1LTMA

Accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
320
structure length
309
Chain Sequence
EPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accelerated X-ray structure elucidation of a 36 kDa muramidase/transglycosylase using wARP.
pubmed rcsb
source organism Escherichia coli
molecule tags Glycosyltransferase
molecule keywords 36 KDA SOLUBLE LYTIC TRANSGLYCOSYLASE
total genus 111
structure length 309
sequence length 320
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1ltmA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1ltmA02
1ZVYB 1G7LC 3TMXA 2A7DA 2XTHA 2ZIKA 1JSEA 1BGIA 1REMA 2DKVA 2G4PA 4FJRA 4H94A 4I0CA 2ZNXY 4KT3A 4NSHA 5D5CA 1XGUC 4WM5A 2D4KA 1D6QA 1XEKA 3D9AC 3G3AB 2AUBA 3TMWA 1GB3A 5C6LA 5II3A 1UUZC 4P2EA 4PGJB 1BVKC 3TXEA 2H9JA 1FLQA 2ZILA 1NDGC 4DD0A 4NIJA 3TMVA 4D9ZA 2Z39A 4G4HA 3D3DA 1AT5A 5I53A 2DQCY 4PRQA 1YKZX 2DBTA 2ZNWY 4XENA 5A3EA 1BVXA 3WUMA 1VDQA 1XGPC 1GF7A 2RSCA 4ZFPA 1B7SA 1YANA 1LOZA 3AW7A 4A7DA 3OK0A 4AGAA 1B7OA 1LZBA 3W6BA 1BB5A 1IX0A 3ULRA 1NBZC 4GN3A 5B05A 5APDA 4NY5A 1LJIA 1LPIA 3GXKA 3LZ2A 1T6VL 1YKYX 1DI3A 3LZTA 3WU9A 4UWNA 4YENA 4ZEEA 1LZ4A 1J1OY 1YAQA 2W1MA 4KXIA 1GFKA 8LYZA 2F2NA 3LN2A 4H9IA 4B4EA 4ZIXA 3AZ7A 4WM4A 1I1ZA 1J1PY 4XN6A 1B5XA 1LSGA 4RLMA 1UACY 1BWIA 4ETBA 5L3HA 2I6ZA 1GE1A 3TXFA 1GB9A 4H9BA 3WXUA 4RW2A 4MCKA 3B72A 1VDTA 1IP1A 1JHLA 3A8ZA 4HJYA 5HMVA 3LHMA 3BKHA 1BB4A 4TWSA 3RU5A 1WQQA 2LZTA 4L41A 2N5ZA 4H9EA 2X0AA 2ZQ3A 1CKFA 4UWVA 4J1BA 5FHWA 1OQMA 4H9FA 4PPOA 1YL1X 4RLNA 1IP3A 1LZCA 4YF2A 1LSZA 4HTNA 3A3RX 2FBDA 4CGEA 3SP3A 3AB6A 1OUFA 2YBMA 1GB6A 2DQDY 5E4PA 2HEBA 1GF8A 5T3FA 1HNLA 3WYHA 2Z2FA 3W6FA 2H9KA 4XADA 1ZV5L 4HV2A 1GB5A 1XGQC 5KXXA 1CJ6A 1GE0A 5B06A 3P64A 4H9HA 1LMNA 3A94A 3AZ6A 3RNXA 1JISA 5AMYA 4LGKA 4Z41A 1CKCA 5KJ9A 4OW1A 1JUGA 3K3TA 2DQAA 2Z38A 4H9AA 4J1AA 3AZ4A 4MSTA 1G7JC 1TAYA 2VB1A 3CSQA 1KIQC 3AW6A 1KXYA 1RE2A 5KKIA 2ZWBA 4N1CC 2BQNA 3A90A 4QGZA 4RDSA 2W1LA 2Z12A 5LYTA 2DQEY 3P68A 1C7PA 4DDBA 4WL6A 1NDMC 1NBYC 1G7IC 1I20A 2MEEA 5KXWA 1MLCE 4BS7A 4TX7A 2Y8PA 4QEQA 1HEPA 1IP5A 1QSWA 1TCYA 3WPKA 1HFYA 3HBDA 3KAMA 4H90A 2Z19A 5EBHA 5APEA 3TXHA 3QNGA 2LYOA 4HTKA 4HSFA 1HERA 1OP9B 5M1YA 1HEOA 4ML7A 1GFHA 2G4NA 1UC0A 2MEAA 1XEJA 2XBRA 1YIKA 3N9AA 4TSBA 3BKVA 1H6MA 4NG1A 2D91A 2LZ2A 4ETAA 3A67Y 1HEQA 4C5FA 2HEDA 5LA8A 5FCPA 5K7OA 3WVYA 3A6CY 4C3WA 1EL1A 1LJJA 1P2CC 1HEMA 2HECA 4GCCA 1KXXA 1D0LA 1LZ5A 2BPUA 4ANRA 4WG1A 1XFPL 2GV0A 1WVUA 4H8YA 1DPWA 1AKIA 1BB3A 5B1GA 1VAUA 4IJ4A 1GF6A 1LHHA 2BQJA 2EQLA 4WLTA 1IWZA 4PHIA 1F6SA 1GFUA 1LJNA 1OUCA 2HUBA 1IP2A 1DKJA 4ET9A 1IR8A 3WVXA 1IOQA 1UIDA 5KXPA 5LVKA 1HC0A 4GLAA 4WLDA 2C8OA 4NGZA 5D5FA 1IWTA 1GDXA 1LZRA 1YAMA 1C43A 2BQLA 1BB6A 4I8SA 5F9XA 3FI7A 5APFA 3WPJA 1BHZA 1FDLY 1GXXA 5IDDA 1GB0A 1NHEA 2BQHA 4EMNA 1UCOA 1LYSA 1HEWA 1IO5A 4HP0A 3WH1A 1UA6Y 2YBNA 5DL9A 1NWGA 1QDTA 1GHLA 4NSJA 3W6EA 2DQGY 5LYMA 4ETCA 1JIYA 1EQ4A 1XGTC 1FLUA 1GWDA 1LSEA 3A6BY 1HSXA 1D0KA 3G3BB 1VATA 1JTOL 1B5VA 4GLVA 2CDSA 4NFVA 1HFXA 1HELA 4ETDA 4OWBA 4DWXA 1GF5A 4FDYA 1CKDA 5C6JA 4H9CA 4CJ2A 3WUAA 3WW5A 4CFPA 4W96A 5F16A 1J1XY 3IJVA 1ZMYL 3HBHA 1HENA 5LYZA 6LYZA 5APCA 1LMAA 2BQDA 5L9JA 3GXRA 1GAZA 2LYMA 1LSCA 4NGVA 1IOCA 2CGIA 4HJZA 4LYTA 1CNSA 4WG7A 5J7CA 1B5YA 5FELA 1FLWA 4TTDA 1FLYA 1LSYA 2IHLA 3OJPA 4BAPA 2W1XA 1GBXA 2YDGA 2DQFC 4XJHA 1LSNA 4AXTA 2BAAA 3TXKA 1I56A 2BQCA 5HNLA 1IP7A 1RJCB 4R0FA 2G4QA 4PRUA 4DD2A 5DLAA 1XGRC 1C45A 1D6PA 1IVMA 1AZFA 133LA 2BQKA 1OUHA 1LJEA 1MELL 1IEEA 1GF9A 1CJ9A 1YQVY 1YKXX 2MEFA 1LHJA 5ILCA 2FYDA 4Z3MA 2XBSA 4N5RA 5DN5A 1B5WA 1CKGA 3J6KA 1IWVA 3F6ZA 1B5UA 4LT2A 4WLYA 1HHLA 3LYTA 5E9RA 2EKSC 1QIOA 1HSWA 5I4XA 2MEDA 2Q0MX 4H91A 1QSAA 2HEFA 1A2YC 1UIGA 4WM3A 3N9EA 4CFOA 1CJ7A 1WQPA 4LYZA 1GFRA 1LMTA 1LSFA 3TXJA 1IR9A 1IOTA 1F0WA 4GCDA 1GBWA 4YEMA 2ZQ4A 1LZNA 1LYZA 1OUDA 1T3PA 1JITA 5B1FA 1VFBC 1LSMA 4J7VA 3TMUA 1JJ1A 1UIEA 2BQFA 4WO9A 1LSAA 1DKKA 3M3UA 1DXJA 4LFPA 4IATA 1DZBX 1JEFA 3IWRA 4DD3A 3P66A 4NWEA 3CT1A 4H92A 4M4OA 4NGYA 2HU1A 1EQ5A 1LJFA 2DQIY 4NHPA 3WUNA 1B9OA 2BQMA 2HTXA 1LZ1A 3AGHA 1B7NA 4NEBA 2B5ZA 4WO6A 4DD1A 1GXV2 3M18B 7LYZA 4TSCA 4MR1A 4GN4A 4X3BA 4DD7A 1WTMA 2CJLA 4B4JA 4KL7A 4E3UA 3HBEX 3RZ4A 2BQGA 4WM6A 5KXTA 3WXTA 1YL0X 3WU8A 2DQJY 2YBJA 3WULA 5ILFA 1LZSA 3RT5X 1UIBA 3B0OA 4B0DA 1LSPA 3CSRA 3A91A 1GFTA 3A92A 4NHTA 1LMQA 1GFEA 3LYZA 3A34A 1JJ3A 4LFXA 1OUIA 4XJGA 2LHMA 1NKHA 1RI8B 1ALCA 1B0DA 4Z46A 1RCMA 1WQOA 3A3QA 5A3ZA 3AYQA 2W1YA 1LZGA 2MEHA 1LKSA 1NF5A 4ET8A 2PC2A 4G4CA 5F9UA 4EOFA 5LA5A 1GE4A 1QQYA 2BQOA 4OWAA 1LJGA 5JENB 1KIPC 1YROA 1RFPA 1VEDA 1G7HC 2BLYA 3A95A 4H1PA 2LYZA 5HNCA 5LVHA 1GEVA 1IWUA 2IFFY 1LMOA 1IC7Y 4NGIA 1O23A 1JWRA 3IJUA 2D6BA 1A4VA 4WOAA 4B4IA 1GFGA 4G4BA 1OUAA 1YAPA 1OUGA 4OWEA 207LA 3N9CA 6LYTA 1JPOA 2I26L 4Z98A 1C46A 154LA 1JKBA 1OUBA 1HFZA 1TBYA 1LSBA 3CB7A 3P65A 4N0JA 4LYOA 4XJFA 4YEOA 5I4WA 3A96A 2YBLA 1JTTL 1LZ6A 2BQAA 1UBZA 2CWIA 5LVJA 5L3IA 1GB8A 5B07A 1GD6A 1GPQC 5DN4A 9LYZA 4HPEA 4XYYA 2EIZC 4W94A 4NGJA 3A93A 3WW6A 3B0KA 5LINA 1GFAA 1UIFA 2FYCA 4GCBA 5HLLA 5KXOA 1LYYA 5I5QA 5LVGA 1IP6A 1Z55A 4OWHA 1QUTA 1WQRA 2XJWA 1B7MA 3W6AA 1F6RA 4NSGA 132LA 1IORA 1GB7A 2EPEA 1IC5Y 4U3XB 5FEKA 4ETEA 5I4YA 3J4GA 1IR7A 5IELA 5LVIA 3EXDA 4HV1A 4GN5C 1E8LA 1LZEA 1GE3A 5FDJA 3ZVQA 3B0IA 3ZEKA 4NHQA 4PJ2C 1H87A 4M6DA 1GBSA 3AJNA 208LA 4LZTA 4J0LA 1YAOA 2MEIA 1FN5A 4HTQA 4II8A 1SQ2L 4NGKA 1V7TA 4XJIA 2ZIJA 1VDSA 2BQBA 2Z18A 3EBAB 4O34A 3WPLA 1LZTA 1REZA 2F4AA 4QDNA 1LZYA 1AM7A 1HMKA 4LT0A 4HJVA 5KXNA 2I25L 1INUA 1DI5A 1LJ3A 4YM8A 3QE8A 3MGWA 4NG8A 5F14A 2YVBA 4DC4A 5KKJA 1IIZA 2MEGA 4H8XA 1B5ZA 5KXSA 4H8ZA 1W6ZA 1DI4A 1B7RA 3FE0A 5LAGA 3WMKA 2DQHY 4BADA 4LYCA 2BQIA 4R6CA 1GBYA 1JKAA 1SLYA 4OOOA 1WVVA 3EO5A 5KXKA 1LKRA 1LTMA 3VWOA 1PZYA 4LT1A 2HEAA 1GBOA 1JKCA 3CT0A 1JJ0A 1LJHA 1FBIX 1LMPA 2FBBA 4BAFA 1GE2A 1DQJC 1WTNA 4XJBA 5DM9A 3E3DA 1WQNA 2Z37A 1IOSA 1B7LA 4GCEA 1FKQA 4N8ZA 4XJDA 5KY1A 1B7PA 5HQ1A 1UIHA 4G49A 4DDAA 4CHXA 1GF3A 3W6CA 1D0MA 1N4FA 1C10A 4YOPA 4B1AA 1TDYA 1KIRC 1LMCA 1LCNA 5KXRA 1GFJA 1JSFA 5KXZA 1UIAA 1OUEA 4NGLA 4UWUA 3T36A 1IWWA 1NQIA 5C6IA 2YBHA 1EQEA 1YILA 2ZYCA 1F10A 5LIOA 4NWHA 3ATNA 1QUSA 1B7QA 1G7MC 1XEIA 3CQLA 3LYMA 4DYGA 1FKVA 3P4ZA 1IY4A 1REXA 1B2KA 2HU3A 4GCFA 4H93A 193LA 1QDRA 1GEZA 1QTEA 2WARA 3TXIA 5B59A 1DPXA 1LAAA 1NMMA 1OUJA 3ATOA 2BQEA 4OOTA 2YBIA 4QY9A 1LHMA 1GF4A 1LSDA 3T6UA 5KXYA 2HEEA 2H5ZA 1D9UA 1XSFA 4N1EI 1CJ8A 1ZVHL 3RW8A 1GFVA 4DDCA 3CT5A 5LAFA 1PS5A 2Z2EA 1AT6A 2ZYPA 4LYBA 2NWDX 3WL2A 5LXWA 3TXDA 194LA 1LYOA 4LYMA 5HMJA 4IASA 1BWHA 5F81A 4NGWA 1BB7A 1LHIA 3AZ5A 3B6LA 1CKHA 1LZ8A 1IWXA 3LYOA 2A7FA 1LZ9A 4RW1A 1GF0A 1UICA 4WM2A 4WM1A 1JTPL 4KPMA 4DD9A 1GBZA 4NHSA 5KXMA 1WQMA 1HMLA 1JKDA 135LA 2YSSC 4WMGA 1LHKA 5I54A 1BWJA 4NGOA 4WLXA 3TXGA 4WL7A 4B49A 2F4GA 3CSZA 3EMSA 3W6DA 2MECA 1TEWA 4G9SA 1QTKA 1GDWA 2C8PA 4NSIA 5FSTA 1REYA 2MEBA 1LZAA 1GAYA 4LT3A 3ZVQB 1KXWA 1LHLA 4HPIA 1GB2A 1BQLY 1IY3A 4N9RA 1C08C 3HFMY 1IC4Y 4DT3A 1LJKA 153LA 1IWYA 134LA 2D4JA 3AGIA 1V7SA 1LJ4A 3W3EA 1W08A 3QY4A 5IHGA 1HF4A 1IP4A 3TXBA 4OWCA 5KXLA 3AGGG 4NHIA 2BLXA 4TUNA 3WU7A 2F30A 1VDPA 2D4IA 1LZDA
chains in the Genus database with same CATH superfamily
1PQJA 2ZIKA 1JSEA 1BGIA 3F8VA 2ZNXY 4NSHA 2CFOA 4LGYA 3D9AC 3FTFA 1XEKA 1L38A 1Z5CA 2Q9DA 5C6LA 5II3A 177LA 1L90A 1P36A 4PGJB 2XEPA 4NOOB 1NDGC 2OEAX 4DD0A 1AUAA 5I53A 2Y0TA 1YKZX 2ZNWY 5EXXA 1VDQA 2OO9A 1VQ1A 2XF3A 4ZFPA 1B7SA 4D80A 2OU8A 1L19A 1LZBA 1P2RA 247LA 5B05A 5APDA 1LPIA 3GXKA 3LZ2A 1T6VL 4I7JA 4UWNA 1UM8A 2KNAA 2W1MA 4XBOA 4ZIXA 3C8RA 3KDSE 1J1PY 4KODA 4II7A 1B5XA 1UACY 3EIEA 4FD2A 3DZDA 3GUPA 4ETBA 1GE1A 228LA 198LA 4H9BA 3OTOM 3HH6A 3B72A 1C6TA 3HTFA 3HDEA 3GRYA 4OU7A 2OE4X 4LG2A 3LHMA 1C62A 1C6HA 4ARMA 3U6LA 2ZTDA 4LJ7A 3GLHA 120LA 2LZTA 1SX2A 1CX7A 3KVWA 2QSFX 1CKFA 1CU5A 2B6ZA 2ZQ3A 1OQMA 2HWJA 1IP3A 4YF2A 5LZMA 1LSZA 3B74A 2L7HA 4LF7M 1OUFA 2YBMA 1GB6A 4EIWA 3HTGA 3W6FA 4EKRA 1ZV5L 5KXXA 3SATA 3DOAA 4QOZC 1GE0A 4I8OA 107LA 3NY9A 3P64A 1LMNA 2JXNA 5AMYA 5KJ9A 222LA 3MMPA 4FVMA 2DQAA 1Q39A 2Z38A 2O01F 2Z3XA 150LA 1QS9A 1L57A 2MH8A 4J1AA 148LE 3AZ4A 2B75A 3ODUA 4MSTA 1KIQC 2LCBA 3SBBC 3AW6A 1L79A 4E97A 1RE2A 2C98A 2Z12A 4LRTA 3P68A 1C7PA 3GLGB 1G7IC 2MEEA 3GLFB 1DYBA 4QEQA 1HEPA 1T8AA 1OIPA 5APEA 4H90A 3VKHA 3C3EA 2WSFF 1L36A 4NRVA 2LYOA 4LJ6A 4HSFA 4JXJA 1C1KA 2XBRA 3N9AA 1XEJA 3JR6A 3BKVA 1H6MA 4ETAA 2OOAA 3A67Y 3FTCA 3SB7A 1OKSA 3W67A 3A6CY 4C3WA 130LA 252LA 2HECA 1HEMA 2B73A 1KXXA 103LA 1L23A 1LZ5A 2R46A 2RGHA 2BPUA 1YE9A 4ANRA 4WG1A 145LA 2WZJA 4H8YA 2FOIC 3FUUA 3LCVB 1OAOC 1L99A 1C6MA 1T6OA 4F1IA 4KT0F 1GFUA 8CATA 2I7PA 1LJNA 1OUCA 243LA 4ARLA 2XLJA 2HUBA 3L2XA 1OWZA 1IR8A 1L35A 119LA 5KXPA 141LA 2DI0A 4HLQA 2L4EA 4M9ZA 4WP2A 5D5FA 1YAMA 1T43A 1BB6A 178LA 4W58A 4I8SA 2M60A 5ITXE 3WPJA 1FDLY 5DYGA 3VKGA 4EMNA 1UCOA 2XQOA 1DYAA 3WH1A 1UA6Y 2F5OA 1NWGA 1LGXA 1OFHA 4MGIE 3W6EA 4ZPXA 200LA 2DQGY 4MH0E 2LZMA 1QTHA 143LA 4DV6M 4ARJA 1D0KA 1D3NA 3GLHE 4ETDA 5C18A 4AW4A 1XXHA 3HWSA 4OWBA 4DWXA 2OU0X 1L11A 152LA 1C64A 3WUAA 3Q8GA 4CFPA 1RU3A 1J1XY 1ZMYL 3IJVA 191LA 5FTLA 227LA 4WG7A 1BVSA 1L60A 3OE6A 4DAJA 3OJPA 4BAPA 5F3WA 1LSNA 3FYCA 1MU5A 5HNLA 142LA 1GLNA 4GRVA 4PRUA 4L16A 2K0BX 1MELL 1L85A 1OVHA 1HT1E 5ILCA 5L8RF 1QT8A 3J81S 4DUYM 4NXNM 4LZJA 1G06A 3TQSA 1L82A 4LF9M 2X8AA 1QIOA 2MEDA 4H91A 1XJUA 1UIGA 4WM3A 1CJ7A 2HUMA 4LYZA 1LSFA 1IR9A 4YEMA 1GBWA 189LA 2HCBA 1JITA 1VFBC 4DV0M 1UIEA 2BQFA 3M3UA 3KSXA 1IBMM 4DD3A 5FLXS 2NQ8C 2R45A 4NWEA 1YSYA 3KSJA 4NHPA 4W52A 131LA 2C9CA 1R2ZA 3RFWA 4DD1A 4EJ4A 7LYZA 4B7GA 4TSCA 4LF4M 5EP4A 3OE0A 4B4JA 3GRVA 3DN1A 1CU3A 1NY6A 3WXTA 2Y21A 3WU8A 3QWLA 224LA 2X4AA 5ILFA 1LI3A 3HUKA 4B0DA 4WURA 167LA 1LSPA 1XEPA 3CSRA 3L29A 3A91A 4JI2M 126LA 1LMQA 4GIPA 2QARC 3GRRA 1IXSB 4XJGA 1OUIA 1NKHA 1L25A 1ALCA 1B0DA 1RI8B 1L77A 1RCMA 3AYQA 2W1YA 4LJ4A 1C6GA 1LKSA 1D2YA 1WHCA 5F9UA 2BQOA 3HH4A 3L64A 4QNRA 1E9SA 1ZYTA 2CWBA 4NSOB 4GHLA 2LYZA 5HNCA 2IFFY 4B7FA 2F32A 4NGIA 2CP8A 1A4VA 2MR9A 1KY1A 4G4BA 2D7EA 3RGPA 1OUGA 4YHHM 3CF2A 4JI7M 1C46A 3B7ZA 3NWLA 1OUBA 3HZJA 4N0JA 4LYOA 1JTTL 5LVJA 1GD6A 5DN4A 4XYYA 4W94A 3M7GA 2FYCA 5KXOA 2F5QA 3PFIA 5I5QA 4HEOA 4I4LA 1EFUB 1Z55A 3PBLA 3W6AA 1QT6A 1IXRC 2EPEA 4ETEA 1IC5Y 2OE9X 3J4GA 5IELA 1L95A 1E8LA 2QCUA 1LZEA 2DZNB 5FDJA 1QAMA 3B0IA 4PJ2C 208LA 4JV5M 2A4TA 1L29A 3UZUA 215LA 1SQ2L 163LA 2ZIJA 3EBAB 2Z18A 1LZTA 2F4AA 1AM7A 1HMKA 1LV7A 1L50A 4LT0A 2I25L 3CDQA 3VW7A 1TF0B 1L91A 5F14A 2ZTCA 4IBJA 4KHPM 3SB8A 5KKJA 1IIZA 1JQUA 1W6ZA 4W59A 3WMKA 1R7RA 2DQHY 2BQIA 4B3RM 3FUXA 1L40A 5KXKA 2DWZB 192LA 3CT0A 1JJ0A 2J5YA 253LA 5DM9A 3E3DA 1Z5BA 4MM3B 4DQ5A 1GVNA 1B7PA 3LVVA 3SASA 1UIHA 2KRKA 3I4YA 5HQ1A 2O79A 4CHXA 3DN4A 3W6CA 1LYHA 1L55A 3HT9A 1PJQA 1LCNA 4EKQA 1JSFA 5KXZA 1DYGA 4EKPA 2RBQA 3T36A 5C6IA 4Y28F 2YBHA 3TE6A 173LA 4DR5M 2Y20A 1FKVA 1L76A 1IY4A 4H93A 3SB6A 4RNAA 193LA 1DPXA 4OOTA 2XSZA 4ARPA 2JNHA 2YBIA 4QY9A 1LSDA 3T6UA 2XFTA 4AKIA 5KXYA 162LA 238LA 1HJPA 4DJHA 1UFZA 1CJ8A 4IBEA 1GFVA 3PDSA 5LAFA 2BJWA 1B6IA 1JTMA 3TXDA 2CHVA 4PT5A 118LA 1HR0M 1LYOA 4LYMA 1NJGA 2KNZA 1QYRA 156LA 1L81A 2A7FA 1GF0A 1WIVA 4WM2A 4WM1A 1JTPL 3HUQA 1JKDA 229LA 3DN2A 3HWLA 4B49A 4L6V6 1JR3A 2F4GA 3CSZA 1CV4A 1QTKA 2C8PA 5FSTA 1LZAA 4HL4A 3GPPA 1GAYA 1JB0F 5LMUM 2D7HA 5DYIA 4ARQB 1SG9A 1IWYA 5EXPA 4B3TM 1P56A 1SSWA 1V7SA 1CU6A 1L06A 3SB5A 1CVKA 4AQYM 168LA 3HHXA 4M0DA 5KXLA 4NHIA 1OVJA 2F30A 2VQEM 3CDOA 2A7DA 185LA 3CF6E 1L56A 4H94A 1XGUC 4OO9A 4LDEA 2HULA 3GQ5A 1DGHB 2G3QA 1GB3A 3TMWA 1L69A 1UUZC 1DV0A 1BVKC 237LA 1FLQA 4EPFA 3I01M 4REZA 2JY5A 4D9ZA 6LZMA 3GUNA 4PDGA 1LLHA 2LXEA 1HT2E 3K1JA 1L10A 1L01A 3SBAA 3JR4A 1BVXA 3ZCBB 1XGPC 1IBKM 7CATA 1C61A 4AGAA 1H6UA 1C6JA 3AOEA 1BB5A 1I4WA 4GN3A 4NY5A 4I7TA 2ANXA 3SHGB 4YENA 2F2NA 3AJIB 1QTCA 4B4EA 3AZ7A 4PJZA 1L72A 3Q8XA 2RAZX 4CHTB 4DQ7A 4RLMA 5A2QS 249LA 5L3HA 4X66M 1C60A 3K8ZA 1NV8A 4HJYA 4P17A 5HMVA 3D8LA 1BB4A 1IN8A 1EE8A 1LI2A 3RUNA 3NBXX 3FRIA 2DAEA 4L41A 1G59A 4W56A 1TGUA 2XGNA 1J7KA 2X0AA 4UWVA 5FHWA 4J1BA 4RLNA 2Z6BA 1LZCA 1VG5A 3A3RX 2FBDA 4CGEA 3GULA 3GUMA 4QOSA 244LA 1GF8A 3CDRA 1TH4A 2J7NA 4HV2A 2GQFA 2XSZD 4H9HA 3A94A 1L93A 1QUHA 1L08A 1JUGA 3B7NA 2Z4SA 3V76A 1L96A 4ARQA 3HT6A 3KS8A 1TAYA 1L94A 1WJ7A 4FWGA 1KXYA 4GC5A 3C7WA 3L2AA 2LVPC 3A90A 3OE8A 2W1LA 1IN7A 1XNRM 1L22A 4BS7A 2Y8PA 3K9OA 1TCYA 1QSWA 3WPKA 3KAMA 3HBDA 1L8QA 4BLCA 182LA 2R0IA 4DR4M 114LA 1OP9B 1N75A 2MEAA 2XZFA 4XADA 199LA 2D91A 2LZ2A 3HY5A 3HT7A 1K28A 1HEQA 1DGHA 2HEDA 5LA8A 5FCPA 4YX7C 5K7OA 1P2CC 2F5SA 4LJ8A 1XFPL 2GV0A 4GEWA 4WW0A 2AHMA 5EP1A 2EQLA 4LDLA 2K47A 3FA0A 4PHIA 4KLNA 1HNZM 1DKJA 3GPXA 1UIDA 1N77A 1NV9A 3FUWA 1TLAA 3AV0A 3SBJA 2A5YB 2BQLA 4X62M 1XC8A 1L75A 2F47A 3HGIA 2OPFA 4I7OA 1QZEA 4DV2M 5IDDA 1K3WA 2BQHA 140LA 1LYSA 2RBPA 1IO5A 3HU2A 3T15A 2YBNA 5DL9A 183LA 3HKPA 3HJSA 4LCBA 1QDTA 4NSJA 166LA 1JIYA 1XGTC 1FLUA 2DENA 1GWDA 1LSEA 1HSXA 1X37A 3G3BB 3SMSA 1L65A 3GLIB 216LA 2X49A 1GF5A 3GUKA 3GO8A 1L2CA 3GQ4A 1L59A 4FDYA 1CKDA 5C6JA 1QSBA 4G4QA 4CJ2A 2JWSA 4S12A 129LA 4W96A 5EQTA 1HENA 3E9SA 2BQDA 3GXRA 2NTGA 4NGVA 1IOCA 1ZQ9A 1L41A 1CNSA 4LYTA 4TTDA 205LA 2IHLA 5EJCA 3OE9A 2L7IA 2W1XA 1G8PA 2BAAA 3L25A 1I56A 2L78A 1RJCB 4DD2A 1D6PA 1IVMA 1AZFA 1L24A 1C6KA 1OUHA 2F2QA 1C6IA 3DNAA 1N32M 2DWLA 4XGIA 1W5SA 2B3TA 1P37A 1L42A 1CV6A 4G4NA 1CKGA 3J6KA 1OFIA 1ZWNA 4WLYA 2R4EA 1N36M 1HHLA 3LYTA 2JUJA 4QHSA 1TH3A 3PNYA 1HSWA 5I4XA 1QSAA 1A2YC 1YUBA 1TTEA 1GFRA 1LMTA 104LA 1IOTA 223LA 4AKHA 1LZNA 1T3PA 3TXEA 1ORYB 1JJ1A 4GITA 1A5TA 1JTNA 1DZBX 1JEFA 3IWRA 1QANA 3P66A 4IATA 3UK6A 3CT1A 4H92A 144LA 3C3DA 3J80S 1L48A 1EQ5A 1R4GA 3WUNA 1IY0A 4IBGA 3AGHA 1B7NA 4WO6A 2B5ZA 2KNVA 1KYIA 1PRBA 1GXV2 4DD7A 1QSQA 2KXEA 2CJLA 3EMLA 4KL7A 186LA 4F2LA 4R71A 3HBEX 5FTMA 1Z5AA 3F92A 1TR8A 3D8BA 2DQJY 2RBOA 2YBJA 3L26A 3RZEA 3WULA 2DZLA 1LZSA 4PDIA 3M6AA 1GFTA 206LA 2RBRA 4QHTA 4NRWA 4ZPUA 5ITQA 1OWYA 3MK6A 5A3ZA 2K6BA 1VDDA 1LZGA 2MEHA 1L27A 2UUBM 3FI5A 2N35A 1LI6A 5LA5A 1L43A 4OWAA 5JENB 4FCWA 4MGZE 2C5RA 5LYTA 250LA 5LVHA 4IJFA 1IWUA 246LA 257LA 3GPUA 2DWNA 4D81A 2QBYA 3TWMA 2D6BA 3IJUA 4CJ6A 1GFGA 261LA 4KO8A 3A98B 1OUAA 207LA 6LYTA 2I26L 4Z98A 154LA 4CISA 3KS4A 2DHYA 1LSBA 2RKOA 1L44A 4YEOA 3DA1A 2YBLA 1QS5A 2CWIA 1NVMA 1L2DA 180LA 1G0PA 5B07A 1GPQC 2EIZC 1XB2B 4NGJA 5LINA 1UIFA 3UJNA 4I7LA 1F4IA 4Z8XA 1T8FA 5LVGA 1IP6A 4OWHA 1WQRA 1F6RA 4YXCA 132LA 1GB7A 1QUOA 4CIZA 5GKNA 1HNXM 4RKUF 1GE3A 3L27A 3EIHA 5KPZA 3ZVQA 3HJQA 3AJNA 5IT9S 1DGGA 3HH3A 3U6MA 2MEIA 2W82A 5ITXA 4II8A 1L83A 1LGWA 3WPLA 1E32A 4GKJM 2BQBA 1REZA 3SFZA 4HJVA 4FWDA 155LA 4YM8A 262LA 2L2DA 3GLIE 1QT5A 1L73A 4H8XA 2DWMA 2VF7A 1DI4A 2KZUA 3E21A 4BADA 1G07A 2F5NA 4LYCA 1JKAA 1SLYA 4OOOA 1Q3CA 1L0JA 3SAVA 3VWOA 1CX6A 1OTRA 1LJHA 1FBIX 2LHCA 4BAFA 1GE2A 1C6CA 3FD9A 1C66A 1DQJC 4G4OA 1C68A 2ERCA 4DV5M 1FNNA 3AOEC 4GCEA 2C99A 3HU3A 1L16A 213LA 1SWYA 1V33A 2R65A 4G49A 4DDAA 1GF3A 1CUQA 1N4FA 1VEKA 1C10A 4YOPA 1L26A 1QTDA 1UIAA 1OUEA 4UWUA 1C6NA 1IWWA 1EQEA 3HH5A 2ZYCA 109LA 1F10A 2CV0A 4NWHA 5LIOA 4GBRB 3ATNA 1G7MC 2P5TA 1DYDA 1KS3A 2Z4RA 3M0EA 3P4ZA 2WARA 3GP1A 1QTEA 5B59A 2LH0A 1LAAA 2DAKA 2QBYB 1C69A 3G3WA 4N1EI 3RW8A 2LVQD 1PS5A 165LA 1AT6A 2Z7JA 2UXBM 4ITQA 1L02A 1BWHA 1DYEA 5F81A 3UGJA 1R6BX 2APLA 3AZ5A 3B6LA 3LYOA 2DHRA 1IWXA 4YY3M 1LZ9A 4DD9A 3TPZA 1GBZA 4NHSA 214LA 2YSSC 4WMGA 4I81A 111LA 5I54A 4B3MM 255LA 4NGOA 113LA 1JQJC 1VEGA 2CUUA 1TEWA 4G9SA 2JA2A 1GDWA 110LA 1L17A 2MEBA 3ZVQB 1GB2A 2DKLA 2HKJA 4DV4M 1BQLY 1C08C 3HFMY 153LA 4S0WA 3W0LB 134LA 1MX0A 3AGIA 4DV1M 2QPAA 1G71A 2JZ1A 3CF0A 1W08A 1SXJB 3TXBA 1SXJE 4OW0A 4OWCA 4LRSA 3U61B 1L09A 2BLXA 3WU7A 172LA 1L74A 2QQ8A 2D4IA 3TMXA 1G7LC 1REMA 3J7BA 2G4PA 3C8SA 2DZOB 3U6DA 4KT3A 3T1YM 217LA 5D5CA 1LGUA 4WM5A 3BBZA 5ITUA 1MN3A 122LA 5FTNA 1L54A 3U6CA 2JY6B 4I7MA 2H9JA 1J09A 4JI6M 4XK8F 4L4UA 1N78A 1QT3A 1NJFA 4G4HA 1AT5A 1DYCA 1G3IA 221LA 3NBIA 4PRQA 2KEBA 4XENA 3HHWA 3WUMA 3B7QA 1GF7A 2RSCA 2EKFA 3AW7A 3OK0A 1LPYA 4A7DA 1B7OA 190LA 1IN4A 3KP1E 3W6BA 3ULRA 1NHWC 1NBZC 4UN2B 1LJIA 1YKYX 1LZ4A 1J1OY 4KXIA 1L15A 1GFKA 259LA 2L09A 1LWKA 4WM4A 4XN6A 2LBCA 4IBBA 2I6ZA 4AI6A 1V34A 3TXFA 102LA 1GB9A 3WXUA 4MCKA 3SYKA 1GJTA 1VDTA 2Z8YM 2QNJA 1C7YA 1L32A 1JHLA 3A8ZA 258LA 4X65M 1ZMUA 2FFJA 4NC6A 1L04A 3C82A 3RU5A 4H9EA 1Y8GA 4PPOA 1YL1X 2BWBA 3D4SA 4FCTA 5E4PA 5T3FA 2Z2FA 1PQMA 2H9KA 1GB5A 1E9RA 1SX7A 3AZ6A 4Z41A 1JISA 4EKSA 157LA 2R6FA 1CKCA 4LGKA 3AL0C 4H9AA 1G7JC 1KY0A 3CSQA 4DKLA 5EXTA 5ITTA 5KKIA 4QGZA 5E6JA 4DDBA 3GLFE 4WL6A 4TUWA 1I20A 3GLGE 1MLCE 4TX7A 1IP5A 3DMVA 5EBHA 3QNGA 3R9XB 1HERA 4LGMA 5M1YA 4ML7A 2JZ0A 1GFHA 2G4NA 2LVOC 4TSBA 1QT4A 1YIKA 5KO3A 4NG1A 1YLAA 1QUDA 4YXAC 3A45A 3LW5F 3QAKA 3WVYA 1EL1A 1LJJA 2ZANA 1WTHA 4EPIA 139LA 3A46A 3HU1A 1DPWA 1AKIA 1BB3A 1CU0A 3AFHA 2DXIA 1PJJA 1L70A 1LHHA 2BQJA 4WLTA 1F6SA 2VF8A 115LA 1G1VA 1JR3D 2OTYX 1IP2A 1WXQA 260LA 1NY5A 2R44A 5LVKA 125LA 1HC0A 4LY6A 2C8OA 4IBIA 1WGLA 2XH9A 1N34M 4D82A 4RF1A 4NGZA 3J27B 1IWTA 1R5LA 2BJVA 5APFA 1BHZA 1GXXA 1NHEA 2KW0A 1QTVA 4HP0A 1XNQM 3FTEA 4DV3M 3FRHA 4ETCA 1EQ4A 3C80A 3A6BY 1SXJA 1QZMA 1JTOL 1B5VA 3U6EA 1VATA 2CDSA 4GLVA 1HELA 5FTKA 2B6XA 1NHGC 3VK8A 4H9CA 2G8LA 3WW5A 2XFSA 5F16A 3HBHA 4G3OA 6LYZA 1GAZA 3NY8A 1LSCA 5J7CA 1L58A 1B5YA 5DFLA 1FLWA 2UXDM 4Z6YA 1LSYA 2XZUA 1L89A 1IY2A 3TWKA 5KPRA 1PQIA 2DQFC 4AXTA 2ZAMA 1L14A 1OAIA 1K3XA 1P3NA 5EP3A 1XGRC 1P7SA 133LA 3CGWA 2KDLA 1LJEA 1IEEA 1GF9A 5JI3E 1CJ9A 1YQVY 1YKXX 1LHJA 5EP2A 1T3TA 5EXSA 2NTHA 2B6YA 158LA 3RE8A 3CTWB 159LA 1Z59A 1L0KA 2V1CA 181LA 4IJEA 4LT2A 236LA 4LF6M 2LNHC 2QENA 2EKSC 2HEFA 1LYGA 1L47A 209LA 3HX3A 1L39A 3N9EA 4CFOA 1WQPA 4AQNA 2LTUA 4GCDA 3B89A 210LA 4JI1M 5E26A 2ZQ4A 1OUDA 1LSMA 226LA 1L20A 4LF5M 4WO9A 1LSAA 4IBDA 3KOZE 4LZZA 4JI3M 1W5TA 4NGYA 2DQIY 2HTXA 5FTJA 184LA 4NXMM 4NEBA 4MR1A 4GN4A 4M9SA 3KP0E 5KPTA 1CUKA 2Y0QA 3UONA 2BQGA 2YQZA 5KXTA 4FWHA 1YL0X 2HUKA 1G0JA 2DAGA 4I7SA 2EO2A 1UIBA 1HNWM 1GABA 1DYFA 4MGYE 4NHTA 1CV3A 1GFEA 220LA 4B3SM 3RGSA 1LYEA 2YNMD 2LHMA 4Z46A 4M0WA 1WQOA 3A3QA 4I7QA 2LWXA 1NF5A 2PC2A 4G4CA 2QZ4A 2C9OA 1CUPA 2E5LM 1L84A 1QQYA 2LHGA 4AG6A 1LJGA 2M5ZA 2QHOB 1YROA 2BLYA 1VEDA 3A95A 4H1PA 4GRIA 188LA 1LMOA 1IC7Y 1DGBA 1O23A 201LA 4B4IA 2L4FA 4LJ5A 1AIPC 1YAPA 4OWEA 1JKBA 1OV5A 1HFZA 3THGA 1EIJA 1TBYA 3CB7A 2CRUA 3KFUG 4R3DA 3A96A 5I4WA 147LA 1XJTA 1EPYA 1UBZA 2BQAA 3C9PA 1GB8A 3K2LA 5BR8M 1R2YA 4HPEA 3JAMS 2V1UA 1KW5A 4W57A 1C6QA 4ARMB 3A93A 3PXGA 1GFAA 4GCBA 3T38A 3U5ZA 2RB2X 1XWIA 4P16A 1QUTA 1B7MA 4NSGA 3LVWA 1IORA 5FEKA 4U3XB 3DMXA 1D3MA 4GN5C 4HV1A 3ZEKA 4NHQA 3SC3A 2B72A 4M6DA 1GBSA 1P5CA 3PNVA 4K5YA 4I5SA 1L86A 1FN5A 1DO0A 4NGKA 1NNUC 1L18A 1V92A 4B08A 1L87A 1G0KA 5KXNA 2EUCA 3C7YA 1L88A 3J2PB 3VDUA 4DC4A 3GUOA 2MEGA 1QTZA 3U61A 232LA 1B5ZA 4AG5A 5KXSA 4H8ZA 1B7RA 3FE0A 5LAGA 3GLFA 2O4WA 3EO5A 2WSCF 1LTMA 1PZYA 245LA 4LT1A 1NHBA 1C6FA 1GBOA 1JKCA 3HTBA 164LA 4AZFA 1WTNA 2B74A 4NL4H 1WQNA 2Z37A 1IOSA 5IWAM 4XJDA 242LA 2KA6B 146LA 2RGOA 1D0MA 3U5ZB 1D9WA 1L33A 2OU9A 4LFAM 1TDYA 1LMCA 1GFJA 2D7GA 5IZ7D 1T6HA 4NGLA 4DQJA 3DMZA 1C6PA 3WHKA 1QUSA 3CQLA 1XEIA 169LA 4DYGA 1REXA 2ZBKB 2CHGA 3DN6A 1GEZA 3TXIA 1PQKA 3ATOA 1OUJA 1GF4A 4DDCA 1ZVHL 3CT5A 2JP7A 3WL2A 3U6QA 4PCZA 194LA 5HMJA 1ZURA 4IASA 1BB7A 1LHIA 1LW9A 2K9DA 4QNMA 1LZ8A 4RW1A 1UICA 4KPMA 1DGFA 3GPYA 2F5PA 2VIIA 3DN3A 3R8FA 1HMLA 1XXHE 1L21A 1LHKA 1D2WA 2FH0A 2KZSA 4WL7A 2O5RA 3GUJA 3EMSA 1L00A 3W6DA 1DO2A 4NSIA 2G5GX 256LA 4LFCM 2IGCA 4LDOA 3H4JA 4GC9A 1KXWA 1LHLA 4MGHA 3HU8A 1C6DA 4N9RA 1IC4Y 4DT3A 1LJKA 2H5XA 4LJAA 2D4JA 1QVRA 3I04M 2FNAA 3FTDA 160LA 3G3XA 3IG5A 3QY4A 5IHGA 1L97A 3V2WA 1HF4A 2H1RA 3AGGG 2RBNA 4DR2M 4TUNA 1J5EM 1CTWA 1LYIA 4PK0A 1C6BA 1VDPA 1LZDA 1ZVYB 1C6LA 2XTHA 2DKVA 4FJRA 3ZH9B 4I0CA 3AKZA 241LA 3GQ3A 5KQDA 212LA 2D4KA 1D6QA 3FUTA 3G3AB 3HDFA 2AUBA 3HHYA 127LA 4P2EA 2CV1A 2ZILA 1SSYA 4NIJA 3TMVA 5DNYA 1ZMVA 3G3VA 2Z39A 1LYDA 3D3DA 2DQCY 1D3FA 5H37D 1CV1A 1IQPA 3KXEC 2DBTA 5A3EA 1D2NA 1Z6TA 1L31A 3K2RA 1YANA 1LOZA 1L34A 1L37A 1IX0A 3F9LA 2CUZA 2VQFM 2EA0A 1OVKA 3VDPA 3LZTA 1CU2A 1DI3A 3WU9A 4ZEEA 4G4RA 196LA 1L1ZA 3U6OA 1YAQA 149LA 8LYZA 197LA 4H9IA 3LN2A 1IN5A 1L12A 2HAKA 1I1ZA 4GMQA 1LSGA 1CV5A 1BWIA 2JY8A 1T97A 3W68A 1IXSA 4DUZM 225LA 1P2LA 4RW2A 3E4RA 4JI5M 1IP1A 3L28A 5IREB 1P46A 3J7AS 3C81A 1E94E 3BKHA 4X64M 2LVNC 4TWSA 1WQQA 2N5ZA 4H9FA 2WSEF 3AOGA 2F4VM 1QT7A 3PVSA 4HTNA 3SP3A 3AB6A 1P3QQ 3QYBA 2FS1A 3E46A 2DQDY 2HEBA 1HNLA 3WYHA 5LMNM 4M9XA 3HTDA 1XGQC 1CJ6A 5B06A 3RNXA 3MJ5A 2CV2A 4OW1A 3K3TA 1MJGM 2VB1A 1LYFA 1OQYA 3GRUA 3C58A 3SYLA 4IBFA 1GKIA 2OE7X 3IECA 170LA 2ZWBA 2OQ4A 4N1CC 2BQNA 3ZQJA 1XHBA 4RDSA 1IXZA 2DQEY 1NDMC 1NBYC 5KXWA 3SAUA 1HFYA 3TXHA 2Z19A 2CE7A 4HTKA 4IBKA 1HEOA 4PD2A 1VDLA 4BBAA 1UC0A 4DR3M 3FE3A 4C5FA 5JI2E 1G41A 251LA 4GCCA 2UU9M 3IHPA 1D0LA 1I6SA 4RF0A 4OVZA 1WVUA 5B1GA 1VAUA 4IJ4A 1GF6A 2CEAA 3UMMA 1IWZA 1I94M 3TL4X 3KOYE 1L61A 1OV7A 4ET9A 3WVXA 1IOQA 4GLAA 4WLDA 3BXWA 1N33M 3C83A 187LA 1GDXA 1LZRA 1C43A 3LQRA 1C67A 235LA 3DFZA 3U6PA 4MGKE 3U60B 3FI7A 5F9XA 4LJ9A 1GB0A 4L8RC 3B9PA 1C63A 2UUCM 3SN6R 1HEWA 1L67A 1KFVA 4JI0M 1L46A 1GHLA 2Q2EB 1L64A 2OOBA 219LA 5LYMA 2FE8A 5LVIA 3LQQA 4NFVA 1HFXA 1ZAEA 137LA 4L15A 2KRUA 3SHFA 4GH9A 1C6AA 234LA 4JN6A 5LYZA 4I7KA 5APCA 4I7PA 1LMAA 1WGNA 5L9JA 1L98A 1L53A 1PGYA 3FKEA 2LYMA 1L52A 4HJZA 2CGIA 1K82A 5FELA 3QYEA 1FLYA 3VK7A 4L78A 3H4MA 2J7OA 2BNKA 218LA 2Q9EA 1GBXA 2YDGA 4XJHA 3TXKA 2YR0A 3HU9A 2EKKA 138LA 1IP7A 1G0MA 2BQCA 4R0FA 2G4QA 5DLAA 1PQDA 4W55A 2KHHA 1C45A 5BPVA 2BQKA 3GUIA 1Q02A 2MEFA 3DN0A 2FYDA 4Z3MA 2XBSA 195LA 174LA 4DR1M 4N5RA 5DN5A 1B5WA 3ZC7B 233LA 3HJ8A 2RRUA 1Q3BA 1IWVA 254LA 1B5UA 3F6ZA 1XMOM 1QUGA 2RB1X 4GKKM 5E9RA 2YFQA 2Q0MX 161LA 2B7XA 4LZMA 3TXJA 1C65A 1F0WA 1L80A 1LYZA 3T6PA 5B1FA 3TMUA 4J7VA 4FCVA 3U6SA 4JI4M 176LA 1DKKA 4LFPA 1DXJA 3I51A 2JY7A 1S3SA 211LA 3A42A 3CDVA 1L49A 2HU1A 4OVZB 1LJFA 4BB9A 1B9OA 3BOSA 1LZ1A 1IBLM 2BQMA 3M18B 4X3BA 1WTMA 4AKGA 4E3UA 5FSWA 1JR3E 3KOXE 4WM6A 3WHLA 2RBSA 4GHAA 1NSFA 4K0KM 1L63A 1GO5A 3RT5X 3B0OA 3I4VA 2MGWA 3C7ZA 4I7NA 4DV7M 3A92A 3LYZA 3A34A 1JJ3A 1XMQM 1L28A 4LFXA 231LA 3C8QA 4W51A 2B6WA 2UUAM 1IM2A 3HT8A 3SMPA 1L45A 5C1BA 4ET8A 2QP9X 2B70A 4EOFA 1GE4A 1D3JA 1GL7A 1KIPC 3GLGA 1RFPA 1G7HC 2LC9A 2V6ZM 2OTZX 2DVWB 3KW6A 1GEVA 4Q7JA 1G0GA 2VDBB 1JWRA 1L66A 4WOAA 2ZAOA 3N9CA 1TDHA 1LYJA 1L92A 1JPOA 3DKEX 3DN8A 1NNJA 3P65A 1LWGA 5LXWA 4XJFA 4OX9M 4M4OA 1LZ6A 5L3IA 9LYZA 230LA 5ITRA 3WW6A 3B0KA 1L68A 1LYYA 2EJSA 2B6TA 1L62A 2XJWA 3FADA 4MB7A 1ZMWA 4W54A 1VEJA 1G4AE 1PM5A 5I4YA 4W5WA 1IR7A 3EXDA 2R62A 1OJLA 1H87A 4LZTA 1L30A 4J0LA 2MJ5B 1SWZA 1YAOA 3U60A 4HTQA 4IBCA 1IY1A 3SAWA 1V7TA 4XJIA 1VDSA 4O34A 1WR1B 4QDNA 1LZYA 2RB0X 2RH1A 1G0QA 1INUA 240LA 1DI5A 1IFYA 1LJ3A 3FYDA 3QE8A 3HHZA 3MGWA 4NG8A 2YVBA 1SXJD 4FW9A 1PJIA 1L07A 248LA 2HL7A 1TDZA 3K9PA 1L05A 112LA 3ILKA 2BWEA 1XXHB 2R18A 2I7NA 1HQYE 1GJSA 4R6CA 1GBYA 2QB0B 3W0FA 4IIWA 1KNIA 1ZV1A 1L1TA 3MHVC 1KW7A 1WVVA 1LKRA 5ITYA 1PQOA 1QAOA 2HEAA 151LA 1P64A 1LMPA 2FBBA 1L03A 108LA 4XJBA 2DAIA 2RAYX 5KQ8A 1OYUA 4NSRA 1FJGM 1B7LA 1FKQA 1P6YA 4N8ZA 5KY1A 3CDTA 175LA 2LVAA 1L2BA 4B1AA 1PJTA 1KIRC 3GLIA 5KXRA 1QTBA 4LF8M 3KOWE 1NQIA 4DR7M 2DNAA 1YILA 2R4JA 4G6ZA 1B7QA 4B7HA 3LYMA 1HQCA 5I14A 1B2KA 2HU3A 4GCFA 1QDRA 3RZ4A 1NMMA 5HLLA 4A3VB 2BQEA 1LHMA 4LFBM 1C6EA 1L51A 2HEEA 2H5ZA 128LA 4R7GA 1D9UA 2ZM6M 2UXCM 1XSFA 4IAPA 2Z2EA 2ZYPA 4JI8M 2NWDX 4LYBA 2DAMA 3SARA 3FUVA 1GL6A 4NGWA 1PJSA 239LA 1CKHA 3LCUA 3LMMA 3SB9A 3V2YA 3JR5A 2MROB 7LZMA 5KXMA 1WQMA 1L13A 135LA 2ANVA 3NYAA 2O25A 1BWJA 1TH2A 3QAUA 1OIZA 4WLXA 3TXGA 4JYAM 4I7RA 2MECA 2C96A 1NO1A 4DBGB 1REYA 1QQWA 3VLFB 4LT3A 1SXJC 4HPIA 2CHQA 3VFDA 1IY3A 2O7AA 4EXMA 1L71A 1IN6A 3TWLA 2HHHM 3IG8A 3HUAA 2GNOA 1LJ4A 4DR6M 2L6OA 3W3EA 1G0LA 1CV0A 1KSFX 1T8GA 3LZMA 1IP4A 4W53A 3T1HM 1G1WA 4CGYB 123LA 3GLHB 171LA 1QAQA 3K92A
chains in the Genus database with same CATH topology
1PQJA 2ZIKA 1JSEA 1BGIA 3F8VA 2ZNXY 4NSHA 3D9AC 1XEKA 1L38A 2Q9DA 5C6LA 5II3A 177LA 1L90A 1P36A 4PGJB 1NDGC 2OEAX 4DD0A 5I53A 1YKZX 2ZNWY 1VDQA 4ZFPA 1B7SA 2OU8A 1L19A 1LZBA 1P2RA 247LA 5B05A 5APDA 1LPIA 3GXKA 3LZ2A 1T6VL 4I7JA 4UWNA 2W1MA 4ZIXA 3C8RA 1J1PY 1B5XA 1UACY 3GUPA 4ETBA 1GE1A 228LA 198LA 4H9BA 3HH6A 3B72A 1C6TA 3HTFA 3HDEA 2OE4X 3LHMA 1C62A 1C6HA 4ARMA 120LA 2LZTA 1SX2A 1CX7A 2B6ZA 1CKFA 1CU5A 2ZQ3A 1OQMA 1IP3A 4YF2A 5LZMA 1LSZA 1OUFA 2YBMA 1GB6A 3HTGA 3W6FA 4EKRA 1ZV5L 5KXXA 1GE0A 107LA 3NY9A 3P64A 1LMNA 5AMYA 5KJ9A 222LA 2DQAA 2Z38A 150LA 1QS9A 1L57A 4J1AA 148LE 3AZ4A 2B75A 4MSTA 3ODUA 1KIQC 2LCBA 3SBBC 3AW6A 1L79A 4E97A 1RE2A 2Z12A 3P68A 1C7PA 1G7IC 2MEEA 1DYBA 4QEQA 1HEPA 1T8AA 5APEA 4H90A 1L36A 2LYOA 4HSFA 2XBRA 3N9AA 1XEJA 3JR6A 3BKVA 1H6MA 4ETAA 3A67Y 3SB7A 3A6CY 4C3WA 130LA 252LA 2HECA 1HEMA 2B73A 1KXXA 103LA 1L23A 1LZ5A 2BPUA 4ANRA 4WG1A 145LA 4H8YA 1L99A 1C6MA 1GFUA 1LJNA 1OUCA 243LA 4ARLA 2HUBA 3L2XA 1OWZA 1IR8A 1L35A 119LA 5KXPA 141LA 5D5FA 1YAMA 1BB6A 178LA 4W58A 4I8SA 3WPJA 1FDLY 4EMNA 1UCOA 2XQOA 1DYAA 3WH1A 1UA6Y 1NWGA 1LGXA 3W6EA 200LA 2DQGY 2LZMA 1QTHA 143LA 4ARJA 1D0KA 1D3NA 4ETDA 4OWBA 4DWXA 2OU0X 1L11A 152LA 1C64A 3WUAA 4CFPA 1J1XY 3IJVA 1ZMYL 191LA 227LA 4WG7A 1L60A 3OE6A 4DAJA 3OJPA 4BAPA 1LSNA 5HNLA 142LA 4GRVA 4PRUA 1MELL 1L85A 1OVHA 5ILCA 1QT8A 1G06A 1L82A 1QIOA 2MEDA 4H91A 1XJUA 1UIGA 4WM3A 1CJ7A 2HUMA 4LYZA 1LSFA 1IR9A 4YEMA 1GBWA 189LA 1JITA 1VFBC 1UIEA 2BQFA 3M3UA 4DD3A 4NWEA 4NHPA 4W52A 131LA 4EJ4A 7LYZA 4DD1A 4TSCA 3OE0A 4B4JA 3DN1A 1CU3A 3WXTA 3WU8A 224LA 5ILFA 1LI3A 3HUKA 4B0DA 167LA 1LSPA 1XEPA 3CSRA 3A91A 126LA 1LMQA 2QARC 4XJGA 1OUIA 1NKHA 1L25A 1ALCA 1B0DA 1RI8B 1L77A 1RCMA 3AYQA 2W1YA 1C6GA 1LKSA 1D2YA 5F9UA 2BQOA 3HH4A 3L64A 1ZYTA 2LYZA 5HNCA 2IFFY 2F32A 4NGIA 1A4VA 1KY1A 4G4BA 1OUGA 1C46A 4N0JA 1OUBA 4LYOA 1JTTL 5LVJA 1GD6A 5DN4A 4XYYA 4W94A 2FYCA 5KXOA 5I5QA 1Z55A 3PBLA 3W6AA 1QT6A 2EPEA 4ETEA 1IC5Y 2OE9X 3J4GA 5IELA 1L95A 1E8LA 1LZEA 5FDJA 3B0IA 4PJ2C 208LA 2A4TA 1L29A 215LA 1SQ2L 163LA 2ZIJA 3EBAB 2Z18A 1LZTA 2F4AA 1AM7A 1HMKA 4LT0A 1L50A 2I25L 3CDQA 3VW7A 1L91A 5F14A 3SB8A 5KKJA 1IIZA 1JQUA 1W6ZA 4W59A 3WMKA 2DQHY 2BQIA 1L40A 5KXKA 192LA 3CT0A 1JJ0A 253LA 5DM9A 3E3DA 4DQ5A 1B7PA 5HQ1A 1UIHA 2O79A 4CHXA 3DN4A 3W6CA 1LYHA 1L55A 3HT9A 1LCNA 4EKQA 1JSFA 5KXZA 1DYGA 4EKPA 2RBQA 3T36A 5C6IA 2YBHA 173LA 1FKVA 1L76A 1IY4A 4H93A 3SB6A 193LA 1DPXA 4OOTA 4ARPA 4QY9A 2YBIA 1LSDA 3T6UA 5KXYA 162LA 238LA 4DJHA 1CJ8A 3PDSA 1GFVA 5LAFA 1B6IA 1JTMA 3TXDA 118LA 1LYOA 4LYMA 156LA 1L81A 2A7FA 1GF0A 4WM1A 4WM2A 1JTPL 3HUQA 1JKDA 229LA 3DN2A 3HWLA 4B49A 2F4GA 3CSZA 1CV4A 1QTKA 2C8PA 5FSTA 1LZAA 1GAYA 4ARQB 1IWYA 1P56A 1SSWA 1V7SA 1CU6A 1L06A 3SB5A 1CVKA 168LA 5KXLA 4NHIA 1OVJA 2F30A 3CDOA 2A7DA 185LA 1L56A 4H94A 1XGUC 4OO9A 4LDEA 2HULA 3TMWA 1GB3A 1L69A 1UUZC 1BVKC 237LA 1FLQA 4EPFA 4D9ZA 6LZMA 3GUNA 1LLHA 1L10A 1L01A 3SBAA 1BVXA 1XGPC 1C61A 4AGAA 1C6JA 1BB5A 4GN3A 4NY5A 4I7TA 2ANXA 4YENA 2F2NA 1QTCA 4B4EA 3AZ7A 4PJZA 1L72A 2RAZX 4DQ7A 4RLMA 249LA 5L3HA 1C60A 4HJYA 5HMVA 1BB4A 1LI2A 3RUNA 4L41A 4W56A 2X0AA 4UWVA 5FHWA 4J1BA 4RLNA 2Z6BA 1LZCA 3A3RX 2FBDA 4CGEA 3GULA 3GUMA 244LA 1GF8A 3CDRA 4HV2A 4H9HA 3A94A 1L93A 1QUHA 1L08A 1JUGA 1L96A 4ARQA 3HT6A 1TAYA 1L94A 1KXYA 3C7WA 3A90A 3OE8A 2W1LA 1L22A 4BS7A 2Y8PA 1TCYA 1QSWA 3WPKA 3KAMA 3HBDA 182LA 114LA 1OP9B 2MEAA 4XADA 199LA 2D91A 2LZ2A 3HT7A 1K28A 1HEQA 2HEDA 5LA8A 5FCPA 4YX7C 5K7OA 1P2CC 1XFPL 2GV0A 2EQLA 4LDLA 3FA0A 4PHIA 1DKJA 1UIDA 1TLAA 2BQLA 2F47A 1L75A 4I7OA 5IDDA 2BQHA 140LA 1LYSA 2RBPA 1IO5A 2YBNA 5DL9A 183LA 1QDTA 4NSJA 166LA 1JIYA 1XGTC 1FLUA 1GWDA 1LSEA 1HSXA 3G3BB 1L65A 216LA 1GF5A 3GUKA 1L59A 4FDYA 1CKDA 5C6JA 1QSBA 4CJ2A 129LA 4W96A 1HENA 2BQDA 3GXRA 2NTGA 4NGVA 1IOCA 1L41A 4LYTA 1CNSA 4TTDA 205LA 2IHLA 3OE9A 2W1XA 2BAAA 1I56A 2L78A 1RJCB 4DD2A 1D6PA 1IVMA 1AZFA 1L24A 1C6KA 1OUHA 2F2QA 1C6IA 3DNAA 1P37A 1L42A 1CV6A 1CKGA 3J6KA 1ZWNA 4WLYA 1HHLA 3LYTA 1HSWA 5I4XA 1QSAA 1A2YC 1GFRA 1LMTA 104LA 1IOTA 223LA 1LZNA 1T3PA 3TXEA 1JJ1A 1JTNA 1DZBX 1JEFA 3IWRA 4IATA 3P66A 3CT1A 4H92A 144LA 1L48A 1EQ5A 3WUNA 3AGHA 1B7NA 4WO6A 2B5ZA 1GXV2 4DD7A 1QSQA 2CJLA 3EMLA 4KL7A 186LA 3HBEX 2DQJY 2RBOA 2YBJA 3RZEA 3WULA 1LZSA 1GFTA 206LA 2RBRA 4ZPUA 1OWYA 5A3ZA 1LZGA 2MEHA 1L27A 3FI5A 1LI6A 5LA5A 1L43A 4OWAA 5JENB 5LYTA 250LA 5LVHA 1IWUA 246LA 257LA 3IJUA 2D6BA 1GFGA 261LA 1OUAA 207LA 6LYTA 2I26L 4Z98A 154LA 1LSBA 1L44A 4YEOA 2YBLA 1QS5A 2CWIA 180LA 1G0PA 5B07A 1GPQC 2EIZC 4NGJA 5LINA 1UIFA 4I7LA 1T8FA 5LVGA 1IP6A 4OWHA 1WQRA 1F6RA 4YXCA 132LA 1GB7A 1QUOA 1GE3A 3ZVQA 3AJNA 3HH3A 2MEIA 4II8A 1L83A 1LGWA 3WPLA 2BQBA 1REZA 4HJVA 155LA 4YM8A 262LA 1QT5A 1L73A 4H8XA 1DI4A 4BADA 1G07A 4LYCA 1JKAA 1SLYA 4OOOA 1L0JA 3VWOA 1CX6A 1LJHA 1FBIX 4BAFA 1GE2A 1C6CA 1C66A 1DQJC 1C68A 4GCEA 1L16A 213LA 1SWYA 4DDAA 4G49A 1GF3A 1CUQA 1N4FA 1C10A 4YOPA 1L26A 1QTDA 1UIAA 1OUEA 4UWUA 1C6NA 1IWWA 1EQEA 3HH5A 2ZYCA 109LA 1F10A 4NWHA 5LIOA 4GBRB 3ATNA 1G7MC 1DYDA 1KS3A 3P4ZA 2WARA 1QTEA 5B59A 1LAAA 3G3WA 1C69A 4N1EI 3RW8A 1PS5A 165LA 1AT6A 1L02A 1BWHA 1DYEA 5F81A 3AZ5A 3B6LA 3LYOA 1IWXA 1LZ9A 4DD9A 1GBZA 4NHSA 214LA 2YSSC 4WMGA 5I54A 111LA 4NGOA 255LA 113LA 2CUUA 1TEWA 4G9SA 1GDWA 110LA 1L17A 2MEBA 3ZVQB 1GB2A 1BQLY 1C08C 3HFMY 153LA 4S0WA 134LA 3AGIA 1W08A 3TXBA 4OWCA 1L09A 2BLXA 3WU7A 172LA 1L74A 2D4IA 3TMXA 1G7LC 1REMA 3C8SA 2G4PA 4KT3A 217LA 5D5CA 1LGUA 4WM5A 122LA 1L54A 4I7MA 2H9JA 1QT3A 4G4HA 1AT5A 1DYCA 221LA 4PRQA 4XENA 3WUMA 1GF7A 2RSCA 3AW7A 4A7DA 3OK0A 1LPYA 1B7OA 190LA 3W6BA 3ULRA 1NBZC 1LJIA 1YKYX 1LZ4A 1J1OY 4KXIA 1L15A 1GFKA 259LA 1LWKA 4WM4A 4XN6A 2I6ZA 3TXFA 102LA 1GB9A 3WXUA 4MCKA 1VDTA 1L32A 1JHLA 3A8ZA 258LA 1L04A 3C82A 3RU5A 4H9EA 4PPOA 1YL1X 3D4SA 5E4PA 5T3FA 2Z2FA 1PQMA 2H9KA 1GB5A 1SX7A 3AZ6A 4Z41A 1JISA 4EKSA 157LA 4LGKA 1CKCA 4H9AA 1G7JC 1KY0A 3CSQA 4DKLA 5KKIA 4QGZA 4DDBA 4WL6A 1I20A 1MLCE 4TX7A 1IP5A 3DMVA 5EBHA 3QNGA 1HERA 5M1YA 4ML7A 1GFHA 2G4NA 4TSBA 1QT4A 1YIKA 4NG1A 1QUDA 4YXAC 3WVYA 3QAKA 1EL1A 1LJJA 1WTHA 4EPIA 139LA 1DPWA 1AKIA 1BB3A 1CU0A 1L70A 1LHHA 2BQJA 4WLTA 1F6SA 115LA 1G1VA 2OTYX 1IP2A 260LA 5LVKA 125LA 1HC0A 2C8OA 4NGZA 1IWTA 5APFA 1BHZA 1GXXA 1NHEA 1QTVA 4HP0A 4ETCA 1EQ4A 3C80A 3A6BY 1VATA 1JTOL 1B5VA 4GLVA 2CDSA 1HELA 2B6XA 4H9CA 3WW5A 5F16A 3HBHA 6LYZA 3NY8A 1GAZA 1LSCA 5J7CA 1L58A 1B5YA 1FLWA 1LSYA 1L89A 1PQIA 2DQFC 4AXTA 1L14A 1P3NA 1XGRC 1P7SA 133LA 1LJEA 1IEEA 1GF9A 1CJ9A 1YQVY 1YKXX 1LHJA 2NTHA 2B6YA 158LA 159LA 1L0KA 181LA 4LT2A 236LA 2EKSC 2HEFA 1LYGA 1L47A 209LA 1L39A 3N9EA 4CFOA 1WQPA 4AQNA 4GCDA 210LA 2ZQ4A 1OUDA 1LSMA 226LA 1L20A 4WO9A 1LSAA 4NGYA 2DQIY 2HTXA 184LA 4NEBA 4MR1A 4GN4A 3UONA 2BQGA 5KXTA 1YL0X 2HUKA 1G0JA 4I7SA 1UIBA 1DYFA 4NHTA 1CV3A 1GFEA 220LA 1LYEA 2LHMA 4Z46A 1WQOA 3A3QA 4I7QA 1NF5A 2PC2A 4G4CA 1CUPA 1L84A 1QQYA 1LJGA 1YROA 2BLYA 1VEDA 3A95A 4H1PA 188LA 1LMOA 1IC7Y 1O23A 201LA 4B4IA 1YAPA 4OWEA 1JKBA 1OV5A 1HFZA 1TBYA 3CB7A 5I4WA 3A96A 147LA 1XJTA 1EPYA 1UBZA 2BQAA 1GB8A 4HPEA 1KW5A 4W57A 1C6QA 4ARMB 3A93A 1GFAA 4GCBA 2RB2X 1QUTA 1B7MA 4NSGA 1IORA 5FEKA 4U3XB 3DMXA 1D3MA 4GN5C 4HV1A 3ZEKA 4NHQA 2B72A 4M6DA 1GBSA 1P5CA 4K5YA 1L86A 1FN5A 4NGKA 1L18A 1L87A 1G0KA 5KXNA 3C7YA 1L88A 4DC4A 3GUOA 2MEGA 1QTZA 232LA 1B5ZA 5KXSA 4H8ZA 1B7RA 3FE0A 5LAGA 2O4WA 3EO5A 1LTMA 1PZYA 245LA 4LT1A 1NHBA 1C6FA 1GBOA 1JKCA 3HTBA 164LA 1WTNA 2B74A 1WQNA 2Z37A 1IOSA 4XJDA 242LA 146LA 1D0MA 1D9WA 2OU9A 1L33A 1TDYA 1LMCA 1GFJA 1T6HA 4NGLA 4DQJA 3DMZA 1C6PA 1QUSA 3CQLA 1XEIA 169LA 4DYGA 1REXA 3DN6A 1GEZA 3TXIA 1PQKA 3ATOA 1OUJA 1GF4A 4DDCA 1ZVHL 3CT5A 3WL2A 194LA 5HMJA 1ZURA 4IASA 1BB7A 1LHIA 1LW9A 1LZ8A 4RW1A 1UICA 4KPMA 3DN3A 1HMLA 1L21A 1LHKA 1D2WA 4WL7A 3GUJA 3EMSA 1L00A 3W6DA 4NSIA 256LA 2IGCA 4LDOA 3HU8A 1KXWA 1LHLA 1C6DA 4N9RA 1IC4Y 4DT3A 1LJKA 2D4JA 160LA 3G3XA 3QY4A 5IHGA 1L97A 3V2WA 1HF4A 3AGGG 2RBNA 4TUNA 1CTWA 1LYIA 4PK0A 1VDPA 1C6BA 1LZDA 1ZVYB 1C6LA 2XTHA 2DKVA 4FJRA 4I0CA 241LA 212LA 2D4KA 1D6QA 3G3AB 3HDFA 2AUBA 127LA 4P2EA 2ZILA 1SSYA 4NIJA 3TMVA 3G3VA 2Z39A 1LYDA 3D3DA 2DQCY 1D3FA 1CV1A 2DBTA 5A3EA 1L31A 3K2RA 1YANA 1LOZA 1L34A 1L37A 1IX0A 3F9LA 1OVKA 3LZTA 1CU2A 1DI3A 3WU9A 4ZEEA 196LA 1YAQA 149LA 8LYZA 197LA 4H9IA 3LN2A 1L12A 1I1ZA 1LSGA 1CV5A 1BWIA 1T97A 225LA 1P2LA 4RW2A 1IP1A 1P46A 3C81A 3BKHA 4TWSA 1WQQA 2N5ZA 4H9FA 4HTNA 1QT7A 3SP3A 3AB6A 2DQDY 2HEBA 1HNLA 3WYHA 3HTDA 1XGQC 1CJ6A 5B06A 3RNXA 4OW1A 3K3TA 2VB1A 1LYFA 2OE7X 170LA 2ZWBA 4N1CC 2BQNA 4RDSA 2DQEY 1NDMC 1NBYC 5KXWA 1HFYA 3TXHA 2Z19A 4HTKA 1HEOA 1UC0A 4C5FA 251LA 4GCCA 1D0LA 1I6SA 1WVUA 5B1GA 1VAUA 4IJ4A 1GF6A 1IWZA 1L61A 1OV7A 4ET9A 3WVXA 1IOQA 4GLAA 4WLDA 3C83A 187LA 1GDXA 1LZRA 1C43A 1C67A 235LA 5F9XA 3FI7A 1GB0A 1C63A 3SN6R 1HEWA 1L67A 1L46A 1GHLA 1L64A 219LA 5LYMA 5LVIA 4NFVA 1HFXA 137LA 1C6AA 234LA 5LYZA 4I7KA 5APCA 4I7PA 1LMAA 5L9JA 1L98A 1L53A 2LYMA 1L52A 4HJZA 2CGIA 5FELA 1FLYA 218LA 2Q9EA 1GBXA 2YDGA 4XJHA 3TXKA 3HU9A 1G0MA 138LA 4R0FA 1IP7A 2BQCA 2G4QA 5DLAA 1PQDA 4W55A 1C45A 2BQKA 3GUIA 2MEFA 3DN0A 2FYDA 4Z3MA 2XBSA 195LA 174LA 4N5RA 5DN5A 1B5WA 233LA 1IWVA 254LA 1B5UA 3F6ZA 1QUGA 2RB1X 5E9RA 2Q0MX 161LA 2B7XA 4LZMA 3TXJA 1C65A 1F0WA 1L80A 1LYZA 5B1FA 3TMUA 4J7VA 176LA 1DKKA 4LFPA 1DXJA 211LA 3CDVA 1L49A 2HU1A 1LJFA 1B9OA 2BQMA 1LZ1A 3M18B 4X3BA 1WTMA 4E3UA 4WM6A 2RBSA 1L63A 3RT5X 3B0OA 3C7ZA 4I7NA 3A92A 3LYZA 3A34A 1JJ3A 1L28A 4LFXA 231LA 3C8QA 4W51A 2B6WA 3HT8A 1L45A 4ET8A 2B70A 4EOFA 1GE4A 1D3JA 1KIPC 1RFPA 2LC9A 1G7HC 2OTZX 1GEVA 1G0GA 1JWRA 1L66A 4WOAA 3N9CA 1LYJA 1L92A 1JPOA 3DKEX 3DN8A 3P65A 1LWGA 5LXWA 4XJFA 4M4OA 1LZ6A 5L3IA 9LYZA 230LA 3WW6A 3B0KA 1L68A 1LYYA 2B6TA 1L62A 2XJWA 3FADA 4W54A 5I4YA 1IR7A 3EXDA 1H87A 4LZTA 1L30A 4J0LA 1SWZA 1YAOA 4HTQA 1V7TA 4XJIA 1VDSA 4O34A 4QDNA 1LZYA 2RB0X 2RH1A 1G0QA 1INUA 240LA 1DI5A 1LJ3A 3QE8A 3MGWA 4NG8A 2YVBA 1L07A 248LA 1L05A 112LA 4R6CA 1GBYA 2QB0B 1KNIA 1KW7A 1WVVA 1LKRA 1PQOA 2HEAA 151LA 1P64A 1LMPA 2FBBA 1L03A 108LA 4XJBA 2RAYX 1OYUA 1B7LA 1P6YA 1FKQA 4N8ZA 5KY1A 3CDTA 175LA 4B1AA 1KIRC 5KXRA 1QTBA 1NQIA 1YILA 1B7QA 3LYMA 5I14A 1B2KA 2HU3A 4GCFA 1QDRA 3RZ4A 1NMMA 5HLLA 2BQEA 1LHMA 1C6EA 1L51A 2HEEA 2H5ZA 128LA 1D9UA 1XSFA 4IAPA 2Z2EA 2ZYPA 4LYBA 2NWDX 4NGWA 239LA 1CKHA 3SB9A 3V2YA 7LZMA 5KXMA 1WQMA 3NYAA 135LA 1L13A 2ANVA 1BWJA 4WLXA 3TXGA 4I7RA 2MECA 1REYA 4LT3A 4HPIA 1IY3A 2O7AA 4EXMA 1L71A 3HUAA 1LJ4A 3W3EA 1G0LA 1CV0A 1T8GA 3LZMA 1IP4A 4W53A 1G1WA 123LA 171LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVY B;  1G7L C;  3TMX A;  2A7D A;  2XTH A;  2ZIK A;  1JSE A;  1BGI A;  1REM A;  2DKV A;  2G4P A;  4FJR A;  4H94 A;  4I0C A;  2ZNX Y;  4KT3 A;  4NSH A;  5D5C A;  1XGU C;  4WM5 A;  2D4K A;  1D6Q A;  1XEK A;  3D9A C;  3G3A B;  2AUB A;  3TMW A;  1GB3 A;  5C6L A;  5II3 A;  1UUZ C;  4P2E A;  4PGJ B;  1BVK C;  3TXE A;  2H9J A;  1FLQ A;  2ZIL A;  1NDG C;  4DD0 A;  4NIJ A;  3TMV A;  4D9Z A;  2Z39 A;  4G4H A;  3D3D A;  1AT5 A;  5I53 A;  2DQC Y;  4PRQ A;  1YKZ X;  2DBT A;  2ZNW Y;  4XEN A;  5A3E A;  1BVX A;  3WUM A;  1VDQ A;  1XGP C;  1GF7 A;  2RSC A;  4ZFP A;  1B7S A;  1YAN A;  1LOZ A;  3AW7 A;  4A7D A;  3OK0 A;  4AGA A;  1B7O A;  1LZB A;  3W6B A;  1BB5 A;  1IX0 A;  3ULR A;  1NBZ C;  4GN3 A;  5B05 A;  5APD A;  4NY5 A;  1LJI A;  1LPI A;  3GXK A;  3LZ2 A;  1T6V L;  1YKY X;  1DI3 A;  3LZT A;  3WU9 A;  4UWN A;  4YEN A;  4ZEE A;  1LZ4 A;  1J1O Y;  1YAQ A;  2W1M A;  4KXI A;  1GFK A;  8LYZ A;  2F2N A;  3LN2 A;  4H9I A;  4B4E A;  4ZIX A;  3AZ7 A;  4WM4 A;  1I1Z A;  1J1P Y;  4XN6 A;  1B5X A;  1LSG A;  4RLM A;  1UAC Y;  1BWI A;  4ETB A;  5L3H A;  2I6Z A;  1GE1 A;  3TXF A;  1GB9 A;  4H9B A;  3WXU A;  4RW2 A;  4MCK A;  3B72 A;  1VDT A;  1IP1 A;  1JHL A;  3A8Z A;  4HJY A;  5HMV A;  3LHM A;  3BKH A;  1BB4 A;  4TWS A;  3RU5 A;  1WQQ A;  2LZT A;  4L41 A;  2N5Z A;  4H9E A;  2X0A A;  2ZQ3 A;  1CKF A;  4UWV A;  4J1B A;  5FHW A;  1OQM A;  4H9F A;  4PPO A;  1YL1 X;  4RLN A;  1IP3 A;  1LZC A;  4YF2 A;  1LSZ A;  4HTN A;  3A3R X;  2FBD A;  4CGE A;  3SP3 A;  3AB6 A;  1OUF A;  2YBM A;  1GB6 A;  2DQD Y;  5E4P A;  2HEB A;  1GF8 A;  5T3F A;  1HNL A;  3WYH A;  2Z2F A;  3W6F A;  2H9K A;  4XAD A;  1ZV5 L;  4HV2 A;  1GB5 A;  1XGQ C;  5KXX A;  1CJ6 A;  1GE0 A;  5B06 A;  3P64 A;  4H9H A;  1LMN A;  3A94 A;  3AZ6 A;  3RNX A;  1JIS A;  5AMY A;  4LGK A;  4Z41 A;  1CKC A;  5KJ9 A;  4OW1 A;  1JUG A;  3K3T A;  2DQA A;  2Z38 A;  4H9A A;  4J1A A;  3AZ4 A;  4MST A;  1G7J C;  1TAY A;  2VB1 A;  3CSQ A;  1KIQ C;  3AW6 A;  1KXY A;  1RE2 A;  5KKI A;  2ZWB A;  4N1C C;  2BQN A;  3A90 A;  4QGZ A;  4RDS A;  2W1L A;  2Z12 A;  5LYT A;  2DQE Y;  3P68 A;  1C7P A;  4DDB A;  4WL6 A;  1NDM C;  1NBY C;  1G7I C;  1I20 A;  2MEE A;  5KXW A;  1MLC E;  4BS7 A;  4TX7 A;  2Y8P A;  4QEQ A;  1HEP A;  1IP5 A;  1QSW A;  1TCY A;  3WPK A;  1HFY A;  3HBD A;  3KAM A;  4H90 A;  2Z19 A;  5EBH A;  5APE A;  3TXH A;  3QNG A;  2LYO A;  4HTK A;  4HSF A;  1HER A;  1OP9 B;  5M1Y A;  1HEO A;  4ML7 A;  1GFH A;  2G4N A;  1UC0 A;  2MEA A;  1XEJ A;  2XBR A;  1YIK A;  3N9A A;  4TSB A;  3BKV A;  1H6M A;  4NG1 A;  2D91 A;  2LZ2 A;  4ETA A;  3A67 Y;  1HEQ A;  4C5F A;  2HED A;  5LA8 A;  5FCP A;  5K7O A;  3WVY A;  3A6C Y;  4C3W A;  1EL1 A;  1LJJ A;  1P2C C;  1HEM A;  2HEC A;  4GCC A;  1KXX A;  1D0L A;  1LZ5 A;  2BPU A;  4ANR A;  4WG1 A;  1XFP L;  2GV0 A;  1WVU A;  4H8Y A;  1DPW A;  1AKI A;  1BB3 A;  5B1G A;  1VAU A;  4IJ4 A;  1GF6 A;  1LHH A;  2BQJ A;  2EQL A;  4WLT A;  1IWZ A;  4PHI A;  1F6S A;  1GFU A;  1LJN A;  1OUC A;  2HUB A;  1IP2 A;  1DKJ A;  4ET9 A;  1IR8 A;  3WVX A;  1IOQ A;  1UID A;  5KXP A;  5LVK A;  1HC0 A;  4GLA A;  4WLD A;  2C8O A;  4NGZ A;  5D5F A;  1IWT A;  1GDX A;  1LZR A;  1YAM A;  1C43 A;  2BQL A;  1BB6 A;  4I8S A;  5F9X A;  3FI7 A;  5APF A;  3WPJ A;  1BHZ A;  1FDL Y;  1GXX A;  5IDD A;  1GB0 A;  1NHE A;  2BQH A;  4EMN A;  1UCO A;  1LYS A;  1HEW A;  1IO5 A;  4HP0 A;  3WH1 A;  1UA6 Y;  2YBN A;  5DL9 A;  1NWG A;  1QDT A;  1GHL A;  4NSJ A;  3W6E A;  2DQG Y;  5LYM A;  4ETC A;  1JIY A;  1EQ4 A;  1XGT C;  1FLU A;  1GWD A;  1LSE A;  3A6B Y;  1HSX A;  1D0K A;  3G3B B;  1VAT A;  1JTO L;  1B5V A;  4GLV A;  2CDS A;  4NFV A;  1HFX A;  1HEL A;  4ETD A;  4OWB A;  4DWX A;  1GF5 A;  4FDY A;  1CKD A;  5C6J A;  4H9C A;  4CJ2 A;  3WUA A;  3WW5 A;  4CFP A;  4W96 A;  5F16 A;  1J1X Y;  3IJV A;  1ZMY L;  3HBH A;  1HEN A;  5LYZ A;  6LYZ A;  5APC A;  1LMA A;  2BQD A;  5L9J A;  3GXR A;  1GAZ A;  2LYM A;  1LSC A;  4NGV A;  1IOC A;  2CGI A;  4HJZ A;  4LYT A;  1CNS A;  4WG7 A;  5J7C A;  1B5Y A;  5FEL A;  1FLW A;  4TTD A;  1FLY A;  1LSY A;  2IHL A;  3OJP A;  4BAP A;  2W1X A;  1GBX A;  2YDG A;  2DQF C;  4XJH A;  1LSN A;  4AXT A;  2BAA A;  3TXK A;  1I56 A;  2BQC A;  5HNL A;  1IP7 A;  1RJC B;  4R0F A;  2G4Q A;  4PRU A;  4DD2 A;  5DLA A;  1XGR C;  1C45 A;  1D6P A;  1IVM A;  1AZF A;  133L A;  2BQK A;  1OUH A;  1LJE A;  1MEL L;  1IEE A;  1GF9 A;  1CJ9 A;  1YQV Y;  1YKX X;  2MEF A;  1LHJ A;  5ILC A;  2FYD A;  4Z3M A;  2XBS A;  4N5R A;  5DN5 A;  1B5W A;  1CKG A;  3J6K A;  1IWV A;  3F6Z A;  1B5U A;  4LT2 A;  4WLY A;  1HHL A;  3LYT A;  5E9R A;  2EKS C;  1QIO A;  1HSW A;  5I4X A;  2MED A;  2Q0M X;  4H91 A;  1QSA A;  2HEF A;  1A2Y C;  1UIG A;  4WM3 A;  3N9E A;  4CFO A;  1CJ7 A;  1WQP A;  4LYZ A;  1GFR A;  1LMT A;  1LSF A;  3TXJ A;  1IR9 A;  1IOT A;  1F0W A;  4GCD A;  1GBW A;  4YEM A;  2ZQ4 A;  1LZN A;  1LYZ A;  1OUD A;  1T3P A;  1JIT A;  5B1F A;  1VFB C;  1LSM A;  4J7V A;  3TMU A;  1JJ1 A;  1UIE A;  2BQF A;  4WO9 A;  1LSA A;  1DKK A;  3M3U A;  1DXJ A;  4LFP A;  4IAT A;  1DZB X;  1JEF A;  3IWR A;  4DD3 A;  3P66 A;  4NWE A;  3CT1 A;  4H92 A;  4M4O A;  4NGY A;  2HU1 A;  1EQ5 A;  1LJF A;  2DQI Y;  4NHP A;  3WUN A;  1B9O A;  2BQM A;  2HTX A;  1LZ1 A;  3AGH A;  1B7N A;  4NEB A;  2B5Z A;  4WO6 A;  4DD1 A;  1GXV 2;  3M18 B;  7LYZ A;  4TSC A;  4MR1 A;  4GN4 A;  4X3B A;  4DD7 A;  1WTM A;  2CJL A;  4B4J A;  4KL7 A;  4E3U A;  3HBE X;  3RZ4 A;  2BQG A;  4WM6 A;  5KXT A;  3WXT A;  1YL0 X;  3WU8 A;  2DQJ Y;  2YBJ A;  3WUL A;  5ILF A;  1LZS A;  3RT5 X;  1UIB A;  3B0O A;  4B0D A;  1LSP A;  3CSR A;  3A91 A;  1GFT A;  3A92 A;  4NHT A;  1LMQ A;  1GFE A;  3LYZ A;  3A34 A;  1JJ3 A;  4LFX A;  1OUI A;  4XJG A;  2LHM A;  1NKH A;  1RI8 B;  1ALC A;  1B0D A;  4Z46 A;  1RCM A;  1WQO A;  3A3Q A;  5A3Z A;  3AYQ A;  2W1Y A;  1LZG A;  2MEH A;  1LKS A;  1NF5 A;  4ET8 A;  2PC2 A;  4G4C A;  5F9U A;  4EOF A;  5LA5 A;  1GE4 A;  1QQY A;  2BQO A;  4OWA A;  1LJG A;  5JEN B;  1KIP C;  1YRO A;  1RFP A;  1VED A;  1G7H C;  2BLY A;  3A95 A;  4H1P A;  2LYZ A;  5HNC A;  5LVH A;  1GEV A;  1IWU A;  2IFF Y;  1LMO A;  1IC7 Y;  4NGI A;  1O23 A;  1JWR A;  3IJU A;  2D6B A;  1A4V A;  4WOA A;  4B4I A;  1GFG A;  4G4B A;  1OUA A;  1YAP A;  1OUG A;  4OWE A;  207L A;  3N9C A;  6LYT A;  1JPO A;  2I26 L;  4Z98 A;  1C46 A;  154L A;  1JKB A;  1OUB A;  1HFZ A;  1TBY A;  1LSB A;  3CB7 A;  3P65 A;  4N0J A;  4LYO A;  4XJF A;  4YEO A;  5I4W A;  3A96 A;  2YBL A;  1JTT L;  1LZ6 A;  2BQA A;  1UBZ A;  2CWI A;  5LVJ A;  5L3I A;  1GB8 A;  5B07 A;  1GD6 A;  1GPQ C;  5DN4 A;  9LYZ A;  4HPE A;  4XYY A;  2EIZ C;  4W94 A;  4NGJ A;  3A93 A;  3WW6 A;  3B0K A;  5LIN A;  1GFA A;  1UIF A;  2FYC A;  4GCB A;  5HLL A;  5KXO A;  1LYY A;  5I5Q A;  5LVG A;  1IP6 A;  1Z55 A;  4OWH A;  1QUT A;  1WQR A;  2XJW A;  1B7M A;  3W6A A;  1F6R A;  4NSG A;  132L A;  1IOR A;  1GB7 A;  2EPE A;  1IC5 Y;  4U3X B;  5FEK A;  4ETE A;  5I4Y A;  3J4G A;  1IR7 A;  5IEL A;  5LVI A;  3EXD A;  4HV1 A;  4GN5 C;  1E8L A;  1LZE A;  1GE3 A;  5FDJ A;  3ZVQ A;  3B0I A;  3ZEK A;  4NHQ A;  4PJ2 C;  1H87 A;  4M6D A;  1GBS A;  3AJN A;  208L A;  4LZT A;  4J0L A;  1YAO A;  2MEI A;  1FN5 A;  4HTQ A;  4II8 A;  1SQ2 L;  4NGK A;  1V7T A;  4XJI A;  2ZIJ A;  1VDS A;  2BQB A;  2Z18 A;  3EBA B;  4O34 A;  3WPL A;  1LZT A;  1REZ A;  2F4A A;  4QDN A;  1LZY A;  1AM7 A;  1HMK A;  4LT0 A;  4HJV A;  5KXN A;  2I25 L;  1INU A;  1DI5 A;  1LJ3 A;  4YM8 A;  3QE8 A;  3MGW A;  4NG8 A;  5F14 A;  2YVB A;  4DC4 A;  5KKJ A;  1IIZ A;  2MEG A;  4H8X A;  1B5Z A;  5KXS A;  4H8Z A;  1W6Z A;  1DI4 A;  1B7R A;  3FE0 A;  5LAG A;  3WMK A;  2DQH Y;  4BAD A;  4LYC A;  2BQI A;  4R6C A;  1GBY A;  1JKA A;  1SLY A;  4OOO A;  1WVV A;  3EO5 A;  5KXK A;  1LKR A;  1LTM A;  3VWO A;  1PZY A;  4LT1 A;  2HEA A;  1GBO A;  1JKC A;  3CT0 A;  1JJ0 A;  1LJH A;  1FBI X;  1LMP A;  2FBB A;  4BAF A;  1GE2 A;  1DQJ C;  1WTN A;  4XJB A;  5DM9 A;  3E3D A;  1WQN A;  2Z37 A;  1IOS A;  1B7L A;  4GCE A;  1FKQ A;  4N8Z A;  4XJD A;  5KY1 A;  1B7P A;  5HQ1 A;  1UIH A;  4G49 A;  4DDA A;  4CHX A;  1GF3 A;  3W6C A;  1D0M A;  1N4F A;  1C10 A;  4YOP A;  4B1A A;  1TDY A;  1KIR C;  1LMC A;  1LCN A;  5KXR A;  1GFJ A;  1JSF A;  5KXZ A;  1UIA A;  1OUE A;  4NGL A;  4UWU A;  3T36 A;  1IWW A;  1NQI A;  5C6I A;  2YBH A;  1EQE A;  1YIL A;  2ZYC A;  1F10 A;  5LIO A;  4NWH A;  3ATN A;  1QUS A;  1B7Q A;  1G7M C;  1XEI A;  3CQL A;  3LYM A;  4DYG A;  1FKV A;  3P4Z A;  1IY4 A;  1REX A;  1B2K A;  2HU3 A;  4GCF A;  4H93 A;  193L A;  1QDR A;  1GEZ A;  1QTE A;  2WAR A;  3TXI A;  5B59 A;  1DPX A;  1LAA A;  1NMM A;  1OUJ A;  3ATO A;  2BQE A;  4OOT A;  2YBI A;  4QY9 A;  1LHM A;  1GF4 A;  1LSD A;  3T6U A;  5KXY A;  2HEE A;  2H5Z A;  1D9U A;  1XSF A;  4N1E I;  1CJ8 A;  1ZVH L;  3RW8 A;  1GFV A;  4DDC A;  3CT5 A;  5LAF A;  1PS5 A;  2Z2E A;  1AT6 A;  2ZYP A;  4LYB A;  2NWD X;  3WL2 A;  5LXW A;  3TXD A;  194L A;  1LYO A;  4LYM A;  5HMJ A;  4IAS A;  1BWH A;  5F81 A;  4NGW A;  1BB7 A;  1LHI A;  3AZ5 A;  3B6L A;  1CKH A;  1LZ8 A;  1IWX A;  3LYO A;  2A7F A;  1LZ9 A;  4RW1 A;  1GF0 A;  1UIC A;  4WM2 A;  4WM1 A;  1JTP L;  4KPM A;  4DD9 A;  1GBZ A;  4NHS A;  5KXM A;  1WQM A;  1HML A;  1JKD A;  135L A;  2YSS C;  4WMG A;  1LHK A;  5I54 A;  1BWJ A;  4NGO A;  4WLX A;  3TXG A;  4WL7 A;  4B49 A;  2F4G A;  3CSZ A;  3EMS A;  3W6D A;  2MEC A;  1TEW A;  4G9S A;  1QTK A;  1GDW A;  2C8P A;  4NSI A;  5FST A;  1REY A;  2MEB A;  1LZA A;  1GAY A;  4LT3 A;  3ZVQ B;  1KXW A;  1LHL A;  4HPI A;  1GB2 A;  1BQL Y;  1IY3 A;  4N9R A;  1C08 C;  3HFM Y;  1IC4 Y;  4DT3 A;  1LJK A;  153L A;  1IWY A;  134L A;  2D4J A;  3AGI A;  1V7S A;  1LJ4 A;  3W3E A;  1W08 A;  3QY4 A;  5IHG A;  1HF4 A;  1IP4 A;  3TXB A;  4OWC A;  5KXL A;  3AGG G;  4NHI A;  2BLX A;  4TUN A;  3WU7 A;  2F30 A;  1VDP A;  2D4I A;  1LZD A; 
#chains in the Genus database with same CATH topology
 1PQJ A;  2ZIK A;  1JSE A;  1BGI A;  3F8V A;  2ZNX Y;  4NSH A;  2CFO A;  4LGY A;  3D9A C;  3FTF A;  1XEK A;  1L38 A;  1Z5C A;  2Q9D A;  5C6L A;  5II3 A;  177L A;  1L90 A;  1P36 A;  4PGJ B;  2XEP A;  4NOO B;  1NDG C;  2OEA X;  4DD0 A;  1AUA A;  5I53 A;  2Y0T A;  1YKZ X;  2ZNW Y;  5EXX A;  1VDQ A;  2OO9 A;  1VQ1 A;  2XF3 A;  4ZFP A;  1B7S A;  4D80 A;  2OU8 A;  1L19 A;  1LZB A;  1P2R A;  247L A;  5B05 A;  5APD A;  1LPI A;  3GXK A;  3LZ2 A;  1T6V L;  4I7J A;  4UWN A;  1UM8 A;  2KNA A;  2W1M A;  4XBO A;  4ZIX A;  3C8R A;  3KDS E;  1J1P Y;  4KOD A;  4II7 A;  1B5X A;  1UAC Y;  3EIE A;  4FD2 A;  3DZD A;  3GUP A;  4ETB A;  1GE1 A;  228L A;  198L A;  4H9B A;  3OTO M;  3HH6 A;  3B72 A;  1C6T A;  3HTF A;  3HDE A;  3GRY A;  4OU7 A;  2OE4 X;  4LG2 A;  3LHM A;  1C62 A;  1C6H A;  4ARM A;  3U6L A;  2ZTD A;  4LJ7 A;  3GLH A;  120L A;  2LZT A;  1SX2 A;  1CX7 A;  3KVW A;  2QSF X;  1CKF A;  1CU5 A;  2B6Z A;  2ZQ3 A;  1OQM A;  2HWJ A;  1IP3 A;  4YF2 A;  5LZM A;  1LSZ A;  3B74 A;  2L7H A;  4LF7 M;  1OUF A;  2YBM A;  1GB6 A;  4EIW A;  3HTG A;  3W6F A;  4EKR A;  1ZV5 L;  5KXX A;  3SAT A;  3DOA A;  4QOZ C;  1GE0 A;  4I8O A;  107L A;  3NY9 A;  3P64 A;  1LMN A;  2JXN A;  5AMY A;  5KJ9 A;  222L A;  3MMP A;  4FVM A;  2DQA A;  1Q39 A;  2Z38 A;  2O01 F;  2Z3X A;  150L A;  1QS9 A;  1L57 A;  2MH8 A;  4J1A A;  148L E;  3AZ4 A;  2B75 A;  3ODU A;  4MST A;  1KIQ C;  2LCB A;  3SBB C;  3AW6 A;  1L79 A;  4E97 A;  1RE2 A;  2C98 A;  2Z12 A;  4LRT A;  3P68 A;  1C7P A;  3GLG B;  1G7I C;  2MEE A;  3GLF B;  1DYB A;  4QEQ A;  1HEP A;  1T8A A;  1OIP A;  5APE A;  4H90 A;  3VKH A;  3C3E A;  2WSF F;  1L36 A;  4NRV A;  2LYO A;  4LJ6 A;  4HSF A;  4JXJ A;  1C1K A;  2XBR A;  3N9A A;  1XEJ A;  3JR6 A;  3BKV A;  1H6M A;  4ETA A;  2OOA A;  3A67 Y;  3FTC A;  3SB7 A;  1OKS A;  3W67 A;  3A6C Y;  4C3W A;  130L A;  252L A;  2HEC A;  1HEM A;  2B73 A;  1KXX A;  103L A;  1L23 A;  1LZ5 A;  2R46 A;  2RGH A;  2BPU A;  1YE9 A;  4ANR A;  4WG1 A;  145L A;  2WZJ A;  4H8Y A;  2FOI C;  3FUU A;  3LCV B;  1OAO C;  1L99 A;  1C6M A;  1T6O A;  4F1I A;  4KT0 F;  1GFU A;  8CAT A;  2I7P A;  1LJN A;  1OUC A;  243L A;  4ARL A;  2XLJ A;  2HUB A;  3L2X A;  1OWZ A;  1IR8 A;  1L35 A;  119L A;  5KXP A;  141L A;  2DI0 A;  4HLQ A;  2L4E A;  4M9Z A;  4WP2 A;  5D5F A;  1YAM A;  1T43 A;  1BB6 A;  178L A;  4W58 A;  4I8S A;  2M60 A;  5ITX E;  3WPJ A;  1FDL Y;  5DYG A;  3VKG A;  4EMN A;  1UCO A;  2XQO A;  1DYA A;  3WH1 A;  1UA6 Y;  2F5O A;  1NWG A;  1LGX A;  1OFH A;  4MGI E;  3W6E A;  4ZPX A;  200L A;  2DQG Y;  4MH0 E;  2LZM A;  1QTH A;  143L A;  4DV6 M;  4ARJ A;  1D0K A;  1D3N A;  3GLH E;  4ETD A;  5C18 A;  4AW4 A;  1XXH A;  3HWS A;  4OWB A;  4DWX A;  2OU0 X;  1L11 A;  152L A;  1C64 A;  3WUA A;  3Q8G A;  4CFP A;  1RU3 A;  1J1X Y;  1ZMY L;  3IJV A;  191L A;  5FTL A;  227L A;  4WG7 A;  1BVS A;  1L60 A;  3OE6 A;  4DAJ A;  3OJP A;  4BAP A;  5F3W A;  1LSN A;  3FYC A;  1MU5 A;  5HNL A;  142L A;  1GLN A;  4GRV A;  4PRU A;  4L16 A;  2K0B X;  1MEL L;  1L85 A;  1OVH A;  1HT1 E;  5ILC A;  5L8R F;  1QT8 A;  3J81 S;  4DUY M;  4NXN M;  4LZJ A;  1G06 A;  3TQS A;  1L82 A;  4LF9 M;  2X8A A;  1QIO A;  2MED A;  4H91 A;  1XJU A;  1UIG A;  4WM3 A;  1CJ7 A;  2HUM A;  4LYZ A;  1LSF A;  1IR9 A;  4YEM A;  1GBW A;  189L A;  2HCB A;  1JIT A;  1VFB C;  4DV0 M;  1UIE A;  2BQF A;  3M3U A;  3KSX A;  1IBM M;  4DD3 A;  5FLX S;  2NQ8 C;  2R45 A;  4NWE A;  1YSY A;  3KSJ A;  4NHP A;  4W52 A;  131L A;  2C9C A;  1R2Z A;  3RFW A;  4DD1 A;  4EJ4 A;  7LYZ A;  4B7G A;  4TSC A;  4LF4 M;  5EP4 A;  3OE0 A;  4B4J A;  3GRV A;  3DN1 A;  1CU3 A;  1NY6 A;  3WXT A;  2Y21 A;  3WU8 A;  3QWL A;  224L A;  2X4A A;  5ILF A;  1LI3 A;  3HUK A;  4B0D A;  4WUR A;  167L A;  1LSP A;  1XEP A;  3CSR A;  3L29 A;  3A91 A;  4JI2 M;  126L A;  1LMQ A;  4GIP A;  2QAR C;  3GRR A;  1IXS B;  4XJG A;  1OUI A;  1NKH A;  1L25 A;  1ALC A;  1B0D A;  1RI8 B;  1L77 A;  1RCM A;  3AYQ A;  2W1Y A;  4LJ4 A;  1C6G A;  1LKS A;  1D2Y A;  1WHC A;  5F9U A;  2BQO A;  3HH4 A;  3L64 A;  4QNR A;  1E9S A;  1ZYT A;  2CWB A;  4NSO B;  4GHL A;  2LYZ A;  5HNC A;  2IFF Y;  4B7F A;  2F32 A;  4NGI A;  2CP8 A;  1A4V A;  2MR9 A;  1KY1 A;  4G4B A;  2D7E A;  3RGP A;  1OUG A;  4YHH M;  3CF2 A;  4JI7 M;  1C46 A;  3B7Z A;  3NWL A;  1OUB A;  3HZJ A;  4N0J A;  4LYO A;  1JTT L;  5LVJ A;  1GD6 A;  5DN4 A;  4XYY A;  4W94 A;  3M7G A;  2FYC A;  5KXO A;  2F5Q A;  3PFI A;  5I5Q A;  4HEO A;  4I4L A;  1EFU B;  1Z55 A;  3PBL A;  3W6A A;  1QT6 A;  1IXR C;  2EPE A;  4ETE A;  1IC5 Y;  2OE9 X;  3J4G A;  5IEL A;  1L95 A;  1E8L A;  2QCU A;  1LZE A;  2DZN B;  5FDJ A;  1QAM A;  3B0I A;  4PJ2 C;  208L A;  4JV5 M;  2A4T A;  1L29 A;  3UZU A;  215L A;  1SQ2 L;  163L A;  2ZIJ A;  3EBA B;  2Z18 A;  1LZT A;  2F4A A;  1AM7 A;  1HMK A;  1LV7 A;  1L50 A;  4LT0 A;  2I25 L;  3CDQ A;  3VW7 A;  1TF0 B;  1L91 A;  5F14 A;  2ZTC A;  4IBJ A;  4KHP M;  3SB8 A;  5KKJ A;  1IIZ A;  1JQU A;  1W6Z A;  4W59 A;  3WMK A;  1R7R A;  2DQH Y;  2BQI A;  4B3R M;  3FUX A;  1L40 A;  5KXK A;  2DWZ B;  192L A;  3CT0 A;  1JJ0 A;  2J5Y A;  253L A;  5DM9 A;  3E3D A;  1Z5B A;  4MM3 B;  4DQ5 A;  1GVN A;  1B7P A;  3LVV A;  3SAS A;  1UIH A;  2KRK A;  3I4Y A;  5HQ1 A;  2O79 A;  4CHX A;  3DN4 A;  3W6C A;  1LYH A;  1L55 A;  3HT9 A;  1PJQ A;  1LCN A;  4EKQ A;  1JSF A;  5KXZ A;  1DYG A;  4EKP A;  2RBQ A;  3T36 A;  5C6I A;  4Y28 F;  2YBH A;  3TE6 A;  173L A;  4DR5 M;  2Y20 A;  1FKV A;  1L76 A;  1IY4 A;  4H93 A;  3SB6 A;  4RNA A;  193L A;  1DPX A;  4OOT A;  2XSZ A;  4ARP A;  2JNH A;  2YBI A;  4QY9 A;  1LSD A;  3T6U A;  2XFT A;  4AKI A;  5KXY A;  162L A;  238L A;  1HJP A;  4DJH A;  1UFZ A;  1CJ8 A;  4IBE A;  1GFV A;  3PDS A;  5LAF A;  2BJW A;  1B6I A;  1JTM A;  3TXD A;  2CHV A;  4PT5 A;  118L A;  1HR0 M;  1LYO A;  4LYM A;  1NJG A;  2KNZ A;  1QYR A;  156L A;  1L81 A;  2A7F A;  1GF0 A;  1WIV A;  4WM2 A;  4WM1 A;  1JTP L;  3HUQ A;  1JKD A;  229L A;  3DN2 A;  3HWL A;  4B49 A;  4L6V 6;  1JR3 A;  2F4G A;  3CSZ A;  1CV4 A;  1QTK A;  2C8P A;  5FST A;  1LZA A;  4HL4 A;  3GPP A;  1GAY A;  1JB0 F;  5LMU M;  2D7H A;  5DYI A;  4ARQ B;  1SG9 A;  1IWY A;  5EXP A;  4B3T M;  1P56 A;  1SSW A;  1V7S A;  1CU6 A;  1L06 A;  3SB5 A;  1CVK A;  4AQY M;  168L A;  3HHX A;  4M0D A;  5KXL A;  4NHI A;  1OVJ A;  2F30 A;  2VQE M;  3CDO A;  2A7D A;  185L A;  3CF6 E;  1L56 A;  4H94 A;  1XGU C;  4OO9 A;  4LDE A;  2HUL A;  3GQ5 A;  1DGH B;  2G3Q A;  1GB3 A;  3TMW A;  1L69 A;  1UUZ C;  1DV0 A;  1BVK C;  237L A;  1FLQ A;  4EPF A;  3I01 M;  4REZ A;  2JY5 A;  4D9Z A;  6LZM A;  3GUN A;  4PDG A;  1LLH A;  2LXE A;  1HT2 E;  3K1J A;  1L10 A;  1L01 A;  3SBA A;  3JR4 A;  1BVX A;  3ZCB B;  1XGP C;  1IBK M;  7CAT A;  1C61 A;  4AGA A;  1H6U A;  1C6J A;  3AOE A;  1BB5 A;  1I4W A;  4GN3 A;  4NY5 A;  4I7T A;  2ANX A;  3SHG B;  4YEN A;  2F2N A;  3AJI B;  1QTC A;  4B4E A;  3AZ7 A;  4PJZ A;  1L72 A;  3Q8X A;  2RAZ X;  4CHT B;  4DQ7 A;  4RLM A;  5A2Q S;  249L A;  5L3H A;  4X66 M;  1C60 A;  3K8Z A;  1NV8 A;  4HJY A;  4P17 A;  5HMV A;  3D8L A;  1BB4 A;  1IN8 A;  1EE8 A;  1LI2 A;  3RUN A;  3NBX X;  3FRI A;  2DAE A;  4L41 A;  1G59 A;  4W56 A;  1TGU A;  2XGN A;  1J7K A;  2X0A A;  4UWV A;  5FHW A;  4J1B A;  4RLN A;  2Z6B A;  1LZC A;  1VG5 A;  3A3R X;  2FBD A;  4CGE A;  3GUL A;  3GUM A;  4QOS A;  244L A;  1GF8 A;  3CDR A;  1TH4 A;  2J7N A;  4HV2 A;  2GQF A;  2XSZ D;  4H9H A;  3A94 A;  1L93 A;  1QUH A;  1L08 A;  1JUG A;  3B7N A;  2Z4S A;  3V76 A;  1L96 A;  4ARQ A;  3HT6 A;  3KS8 A;  1TAY A;  1L94 A;  1WJ7 A;  4FWG A;  1KXY A;  4GC5 A;  3C7W A;  3L2A A;  2LVP C;  3A90 A;  3OE8 A;  2W1L A;  1IN7 A;  1XNR M;  1L22 A;  4BS7 A;  2Y8P A;  3K9O A;  1TCY A;  1QSW A;  3WPK A;  3KAM A;  3HBD A;  1L8Q A;  4BLC A;  182L A;  2R0I A;  4DR4 M;  114L A;  1OP9 B;  1N75 A;  2MEA A;  2XZF A;  4XAD A;  199L A;  2D91 A;  2LZ2 A;  3HY5 A;  3HT7 A;  1K28 A;  1HEQ A;  1DGH A;  2HED A;  5LA8 A;  5FCP A;  4YX7 C;  5K7O A;  1P2C C;  2F5S A;  4LJ8 A;  1XFP L;  2GV0 A;  4GEW A;  4WW0 A;  2AHM A;  5EP1 A;  2EQL A;  4LDL A;  2K47 A;  3FA0 A;  4PHI A;  4KLN A;  1HNZ M;  1DKJ A;  3GPX A;  1UID A;  1N77 A;  1NV9 A;  3FUW A;  1TLA A;  3AV0 A;  3SBJ A;  2A5Y B;  2BQL A;  4X62 M;  1XC8 A;  1L75 A;  2F47 A;  3HGI A;  2OPF A;  4I7O A;  1QZE A;  4DV2 M;  5IDD A;  1K3W A;  2BQH A;  140L A;  1LYS A;  2RBP A;  1IO5 A;  3HU2 A;  3T15 A;  2YBN A;  5DL9 A;  183L A;  3HKP A;  3HJS A;  4LCB A;  1QDT A;  4NSJ A;  166L A;  1JIY A;  1XGT C;  1FLU A;  2DEN A;  1GWD A;  1LSE A;  1HSX A;  1X37 A;  3G3B B;  3SMS A;  1L65 A;  3GLI B;  216L A;  2X49 A;  1GF5 A;  3GUK A;  3GO8 A;  1L2C A;  3GQ4 A;  1L59 A;  4FDY A;  1CKD A;  5C6J A;  1QSB A;  4G4Q A;  4CJ2 A;  2JWS A;  4S12 A;  129L A;  4W96 A;  5EQT A;  1HEN A;  3E9S A;  2BQD A;  3GXR A;  2NTG A;  4NGV A;  1IOC A;  1ZQ9 A;  1L41 A;  1CNS A;  4LYT A;  4TTD A;  205L A;  2IHL A;  5EJC A;  3OE9 A;  2L7I A;  2W1X A;  1G8P A;  2BAA A;  3L25 A;  1I56 A;  2L78 A;  1RJC B;  4DD2 A;  1D6P A;  1IVM A;  1AZF A;  1L24 A;  1C6K A;  1OUH A;  2F2Q A;  1C6I A;  3DNA A;  1N32 M;  2DWL A;  4XGI A;  1W5S A;  2B3T A;  1P37 A;  1L42 A;  1CV6 A;  4G4N A;  1CKG A;  3J6K A;  1OFI A;  1ZWN A;  4WLY A;  2R4E A;  1N36 M;  1HHL A;  3LYT A;  2JUJ A;  4QHS A;  1TH3 A;  3PNY A;  1HSW A;  5I4X A;  1QSA A;  1A2Y C;  1YUB A;  1TTE A;  1GFR A;  1LMT A;  104L A;  1IOT A;  223L A;  4AKH A;  1LZN A;  1T3P A;  3TXE A;  1ORY B;  1JJ1 A;  4GIT A;  1A5T A;  1JTN A;  1DZB X;  1JEF A;  3IWR A;  1QAN A;  3P66 A;  4IAT A;  3UK6 A;  3CT1 A;  4H92 A;  144L A;  3C3D A;  3J80 S;  1L48 A;  1EQ5 A;  1R4G A;  3WUN A;  1IY0 A;  4IBG A;  3AGH A;  1B7N A;  4WO6 A;  2B5Z A;  2KNV A;  1KYI A;  1PRB A;  1GXV 2;  4DD7 A;  1QSQ A;  2KXE A;  2CJL A;  3EML A;  4KL7 A;  186L A;  4F2L A;  4R71 A;  3HBE X;  5FTM A;  1Z5A A;  3F92 A;  1TR8 A;  3D8B A;  2DQJ Y;  2RBO A;  2YBJ A;  3L26 A;  3RZE A;  3WUL A;  2DZL A;  1LZS A;  4PDI A;  3M6A A;  1GFT A;  206L A;  2RBR A;  4QHT A;  4NRW A;  4ZPU A;  5ITQ A;  1OWY A;  3MK6 A;  5A3Z A;  2K6B A;  1VDD A;  1LZG A;  2MEH A;  1L27 A;  2UUB M;  3FI5 A;  2N35 A;  1LI6 A;  5LA5 A;  1L43 A;  4OWA A;  5JEN B;  4FCW A;  4MGZ E;  2C5R A;  5LYT A;  250L A;  5LVH A;  4IJF A;  1IWU A;  246L A;  257L A;  3GPU A;  2DWN A;  4D81 A;  2QBY A;  3TWM A;  2D6B A;  3IJU A;  4CJ6 A;  1GFG A;  261L A;  4KO8 A;  3A98 B;  1OUA A;  207L A;  6LYT A;  2I26 L;  4Z98 A;  154L A;  4CIS A;  3KS4 A;  2DHY A;  1LSB A;  2RKO A;  1L44 A;  4YEO A;  3DA1 A;  2YBL A;  1QS5 A;  2CWI A;  1NVM A;  1L2D A;  180L A;  1G0P A;  5B07 A;  1GPQ C;  2EIZ C;  1XB2 B;  4NGJ A;  5LIN A;  1UIF A;  3UJN A;  4I7L A;  1F4I A;  4Z8X A;  1T8F A;  5LVG A;  1IP6 A;  4OWH A;  1WQR A;  1F6R A;  4YXC A;  132L A;  1GB7 A;  1QUO A;  4CIZ A;  5GKN A;  1HNX M;  4RKU F;  1GE3 A;  3L27 A;  3EIH A;  5KPZ A;  3ZVQ A;  3HJQ A;  3AJN A;  5IT9 S;  1DGG A;  3HH3 A;  3U6M A;  2MEI A;  2W82 A;  5ITX A;  4II8 A;  1L83 A;  1LGW A;  3WPL A;  1E32 A;  4GKJ M;  2BQB A;  1REZ A;  3SFZ A;  4HJV A;  4FWD A;  155L A;  4YM8 A;  262L A;  2L2D A;  3GLI E;  1QT5 A;  1L73 A;  4H8X A;  2DWM A;  2VF7 A;  1DI4 A;  2KZU A;  3E21 A;  4BAD A;  1G07 A;  2F5N A;  4LYC A;  1JKA A;  1SLY A;  4OOO A;  1Q3C A;  1L0J A;  3SAV A;  3VWO A;  1CX6 A;  1OTR A;  1LJH A;  1FBI X;  2LHC A;  4BAF A;  1GE2 A;  1C6C A;  3FD9 A;  1C66 A;  1DQJ C;  4G4O A;  1C68 A;  2ERC A;  4DV5 M;  1FNN A;  3AOE C;  4GCE A;  2C99 A;  3HU3 A;  1L16 A;  213L A;  1SWY A;  1V33 A;  2R65 A;  4G49 A;  4DDA A;  1GF3 A;  1CUQ A;  1N4F A;  1VEK A;  1C10 A;  4YOP A;  1L26 A;  1QTD A;  1UIA A;  1OUE A;  4UWU A;  1C6N A;  1IWW A;  1EQE A;  3HH5 A;  2ZYC A;  109L A;  1F10 A;  2CV0 A;  4NWH A;  5LIO A;  4GBR B;  3ATN A;  1G7M C;  2P5T A;  1DYD A;  1KS3 A;  2Z4R A;  3M0E A;  3P4Z A;  2WAR A;  3GP1 A;  1QTE A;  5B59 A;  2LH0 A;  1LAA A;  2DAK A;  2QBY B;  1C69 A;  3G3W A;  4N1E I;  3RW8 A;  2LVQ D;  1PS5 A;  165L A;  1AT6 A;  2Z7J A;  2UXB M;  4ITQ A;  1L02 A;  1BWH A;  1DYE A;  5F81 A;  3UGJ A;  1R6B X;  2APL A;  3AZ5 A;  3B6L A;  3LYO A;  2DHR A;  1IWX A;  4YY3 M;  1LZ9 A;  4DD9 A;  3TPZ A;  1GBZ A;  4NHS A;  214L A;  2YSS C;  4WMG A;  4I81 A;  111L A;  5I54 A;  4B3M M;  255L A;  4NGO A;  113L A;  1JQJ C;  1VEG A;  2CUU A;  1TEW A;  4G9S A;  2JA2 A;  1GDW A;  110L A;  1L17 A;  2MEB A;  3ZVQ B;  1GB2 A;  2DKL A;  2HKJ A;  4DV4 M;  1BQL Y;  1C08 C;  3HFM Y;  153L A;  4S0W A;  3W0L B;  134L A;  1MX0 A;  3AGI A;  4DV1 M;  2QPA A;  1G71 A;  2JZ1 A;  3CF0 A;  1W08 A;  1SXJ B;  3TXB A;  1SXJ E;  4OW0 A;  4OWC A;  4LRS A;  3U61 B;  1L09 A;  2BLX A;  3WU7 A;  172L A;  1L74 A;  2QQ8 A;  2D4I A;  3TMX A;  1G7L C;  1REM A;  3J7B A;  2G4P A;  3C8S A;  2DZO B;  3U6D A;  4KT3 A;  3T1Y M;  217L A;  5D5C A;  1LGU A;  4WM5 A;  3BBZ A;  5ITU A;  1MN3 A;  122L A;  5FTN A;  1L54 A;  3U6C A;  2JY6 B;  4I7M A;  2H9J A;  1J09 A;  4JI6 M;  4XK8 F;  4L4U A;  1N78 A;  1QT3 A;  1NJF A;  4G4H A;  1AT5 A;  1DYC A;  1G3I A;  221L A;  3NBI A;  4PRQ A;  2KEB A;  4XEN A;  3HHW A;  3WUM A;  3B7Q A;  1GF7 A;  2RSC A;  2EKF A;  3AW7 A;  3OK0 A;  1LPY A;  4A7D A;  1B7O A;  190L A;  1IN4 A;  3KP1 E;  3W6B A;  3ULR A;  1NHW C;  1NBZ C;  4UN2 B;  1LJI A;  1YKY X;  1LZ4 A;  1J1O Y;  4KXI A;  1L15 A;  1GFK A;  259L A;  2L09 A;  1LWK A;  4WM4 A;  4XN6 A;  2LBC A;  4IBB A;  2I6Z A;  4AI6 A;  1V34 A;  3TXF A;  102L A;  1GB9 A;  3WXU A;  4MCK A;  3SYK A;  1GJT A;  1VDT A;  2Z8Y M;  2QNJ A;  1C7Y A;  1L32 A;  1JHL A;  3A8Z A;  258L A;  4X65 M;  1ZMU A;  2FFJ A;  4NC6 A;  1L04 A;  3C82 A;  3RU5 A;  4H9E A;  1Y8G A;  4PPO A;  1YL1 X;  2BWB A;  3D4S A;  4FCT A;  5E4P A;  5T3F A;  2Z2F A;  1PQM A;  2H9K A;  1GB5 A;  1E9R A;  1SX7 A;  3AZ6 A;  4Z41 A;  1JIS A;  4EKS A;  157L A;  2R6F A;  1CKC A;  4LGK A;  3AL0 C;  4H9A A;  1G7J C;  1KY0 A;  3CSQ A;  4DKL A;  5EXT A;  5ITT A;  5KKI A;  4QGZ A;  5E6J A;  4DDB A;  3GLF E;  4WL6 A;  4TUW A;  1I20 A;  3GLG E;  1MLC E;  4TX7 A;  1IP5 A;  3DMV A;  5EBH A;  3QNG A;  3R9X B;  1HER A;  4LGM A;  5M1Y A;  4ML7 A;  2JZ0 A;  1GFH A;  2G4N A;  2LVO C;  4TSB A;  1QT4 A;  1YIK A;  5KO3 A;  4NG1 A;  1YLA A;  1QUD A;  4YXA C;  3A45 A;  3LW5 F;  3QAK A;  3WVY A;  1EL1 A;  1LJJ A;  2ZAN A;  1WTH A;  4EPI A;  139L A;  3A46 A;  3HU1 A;  1DPW A;  1AKI A;  1BB3 A;  1CU0 A;  3AFH A;  2DXI A;  1PJJ A;  1L70 A;  1LHH A;  2BQJ A;  4WLT A;  1F6S A;  2VF8 A;  115L A;  1G1V A;  1JR3 D;  2OTY X;  1IP2 A;  1WXQ A;  260L A;  1NY5 A;  2R44 A;  5LVK A;  125L A;  1HC0 A;  4LY6 A;  2C8O A;  4IBI A;  1WGL A;  2XH9 A;  1N34 M;  4D82 A;  4RF1 A;  4NGZ A;  3J27 B;  1IWT A;  1R5L A;  2BJV A;  5APF A;  1BHZ A;  1GXX A;  1NHE A;  2KW0 A;  1QTV A;  4HP0 A;  1XNQ M;  3FTE A;  4DV3 M;  3FRH A;  4ETC A;  1EQ4 A;  3C80 A;  3A6B Y;  1SXJ A;  1QZM A;  1JTO L;  1B5V A;  3U6E A;  1VAT A;  2CDS A;  4GLV A;  1HEL A;  5FTK A;  2B6X A;  1NHG C;  3VK8 A;  4H9C A;  2G8L A;  3WW5 A;  2XFS A;  5F16 A;  3HBH A;  4G3O A;  6LYZ A;  1GAZ A;  3NY8 A;  1LSC A;  5J7C A;  1L58 A;  1B5Y A;  5DFL A;  1FLW A;  2UXD M;  4Z6Y A;  1LSY A;  2XZU A;  1L89 A;  1IY2 A;  3TWK A;  5KPR A;  1PQI A;  2DQF C;  4AXT A;  2ZAM A;  1L14 A;  1OAI A;  1K3X A;  1P3N A;  5EP3 A;  1XGR C;  1P7S A;  133L A;  3CGW A;  2KDL A;  1LJE A;  1IEE A;  1GF9 A;  5JI3 E;  1CJ9 A;  1YQV Y;  1YKX X;  1LHJ A;  5EP2 A;  1T3T A;  5EXS A;  2NTH A;  2B6Y A;  158L A;  3RE8 A;  3CTW B;  159L A;  1Z59 A;  1L0K A;  2V1C A;  181L A;  4IJE A;  4LT2 A;  236L A;  4LF6 M;  2LNH C;  2QEN A;  2EKS C;  2HEF A;  1LYG A;  1L47 A;  209L A;  3HX3 A;  1L39 A;  3N9E A;  4CFO A;  1WQP A;  4AQN A;  2LTU A;  4GCD A;  3B89 A;  210L A;  4JI1 M;  5E26 A;  2ZQ4 A;  1OUD A;  1LSM A;  226L A;  1L20 A;  4LF5 M;  4WO9 A;  1LSA A;  4IBD A;  3KOZ E;  4LZZ A;  4JI3 M;  1W5T A;  4NGY A;  2DQI Y;  2HTX A;  5FTJ A;  184L A;  4NXM M;  4NEB A;  4MR1 A;  4GN4 A;  4M9S A;  3KP0 E;  5KPT A;  1CUK A;  2Y0Q A;  3UON A;  2BQG A;  2YQZ A;  5KXT A;  4FWH A;  1YL0 X;  2HUK A;  1G0J A;  2DAG A;  4I7S A;  2EO2 A;  1UIB A;  1HNW M;  1GAB A;  1DYF A;  4MGY E;  4NHT A;  1CV3 A;  1GFE A;  220L A;  4B3S M;  3RGS A;  1LYE A;  2YNM D;  2LHM A;  4Z46 A;  4M0W A;  1WQO A;  3A3Q A;  4I7Q A;  2LWX A;  1NF5 A;  2PC2 A;  4G4C A;  2QZ4 A;  2C9O A;  1CUP A;  2E5L M;  1L84 A;  1QQY A;  2LHG A;  4AG6 A;  1LJG A;  2M5Z A;  2QHO B;  1YRO A;  2BLY A;  1VED A;  3A95 A;  4H1P A;  4GRI A;  188L A;  1LMO A;  1IC7 Y;  1DGB A;  1O23 A;  201L A;  4B4I A;  2L4F A;  4LJ5 A;  1AIP C;  1YAP A;  4OWE A;  1JKB A;  1OV5 A;  1HFZ A;  3THG A;  1EIJ A;  1TBY A;  3CB7 A;  2CRU A;  3KFU G;  4R3D A;  3A96 A;  5I4W A;  147L A;  1XJT A;  1EPY A;  1UBZ A;  2BQA A;  3C9P A;  1GB8 A;  3K2L A;  5BR8 M;  1R2Y A;  4HPE A;  3JAM S;  2V1U A;  1KW5 A;  4W57 A;  1C6Q A;  4ARM B;  3A93 A;  3PXG A;  1GFA A;  4GCB A;  3T38 A;  3U5Z A;  2RB2 X;  1XWI A;  4P16 A;  1QUT A;  1B7M A;  4NSG A;  3LVW A;  1IOR A;  5FEK A;  4U3X B;  3DMX A;  1D3M A;  4GN5 C;  4HV1 A;  3ZEK A;  4NHQ A;  3SC3 A;  2B72 A;  4M6D A;  1GBS A;  1P5C A;  3PNV A;  4K5Y A;  4I5S A;  1L86 A;  1FN5 A;  1DO0 A;  4NGK A;  1NNU C;  1L18 A;  1V92 A;  4B08 A;  1L87 A;  1G0K A;  5KXN A;  2EUC A;  3C7Y A;  1L88 A;  3J2P B;  3VDU A;  4DC4 A;  3GUO A;  2MEG A;  1QTZ A;  3U61 A;  232L A;  1B5Z A;  4AG5 A;  5KXS A;  4H8Z A;  1B7R A;  3FE0 A;  5LAG A;  3GLF A;  2O4W A;  3EO5 A;  2WSC F;  1LTM A;  1PZY A;  245L A;  4LT1 A;  1NHB A;  1C6F A;  1GBO A;  1JKC A;  3HTB A;  164L A;  4AZF A;  1WTN A;  2B74 A;  4NL4 H;  1WQN A;  2Z37 A;  1IOS A;  5IWA M;  4XJD A;  242L A;  2KA6 B;  146L A;  2RGO A;  1D0M A;  3U5Z B;  1D9W A;  1L33 A;  2OU9 A;  4LFA M;  1TDY A;  1LMC A;  1GFJ A;  2D7G A;  5IZ7 D;  1T6H A;  4NGL A;  4DQJ A;  3DMZ A;  1C6P A;  3WHK A;  1QUS A;  3CQL A;  1XEI A;  169L A;  4DYG A;  1REX A;  2ZBK B;  2CHG A;  3DN6 A;  1GEZ A;  3TXI A;  1PQK A;  3ATO A;  1OUJ A;  1GF4 A;  4DDC A;  1ZVH L;  3CT5 A;  2JP7 A;  3WL2 A;  3U6Q A;  4PCZ A;  194L A;  5HMJ A;  1ZUR A;  4IAS A;  1BB7 A;  1LHI A;  1LW9 A;  2K9D A;  4QNM A;  1LZ8 A;  4RW1 A;  1UIC A;  4KPM A;  1DGF A;  3GPY A;  2F5P A;  2VII A;  3DN3 A;  3R8F A;  1HML A;  1XXH E;  1L21 A;  1LHK A;  1D2W A;  2FH0 A;  2KZS A;  4WL7 A;  2O5R A;  3GUJ A;  3EMS A;  1L00 A;  3W6D A;  1DO2 A;  4NSI A;  2G5G X;  256L A;  4LFC M;  2IGC A;  4LDO A;  3H4J A;  4GC9 A;  1KXW A;  1LHL A;  4MGH A;  3HU8 A;  1C6D A;  4N9R A;  1IC4 Y;  4DT3 A;  1LJK A;  2H5X A;  4LJA A;  2D4J A;  1QVR A;  3I04 M;  2FNA A;  3FTD A;  160L A;  3G3X A;  3IG5 A;  3QY4 A;  5IHG A;  1L97 A;  3V2W A;  1HF4 A;  2H1R A;  3AGG G;  2RBN A;  4DR2 M;  4TUN A;  1J5E M;  1CTW A;  1LYI A;  4PK0 A;  1C6B A;  1VDP A;  1LZD A;  1ZVY B;  1C6L A;  2XTH A;  2DKV A;  4FJR A;  3ZH9 B;  4I0C A;  3AKZ A;  241L A;  3GQ3 A;  5KQD A;  212L A;  2D4K A;  1D6Q A;  3FUT A;  3G3A B;  3HDF A;  2AUB A;  3HHY A;  127L A;  4P2E A;  2CV1 A;  2ZIL A;  1SSY A;  4NIJ A;  3TMV A;  5DNY A;  1ZMV A;  3G3V A;  2Z39 A;  1LYD A;  3D3D A;  2DQC Y;  1D3F A;  5H37 D;  1CV1 A;  1IQP A;  3KXE C;  2DBT A;  5A3E A;  1D2N A;  1Z6T A;  1L31 A;  3K2R A;  1YAN A;  1LOZ A;  1L34 A;  1L37 A;  1IX0 A;  3F9L A;  2CUZ A;  2VQF M;  2EA0 A;  1OVK A;  3VDP A;  3LZT A;  1CU2 A;  1DI3 A;  3WU9 A;  4ZEE A;  4G4R A;  196L A;  1L1Z A;  3U6O A;  1YAQ A;  149L A;  8LYZ A;  197L A;  4H9I A;  3LN2 A;  1IN5 A;  1L12 A;  2HAK A;  1I1Z A;  4GMQ A;  1LSG A;  1CV5 A;  1BWI A;  2JY8 A;  1T97 A;  3W68 A;  1IXS A;  4DUZ M;  225L A;  1P2L A;  4RW2 A;  3E4R A;  4JI5 M;  1IP1 A;  3L28 A;  5IRE B;  1P46 A;  3J7A S;  3C81 A;  1E94 E;  3BKH A;  4X64 M;  2LVN C;  4TWS A;  1WQQ A;  2N5Z A;  4H9F A;  2WSE F;  3AOG A;  2F4V M;  1QT7 A;  3PVS A;  4HTN A;  3SP3 A;  3AB6 A;  1P3Q Q;  3QYB A;  2FS1 A;  3E46 A;  2DQD Y;  2HEB A;  1HNL A;  3WYH A;  5LMN M;  4M9X A;  3HTD A;  1XGQ C;  1CJ6 A;  5B06 A;  3RNX A;  3MJ5 A;  2CV2 A;  4OW1 A;  3K3T A;  1MJG M;  2VB1 A;  1LYF A;  1OQY A;  3GRU A;  3C58 A;  3SYL A;  4IBF A;  1GKI A;  2OE7 X;  3IEC A;  170L A;  2ZWB A;  2OQ4 A;  4N1C C;  2BQN A;  3ZQJ A;  1XHB A;  4RDS A;  1IXZ A;  2DQE Y;  1NDM C;  1NBY C;  5KXW A;  3SAU A;  1HFY A;  3TXH A;  2Z19 A;  2CE7 A;  4HTK A;  4IBK A;  1HEO A;  4PD2 A;  1VDL A;  4BBA A;  1UC0 A;  4DR3 M;  3FE3 A;  4C5F A;  5JI2 E;  1G41 A;  251L A;  4GCC A;  2UU9 M;  3IHP A;  1D0L A;  1I6S A;  4RF0 A;  4OVZ A;  1WVU A;  5B1G A;  1VAU A;  4IJ4 A;  1GF6 A;  2CEA A;  3UMM A;  1IWZ A;  1I94 M;  3TL4 X;  3KOY E;  1L61 A;  1OV7 A;  4ET9 A;  3WVX A;  1IOQ A;  4GLA A;  4WLD A;  3BXW A;  1N33 M;  3C83 A;  187L A;  1GDX A;  1LZR A;  1C43 A;  3LQR A;  1C67 A;  235L A;  3DFZ A;  3U6P A;  4MGK E;  3U60 B;  3FI7 A;  5F9X A;  4LJ9 A;  1GB0 A;  4L8R C;  3B9P A;  1C63 A;  2UUC M;  3SN6 R;  1HEW A;  1L67 A;  1KFV A;  4JI0 M;  1L46 A;  1GHL A;  2Q2E B;  1L64 A;  2OOB A;  219L A;  5LYM A;  2FE8 A;  5LVI A;  3LQQ A;  4NFV A;  1HFX A;  1ZAE A;  137L A;  4L15 A;  2KRU A;  3SHF A;  4GH9 A;  1C6A A;  234L A;  4JN6 A;  5LYZ A;  4I7K A;  5APC A;  4I7P A;  1LMA A;  1WGN A;  5L9J A;  1L98 A;  1L53 A;  1PGY A;  3FKE A;  2LYM A;  1L52 A;  4HJZ A;  2CGI A;  1K82 A;  5FEL A;  3QYE A;  1FLY A;  3VK7 A;  4L78 A;  3H4M A;  2J7O A;  2BNK A;  218L A;  2Q9E A;  1GBX A;  2YDG A;  4XJH A;  3TXK A;  2YR0 A;  3HU9 A;  2EKK A;  138L A;  1IP7 A;  1G0M A;  2BQC A;  4R0F A;  2G4Q A;  5DLA A;  1PQD A;  4W55 A;  2KHH A;  1C45 A;  5BPV A;  2BQK A;  3GUI A;  1Q02 A;  2MEF A;  3DN0 A;  2FYD A;  4Z3M A;  2XBS A;  195L A;  174L A;  4DR1 M;  4N5R A;  5DN5 A;  1B5W A;  3ZC7 B;  233L A;  3HJ8 A;  2RRU A;  1Q3B A;  1IWV A;  254L A;  1B5U A;  3F6Z A;  1XMO M;  1QUG A;  2RB1 X;  4GKK M;  5E9R A;  2YFQ A;  2Q0M X;  161L A;  2B7X A;  4LZM A;  3TXJ A;  1C65 A;  1F0W A;  1L80 A;  1LYZ A;  3T6P A;  5B1F A;  3TMU A;  4J7V A;  4FCV A;  3U6S A;  4JI4 M;  176L A;  1DKK A;  4LFP A;  1DXJ A;  3I51 A;  2JY7 A;  1S3S A;  211L A;  3A42 A;  3CDV A;  1L49 A;  2HU1 A;  4OVZ B;  1LJF A;  4BB9 A;  1B9O A;  3BOS A;  1LZ1 A;  1IBL M;  2BQM A;  3M18 B;  4X3B A;  1WTM A;  4AKG A;  4E3U A;  5FSW A;  1JR3 E;  3KOX E;  4WM6 A;  3WHL A;  2RBS A;  4GHA A;  1NSF A;  4K0K M;  1L63 A;  1GO5 A;  3RT5 X;  3B0O A;  3I4V A;  2MGW A;  3C7Z A;  4I7N A;  4DV7 M;  3A92 A;  3LYZ A;  3A34 A;  1JJ3 A;  1XMQ M;  1L28 A;  4LFX A;  231L A;  3C8Q A;  4W51 A;  2B6W A;  2UUA M;  1IM2 A;  3HT8 A;  3SMP A;  1L45 A;  5C1B A;  4ET8 A;  2QP9 X;  2B70 A;  4EOF A;  1GE4 A;  1D3J A;  1GL7 A;  1KIP C;  3GLG A;  1RFP A;  1G7H C;  2LC9 A;  2V6Z M;  2OTZ X;  2DVW B;  3KW6 A;  1GEV A;  4Q7J A;  1G0G A;  2VDB B;  1JWR A;  1L66 A;  4WOA A;  2ZAO A;  3N9C A;  1TDH A;  1LYJ A;  1L92 A;  1JPO A;  3DKE X;  3DN8 A;  1NNJ A;  3P65 A;  1LWG A;  5LXW A;  4XJF A;  4OX9 M;  4M4O A;  1LZ6 A;  5L3I A;  9LYZ A;  230L A;  5ITR A;  3WW6 A;  3B0K A;  1L68 A;  1LYY A;  2EJS A;  2B6T A;  1L62 A;  2XJW A;  3FAD A;  4MB7 A;  1ZMW A;  4W54 A;  1VEJ A;  1G4A E;  1PM5 A;  5I4Y A;  4W5W A;  1IR7 A;  3EXD A;  2R62 A;  1OJL A;  1H87 A;  4LZT A;  1L30 A;  4J0L A;  2MJ5 B;  1SWZ A;  1YAO A;  3U60 A;  4HTQ A;  4IBC A;  1IY1 A;  3SAW A;  1V7T A;  4XJI A;  1VDS A;  4O34 A;  1WR1 B;  4QDN A;  1LZY A;  2RB0 X;  2RH1 A;  1G0Q A;  1INU A;  240L A;  1DI5 A;  1IFY A;  1LJ3 A;  3FYD A;  3QE8 A;  3HHZ A;  3MGW A;  4NG8 A;  2YVB A;  1SXJ D;  4FW9 A;  1PJI A;  1L07 A;  248L A;  2HL7 A;  1TDZ A;  3K9P A;  1L05 A;  112L A;  3ILK A;  2BWE A;  1XXH B;  2R18 A;  2I7N A;  1HQY E;  1GJS A;  4R6C A;  1GBY A;  2QB0 B;  3W0F A;  4IIW A;  1KNI A;  1ZV1 A;  1L1T A;  3MHV C;  1KW7 A;  1WVV A;  1LKR A;  5ITY A;  1PQO A;  1QAO A;  2HEA A;  151L A;  1P64 A;  1LMP A;  2FBB A;  1L03 A;  108L A;  4XJB A;  2DAI A;  2RAY X;  5KQ8 A;  1OYU A;  4NSR A;  1FJG M;  1B7L A;  1FKQ A;  1P6Y A;  4N8Z A;  5KY1 A;  3CDT A;  175L A;  2LVA A;  1L2B A;  4B1A A;  1PJT A;  1KIR C;  3GLI A;  5KXR A;  1QTB A;  4LF8 M;  3KOW E;  1NQI A;  4DR7 M;  2DNA A;  1YIL A;  2R4J A;  4G6Z A;  1B7Q A;  4B7H A;  3LYM A;  1HQC A;  5I14 A;  1B2K A;  2HU3 A;  4GCF A;  1QDR A;  3RZ4 A;  1NMM A;  5HLL A;  4A3V B;  2BQE A;  1LHM A;  4LFB M;  1C6E A;  1L51 A;  2HEE A;  2H5Z A;  128L A;  4R7G A;  1D9U A;  2ZM6 M;  2UXC M;  1XSF A;  4IAP A;  2Z2E A;  2ZYP A;  4JI8 M;  2NWD X;  4LYB A;  2DAM A;  3SAR A;  3FUV A;  1GL6 A;  4NGW A;  1PJS A;  239L A;  1CKH A;  3LCU A;  3LMM A;  3SB9 A;  3V2Y A;  3JR5 A;  2MRO B;  7LZM A;  5KXM A;  1WQM A;  1L13 A;  135L A;  2ANV A;  3NYA A;  2O25 A;  1BWJ A;  1TH2 A;  3QAU A;  1OIZ A;  4WLX A;  3TXG A;  4JYA M;  4I7R A;  2MEC A;  2C96 A;  1NO1 A;  4DBG B;  1REY A;  1QQW A;  3VLF B;  4LT3 A;  1SXJ C;  4HPI A;  2CHQ A;  3VFD A;  1IY3 A;  2O7A A;  4EXM A;  1L71 A;  1IN6 A;  3TWL A;  2HHH M;  3IG8 A;  3HUA A;  2GNO A;  1LJ4 A;  4DR6 M;  2L6O A;  3W3E A;  1G0L A;  1CV0 A;  1KSF X;  1T8G A;  3LZM A;  1IP4 A;  4W53 A;  3T1H M;  1G1W A;  4CGY B;  123L A;  3GLH B;  171L A;  1QAQ A;  3K92 A; 
#chains in the Genus database with same CATH homology
 1PQJ A;  2ZIK A;  1JSE A;  1BGI A;  3F8V A;  2ZNX Y;  4NSH A;  3D9A C;  1XEK A;  1L38 A;  2Q9D A;  5C6L A;  5II3 A;  177L A;  1L90 A;  1P36 A;  4PGJ B;  1NDG C;  2OEA X;  4DD0 A;  5I53 A;  1YKZ X;  2ZNW Y;  1VDQ A;  4ZFP A;  1B7S A;  2OU8 A;  1L19 A;  1LZB A;  1P2R A;  247L A;  5B05 A;  5APD A;  1LPI A;  3GXK A;  3LZ2 A;  1T6V L;  4I7J A;  4UWN A;  2W1M A;  4ZIX A;  3C8R A;  1J1P Y;  1B5X A;  1UAC Y;  3GUP A;  4ETB A;  1GE1 A;  228L A;  198L A;  4H9B A;  3HH6 A;  3B72 A;  1C6T A;  3HTF A;  3HDE A;  2OE4 X;  3LHM A;  1C62 A;  1C6H A;  4ARM A;  120L A;  2LZT A;  1SX2 A;  1CX7 A;  2B6Z A;  1CKF A;  1CU5 A;  2ZQ3 A;  1OQM A;  1IP3 A;  4YF2 A;  5LZM A;  1LSZ A;  1OUF A;  2YBM A;  1GB6 A;  3HTG A;  3W6F A;  4EKR A;  1ZV5 L;  5KXX A;  1GE0 A;  107L A;  3NY9 A;  3P64 A;  1LMN A;  5AMY A;  5KJ9 A;  222L A;  2DQA A;  2Z38 A;  150L A;  1QS9 A;  1L57 A;  4J1A A;  148L E;  3AZ4 A;  2B75 A;  4MST A;  3ODU A;  1KIQ C;  2LCB A;  3SBB C;  3AW6 A;  1L79 A;  4E97 A;  1RE2 A;  2Z12 A;  3P68 A;  1C7P A;  1G7I C;  2MEE A;  1DYB A;  4QEQ A;  1HEP A;  1T8A A;  5APE A;  4H90 A;  1L36 A;  2LYO A;  4HSF A;  2XBR A;  3N9A A;  1XEJ A;  3JR6 A;  3BKV A;  1H6M A;  4ETA A;  3A67 Y;  3SB7 A;  3A6C Y;  4C3W A;  130L A;  252L A;  2HEC A;  1HEM A;  2B73 A;  1KXX A;  103L A;  1L23 A;  1LZ5 A;  2BPU A;  4ANR A;  4WG1 A;  145L A;  4H8Y A;  1L99 A;  1C6M A;  1GFU A;  1LJN A;  1OUC A;  243L A;  4ARL A;  2HUB A;  3L2X A;  1OWZ A;  1IR8 A;  1L35 A;  119L A;  5KXP A;  141L A;  5D5F A;  1YAM A;  1BB6 A;  178L A;  4W58 A;  4I8S A;  3WPJ A;  1FDL Y;  4EMN A;  1UCO A;  2XQO A;  1DYA A;  3WH1 A;  1UA6 Y;  1NWG A;  1LGX A;  3W6E A;  200L A;  2DQG Y;  2LZM A;  1QTH A;  143L A;  4ARJ A;  1D0K A;  1D3N A;  4ETD A;  4OWB A;  4DWX A;  2OU0 X;  1L11 A;  152L A;  1C64 A;  3WUA A;  4CFP A;  1J1X Y;  3IJV A;  1ZMY L;  191L A;  227L A;  4WG7 A;  1L60 A;  3OE6 A;  4DAJ A;  3OJP A;  4BAP A;  1LSN A;  5HNL A;  142L A;  4GRV A;  4PRU A;  1MEL L;  1L85 A;  1OVH A;  5ILC A;  1QT8 A;  1G06 A;  1L82 A;  1QIO A;  2MED A;  4H91 A;  1XJU A;  1UIG A;  4WM3 A;  1CJ7 A;  2HUM A;  4LYZ A;  1LSF A;  1IR9 A;  4YEM A;  1GBW A;  189L A;  1JIT A;  1VFB C;  1UIE A;  2BQF A;  3M3U A;  4DD3 A;  4NWE A;  4NHP A;  4W52 A;  131L A;  4EJ4 A;  7LYZ A;  4DD1 A;  4TSC A;  3OE0 A;  4B4J A;  3DN1 A;  1CU3 A;  3WXT A;  3WU8 A;  224L A;  5ILF A;  1LI3 A;  3HUK A;  4B0D A;  167L A;  1LSP A;  1XEP A;  3CSR A;  3A91 A;  126L A;  1LMQ A;  2QAR C;  4XJG A;  1OUI A;  1NKH A;  1L25 A;  1ALC A;  1B0D A;  1RI8 B;  1L77 A;  1RCM A;  3AYQ A;  2W1Y A;  1C6G A;  1LKS A;  1D2Y A;  5F9U A;  2BQO A;  3HH4 A;  3L64 A;  1ZYT A;  2LYZ A;  5HNC A;  2IFF Y;  2F32 A;  4NGI A;  1A4V A;  1KY1 A;  4G4B A;  1OUG A;  1C46 A;  4N0J A;  1OUB A;  4LYO A;  1JTT L;  5LVJ A;  1GD6 A;  5DN4 A;  4XYY A;  4W94 A;  2FYC A;  5KXO A;  5I5Q A;  1Z55 A;  3PBL A;  3W6A A;  1QT6 A;  2EPE A;  4ETE A;  1IC5 Y;  2OE9 X;  3J4G A;  5IEL A;  1L95 A;  1E8L A;  1LZE A;  5FDJ A;  3B0I A;  4PJ2 C;  208L A;  2A4T A;  1L29 A;  215L A;  1SQ2 L;  163L A;  2ZIJ A;  3EBA B;  2Z18 A;  1LZT A;  2F4A A;  1AM7 A;  1HMK A;  4LT0 A;  1L50 A;  2I25 L;  3CDQ A;  3VW7 A;  1L91 A;  5F14 A;  3SB8 A;  5KKJ A;  1IIZ A;  1JQU A;  1W6Z A;  4W59 A;  3WMK A;  2DQH Y;  2BQI A;  1L40 A;  5KXK A;  192L A;  3CT0 A;  1JJ0 A;  253L A;  5DM9 A;  3E3D A;  4DQ5 A;  1B7P A;  5HQ1 A;  1UIH A;  2O79 A;  4CHX A;  3DN4 A;  3W6C A;  1LYH A;  1L55 A;  3HT9 A;  1LCN A;  4EKQ A;  1JSF A;  5KXZ A;  1DYG A;  4EKP A;  2RBQ A;  3T36 A;  5C6I A;  2YBH A;  173L A;  1FKV A;  1L76 A;  1IY4 A;  4H93 A;  3SB6 A;  193L A;  1DPX A;  4OOT A;  4ARP A;  4QY9 A;  2YBI A;  1LSD A;  3T6U A;  5KXY A;  162L A;  238L A;  4DJH A;  1CJ8 A;  3PDS A;  1GFV A;  5LAF A;  1B6I A;  1JTM A;  3TXD A;  118L A;  1LYO A;  4LYM A;  156L A;  1L81 A;  2A7F A;  1GF0 A;  4WM1 A;  4WM2 A;  1JTP L;  3HUQ A;  1JKD A;  229L A;  3DN2 A;  3HWL A;  4B49 A;  2F4G A;  3CSZ A;  1CV4 A;  1QTK A;  2C8P A;  5FST A;  1LZA A;  1GAY A;  4ARQ B;  1IWY A;  1P56 A;  1SSW A;  1V7S A;  1CU6 A;  1L06 A;  3SB5 A;  1CVK A;  168L A;  5KXL A;  4NHI A;  1OVJ A;  2F30 A;  3CDO A;  2A7D A;  185L A;  1L56 A;  4H94 A;  1XGU C;  4OO9 A;  4LDE A;  2HUL A;  3TMW A;  1GB3 A;  1L69 A;  1UUZ C;  1BVK C;  237L A;  1FLQ A;  4EPF A;  4D9Z A;  6LZM A;  3GUN A;  1LLH A;  1L10 A;  1L01 A;  3SBA A;  1BVX A;  1XGP C;  1C61 A;  4AGA A;  1C6J A;  1BB5 A;  4GN3 A;  4NY5 A;  4I7T A;  2ANX A;  4YEN A;  2F2N A;  1QTC A;  4B4E A;  3AZ7 A;  4PJZ A;  1L72 A;  2RAZ X;  4DQ7 A;  4RLM A;  249L A;  5L3H A;  1C60 A;  4HJY A;  5HMV A;  1BB4 A;  1LI2 A;  3RUN A;  4L41 A;  4W56 A;  2X0A A;  4UWV A;  5FHW A;  4J1B A;  4RLN A;  2Z6B A;  1LZC A;  3A3R X;  2FBD A;  4CGE A;  3GUL A;  3GUM A;  244L A;  1GF8 A;  3CDR A;  4HV2 A;  4H9H A;  3A94 A;  1L93 A;  1QUH A;  1L08 A;  1JUG A;  1L96 A;  4ARQ A;  3HT6 A;  1TAY A;  1L94 A;  1KXY A;  3C7W A;  3A90 A;  3OE8 A;  2W1L A;  1L22 A;  4BS7 A;  2Y8P A;  1TCY A;  1QSW A;  3WPK A;  3KAM A;  3HBD A;  182L A;  114L A;  1OP9 B;  2MEA A;  4XAD A;  199L A;  2D91 A;  2LZ2 A;  3HT7 A;  1K28 A;  1HEQ A;  2HED A;  5LA8 A;  5FCP A;  4YX7 C;  5K7O A;  1P2C C;  1XFP L;  2GV0 A;  2EQL A;  4LDL A;  3FA0 A;  4PHI A;  1DKJ A;  1UID A;  1TLA A;  2BQL A;  2F47 A;  1L75 A;  4I7O A;  5IDD A;  2BQH A;  140L A;  1LYS A;  2RBP A;  1IO5 A;  2YBN A;  5DL9 A;  183L A;  1QDT A;  4NSJ A;  166L A;  1JIY A;  1XGT C;  1FLU A;  1GWD A;  1LSE A;  1HSX A;  3G3B B;  1L65 A;  216L A;  1GF5 A;  3GUK A;  1L59 A;  4FDY A;  1CKD A;  5C6J A;  1QSB A;  4CJ2 A;  129L A;  4W96 A;  1HEN A;  2BQD A;  3GXR A;  2NTG A;  4NGV A;  1IOC A;  1L41 A;  4LYT A;  1CNS A;  4TTD A;  205L A;  2IHL A;  3OE9 A;  2W1X A;  2BAA A;  1I56 A;  2L78 A;  1RJC B;  4DD2 A;  1D6P A;  1IVM A;  1AZF A;  1L24 A;  1C6K A;  1OUH A;  2F2Q A;  1C6I A;  3DNA A;  1P37 A;  1L42 A;  1CV6 A;  1CKG A;  3J6K A;  1ZWN A;  4WLY A;  1HHL A;  3LYT A;  1HSW A;  5I4X A;  1QSA A;  1A2Y C;  1GFR A;  1LMT A;  104L A;  1IOT A;  223L A;  1LZN A;  1T3P A;  3TXE A;  1JJ1 A;  1JTN A;  1DZB X;  1JEF A;  3IWR A;  4IAT A;  3P66 A;  3CT1 A;  4H92 A;  144L A;  1L48 A;  1EQ5 A;  3WUN A;  3AGH A;  1B7N A;  4WO6 A;  2B5Z A;  1GXV 2;  4DD7 A;  1QSQ A;  2CJL A;  3EML A;  4KL7 A;  186L A;  3HBE X;  2DQJ Y;  2RBO A;  2YBJ A;  3RZE A;  3WUL A;  1LZS A;  1GFT A;  206L A;  2RBR A;  4ZPU A;  1OWY A;  5A3Z A;  1LZG A;  2MEH A;  1L27 A;  3FI5 A;  1LI6 A;  5LA5 A;  1L43 A;  4OWA A;  5JEN B;  5LYT A;  250L A;  5LVH A;  1IWU A;  246L A;  257L A;  3IJU A;  2D6B A;  1GFG A;  261L A;  1OUA A;  207L A;  6LYT A;  2I26 L;  4Z98 A;  154L A;  1LSB A;  1L44 A;  4YEO A;  2YBL A;  1QS5 A;  2CWI A;  180L A;  1G0P A;  5B07 A;  1GPQ C;  2EIZ C;  4NGJ A;  5LIN A;  1UIF A;  4I7L A;  1T8F A;  5LVG A;  1IP6 A;  4OWH A;  1WQR A;  1F6R A;  4YXC A;  132L A;  1GB7 A;  1QUO A;  1GE3 A;  3ZVQ A;  3AJN A;  3HH3 A;  2MEI A;  4II8 A;  1L83 A;  1LGW A;  3WPL A;  2BQB A;  1REZ A;  4HJV A;  155L A;  4YM8 A;  262L A;  1QT5 A;  1L73 A;  4H8X A;  1DI4 A;  4BAD A;  1G07 A;  4LYC A;  1JKA A;  1SLY A;  4OOO A;  1L0J A;  3VWO A;  1CX6 A;  1LJH A;  1FBI X;  4BAF A;  1GE2 A;  1C6C A;  1C66 A;  1DQJ C;  1C68 A;  4GCE A;  1L16 A;  213L A;  1SWY A;  4DDA A;  4G49 A;  1GF3 A;  1CUQ A;  1N4F A;  1C10 A;  4YOP A;  1L26 A;  1QTD A;  1UIA A;  1OUE A;  4UWU A;  1C6N A;  1IWW A;  1EQE A;  3HH5 A;  2ZYC A;  109L A;  1F10 A;  4NWH A;  5LIO A;  4GBR B;  3ATN A;  1G7M C;  1DYD A;  1KS3 A;  3P4Z A;  2WAR A;  1QTE A;  5B59 A;  1LAA A;  3G3W A;  1C69 A;  4N1E I;  3RW8 A;  1PS5 A;  165L A;  1AT6 A;  1L02 A;  1BWH A;  1DYE A;  5F81 A;  3AZ5 A;  3B6L A;  3LYO A;  1IWX A;  1LZ9 A;  4DD9 A;  1GBZ A;  4NHS A;  214L A;  2YSS C;  4WMG A;  5I54 A;  111L A;  4NGO A;  255L A;  113L A;  2CUU A;  1TEW A;  4G9S A;  1GDW A;  110L A;  1L17 A;  2MEB A;  3ZVQ B;  1GB2 A;  1BQL Y;  1C08 C;  3HFM Y;  153L A;  4S0W A;  134L A;  3AGI A;  1W08 A;  3TXB A;  4OWC A;  1L09 A;  2BLX A;  3WU7 A;  172L A;  1L74 A;  2D4I A;  3TMX A;  1G7L C;  1REM A;  3C8S A;  2G4P A;  4KT3 A;  217L A;  5D5C A;  1LGU A;  4WM5 A;  122L A;  1L54 A;  4I7M A;  2H9J A;  1QT3 A;  4G4H A;  1AT5 A;  1DYC A;  221L A;  4PRQ A;  4XEN A;  3WUM A;  1GF7 A;  2RSC A;  3AW7 A;  4A7D A;  3OK0 A;  1LPY A;  1B7O A;  190L A;  3W6B A;  3ULR A;  1NBZ C;  1LJI A;  1YKY X;  1LZ4 A;  1J1O Y;  4KXI A;  1L15 A;  1GFK A;  259L A;  1LWK A;  4WM4 A;  4XN6 A;  2I6Z A;  3TXF A;  102L A;  1GB9 A;  3WXU A;  4MCK A;  1VDT A;  1L32 A;  1JHL A;  3A8Z A;  258L A;  1L04 A;  3C82 A;  3RU5 A;  4H9E A;  4PPO A;  1YL1 X;  3D4S A;  5E4P A;  5T3F A;  2Z2F A;  1PQM A;  2H9K A;  1GB5 A;  1SX7 A;  3AZ6 A;  4Z41 A;  1JIS A;  4EKS A;  157L A;  4LGK A;  1CKC A;  4H9A A;  1G7J C;  1KY0 A;  3CSQ A;  4DKL A;  5KKI A;  4QGZ A;  4DDB A;  4WL6 A;  1I20 A;  1MLC E;  4TX7 A;  1IP5 A;  3DMV A;  5EBH A;  3QNG A;  1HER A;  5M1Y A;  4ML7 A;  1GFH A;  2G4N A;  4TSB A;  1QT4 A;  1YIK A;  4NG1 A;  1QUD A;  4YXA C;  3WVY A;  3QAK A;  1EL1 A;  1LJJ A;  1WTH A;  4EPI A;  139L A;  1DPW A;  1AKI A;  1BB3 A;  1CU0 A;  1L70 A;  1LHH A;  2BQJ A;  4WLT A;  1F6S A;  115L A;  1G1V A;  2OTY X;  1IP2 A;  260L A;  5LVK A;  125L A;  1HC0 A;  2C8O A;  4NGZ A;  1IWT A;  5APF A;  1BHZ A;  1GXX A;  1NHE A;  1QTV A;  4HP0 A;  4ETC A;  1EQ4 A;  3C80 A;  3A6B Y;  1VAT A;  1JTO L;  1B5V A;  4GLV A;  2CDS A;  1HEL A;  2B6X A;  4H9C A;  3WW5 A;  5F16 A;  3HBH A;  6LYZ A;  3NY8 A;  1GAZ A;  1LSC A;  5J7C A;  1L58 A;  1B5Y A;  1FLW A;  1LSY A;  1L89 A;  1PQI A;  2DQF C;  4AXT A;  1L14 A;  1P3N A;  1XGR C;  1P7S A;  133L A;  1LJE A;  1IEE A;  1GF9 A;  1CJ9 A;  1YQV Y;  1YKX X;  1LHJ A;  2NTH A;  2B6Y A;  158L A;  159L A;  1L0K A;  181L A;  4LT2 A;  236L A;  2EKS C;  2HEF A;  1LYG A;  1L47 A;  209L A;  1L39 A;  3N9E A;  4CFO A;  1WQP A;  4AQN A;  4GCD A;  210L A;  2ZQ4 A;  1OUD A;  1LSM A;  226L A;  1L20 A;  4WO9 A;  1LSA A;  4NGY A;  2DQI Y;  2HTX A;  184L A;  4NEB A;  4MR1 A;  4GN4 A;  3UON A;  2BQG A;  5KXT A;  1YL0 X;  2HUK A;  1G0J A;  4I7S A;  1UIB A;  1DYF A;  4NHT A;  1CV3 A;  1GFE A;  220L A;  1LYE A;  2LHM A;  4Z46 A;  1WQO A;  3A3Q A;  4I7Q A;  1NF5 A;  2PC2 A;  4G4C A;  1CUP A;  1L84 A;  1QQY A;  1LJG A;  1YRO A;  2BLY A;  1VED A;  3A95 A;  4H1P A;  188L A;  1LMO A;  1IC7 Y;  1O23 A;  201L A;  4B4I A;  1YAP A;  4OWE A;  1JKB A;  1OV5 A;  1HFZ A;  1TBY A;  3CB7 A;  5I4W A;  3A96 A;  147L A;  1XJT A;  1EPY A;  1UBZ A;  2BQA A;  1GB8 A;  4HPE A;  1KW5 A;  4W57 A;  1C6Q A;  4ARM B;  3A93 A;  1GFA A;  4GCB A;  2RB2 X;  1QUT A;  1B7M A;  4NSG A;  1IOR A;  5FEK A;  4U3X B;  3DMX A;  1D3M A;  4GN5 C;  4HV1 A;  3ZEK A;  4NHQ A;  2B72 A;  4M6D A;  1GBS A;  1P5C A;  4K5Y A;  1L86 A;  1FN5 A;  4NGK A;  1L18 A;  1L87 A;  1G0K A;  5KXN A;  3C7Y A;  1L88 A;  4DC4 A;  3GUO A;  2MEG A;  1QTZ A;  232L A;  1B5Z A;  5KXS A;  4H8Z A;  1B7R A;  3FE0 A;  5LAG A;  2O4W A;  3EO5 A;  1LTM A;  1PZY A;  245L A;  4LT1 A;  1NHB A;  1C6F A;  1GBO A;  1JKC A;  3HTB A;  164L A;  1WTN A;  2B74 A;  1WQN A;  2Z37 A;  1IOS A;  4XJD A;  242L A;  146L A;  1D0M A;  1D9W A;  2OU9 A;  1L33 A;  1TDY A;  1LMC A;  1GFJ A;  1T6H A;  4NGL A;  4DQJ A;  3DMZ A;  1C6P A;  1QUS A;  3CQL A;  1XEI A;  169L A;  4DYG A;  1REX A;  3DN6 A;  1GEZ A;  3TXI A;  1PQK A;  3ATO A;  1OUJ A;  1GF4 A;  4DDC A;  1ZVH L;  3CT5 A;  3WL2 A;  194L A;  5HMJ A;  1ZUR A;  4IAS A;  1BB7 A;  1LHI A;  1LW9 A;  1LZ8 A;  4RW1 A;  1UIC A;  4KPM A;  3DN3 A;  1HML A;  1L21 A;  1LHK A;  1D2W A;  4WL7 A;  3GUJ A;  3EMS A;  1L00 A;  3W6D A;  4NSI A;  256L A;  2IGC A;  4LDO A;  3HU8 A;  1KXW A;  1LHL A;  1C6D A;  4N9R A;  1IC4 Y;  4DT3 A;  1LJK A;  2D4J A;  160L A;  3G3X A;  3QY4 A;  5IHG A;  1L97 A;  3V2W A;  1HF4 A;  3AGG G;  2RBN A;  4TUN A;  1CTW A;  1LYI A;  4PK0 A;  1VDP A;  1C6B A;  1LZD A;  1ZVY B;  1C6L A;  2XTH A;  2DKV A;  4FJR A;  4I0C A;  241L A;  212L A;  2D4K A;  1D6Q A;  3G3A B;  3HDF A;  2AUB A;  127L A;  4P2E A;  2ZIL A;  1SSY A;  4NIJ A;  3TMV A;  3G3V A;  2Z39 A;  1LYD A;  3D3D A;  2DQC Y;  1D3F A;  1CV1 A;  2DBT A;  5A3E A;  1L31 A;  3K2R A;  1YAN A;  1LOZ A;  1L34 A;  1L37 A;  1IX0 A;  3F9L A;  1OVK A;  3LZT A;  1CU2 A;  1DI3 A;  3WU9 A;  4ZEE A;  196L A;  1YAQ A;  149L A;  8LYZ A;  197L A;  4H9I A;  3LN2 A;  1L12 A;  1I1Z A;  1LSG A;  1CV5 A;  1BWI A;  1T97 A;  225L A;  1P2L A;  4RW2 A;  1IP1 A;  1P46 A;  3C81 A;  3BKH A;  4TWS A;  1WQQ A;  2N5Z A;  4H9F A;  4HTN A;  1QT7 A;  3SP3 A;  3AB6 A;  2DQD Y;  2HEB A;  1HNL A;  3WYH A;  3HTD A;  1XGQ C;  1CJ6 A;  5B06 A;  3RNX A;  4OW1 A;  3K3T A;  2VB1 A;  1LYF A;  2OE7 X;  170L A;  2ZWB A;  4N1C C;  2BQN A;  4RDS A;  2DQE Y;  1NDM C;  1NBY C;  5KXW A;  1HFY A;  3TXH A;  2Z19 A;  4HTK A;  1HEO A;  1UC0 A;  4C5F A;  251L A;  4GCC A;  1D0L A;  1I6S A;  1WVU A;  5B1G A;  1VAU A;  4IJ4 A;  1GF6 A;  1IWZ A;  1L61 A;  1OV7 A;  4ET9 A;  3WVX A;  1IOQ A;  4GLA A;  4WLD A;  3C83 A;  187L A;  1GDX A;  1LZR A;  1C43 A;  1C67 A;  235L A;  5F9X A;  3FI7 A;  1GB0 A;  1C63 A;  3SN6 R;  1HEW A;  1L67 A;  1L46 A;  1GHL A;  1L64 A;  219L A;  5LYM A;  5LVI A;  4NFV A;  1HFX A;  137L A;  1C6A A;  234L A;  5LYZ A;  4I7K A;  5APC A;  4I7P A;  1LMA A;  5L9J A;  1L98 A;  1L53 A;  2LYM A;  1L52 A;  4HJZ A;  2CGI A;  5FEL A;  1FLY A;  218L A;  2Q9E A;  1GBX A;  2YDG A;  4XJH A;  3TXK A;  3HU9 A;  1G0M A;  138L A;  4R0F A;  1IP7 A;  2BQC A;  2G4Q A;  5DLA A;  1PQD A;  4W55 A;  1C45 A;  2BQK A;  3GUI A;  2MEF A;  3DN0 A;  2FYD A;  4Z3M A;  2XBS A;  195L A;  174L A;  4N5R A;  5DN5 A;  1B5W A;  233L A;  1IWV A;  254L A;  1B5U A;  3F6Z A;  1QUG A;  2RB1 X;  5E9R A;  2Q0M X;  161L A;  2B7X A;  4LZM A;  3TXJ A;  1C65 A;  1F0W A;  1L80 A;  1LYZ A;  5B1F A;  3TMU A;  4J7V A;  176L A;  1DKK A;  4LFP A;  1DXJ A;  211L A;  3CDV A;  1L49 A;  2HU1 A;  1LJF A;  1B9O A;  2BQM A;  1LZ1 A;  3M18 B;  4X3B A;  1WTM A;  4E3U A;  4WM6 A;  2RBS A;  1L63 A;  3RT5 X;  3B0O A;  3C7Z A;  4I7N A;  3A92 A;  3LYZ A;  3A34 A;  1JJ3 A;  1L28 A;  4LFX A;  231L A;  3C8Q A;  4W51 A;  2B6W A;  3HT8 A;  1L45 A;  4ET8 A;  2B70 A;  4EOF A;  1GE4 A;  1D3J A;  1KIP C;  1RFP A;  2LC9 A;  1G7H C;  2OTZ X;  1GEV A;  1G0G A;  1JWR A;  1L66 A;  4WOA A;  3N9C A;  1LYJ A;  1L92 A;  1JPO A;  3DKE X;  3DN8 A;  3P65 A;  1LWG A;  5LXW A;  4XJF A;  4M4O A;  1LZ6 A;  5L3I A;  9LYZ A;  230L A;  3WW6 A;  3B0K A;  1L68 A;  1LYY A;  2B6T A;  1L62 A;  2XJW A;  3FAD A;  4W54 A;  5I4Y A;  1IR7 A;  3EXD A;  1H87 A;  4LZT A;  1L30 A;  4J0L A;  1SWZ A;  1YAO A;  4HTQ A;  1V7T A;  4XJI A;  1VDS A;  4O34 A;  4QDN A;  1LZY A;  2RB0 X;  2RH1 A;  1G0Q A;  1INU A;  240L A;  1DI5 A;  1LJ3 A;  3QE8 A;  3MGW A;  4NG8 A;  2YVB A;  1L07 A;  248L A;  1L05 A;  112L A;  4R6C A;  1GBY A;  2QB0 B;  1KNI A;  1KW7 A;  1WVV A;  1LKR A;  1PQO A;  2HEA A;  151L A;  1P64 A;  1LMP A;  2FBB A;  1L03 A;  108L A;  4XJB A;  2RAY X;  1OYU A;  1B7L A;  1P6Y A;  1FKQ A;  4N8Z A;  5KY1 A;  3CDT A;  175L A;  4B1A A;  1KIR C;  5KXR A;  1QTB A;  1NQI A;  1YIL A;  1B7Q A;  3LYM A;  5I14 A;  1B2K A;  2HU3 A;  4GCF A;  1QDR A;  3RZ4 A;  1NMM A;  5HLL A;  2BQE A;  1LHM A;  1C6E A;  1L51 A;  2HEE A;  2H5Z A;  128L A;  1D9U A;  1XSF A;  4IAP A;  2Z2E A;  2ZYP A;  4LYB A;  2NWD X;  4NGW A;  239L A;  1CKH A;  3SB9 A;  3V2Y A;  7LZM A;  5KXM A;  1WQM A;  3NYA A;  135L A;  1L13 A;  2ANV A;  1BWJ A;  4WLX A;  3TXG A;  4I7R A;  2MEC A;  1REY A;  4LT3 A;  4HPI A;  1IY3 A;  2O7A A;  4EXM A;  1L71 A;  3HUA A;  1LJ4 A;  3W3E A;  1G0L A;  1CV0 A;  1T8G A;  3LZM A;  1IP4 A;  4W53 A;  1G1W A;  123L A;  171L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...