NVMA 150LA 157LA 4NSIA 3NY8A 3FUWA 131LA 228LA 1REZA 2IHLA 5I14A 1T3TA 2BQGA 1LHKA 4II7A 1ZQ9A 4G4RA 1IP5A 2OOBA 1L08A 243LA 4Y28F 1IR9A 3HJ8A 3W6AA 4G49A 4G4BA 2V1CA 176LA 109LA 1WQRA 2WSEF 4X65M 1IBKM 1DGFA 4LCBA 4LF4M 4KL7A 1L98A 250LA 4WM5A 1L46A 237LA 3BKHA 5F14A 1R6BX 2OTYX 3L64A 2FBBA 1OV5A 1GB8A 4JXJA 4DD9A 2ZIJA 4LF7M 5B05A 1IC4Y 3J7AS 172LA 4DAJA 3KFUG 4B08A 1HEWA 1NQIA 1IN5A 1DYGA 3FTEA 2Z2EA 2B6ZA 4N9RA 3HHWA 4I7QA 2HU1A 5LZMA 1YQVY 210LA 5GKNA 1FKVA 4E3UA 1XB2B 3T6PA 5LYZA 1BQLY 3VFDA 1PZYA 1P2LA 4ZPXA 3VW7A 2C5RA 232LA 1OUIA 1PS5A 3F9LA 3WPLA 1GPQC 4LF5M 1OUGA 3TQSA 1OVKA 1H6MA 1LJ3A 2W1LA 3T38A 2HL7A 1I56A 1CV0A 1VFBC 1DYDA 3SB6A 3K2LA 4AG5A 4LZJA 2V1UA 5LYMA 155LA 4WLYA 3T36A 4M4OA 2UU9M 3IWRA 4P16A 3CB7A 2EUCA 2RB1X 4WP2A 1T97A 1OJLA 4LRTA 2DWLA 3SYLA 1YL0X 1T8FA 3FI5A 2Z37A 3TXFA 1JTOL 4K5YA 1QSWA 2FFJA 4JI0M 224LA 1OUCA 3WHLA 3GLGB 1CU2A 4DV3M 3AOEC 4QGZA 4MM3B 4YHHM 1KSFX 1ZYTA 4L4UA 1LSAA 168LA 3TMWA 1B7OA 3BKVA 1L88A 1CVKA 2CHGA 3EMLA 4LFAM 148LE 4BAFA 3U6LA 3GRRA 8LYZA 2VQFM 2R4EA 3SB5A 1WIVA 4W5WA 1G0LA 1G7HC 4DQ5A 1T6HA 112LA 1C69A 1GF4A 2HUBA 1Z5AA 1AT6A 1JUGA 1GXV2 4FCWA 1L69A 5HMVA 1AIPC 1KXXA 3TMUA 1W08A 1L33A 1GFHA 1R4GA 1GB5A 2DBTA 4B3SM 251LA 2JZ1A 208LA 1SSWA 2DAGA 1WR1B 1QT5A 2AUBA 2X4AA 1UIDA 4HJVA 5HLLA 4I7KA 1HEQA 2B73A 1L40A 1N36M 1DYCA 1JJ3A 194LA 1F6RA 4WM3A 3SB7A 1L74A 4L41A 5FTNA 1L1TA 4H9BA 3VDUA 4IBJA 4EKQA 4CIZA 2RB0X 3HUKA 3LCUA 3ZC7B 3GLIE 1KYIA 5DFLA 1IC7Y 3B9PA 2F2QA 1KIPC 1LYHA 4D80A 3L2AA 4NSGA 4S12A 3HU2A 3JR4A 2Z8YM 1XGTC 3BXWA 2XTHA 1UA6Y 3LHMA 4NGJA 1OKSA 103LA 216LA 4LYTA 3LQQA 3L27A 4LDOA 225LA 152LA 1TH2A 1XXHE 3G3WA 2LZMA 4WO9A 1PGYA 2I25L 1GFGA 5DYIA 3ULRA 4NG8A 2HU3A 5JI2E 1BWJA 2ZWBA 2LVAA 4NRVA 2UXDM 1L89A 1F6SA 1GB3A 1JB0F 5E4PA 1FLYA 3AKZA 1CKFA 2DAEA 1KIRC 4XENA 4FVMA 1LHIA 2DQJY 4ARPA 3M0EA 5ITYA 3OE0A 3AJNA 2KNVA 5L3IA 2RBNA 1LKRA 5L8RF 1G7LC 1GBXA 3HWSA 1IXSB 4LFBM 4CHTB 1GF3A 1B5YA 209LA 3R8FA 1SWZA 1GFJA 4DUZM 1D0MA 3SAUA 5EBHA 1NHWC 2ERCA 2RGHA 1EQ5A 4XJDA 2F4VM 1QUDA 1XXHA 1UIAA 3KSJA 1FLUA 2DI0A 4Z6YA 220LA 1IVMA 5KY1A 1K28A 4AKHA 1LMCA 1G8PA 4LJAA 1F4IA 222LA 4C5FA 1PRBA 4B1AA 1PQMA 261LA 3GUNA 3GLHB 2K9DA 1REXA 1OFIA 2FE8A 4GEWA 1L36A 5LVIA 1F0WA 2XEPA 2BQAA 4R71A 4B3TM 3IHPA 2F30A 1CNSA 4DKLA 4B4JA 5DM9A 2LVPC 4B0DA 3RGPA 1L63A 4M9XA 3C7WA 1HERA 3DN1A 3A67Y 5LAFA 3FE3A 2C9CA 1Q39A 5F16A 1VDLA 2Y21A 1KFVA 165LA 1XJTA 6LZMA 4QEQA 1JR3A 4I8OA 4MGIE 5JI3E 2DZOB 4GITA 1V34A 3K92A 2BWBA 3H4MA 139LA 4IATA 1LTMA 3A45A 1LZYA 5F81A 3DZDA 4LF8M 5E26A 2CWIA 1MN3A 1BWIA 1E94E 3A96A 1GF5A 4YOPA 3W6CA 2D7EA 4RNAA 4NWEA 4KT0F 1REMA 1Q3CA 1LZ5A 1JKBA 1C6JA 1C46A 4LYBA 246LA 1C67A 2JXNA 3A94A 4N5RA 4CJ2A 2QQ8A 2HUMA 1T8AA 4A7DA 2W82A 1TDHA 1QUGA 4IJ4A 1C6LA 1CV4A 1HELA 3MK6A 153LA 4KHPM 4DJHA 127LA 1W5SA 3AJIB 2XLJA 1T3PA 3KP0E 4I7OA 4M6DA 3C3DA 4XJFA 1J09A 1J5EM 1IN8A 1C6MA 3GUKA 1VDDA 5A3EA 2FYCA 1XC8A 1CU5A 4B7GA 1C6GA 4OU7A 2UUBM 3W3EA 4Z3MA 2R45A 4GH9A 1LMTA 4LDLA 4NRWA 1SXJE 1K3XA 234LA 2L78A 3T1YM 1IOCA 1HSWA 1NV9A 3PNVA 3HH5A 1TDZA 3U5ZB 3JR6A 2BJVA 4ITQA 2XFTA 4NWHA 1WQPA 1H87A 1L39A 2RBRA 3SP3A 162LA 5M1YA 1QTCA 4WLTA 5LIOA 3CF6E 3AFHA 1LSMA 4QDNA 1IFYA 3HDFA 1LGXA 3NWLA 2W1MA 1B7RA 3UONA 4PGJB 3BBZA 1D3FA 2ZYCA 1L06A 2RAYX 1DKJA 5FLXS 3CSZA 4QOSA 3THGA 2YBHA 1PJQA 5FSTA 3AW6A 3J4GA 3HBHA 4GHLA 1L87A 1LHMA 4WW0A 4NHSA 2O01F 3OJPA 4ZPUA 3GQ5A 1IP2A 1BVKC 3AZ7A 4G4OA 4WM2A 2Q9DA 1HNLA 2MH8A 4REZA 3KP1E 1LV7A 118LA 5ITTA 1XGQC 1QQWA 138LA 5IHGA 4WG7A 3C83A 3DN0A 3GXKA 3AZ5A 4PD2A 1LLHA 2RBOA 5KO3A 1SX2A 3CF2A 1VAUA 4MH0E 1HHLA 3TXKA 3M6AA 175LA 2QSFX 4G6ZA 2LYOA 1UIFA 2EKFA 1P64A 2DENA 2CWBA 4M0WA 1WQMA 2ZNWY 1B7NA 4MGYE 4MGKE 1MJGM 5EP2A 5ILFA 2Q0MX 3TMXA 1Y8GA 2HAKA 3DFZA 2M5ZA 3GUJA 3HUQA 4GCDA 3U6OA 2QARC 2B7XA 4YY3M 4GN5C 2LXEA 1GE4A 1VDQA 3A3QA 3A98B 1FNNA 113LA 4NGWA 4OO9A 1C6NA 146LA 187LA 1NNUC 1TCYA 1FDLY 4H92A 2JY7A 1CX6A 2FBDA 3GQ4A 4B4IA 1P2RA 4OX9M 1L96A 2KNAA 174LA 2EQLA 3N9CA 4OWCA 1GDXA 1L97A 218LA 2RSCA 1C61A 4IAPA 9LYZA 3A90A 4ETBA 2W1YA 4I0CA 5E9RA 4I81A 3DN2A 4YENA 4Z98A 2L2DA 3WPJA 1GB0A 257LA 1L52A 2FH0A 4ET8A 4AKGA 1G0JA 4LT1A 3WUAA 2YNMD 1WGLA 5FDJA 7LZMA 1CUPA 1L19A 1R2ZA 1JQJC 1DGBA 3W68A 4LG2A 1INUA 3GXRA 2HCBA 2H5ZA 3G3VA 4WM1A 4NSOB 1KS3A 1B5ZA 1LMQA 1QUOA 1NJFA 1L72A 3T6UA 3FUUA 4L78A 245LA 3B0IA 1PJIA 2L09A 3SARA 4WURA 3A92A 4GLVA 5HQ1A 1HF4A 1C43A 4MGHA 3LW5F 2N5ZA 149LA 1L85A 4L8RC 1OUDA 1D0KA 4PRUA 4FWHA 3C7ZA 3DMZA 2LYMA 4JI6M 233LA 180LA 3SB9A 4LT2A 1ZMVA 2QENA 3FUTA 4AKIA 1KW5A 3P65A 2CV0A 1KXYA 1L91A 3FRHA 4QY9A 2Y20A 1D2YA 1FJGM 125LA 156LA 4D82A 4W94A 1UIHA 2K0BX 2LVNC 6LYTA 1I1ZA 247LA 3U6DA 3IJUA 2F4GA 3U6MA 2MROB 2Q9EA 3Q8GA 4FCTA 1QDTA 1GF7A 2B75A 2RAZX 1IR8A 1I4WA 4MGZE 1L94A 7LYZA 3W67A 3K9PA 1IORA 2HWJA 3QY4A 2Z4RA 1EFUB 1IR7A 1HEOA 253LA 242LA 2YBMA 1IIZA 4X64M 1TH3A 4LT0A 1LYZA 2EKKA 3TXDA 4WLXA 2H1RA 178LA 1L26A 1TF0B 2BQJA 4OWBA 1WQQA 4NHQA 5B07A 2OE7X 3EIHA 3WMKA 2C8PA 4AG6A 1GAZA 5IWAM 3LN2A 2F5NA 166LA 217LA 3U6CA 3CDRA 3DA1A 1RCMA 5FCPA 2A5YB 4LJ5A 1E8LA 3WULA 4XJHA 5KXTA 2QZ4A 1NBZC 3VLFB 4K0KM 3CDOA 1LI3A 1NDMC 4QHSA 1QTKA 235LA 4DD1A 1QUTA 5FTMA 1GWDA 1QYRA 5ITUA 2ZIKA 1JISA 1L76A 1ZVYB 2H5XA 3RUNA 2Q2EB 1GKIA 4I7LA 5FSWA 3IJVA 1LJFA 2OOAA 5II3A 5DN4A 3SMSA 2B6YA 1GE3A 3DN4A 3TWMA 1KIQC 3I4YA 1HJPA 3A6BY 5LVKA 1B5VA 1BGIA 2FNAA 3RU5A 3GPUA 3M3UA 1B7SA 3GLFE 2BQEA 2BJWA 1EQEA 1C6DA 4EOFA 3F92A 3FE0A 1XGUC 1OWYA 2LYZA 5APEA 2KA6B 4ARMA 4XYYA 1NHBA 2CHVA 1C6AA 4JI5M 2VQEM 2ANXA 5EXPA 1PQIA 1QTVA 5APCA 1CU0A 4KLNA 4H8XA 2DWMA 1JSEA 5FHWA 4RDSA 1LZAA 5FELA 1J1XY 1LHLA 2MEGA 2XSZA 1CJ6A 2Z4SA 1IY4A 2D7GA 1GFVA 1TTEA 4GKJM 1QS9A 4FDYA 2HTXA 1LMPA 3E3DA 1L81A 2H9JA 4GHAA 2DZLA 5J7CA 2Z18A 4ZIXA 4DC4A 3GUPA 1L41A 1K3WA 1P56A 4NOOB 2B70A 4H93A 4BAPA 1D3JA 1XXHB 4DV5M 3FTCA 1BB7A 3WUNA 1Z6TA 1VDSA 3LYTA 3GRUA 2RGOA 4NHIA 1IO5A 5ILCA 3KOYE 1I20A 1ZMWA 5KXWA 1H6UA 4HPIA 1G0QA 3TWKA 4J1AA 1BB4A 3FA0A 1IOTA 1RJCB 1L07A 1QS5A 3SBJA 1QUHA 4TTDA 4N8ZA 133LA 2D4JA 3PBLA 1D9WA 1GFTA 3SN6R 5KXZA 2XF3A 4FJRA 240LA 4J0LA 2BQCA 5KXPA 2DQAA 1YKXX 1B0DA 4W52A 1TBYA 1LGUA 1JITA 1L8QA 1LMNA 4IBFA 4W51A 1IP4A 3L29A 1FLWA 3LZMA 3T15A 1JTPL 2VDBB 1QDRA 2LBCA 4DV2M 3QAKA 1DYBA 1GABA 4PHIA 183LA 1B5XA 120LA 5HMJA 5KXKA 1GXXA 1G59A 2W1XA 200LA 1C60A 1V33A 3VK7A 3VDPA 1LSNA 4ETDA 5C18A 1OIZA 4GIPA 3B7QA 1UUZC 4DT3A 1GB2A 123LA 4UWNA 1CUQA 2A4TA 1L77A 2GNOA 1C7PA 2WARA 1LZ4A 4W58A 4II8A 1WGNA 2X8AA 4TWSA 1GO5A 1XEPA 5IT9S 4GCBA 2KXEA 4EKPA 3HHYA 1B7QA 4RLMA 2NTGA 1J1PY 4W59A 1C45A 241LA 1L56A 5C6IA 4OWAA 1KNIA 3A34A 3HU9A 3WW5A 2A7DA 191LA 4FCVA 2C9OA 4DR6M 1DI5A 2BQNA 1GB9A 2MEDA 4DBGB 1N33M 2YDGA 4X3BA 1QAQA 3ZCBB 4DV7M 1L00A 114LA 3HWLA 2CHQA 1XNRM 4DR1M 1NSFA 188LA 1OYUA 5I5QA 2DQFC 2UUCM 1LYEA 3A3RX 1PQKA 2OU8A 1IC5Y 2LVOC 2XSZD 1LHJA 3HH6A 1DYEA 4KXIA 5DL9A 2JY8A 1LGWA 4W55A 4RKUF 4G4CA 4DD7A 1IP7A 4IBBA 1HQYE 3SMPA 1GBSA 4H8YA 5KXNA 4KT3A 3A91A 5D5CA 3WU7A 3E9SA 1L13A 1QAMA 1PQDA 2R0IA 5KQ8A 2XBRA 2KNZA 1UC0A 4H9HA 5HNCA 2DHRA 5B59A 3MHVC 1IQPA 1QANA 122LA 115LA 1YILA 2HEBA 1GVNA 1D3MA 4JI3M 4ET9A 1LJGA 3FTDA 5LYTA 1GBOA 1QT7A 223LA 4H94A 1O23A 4PCZA 4EIWA 1C6EA 3WH1A 1ALCA 3HT6A 1XNQM 1C7YA 3G3XA 141LA 1QVRA 4BADA 1L60A 3WYHA 1LWGA 3DKEX 2R44A 3P66A 1CKHA 2EPEA 2QBYA 2CJLA 5KPTA 1VEKA 4LJ4A 1PJSA 1LZNA 4I7NA 1RI8B 1LPYA 2F5PA 3KDSE 1QAOA 1IY3A 4AGAA 1CV1A 3GLIA 1XEJA 1CKDA 1XMOM 104LA 4S0WA 3HBEX 3TXGA 1SXJC 3K1JA 1L48A 1C6CA 4OW0A 1S3SA 7CATA 3TMVA 4I4LA 4GCFA 1P3QQ 1YAMA 2VF8A 1L0JA 1GLNA 1V7SA 1L01A 1L84A 3A95A 1RE2A 3HKPA 1GFUA 1IWTA 4AQNA 2VB1A 1OQYA 1L65A 4JN6A 4TSCA 3WL2A 2F5OA 3GULA 2CV1A 1OUAA 2CRUA 2ZAMA 2R62A 1LZGA 2XJWA 1UFZA 1OAIA 1IOSA 3LZ2A 3JAMS 2L4EA 3C58A 215LA 1L49A 2HEFA 2R65A 3GPPA 4DR3M 1L62A 1OAOC 1TEWA 3C9PA 4OW1A 1NHEA 3C8RA 1T6VL 2ANVA 4LYZA 2OTZX 1CU3A 1DPWA 3W0FA 2F5SA 1LSFA 3E4RA 1HFXA 2B6WA 4PDIA 1K82A 1LJKA 1G3IA 2JNHA 1G0KA 1L04A 2QNJA 1WTNA 4I7JA 1L32A 4H8ZA 1LZ9A 1XHBA 5HNLA 1L14A 4HL4A 2K47A 2I7NA 1UICA 2ZTDA 1L16A 2DWNA 2GQFA 1HEPA 3QE8A 1C62A 4PJ2C 1LJNA 3TL4X 2DQEY 3SAWA 2F4AA 1VQ1A 1WVVA 1G7MC 4R3DA 3GLGE 3GRVA 3CT1A 147LA 1C66A 3U6QA 1XEKA 2BPUA 4LYCA 207LA 3C8QA 259LA 2QHOB 1PQJA 1IN6A 1RFPA 181LA 1KXWA 4CFOA 2RKOA 3I51A 4GRIA 134LA 1JKCA 2YBNA 169LA 1AZFA 1LZCA 1VG5A 126LA 4YXAC 177LA 1QUSA 2M60A 1P3NA 2DKVA 2MJ5B 1YKZX 3G3BB 1LJEA 1C6HA 3HUAA 2OE9X 2WSFF 196LA 2EKSC 1ZV1A 1L12A 3DNAA 3TE6A 227LA 1LZ1A 3PNYA 2RBQA 2MEEA 1MELL 3LVWA 1GB7A 3B89A 4WG1A 4EMNA 1NHGC 2LZTA 3B0KA 1C6FA 1VDTA 4DR7M 2JA2A 3W6EA 1NO1A 1L45A 1J7KA 1X37A 1QTZA 1LWKA 4CGYB 4RF0A 4I7PA 3HBDA 2BQHA 3D3DA 5FTJA 3TXIA 3E21A 2VF7A 3CQLA 1CV5A 2HEAA 4GMQA 1PJTA 1D2NA 3J27B 1JTNA 1OVHA 1P5CA 5C6LA 3NYAA 1R7RA 3ZH9B 4GN4A 1T43A 3U6EA 1IY1A 3GUIA 3NBIA 1SXJA 5EP3A 1QT4A 1A5TA 1L27A 2KHHA 4JI8M 1CV6A 4HJZA 1NMMA 4XN6A 1L70A 1GL6A 1A2YC 3K8ZA 4EPFA 1EL1A 171LA 1G1WA 2D91A 3VKGA 4IBCA 5APFA 5LA8A 4NSRA 1LYFA 4JYAM 3CSQA 1HR0M 4FWGA 163LA 4ARMB 1GBZA 3J7BA 2G4NA 3RE8A 3OE6A 2OEAX 2DNAA 5EXSA 4Z46A 5LXWA 1L31A 1SSYA 3QAUA 1ZVHL 4XK8F 1LYSA 3P4ZA 4O34A 1WXQA 1TAYA 214LA 2CGIA 1JTMA 3TXEA 1L50A 1JR3D 1P37A 2BQBA 1L34A 4ZEEA 4Z8XA 1LZTA 3HTFA 3RZ4A 3L26A 5LINA 4TUWA 5D5FA 3DMXA 3HDEA 2LHGA 1J1OY 184LA 1QT8A 1LPIA 3EXDA 2MEFA 3HTBA 2I7PA 3FRIA 4NXNM 1CKCA 1TDYA 3V76A 2BAAA 2AHMA 2HHHM 1GHLA 2OU0X 4NY5A 2YQZA 1PM5A 1ZMYL 3CGWA 3JR5A 4QHTA 3GLHE 1IWVA 2F32A 4IJFA 3HU1A 256LA 192LA 4F2LA 1N77A 1YAPA 4HV1A 3PFIA 4LJ8A 1ZAEA 1IP3A 4M9ZA 2E5LM 1DI4A 2JY6B 2LVQD 2XQOA 5B1GA 2BWEA 5EXXA 1TH4A 2B5ZA 1MX0A 1XWIA 1LZ8A 2C98A 3U60A 3EMSA 2XZFA 2HKJA 1C6PA 3FUVA 1BWHA 4DDAA 1CV3A 2DQCY 5H37D 3HT9A 3CDTA 2CV2A 2HULA 1L75A 5IELA 4OWHA 4OOTA 1CJ8A 4B7FA 4H9EA 1DGGA 1AUAA 4LZTA 4LJ6A 1GE1A 4H90A 3ATNA 1N75A 5BR8M 1XGPC 3W6BA 4ETAA 1FKQA 1EIJA 205LA 4NGZA 3UK6A 4JI4M 4G4QA 1G0MA 1IWWA 3GLHA 2R4JA 2CP8A 4R6CA 1B5WA 160LA 2XH9A 3LQRA 1L66A 1SQ2L 4EPIA 1L44A 226LA 3DN3A 2A7FA 1IXRC 2DAIA 1P46A 5I4WA 1L67A 4DWXA 4H1PA 3DOAA 1LSPA 1C64A 1DO2A 135LA 3SAVA 1HT1E 1L55A 4GN3A 2MGWA 3CF0A 3M7GA 1L82A 2MEHA 1QZEA 3UJNA 1L23A 1JJ1A 3L2XA 212LA 5A3ZA 1SXJD 2LWXA 1L1ZA 3KW6A 1D6QA 5BPVA 4GCEA 5K7OA 145LA 213LA 4XJIA 2Y0QA 5C1BA 3B74A 2B74A 4DR5M 1L09A 3SHGB 3K2RA 1IWZA 1JPOA 4B3RM 1L86A 3C80A 1N78A 2DAMA 2GV0A 1L24A 4JI1M 4GKKM 1GAYA 3AZ6A 3RFWA 1DGHA 1DPXA 3D9AC 5KXSA 1IY2A 3KOXE 4DR4M 5APDA 4H9FA 197LA 2FS1A 1C6QA 1HC0A 2JY5A 5C6JA 5LMNM 4LJ7A 4DUYM 1CTWA 5KPZA 1L28A 4ARLA 4D9ZA 4MR1A 1OFHA 3LVVA 1OIPA 2LC9A 144LA 2LH0A 185LA 4LJ9A 1WTMA 2ZAOA 2L7IA 4IJEA 2I6ZA 3GO8A 3HHXA 1LZDA 2ZILA 244LA 1EPYA 1TR8A 4TSBA 4C3WA 142LA 1L29A 4DDBA 2KRUA 1LAAA 2ZBKB 2VIIA 128LA 3PVSA 4MB7A 1QTHA 1LKSA 1L99A 258LA 1ZMUA 4AZFA 3AW7A 1UM8A 4HTQA 4G4HA 1QSAA 4P2EA 4G4NA 3VKHA 2G5GX 1XSFA 1QTBA 4DV4M 4JI2M 3KVWA 1W6ZA 4R7GA 1JKAA 1ZWNA 1L15A 3WVXA 1GF8A 3KAMA 3UZUA 1LSDA 2O79A 4N1CC 1QSBA 190LA 140LA 1AKIA 1G7IC 1DXJA 1JSFA 262LA 154LA 1NY5A 1GJTA 2BQLA 4LFCM 1NJGA 1V92A 2FOIC 108LA 1C6TA 1OUFA 4NXMM 2JWSA 2CEAA 2I26L 1DV0A 1C6KA 1GB6A 3C82A 2QBYB 1HMLA 3TPZA 1AM7A 1UACY 1CJ7A 1L38A 3ZQJA 1L25A 1L71A 4NGLA 3DN6A 2RRUA 3GLIB 5ITXE 3FUXA 2D4IA 3LYZA 5DN5A 3LMMA 1C6IA 4ARQA 3IG5A 1B7MA 4GC9A 2LHCA 1L17A 3P64A 4N0JA 1C6BA 3HH3A 4DQJA 1OWZA 4YXCA 164LA 1IY0A 2UXCM 1HMKA 3N9AA 1R2YA 1L11A 3SBBC 5LVJA 2KRKA 132LA 1C1KA 3GLFA 4I5SA 2Z7JA 1L68A 238LA 2LCBA 2OO9A 1NDGC 1P7SA 5FEKA 3CT0A 2EIZC 4DD0A 3WU9A 3ILKA 5L9JA 4HTNA 167LA 2LZ2A 1N32M 1C63A 3QWLA 3KSXA 2OU9A 4LYOA 3L25A 3HT8A 1IM2A 4KPMA 5F9XA 2MEBA 1BB6A 2BQMA 1YAQA 1YROA 4DD2A 143LA 4H91A 4B4EA 3GQ3A 2Z3XA 5ITXA 4YF2A 4NGVA 3I4VA 3D4SA 1G0GA 4CJ6A 2IFFY 4LRSA 1LSEA 4EKSA 3RT5X 4ETCA 1NY6A 170LA 4W53A 2DZNB 2G4QA 1E9SA 1VEJA 3I04M 2EJSA 1L73A 1Q3BA 107LA 2ZYPA 4LF6M 110LA 1B6IA 1VATA 2OE4X 4RW1A 1L03A 1BVXA 1L30A 3LYMA 4HSFA 4NIJA 2ZTCA 1N34M 3V2YA 1IP6A 1SG9A 2R18A 5EXTA 3AL0C 3HTDA 1Q02A 3HJSA 3AOGA 1LYGA 206LA 151LA 3WUMA 3SC3A 2XFSA 4X62M 119LA 1D3NA 4GBRB 1L35A 3ATOA 3C7YA 1HEMA 1E32A 1L57A 1IOQA 4QNRA 4GLAA 4D81A 4WM4A 3B72A 3GRYA 248LA 1YKYX 1WTHA 2MECA 1L0KA 4HLQA 3SHFA 1C68A 4W54A 5KXLA 3WXTA 2Y8PA 2RBSA 2Z6BA 1JJ0A 1LMOA 1LSZA 5IZ7D 1OUHA 4NFVA 4AI6A 4I7SA 5EJCA 2Y0TA 2XBSA 2ZQ4A 4LZMA 3WW6A 4IBIA 1JEFA 4M9SA 4QOZC 1C08C 4DD3A 1EQ4A 4LGKA 3W6FA 1P2CC 4LY6A 1LYOA 4RLNA 1UIGA 4DV1M 1DO0A 1LCNA 1HENA 4W57A 3IECA 4I8SA 4FD2A 2YSSC 1W5TA 4G3OA 1LYIA 2OPFA 2QCUA 231LA 4DDCA 4LGYA 3MMPA 5F9UA 3GUMA 5I4XA 1Z5BA 2F47A 4DR2M 2CDSA 2Z38A 2V6ZM 1WJ7A 3R9XB 1L20A
chains in the Genus database with same CATH topology
3WXUA 4IASA 2Z2FA 1NWGA 3HH4A 1JTTL 4I7MA 1GD6A 3CDQA 1L53A 2DQGY 1SWYA 3QNGA 1YIKA 1L54A 3OE8A 1LZRA 1N4FA 3MGWA 1LI2A 249LA 3AGGG 201LA 3ZVQA 3C81A 1SX7A 4ETEA 1HFZA 1IWXA 3WU8A 4PJZA 4GRVA 4HJYA 1JIYA 102LA 1DKKA 3CT5A 2C8OA 4ML7A 4YEOA 1L37A 2CUUA 2NTHA 260LA 3HTGA 3P68A 1LJIA 5T3FA 4H9IA 3HU8A 1OP9B 3RW8A 4WOAA 221LA 219LA 5KXXA 1D0LA 1REYA 3B0OA 2HUKA 1L93A 1LJHA 1IWUA 4GCCA 4XADA 1T8GA 230LA 4PRQA 1L22A 5AMYA 4HPEA 111LA 1GEZA 1FLQA 1QQYA 3NY9A 1G1VA 1IP1A 2BLXA 1GBWA 3F8VA 5KXYA 211LA 4WM6A 3TXJA 1L05A 1L80A 1OQMA 4NG1A 1GF0A 4UWVA 5L3HA 2F2NA 1IEEA 2O7AA 4LFXA 189LA 4EKRA 4ZFPA 3OK0A 1DI3A 5I4YA 1Z55A 1LSBA 255LA 3GUOA 2MEIA 4R0FA 182LA 236LA 1OV7A 5LAGA 1XJUA 1GE0A 1QT3A 1JHLA 4UWUA 2HEEA 5LVGA 1VDPA 4DQ7A 4HTKA 1GFKA 5KXMA 1OUJA 3EBAB 5I53A 1F10A 4MCKA 1LZSA 1LHHA 3FI7A 1LSCA 2B72A 1L43A 4J1BA 5KKJA 1LZEA 1L59A 252LA 1WQOA 3RZEA 5IDDA 193LA 1L92A 3A93A 3F6ZA 4EXMA 4E97A 4ARJA 4WO6A 1MLCE 1JKDA 4YEMA 3PDSA 4I7TA 1L21A 1L95A 1G07A 1ZURA 3EO5A 1GDWA 2HECA 3SB8A 1L10A 2RB2X 3SBAA 3HFMY 4HV2A 5KJ9A 1ZV5L 3V2WA 1L47A 4WMGA 2BQOA 4PPOA 2DQHY 4BS7A 3FADA 1DYFA 1LSGA 3K3TA 1KY1A 4CGEA 1L64A 1HFYA 2B6XA 130LA 6LYZA 3LZTA 4NEBA 4H9AA 1YAOA 4LDEA 1WVUA 4ANRA 2BQKA 1LOZA 3CSRA 3M18B 4PK0A 3TXBA 4I7RA 5KXOA 1LJJA 1CX7A 1BB3A 5JENB 3DMVA 2RBPA 5DLAA 4NHPA 1HSXA 1DYAA 1GFAA 2YBLA 1QSQA 3RNXA 4ARQB 1LZBA 254LA 3W6DA 2PC2A 2LHMA 4B49A 4LT3A 1L18A 4J7VA 4NGIA 1JWRA 1XEIA 1D9UA 1OUBA 1VEDA 2DQDY 2IGCA 3G3AB 2O4WA 1L61A 2DQIY 1NBYC 1LYYA 4OWEA 137LA 1CU6A 1B9OA 2D6BA 3AGHA 2FYDA 1QTDA 1GEVA 1IX0A 2D4KA 4LFPA 3WVYA 3CDVA 4DYGA 1D6PA 1BB5A 5LVHA 1C65A 2BLYA 1CKGA 1L02A 1LJ4A 4Z41A 173LA 2QB0B 1GBYA 1TLAA 2Z12A 2ZQ3A 4HP0A 4YM8A 4U3XB 1LMAA 2NWDX 1GF6A 1QT6A 1B7PA 1L79A 4EJ4A 4W96A 1NF5A 229LA 1L83A 1A4VA 1P6YA 1WQNA 1G0PA 1UBZA 1AT5A 186LA 2H9KA 3ZEKA 1CJ9A 1G7JC 3ODUA 3VWOA 2X0AA 1KY0A 1IWYA 4MSTA 2Z39A 1B5UA 195LA 1G06A 3AB6A 3TXHA 199LA 1LW9A 1D2WA 1YANA 2B6TA 1L90A 4W56A 4NGKA 158LA 1LZ6A 129LA 4N1EI 1GFEA 1DZBX 1YL1X 1LYJA 3AZ4A 1GE2A 1FBIX 159LA 4H9CA 4XJGA 3LYOA 3AYQA 4OOOA 161LA 1UIBA 3A6CY 3N9EA 4RW2A 4WL7A 1LYDA 2YBJA 4AXTA 1C10A 198LA 1PQOA 3B6LA 3ZVQB 4TUNA 1GF9A 239LA 3DN8A 1V7TA 1L58A 1LSYA 4NSHA 4LYMA 1B7LA 4CFPA 4NHTA 3C8SA 3J6KA 1L51A 2Z19A 4WL6A 1B2KA 1P36A 4YX7C 2BQIA 5KXRA 2HEDA 1I6SA 3A8ZA 5I54A 1GFRA 2YBIA 1XGRC 2MEAA 1XFPL 1LI6A 1KW7A 1NKHA 1UCOA 3OE9A 1OVJA 2BQDA 2BQFA 5B1FA 4TX7A 1QIOA 1UIEA 1BHZA 1JQUA 1QTEA 5LA5A 5B06A 4XJBA 3AGIA 1SLYA 2YVBA 4G9SA 4NGOA 2G4PA 4CHXA 4NGYA 1OUEA 2RH1A 3WPKA 1DQJC 2ZNXY 5KKIA 1L42A 4WLDA 4NSJA 3HT7A 1FN5A 157LA 150LA 4NSIA 3NY8A 131LA 228LA 1REZA 2IHLA 5I14A 2BQGA 1LHKA 1IP5A 1L08A 243LA 3W6AA 1IR9A 4G49A 4G4BA 176LA 109LA 1WQRA 4KL7A 1L98A 250LA 4WM5A 1L46A 237LA 3BKHA 5F14A 2OTYX 3L64A 2FBBA 1OV5A 1GB8A 4DD9A 2ZIJA 5B05A 1IC4Y 172LA 4DAJA 1HEWA 1NQIA 1DYGA 2Z2EA 2B6ZA 4N9RA 4I7QA 2HU1A 5LZMA 1YQVY 210LA 1FKVA 4E3UA 5LYZA 1BQLY 1PZYA 1P2LA 3VW7A 232LA 1OUIA 1PS5A 3F9LA 3WPLA 1GPQC 1OUGA 1OVKA 1H6MA 1LJ3A 2W1LA 1I56A 1CV0A 1VFBC 1DYDA 3SB6A 5LYMA 155LA 4WLYA 3T36A 4M4OA 3IWRA 3CB7A 2RB1X 1T97A 1YL0X 1T8FA 3FI5A 2Z37A 3TXFA 1JTOL 4K5YA 1QSWA 224LA 1OUCA 1CU2A 4QGZA 1ZYTA 1LSAA 168LA 3TMWA 1B7OA 3BKVA 1L88A 1CVKA 3EMLA 148LE 4BAFA 8LYZA 3SB5A 1G0LA 1G7HC 4DQ5A 1T6HA 112LA 1C69A 1GF4A 2HUBA 1AT6A 1JUGA 1GXV2 5HMVA 1L69A 1KXXA 3TMUA 1W08A 1L33A 1GFHA 1GB5A 2DBTA 251LA 208LA 1SSWA 1QT5A 2AUBA 1UIDA 4HJVA 5HLLA 4I7KA 1HEQA 2B73A 1L40A 1JJ3A 1DYCA 1F6RA 194LA 4WM3A 3SB7A 1L74A 4L41A 4H9BA 4EKQA 2RB0X 3HUKA 1IC7Y 2F2QA 1KIPC 1LYHA 4NSGA 1XGTC 2XTHA 1UA6Y 3LHMA 4NGJA 103LA 216LA 4LYTA 4LDOA 225LA 152LA 3G3WA 2LZMA 4WO9A 2I25L 1GFGA 3ULRA 4NG8A 2HU3A 2ZWBA 1BWJA 1L89A 1F6SA 1GB3A 5E4PA 1FLYA 1CKFA 1KIRC 4XENA 1LHIA 2DQJY 4ARPA 3OE0A 3AJNA 5L3IA 2RBNA 1LKRA 1G7LC 1GBXA 1GF3A 1B5YA 209LA 1SWZA 1GFJA 1D0MA 5EBHA 1EQ5A 4XJDA 1QUDA 1UIAA 1FLUA 220LA 1IVMA 5KY1A 1K28A 1LMCA 222LA 4C5FA 4B1AA 1PQMA 261LA 3GUNA 1REXA 1L36A 5LVIA 1F0WA 2BQAA 2F30A 1CNSA 4DKLA 4B4JA 5DM9A 4B0DA 1L63A 3C7WA 1HERA 3DN1A 3A67Y 5LAFA 5F16A 165LA 1XJTA 6LZMA 4QEQA 139LA 5F81A 4IATA 1LTMA 1LZYA 2CWIA 1BWIA 3A96A 1GF5A 4YOPA 3W6CA 4NWEA 1REMA 1LZ5A 1JKBA 1C6JA 1C46A 4LYBA 246LA 1C67A 3A94A 4N5RA 4CJ2A 2HUMA 4A7DA 1T8AA 1QUGA 4IJ4A 1C6LA 1CV4A 1HELA 153LA 4DJHA 127LA 1T3PA 4I7OA 4M6DA 4XJFA 1C6MA 3GUKA 5A3EA 2FYCA 1CU5A 1C6GA 3W3EA 4Z3MA 1LMTA 4LDLA 2L78A 234LA 1IOCA 1HSWA 3HH5A 3JR6A 4NWHA 1WQPA 1H87A 1L39A 2RBRA 3SP3A 162LA 5M1YA 1QTCA 4WLTA 5LIOA 1LSMA 4QDNA 3HDFA 1LGXA 2W1MA 3UONA 1B7RA 4PGJB 1D3FA 2ZYCA 1L06A 2RAYX 1DKJA 3CSZA 2YBHA 5FSTA 3AW6A 3J4GA 3HBHA 1L87A 1LHMA 4NHSA 3OJPA 4ZPUA 1IP2A 1BVKC 3AZ7A 4WM2A 2Q9DA 1HNLA 118LA 1XGQC 138LA 5IHGA 4WG7A 3GXKA 3DN0A 3C83A 3AZ5A 1LLHA 2RBOA 1SX2A 1VAUA 1HHLA 3TXKA 175LA 2LYOA 1UIFA 1P64A 1WQMA 2ZNWY 1B7NA 5ILFA 2Q0MX 3TMXA 3HUQA 3GUJA 4GN5C 4GCDA 2QARC 2B7XA 1GE4A 1VDQA 3A3QA 113LA 4NGWA 4OO9A 1C6NA 146LA 187LA 1TCYA 1FDLY 4H92A 1CX6A 2FBDA 4B4IA 1P2RA 1L96A 2EQLA 174LA 3N9CA 4OWCA 1GDXA 1L97A 218LA 2RSCA 1C61A 4IAPA 9LYZA 3A90A 4ETBA 2W1YA 4I0CA 5E9RA 3DN2A 4YENA 4Z98A 3WPJA 1GB0A 257LA 1L52A 4ET8A 1G0JA 4LT1A 3WUAA 5FDJA 7LZMA 1CUPA 1L19A 1INUA 3GXRA 2H5ZA 3G3VA 4WM1A 1KS3A 1B5ZA 1LMQA 1QUOA 1L72A 3T6UA 245LA 3B0IA 3A92A 4GLVA 5HQ1A 1HF4A 1C43A 2N5ZA 149LA 1L85A 1OUDA 1D0KA 4PRUA 3C7ZA 3DMZA 2LYMA 233LA 180LA 3SB9A 4LT2A 1KW5A 3P65A 1KXYA 1L91A 4QY9A 1D2YA 125LA 156LA 4W94A 1UIHA 6LYTA 1I1ZA 247LA 3IJUA 2F4GA 2Q9EA 1QDTA 1GF7A 2B75A 2RAZX 1IR8A 1L94A 7LYZA 1IORA 3QY4A 253LA 1IR7A 1HEOA 242LA 2YBMA 1IIZA 4LT0A 1LYZA 3TXDA 4WLXA 178LA 1L26A 2BQJA 4OWBA 1WQQA 4NHQA 5B07A 2OE7X 3WMKA 2C8PA 1GAZA 3LN2A 166LA 217LA 3CDRA 1RCMA 5FCPA 1E8LA 3WULA 4XJHA 5KXTA 1NBZC 3CDOA 1LI3A 1NDMC 1QTKA 235LA 4DD1A 1QUTA 1GWDA 2ZIKA 1JISA 1L76A 1ZVYB 3RUNA 4I7LA 3IJVA 1LJFA 5II3A 5DN4A 2B6YA 1GE3A 3DN4A 1KIQC 3A6BY 5LVKA 1B5VA 1BGIA 3RU5A 3M3UA 1B7SA 2BQEA 1EQEA 1C6DA 4EOFA 3FE0A 1XGUC 1OWYA 2LYZA 5APEA 4ARMA 4XYYA 1NHBA 1C6AA 2ANXA 1QTVA 1PQIA 5APCA 1CU0A 4H8XA 1JSEA 5FHWA 4RDSA 1LZAA 5FELA 1J1XY 1LHLA 2MEGA 1CJ6A 1IY4A 1GFVA 1QS9A 4FDYA 2HTXA 1LMPA 3E3DA 1L81A 2H9JA 5J7CA 2Z18A 4ZIXA 4DC4A 3GUPA 1L41A 1P56A 2B70A 4H93A 4BAPA 1D3JA 1BB7A 3WUNA 1VDSA 3LYTA 4NHIA 1IO5A 5ILCA 1I20A 5KXWA 4HPIA 1G0QA 4J1AA 1BB4A 3FA0A 1IOTA 1RJCB 1L07A 1QS5A 1QUHA 4TTDA 4N8ZA 133LA 2D4JA 3PBLA 1D9WA 1GFTA 3SN6R 5KXZA 4FJRA 240LA 4J0LA 2BQCA 5KXPA 2DQAA 1YKXX 1B0DA 4W52A 1TBYA 1LGUA 1JITA 1LMNA 4W51A 1IP4A 1FLWA 3LZMA 1JTPL 1QDRA 3QAKA 1DYBA 4PHIA 183LA 1B5XA 120LA 5HMJA 5KXKA 1GXXA 2W1XA 200LA 1C60A 1LSNA 4ETDA 1UUZC 4DT3A 1GB2A 123LA 4UWNA 1CUQA 2A4TA 1L77A 1C7PA 2WARA 1LZ4A 4W58A 4II8A 4TWSA 1XEPA 4GCBA 4EKPA 1B7QA 4RLMA 2NTGA 1J1PY 4W59A 1C45A 241LA 1L56A 5C6IA 4OWAA 1KNIA 3A34A 3HU9A 3WW5A 2A7DA 191LA 1DI5A 2BQNA 1GB9A 2MEDA 2YDGA 4X3BA 1L00A 114LA 3HWLA 188LA 1OYUA 5I5QA 2DQFC 1LYEA 3A3RX 1PQKA 2OU8A 1IC5Y 3HH6A 1LHJA 1DYEA 4KXIA 5DL9A 1LGWA 4W55A 4G4CA 4DD7A 1IP7A 1GBSA 4H8YA 5KXNA 4KT3A 3A91A 5D5CA 3WU7A 1L13A 1PQDA 2XBRA 1UC0A 4H9HA 5HNCA 122LA 115LA 1YILA 2HEBA 1D3MA 4ET9A 1LJGA 5LYTA 1GBOA 1QT7A 223LA 4H94A 1O23A 1C6EA 3WH1A 1ALCA 3HT6A 3G3XA 141LA 4BADA 1L60A 3WYHA 1LWGA 3DKEX 3P66A 1CKHA 2EPEA 2CJLA 1LZNA 4I7NA 1RI8B 1LPYA 1IY3A 4AGAA 1CV1A 1XEJA 1CKDA 104LA 4S0WA 3HBEX 3TXGA 1L48A 1C6CA 3TMVA 4GCFA 1YAMA 1L0JA 1V7SA 1L01A 1L84A 3A95A 1RE2A 1GFUA 1IWTA 4AQNA 2VB1A 1L65A 4TSCA 3WL2A 3GULA 1OUAA 1LZGA 2XJWA 1IOSA 3LZ2A 215LA 1L49A 2HEFA 1L62A 1TEWA 4OW1A 1NHEA 3C8RA 1T6VL 2ANVA 4LYZA 2OTZX 1CU3A 1DPWA 1LSFA 2B6WA 1HFXA 1LJKA 1G0KA 1L04A 1WTNA 4I7JA 1L32A 4H8ZA 1LZ9A 5HNLA 1L14A 1UICA 1L16A 1HEPA 3QE8A 1C62A 4PJ2C 1LJNA 2DQEY 2F4AA 1WVVA 1G7MC 3CT1A 147LA 1C66A 1XEKA 2BPUA 4LYCA 207LA 3C8QA 259LA 1PQJA 1RFPA 181LA 1KXWA 4CFOA 134LA 1JKCA 2YBNA 169LA 1AZFA 1LZCA 126LA 4YXAC 177LA 1QUSA 1P3NA 2DKVA 1YKZX 3G3BB 1LJEA 1C6HA 3HUAA 2OE9X 196LA 2EKSC 1L12A 3DNAA 227LA 1LZ1A 2RBQA 2MEEA 1MELL 1GB7A 4WG1A 4EMNA 2LZTA 3B0KA 1C6FA 1VDTA 3W6EA 1L45A 1QTZA 1LWKA 4I7PA 3HBDA 2BQHA 3D3DA 3TXIA 3CQLA 1CV5A 2HEAA 1OVHA 1JTNA 1P5CA 5C6LA 3NYAA 4GN4A 3GUIA 1QT4A 1L27A 4XN6A 1CV6A 4HJZA 1NMMA 1L70A 1A2YC 4EPFA 1EL1A 171LA 1G1WA 2D91A 5APFA 5LA8A 1LYFA 3CSQA 163LA 4ARMB 1GBZA 2G4NA 3OE6A 2OEAX 4Z46A 5LXWA 1L31A 1SSYA 1ZVHL 1LYSA 3P4ZA 4O34A 1TAYA 214LA 2CGIA 1JTMA 3TXEA 1L50A 1P37A 2BQBA 1L34A 4ZEEA 1LZTA 3HTFA 3RZ4A 5LINA 5D5FA 3DMXA 3HDEA 1J1OY 4N1CC 184LA 1QT8A 1LPIA 3EXDA 2MEFA 3HTBA 1CKCA 1TDYA 2BAAA 1GHLA 2OU0X 4NY5A 1ZMYL 1IWVA 2F32A 256LA 192LA 1YAPA 4HV1A 1IP3A 1DI4A 2XQOA 5B1GA 2B5ZA 1LZ8A 3EMSA 1C6PA 1BWHA 4DDAA 1CV3A 2DQCY 3HT9A 3CDTA 2HULA 1L75A 5IELA 4OWHA 4OOTA 1CJ8A 4H9EA 4LZTA 4H90A 1GE1A 3ATNA 3W6BA 1XGPC 4ETAA 1FKQA 205LA 4NGZA 1G0MA 1IWWA 4R6CA 1B5WA 160LA 1L66A 1SQ2L 4EPIA 1L44A 226LA 3DN3A 2A7FA 1P46A 5I4WA 1L67A 4DWXA 4H1PA 1LSPA 1C64A 135LA 1L55A 4GN3A 1L82A 2MEHA 1L23A 1JJ1A 3L2XA 212LA 5A3ZA 1D6QA 4GCEA 5K7OA 145LA 213LA 4XJIA 2B74A 1L09A 3K2RA 1IWZA 1JPOA 1L86A 3C80A 2GV0A 1L24A 1GAYA 3AZ6A 1DPXA 3D9AC 5KXSA 5APDA 4H9FA 197LA 1C6QA 1HC0A 5C6JA 4D9ZA 1CTWA 1L28A 4ARLA 4MR1A 2LC9A 144LA 185LA 1WTMA 2I6ZA 1LZDA 2ZILA 244LA 1EPYA 4TSBA 4C3WA 142LA 1L29A 4DDBA 1LAAA 128LA 1QTHA 1LKSA 1L99A 258LA 3AW7A 4HTQA 4G4HA 1QSAA 4P2EA 1XSFA 1QTBA 1W6ZA 1JKAA 1ZWNA 1L15A 3WVXA 1GF8A 3KAMA 1LSDA 2O79A 1QSBA 190LA 140LA 1AKIA 1G7IC 1DXJA 1JSFA 262LA 154LA 2BQLA 1C6TA 108LA 1OUFA 2I26L 1C6KA 1GB6A 3C82A 1HMLA 1AM7A 1UACY 1CJ7A 1L38A 1L25A 1L71A 4NGLA 3DN6A 2D4IA 3LYZA 5DN5A 1C6IA 4ARQA 1B7MA 1L17A 3P64A 4N0JA 1C6BA 3HH3A 4DQJA 1OWZA 4YXCA 164LA 3N9AA 1HMKA 1L11A 3SBBC 5LVJA 132LA 1L68A 238LA 2LCBA 1NDGC 1P7SA 5FEKA 3CT0A 2EIZC 4DD0A 3WU9A 5L9JA 4HTNA 167LA 2LZ2A 1C63A 2OU9A 4LYOA 3HT8A 4KPMA 5F9XA 2MEBA 1BB6A 2BQMA 1YAQA 1YROA 4DD2A 143LA 4H91A 4B4EA 4YF2A 4NGVA 3D4SA 1G0GA 2IFFY 1LSEA 4EKSA 4ETCA 3RT5X 170LA 4W53A 2G4QA 1L73A 107LA 2ZYPA 110LA 1B6IA 1VATA 2OE4X 4RW1A 1L03A 1BVXA 1L30A 3LYMA 4HSFA 4NIJA 3V2YA 1IP6A 3HTDA 1LYGA 206LA 151LA 3WUMA 1D3NA 119LA 4GBRB 1L35A 3ATOA 3C7YA 1HEMA 1L57A 1IOQA 4GLAA 4WM4A 3B72A 248LA 1YKYX 1WTHA 2MECA 1L0KA 1C68A 4W54A 5KXLA 3WXTA 2Y8PA 2RBSA 2Z6BA 1JJ0A 1LMOA 1LSZA 1OUHA 4NFVA 4I7SA 2ZQ4A 2XBSA 4LZMA 3WW6A 1JEFA 1C08C 4DD3A 1EQ4A 4LGKA 3W6FA 1P2CC 1LYOA 4RLNA 1UIGA 1LCNA 1HENA 4W57A 4I8SA 2YSSC 1LYIA 231LA 4DDCA 5F9UA 3GUMA 5I4XA 2F47A 2CDSA 2Z38A 5B59A 1L20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WXU A;  4IAS A;  1NKH A;  1UCO A;  1XEK A;  2BPU A;  4LYC A;  2Z2F A;  1NWG A;  207L A;  2BQD A;  2BQF A;  1INU A;  5B1F A;  4TX7 A;  1QIO A;  1RFP A;  1BHZ A;  1JTT L;  1UIE A;  2H5Z A;  3GXR A;  1QTE A;  1GD6 A;  1KXW A;  4WM1 A;  5B06 A;  4XJB A;  4CFO A;  1B5Z A;  5LA5 A;  134L A;  1LMQ A;  3AGI A;  1JKC A;  1SLY A;  2YBN A;  2DQG Y;  1AZF A;  1LZC A;  2YVB A;  3QNG A;  4G9S A;  3T6U A;  1YIK A;  1LZR A;  4NGO A;  3B0I A;  1N4F A;  3A92 A;  1QUS A;  2G4P A;  3MGW A;  2DKV A;  4GLV A;  4CHX A;  3AGG G;  4NGY A;  1OUE A;  1YKZ X;  3G3B B;  1DQJ C;  3WPK A;  5HQ1 A;  1LJE A;  1HF4 A;  2ZNX Y;  1C43 A;  5KKI A;  4WLD A;  2EKS C;  4NSJ A;  3ZVQ A;  1FN5 A;  4ETE A;  2N5Z A;  1HFZ A;  1IWX A;  4NSI A;  1LZ1 A;  3WU8 A;  1OUD A;  2MEE A;  1D0K A;  4HJY A;  4PRU A;  1MEL L;  1JIY A;  5I4X A;  1GB7 A;  4WG1 A;  4EMN A;  1DKK A;  2LZT A;  1REZ A;  2IHL A;  3B0K A;  2LYM A;  2BQG A;  3CT5 A;  1VDT A;  2C8O A;  1LHK A;  4ML7 A;  3W6E A;  4LT2 A;  1IP5 A;  3W6A A;  1IR9 A;  4YEO A;  4G49 A;  3P65 A;  4G4B A;  1KXY A;  1WQR A;  4QY9 A;  3HBD A;  4KL7 A;  3P68 A;  4WM5 A;  1LJI A;  2BQH A;  3D3D A;  3BKH A;  5T3F A;  4H9I A;  5F14 A;  4W94 A;  1UIH A;  3TXI A;  3CQL A;  6LYT A;  1OP9 B;  2FBB A;  1I1Z A;  3RW8 A;  1GB8 A;  4WOA A;  2HEA A;  3IJU A;  2F4G A;  4DD9 A;  5C6L A;  2ZIJ A;  5KXX A;  1D0L A;  5B05 A;  4GN4 A;  1QDT A;  1IC4 Y;  1GF7 A;  1REY A;  3B0O A;  1IR8 A;  1HEW A;  1LJH A;  1IWU A;  1NQI A;  4GCC A;  4XAD A;  4PRQ A;  2Z2E A;  7LYZ A;  4N9R A;  5AMY A;  1IOR A;  4HPE A;  2HU1 A;  3QY4 A;  1GEZ A;  1YQV Y;  1IR7 A;  1HEO A;  1FKV A;  4E3U A;  2YBM A;  1IIZ A;  1FLQ A;  1QQY A;  4XN6 A;  4HJZ A;  1NMM A;  5LYZ A;  1IP1 A;  1BQL Y;  1GBW A;  2BLX A;  5KXY A;  4LT0 A;  1LYZ A;  1A2Y C;  1PZY A;  3TXD A;  4WLX A;  4WM6 A;  3TXJ A;  1EL1 A;  1OQM A;  2BQJ A;  4NG1 A;  4OWB A;  2D91 A;  1WQQ A;  1GF0 A;  1OUI A;  1PS5 A;  4NHQ A;  3WPL A;  5B07 A;  1GPQ C;  1OUG A;  4UWV A;  5APF A;  5LA8 A;  5L3H A;  2F2N A;  1IEE A;  3CSQ A;  3WMK A;  1H6M A;  2C8P A;  1GAZ A;  1LJ3 A;  2W1L A;  1GBZ A;  2G4N A;  3LN2 A;  4LFX A;  4ZFP A;  1I56 A;  3OK0 A;  4Z46 A;  1DI3 A;  5I4Y A;  1RCM A;  5LXW A;  5FCP A;  1VFB C;  1Z55 A;  1LSB A;  2MEI A;  1ZVH L;  4R0F A;  1E8L A;  1LYS A;  3WUL A;  5LYM A;  3P4Z A;  4O34 A;  4XJH A;  1TAY A;  4WLY A;  5LAG A;  2CGI A;  3T36 A;  5KXT A;  4M4O A;  3TXE A;  1NBZ C;  2BQB A;  3IWR A;  4ZEE A;  1NDM C;  1QTK A;  1LZT A;  3CB7 A;  1GE0 A;  4DD1 A;  3RZ4 A;  1QUT A;  5LIN A;  5D5F A;  1GWD A;  4N1C C;  1J1O Y;  1JHL A;  1LPI A;  1YL0 X;  2MEF A;  3EXD A;  2ZIK A;  4UWU A;  2HEE A;  1CKC A;  1JIS A;  1TDY A;  5LVG A;  1ZVY B;  2BAA A;  2Z37 A;  3TXF A;  1JTO L;  1VDP A;  1GHL A;  1QSW A;  4NY5 A;  1OUC A;  3IJV A;  1LJF A;  1ZMY L;  4HTK A;  1GFK A;  5KXM A;  5II3 A;  1IWV A;  1OUJ A;  3EBA B;  4QGZ A;  5DN4 A;  5I53 A;  1LSA A;  1GE3 A;  3TMW A;  1YAP A;  1B7O A;  1KIQ C;  3BKV A;  4HV1 A;  1F10 A;  3A6B Y;  5LVK A;  1BGI A;  1B5V A;  1IP3 A;  3RU5 A;  1DI4 A;  3M3U A;  1B7S A;  4BAF A;  8LYZ A;  4MCK A;  1LZS A;  2BQE A;  1G7H C;  5B1G A;  1EQE A;  1GF4 A;  1LHH A;  2B5Z A;  3FI7 A;  4EOF A;  1LSC A;  2HUB A;  3FE0 A;  1XGU C;  1LZ8 A;  2LYZ A;  5APE A;  1AT6 A;  3EMS A;  1JUG A;  5KKJ A;  4J1B A;  1GXV 2;  4XYY A;  5HMV A;  1LZE A;  1BWH A;  1KXX A;  3TMU A;  1W08 A;  1GFH A;  4DDA A;  1GB5 A;  2DQC Y;  2DBT A;  5L3I A;  1WQO A;  5APC A;  208L A;  5IDD A;  193L A;  5IEL A;  4OWH A;  4OOT A;  3A93 A;  4H8X A;  2AUB A;  3F6Z A;  1CJ8 A;  4H9E A;  1UID A;  4LZT A;  4HJV A;  5HLL A;  1JSE A;  5FHW A;  1HEQ A;  4H90 A;  1GE1 A;  4RDS A;  3ATN A;  1JJ3 A;  1LZA A;  1F6R A;  194L A;  1XGP C;  1MLC E;  1JKD A;  1FKQ A;  4WM3 A;  4WO6 A;  1J1X Y;  4L41 A;  4NGZ A;  5FEL A;  1LHL A;  2MEG A;  4H9B A;  4YEM A;  1IWW A;  1CJ6 A;  1IY4 A;  1GFV A;  4R6C A;  1B5W A;  4FDY A;  2HTX A;  1LMP A;  3E3D A;  2H9J A;  1SQ2 L;  5J7C A;  2Z18 A;  4ZIX A;  2A7F A;  4DC4 A;  1IC7 Y;  5I4W A;  3EO5 A;  4DWX A;  4H1P A;  1KIP C;  1GDW A;  1LSP A;  4H93 A;  2HEC A;  135L A;  4NSG A;  4BAP A;  1XGT C;  2XTH A;  1BB7 A;  1UA6 Y;  4GN3 A;  1VDS A;  3LHM A;  3LYT A;  3WUN A;  4NGJ A;  4NHI A;  2MEH A;  4LYT A;  1IO5 A;  3HFM Y;  4HV2 A;  1ZV5 L;  1JJ1 A;  5KJ9 A;  5ILC A;  1I20 A;  5A3Z A;  4HPI A;  5KXW A;  4J1A A;  4WMG A;  2BQO A;  1BB4 A;  1D6Q A;  4PPO A;  1IOT A;  2DQH Y;  1RJC B;  4GCE A;  4WO9 A;  4BS7 A;  5K7O A;  2I25 L;  1GFG A;  1LSG A;  4XJI A;  3ULR A;  4NG8 A;  4TTD A;  4N8Z A;  133L A;  2HU3 A;  1BWJ A;  2D4J A;  2ZWB A;  1GFT A;  3K3T A;  1F6S A;  4CGE A;  1GB3 A;  5KXZ A;  4FJR A;  1IWZ A;  1JPO A;  1HFY A;  5E4P A;  4J0L A;  2BQC A;  5KXP A;  1FLY A;  2DQA A;  2GV0 A;  3W6B A;  1CKF A;  1KIR C;  1YKX X;  1B0D A;  4XEN A;  1TBY A;  1LHI A;  6LYZ A;  2DQJ Y;  3LZT A;  4NEB A;  4H9A A;  1JIT A;  1LMN A;  1GAY A;  3AZ6 A;  3AJN A;  1YAO A;  1IP4 A;  1DPX A;  3D9A C;  5KXS A;  1WVU A;  4ANR A;  1FLW A;  1JTP L;  1LKR A;  1LOZ A;  1G7L C;  1GBX A;  2BQK A;  1QDR A;  3CSR A;  1GF3 A;  1B5Y A;  5APD A;  5IHG A;  3M18 B;  4H9F A;  4PHI A;  3TXB A;  1B5X A;  1HC0 A;  1GFJ A;  5C6J A;  4D9Z A;  1D0M A;  5HMJ A;  5EBH A;  5KXK A;  1GXX A;  5KXO A;  4MR1 A;  1LJJ A;  1EQ5 A;  4XJD A;  2W1X A;  1LSN A;  1BB3 A;  4ETD A;  5JEN B;  1UIA A;  1UUZ C;  1WTM A;  4DT3 A;  1FLU A;  2I6Z A;  4NHP A;  5DLA A;  1LZD A;  1HSX A;  1IVM A;  1GB2 A;  5KY1 A;  4UWN A;  2ZIL A;  1LMC A;  1C7P A;  1GFA A;  1LZ4 A;  2WAR A;  2YBL A;  4II8 A;  4C5F A;  4TSB A;  4TWS A;  3RNX A;  4B1A A;  4C3W A;  1LZB A;  4GCB A;  3W6D A;  1REX A;  4DDB A;  1LAA A;  5I54 A;  1B7Q A;  2PC2 A;  5LVI A;  1F0W A;  2BQA A;  2LHM A;  4RLM A;  1LKS A;  1J1P Y;  4B49 A;  4LT3 A;  2F30 A;  4J7V A;  1C45 A;  1CNS A;  3AW7 A;  5C6I A;  5DM9 A;  4HTQ A;  4B4J A;  4G4H A;  1QSA A;  4NGI A;  4OWA A;  4P2E A;  4B0D A;  1JWR A;  1XEI A;  3A34 A;  1XSF A;  1HER A;  1D9U A;  1OUB A;  3WW5 A;  1W6Z A;  1JKA A;  2A7D A;  3A67 Y;  5LAF A;  1VED A;  2DQD Y;  3G3A B;  5F16 A;  1DI5 A;  2BQN A;  1GB9 A;  3WVX A;  1GF8 A;  3KAM A;  2MED A;  4QEQ A;  1LSD A;  2DQI Y;  1NBY C;  2YDG A;  4X3B A;  1AKI A;  1G7I C;  1JSF A;  1LYY A;  1DXJ A;  154L A;  4OWE A;  5F81 A;  4IAT A;  1LTM A;  1LZY A;  2CWI A;  2BQL A;  1B9O A;  2D6B A;  5I5Q A;  1OUF A;  2DQF C;  1BWI A;  3A3R X;  2I26 L;  3A96 A;  1GF5 A;  3AGH A;  1GB6 A;  4YOP A;  3W6C A;  2FYD A;  1GEV A;  1IC5 Y;  1IX0 A;  1LHJ A;  4NWE A;  1REM A;  1HML A;  1LZ5 A;  2D4K A;  1JKB A;  1AM7 A;  4KXI A;  5DL9 A;  1UAC Y;  1C46 A;  1CJ7 A;  4LYB A;  4G4C A;  4DD7 A;  1IP7 A;  3A94 A;  4N5R A;  4NGL A;  4LFP A;  3WVY A;  4DYG A;  2D4I A;  3LYZ A;  4CJ2 A;  1D6P A;  5DN5 A;  4A7D A;  1GBS A;  1BB5 A;  4H8Y A;  1B7M A;  5LVH A;  5KXN A;  4IJ4 A;  2BLY A;  4KT3 A;  1HEL A;  3P64 A;  4N0J A;  5D5C A;  3A91 A;  1CKG A;  1LJ4 A;  3WU7 A;  153L A;  3N9A A;  1HMK A;  1T3P A;  4M6D A;  2XBR A;  4Z41 A;  4XJF A;  5LVJ A;  132L A;  1UC0 A;  4H9H A;  5A3E A;  2FYC A;  5HNC A;  1GBY A;  2Z12 A;  2ZQ3 A;  3W3E A;  4HP0 A;  4Z3M A;  1NDG C;  4U3X B;  1LMA A;  1LMT A;  2NWD X;  1GF6 A;  5FEK A;  4YM8 A;  1YIL A;  2HEB A;  3CT0 A;  2EIZ C;  4DD0 A;  3WU9 A;  4ET9 A;  1LJG A;  5L9J A;  4HTN A;  1B7P A;  2LZ2 A;  1IOC A;  1HSW A;  4W96 A;  1GBO A;  5LYT A;  1NF5 A;  4LYO A;  4H94 A;  1O23 A;  3WH1 A;  4NWH A;  1ALC A;  1WQP A;  1H87 A;  4KPM A;  5F9X A;  2MEB A;  3SP3 A;  1A4V A;  1BB6 A;  1WQN A;  2BQM A;  1YAQ A;  1YRO A;  4DD2 A;  5M1Y A;  4BAD A;  4H91 A;  4B4E A;  4WLT A;  5LIO A;  1UBZ A;  3WYH A;  1AT5 A;  4YF2 A;  4NGV A;  1LSM A;  4QDN A;  2H9K A;  3ZEK A;  1CJ9 A;  1LSE A;  2IFF Y;  3P66 A;  1CKH A;  2EPE A;  1G7J C;  3RT5 X;  4ETC A;  2CJL A;  2W1M A;  1B7R A;  4PGJ B;  1LZN A;  2G4Q A;  1RI8 B;  3VWO A;  2X0A A;  2ZYC A;  1IY3 A;  4AGA A;  1IWY A;  4MST A;  1DKJ A;  2Z39 A;  1XEJ A;  1CKD A;  3CSZ A;  1B5U A;  2YBH A;  5FST A;  3HBE X;  3TXG A;  3AW6 A;  3J4G A;  2ZYP A;  3HBH A;  1VAT A;  4RW1 A;  1BVX A;  1LHM A;  3LYM A;  4HSF A;  4NIJ A;  4NHS A;  3TMV A;  3AB6 A;  4GCF A;  3TXH A;  1YAM A;  1IP6 A;  3OJP A;  1YAN A;  1IP2 A;  1BVK C;  3AZ7 A;  4NGK A;  3WUM A;  4WM2 A;  1LZ6 A;  1HNL A;  4N1E I;  3ATO A;  1V7S A;  1HEM A;  1XGQ C;  1GFE A;  1IOQ A;  1DZB X;  1YL1 X;  3GXK A;  4GLA A;  3AZ5 A;  3A95 A;  4WG7 A;  4WM4 A;  3AZ4 A;  1RE2 A;  1GE2 A;  1FBI X;  3B72 A;  4ETA A;  4H9C A;  1GFU A;  1YKY X;  1IWT A;  4XJG A;  3LYO A;  2VB1 A;  2MEC A;  1VAU A;  3AYQ A;  1HHL A;  4OOO A;  4TSC A;  3TXK A;  3WL2 A;  5KXL A;  3WXT A;  1OUA A;  1UIB A;  2Y8P A;  1LZG A;  2LYO A;  2XJW A;  1UIF A;  3A6C Y;  1IOS A;  3N9E A;  1JJ0 A;  3LZ2 A;  1LMO A;  1LSZ A;  1WQM A;  2ZNW Y;  4RW2 A;  1B7N A;  4WL7 A;  1OUH A;  4NFV A;  2HEF A;  2YBJ A;  4AXT A;  1C10 A;  5ILF A;  2Q0M X;  1TEW A;  3TMX A;  4OW1 A;  1NHE A;  4LYZ A;  1T6V L;  3B6L A;  2ZQ4 A;  2XBS A;  3WW6 A;  1DPW A;  4GN5 C;  1JEF A;  4GCD A;  4TUN A;  1GF9 A;  3ZVQ B;  1LSF A;  1C08 C;  1HFX A;  1GE4 A;  1VDQ A;  3A3Q A;  4DD3 A;  1EQ4 A;  4NGW A;  4LGK A;  3W6F A;  1P2C C;  1LJK A;  1V7T A;  1LYO A;  4RLN A;  1WTN A;  1LSY A;  1UIG A;  4H8Z A;  1LZ9 A;  1TCY A;  4NSH A;  4LYM A;  1LCN A;  1B7L A;  1FDL Y;  1HEN A;  4H92 A;  4NHT A;  4CFP A;  3J6K A;  5HNL A;  4I8S A;  2FBD A;  4B4I A;  2Z19 A;  4WL6 A;  2YSS C;  2EQL A;  1B2K A;  3N9C A;  4OWC A;  1GDX A;  2BQI A;  2RSC A;  1UIC A;  5KXR A;  9LYZ A;  2HED A;  3A90 A;  4ETB A;  2W1Y A;  3A8Z A;  1HEP A;  4I0C A;  4DDC A;  3QE8 A;  5E9R A;  4PJ2 C;  5F9U A;  1GFR A;  1LJN A;  2DQE Y;  2YBI A;  1XGR C;  2F4A A;  2MEA A;  4YEN A;  1GB0 A;  1WVV A;  2CDS A;  1G7M C;  4Z98 A;  3WPJ A;  4ET8 A;  2Z38 A;  1XFP L;  4LT1 A;  5B59 A;  3WUA A;  5FDJ A;  3CT1 A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  3WXU A;  2JP7 A;  4IAS A;  2Z2F A;  1NWG A;  3HH4 A;  1JTT L;  4I7M A;  1GD6 A;  1PJJ A;  3CDQ A;  3U6P A;  1L53 A;  2DQG Y;  1SWY A;  3QNG A;  1YIK A;  1SXJ B;  1L54 A;  3OE8 A;  1LZR A;  1N4F A;  3MGW A;  1LI2 A;  3SAT A;  249L A;  3AGG G;  2KZU A;  201L A;  4JI7 M;  3H4J A;  5F3W A;  3ZVQ A;  3D8B A;  3HHZ A;  3C81 A;  4IBG A;  1SX7 A;  4ETE A;  1HFZ A;  1IWX A;  3WU8 A;  4PJZ A;  4GRV A;  1YSY A;  4HJY A;  1JIY A;  1YE9 A;  102L A;  3EIE A;  1G4A E;  3U61 A;  1DKK A;  3CT5 A;  2C8O A;  1GJS A;  4ML7 A;  3HZJ A;  4YEO A;  1L37 A;  2CUU A;  1QZM A;  2NTH A;  2L4F A;  260L A;  3KOZ E;  3UGJ A;  3HTG A;  3P68 A;  1LJI A;  5T3F A;  3MJ5 A;  4H9I A;  3HU8 A;  1OP9 B;  3RW8 A;  1IBM M;  4WOA A;  221L A;  1HNX M;  219L A;  1CUK A;  5KXX A;  4QNM A;  1D0L A;  5ITR A;  4B3M M;  1REY A;  1IN7 A;  3B0O A;  2HUK A;  1L93 A;  1LJH A;  1IWU A;  4GCC A;  4XAD A;  1T8G A;  230L A;  4PRQ A;  1L22 A;  5AMY A;  4HPE A;  111L A;  2DXI A;  4FWD A;  1GEZ A;  3B7Z A;  4AQY M;  1FLQ A;  1QQY A;  3NY9 A;  1TGU A;  1G1V A;  1IP1 A;  2BLX A;  1GBW A;  3F8V A;  5KXY A;  211L A;  4WM6 A;  3TXJ A;  2DVW B;  3I01 M;  1L05 A;  1L80 A;  1OQM A;  4NG1 A;  4RF1 A;  1GF0 A;  4UWV A;  5L3H A;  2NQ8 C;  1G71 A;  2F2N A;  1IEE A;  3U60 B;  2ZM6 M;  1RU3 A;  2O7A A;  2LNH C;  189L A;  4LFX A;  4EKR A;  2JZ0 A;  4ZFP A;  3OK0 A;  1DI3 A;  5I4Y A;  2YFQ A;  1JR3 E;  1Z55 A;  1LSB A;  255L A;  3GUO A;  2MEI A;  5A2Q S;  4Q7J A;  4R0F A;  182L A;  236L A;  1OV7 A;  5LAG A;  5KQD A;  4BBA A;  1XJU A;  1GE0 A;  4LGM A;  3SAS A;  1QT3 A;  1JHL A;  4UWU A;  2HEE A;  5LVG A;  1VDP A;  4DQ7 A;  3E46 A;  1R5L A;  4HTK A;  3CTW B;  1GFK A;  3IG8 A;  5KXM A;  1OUJ A;  3EBA B;  5I53 A;  5ITQ A;  1F10 A;  2CUZ A;  3AOE A;  3TWL A;  2J7O A;  4MCK A;  1LZS A;  3Q8X A;  1LHH A;  3FI7 A;  1LSC A;  2B72 A;  5IRE B;  1L43 A;  4J1B A;  5KKJ A;  1LZE A;  1L59 A;  3AV0 A;  252L A;  2L7H A;  4F1I A;  1WQO A;  3RZE A;  5E6J A;  5IDD A;  193L A;  1HNW M;  1IN4 A;  1L92 A;  3A93 A;  3F6Z A;  4L16 A;  4EXM A;  4E97 A;  4ARJ A;  3OTO M;  2N35 A;  4WO6 A;  1G41 A;  4GC5 A;  3J80 S;  1JKD A;  1YUB A;  1MLC E;  1DGH B;  4NL4 H;  4YEM A;  2CE7 A;  3PDS A;  3RGS A;  4I7T A;  3SFZ A;  1L21 A;  2D7H A;  1HT2 E;  1L95 A;  1G07 A;  4XBO A;  2UUA M;  3A42 A;  3GLG A;  1ZUR A;  3EO5 A;  1GDW A;  2KEB A;  2HEC A;  1IBL M;  3SB8 A;  1L10 A;  3WHK A;  2RB2 X;  4IBE A;  2UXB M;  3SBA A;  3HFM Y;  4HV2 A;  5KJ9 A;  1ZV5 L;  3V2W A;  1L47 A;  3HX3 A;  4FW9 A;  4WMG A;  2BQO A;  4PPO A;  2DQH Y;  4BS7 A;  3FAD A;  1DYF A;  1LSG A;  4JV5 M;  3K3T A;  2YR0 A;  1KY1 A;  4CGE A;  1T6O A;  1L64 A;  1HFY A;  2B6X A;  130L A;  3FD9 A;  3HGI A;  8CAT A;  4X66 M;  2EO2 A;  1NV8 A;  2KZS A;  6LYZ A;  3LZT A;  4L6V 6;  4NEB A;  4H9A A;  3A46 A;  1YAO A;  4IIW A;  4LDE A;  1WVU A;  4ANR A;  3J2P B;  2BQK A;  1LOZ A;  3CSR A;  3FYD A;  3M18 B;  4PK0 A;  4I7R A;  3TXB A;  3SYK A;  5KXO A;  1LJJ A;  2APL A;  1CX7 A;  4BLC A;  1BB3 A;  5JEN B;  1I94 M;  2OQ4 A;  3DMV A;  2J5Y A;  2RBP A;  5DLA A;  4NHP A;  1HSX A;  4KOD A;  2LTU A;  1DYA A;  1GFA A;  2YBL A;  1QSQ A;  3RNX A;  1L2C A;  4ARQ B;  1LZB A;  254L A;  3KS4 A;  5LMU M;  5EP4 A;  3W6D A;  2PC2 A;  2LHM A;  4B49 A;  4LT3 A;  1L18 A;  4J7V A;  3GLF B;  3LCV B;  1BVS A;  4NGI A;  4LF9 M;  1JWR A;  1XEI A;  5KPR A;  2ZAN A;  1D9U A;  1OUB A;  4L15 A;  3GPY A;  1VED A;  2DQD Y;  2IGC A;  3GPX A;  3G3A B;  2O4W A;  4AW4 A;  1L61 A;  1Z5C A;  2DQI Y;  1NBY C;  2QP9 X;  1LYY A;  1IXS A;  4OWE A;  3L28 A;  2G8L A;  137L A;  1CU6 A;  4PT5 A;  1B9O A;  2D6B A;  4XGI A;  4B7H A;  3AGH A;  2FYD A;  1QTD A;  1GEV A;  1IX0 A;  2R6F A;  5EP1 A;  3HU3 A;  2D4K A;  2MR9 A;  2O25 A;  3QYB A;  2C99 A;  4LFP A;  3WVY A;  3CDV A;  4DYG A;  5DNY A;  1D6P A;  3UMM A;  1BB5 A;  5LVH A;  3J81 S;  1C65 A;  2BLY A;  1CKG A;  1L02 A;  1LJ4 A;  2R46 A;  5DYG A;  4Z41 A;  173L A;  2QB0 B;  1ORY B;  2O5R A;  1GBY A;  1TLA A;  1WHC A;  2Z12 A;  4IBD A;  2ZQ3 A;  1E9R A;  4HP0 A;  3VK8 A;  4U3X B;  1LMA A;  2NWD X;  3FTF A;  1GF6 A;  4YM8 A;  1NNJ A;  2X49 A;  3U6S A;  4HEO A;  3W0L B;  1QT6 A;  1B7P A;  5FTL A;  1L2D A;  1L79 A;  3GP1 A;  4EJ4 A;  4W96 A;  2CFO A;  5EQT A;  1NF5 A;  2DWZ B;  1GL7 A;  229L A;  1L83 A;  2WSC F;  2DHY A;  1A4V A;  1P6Y A;  2J7N A;  1WQN A;  3T1H M;  1G0P A;  2L6O A;  3FKE A;  1UBZ A;  1AT5 A;  1OTR A;  3K9O A;  186L A;  2H9K A;  5FTK A;  1CJ9 A;  3ZEK A;  1G7J C;  2DAK A;  3ODU A;  3HJQ A;  1L2B A;  3VWO A;  2X0A A;  1KY0 A;  1VEG A;  1IWY A;  4MST A;  2Z39 A;  1B5U A;  4NC6 A;  3HY5 A;  2P5T A;  195L A;  1G06 A;  3AB6 A;  3TXH A;  2K6B A;  199L A;  1LW9 A;  1D2W A;  1YAN A;  2B6T A;  1L90 A;  4W56 A;  4NGK A;  2EA0 A;  3D8L A;  158L A;  1LZ6 A;  3QYE A;  129L A;  4KO8 A;  4N1E I;  1IXZ A;  4BB9 A;  1GFE A;  4A3V B;  1DZB X;  1YL1 X;  1LYJ A;  1XMQ M;  3AZ4 A;  1GE2 A;  1FBI X;  4OVZ B;  159L A;  4H9C A;  2G3Q A;  4XJG A;  2JUJ A;  2WZJ A;  3LYO A;  3AYQ A;  4OOO A;  161L A;  3U5Z A;  1UIB A;  3NBX X;  4CIS A;  3A6C Y;  2QPA A;  3N9E A;  4P17 A;  4RW2 A;  4WL7 A;  1YLA A;  3C3E A;  3B7N A;  3FYC A;  1LYD A;  2YBJ A;  4AXT A;  1C10 A;  2XGN A;  198L A;  1PQO A;  3B6L A;  3KOW E;  2XZU A;  3ZVQ B;  4TUN A;  1GF9 A;  1Z59 A;  3PXG A;  239L A;  3KS8 A;  3DN8 A;  4IBK A;  1V7T A;  4UN2 B;  3U61 B;  1L58 A;  1LSY A;  4NSH A;  4LYM A;  1B7L A;  2BNK A;  4CFP A;  4NHT A;  3C8S A;  3J6K A;  4DV6 M;  1L51 A;  2Z19 A;  4WL6 A;  2KDL A;  1EE8 A;  1B2K A;  2B3T A;  3KXE C;  2KW0 A;  1P36 A;  4YX7 C;  2BQI A;  5KXR A;  2HED A;  1I6S A;  3A8Z A;  3BOS A;  5I54 A;  1GFR A;  2YBI A;  1XGR C;  2MEA A;  4LZZ A;  1XFP L;  4DV0 M;  1KW7 A;  1LI6 A;  1NKH A;  1UCO A;  3OE9 A;  1OVJ A;  2BQD A;  2BQF A;  5B1F A;  4TX7 A;  4M0D A;  1QIO A;  1BHZ A;  1UIE A;  1JQU A;  1QTE A;  1HQC A;  5LA5 A;  5B06 A;  4XJB A;  1MU5 A;  3AGI A;  1SLY A;  2YVB A;  4PDG A;  2F5Q A;  4G9S A;  2DKL A;  4NGO A;  2C96 A;  2G4P A;  4CHX A;  4NGY A;  1OUE A;  2RH1 A;  3WPK A;  1DQJ C;  1HNZ M;  2ZNX Y;  5KKI A;  1L42 A;  4WLD A;  4NSJ A;  3HT7 A;  1FN5 A;  1NVM A;  150L A;  157L A;  4NSI A;  3NY8 A;  3FUW A;  131L A;  228L A;  1REZ A;  2IHL A;  5I14 A;  1T3T A;  2BQG A;  1LHK A;  4II7 A;  1ZQ9 A;  4G4R A;  1IP5 A;  2OOB A;  1L08 A;  243L A;  4Y28 F;  1IR9 A;  3HJ8 A;  3W6A A;  4G49 A;  4G4B A;  2V1C A;  176L A;  109L A;  1WQR A;  2WSE F;  4X65 M;  1IBK M;  1DGF A;  4LCB A;  4LF4 M;  4KL7 A;  1L98 A;  250L A;  4WM5 A;  1L46 A;  237L A;  3BKH A;  5F14 A;  1R6B X;  2OTY X;  3L64 A;  2FBB A;  1OV5 A;  1GB8 A;  4JXJ A;  4DD9 A;  2ZIJ A;  4LF7 M;  5B05 A;  1IC4 Y;  3J7A S;  172L A;  4DAJ A;  3KFU G;  4B08 A;  1HEW A;  1NQI A;  1IN5 A;  1DYG A;  3FTE A;  2Z2E A;  2B6Z A;  4N9R A;  3HHW A;  4I7Q A;  2HU1 A;  5LZM A;  1YQV Y;  210L A;  5GKN A;  1FKV A;  4E3U A;  1XB2 B;  3T6P A;  5LYZ A;  1BQL Y;  3VFD A;  1PZY A;  1P2L A;  4ZPX A;  3VW7 A;  2C5R A;  232L A;  1OUI A;  1PS5 A;  3F9L A;  3WPL A;  1GPQ C;  4LF5 M;  1OUG A;  3TQS A;  1OVK A;  1H6M A;  1LJ3 A;  2W1L A;  3T38 A;  2HL7 A;  1I56 A;  1CV0 A;  1VFB C;  1DYD A;  3SB6 A;  3K2L A;  4AG5 A;  4LZJ A;  2V1U A;  5LYM A;  155L A;  4WLY A;  3T36 A;  4M4O A;  2UU9 M;  3IWR A;  4P16 A;  3CB7 A;  2EUC A;  2RB1 X;  4WP2 A;  1T97 A;  1OJL A;  4LRT A;  2DWL A;  3SYL A;  1YL0 X;  1T8F A;  3FI5 A;  2Z37 A;  3TXF A;  1JTO L;  4K5Y A;  1QSW A;  2FFJ A;  4JI0 M;  224L A;  1OUC A;  3WHL A;  3GLG B;  1CU2 A;  4DV3 M;  3AOE C;  4QGZ A;  4MM3 B;  4YHH M;  1KSF X;  1ZYT A;  4L4U A;  1LSA A;  168L A;  3TMW A;  1B7O A;  3BKV A;  1L88 A;  1CVK A;  2CHG A;  3EML A;  4LFA M;  148L E;  4BAF A;  3U6L A;  3GRR A;  8LYZ A;  2VQF M;  2R4E A;  3SB5 A;  1WIV A;  4W5W A;  1G0L A;  1G7H C;  4DQ5 A;  1T6H A;  112L A;  1C69 A;  1GF4 A;  2HUB A;  1Z5A A;  1AT6 A;  1JUG A;  1GXV 2;  4FCW A;  1L69 A;  5HMV A;  1AIP C;  1KXX A;  3TMU A;  1W08 A;  1L33 A;  1GFH A;  1R4G A;  1GB5 A;  2DBT A;  4B3S M;  251L A;  2JZ1 A;  208L A;  1SSW A;  2DAG A;  1WR1 B;  1QT5 A;  2AUB A;  2X4A A;  1UID A;  4HJV A;  5HLL A;  4I7K A;  1HEQ A;  2B73 A;  1L40 A;  1N36 M;  1DYC A;  1JJ3 A;  194L A;  1F6R A;  4WM3 A;  3SB7 A;  1L74 A;  4L41 A;  5FTN A;  1L1T A;  4H9B A;  3VDU A;  4IBJ A;  4EKQ A;  4CIZ A;  2RB0 X;  3HUK A;  3LCU A;  3ZC7 B;  3GLI E;  1KYI A;  5DFL A;  1IC7 Y;  3B9P A;  2F2Q A;  1KIP C;  1LYH A;  4D80 A;  3L2A A;  4NSG A;  4S12 A;  3HU2 A;  3JR4 A;  2Z8Y M;  1XGT C;  3BXW A;  2XTH A;  1UA6 Y;  3LHM A;  4NGJ A;  1OKS A;  103L A;  216L A;  4LYT A;  3LQQ A;  3L27 A;  4LDO A;  225L A;  152L A;  1TH2 A;  1XXH E;  3G3W A;  2LZM A;  4WO9 A;  1PGY A;  2I25 L;  1GFG A;  5DYI A;  3ULR A;  4NG8 A;  2HU3 A;  5JI2 E;  1BWJ A;  2ZWB A;  2LVA A;  4NRV A;  2UXD M;  1L89 A;  1F6S A;  1GB3 A;  1JB0 F;  5E4P A;  1FLY A;  3AKZ A;  1CKF A;  2DAE A;  1KIR C;  4XEN A;  4FVM A;  1LHI A;  2DQJ Y;  4ARP A;  3M0E A;  5ITY A;  3OE0 A;  3AJN A;  2KNV A;  5L3I A;  2RBN A;  1LKR A;  5L8R F;  1G7L C;  1GBX A;  3HWS A;  1IXS B;  4LFB M;  4CHT B;  1GF3 A;  1B5Y A;  209L A;  3R8F A;  1SWZ A;  1GFJ A;  4DUZ M;  1D0M A;  3SAU A;  5EBH A;  1NHW C;  2ERC A;  2RGH A;  1EQ5 A;  4XJD A;  2F4V M;  1QUD A;  1XXH A;  1UIA A;  3KSJ A;  1FLU A;  2DI0 A;  4Z6Y A;  220L A;  1IVM A;  5KY1 A;  1K28 A;  4AKH A;  1LMC A;  1G8P A;  4LJA A;  1F4I A;  222L A;  4C5F A;  1PRB A;  4B1A A;  1PQM A;  261L A;  3GUN A;  3GLH B;  2K9D A;  1REX A;  1OFI A;  2FE8 A;  4GEW A;  1L36 A;  5LVI A;  1F0W A;  2XEP A;  2BQA A;  4R71 A;  4B3T M;  3IHP A;  2F30 A;  1CNS A;  4DKL A;  4B4J A;  5DM9 A;  2LVP C;  4B0D A;  3RGP A;  1L63 A;  4M9X A;  3C7W A;  1HER A;  3DN1 A;  3A67 Y;  5LAF A;  3FE3 A;  2C9C A;  1Q39 A;  5F16 A;  1VDL A;  2Y21 A;  1KFV A;  165L A;  1XJT A;  6LZM A;  4QEQ A;  1JR3 A;  4I8O A;  4MGI E;  5JI3 E;  2DZO B;  4GIT A;  1V34 A;  3K92 A;  2BWB A;  3H4M A;  139L A;  4IAT A;  1LTM A;  3A45 A;  1LZY A;  5F81 A;  3DZD A;  4LF8 M;  5E26 A;  2CWI A;  1MN3 A;  1BWI A;  1E94 E;  3A96 A;  1GF5 A;  4YOP A;  3W6C A;  2D7E A;  4RNA A;  4NWE A;  4KT0 F;  1REM A;  1Q3C A;  1LZ5 A;  1JKB A;  1C6J A;  1C46 A;  4LYB A;  246L A;  1C67 A;  2JXN A;  3A94 A;  4N5R A;  4CJ2 A;  2QQ8 A;  2HUM A;  1T8A A;  4A7D A;  2W82 A;  1TDH A;  1QUG A;  4IJ4 A;  1C6L A;  1CV4 A;  1HEL A;  3MK6 A;  153L A;  4KHP M;  4DJH A;  127L A;  1W5S A;  3AJI B;  2XLJ A;  1T3P A;  3KP0 E;  4I7O A;  4M6D A;  3C3D A;  4XJF A;  1J09 A;  1J5E M;  1IN8 A;  1C6M A;  3GUK A;  1VDD A;  5A3E A;  2FYC A;  1XC8 A;  1CU5 A;  4B7G A;  1C6G A;  4OU7 A;  2UUB M;  3W3E A;  4Z3M A;  2R45 A;  4GH9 A;  1LMT A;  4LDL A;  4NRW A;  1SXJ E;  1K3X A;  234L A;  2L78 A;  3T1Y M;  1IOC A;  1HSW A;  1NV9 A;  3PNV A;  3HH5 A;  1TDZ A;  3U5Z B;  3JR6 A;  2BJV A;  4ITQ A;  2XFT A;  4NWH A;  1WQP A;  1H87 A;  1L39 A;  2RBR A;  3SP3 A;  162L A;  5M1Y A;  1QTC A;  4WLT A;  5LIO A;  3CF6 E;  3AFH A;  1LSM A;  4QDN A;  1IFY A;  3HDF A;  1LGX A;  3NWL A;  2W1M A;  1B7R A;  3UON A;  4PGJ B;  3BBZ A;  1D3F A;  2ZYC A;  1L06 A;  2RAY X;  1DKJ A;  5FLX S;  3CSZ A;  4QOS A;  3THG A;  2YBH A;  1PJQ A;  5FST A;  3AW6 A;  3J4G A;  3HBH A;  4GHL A;  1L87 A;  1LHM A;  4WW0 A;  4NHS A;  2O01 F;  3OJP A;  4ZPU A;  3GQ5 A;  1IP2 A;  1BVK C;  3AZ7 A;  4G4O A;  4WM2 A;  2Q9D A;  1HNL A;  2MH8 A;  4REZ A;  3KP1 E;  1LV7 A;  118L A;  5ITT A;  1XGQ C;  1QQW A;  138L A;  5IHG A;  4WG7 A;  3C83 A;  3DN0 A;  3GXK A;  3AZ5 A;  4PD2 A;  1LLH A;  2RBO A;  5KO3 A;  1SX2 A;  3CF2 A;  1VAU A;  4MH0 E;  1HHL A;  3TXK A;  3M6A A;  175L A;  2QSF X;  4G6Z A;  2LYO A;  1UIF A;  2EKF A;  1P64 A;  2DEN A;  2CWB A;  4M0W A;  1WQM A;  2ZNW Y;  1B7N A;  4MGY E;  4MGK E;  1MJG M;  5EP2 A;  5ILF A;  2Q0M X;  3TMX A;  1Y8G A;  2HAK A;  3DFZ A;  2M5Z A;  3GUJ A;  3HUQ A;  4GCD A;  3U6O A;  2QAR C;  2B7X A;  4YY3 M;  4GN5 C;  2LXE A;  1GE4 A;  1VDQ A;  3A3Q A;  3A98 B;  1FNN A;  113L A;  4NGW A;  4OO9 A;  1C6N A;  146L A;  187L A;  1NNU C;  1TCY A;  1FDL Y;  4H92 A;  2JY7 A;  1CX6 A;  2FBD A;  3GQ4 A;  4B4I A;  1P2R A;  4OX9 M;  1L96 A;  2KNA A;  174L A;  2EQL A;  3N9C A;  4OWC A;  1GDX A;  1L97 A;  218L A;  2RSC A;  1C61 A;  4IAP A;  9LYZ A;  3A90 A;  4ETB A;  2W1Y A;  4I0C A;  5E9R A;  4I81 A;  3DN2 A;  4YEN A;  4Z98 A;  2L2D A;  3WPJ A;  1GB0 A;  257L A;  1L52 A;  2FH0 A;  4ET8 A;  4AKG A;  1G0J A;  4LT1 A;  3WUA A;  2YNM D;  1WGL A;  5FDJ A;  7LZM A;  1CUP A;  1L19 A;  1R2Z A;  1JQJ C;  1DGB A;  3W68 A;  4LG2 A;  1INU A;  3GXR A;  2HCB A;  2H5Z A;  3G3V A;  4WM1 A;  4NSO B;  1KS3 A;  1B5Z A;  1LMQ A;  1QUO A;  1NJF A;  1L72 A;  3T6U A;  3FUU A;  4L78 A;  245L A;  3B0I A;  1PJI A;  2L09 A;  3SAR A;  4WUR A;  3A92 A;  4GLV A;  5HQ1 A;  1HF4 A;  1C43 A;  4MGH A;  3LW5 F;  2N5Z A;  149L A;  1L85 A;  4L8R C;  1OUD A;  1D0K A;  4PRU A;  4FWH A;  3C7Z A;  3DMZ A;  2LYM A;  4JI6 M;  233L A;  180L A;  3SB9 A;  4LT2 A;  1ZMV A;  2QEN A;  3FUT A;  4AKI A;  1KW5 A;  3P65 A;  2CV0 A;  1KXY A;  1L91 A;  3FRH A;  4QY9 A;  2Y20 A;  1D2Y A;  1FJG M;  125L A;  156L A;  4D82 A;  4W94 A;  1UIH A;  2K0B X;  2LVN C;  6LYT A;  1I1Z A;  247L A;  3U6D A;  3IJU A;  2F4G A;  3U6M A;  2MRO B;  2Q9E A;  3Q8G A;  4FCT A;  1QDT A;  1GF7 A;  2B75 A;  2RAZ X;  1IR8 A;  1I4W A;  4MGZ E;  1L94 A;  7LYZ A;  3W67 A;  3K9P A;  1IOR A;  2HWJ A;  3QY4 A;  2Z4R A;  1EFU B;  1IR7 A;  1HEO A;  253L A;  242L A;  2YBM A;  1IIZ A;  4X64 M;  1TH3 A;  4LT0 A;  1LYZ A;  2EKK A;  3TXD A;  4WLX A;  2H1R A;  178L A;  1L26 A;  1TF0 B;  2BQJ A;  4OWB A;  1WQQ A;  4NHQ A;  5B07 A;  2OE7 X;  3EIH A;  3WMK A;  2C8P A;  4AG6 A;  1GAZ A;  5IWA M;  3LN2 A;  2F5N A;  166L A;  217L A;  3U6C A;  3CDR A;  3DA1 A;  1RCM A;  5FCP A;  2A5Y B;  4LJ5 A;  1E8L A;  3WUL A;  4XJH A;  5KXT A;  2QZ4 A;  1NBZ C;  3VLF B;  4K0K M;  3CDO A;  1LI3 A;  1NDM C;  4QHS A;  1QTK A;  235L A;  4DD1 A;  1QUT A;  5FTM A;  1GWD A;  1QYR A;  5ITU A;  2ZIK A;  1JIS A;  1L76 A;  1ZVY B;  2H5X A;  3RUN A;  2Q2E B;  1GKI A;  4I7L A;  5FSW A;  3IJV A;  1LJF A;  2OOA A;  5II3 A;  5DN4 A;  3SMS A;  2B6Y A;  1GE3 A;  3DN4 A;  3TWM A;  1KIQ C;  3I4Y A;  1HJP A;  3A6B Y;  5LVK A;  1B5V A;  1BGI A;  2FNA A;  3RU5 A;  3GPU A;  3M3U A;  1B7S A;  3GLF E;  2BQE A;  2BJW A;  1EQE A;  1C6D A;  4EOF A;  3F92 A;  3FE0 A;  1XGU C;  1OWY A;  2LYZ A;  5APE A;  2KA6 B;  4ARM A;  4XYY A;  1NHB A;  2CHV A;  1C6A A;  4JI5 M;  2VQE M;  2ANX A;  5EXP A;  1PQI A;  1QTV A;  5APC A;  1CU0 A;  4KLN A;  4H8X A;  2DWM A;  1JSE A;  5FHW A;  4RDS A;  1LZA A;  5FEL A;  1J1X Y;  1LHL A;  2MEG A;  2XSZ A;  1CJ6 A;  2Z4S A;  1IY4 A;  2D7G A;  1GFV A;  1TTE A;  4GKJ M;  1QS9 A;  4FDY A;  2HTX A;  1LMP A;  3E3D A;  1L81 A;  2H9J A;  4GHA A;  2DZL A;  5J7C A;  2Z18 A;  4ZIX A;  4DC4 A;  3GUP A;  1L41 A;  1K3W A;  1P56 A;  4NOO B;  2B70 A;  4H93 A;  4BAP A;  1D3J A;  1XXH B;  4DV5 M;  3FTC A;  1BB7 A;  3WUN A;  1Z6T A;  1VDS A;  3LYT A;  3GRU A;  2RGO A;  4NHI A;  1IO5 A;  5ILC A;  3KOY E;  1I20 A;  1ZMW A;  5KXW A;  1H6U A;  4HPI A;  1G0Q A;  3TWK A;  4J1A A;  1BB4 A;  3FA0 A;  1IOT A;  1RJC B;  1L07 A;  1QS5 A;  3SBJ A;  1QUH A;  4TTD A;  4N8Z A;  133L A;  2D4J A;  3PBL A;  1D9W A;  1GFT A;  3SN6 R;  5KXZ A;  2XF3 A;  4FJR A;  240L A;  4J0L A;  2BQC A;  5KXP A;  2DQA A;  1YKX X;  1B0D A;  4W52 A;  1TBY A;  1LGU A;  1JIT A;  1L8Q A;  1LMN A;  4IBF A;  4W51 A;  1IP4 A;  3L29 A;  1FLW A;  3LZM A;  3T15 A;  1JTP L;  2VDB B;  1QDR A;  2LBC A;  4DV2 M;  3QAK A;  1DYB A;  1GAB A;  4PHI A;  183L A;  1B5X A;  120L A;  5HMJ A;  5KXK A;  1GXX A;  1G59 A;  2W1X A;  200L A;  1C60 A;  1V33 A;  3VK7 A;  3VDP A;  1LSN A;  4ETD A;  5C18 A;  1OIZ A;  4GIP A;  3B7Q A;  1UUZ C;  4DT3 A;  1GB2 A;  123L A;  4UWN A;  1CUQ A;  2A4T A;  1L77 A;  2GNO A;  1C7P A;  2WAR A;  1LZ4 A;  4W58 A;  4II8 A;  1WGN A;  2X8A A;  4TWS A;  1GO5 A;  1XEP A;  5IT9 S;  4GCB A;  2KXE A;  4EKP A;  3HHY A;  1B7Q A;  4RLM A;  2NTG A;  1J1P Y;  4W59 A;  1C45 A;  241L A;  1L56 A;  5C6I A;  4OWA A;  1KNI A;  3A34 A;  3HU9 A;  3WW5 A;  2A7D A;  191L A;  4FCV A;  2C9O A;  4DR6 M;  1DI5 A;  2BQN A;  1GB9 A;  2MED A;  4DBG B;  1N33 M;  2YDG A;  4X3B A;  1QAQ A;  3ZCB B;  4DV7 M;  1L00 A;  114L A;  3HWL A;  2CHQ A;  1XNR M;  4DR1 M;  1NSF A;  188L A;  1OYU A;  5I5Q A;  2DQF C;  2UUC M;  1LYE A;  3A3R X;  1PQK A;  2OU8 A;  1IC5 Y;  2LVO C;  2XSZ D;  1LHJ A;  3HH6 A;  1DYE A;  4KXI A;  5DL9 A;  2JY8 A;  1LGW A;  4W55 A;  4RKU F;  4G4C A;  4DD7 A;  1IP7 A;  4IBB A;  1HQY E;  3SMP A;  1GBS A;  4H8Y A;  5KXN A;  4KT3 A;  3A91 A;  5D5C A;  3WU7 A;  3E9S A;  1L13 A;  1QAM A;  1PQD A;  2R0I A;  5KQ8 A;  2XBR A;  2KNZ A;  1UC0 A;  4H9H A;  5HNC A;  2DHR A;  5B59 A;  3MHV C;  1IQP A;  1QAN A;  122L A;  115L A;  1YIL A;  2HEB A;  1GVN A;  1D3M A;  4JI3 M;  4ET9 A;  1LJG A;  3FTD A;  5LYT A;  1GBO A;  1QT7 A;  223L A;  4H94 A;  1O23 A;  4PCZ A;  4EIW A;  1C6E A;  3WH1 A;  1ALC A;  3HT6 A;  1XNQ M;  1C7Y A;  3G3X A;  141L A;  1QVR A;  4BAD A;  1L60 A;  3WYH A;  1LWG A;  3DKE X;  2R44 A;  3P66 A;  1CKH A;  2EPE A;  2QBY A;  2CJL A;  5KPT A;  1VEK A;  4LJ4 A;  1PJS A;  1LZN A;  4I7N A;  1RI8 B;  1LPY A;  2F5P A;  3KDS E;  1QAO A;  1IY3 A;  4AGA A;  1CV1 A;  3GLI A;  1XEJ A;  1CKD A;  1XMO M;  104L A;  4S0W A;  3HBE X;  3TXG A;  1SXJ C;  3K1J A;  1L48 A;  1C6C A;  4OW0 A;  1S3S A;  7CAT A;  3TMV A;  4I4L A;  4GCF A;  1P3Q Q;  1YAM A;  2VF8 A;  1L0J A;  1GLN A;  1V7S A;  1L01 A;  1L84 A;  3A95 A;  1RE2 A;  3HKP A;  1GFU A;  1IWT A;  4AQN A;  2VB1 A;  1OQY A;  1L65 A;  4JN6 A;  4TSC A;  3WL2 A;  2F5O A;  3GUL A;  2CV1 A;  1OUA A;  2CRU A;  2ZAM A;  2R62 A;  1LZG A;  2XJW A;  1UFZ A;  1OAI A;  1IOS A;  3LZ2 A;  3JAM S;  2L4E A;  3C58 A;  215L A;  1L49 A;  2HEF A;  2R65 A;  3GPP A;  4DR3 M;  1L62 A;  1OAO C;  1TEW A;  3C9P A;  4OW1 A;  1NHE A;  3C8R A;  1T6V L;  2ANV A;  4LYZ A;  2OTZ X;  1CU3 A;  1DPW A;  3W0F A;  2F5S A;  1LSF A;  3E4R A;  1HFX A;  2B6W A;  4PDI A;  1K82 A;  1LJK A;  1G3I A;  2JNH A;  1G0K A;  1L04 A;  2QNJ A;  1WTN A;  4I7J A;  1L32 A;  4H8Z A;  1LZ9 A;  1XHB A;  5HNL A;  1L14 A;  4HL4 A;  2K47 A;  2I7N A;  1UIC A;  2ZTD A;  1L16 A;  2DWN A;  2GQF A;  1HEP A;  3QE8 A;  1C62 A;  4PJ2 C;  1LJN A;  3TL4 X;  2DQE Y;  3SAW A;  2F4A A;  1VQ1 A;  1WVV A;  1G7M C;  4R3D A;  3GLG E;  3GRV A;  3CT1 A;  147L A;  1C66 A;  3U6Q A;  1XEK A;  2BPU A;  4LYC A;  207L A;  3C8Q A;  259L A;  2QHO B;  1PQJ A;  1IN6 A;  1RFP A;  181L A;  1KXW A;  4CFO A;  2RKO A;  3I51 A;  4GRI A;  134L A;  1JKC A;  2YBN A;  169L A;  1AZF A;  1LZC A;  1VG5 A;  126L A;  4YXA C;  177L A;  1QUS A;  2M60 A;  1P3N A;  2DKV A;  2MJ5 B;  1YKZ X;  3G3B B;  1LJE A;  1C6H A;  3HUA A;  2OE9 X;  2WSF F;  196L A;  2EKS C;  1ZV1 A;  1L12 A;  3DNA A;  3TE6 A;  227L A;  1LZ1 A;  3PNY A;  2RBQ A;  2MEE A;  1MEL L;  3LVW A;  1GB7 A;  3B89 A;  4WG1 A;  4EMN A;  1NHG C;  2LZT A;  3B0K A;  1C6F A;  1VDT A;  4DR7 M;  2JA2 A;  3W6E A;  1NO1 A;  1L45 A;  1J7K A;  1X37 A;  1QTZ A;  1LWK A;  4CGY B;  4RF0 A;  4I7P A;  3HBD A;  2BQH A;  3D3D A;  5FTJ A;  3TXI A;  3E21 A;  2VF7 A;  3CQL A;  1CV5 A;  2HEA A;  4GMQ A;  1PJT A;  1D2N A;  3J27 B;  1JTN A;  1OVH A;  1P5C A;  5C6L A;  3NYA A;  1R7R A;  3ZH9 B;  4GN4 A;  1T43 A;  3U6E A;  1IY1 A;  3GUI A;  3NBI A;  1SXJ A;  5EP3 A;  1QT4 A;  1A5T A;  1L27 A;  2KHH A;  4JI8 M;  1CV6 A;  4HJZ A;  1NMM A;  4XN6 A;  1L70 A;  1GL6 A;  1A2Y C;  3K8Z A;  4EPF A;  1EL1 A;  171L A;  1G1W A;  2D91 A;  3VKG A;  4IBC A;  5APF A;  5LA8 A;  4NSR A;  1LYF A;  4JYA M;  3CSQ A;  1HR0 M;  4FWG A;  163L A;  4ARM B;  1GBZ A;  3J7B A;  2G4N A;  3RE8 A;  3OE6 A;  2OEA X;  2DNA A;  5EXS A;  4Z46 A;  5LXW A;  1L31 A;  1SSY A;  3QAU A;  1ZVH L;  4XK8 F;  1LYS A;  3P4Z A;  4O34 A;  1WXQ A;  1TAY A;  214L A;  2CGI A;  1JTM A;  3TXE A;  1L50 A;  1JR3 D;  1P37 A;  2BQB A;  1L34 A;  4ZEE A;  4Z8X A;  1LZT A;  3HTF A;  3RZ4 A;  3L26 A;  5LIN A;  4TUW A;  5D5F A;  3DMX A;  3HDE A;  2LHG A;  1J1O Y;  184L A;  1QT8 A;  1LPI A;  3EXD A;  2MEF A;  3HTB A;  2I7P A;  3FRI A;  4NXN M;  1CKC A;  1TDY A;  3V76 A;  2BAA A;  2AHM A;  2HHH M;  1GHL A;  2OU0 X;  4NY5 A;  2YQZ A;  1PM5 A;  1ZMY L;  3CGW A;  3JR5 A;  4QHT A;  3GLH E;  1IWV A;  2F32 A;  4IJF A;  3HU1 A;  256L A;  192L A;  4F2L A;  1N77 A;  1YAP A;  4HV1 A;  3PFI A;  4LJ8 A;  1ZAE A;  1IP3 A;  4M9Z A;  2E5L M;  1DI4 A;  2JY6 B;  2LVQ D;  2XQO A;  5B1G A;  2BWE A;  5EXX A;  1TH4 A;  2B5Z A;  1MX0 A;  1XWI A;  1LZ8 A;  2C98 A;  3U60 A;  3EMS A;  2XZF A;  2HKJ A;  1C6P A;  3FUV A;  1BWH A;  4DDA A;  1CV3 A;  2DQC Y;  5H37 D;  3HT9 A;  3CDT A;  2CV2 A;  2HUL A;  1L75 A;  5IEL A;  4OWH A;  4OOT A;  1CJ8 A;  4B7F A;  4H9E A;  1DGG A;  1AUA A;  4LZT A;  4LJ6 A;  1GE1 A;  4H90 A;  3ATN A;  1N75 A;  5BR8 M;  1XGP C;  3W6B A;  4ETA A;  1FKQ A;  1EIJ A;  205L A;  4NGZ A;  3UK6 A;  4JI4 M;  4G4Q A;  1G0M A;  1IWW A;  3GLH A;  2R4J A;  2CP8 A;  4R6C A;  1B5W A;  160L A;  2XH9 A;  3LQR A;  1L66 A;  1SQ2 L;  4EPI A;  1L44 A;  226L A;  3DN3 A;  2A7F A;  1IXR C;  2DAI A;  1P46 A;  5I4W A;  1L67 A;  4DWX A;  4H1P A;  3DOA A;  1LSP A;  1C64 A;  1DO2 A;  135L A;  3SAV A;  1HT1 E;  1L55 A;  4GN3 A;  2MGW A;  3CF0 A;  3M7G A;  1L82 A;  2MEH A;  1QZE A;  3UJN A;  1L23 A;  1JJ1 A;  3L2X A;  212L A;  5A3Z A;  1SXJ D;  2LWX A;  1L1Z A;  3KW6 A;  1D6Q A;  5BPV A;  4GCE A;  5K7O A;  145L A;  213L A;  4XJI A;  2Y0Q A;  5C1B A;  3B74 A;  2B74 A;  4DR5 M;  1L09 A;  3SHG B;  3K2R A;  1IWZ A;  1JPO A;  4B3R M;  1L86 A;  3C80 A;  1N78 A;  2DAM A;  2GV0 A;  1L24 A;  4JI1 M;  4GKK M;  1GAY A;  3AZ6 A;  3RFW A;  1DGH A;  1DPX A;  3D9A C;  5KXS A;  1IY2 A;  3KOX E;  4DR4 M;  5APD A;  4H9F A;  197L A;  2FS1 A;  1C6Q A;  1HC0 A;  2JY5 A;  5C6J A;  5LMN M;  4LJ7 A;  4DUY M;  1CTW A;  5KPZ A;  1L28 A;  4ARL A;  4D9Z A;  4MR1 A;  1OFH A;  3LVV A;  1OIP A;  2LC9 A;  144L A;  2LH0 A;  185L A;  4LJ9 A;  1WTM A;  2ZAO A;  2L7I A;  4IJE A;  2I6Z A;  3GO8 A;  3HHX A;  1LZD A;  2ZIL A;  244L A;  1EPY A;  1TR8 A;  4TSB A;  4C3W A;  142L A;  1L29 A;  4DDB A;  2KRU A;  1LAA A;  2ZBK B;  2VII A;  128L A;  3PVS A;  4MB7 A;  1QTH A;  1LKS A;  1L99 A;  258L A;  1ZMU A;  4AZF A;  3AW7 A;  1UM8 A;  4HTQ A;  4G4H A;  1QSA A;  4P2E A;  4G4N A;  3VKH A;  2G5G X;  1XSF A;  1QTB A;  4DV4 M;  4JI2 M;  3KVW A;  1W6Z A;  4R7G A;  1JKA A;  1ZWN A;  1L15 A;  3WVX A;  1GF8 A;  3KAM A;  3UZU A;  1LSD A;  2O79 A;  4N1C C;  1QSB A;  190L A;  140L A;  1AKI A;  1G7I C;  1DXJ A;  1JSF A;  262L A;  154L A;  1NY5 A;  1GJT A;  2BQL A;  4LFC M;  1NJG A;  1V92 A;  2FOI C;  108L A;  1C6T A;  1OUF A;  4NXM M;  2JWS A;  2CEA A;  2I26 L;  1DV0 A;  1C6K A;  1GB6 A;  3C82 A;  2QBY B;  1HML A;  3TPZ A;  1AM7 A;  1UAC Y;  1CJ7 A;  1L38 A;  3ZQJ A;  1L25 A;  1L71 A;  4NGL A;  3DN6 A;  2RRU A;  3GLI B;  5ITX E;  3FUX A;  2D4I A;  3LYZ A;  5DN5 A;  3LMM A;  1C6I A;  4ARQ A;  3IG5 A;  1B7M A;  4GC9 A;  2LHC A;  1L17 A;  3P64 A;  4N0J A;  1C6B A;  3HH3 A;  4DQJ A;  1OWZ A;  4YXC A;  164L A;  1IY0 A;  2UXC M;  1HMK A;  3N9A A;  1R2Y A;  1L11 A;  3SBB C;  5LVJ A;  2KRK A;  132L A;  1C1K A;  3GLF A;  4I5S A;  2Z7J A;  1L68 A;  238L A;  2LCB A;  2OO9 A;  1NDG C;  1P7S A;  5FEK A;  3CT0 A;  2EIZ C;  4DD0 A;  3WU9 A;  3ILK A;  5L9J A;  4HTN A;  167L A;  2LZ2 A;  1N32 M;  1C63 A;  3QWL A;  3KSX A;  2OU9 A;  4LYO A;  3L25 A;  3HT8 A;  1IM2 A;  4KPM A;  5F9X A;  2MEB A;  1BB6 A;  2BQM A;  1YAQ A;  1YRO A;  4DD2 A;  143L A;  4H91 A;  4B4E A;  3GQ3 A;  2Z3X A;  5ITX A;  4YF2 A;  4NGV A;  3I4V A;  3D4S A;  1G0G A;  4CJ6 A;  2IFF Y;  4LRS A;  1LSE A;  4EKS A;  3RT5 X;  4ETC A;  1NY6 A;  170L A;  4W53 A;  2DZN B;  2G4Q A;  1E9S A;  1VEJ A;  3I04 M;  2EJS A;  1L73 A;  1Q3B A;  107L A;  2ZYP A;  4LF6 M;  110L A;  1B6I A;  1VAT A;  2OE4 X;  4RW1 A;  1L03 A;  1BVX A;  1L30 A;  3LYM A;  4HSF A;  4NIJ A;  2ZTC A;  1N34 M;  3V2Y A;  1IP6 A;  1SG9 A;  2R18 A;  5EXT A;  3AL0 C;  3HTD A;  1Q02 A;  3HJS A;  3AOG A;  1LYG A;  206L A;  151L A;  3WUM A;  3SC3 A;  2XFS A;  4X62 M;  119L A;  1D3N A;  4GBR B;  1L35 A;  3ATO A;  3C7Y A;  1HEM A;  1E32 A;  1L57 A;  1IOQ A;  4QNR A;  4GLA A;  4D81 A;  4WM4 A;  3B72 A;  3GRY A;  248L A;  1YKY X;  1WTH A;  2MEC A;  1L0K A;  4HLQ A;  3SHF A;  1C68 A;  4W54 A;  5KXL A;  3WXT A;  2Y8P A;  2RBS A;  2Z6B A;  1JJ0 A;  1LMO A;  1LSZ A;  5IZ7 D;  1OUH A;  4NFV A;  4AI6 A;  4I7S A;  5EJC A;  2Y0T A;  2XBS A;  2ZQ4 A;  4LZM A;  3WW6 A;  4IBI A;  1JEF A;  4M9S A;  4QOZ C;  1C08 C;  4DD3 A;  1EQ4 A;  4LGK A;  3W6F A;  1P2C C;  4LY6 A;  1LYO A;  4RLN A;  1UIG A;  4DV1 M;  1DO0 A;  1LCN A;  1HEN A;  4W57 A;  3IEC A;  4I8S A;  4FD2 A;  2YSS C;  1W5T A;  4G3O A;  1LYI A;  2OPF A;  2QCU A;  231L A;  4DDC A;  4LGY A;  3MMP A;  5F9U A;  3GUM A;  5I4X A;  1Z5B A;  2F47 A;  4DR2 M;  2CDS A;  2Z38 A;  2V6Z M;  1WJ7 A;  3R9X B;  1L20 A; 
#chains in the Genus database with same CATH homology
 3WXU A;  4IAS A;  2Z2F A;  1NWG A;  3HH4 A;  1JTT L;  4I7M A;  1GD6 A;  3CDQ A;  1L53 A;  2DQG Y;  1SWY A;  3QNG A;  1YIK A;  1L54 A;  3OE8 A;  1LZR A;  1N4F A;  3MGW A;  1LI2 A;  249L A;  3AGG G;  201L A;  3ZVQ A;  3C81 A;  1SX7 A;  4ETE A;  1HFZ A;  1IWX A;  3WU8 A;  4PJZ A;  4GRV A;  4HJY A;  1JIY A;  102L A;  1DKK A;  3CT5 A;  2C8O A;  4ML7 A;  4YEO A;  1L37 A;  2CUU A;  2NTH A;  260L A;  3HTG A;  3P68 A;  1LJI A;  5T3F A;  4H9I A;  3HU8 A;  1OP9 B;  3RW8 A;  4WOA A;  221L A;  219L A;  5KXX A;  1D0L A;  1REY A;  3B0O A;  2HUK A;  1L93 A;  1LJH A;  1IWU A;  4GCC A;  4XAD A;  1T8G A;  230L A;  4PRQ A;  1L22 A;  5AMY A;  4HPE A;  111L A;  1GEZ A;  1FLQ A;  1QQY A;  3NY9 A;  1G1V A;  1IP1 A;  2BLX A;  1GBW A;  3F8V A;  5KXY A;  211L A;  4WM6 A;  3TXJ A;  1L05 A;  1L80 A;  1OQM A;  4NG1 A;  1GF0 A;  4UWV A;  5L3H A;  2F2N A;  1IEE A;  2O7A A;  4LFX A;  189L A;  4EKR A;  4ZFP A;  3OK0 A;  1DI3 A;  5I4Y A;  1Z55 A;  1LSB A;  255L A;  3GUO A;  2MEI A;  4R0F A;  182L A;  236L A;  1OV7 A;  5LAG A;  1XJU A;  1GE0 A;  1QT3 A;  1JHL A;  4UWU A;  2HEE A;  5LVG A;  1VDP A;  4DQ7 A;  4HTK A;  1GFK A;  5KXM A;  1OUJ A;  3EBA B;  5I53 A;  1F10 A;  4MCK A;  1LZS A;  1LHH A;  3FI7 A;  1LSC A;  2B72 A;  1L43 A;  4J1B A;  5KKJ A;  1LZE A;  1L59 A;  252L A;  1WQO A;  3RZE A;  5IDD A;  193L A;  1L92 A;  3A93 A;  3F6Z A;  4EXM A;  4E97 A;  4ARJ A;  4WO6 A;  1MLC E;  1JKD A;  4YEM A;  3PDS A;  4I7T A;  1L21 A;  1L95 A;  1G07 A;  1ZUR A;  3EO5 A;  1GDW A;  2HEC A;  3SB8 A;  1L10 A;  2RB2 X;  3SBA A;  3HFM Y;  4HV2 A;  5KJ9 A;  1ZV5 L;  3V2W A;  1L47 A;  4WMG A;  2BQO A;  4PPO A;  2DQH Y;  4BS7 A;  3FAD A;  1DYF A;  1LSG A;  3K3T A;  1KY1 A;  4CGE A;  1L64 A;  1HFY A;  2B6X A;  130L A;  6LYZ A;  3LZT A;  4NEB A;  4H9A A;  1YAO A;  4LDE A;  1WVU A;  4ANR A;  2BQK A;  1LOZ A;  3CSR A;  3M18 B;  4PK0 A;  3TXB A;  4I7R A;  5KXO A;  1LJJ A;  1CX7 A;  1BB3 A;  5JEN B;  3DMV A;  2RBP A;  5DLA A;  4NHP A;  1HSX A;  1DYA A;  1GFA A;  2YBL A;  1QSQ A;  3RNX A;  4ARQ B;  1LZB A;  254L A;  3W6D A;  2PC2 A;  2LHM A;  4B49 A;  4LT3 A;  1L18 A;  4J7V A;  4NGI A;  1JWR A;  1XEI A;  1D9U A;  1OUB A;  1VED A;  2DQD Y;  2IGC A;  3G3A B;  2O4W A;  1L61 A;  2DQI Y;  1NBY C;  1LYY A;  4OWE A;  137L A;  1CU6 A;  1B9O A;  2D6B A;  3AGH A;  2FYD A;  1QTD A;  1GEV A;  1IX0 A;  2D4K A;  4LFP A;  3WVY A;  3CDV A;  4DYG A;  1D6P A;  1BB5 A;  5LVH A;  1C65 A;  2BLY A;  1CKG A;  1L02 A;  1LJ4 A;  4Z41 A;  173L A;  2QB0 B;  1GBY A;  1TLA A;  2Z12 A;  2ZQ3 A;  4HP0 A;  4YM8 A;  4U3X B;  1LMA A;  2NWD X;  1GF6 A;  1QT6 A;  1B7P A;  1L79 A;  4EJ4 A;  4W96 A;  1NF5 A;  229L A;  1L83 A;  1A4V A;  1P6Y A;  1WQN A;  1G0P A;  1UBZ A;  1AT5 A;  186L A;  2H9K A;  3ZEK A;  1CJ9 A;  1G7J C;  3ODU A;  3VWO A;  2X0A A;  1KY0 A;  1IWY A;  4MST A;  2Z39 A;  1B5U A;  195L A;  1G06 A;  3AB6 A;  3TXH A;  199L A;  1LW9 A;  1D2W A;  1YAN A;  2B6T A;  1L90 A;  4W56 A;  4NGK A;  158L A;  1LZ6 A;  129L A;  4N1E I;  1GFE A;  1DZB X;  1YL1 X;  1LYJ A;  3AZ4 A;  1GE2 A;  1FBI X;  159L A;  4H9C A;  4XJG A;  3LYO A;  3AYQ A;  4OOO A;  161L A;  1UIB A;  3A6C Y;  3N9E A;  4RW2 A;  4WL7 A;  1LYD A;  2YBJ A;  4AXT A;  1C10 A;  198L A;  1PQO A;  3B6L A;  3ZVQ B;  4TUN A;  1GF9 A;  239L A;  3DN8 A;  1V7T A;  1L58 A;  1LSY A;  4NSH A;  4LYM A;  1B7L A;  4CFP A;  4NHT A;  3C8S A;  3J6K A;  1L51 A;  2Z19 A;  4WL6 A;  1B2K A;  1P36 A;  4YX7 C;  2BQI A;  5KXR A;  2HED A;  1I6S A;  3A8Z A;  5I54 A;  1GFR A;  2YBI A;  1XGR C;  2MEA A;  1XFP L;  1LI6 A;  1KW7 A;  1NKH A;  1UCO A;  3OE9 A;  1OVJ A;  2BQD A;  2BQF A;  5B1F A;  4TX7 A;  1QIO A;  1UIE A;  1BHZ A;  1JQU A;  1QTE A;  5LA5 A;  5B06 A;  4XJB A;  3AGI A;  1SLY A;  2YVB A;  4G9S A;  4NGO A;  2G4P A;  4CHX A;  4NGY A;  1OUE A;  2RH1 A;  3WPK A;  1DQJ C;  2ZNX Y;  5KKI A;  1L42 A;  4WLD A;  4NSJ A;  3HT7 A;  1FN5 A;  157L A;  150L A;  4NSI A;  3NY8 A;  131L A;  228L A;  1REZ A;  2IHL A;  5I14 A;  2BQG A;  1LHK A;  1IP5 A;  1L08 A;  243L A;  3W6A A;  1IR9 A;  4G49 A;  4G4B A;  176L A;  109L A;  1WQR A;  4KL7 A;  1L98 A;  250L A;  4WM5 A;  1L46 A;  237L A;  3BKH A;  5F14 A;  2OTY X;  3L64 A;  2FBB A;  1OV5 A;  1GB8 A;  4DD9 A;  2ZIJ A;  5B05 A;  1IC4 Y;  172L A;  4DAJ A;  1HEW A;  1NQI A;  1DYG A;  2Z2E A;  2B6Z A;  4N9R A;  4I7Q A;  2HU1 A;  5LZM A;  1YQV Y;  210L A;  1FKV A;  4E3U A;  5LYZ A;  1BQL Y;  1PZY A;  1P2L A;  3VW7 A;  232L A;  1OUI A;  1PS5 A;  3F9L A;  3WPL A;  1GPQ C;  1OUG A;  1OVK A;  1H6M A;  1LJ3 A;  2W1L A;  1I56 A;  1CV0 A;  1VFB C;  1DYD A;  3SB6 A;  5LYM A;  155L A;  4WLY A;  3T36 A;  4M4O A;  3IWR A;  3CB7 A;  2RB1 X;  1T97 A;  1YL0 X;  1T8F A;  3FI5 A;  2Z37 A;  3TXF A;  1JTO L;  4K5Y A;  1QSW A;  224L A;  1OUC A;  1CU2 A;  4QGZ A;  1ZYT A;  1LSA A;  168L A;  3TMW A;  1B7O A;  3BKV A;  1L88 A;  1CVK A;  3EML A;  148L E;  4BAF A;  8LYZ A;  3SB5 A;  1G0L A;  1G7H C;  4DQ5 A;  1T6H A;  112L A;  1C69 A;  1GF4 A;  2HUB A;  1AT6 A;  1JUG A;  1GXV 2;  5HMV A;  1L69 A;  1KXX A;  3TMU A;  1W08 A;  1L33 A;  1GFH A;  1GB5 A;  2DBT A;  251L A;  208L A;  1SSW A;  1QT5 A;  2AUB A;  1UID A;  4HJV A;  5HLL A;  4I7K A;  1HEQ A;  2B73 A;  1L40 A;  1JJ3 A;  1DYC A;  1F6R A;  194L A;  4WM3 A;  3SB7 A;  1L74 A;  4L41 A;  4H9B A;  4EKQ A;  2RB0 X;  3HUK A;  1IC7 Y;  2F2Q A;  1KIP C;  1LYH A;  4NSG A;  1XGT C;  2XTH A;  1UA6 Y;  3LHM A;  4NGJ A;  103L A;  216L A;  4LYT A;  4LDO A;  225L A;  152L A;  3G3W A;  2LZM A;  4WO9 A;  2I25 L;  1GFG A;  3ULR A;  4NG8 A;  2HU3 A;  2ZWB A;  1BWJ A;  1L89 A;  1F6S A;  1GB3 A;  5E4P A;  1FLY A;  1CKF A;  1KIR C;  4XEN A;  1LHI A;  2DQJ Y;  4ARP A;  3OE0 A;  3AJN A;  5L3I A;  2RBN A;  1LKR A;  1G7L C;  1GBX A;  1GF3 A;  1B5Y A;  209L A;  1SWZ A;  1GFJ A;  1D0M A;  5EBH A;  1EQ5 A;  4XJD A;  1QUD A;  1UIA A;  1FLU A;  220L A;  1IVM A;  5KY1 A;  1K28 A;  1LMC A;  222L A;  4C5F A;  4B1A A;  1PQM A;  261L A;  3GUN A;  1REX A;  1L36 A;  5LVI A;  1F0W A;  2BQA A;  2F30 A;  1CNS A;  4DKL A;  4B4J A;  5DM9 A;  4B0D A;  1L63 A;  3C7W A;  1HER A;  3DN1 A;  3A67 Y;  5LAF A;  5F16 A;  165L A;  1XJT A;  6LZM A;  4QEQ A;  139L A;  5F81 A;  4IAT A;  1LTM A;  1LZY A;  2CWI A;  1BWI A;  3A96 A;  1GF5 A;  4YOP A;  3W6C A;  4NWE A;  1REM A;  1LZ5 A;  1JKB A;  1C6J A;  1C46 A;  4LYB A;  246L A;  1C67 A;  3A94 A;  4N5R A;  4CJ2 A;  2HUM A;  4A7D A;  1T8A A;  1QUG A;  4IJ4 A;  1C6L A;  1CV4 A;  1HEL A;  153L A;  4DJH A;  127L A;  1T3P A;  4I7O A;  4M6D A;  4XJF A;  1C6M A;  3GUK A;  5A3E A;  2FYC A;  1CU5 A;  1C6G A;  3W3E A;  4Z3M A;  1LMT A;  4LDL A;  2L78 A;  234L A;  1IOC A;  1HSW A;  3HH5 A;  3JR6 A;  4NWH A;  1WQP A;  1H87 A;  1L39 A;  2RBR A;  3SP3 A;  162L A;  5M1Y A;  1QTC A;  4WLT A;  5LIO A;  1LSM A;  4QDN A;  3HDF A;  1LGX A;  2W1M A;  3UON A;  1B7R A;  4PGJ B;  1D3F A;  2ZYC A;  1L06 A;  2RAY X;  1DKJ A;  3CSZ A;  2YBH A;  5FST A;  3AW6 A;  3J4G A;  3HBH A;  1L87 A;  1LHM A;  4NHS A;  3OJP A;  4ZPU A;  1IP2 A;  1BVK C;  3AZ7 A;  4WM2 A;  2Q9D A;  1HNL A;  118L A;  1XGQ C;  138L A;  5IHG A;  4WG7 A;  3GXK A;  3DN0 A;  3C83 A;  3AZ5 A;  1LLH A;  2RBO A;  1SX2 A;  1VAU A;  1HHL A;  3TXK A;  175L A;  2LYO A;  1UIF A;  1P64 A;  1WQM A;  2ZNW Y;  1B7N A;  5ILF A;  2Q0M X;  3TMX A;  3HUQ A;  3GUJ A;  4GN5 C;  4GCD A;  2QAR C;  2B7X A;  1GE4 A;  1VDQ A;  3A3Q A;  113L A;  4NGW A;  4OO9 A;  1C6N A;  146L A;  187L A;  1TCY A;  1FDL Y;  4H92 A;  1CX6 A;  2FBD A;  4B4I A;  1P2R A;  1L96 A;  2EQL A;  174L A;  3N9C A;  4OWC A;  1GDX A;  1L97 A;  218L A;  2RSC A;  1C61 A;  4IAP A;  9LYZ A;  3A90 A;  4ETB A;  2W1Y A;  4I0C A;  5E9R A;  3DN2 A;  4YEN A;  4Z98 A;  3WPJ A;  1GB0 A;  257L A;  1L52 A;  4ET8 A;  1G0J A;  4LT1 A;  3WUA A;  5FDJ A;  7LZM A;  1CUP A;  1L19 A;  1INU A;  3GXR A;  2H5Z A;  3G3V A;  4WM1 A;  1KS3 A;  1B5Z A;  1LMQ A;  1QUO A;  1L72 A;  3T6U A;  245L A;  3B0I A;  3A92 A;  4GLV A;  5HQ1 A;  1HF4 A;  1C43 A;  2N5Z A;  149L A;  1L85 A;  1OUD A;  1D0K A;  4PRU A;  3C7Z A;  3DMZ A;  2LYM A;  233L A;  180L A;  3SB9 A;  4LT2 A;  1KW5 A;  3P65 A;  1KXY A;  1L91 A;  4QY9 A;  1D2Y A;  125L A;  156L A;  4W94 A;  1UIH A;  6LYT A;  1I1Z A;  247L A;  3IJU A;  2F4G A;  2Q9E A;  1QDT A;  1GF7 A;  2B75 A;  2RAZ X;  1IR8 A;  1L94 A;  7LYZ A;  1IOR A;  3QY4 A;  253L A;  1IR7 A;  1HEO A;  242L A;  2YBM A;  1IIZ A;  4LT0 A;  1LYZ A;  3TXD A;  4WLX A;  178L A;  1L26 A;  2BQJ A;  4OWB A;  1WQQ A;  4NHQ A;  5B07 A;  2OE7 X;  3WMK A;  2C8P A;  1GAZ A;  3LN2 A;  166L A;  217L A;  3CDR A;  1RCM A;  5FCP A;  1E8L A;  3WUL A;  4XJH A;  5KXT A;  1NBZ C;  3CDO A;  1LI3 A;  1NDM C;  1QTK A;  235L A;  4DD1 A;  1QUT A;  1GWD A;  2ZIK A;  1JIS A;  1L76 A;  1ZVY B;  3RUN A;  4I7L A;  3IJV A;  1LJF A;  5II3 A;  5DN4 A;  2B6Y A;  1GE3 A;  3DN4 A;  1KIQ C;  3A6B Y;  5LVK A;  1B5V A;  1BGI A;  3RU5 A;  3M3U A;  1B7S A;  2BQE A;  1EQE A;  1C6D A;  4EOF A;  3FE0 A;  1XGU C;  1OWY A;  2LYZ A;  5APE A;  4ARM A;  4XYY A;  1NHB A;  1C6A A;  2ANX A;  1QTV A;  1PQI A;  5APC A;  1CU0 A;  4H8X A;  1JSE A;  5FHW A;  4RDS A;  1LZA A;  5FEL A;  1J1X Y;  1LHL A;  2MEG A;  1CJ6 A;  1IY4 A;  1GFV A;  1QS9 A;  4FDY A;  2HTX A;  1LMP A;  3E3D A;  1L81 A;  2H9J A;  5J7C A;  2Z18 A;  4ZIX A;  4DC4 A;  3GUP A;  1L41 A;  1P56 A;  2B70 A;  4H93 A;  4BAP A;  1D3J A;  1BB7 A;  3WUN A;  1VDS A;  3LYT A;  4NHI A;  1IO5 A;  5ILC A;  1I20 A;  5KXW A;  4HPI A;  1G0Q A;  4J1A A;  1BB4 A;  3FA0 A;  1IOT A;  1RJC B;  1L07 A;  1QS5 A;  1QUH A;  4TTD A;  4N8Z A;  133L A;  2D4J A;  3PBL A;  1D9W A;  1GFT A;  3SN6 R;  5KXZ A;  4FJR A;  240L A;  4J0L A;  2BQC A;  5KXP A;  2DQA A;  1YKX X;  1B0D A;  4W52 A;  1TBY A;  1LGU A;  1JIT A;  1LMN A;  4W51 A;  1IP4 A;  1FLW A;  3LZM A;  1JTP L;  1QDR A;  3QAK A;  1DYB A;  4PHI A;  183L A;  1B5X A;  120L A;  5HMJ A;  5KXK A;  1GXX A;  2W1X A;  200L A;  1C60 A;  1LSN A;  4ETD A;  1UUZ C;  4DT3 A;  1GB2 A;  123L A;  4UWN A;  1CUQ A;  2A4T A;  1L77 A;  1C7P A;  2WAR A;  1LZ4 A;  4W58 A;  4II8 A;  4TWS A;  1XEP A;  4GCB A;  4EKP A;  1B7Q A;  4RLM A;  2NTG A;  1J1P Y;  4W59 A;  1C45 A;  241L A;  1L56 A;  5C6I A;  4OWA A;  1KNI A;  3A34 A;  3HU9 A;  3WW5 A;  2A7D A;  191L A;  1DI5 A;  2BQN A;  1GB9 A;  2MED A;  2YDG A;  4X3B A;  1L00 A;  114L A;  3HWL A;  188L A;  1OYU A;  5I5Q A;  2DQF C;  1LYE A;  3A3R X;  1PQK A;  2OU8 A;  1IC5 Y;  3HH6 A;  1LHJ A;  1DYE A;  4KXI A;  5DL9 A;  1LGW A;  4W55 A;  4G4C A;  4DD7 A;  1IP7 A;  1GBS A;  4H8Y A;  5KXN A;  4KT3 A;  3A91 A;  5D5C A;  3WU7 A;  1L13 A;  1PQD A;  2XBR A;  1UC0 A;  4H9H A;  5HNC A;  122L A;  115L A;  1YIL A;  2HEB A;  1D3M A;  4ET9 A;  1LJG A;  5LYT A;  1GBO A;  1QT7 A;  223L A;  4H94 A;  1O23 A;  1C6E A;  3WH1 A;  1ALC A;  3HT6 A;  3G3X A;  141L A;  4BAD A;  1L60 A;  3WYH A;  1LWG A;  3DKE X;  3P66 A;  1CKH A;  2EPE A;  2CJL A;  1LZN A;  4I7N A;  1RI8 B;  1LPY A;  1IY3 A;  4AGA A;  1CV1 A;  1XEJ A;  1CKD A;  104L A;  4S0W A;  3HBE X;  3TXG A;  1L48 A;  1C6C A;  3TMV A;  4GCF A;  1YAM A;  1L0J A;  1V7S A;  1L01 A;  1L84 A;  3A95 A;  1RE2 A;  1GFU A;  1IWT A;  4AQN A;  2VB1 A;  1L65 A;  4TSC A;  3WL2 A;  3GUL A;  1OUA A;  1LZG A;  2XJW A;  1IOS A;  3LZ2 A;  215L A;  1L49 A;  2HEF A;  1L62 A;  1TEW A;  4OW1 A;  1NHE A;  3C8R A;  1T6V L;  2ANV A;  4LYZ A;  2OTZ X;  1CU3 A;  1DPW A;  1LSF A;  2B6W A;  1HFX A;  1LJK A;  1G0K A;  1L04 A;  1WTN A;  4I7J A;  1L32 A;  4H8Z A;  1LZ9 A;  5HNL A;  1L14 A;  1UIC A;  1L16 A;  1HEP A;  3QE8 A;  1C62 A;  4PJ2 C;  1LJN A;  2DQE Y;  2F4A A;  1WVV A;  1G7M C;  3CT1 A;  147L A;  1C66 A;  1XEK A;  2BPU A;  4LYC A;  207L A;  3C8Q A;  259L A;  1PQJ A;  1RFP A;  181L A;  1KXW A;  4CFO A;  134L A;  1JKC A;  2YBN A;  169L A;  1AZF A;  1LZC A;  126L A;  4YXA C;  177L A;  1QUS A;  1P3N A;  2DKV A;  1YKZ X;  3G3B B;  1LJE A;  1C6H A;  3HUA A;  2OE9 X;  196L A;  2EKS C;  1L12 A;  3DNA A;  227L A;  1LZ1 A;  2RBQ A;  2MEE A;  1MEL L;  1GB7 A;  4WG1 A;  4EMN A;  2LZT A;  3B0K A;  1C6F A;  1VDT A;  3W6E A;  1L45 A;  1QTZ A;  1LWK A;  4I7P A;  3HBD A;  2BQH A;  3D3D A;  3TXI A;  3CQL A;  1CV5 A;  2HEA A;  1OVH A;  1JTN A;  1P5C A;  5C6L A;  3NYA A;  4GN4 A;  3GUI A;  1QT4 A;  1L27 A;  4XN6 A;  1CV6 A;  4HJZ A;  1NMM A;  1L70 A;  1A2Y C;  4EPF A;  1EL1 A;  171L A;  1G1W A;  2D91 A;  5APF A;  5LA8 A;  1LYF A;  3CSQ A;  163L A;  4ARM B;  1GBZ A;  2G4N A;  3OE6 A;  2OEA X;  4Z46 A;  5LXW A;  1L31 A;  1SSY A;  1ZVH L;  1LYS A;  3P4Z A;  4O34 A;  1TAY A;  214L A;  2CGI A;  1JTM A;  3TXE A;  1L50 A;  1P37 A;  2BQB A;  1L34 A;  4ZEE A;  1LZT A;  3HTF A;  3RZ4 A;  5LIN A;  5D5F A;  3DMX A;  3HDE A;  1J1O Y;  4N1C C;  184L A;  1QT8 A;  1LPI A;  3EXD A;  2MEF A;  3HTB A;  1CKC A;  1TDY A;  2BAA A;  1GHL A;  2OU0 X;  4NY5 A;  1ZMY L;  1IWV A;  2F32 A;  256L A;  192L A;  1YAP A;  4HV1 A;  1IP3 A;  1DI4 A;  2XQO A;  5B1G A;  2B5Z A;  1LZ8 A;  3EMS A;  1C6P A;  1BWH A;  4DDA A;  1CV3 A;  2DQC Y;  3HT9 A;  3CDT A;  2HUL A;  1L75 A;  5IEL A;  4OWH A;  4OOT A;  1CJ8 A;  4H9E A;  4LZT A;  4H90 A;  1GE1 A;  3ATN A;  3W6B A;  1XGP C;  4ETA A;  1FKQ A;  205L A;  4NGZ A;  1G0M A;  1IWW A;  4R6C A;  1B5W A;  160L A;  1L66 A;  1SQ2 L;  4EPI A;  1L44 A;  226L A;  3DN3 A;  2A7F A;  1P46 A;  5I4W A;  1L67 A;  4DWX A;  4H1P A;  1LSP A;  1C64 A;  135L A;  1L55 A;  4GN3 A;  1L82 A;  2MEH A;  1L23 A;  1JJ1 A;  3L2X A;  212L A;  5A3Z A;  1D6Q A;  4GCE A;  5K7O A;  145L A;  213L A;  4XJI A;  2B74 A;  1L09 A;  3K2R A;  1IWZ A;  1JPO A;  1L86 A;  3C80 A;  2GV0 A;  1L24 A;  1GAY A;  3AZ6 A;  1DPX A;  3D9A C;  5KXS A;  5APD A;  4H9F A;  197L A;  1C6Q A;  1HC0 A;  5C6J A;  4D9Z A;  1CTW A;  1L28 A;  4ARL A;  4MR1 A;  2LC9 A;  144L A;  185L A;  1WTM A;  2I6Z A;  1LZD A;  2ZIL A;  244L A;  1EPY A;  4TSB A;  4C3W A;  142L A;  1L29 A;  4DDB A;  1LAA A;  128L A;  1QTH A;  1LKS A;  1L99 A;  258L A;  3AW7 A;  4HTQ A;  4G4H A;  1QSA A;  4P2E A;  1XSF A;  1QTB A;  1W6Z A;  1JKA A;  1ZWN A;  1L15 A;  3WVX A;  1GF8 A;  3KAM A;  1LSD A;  2O79 A;  1QSB A;  190L A;  140L A;  1AKI A;  1G7I C;  1DXJ A;  1JSF A;  262L A;  154L A;  2BQL A;  1C6T A;  108L A;  1OUF A;  2I26 L;  1C6K A;  1GB6 A;  3C82 A;  1HML A;  1AM7 A;  1UAC Y;  1CJ7 A;  1L38 A;  1L25 A;  1L71 A;  4NGL A;  3DN6 A;  2D4I A;  3LYZ A;  5DN5 A;  1C6I A;  4ARQ A;  1B7M A;  1L17 A;  3P64 A;  4N0J A;  1C6B A;  3HH3 A;  4DQJ A;  1OWZ A;  4YXC A;  164L A;  3N9A A;  1HMK A;  1L11 A;  3SBB C;  5LVJ A;  132L A;  1L68 A;  238L A;  2LCB A;  1NDG C;  1P7S A;  5FEK A;  3CT0 A;  2EIZ C;  4DD0 A;  3WU9 A;  5L9J A;  4HTN A;  167L A;  2LZ2 A;  1C63 A;  2OU9 A;  4LYO A;  3HT8 A;  4KPM A;  5F9X A;  2MEB A;  1BB6 A;  2BQM A;  1YAQ A;  1YRO A;  4DD2 A;  143L A;  4H91 A;  4B4E A;  4YF2 A;  4NGV A;  3D4S A;  1G0G A;  2IFF Y;  1LSE A;  4EKS A;  4ETC A;  3RT5 X;  170L A;  4W53 A;  2G4Q A;  1L73 A;  107L A;  2ZYP A;  110L A;  1B6I A;  1VAT A;  2OE4 X;  4RW1 A;  1L03 A;  1BVX A;  1L30 A;  3LYM A;  4HSF A;  4NIJ A;  3V2Y A;  1IP6 A;  3HTD A;  1LYG A;  206L A;  151L A;  3WUM A;  1D3N A;  119L A;  4GBR B;  1L35 A;  3ATO A;  3C7Y A;  1HEM A;  1L57 A;  1IOQ A;  4GLA A;  4WM4 A;  3B72 A;  248L A;  1YKY X;  1WTH A;  2MEC A;  1L0K A;  1C68 A;  4W54 A;  5KXL A;  3WXT A;  2Y8P A;  2RBS A;  2Z6B A;  1JJ0 A;  1LMO A;  1LSZ A;  1OUH A;  4NFV A;  4I7S A;  2ZQ4 A;  2XBS A;  4LZM A;  3WW6 A;  1JEF A;  1C08 C;  4DD3 A;  1EQ4 A;  4LGK A;  3W6F A;  1P2C C;  1LYO A;  4RLN A;  1UIG A;  1LCN A;  1HEN A;  4W57 A;  4I8S A;  2YSS C;  1LYI A;  231L A;  4DDC A;  5F9U A;  3GUM A;  5I4X A;  2F47 A;  2CDS A;  2Z38 A;  5B59 A;  1L20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...