1LTMA

Accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
320
structure length
309
Chain Sequence
EPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 36 KDA SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Accelerated X-ray structure elucidation of a 36 kDa muramidase/transglycosylase using wARP.
pubmed rcsb
source organism Escherichia coli
molecule tags Glycosyltransferase
total genus 111
structure length 309
sequence length 320
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1ltmA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1ltmA02
4NGKA 1LZSA 1LKRA 2F4AA 1IP3A 3W6AA 1IOCA 1B5UA 1JKAA 4AXTA 2BQGA 4FJRA 1HEPA 5LIOA 4B4IA 5ILCA 5F81A 4CJ2A 1IOSA 4I0CA 1CJ8A 2Z12A 3LYMA 4I8SA 4J7VA 4QEQA 2LZTA 4LYBA 3HBHA 2A7FA 2BQIA 2GV0A 1LZ9A 3AYQA 1LJHA 1PZYA 3LN2A 4MSTA 208LA 4PGJB 3TXFA 3QE8A 1LHHA 3WL2A 4WL6A 4H9IA 2BQBA 1MLCE 1WVVA 2MECA 4B0DA 2YBHA 3P64A 3WMKA 1IWUA 5FSTA 4G49A 1C10A 1HHLA 2ZQ3A 3AZ6A 1VDPA 2B5ZA 4B49A 4NHTA 1LKSA 2FBDA 3N9EA 2Z39A 4DDBA 5LA8A 4FDYA 1D0KA 4J1BA 1V7TA 2YBLA 3M3UA 1CJ9A 4WO9A 2CDSA 1LJJA 4KL7A 3A94A 4KXIA 4LYCA 4ZFPA 2IFFY 4LGKA 3G3BB 134LA 1GF8A 1VDTA 5LINA 4RDSA 4NFVA 1GWDA 1HEWA 1LMAA 1OUDA 2Z37A 2HEDA 4RLNA 1JKCA 4YM8A 1B7OA 1DKJA 3P65A 1FN5A 3W6DA 2HEAA 1LHLA 4HSFA 4WM4A 1B7NA 4O34A 1DXJA 5HMVA 1JIYA 1GF9A 1BWJA 4NGWA 2Z2EA 5F9UA 1GXXA 1YANA 4H9FA 1NBZC 2LYMA 1LZCA 3N9AA 3W3EA 5KXLA 2DQIY 2C8PA 4H1PA 1CJ6A 3AW6A 1GF7A 1JJ1A 1I1ZA 1B7RA 1GBWA 2RSCA 2DQGY 1LHJA 2BQNA 3G3AB 4M6DA 3TXGA 3WVXA 4PRQA 1REZA 1BB3A 1GFJA 4DD9A 4H9HA 1HENA 5FCPA 3LZTA 3TMXA 1FLUA 5IHGA 5FELA 4BAFA 4XJBA 5L9JA 1LMTA 1IP2A 1QDTA 3BKHA 1TBYA 3TXBA 4R6CA 4WM3A 3ULRA 5KXTA 1MELL 4J0LA 4N8ZA 3WUMA 1GF6A 1DKKA 1FLQA 2DQEY 3AGHA 1LSCA 3HFMY 4HTNA 4NWHA 4OWEA 4WM5A 5I4YA 4ETDA 4LZTA 1GBSA 1IOTA 1GB3A 3AW7A 4PRUA 6LYTA 1LSFA 2BLXA 5FDJA 2HEFA 2LYOA 1KIQC 3WUNA 1C45A 4NSJA 1LJFA 5AMYA 5K7OA 2LHMA 1E8LA 4GCEA 1HSXA 1GE4A 4IATA 5LVIA 3CSQA 3IJUA 1HEQA 1OUBA 133LA 1RJCB 2MEHA 1D6QA 3A3RX 5EBHA 5B07A 1XSFA 1G7LC 4N1CC 4KT3A 3WH1A 5LYTA 1IC4Y 4NHSA 5I4WA 2HU1A 2BQJA 4DD2A 1IC5Y 5LVHA 3GXRA 4NG1A 5I4XA 4B4JA 3CT5A 4G9SA 1LHIA 1LMPA 4GN4A 5LVGA 5M1YA 1B9OA 5APFA 1ALCA 4H90A 1W6ZA 5APDA 3A3QA 5HNLA 2HUBA 1YQVY 1ZMYL 5I54A 1VFBC 1IP4A 1C43A 1LSGA 4NHPA 4RW2A 1RFPA 4AGAA 194LA 1NDGC 1QTEA 1REYA 3WVYA 5KKJA 2G4PA 2A7DA 1YILA 3B0IA 5L3IA 2HEBA 2W1MA 2HTXA 1JTTL 1LOZA 4H94A 1G7MC 4LT3A 1UBZA 3IWRA 5KXPA 2BQOA 3BKVA 1UIGA 1QSWA 4XJDA 9LYZA 1XGQC 1LZYA 3J6KA 1RI8B 5LAGA 4G4BA 3TXJA 4TTDA 5C6IA 1IX0A 4NEBA 1GD6A 2I25L 2FYCA 4TSBA 3EXDA 1JWRA 5IDDA 4EOFA 1GFKA 1GAZA 1UUZC 4DT3A 1GFVA 4NSHA 4LYZA 1GB8A 3OJPA 1W08A 4NGVA 4GLAA 3WUAA 1IY4A 1UIFA 2X0AA 1LZRA 1B7LA 2W1XA 4HV2A 3E3DA 1C7PA 2H5ZA 1B7PA 1Z55A 1GFAA 4H93A 4DYGA 5LA5A 1G7IC 1LJIA 3J4GA 3AGIA 3P4ZA 4EMNA 1LYOA 1BWHA 1JTOL 4UWNA 4UWUA 2BQFA 1LJ3A 1XEKA 1XEIA 2ZYCA 4XENA 4WMGA 4XYYA 2BQHA 1LZ8A 4GLVA 1EQEA 1QIOA 3TMUA 1F0WA 4W96A 1IR9A 1ZV5L 2MEBA 1T3PA 1XGRC 1BHZA 3LHMA 3D9AC 4WM6A 4DWXA 1OUJA 3D3DA 5I53A 4WOAA 1RE2A 1HFXA 1GAYA 4HTKA 2F30A 4U3XB 1JISA 1NHEA 1YKZX 1V7SA 4RW1A 2DQDY 1YAQA 2IHLA 4HJYA 1B5YA 1NBYC 4Z3MA 4Z41A 2D4IA 4B1AA 3P68A 154LA 1C46A 1JTPL 3W6FA 1LZ5A 1IC7Y 1BB7A 3ZVQB 1JSFA 4NGLA 1FKQA 4XJHA 1OUAA 1GB6A 5E4PA 5DL9A 2BQCA 1OUEA 1FBIX 1LHMA 1JUGA 4C5FA 5JENB 1BVXA 3M18B 4NSIA 1QQYA 2XJWA 4WM1A 3ATOA 3WU7A 1DQJC 3TXEA 3A8ZA 4HJVA 1EQ5A 3RZ4A 2ZYPA 5D5CA 4BADA 1LSBA 5LAFA 4ET9A 132LA 4OWCA 5C6JA 1LSZA 2MEDA 5B05A 4LYOA 4XJFA 3P66A 1AM7A 1JJ3A 1LHKA 1D0LA 1G7JC 4BAPA 1LZDA 1LZBA 2H9KA 1CKHA 1VEDA 5D5FA 4N1EI 3CSZA 1H87A 1KIPC 6LYZA 3SP3A 1CNSA 1LJKA 1LMOA 1UIAA 1HERA 4ETCA 4ET8A 3CT1A 3TXIA 1HC0A 4NG8A 3B0KA 2BQAA 2YBJA 3FE0A 1CJ7A 4DDAA 1PS5A 3RNXA 2D4KA 4LT2A 1IWWA 1AKIA 1BVKC 4J1AA 2D6BA 5KXZA 1LZ1A 5F9XA 1NWGA 5DN4A 2DQAA 4NHQA 1CKFA 4E3UA 1LSMA 1JSEA 1UCOA 4HPIA 1IR8A 1BWIA 2G4NA 4DD3A 4II8A 4CFOA 3B6LA 5B1FA 3RT5X 1HMLA 4L41A 3CB7A 1B2KA 1SLYA 1REMA 1TCYA 4OW1A 2D4JA 3GXKA 2HECA 1GB0A 3EMSA 2MEFA 3MGWA 4NGYA 4P2EA 4CHXA 4HTQA 1GEZA 3RU5A 4XADA 1IWXA 4TSCA 1IWVA 2DQJY 1WQOA 1XGUC 2MEIA 4OWBA 4DD1A 4HV1A 3A34A 4G4CA 1B5XA 2DKVA 5LYZA 1DI4A 1LTMA 1WTMA 5I5QA 3VWOA 5C6LA 5II3A 1LZ6A 4MCKA 1YIKA 3ATNA 1CKGA 4TX7A 3T6UA 1LZNA 5FEKA 3AJNA 5HNCA 4YEOA 4R0FA 5FHWA 1B7MA 4NHIA 1XGTC 3KAMA 2I26L 1IP1A 3B72A 1GDXA 1OUCA 1LMQA 1P2CC 4BS7A 5ILFA 1NMMA 4GN3A 2MEGA 4XJIA 1VATA 2EIZC 3IJVA 4XN6A 1LCNA 1WQMA 1G7HC 5LYMA 1FLYA 1A2YC 2FBBA 5T3FA 5KXSA 3A90A 3OK0A 1FDLY 3WU8A 4LYTA 5B59A 5KXXA 1LZGA 1UIHA 4QDNA 5KXOA 5DN5A 1IY3A 2XBRA 1IP6A 1UIEA 1GF5A 1KIRC 1XEJA 5KXYA 1F6RA 3A67Y 1JKDA 4NWEA 2ZWBA 5HMJA 1A4VA 1TDYA 1YAMA 1F6SA 1NF5A 2Y8PA 1J1PY 207LA 2YBNA 1LZ4A 2MEEA 1WTNA 1B5VA 1HEOA 2FYDA 1GF4A 1SQ2L 1OQMA 1HELA 153LA 4UWVA 2Z18A 3A92A 1GFRA 1LJEA 1EL1A 2VB1A 4DD0A 1LZTA 3AZ7A 1TEWA 135LA 1QDRA 2C8OA 4KPMA 5KJ9A 4XJGA 1N4FA 3F6ZA 1JKBA 3CQLA 1YKXX 4NGJA 4NIJA 4OWHA 4WO6A 1HNLA 1JPOA 3WXUA 1GB2A 1GFHA 1BB4A 1LMNA 1DPXA 5HQ1A 1JHLA 1HF4A 2YVBA 1WQNA 1B5WA 4MR1A 1WVUA 2BQMA 3TXHA 1YROA 1KXWA 2YSSC 1HSWA 1LSYA 2YBMA 3A6CY 3TMWA 2CGIA 1GFTA 1I20A 2YDGA 3WW5A 3WPJA 4CGEA 5KKIA 3HBDA 4M4OA 1D6PA 4GCFA 1GDWA 4H9AA 1FLWA 1CKCA 2WARA 1DI5A 3LYOA 2N5ZA 1D0MA 4LFPA 2BQKA 2G4QA 1J1OY 2DBTA 4N5RA 4ZIXA 2MEAA 4ANRA 2LZ2A 2ZILA 1LJNA 5B1GA 4OOOA 1LSAA 1QUSA 1GB5A 1ZVHL 2PC2A 4NGIA 3WXTA 5KXWA 1HFZA 1EQ4A 2BQDA 1LYZA 4HP0A 4WLXA 193LA 1JEFA 4TUNA 3QNGA 1OUFA 3WPKA 1T6VL 7LYZA 1LSNA 4GCCA 1IORA 1C08C 2Z2FA 1F10A 3HBEX 3AZ4A 3LZ2A 1OP9B 4ZEEA 4H9BA 5L3HA 4CFPA 2CJLA 2Q0MX 4PHIA 3N9CA 4G4HA 4WG1A 4WLTA 4Z46A 1YL1X 4ETBA 1IP5A 1LPIA 1IEEA 5LVKA 5DM9A 3TXKA 1GE0A 2EKSC 1LZEA 5A3ZA 1WQQA 1GEVA 5DLAA 1HFYA 5LXWA 1FKVA 1IR7A 1UIBA 1LYSA 4QGZA 1UICA 1BQLY 3W6BA 5IELA 1GFEA 1GXV2 2W1LA 3QY4A 1AZFA 8LYZA 2HU3A 1KXYA 4B4EA 4NSGA 2Z19A 2EPEA 1REXA 1XFPL 5J7CA 1IO5A 1VDSA 1YKYX 3EBAB 2CWIA 1GB9A 4TWSA 3WU9A 4YENA 1B7SA 1LAAA 4YEMA 1IIZA 1VAUA 2YBIA 4HPEA 1GE2A 2BQLA 3CSRA 1DPWA 4LT0A 4LYMA 1J1XY 5KXRA 1WQPA 3W6EA 2F2NA 3CT0A 2Z38A 4H8XA 4LFXA 1LZAA 1B5ZA 1NDMC 4A7DA 2BQEA 1YL0X 1OUIA 3WPLA 4LT1A 2LYZA 2DQHY 4W94A 3T36A 1GBZA 2H9JA 1IP7A 4QY9A 3AB6A 2EQLA 1IWTA 4H8YA 1AT6A 4N0JA 1GFGA 5E9RA 2W1YA 1GB7A 4RLMA 5A3EA 1GE1A 4H91A 1D9UA 2BLYA 2XTHA 5KXKA 2I6ZA 4OOTA 3K3TA 3A6BY 5F16A 2ZQ4A 4ETAA 4YF2A 1GF3A 4IJ4A 4HJZA 3A93A 1OUHA 1B0DA 1YAOA 3AZ5A 1CKDA 3FI7A 2BPUA 2F4GA 3LYTA 4IASA 1NKHA 1TAYA 3WYHA 1GE3A 3ZVQA 4ETEA 4H8ZA 3LYZA 2ZIJA 3TXDA 1INUA 1HMKA 1GPQC 1QSAA 4NGZA 1GBYA 2D91A 3WULA 4N9RA 4NGOA 4YOPA 1BB5A 1IOQA 1VDQA 4DD7A 1IWZA 2HEEA 1QUTA 1GF0A 3WW6A 4OWAA 1LJ4A 4NY5A 3AGGG 2BAAA 3EO5A 1QTKA 4WLDA 1GFUA 4WLYA 1O23A 2NWDX 1LSEA 1LJGA 1B7QA 1HEMA 1UACY 4Z98A 1KXXA 5KXNA 4D9ZA 2DQCY 5F14A 1I56A 1H6MA 1UIDA 2ZIKA 5B06A 1LSPA 4WM2A 3A96A 3A95A 1UC0A 4GN5C 1UA6Y 4PPOA 4X3BA 1RCMA 1AT5A 1WQRA 4DC4A 1GBOA 1YAPA 1JJ0A 1NQIA 1XGPC 2DQFC 1DZBX 1JITA 4WL7A 3B0OA 4GCBA 2ZNWY 3RW8A 2XBSA 1OUGA 1IWYA 5APEA 5HLLA 4WG7A 4GCDA 2ZNXY 1DI3A 4C3WA 1GHLA 4H9EA 1GBXA 1LMCA 1LSDA 1LYYA 3W6CA 4H9CA 4DDCA 2AUBA 5KY1A 4H92A 1IVMA 1BGIA 5KXMA 3TMVA 5LVJA 5APCA 4PJ2C 3ZEKA 3A91A 4ML7A 1BB6A 1ZVYB
chains in the Genus database with same CATH superfamily
1LWKA 1QZMA 1LKRA 1QTDA 1L61A 126LA 3ZC7B 4GBRB 3SYKA 5F81A 3KS8A 3NWLA 3TWMA 2LXEA 4RF0A 1IOSA 1LWGA 3DN2A 4I0CA 3LYMA 4ZPXA 4QEQA 2LZTA 3HBHA 2A7FA 155LA 5JI2E 3AYQA 3SC3A 1QUDA 4PGJB 3QAKA 3TXFA 3QE8A 1L21A 3WL2A 3DKEX 4G4OA 4RNAA 4B0DA 2KZUA 1GO5A 1C10A 172LA 1NNUC 1VDPA 1WGNA 4R71A 3SAUA 4NHTA 3R9XB 3N9EA 2Z39A 3GUJA 4J1BA 1CJ9A 5EXXA 2CDSA 2FOIC 1WGLA 2LVQD 1C6AA 4QNRA 4NXNM 200LA 4CIZA 3L29A 2UUBM 3CF2A 2O01F 5LINA 4NFVA 1L73A 3DN8A 1L05A 4EKSA 1JKCA 1DKJA 2HEAA 2XFSA 4WM4A 218LA 1DXJA 5HMVA 1BWJA 4NGWA 222LA 4NOOB 1NY6A 4H9FA 2KRKA 2H1RA 1WJ7A 2EUCA 3DOAA 3T6PA 1LHJA 1GKIA 1L85A 1BB3A 232LA 4AI6A 5FCPA 163LA 3TMXA 1NV8A 4LG2A 4BAFA 4XJBA 3SBBC 1LMTA 1GVNA 3TXBA 4WM3A 5KXTA 3AGHA 1FLQA 1LSCA 3LW5F 1V33A 4ETDA 1IOTA 4PRUA 5FDJA 159LA 3BXWA 1LJFA 5AMYA 2DKLA 170LA 1L68A 1E8LA 1QTZA 4IATA 5LVIA 5EBHA 1HEQA 133LA 1L77A 1L51A 5DFLA 4LJ9A 4B4JA 151LA 1LMPA 5M1YA 1B9OA 2M5ZA 3GLFA 239LA 4H90A 1W6ZA 5HNLA 209LA 1YQVY 1ZMYL 4IBKA 2DENA 1LSGA 3NYAA 4NHPA 4RW2A 1RFPA 3WVYA 1REYA 1C61A 1YILA 2QP9X 2HEBA 3C9PA 1JTTL 4W55A 1LOZA 1IN7A 4I7PA 2QQ8A 1UBZA 5KXPA 3BKVA 1UIGA 3J6KA 240LA 3TXJA 1IX0A 1L49A 4Z8XA 2NQ8C 5FLXS 4EOFA 3HH6A 4YXCA 4NGVA 4GLAA 1UIFA 1LZRA 2CHVA 4REZA 2HHHM 1G0LA 2H5ZA 2DWMA 4IBDA 4H93A 4KLNA 4RF1A 1LYOA 5C1BA 253LA 1JTOL 4UWNA 3M7GA 4BLCA 261LA 2BQFA 1XEKA 2ZYCA 2Y0QA 4WMGA 1C6EA 3TMUA 4M9ZA 1L15A 1DGHB 1K28A 3D9AC 1L36A 1R4GA 1L28A 3FTDA 2V6ZM 1L92A 1L1ZA 2R18A 3FTCA 4HTKA 1JQUA 1P37A 1V7SA 4RW1A 4FCTA 2DQDY 3HDEA 1NBYC 4B7HA 1LZ5A 1G4AE 1BB7A 3ZVQB 3SB5A 4XJHA 1LI6A 1FBIX 1LHMA 3L25A 1JUGA 5JENB 4CISA 1B6IA 2XJWA 3TXEA 3A8ZA 4HJVA 1EQ5A 1C64A 1TF0B 1G41A 5LAFA 4OWCA 5GKNA 1CTWA 1LSZA 4XJFA 3P66A 1D0LA 1G7JC 4BAPA 1CKHA 3KOZE 1VEDA 5D5FA 4JI0M 5EP3A 3SBJA 1CNSA 4ET8A 3TXIA 152LA 3B0KA 2YBJA 3FE0A 3OE9A 4DV7M 1J5EM 1AKIA 1BVKC 4J1AA 1LZ1A 1D2NA 5F9XA 4I8OA 4W53A 1SX7A 4QNMA 2Z3XA 2LWXA 4LF4M 1IR8A 1BWIA 1G0MA 4II8A 2F47A 1ZV1A 1TCYA 3NBXX 4L8RC 1QSQA 2D4JA 2O79A 3GXKA 3RU5A 4TSCA 2DQJY 1F4IA 4DD1A 4IAPA 2DKVA 4D81A 1LTMA 3VWOA 2VF8A 1LZ6A 3ATNA 4OW0A 4TX7A 2R0IA 3AJNA 2RBOA 1XWIA 1B7MA 4I7QA 1CU5A 4BS7A 5ILFA 4PT5A 4GN3A 2MEGA 4XJIA 4FWGA 4NSOB 3IJVA 238LA 1L84A 2QHOB 1LCNA 1WQMA 1FLYA 3PNYA 2FBBA 5T3FA 1L30A 3OK0A 1FDLY 5KXXA 4W52A 5DN5A 1PQJA 1L2CA 1F6RA 2VQFM 1L57A 4I81A 2R65A 5HMJA 3LVWA 1A4VA 2YBNA 1NF5A 1J1PY 2MEEA 1B5VA 1HEOA 2FYDA 1GF4A 1SQ2L 1OQMA 2Z18A 1PQOA 2V1UA 1FNNA 4I4LA 1GFRA 1EL1A 1HNWM 4KPMA 3ILKA 3CQLA 4NIJA 2RBSA 233LA 1LYHA 2O7AA 1QUHA 1XJUA 3WXUA 3GQ4A 4ARLA 2Y20A 3A45A 1JHLA 1NV9A 3TQSA 1T8AA 3UJNA 1KXWA 2YSSC 1HSWA 3TMWA 1D3NA 4LZJA 1XJTA 4CGEA 4UN2B 1L14A 1L62A 1IN8A 4H9AA 3TL4X 4G3OA 2DAMA 3LYOA 3DA1A 3RE8A 4LFPA 3LVVA 2I7NA 1J1OY 1HNXM 3HU1A 2LZ2A 4TUWA 2ZILA 2LHGA 166LA 4JN6A 1GABA 156LA 1L63A 1LSAA 4NGIA 1OVHA 1HFZA 1EQ4A 2BQDA 3GLIA 2QSFX 4IBJA 3K9OA 1LSNA 3OE0A 4II7A 1CUKA 3T1YM 1L07A 1VDLA 5EXSA 4H9BA 4CGYB 249LA 212LA 4WG1A 4WLTA 1IEEA 1L58A 2JNHA 4LF5M 5DM9A 3TXKA 1L87A 4IBFA 2EKSC 1LZEA 1GEVA 1OFHA 1IR7A 1Z5BA 3UZUA 2JUJA 1LYSA 1QT4A 4EKPA 2UUCM 1Q3CA 3W0LB 5IELA 4DV6M 1L79A 1C62A 4AG5A 2HU3A 2Z19A 3J27B 199LA 1YKYX 1VAUA 1QT8A 2D7GA 4DR5M 3CDRA 1DPWA 1FJGM 1L2DA 1PQDA 3EIEA 131LA 1NJGA 3KOXE 1L34A 3CT0A 4GRVA 1LYDA 255LA 2B7XA 3PFIA 4S0WA 1LGXA 1L1TA 2DQHY 4W94A 3T36A 1GBZA 3VK8A 2H9JA 4QY9A 4I7TA 4JI1M 4GITA 1IWTA 5E9RA 103LA 1GB7A 5A3EA 2RKOA 1GE1A 2BLYA 2KDLA 2I6ZA 3K3TA 2DHYA 5F16A 4ETAA 186LA 1CU0A 3SBAA 1AUAA 5EXTA 3HU8A 1KW7A 3U61B 3IHPA 1JQJC 2FE8A 3FA0A 3B7ZA 1B0DA 1QUGA 4GHAA 2F4GA 3U6LA 3FI7A 2HUMA 4IASA 3OTOM 3CTWB 4JYAM 1XMOM 4XK8F 4I7NA 3HDFA 3LYZA 2ZIJA 1GBYA 3PBLA 1HT1E 3IECA 1BB5A 4B3RM 1C6MA 1IOQA 1VDQA 3VDPA 2DI0A 1DYEA 3LQRA 1IWZA 2BNKA 3FUWA 4JI2M 236LA 4IBIA 4R3DA 4GH9A 1QTKA 1GFUA 1L98A 1O23A 2WSEF 1Z6TA 1UACY 1B7QA 4Z98A 4X62M 4W56A 2DQCY 1UIDA 1L46A 5B06A 1LSPA 3A96A 189LA 1AT5A 1WQRA 1D9WA 3K2RA 1OFIA 4DC4A 1YAPA 1NO1A 1JJ0A 1DZBX 5LMNM 2H5XA 4GHLA 130LA 1D3MA 2RBNA 4WL7A 2YFQA 1IWYA 1KFVA 181LA 1E32A 1K3WA 1DI3A 2K0BX 1GHLA 1PJQA 1LYYA 3W6CA 5KY1A 4H92A 1L75A 1C67A 1BGIA 5LVJA 3I51A 3IG5A 1L67A 2DWZB 3GULA 1ZMWA 4NGKA 1LZSA 2F4AA 1L99A 3W6AA 1B5UA 2DNAA 2BQGA 5LIOA 1GL6A 5ILCA 3U6MA 4CJ2A 3HHWA 5C18A 3K8ZA 1IXSA 4DV0M 1DYDA 2BQIA 214LA 4GC9A 1PZYA 1L53A 2Z7JA 5FTLA 3H4MA 4MSTA 208LA 4OVZA 3SAWA 1YLAA 4M9SA 129LA 1LHHA 4WL6A 1G1VA 1MLCE 4QHSA 2BQBA 1NJFA 256LA 1IWUA 5FSTA 3FE3A 1IY0A 1TH3A 1HHLA 3KP0E 2B5ZA 2A5YB 1LKSA 2J5YA 1L11A 3SN6R 4DR7M 4DDBA 5LA8A 1V7TA 2YBLA 3JR4A 1SXJA 3CDOA 4HL4A 4WO9A 4LDLA 3SMSA 2DHRA 3SB6A 1LJJA 1C65A 1G0QA 3A94A 4ZFPA 4IJFA 4LGKA 3G3BB 1GF8A 1P3NA 1VDTA 1I94M 182LA 1GWDA 1N75A 1OUDA 2R45A 4DR6M 4IBCA 4Q7JA 4HSFA 4IBGA 3MJ5A 196LA 1VG5A 1HJPA 247LA 5F9UA 1GXXA 1YANA 4LF6M 4W5WA 3D8BA 185LA 1XXHE 5KXLA 1CJ6A 1JJ1A 2L4EA 3G3AB 2WSFF 2DQGY 242LA 3KOWE 219LA 2QENA 1HENA 1G06A 4H9HA 5IHGA 5IREB 1L10A 5ITXE 3F8VA 5FELA 4FCVA 5L9JA 4DR4M 3BKHA 2KNVA 3GPPA 1Z59A 4J0LA 4I7LA 3WUMA 4WM5A 3J80S 3HFMY 4HTNA 1VDDA 3L2XA 4NWHA 1P2RA 2BJVA 3AFHA 1GB3A 2HEFA 1KIQC 3WUNA 5ITRA 3CSQA 2MEHA 3GUNA 1L89A 2F2QA 3RZEA 5LYTA 1IC4Y 1L86A 3NY8A 4DD2A 3GXRA 4NG1A 1QT3A 3CT5A 4ARJA 2G3QA 1C6JA 1NSFA 2F32A 1YE9A 1C6GA 5APDA 2QNJA 3A3QA 2HUBA 4ARMA 4KODA 1CU3A 1C43A 1OAOC 1QAMA 2L7IA 1L96A 5KKJA 3HJQA 2VIIA 2XSZD 3WHKA 2BQOA 4PDGA 4XJDA 1XGQC 1RI8B 3C8QA 5C6IA 4NEBA 1GD6A 2I25L 5JI3E 1L27A 1AIPC 1GFKA 4DT3A 4NSHA 2EKFA 1GB8A 4ITQA 2XH9A 5IT9S 3WUAA 7CATA 5A2QS 128LA 2WZJA 3T1HM 4JI6M 4ARPA 4KT0F 3GQ5A 1LJIA 4EMNA 3CF6E 3SB8A 4UWUA 2RGHA 1XEIA 110LA 262LA 3DNAA 1EQEA 1LI3A 188LA 2OO9A 1IN4A 1L04A 2MEBA 5KO3A 2XLJA 2OQ4A 4WM6A 1NHBA 5FTNA 1GAYA 1L66A 2QARC 1OQYA 1L80A 1YAQA 220LA 4LRSA 1HNZM 1C46A 3HGIA 2LNHC 3U6CA 1L2BA 3KW6A 1JSFA 3VW7A 2CP8A 1FKQA 4B7FA 5DL9A 3B7QA 3J2PB 4C5FA 5KQDA 4BB9A 1LYIA 3ATOA 4YXAC 1L81A 3U5ZB 1T6OA 1I6SA 4JI4M 4BADA 3FI5A 4ET9A 132LA 2ZANA 3BOSA 1NVMA 5C6JA 2Q9DA 1L83A 4G6ZA 1AM7A 3M0EA 2R46A 137LA 1IY1A 2B72A 1LZBA 2OTYX 1PQMA 4N1EI 3CSZA 1H87A 1NNJA 3SP3A 1LJKA 2JZ1A 3C3DA 1DYGA 2OU8A 1Q3BA 4LZMA 3FYDA 1KYIA 1HC0A 3KS4A 2E5LM 4LJAA 1WXQA 4F2LA 1CJ7A 4DDAA 2L2DA 3AV0A 2D4KA 3LZMA 2B6WA 1IWWA 2D6BA 5KXZA 4MH0E 1NWGA 2Q2EB 1CKFA 4E3UA 1LSMA 1UCOA 4HPIA 1YSYA 2JY6B 2G4NA 3SARA 3B6LA 1CV3A 3RT5X 2OU0X 3CB7A 157LA 2WSCF 4OW1A 2CHQA 2R62A 3MGWA 3VKGA 1C68A 1LGUA 4HTQA 1GEZA 1IWXA 1L8QA 1WQOA 1XGUC 5KQ8A 4OWBA 5DYGA 1L24A 4HV1A 3A34A 1E9SA 1SSYA 2Q9EA 2HULA 1UM8A 1C6DA 1WTMA 5C6LA 2B74A 5II3A 1YIKA 4LJ8A 3U6PA 1CKGA 1LZNA 5FEKA 4R0FA 4NHIA 251LA 3F9LA 1IP1A 107LA 1GDXA 1OUCA 1J7KA 3GRYA 1VATA 3HH4A 4XN6A 1IXZA 1G7HC 5LYMA 1L39A 3HUKA 1A2YC 1L42A 1QT6A 5KXSA 1JTMA 5KXOA 1IY3A 1LV7A 3HTBA 2KZSA 2XBRA 4WP2A 227LA 3GQ3A 1GF5A 1MN3A 1XEJA 3SYLA 1PRBA 3C82A 2ZWBA 123LA 1TDYA 1F6SA 3GLGE 1HELA 3WHLA 3A92A 3HWLA 144LA 1L00A 2KRUA 1LJEA 2VB1A 1T3TA 229LA 4IJEA 3C3EA 1LZTA 1SWYA 5I14A 1Z5CA 2C8OA 5KJ9A 3F6ZA 1OIPA 4NGJA 4DV2M 4OWHA 2RGOA 1QT5A 2D7HA 2C99A 4IIWA 1HNLA 3SFZA 4L6V6 1WR1B 4AQYM 1DPXA 5HQ1A 2YVBA 3TXHA 1YROA 2A4TA 3P65A 1LSYA 1CU2A 1I20A 235LA 3GLHE 2YDGA 3WW5A 3TWLA 1D6PA 201LA 4GCFA 1P2LA 1R5LA 244LA 3HU9A 1CKCA 3C8RA 2WARA 1DI5A 4ZIXA 4LFAM 216LA 2JY7A 3HT7A 3I04M 3C81A 1QTBA 1GB5A 2PC2A 3WXTA 2MROB 4QHTA 3THGA 195LA 4XGIA 4WLXA 193LA 1OUFA 4I7OA 4L78A 3QWLA 3TE6A 3DN0A 3HBEX 3LZ2A 1ZQ9A 3QYEA 1C6TA 3G3XA 1HR0M 2V1CA 4EKQA 3N9CA 3R8FA 3E46A 4ETBA 1LPIA 4GMQA 4DUZM 5LVKA 2VDBB 1GE0A 1XXHB 1C6QA 1WQQA 1P7SA 2ANVA 3CDVA 4L15A 1HFYA 5LXWA 3GRRA 1MX0A 4QGZA 2ZTDA 3G3WA 1GFEA 3IG8A 8LYZA 4DUYM 2F5PA 4B4EA 2EPEA 1REXA 5J7CA 3JAMS 3U6DA 1B7SA 2RH1A 1LYGA 1KNIA 4HPEA 1GE2A 4LYMA 1J1XY 5KXRA 3DN4A 1R6BX 2XZUA 5EQTA 2XF3A 4FCWA 2DZNB 2K47A 3W68A 4H8XA 1LZAA 4A7DA 1YUBA 2YR0A 1OUIA 4F1IA 2B73A 2I7PA 3F92A 3SATA 4H8YA 3FRIA 2HUKA 2UUAM 1GFGA 4RLMA 1KY0A 1DGHA 4DV1M 4OX9M 206LA 3AOGA 3A6BY 1GF3A 2CV2A 2O5RA 250LA 1SXJD 5EP4A 3C7YA 1K82A 192LA 3KSJA 108LA 1JR3A 3ZVQA 1QS9A 3A98B 3ZQJA 4LZZA 2MJ5B 1HMKA 3AL0C 184LA 1OVKA 2DAKA 3HT9A 4NRWA 5DNYA 1C66A 1TH2A 3OE8A 1L94A 2ZM6M 2B70A 1GF0A 1R2ZA 3WW6A 3C8SA 1LJ4A 1G0KA 1SG9A 2BAAA 1QQWA 252LA 4LGMA 1LSEA 1OTRA 1KXXA 5KPRA 1I56A 2XGNA 1H6MA 114LA 1L71A 2ZIKA 2HL7A 2C9CA 2MH8A 3HJSA 4GN5C 1L76A 4X64M 4X3BA 3GUIA 168LA 5H37D 3HUQA 5ITXA 1JITA 1G1WA 3B0OA 1QTCA 3RW8A 2XBSA 3B9PA 5APEA 2GQFA 5HLLA 4DQ5A 4G4QA 4C3WA 2J7NA 1SWZA 4H9CA 2CEAA 1IVMA 3B74A 5KXMA 3HY5A 228LA 1BB6A 5ITUA 2KW0A 2LCBA 2QBYB 146LA 1IOCA 5EP2A 1JKAA 4AXTA 4FJRA 4B4IA 2R4JA 1C1KA 1OVJA 2Z12A 4L16A 4I8SA 2Z4SA 4J7VA 5KPTA 1JB0F 1LJHA 3LN2A 1ZMVA 2LVPC 1XNQM 4DAJA 1DO2A 1WVVA 2MECA 2YBHA 3P64A 3WMKA 4I7JA 1L22A 2RB1X 1L44A 246LA 1OWYA 2YQZA 4B49A 3B89A 2FBDA 3UONA 4PCZA 4AKHA 1D0KA 3M3UA 1L82A 3AKZA 1C7YA 3K2LA 4KXIA 4GIPA 2B6XA 4LYCA 1QT7A 4DR2M 1DYBA 2OE7X 3G3VA 1L25A 2Y0TA 4FD2A 177LA 1LMAA 2Z37A 4S12A 1KS3A 1P5CA 3W6DA 1L19A 3C83A 4WW0A 4QOZC 2BWEA 1QANA 3QYBA 1PM5A 4NL4H 2Z2EA 4JI5M 1SX2A 1NBZC 1WTHA 3N9AA 2DAGA 4MGYE 4W58A 3W3EA 2C8PA 1IXRC 3AW6A 3GLFE 1I1ZA 1B7RA 2RSCA 4M6DA 5ITQA 3TXGA 1C6NA 4PRQA 1REZA 1D2YA 3L26A 176LA 2EA0A 2R44A 2R6FA 147LA 3HT8A 1LLHA 2ZTCA 1CX6A 1TBYA 3HX3A 4I5SA 1MELL 2DQEY 4OWEA 4DV4M 231LA 4EPIA 5I4YA 4LZTA 2X4AA 2CUUA 3FADA 1IY2A 5K7OA 2LHMA 1TTEA 1ZAEA 1GE4A 1HSXA 4GCEA 6LYZA 3IJUA 5B07A 1OUBA 3A3RX 2CV1A 1G7LC 2L78A 3WH1A 142LA 4NHSA 3PDSA 5I4WA 4YHHM 4LFCM 1IC5Y 4M0WA 4LDOA 5LVHA 3FRHA 2DWLA 4G9SA 3W67A 1GL7A 3GO8A 1L69A 1DGBA 1LHIA 1DYAA 3GLGB 2OPFA 1C63A 230LA 223LA 1DYFA 1IN6A 5I54A 2DVWB 1VFBC 1IP4A 1Q02A 194LA 1NDGC 1QTEA 2UXBM 2W1MA 2HTXA 1CVKA 3Q8GA 4GRIA 2C96A 1CUPA 4LF8M 2HAKA 3PNVA 5LMUM 1LZYA 3CDQA 1PQKA 1EIJA 2CHGA 1ZURA 1Y8GA 2FYCA 4LF9M 3EXDA 5IDDA 4NRVA 4L4UA 2L6OA 3GLHB 1WIVA 1GAZA 1UUZC 257LA 1G8PA 4LYZA 3OJPA 3CF0A 2CFOA 1KY1A 3FUVA 4P16A 1VQ1A 1IY4A 2RB0X 2X0AA 1L40A 3V2YA 1B7LA 2W1XA 4HV2A 2QPAA 3DN3A 1C7PA 1G3IA 5BR8M 1PJJA 4LFBM 190LA 1GFAA 2QB0B 5LA5A 1G7IC 1OKSA 3AGIA 3FUUA 2FS1A 3U61A 4BBAA 3ODUA 2BQHA 1LZ8A 1QIOA 1DYCA 1F0WA 1XGRC 1OUJA 4PD2A 1RE2A 2ZAOA 161LA 1L13A 1PGYA 2JY5A 4U3XB 2LZMA 1JISA 1YKZX 5DYIA 4JI3M 1CX7A 1L16A 1B5YA 4Z3MA 3TPZA 4B1AA 2C9OA 1JTPL 4FWHA 1N34M 4ARQB 4NGLA 1C6KA 5E4PA 4NSIA 1CUQA 1QQYA 4WM1A 3AOEA 4PJZA 2ZYPA 3RZ4A 164LA 169LA 1LSBA 2UU9M 4GKKM 3MMPA 1WHCA 3E21A 5B05A 4FWDA 4LYOA 1JJ3A 2JXNA 1L50A 1LZDA 2QCUA 1KIPC 1UIAA 1LMOA 4MGHA 2ERCA 3CT1A 4NG8A 2G5GX 1L0JA 1PS5A 3RNXA 4NXMM 4D82A 167LA 1IFYA 4LT2A 3D4SA 3DZDA 2LVAA 4KHPM 1L91A 1JSEA 4IBEA 122LA 1NHWC 2GNOA 1D3JA 4L41A 1SLYA 4AG6A 4B7GA 1L97A 4P2EA 1LYEA 2MEFA 145LA 5LZMA 3HTGA 3VLFB 1IWVA 2LC9A 3HTFA 1CU6A 4I7RA 2C98A 2MEIA 2NTGA 3I01M 3U60B 1DI4A 3HUAA 1L12A 4MCKA 148LE 1L54A 4W54A 5HNCA 4ARQA 5FHWA 1L23A 180LA 1XGTC 2I26L 3B72A 1N77A 3GPYA 1P2CC 4DR3M 3SB9A 2OE4X 1MU5A 3H4JA 3KOYE 3SAVA 4EXMA 3A90A 3WU8A 5B59A 4QDNA 2QZ4A 1XMQM 1IP6A 4X65M 1UIEA 4LRTA 1KIRC 5KXYA 4I7KA 2BWBA 1CV5A 1T8GA 1DGGA 4MB7A 5BPVA 4NWEA 1P56A 187LA 3GLIE 2JP7A 1UFZA 1WTNA 153LA 3AOEC 2OTZX 4UWVA 3UMMA 2Y21A 2B6TA 135LA 4AQNA 4B3SM 4XJGA 1JKBA 4WO6A 2D7EA 165LA 1JPOA 234LA 1GFHA 1BB4A 3HTDA 3BBZA 1HF4A 1WQNA 1L0KA 1JR3D 1WVUA 1GJTA 3A6CY 4LJ5A 119LA 2B6YA 1GFTA 2CGIA 1IM2A 3WPJA 2W82A 5KKIA 1XHBA 4M4OA 1G0JA 226LA 1GDWA 1FLWA 4B08A 2N5ZA 4N5RA 3FTEA 2DBTA 1PJIA 4ANRA 1HQYE 4LJ6A 1VEJA 1L47A 1QUSA 3U60A 140LA 237LA 1N36M 4W51A 258LA 5KXWA 254LA 3DN6A 1LYZA 4W57A 1LW9A 3TWKA 1X37A 1JEFA 4TUNA 3WPKA 3V2WA 7LYZA 4GCCA 3VKHA 3HHZA 1IORA 2RAZX 1F10A 3HHXA 3AZ4A 4P17A 5L3HA 3GUOA 4CFPA 1L72A 2CJLA 2Q0MX 2VF7A 4Z46A 2VQEM 2LVNC 149LA 1L74A 4YY3M 2F4VM 5A3ZA 4MGZE 3NBIA 1ORYB 217LA 3GLFB 1UIBA 4I7MA 4NSRA 1UICA 1BQLY 3W6BA 2OEAX 2O4WA 1KXYA 4NSGA 1XFPL 7LZMA 1L38A 3EBAB 4TWSA 3WU9A 4YEMA 4YENA 1LAAA 2YBIA 3A42A 2B6ZA 2BQLA 3CSRA 4AKGA 3EMLA 2F2NA 3E9SA 2DWNA 1H6UA 224LA 4LFXA 1P46A 1NDMC 3QAUA 2LTUA 2BQEA 1YL0X 1C6IA 3LCVB 4LT1A 3RGSA 2JZ0A 2L7HA 3GUKA 1IP7A 3FKEA 3FTFA 2EQLA 4N0JA 3FYCA 1LI2A 4H91A 1D9UA 3VFDA 3FUTA 2XTHA 5KXKA 4OOTA 3KVWA 1G59A 2F5OA 4IJ4A 1QSBA 4HJZA 1JTNA 4YX7C 173LA 1ZMUA 1OUHA 4OO9A 1TH4A 1CKDA 2BPUA 1L35A 1NKHA 3T38A 1TAYA 4ETEA 4H8ZA 3TXDA 1QSAA 2OOBA 3WULA 2G8LA 2D91A 2XFTA 4HEOA 4N9RA 4YOPA 3ZCBB 115LA 1QAQA 1P3QQ 2L09A 3U5ZA 3GUPA 1QUTA 2HCBA 1NY5A 2RRUA 1L93A 1P64A 4NY5A 4ZPUA 3EO5A 4WLDA 102LA 1OAIA 1LJGA 5F14A 4EJ4A 4PK0A 1CV6A 1ZWNA 158LA 1UC0A 3HH3A 4PPOA 3M6AA 4K0KM 2KA6B 2Z8YM 4GEWA 2DQFC 5FTMA 3V76A 4GCBA 1IBLM 2ZNWY 1OUGA 4WG7A 1LGWA 1SXJE 1C60A 2ZNXY 4B3MM 1GBXA 1LSDA 1A5TA 221LA 2KEBA 1KSFX 2ZAMA 4JXJA 5EXPA 4LJ7A 5APCA 3A91A 4ML7A 3W0FA 1ZVYB 5EP1A 150LA 1IP3A 3DMVA 1HEPA 2K9DA 1VEKA 3Q8XA 1E9RA 1EFUB 3KFUG 1T6HA 4AZFA 1CJ8A 1Q39A 3GUMA 1Z5AA 4LYBA 2GV0A 5L8RF 1LZ9A 1T97A 1L03A 1D3FA 112LA 160LA 1L31A 4KO8A 4H9IA 4CJ6A 2DZLA 3B7NA 2UXDM 4G49A 113LA 205LA 2ZQ3A 3AZ6A 2F5NA 4EIWA 4FDYA 109LA 1L48A 1TDHA 4MGIE 4KL7A 1OYUA 3L28A 2IFFY 3K9PA 134LA 3KXEC 1L17A 4DV3M 4RDSA 1BVSA 1HEWA 2HEDA 4RLNA 4YM8A 1B7OA 1L56A 3AJIB 2YNMD 4WURA 141LA 1FN5A 2P5TA 3C80A 2FNAA 4GKJM 1L29A 2KXEA 1LHLA 1B7NA 4O34A 4FVMA 2CRUA 1JIYA 1GF9A 1L06A 2LYMA 1LZCA 3L2AA 241LA 3EIHA 2DQIY 4H1PA 1HQCA 5FTJA 1GF7A 1GBWA 3GPXA 3WVXA 2FFJA 2BQNA 3DMZA 2HKJA 1L95A 1R2YA 1GFJA 4DD9A 3LZTA 1FLUA 1TR8A 2XSZA 1IP2A 1L65A 1QDTA 4W59A 2C5RA 2DXIA 4R6CA 5ITTA 2KHHA 3ULRA 4N8ZA 1GF6A 1DKKA 2X8AA 2N35A 1GBSA 6LYTA 3AW7A 1LSFA 2BLXA 1ZYTA 2LYOA 3DFZA 1L02A 1N33M 1KW5A 1XEPA 1C45A 4NSJA 2ANXA 111LA 4R7GA 1RJCB 5IZ7D 1D6QA 1XSFA 1L60A 1W5TA 4N1CC 4KT3A 2HU1A 2BQJA 2Z4RA 1QTVA 2XZFA 3DMXA 5I4XA 1L33A 1QYRA 1XXHA 3GLIB 4GN4A 5LVGA 5APFA 5F3WA 1ALCA 1CV0A 4XBOA 2CUZA 3L27A 178LA 3SMPA 1C6CA 4DR1M 4AGAA 2DAEA 2G4PA 2A7DA 3B0IA 5L3IA 4H94A 120LA 1W5SA 1G7MC 4DQ7A 4LT3A 2AHMA 3K92A 3IWRA 2NTHA 1QSWA 9LYZA 5LAGA 1MJGM 4G4BA 4TTDA 3PXGA 2RAYX 2KNAA 5E6JA 4TSBA 1JWRA 3C58A 1GFVA 1L32A 1QTHA 3T15A 243LA 3NY9A 2F5SA 1W08A 1L64A 143LA 1EPYA 3D8LA 3E3DA 5EJCA 4JI8M 4IBBA 1B7PA 3J81S 118LA 1Z55A 4DYGA 3J4GA 1G0GA 4DV5M 3P4ZA 3C7WA 1BWHA 2LH0A 1LPYA 2B75A 4XYYA 1LJ3A 245LA 2JY8A 4XENA 2EKKA 4EPFA 4GLVA 1DGFA 2M60A 4W96A 1IR9A 1ZV5L 1T3PA 1BHZA 3LHMA 4DWXA 4LF7M 3D3DA 5I53A 1L01A 4WOAA 4E97A 1HFXA 1XC8A 183LA 3LMMA 1QS5A 2F30A 1NHEA 2IHLA 3K1JA 4HJYA 2MR9A 4Z41A 2D4IA 3P68A 154LA 3W6FA 1IC7Y 3RGPA 2JA2A 260LA 1C6LA 1OUAA 1GB6A 3KDSE 3HH5A 2BQCA 1OUEA 175LA 1BVXA 3M18B 3WU7A 1DQJC 4PDIA 1L59A 1T43A 1N32M 5D5CA 2RBRA 1XB2B 3FD9A 4DKLA 1GJSA 1OV5A 2MEDA 3DN1A 4M9XA 2O25A 1LHKA 1TGUA 2H9KA 1R7RA 1L18A 1HERA 4ETCA 4G4RA 4HLQA 191LA 2K6BA 2BQAA 3PVSA 4A3VB 1LYJA 2L4FA 1L55A 2QBYA 8CATA 2HWJA 2KNZA 3U6SA 5DN4A 2OU9A 2DQAA 2J7OA 1L20A 4NHQA 1L26A 2LVOC 4OU7A 2DAIA 3UGJA 2UXCM 259LA 1C6BA 3RUNA 4Y28F 4DD3A 4CFOA 5B1FA 1HMLA 4DQJA 3J7BA 1DO0A 1B2KA 1REMA 2HECA 1GB0A 3EMSA 4CHXA 4NGYA 3L64A 4MGKE 4XADA 1IXSB 104LA 4LY6A 1IN5A 4G4CA 1B5XA 125LA 4LGYA 1CV1A 4OVZB 5LYZA 3OE6A 1TLAA 4MM3B 5I5QA 4JI7M 2CE7A 2APLA 3VK7A 4K5YA 1DV0A 3T6UA 4YEOA 3KAMA 1E94E 3SHFA 2OOAA 1LMQA 3SASA 1NMMA 4DJHA 2EIZC 3GPUA 213LA 198LA 1SXJB 1LYFA 3HU3A 4Z6YA 4LYTA 5IWAM 1LZGA 1UIHA 211LA 3HWSA 5KPZA 2ZBKB 1C6HA 1P36A 3A67Y 1JKDA 3HHYA 1N78A 3KP1E 1G0PA 1PJSA 127LA 1YAMA 2Y8PA 3JR6A 207LA 1LZ4A 248LA 4X66M 1L88A 2XEPA 3KSXA 4DD0A 3AZ7A 6LZMA 1TEWA 1QDRA 1P6YA 1N4FA 1L41A 1YKXX 2DZOB 3GRUA 1QUOA 210LA 4G4NA 1GB2A 3U6EA 1LMNA 3CDTA 1L52A 2X49A 1GLNA 1B5WA 4MR1A 2EO2A 1IQPA 1C6PA 2BQMA 4RKUF 3SHGB 225LA 2YBMA 4M0DA 4NC6A 4I7SA 5FSWA 3HBDA 3JR5A 1T8FA 4EKRA 139LA 1D0MA 2IGCA 2BQKA 2G4QA 1QAOA 2MEAA 3GRVA 1L70A 1LJNA 1EE8A 1V92A 3I4YA 4OOOA 5B1GA 1ZVHL 3MHVC 2CV0A 3C7ZA 3FUXA 3MK6A 4AKIA 4HP0A 1S3SA 3QNGA 3GLGA 1T6VL 1OWZA 4D80A 3HT6A 1C08C 3VDUA 2Z2FA 4FW9A 1OP9B 4ZEEA 1QVRA 1IBMM 3LCUA 1XNRM 1CV4A 1L45A 2RBPA 4PHIA 4G4HA 1YL1X 3E4RA 3J7AS 1IP5A 138LA 1OJLA 3A46A 2LHCA 5DLAA 1FKVA 1J09A 3CGWA 1JR3E 4ARMB 1GXV2 2W1LA 3QY4A 1G07A 1AZFA 1PJTA 1NHGC 2Z6BA 3SB7A 2BJWA 3GLHA 1IO5A 1VDSA 2CWIA 1GB9A 4LCBA 1IIZA 1L09A 4GC5A 1SSWA 4LT0A 1I4WA 1IBKM 1WQPA 4DBGB 3W6EA 1PQIA 2Z38A 1HT2E 171LA 197LA 1B5ZA 2JWSA 3U6QA 2OE9X 3WPLA 215LA 1L90A 4LDEA 2LYZA 2XQOA 1VEGA 3HZJA 3AB6A 1RU3A 1G71A 1AT6A 2W1YA 2RB2X 2F5QA 2ZQ4A 4YF2A 1C6FA 2B3TA 3A93A 1C69A 1V34A 4LJ4A 1YAOA 3AZ5A 3LYTA 3WYHA 3HKPA 2MGWA 1GE3A 1D2WA 1L37A 4JV5M 2CWBA 1INUA 162LA 1GPQC 4CHTB 174LA 4NGZA 4AW4A 4NGOA 2EJSA 4DD7A 2HEEA 5ITYA 1L43A 3LQQA 5FTKA 4OWAA 3AGGG 4WLYA 3GP1A 2NWDX 5E26A 3ZH9B 1HEMA 5KXNA 4D9ZA 2RBQA 4B3TM 4QOSA 4WM2A 3A95A 1UA6Y 3UK6A 3HJ8A 1L08A 1RCMA 3U6OA 3HU2A 1OIZA 1GBOA 1QZEA 1NQIA 1XGPC 1OV7A 2LBCA 1SXJC 2FH0A 3RFWA 1TDZA 4GCDA 2R4EA 4H9EA 1LMCA 4DDCA 3I4VA 2AUBA 3TMVA 4PJ2C 3ZEKA 1K3XA
chains in the Genus database with same CATH topology
1LWKA 1LKRA 1QTDA 1L61A 126LA 4GBRB 5F81A 1IOSA 1LWGA 3DN2A 4I0CA 3LYMA 4QEQA 2LZTA 3HBHA 2A7FA 155LA 3AYQA 1QUDA 4PGJB 3QAKA 3TXFA 3QE8A 1L21A 3WL2A 3DKEX 4B0DA 1C10A 172LA 1VDPA 4NHTA 3N9EA 2Z39A 3GUJA 4J1BA 1CJ9A 2CDSA 1C6AA 200LA 5LINA 4NFVA 1L73A 3DN8A 1L05A 4EKSA 1JKCA 1DKJA 2HEAA 4WM4A 218LA 1DXJA 5HMVA 1BWJA 4NGWA 222LA 4H9FA 1LHJA 1L85A 1BB3A 232LA 5FCPA 163LA 3TMXA 4BAFA 4XJBA 3SBBC 1LMTA 3TXBA 4WM3A 5KXTA 3AGHA 1FLQA 1LSCA 4ETDA 1IOTA 4PRUA 5FDJA 159LA 1LJFA 5AMYA 170LA 1L68A 1E8LA 1QTZA 4IATA 5LVIA 5EBHA 1HEQA 133LA 1L77A 1L51A 4B4JA 151LA 1LMPA 5M1YA 1B9OA 239LA 4H90A 1W6ZA 5HNLA 209LA 1YQVY 1ZMYL 3NYAA 1LSGA 4NHPA 4RW2A 1RFPA 3WVYA 1REYA 1C61A 1YILA 2HEBA 1JTTL 4W55A 1LOZA 4I7PA 1UBZA 5KXPA 3BKVA 1UIGA 3J6KA 240LA 3TXJA 1IX0A 1L49A 4EOFA 3HH6A 4YXCA 4NGVA 4GLAA 1UIFA 1LZRA 1G0LA 2H5ZA 4H93A 1LYOA 253LA 1JTOL 4UWNA 261LA 2BQFA 1XEKA 2ZYCA 4WMGA 1C6EA 3TMUA 1L15A 1K28A 3D9AC 1L36A 1L28A 1L92A 4HTKA 1JQUA 1P37A 1V7SA 4RW1A 2DQDY 3HDEA 1NBYC 1LZ5A 1BB7A 3ZVQB 3SB5A 4XJHA 1LI6A 1FBIX 1LHMA 1JUGA 5JENB 1B6IA 2XJWA 3TXEA 3A8ZA 4HJVA 1EQ5A 1C64A 5LAFA 4OWCA 1CTWA 1LSZA 4XJFA 3P66A 1D0LA 1G7JC 4BAPA 1CKHA 1VEDA 5D5FA 1CNSA 4ET8A 3TXIA 152LA 3B0KA 2YBJA 3FE0A 3OE9A 1BVKC 1AKIA 4J1AA 1LZ1A 5F9XA 4W53A 1SX7A 1IR8A 1BWIA 1G0MA 4II8A 2F47A 1TCYA 1QSQA 2D4JA 3GXKA 2O79A 3RU5A 4TSCA 2DQJY 4DD1A 4IAPA 2DKVA 1LTMA 3VWOA 1LZ6A 3ATNA 4TX7A 3AJNA 2RBOA 1B7MA 4I7QA 1CU5A 4BS7A 5ILFA 4GN3A 2MEGA 4XJIA 3IJVA 238LA 1L84A 1LCNA 1WQMA 1FLYA 2FBBA 5T3FA 1L30A 3OK0A 1FDLY 5KXXA 4W52A 5DN5A 1PQJA 1F6RA 1L57A 5HMJA 1A4VA 2YBNA 1NF5A 1J1PY 2MEEA 1B5VA 1HEOA 2FYDA 1GF4A 1SQ2L 1OQMA 2Z18A 1PQOA 1GFRA 1EL1A 4KPMA 3CQLA 4NIJA 2RBSA 233LA 1LYHA 2O7AA 1QUHA 1XJUA 3WXUA 4ARLA 1JHLA 1T8AA 2YSSC 1KXWA 1HSWA 3TMWA 1D3NA 1XJTA 4CGEA 1L14A 1L62A 4H9AA 3LYOA 4LFPA 1J1OY 2LZ2A 2ZILA 166LA 156LA 1L63A 1LSAA 4NGIA 1OVHA 1HFZA 1EQ4A 2BQDA 1LSNA 3OE0A 1L07A 4H9BA 249LA 212LA 4WG1A 4WLTA 1IEEA 1L58A 5DM9A 3TXKA 1L87A 2EKSC 1LZEA 1GEVA 4EKPA 1IR7A 1QT4A 1LYSA 5IELA 1L79A 1C62A 2HU3A 2Z19A 199LA 1YKYX 1VAUA 1QT8A 3CDRA 1DPWA 1PQDA 131LA 1L34A 3CT0A 4GRVA 1LYDA 255LA 2B7XA 4S0WA 1LGXA 2DQHY 4W94A 3T36A 1GBZA 2H9JA 4QY9A 4I7TA 1IWTA 5E9RA 103LA 1GB7A 5A3EA 1GE1A 2BLYA 2I6ZA 3K3TA 5F16A 4ETAA 186LA 1CU0A 3SBAA 3HU8A 1KW7A 3FA0A 1B0DA 1QUGA 3FI7A 2F4GA 4IASA 2HUMA 4I7NA 3HDFA 3LYZA 2ZIJA 1GBYA 3PBLA 1BB5A 1IOQA 1C6MA 1VDQA 1DYEA 1IWZA 236LA 1QTKA 1GFUA 1L98A 1O23A 1UACY 1B7QA 4Z98A 4W56A 2DQCY 1UIDA 1L46A 5B06A 1LSPA 3A96A 189LA 1AT5A 1WQRA 1D9WA 3K2RA 4DC4A 1YAPA 1JJ0A 1DZBX 4WL7A 130LA 1D3MA 2RBNA 1IWYA 181LA 1DI3A 1GHLA 1LYYA 3W6CA 5KY1A 4H92A 1L75A 1C67A 1BGIA 5LVJA 3GULA 1L67A 4NGKA 1LZSA 2F4AA 1L99A 3W6AA 1B5UA 2BQGA 5LIOA 5ILCA 4CJ2A 1DYDA 2BQIA 214LA 1PZYA 1L53A 4MSTA 208LA 1LHHA 129LA 4WL6A 1G1VA 1MLCE 2BQBA 256LA 1IWUA 5FSTA 1HHLA 2B5ZA 1LKSA 1L11A 3SN6R 4DDBA 5LA8A 1V7TA 2YBLA 3CDOA 4WO9A 4LDLA 3SB6A 1LJJA 1C65A 1G0QA 3A94A 4ZFPA 4LGKA 3G3BB 1GF8A 1P3NA 1VDTA 182LA 1GWDA 1OUDA 4HSFA 196LA 247LA 5F9UA 1GXXA 1YANA 185LA 5KXLA 1CJ6A 1JJ1A 3G3AB 2DQGY 242LA 219LA 4H9HA 1HENA 1G06A 5IHGA 1L10A 3F8VA 5FELA 5L9JA 3BKHA 4J0LA 4I7LA 3WUMA 4WM5A 3HFMY 4HTNA 3L2XA 4NWHA 1P2RA 1GB3A 2HEFA 1KIQC 3WUNA 3CSQA 2MEHA 3GUNA 1L89A 2F2QA 3RZEA 5LYTA 1IC4Y 1L86A 3NY8A 4DD2A 3GXRA 4NG1A 1QT3A 3CT5A 4ARJA 1C6JA 2F32A 1C6GA 5APDA 3A3QA 2HUBA 4ARMA 1CU3A 1C43A 1L96A 5KKJA 2BQOA 4XJDA 1XGQC 1RI8B 3C8QA 5C6IA 4NEBA 1GD6A 2I25L 1L27A 1GFKA 4DT3A 4NSHA 1GB8A 3WUAA 128LA 4ARPA 1LJIA 4EMNA 3SB8A 4UWUA 1XEIA 110LA 3DNAA 262LA 1EQEA 1LI3A 188LA 1L04A 2MEBA 4WM6A 1NHBA 1GAYA 1L66A 2QARC 1L80A 1YAQA 220LA 1C46A 1JSFA 3VW7A 1FKQA 5DL9A 4C5FA 1LYIA 3ATOA 4YXAC 1L81A 1I6SA 4BADA 3FI5A 4ET9A 132LA 5C6JA 2Q9DA 1L83A 1AM7A 137LA 2B72A 1LZBA 2OTYX 1PQMA 4N1EI 3CSZA 1H87A 3SP3A 1LJKA 2OU8A 1DYGA 4LZMA 1HC0A 1CJ7A 4DDAA 2D4KA 3LZMA 2B6WA 1IWWA 2D6BA 5KXZA 1NWGA 1CKFA 4E3UA 1LSMA 1UCOA 4HPIA 2G4NA 3B6LA 1CV3A 3RT5X 2OU0X 3CB7A 157LA 4OW1A 3MGWA 1C68A 1LGUA 4HTQA 1GEZA 1IWXA 1WQOA 1XGUC 4OWBA 1L24A 4HV1A 3A34A 1SSYA 2Q9EA 2HULA 1C6DA 1WTMA 5C6LA 2B74A 5II3A 1YIKA 1CKGA 1LZNA 5FEKA 4R0FA 4NHIA 251LA 3F9LA 1IP1A 107LA 1GDXA 1OUCA 1VATA 3HH4A 4XN6A 1G7HC 5LYMA 1L39A 3HUKA 1A2YC 1L42A 1QT6A 5KXSA 1JTMA 5KXOA 1IY3A 3HTBA 2XBRA 227LA 1GF5A 1XEJA 3C82A 2ZWBA 123LA 1TDYA 1F6SA 1HELA 3A92A 3HWLA 144LA 1L00A 1LJEA 2VB1A 229LA 1SWYA 1LZTA 5I14A 2C8OA 5KJ9A 3F6ZA 4NGJA 4OWHA 1QT5A 1HNLA 1DPXA 5HQ1A 2YVBA 3TXHA 1YROA 2A4TA 1LSYA 1CU2A 1I20A 235LA 2YDGA 3WW5A 201LA 1D6PA 4GCFA 1P2LA 244LA 3HU9A 1CKCA 3C8RA 2WARA 1DI5A 4ZIXA 216LA 3HT7A 3C81A 1QTBA 1GB5A 2PC2A 3WXTA 195LA 4WLXA 193LA 1OUFA 4I7OA 3HBEX 3LZ2A 3DN0A 1C6TA 3G3XA 4EKQA 3N9CA 4ETBA 1LPIA 5LVKA 1GE0A 1C6QA 1WQQA 1P7SA 2ANVA 3CDVA 1HFYA 5LXWA 4QGZA 3G3WA 1GFEA 8LYZA 4B4EA 2EPEA 1REXA 5J7CA 1B7SA 2RH1A 1LYGA 4HPEA 1KNIA 1GE2A 4LYMA 1J1XY 5KXRA 3DN4A 4H8XA 1LZAA 4A7DA 1OUIA 2B73A 4H8YA 2HUKA 1GFGA 4RLMA 1KY0A 206LA 3A6BY 1GF3A 250LA 3C7YA 192LA 3ZVQA 108LA 1QS9A 1HMKA 184LA 1OVKA 3HT9A 1C66A 3OE8A 1L94A 2B70A 1GF0A 3WW6A 3C8SA 1LJ4A 1G0KA 2BAAA 252LA 1LSEA 1KXXA 1I56A 1H6MA 1L71A 114LA 2ZIKA 4GN5C 1L76A 4X3BA 3GUIA 168LA 3HUQA 1JITA 1G1WA 3B0OA 1QTCA 3RW8A 2XBSA 5APEA 5HLLA 4DQ5A 4C3WA 1SWZA 4H9CA 1IVMA 5KXMA 228LA 1BB6A 2LCBA 146LA 1IOCA 1JKAA 4AXTA 4FJRA 4B4IA 1OVJA 2Z12A 4I8SA 4J7VA 1LJHA 3LN2A 4DAJA 1WVVA 2MECA 2YBHA 3P64A 3WMKA 4I7JA 1L22A 2RB1X 1L44A 246LA 1OWYA 4B49A 2FBDA 3UONA 1D0KA 3M3UA 1L82A 4KXIA 2B6XA 4LYCA 1QT7A 1DYBA 2OE7X 3G3VA 1L25A 177LA 1LMAA 2Z37A 1KS3A 1P5CA 3W6DA 1L19A 3C83A 2Z2EA 1SX2A 1NBZC 1WTHA 3N9AA 4W58A 3W3EA 2C8PA 3AW6A 1I1ZA 1B7RA 2RSCA 4M6DA 3TXGA 1C6NA 4PRQA 1REZA 1D2YA 176LA 147LA 3HT8A 1LLHA 1CX6A 1TBYA 1MELL 2DQEY 4OWEA 231LA 4EPIA 5I4YA 4LZTA 2CUUA 3FADA 5K7OA 2LHMA 4GCEA 1HSXA 1GE4A 6LYZA 3IJUA 5B07A 1OUBA 3A3RX 1G7LC 2L78A 3WH1A 142LA 4NHSA 3PDSA 5I4WA 1IC5Y 4LDOA 5LVHA 4G9SA 1L69A 1LHIA 1DYAA 223LA 1C63A 230LA 1DYFA 5I54A 1VFBC 1IP4A 194LA 1NDGC 1QTEA 2W1MA 2HTXA 1CVKA 1CUPA 1LZYA 3CDQA 1PQKA 1ZURA 2FYCA 3EXDA 5IDDA 257LA 1GAZA 1UUZC 4LYZA 3OJPA 1KY1A 2RB0X 1IY4A 2X0AA 1L40A 3V2YA 1B7LA 2W1XA 4HV2A 3DN3A 1C7PA 2QB0B 190LA 1GFAA 5LA5A 1G7IC 3AGIA 3ODUA 2BQHA 1LZ8A 1QIOA 1F0WA 1DYCA 1XGRC 1OUJA 1RE2A 161LA 1L13A 4U3XB 2LZMA 1JISA 1YKZX 1CX7A 1L16A 1B5YA 4Z3MA 4B1AA 1JTPL 4ARQB 4NGLA 1C6KA 5E4PA 4NSIA 1CUQA 1QQYA 4WM1A 4PJZA 2ZYPA 3RZ4A 164LA 169LA 1LSBA 5B05A 4LYOA 1JJ3A 1L50A 1LZDA 1KIPC 1UIAA 1LMOA 3CT1A 4NG8A 1L0JA 1PS5A 3RNXA 167LA 4LT2A 3D4SA 1L91A 1JSEA 122LA 1D3JA 4L41A 1SLYA 1L97A 4P2EA 1LYEA 2MEFA 145LA 5LZMA 3HTGA 1IWVA 2LC9A 3HTFA 1CU6A 4I7RA 2MEIA 2NTGA 1DI4A 3HUAA 1L12A 4MCKA 148LE 1L54A 4W54A 5HNCA 4ARQA 5FHWA 1L23A 180LA 1XGTC 2I26L 3B72A 1P2CC 3SB9A 2OE4X 4EXMA 3A90A 3WU8A 5B59A 4QDNA 1IP6A 1UIEA 1KIRC 5KXYA 4I7KA 1CV5A 1T8GA 4NWEA 1P56A 187LA 1WTNA 153LA 2OTZX 4UWVA 2B6TA 135LA 4AQNA 4XJGA 1JKBA 4WO6A 165LA 1JPOA 234LA 1GFHA 1BB4A 3HTDA 1HF4A 1WQNA 1L0KA 1WVUA 3A6CY 119LA 2B6YA 1GFTA 2CGIA 3WPJA 5KKIA 4M4OA 1G0JA 226LA 1GDWA 1FLWA 2N5ZA 4N5RA 2DBTA 4ANRA 1L47A 1QUSA 140LA 237LA 4W51A 258LA 5KXWA 254LA 3DN6A 1LYZA 4W57A 1LW9A 1JEFA 3WPKA 4TUNA 7LYZA 3V2WA 4GCCA 1IORA 2RAZX 1F10A 3AZ4A 5L3HA 3GUOA 4CFPA 1L72A 2CJLA 2Q0MX 4Z46A 149LA 1L74A 5A3ZA 217LA 1UIBA 4I7MA 1UICA 1BQLY 3W6BA 2OEAX 2O4WA 1KXYA 4NSGA 1XFPL 7LZMA 1L38A 3EBAB 4TWSA 3WU9A 4YEMA 4YENA 1LAAA 2YBIA 2B6ZA 2BQLA 3CSRA 3EMLA 2F2NA 224LA 4LFXA 1P46A 1NDMC 2BQEA 1YL0X 1C6IA 4LT1A 3GUKA 1IP7A 2EQLA 4N0JA 1LI2A 4H91A 1D9UA 2XTHA 5KXKA 4OOTA 4IJ4A 1QSBA 4HJZA 1JTNA 4YX7C 173LA 1OUHA 4OO9A 1CKDA 2BPUA 1L35A 1NKHA 1TAYA 4ETEA 4H8ZA 3TXDA 1QSAA 3WULA 2D91A 4N9RA 4YOPA 115LA 3GUPA 1QUTA 1L93A 1P64A 4NY5A 4ZPUA 3EO5A 4WLDA 102LA 1LJGA 5F14A 4EJ4A 4PK0A 1CV6A 1ZWNA 158LA 1UC0A 3HH3A 4PPOA 2DQFC 4GCBA 2ZNWY 1OUGA 4WG7A 1LGWA 1C60A 2ZNXY 1GBXA 1LSDA 221LA 5APCA 3A91A 4ML7A 1ZVYB 150LA 1IP3A 3DMVA 1HEPA 1T6HA 1CJ8A 3GUMA 4LYBA 2GV0A 1LZ9A 1T97A 1L03A 1D3FA 112LA 160LA 1L31A 4H9IA 4G49A 113LA 205LA 2ZQ3A 3AZ6A 4FDYA 109LA 1L48A 4KL7A 1OYUA 2IFFY 134LA 1L17A 4RDSA 1HEWA 2HEDA 4RLNA 4YM8A 1B7OA 1L56A 141LA 3P65A 1FN5A 3C80A 1L29A 1LHLA 1B7NA 4O34A 1JIYA 1GF9A 1L06A 2LYMA 1LZCA 241LA 2DQIY 4H1PA 1GF7A 1GBWA 3WVXA 2BQNA 3DMZA 1L95A 1GFJA 4DD9A 3LZTA 1FLUA 1IP2A 1L65A 1QDTA 4W59A 4R6CA 3ULRA 4N8ZA 1GF6A 1DKKA 1GBSA 6LYTA 3AW7A 1LSFA 2BLXA 1ZYTA 2LYOA 1L02A 1KW5A 1XEPA 1C45A 4NSJA 2ANXA 111LA 1RJCB 1D6QA 1XSFA 1L60A 4N1CC 4KT3A 2HU1A 2BQJA 1QTVA 3DMXA 5I4XA 1L33A 4GN4A 5LVGA 5APFA 1ALCA 1CV0A 178LA 1C6CA 4AGAA 2G4PA 2A7DA 3B0IA 5L3IA 4H94A 120LA 1G7MC 4DQ7A 4LT3A 3IWRA 2NTHA 1QSWA 9LYZA 5LAGA 4G4BA 4TTDA 2RAYX 4TSBA 1JWRA 1GFVA 1L32A 1QTHA 243LA 3NY9A 1W08A 1L64A 143LA 1EPYA 3E3DA 4DYGA 118LA 1B7PA 1Z55A 3J4GA 1G0GA 3P4ZA 3C7WA 1BWHA 1LPYA 2B75A 4XYYA 1LJ3A 245LA 4XENA 4EPFA 4GLVA 4W96A 1IR9A 1ZV5L 1T3PA 1BHZA 3LHMA 4DWXA 3D3DA 5I53A 1L01A 4WOAA 4E97A 1HFXA 183LA 2F30A 1QS5A 1NHEA 2IHLA 4HJYA 4Z41A 2D4IA 3P68A 154LA 3W6FA 1IC7Y 260LA 1C6LA 1OUAA 1GB6A 3HH5A 2BQCA 1OUEA 175LA 1BVXA 3M18B 3WU7A 1DQJC 1L59A 5D5CA 2RBRA 4DKLA 1OV5A 2MEDA 3DN1A 1LHKA 2H9KA 1L18A 1HERA 4ETCA 191LA 2BQAA 1LYJA 1L55A 5DN4A 2OU9A 2DQAA 1L20A 4NHQA 1L26A 259LA 1C6BA 3RUNA 4DD3A 4CFOA 5B1FA 1HMLA 4DQJA 1B2KA 1REMA 2HECA 1GB0A 3EMSA 4CHXA 4NGYA 3L64A 4XADA 104LA 4G4CA 1B5XA 125LA 1CV1A 5LYZA 3OE6A 1TLAA 5I5QA 4K5YA 3T6UA 4YEOA 3KAMA 1LMQA 4DJHA 1NMMA 2EIZC 213LA 198LA 1LYFA 4LYTA 1LZGA 1UIHA 211LA 1C6HA 1P36A 3A67Y 1JKDA 1G0PA 1YAMA 127LA 2Y8PA 3JR6A 207LA 1LZ4A 248LA 1L88A 4DD0A 3AZ7A 6LZMA 1TEWA 1QDRA 1P6YA 1N4FA 1L41A 1YKXX 210LA 1QUOA 1GB2A 1LMNA 3CDTA 1L52A 1B5WA 4MR1A 1C6PA 2BQMA 2YBMA 225LA 4I7SA 3HBDA 1T8FA 4EKRA 139LA 1D0MA 2IGCA 2BQKA 2G4QA 2MEAA 1L70A 1LJNA 5B1GA 4OOOA 1ZVHL 3C7ZA 4HP0A 3QNGA 1T6VL 1OWZA 3HT6A 1C08C 2Z2FA 1OP9B 4ZEEA 1L45A 1CV4A 2RBPA 4PHIA 4G4HA 1YL1X 1IP5A 138LA 5DLAA 1FKVA 4ARMB 1GXV2 2W1LA 3QY4A 1G07A 1AZFA 2Z6BA 3SB7A 1IO5A 1VDSA 2CWIA 1GB9A 1IIZA 1L09A 1SSWA 4LT0A 1WQPA 3W6EA 1PQIA 2Z38A 171LA 197LA 1B5ZA 2OE9X 3WPLA 215LA 1L90A 4LDEA 2LYZA 2XQOA 3AB6A 1AT6A 2W1YA 2RB2X 2ZQ4A 4YF2A 1C6FA 3A93A 1C69A 1YAOA 3AZ5A 3LYTA 3WYHA 1GE3A 1D2WA 1L37A 162LA 1INUA 1GPQC 4NGZA 174LA 4NGOA 4DD7A 2HEEA 1L43A 4OWAA 3AGGG 4WLYA 2NWDX 1HEMA 5KXNA 4D9ZA 2RBQA 4WM2A 3A95A 1UA6Y 1L08A 1RCMA 1GBOA 1NQIA 1XGPC 1OV7A 4GCDA 4H9EA 1LMCA 4DDCA 2AUBA 3TMVA 4PJ2C 3ZEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGK A;  1LZS A;  1LKR A;  2F4A A;  1IP3 A;  3W6A A;  1IOC A;  1B5U A;  1JKA A;  4AXT A;  2BQG A;  4FJR A;  1HEP A;  5LIO A;  4B4I A;  5ILC A;  5F81 A;  4CJ2 A;  1IOS A;  4I0C A;  1CJ8 A;  2Z12 A;  3LYM A;  4I8S A;  4J7V A;  4QEQ A;  2LZT A;  4LYB A;  3HBH A;  2A7F A;  2BQI A;  2GV0 A;  1LZ9 A;  3AYQ A;  1LJH A;  1PZY A;  3LN2 A;  4MST A;  208L A;  4PGJ B;  3TXF A;  3QE8 A;  1LHH A;  3WL2 A;  4WL6 A;  4H9I A;  2BQB A;  1MLC E;  1WVV A;  2MEC A;  4B0D A;  2YBH A;  3P64 A;  3WMK A;  1IWU A;  5FST A;  4G49 A;  1C10 A;  1HHL A;  2ZQ3 A;  3AZ6 A;  1VDP A;  2B5Z A;  4B49 A;  4NHT A;  1LKS A;  2FBD A;  3N9E A;  2Z39 A;  4DDB A;  5LA8 A;  4FDY A;  1D0K A;  4J1B A;  1V7T A;  2YBL A;  3M3U A;  1CJ9 A;  4WO9 A;  2CDS A;  1LJJ A;  4KL7 A;  3A94 A;  4KXI A;  4LYC A;  4ZFP A;  2IFF Y;  4LGK A;  3G3B B;  134L A;  1GF8 A;  1VDT A;  5LIN A;  4RDS A;  4NFV A;  1GWD A;  1HEW A;  1LMA A;  1OUD A;  2Z37 A;  2HED A;  4RLN A;  1JKC A;  4YM8 A;  1B7O A;  1DKJ A;  3P65 A;  1FN5 A;  3W6D A;  2HEA A;  1LHL A;  4HSF A;  4WM4 A;  1B7N A;  4O34 A;  1DXJ A;  5HMV A;  1JIY A;  1GF9 A;  1BWJ A;  4NGW A;  2Z2E A;  5F9U A;  1GXX A;  1YAN A;  4H9F A;  1NBZ C;  2LYM A;  1LZC A;  3N9A A;  3W3E A;  5KXL A;  2DQI Y;  2C8P A;  4H1P A;  1CJ6 A;  3AW6 A;  1GF7 A;  1JJ1 A;  1I1Z A;  1B7R A;  1GBW A;  2RSC A;  2DQG Y;  1LHJ A;  2BQN A;  3G3A B;  4M6D A;  3TXG A;  3WVX A;  4PRQ A;  1REZ A;  1BB3 A;  1GFJ A;  4DD9 A;  4H9H A;  1HEN A;  5FCP A;  3LZT A;  3TMX A;  1FLU A;  5IHG A;  5FEL A;  4BAF A;  4XJB A;  5L9J A;  1LMT A;  1IP2 A;  1QDT A;  3BKH A;  1TBY A;  3TXB A;  4R6C A;  4WM3 A;  3ULR A;  5KXT A;  1MEL L;  4J0L A;  4N8Z A;  3WUM A;  1GF6 A;  1DKK A;  1FLQ A;  2DQE Y;  3AGH A;  1LSC A;  3HFM Y;  4HTN A;  4NWH A;  4OWE A;  4WM5 A;  5I4Y A;  4ETD A;  4LZT A;  1GBS A;  1IOT A;  1GB3 A;  3AW7 A;  4PRU A;  6LYT A;  1LSF A;  2BLX A;  5FDJ A;  2HEF A;  2LYO A;  1KIQ C;  3WUN A;  1C45 A;  4NSJ A;  1LJF A;  5AMY A;  5K7O A;  2LHM A;  1E8L A;  4GCE A;  1HSX A;  1GE4 A;  4IAT A;  5LVI A;  3CSQ A;  3IJU A;  1HEQ A;  1OUB A;  133L A;  1RJC B;  2MEH A;  1D6Q A;  3A3R X;  5EBH A;  5B07 A;  1XSF A;  1G7L C;  4N1C C;  4KT3 A;  3WH1 A;  5LYT A;  1IC4 Y;  4NHS A;  5I4W A;  2HU1 A;  2BQJ A;  4DD2 A;  1IC5 Y;  5LVH A;  3GXR A;  4NG1 A;  5I4X A;  4B4J A;  3CT5 A;  4G9S A;  1LHI A;  1LMP A;  4GN4 A;  5LVG A;  5M1Y A;  1B9O A;  5APF A;  1ALC A;  4H90 A;  1W6Z A;  5APD A;  3A3Q A;  5HNL A;  2HUB A;  1YQV Y;  1ZMY L;  5I54 A;  1VFB C;  1IP4 A;  1C43 A;  1LSG A;  4NHP A;  4RW2 A;  1RFP A;  4AGA A;  194L A;  1NDG C;  1QTE A;  1REY A;  3WVY A;  5KKJ A;  2G4P A;  2A7D A;  1YIL A;  3B0I A;  5L3I A;  2HEB A;  2W1M A;  2HTX A;  1JTT L;  1LOZ A;  4H94 A;  1G7M C;  4LT3 A;  1UBZ A;  3IWR A;  5KXP A;  2BQO A;  3BKV A;  1UIG A;  1QSW A;  4XJD A;  9LYZ A;  1XGQ C;  1LZY A;  3J6K A;  1RI8 B;  5LAG A;  4G4B A;  3TXJ A;  4TTD A;  5C6I A;  1IX0 A;  4NEB A;  1GD6 A;  2I25 L;  2FYC A;  4TSB A;  3EXD A;  1JWR A;  5IDD A;  4EOF A;  1GFK A;  1GAZ A;  1UUZ C;  4DT3 A;  1GFV A;  4NSH A;  4LYZ A;  1GB8 A;  3OJP A;  1W08 A;  4NGV A;  4GLA A;  3WUA A;  1IY4 A;  1UIF A;  2X0A A;  1LZR A;  1B7L A;  2W1X A;  4HV2 A;  3E3D A;  1C7P A;  2H5Z A;  1B7P A;  1Z55 A;  1GFA A;  4H93 A;  4DYG A;  5LA5 A;  1G7I C;  1LJI A;  3J4G A;  3AGI A;  3P4Z A;  4EMN A;  1LYO A;  1BWH A;  1JTO L;  4UWN A;  4UWU A;  2BQF A;  1LJ3 A;  1XEK A;  1XEI A;  2ZYC A;  4XEN A;  4WMG A;  4XYY A;  2BQH A;  1LZ8 A;  4GLV A;  1EQE A;  1QIO A;  3TMU A;  1F0W A;  4W96 A;  1IR9 A;  1ZV5 L;  2MEB A;  1T3P A;  1XGR C;  1BHZ A;  3LHM A;  3D9A C;  4WM6 A;  4DWX A;  1OUJ A;  3D3D A;  5I53 A;  4WOA A;  1RE2 A;  1HFX A;  1GAY A;  4HTK A;  2F30 A;  4U3X B;  1JIS A;  1NHE A;  1YKZ X;  1V7S A;  4RW1 A;  2DQD Y;  1YAQ A;  2IHL A;  4HJY A;  1B5Y A;  1NBY C;  4Z3M A;  4Z41 A;  2D4I A;  4B1A A;  3P68 A;  154L A;  1C46 A;  1JTP L;  3W6F A;  1LZ5 A;  1IC7 Y;  1BB7 A;  3ZVQ B;  1JSF A;  4NGL A;  1FKQ A;  4XJH A;  1OUA A;  1GB6 A;  5E4P A;  5DL9 A;  2BQC A;  1OUE A;  1FBI X;  1LHM A;  1JUG A;  4C5F A;  5JEN B;  1BVX A;  3M18 B;  4NSI A;  1QQY A;  2XJW A;  4WM1 A;  3ATO A;  3WU7 A;  1DQJ C;  3TXE A;  3A8Z A;  4HJV A;  1EQ5 A;  3RZ4 A;  2ZYP A;  5D5C A;  4BAD A;  1LSB A;  5LAF A;  4ET9 A;  132L A;  4OWC A;  5C6J A;  1LSZ A;  2MED A;  5B05 A;  4LYO A;  4XJF A;  3P66 A;  1AM7 A;  1JJ3 A;  1LHK A;  1D0L A;  1G7J C;  4BAP A;  1LZD A;  1LZB A;  2H9K A;  1CKH A;  1VED A;  5D5F A;  4N1E I;  3CSZ A;  1H87 A;  1KIP C;  6LYZ A;  3SP3 A;  1CNS A;  1LJK A;  1LMO A;  1UIA A;  1HER A;  4ETC A;  4ET8 A;  3CT1 A;  3TXI A;  1HC0 A;  4NG8 A;  3B0K A;  2BQA A;  2YBJ A;  3FE0 A;  1CJ7 A;  4DDA A;  1PS5 A;  3RNX A;  2D4K A;  4LT2 A;  1IWW A;  1AKI A;  1BVK C;  4J1A A;  2D6B A;  5KXZ A;  1LZ1 A;  5F9X A;  1NWG A;  5DN4 A;  2DQA A;  4NHQ A;  1CKF A;  4E3U A;  1LSM A;  1JSE A;  1UCO A;  4HPI A;  1IR8 A;  1BWI A;  2G4N A;  4DD3 A;  4II8 A;  4CFO A;  3B6L A;  5B1F A;  3RT5 X;  1HML A;  4L41 A;  3CB7 A;  1B2K A;  1SLY A;  1REM A;  1TCY A;  4OW1 A;  2D4J A;  3GXK A;  2HEC A;  1GB0 A;  3EMS A;  2MEF A;  3MGW A;  4NGY A;  4P2E A;  4CHX A;  4HTQ A;  1GEZ A;  3RU5 A;  4XAD A;  1IWX A;  4TSC A;  1IWV A;  2DQJ Y;  1WQO A;  1XGU C;  2MEI A;  4OWB A;  4DD1 A;  4HV1 A;  3A34 A;  4G4C A;  1B5X A;  2DKV A;  5LYZ A;  1DI4 A;  1LTM A;  1WTM A;  5I5Q A;  3VWO A;  5C6L A;  5II3 A;  1LZ6 A;  4MCK A;  1YIK A;  3ATN A;  1CKG A;  4TX7 A;  3T6U A;  1LZN A;  5FEK A;  3AJN A;  5HNC A;  4YEO A;  4R0F A;  5FHW A;  1B7M A;  4NHI A;  1XGT C;  3KAM A;  2I26 L;  1IP1 A;  3B72 A;  1GDX A;  1OUC A;  1LMQ A;  1P2C C;  4BS7 A;  5ILF A;  1NMM A;  4GN3 A;  2MEG A;  4XJI A;  1VAT A;  2EIZ C;  3IJV A;  4XN6 A;  1LCN A;  1WQM A;  1G7H C;  5LYM A;  1FLY A;  1A2Y C;  2FBB A;  5T3F A;  5KXS A;  3A90 A;  3OK0 A;  1FDL Y;  3WU8 A;  4LYT A;  5B59 A;  5KXX A;  1LZG A;  1UIH A;  4QDN A;  5KXO A;  5DN5 A;  1IY3 A;  2XBR A;  1IP6 A;  1UIE A;  1GF5 A;  1KIR C;  1XEJ A;  5KXY A;  1F6R A;  3A67 Y;  1JKD A;  4NWE A;  2ZWB A;  5HMJ A;  1A4V A;  1TDY A;  1YAM A;  1F6S A;  1NF5 A;  2Y8P A;  1J1P Y;  207L A;  2YBN A;  1LZ4 A;  2MEE A;  1WTN A;  1B5V A;  1HEO A;  2FYD A;  1GF4 A;  1SQ2 L;  1OQM A;  1HEL A;  153L A;  4UWV A;  2Z18 A;  3A92 A;  1GFR A;  1LJE A;  1EL1 A;  2VB1 A;  4DD0 A;  1LZT A;  3AZ7 A;  1TEW A;  135L A;  1QDR A;  2C8O A;  4KPM A;  5KJ9 A;  4XJG A;  1N4F A;  3F6Z A;  1JKB A;  3CQL A;  1YKX X;  4NGJ A;  4NIJ A;  4OWH A;  4WO6 A;  1HNL A;  1JPO A;  3WXU A;  1GB2 A;  1GFH A;  1BB4 A;  1LMN A;  1DPX A;  5HQ1 A;  1JHL A;  1HF4 A;  2YVB A;  1WQN A;  1B5W A;  4MR1 A;  1WVU A;  2BQM A;  3TXH A;  1YRO A;  1KXW A;  2YSS C;  1HSW A;  1LSY A;  2YBM A;  3A6C Y;  3TMW A;  2CGI A;  1GFT A;  1I20 A;  2YDG A;  3WW5 A;  3WPJ A;  4CGE A;  5KKI A;  3HBD A;  4M4O A;  1D6P A;  4GCF A;  1GDW A;  4H9A A;  1FLW A;  1CKC A;  2WAR A;  1DI5 A;  3LYO A;  2N5Z A;  1D0M A;  4LFP A;  2BQK A;  2G4Q A;  1J1O Y;  2DBT A;  4N5R A;  4ZIX A;  2MEA A;  4ANR A;  2LZ2 A;  2ZIL A;  1LJN A;  5B1G A;  4OOO A;  1LSA A;  1QUS A;  1GB5 A;  1ZVH L;  2PC2 A;  4NGI A;  3WXT A;  5KXW A;  1HFZ A;  1EQ4 A;  2BQD A;  1LYZ A;  4HP0 A;  4WLX A;  193L A;  1JEF A;  4TUN A;  3QNG A;  1OUF A;  3WPK A;  1T6V L;  7LYZ A;  1LSN A;  4GCC A;  1IOR A;  1C08 C;  2Z2F A;  1F10 A;  3HBE X;  3AZ4 A;  3LZ2 A;  1OP9 B;  4ZEE A;  4H9B A;  5L3H A;  4CFP A;  2CJL A;  2Q0M X;  4PHI A;  3N9C A;  4G4H A;  4WG1 A;  4WLT A;  4Z46 A;  1YL1 X;  4ETB A;  1IP5 A;  1LPI A;  1IEE A;  5LVK A;  5DM9 A;  3TXK A;  1GE0 A;  2EKS C;  1LZE A;  5A3Z A;  1WQQ A;  1GEV A;  5DLA A;  1HFY A;  5LXW A;  1FKV A;  1IR7 A;  1UIB A;  1LYS A;  4QGZ A;  1UIC A;  1BQL Y;  3W6B A;  5IEL A;  1GFE A;  1GXV 2;  2W1L A;  3QY4 A;  1AZF A;  8LYZ A;  2HU3 A;  1KXY A;  4B4E A;  4NSG A;  2Z19 A;  2EPE A;  1REX A;  1XFP L;  5J7C A;  1IO5 A;  1VDS A;  1YKY X;  3EBA B;  2CWI A;  1GB9 A;  4TWS A;  3WU9 A;  4YEN A;  1B7S A;  1LAA A;  4YEM A;  1IIZ A;  1VAU A;  2YBI A;  4HPE A;  1GE2 A;  2BQL A;  3CSR A;  1DPW A;  4LT0 A;  4LYM A;  1J1X Y;  5KXR A;  1WQP A;  3W6E A;  2F2N A;  3CT0 A;  2Z38 A;  4H8X A;  4LFX A;  1LZA A;  1B5Z A;  1NDM C;  4A7D A;  2BQE A;  1YL0 X;  1OUI A;  3WPL A;  4LT1 A;  2LYZ A;  2DQH Y;  4W94 A;  3T36 A;  1GBZ A;  2H9J A;  1IP7 A;  4QY9 A;  3AB6 A;  2EQL A;  1IWT A;  4H8Y A;  1AT6 A;  4N0J A;  1GFG A;  5E9R A;  2W1Y A;  1GB7 A;  4RLM A;  5A3E A;  1GE1 A;  4H91 A;  1D9U A;  2BLY A;  2XTH A;  5KXK A;  2I6Z A;  4OOT A;  3K3T A;  3A6B Y;  5F16 A;  2ZQ4 A;  4ETA A;  4YF2 A;  1GF3 A;  4IJ4 A;  4HJZ A;  3A93 A;  1OUH A;  1B0D A;  1YAO A;  3AZ5 A;  1CKD A;  3FI7 A;  2BPU A;  2F4G A;  3LYT A;  4IAS A;  1NKH A;  1TAY A;  3WYH A;  1GE3 A;  3ZVQ A;  4ETE A;  4H8Z A;  3LYZ A;  2ZIJ A;  3TXD A;  1INU A;  1HMK A;  1GPQ C;  1QSA A;  4NGZ A;  1GBY A;  2D91 A;  3WUL A;  4N9R A;  4NGO A;  4YOP A;  1BB5 A;  1IOQ A;  1VDQ A;  4DD7 A;  1IWZ A;  2HEE A;  1QUT A;  1GF0 A;  3WW6 A;  4OWA A;  1LJ4 A;  4NY5 A;  3AGG G;  2BAA A;  3EO5 A;  1QTK A;  4WLD A;  1GFU A;  4WLY A;  1O23 A;  2NWD X;  1LSE A;  1LJG A;  1B7Q A;  1HEM A;  1UAC Y;  4Z98 A;  1KXX A;  5KXN A;  4D9Z A;  2DQC Y;  5F14 A;  1I56 A;  1H6M A;  1UID A;  2ZIK A;  5B06 A;  1LSP A;  4WM2 A;  3A96 A;  3A95 A;  1UC0 A;  4GN5 C;  1UA6 Y;  4PPO A;  4X3B A;  1RCM A;  1AT5 A;  1WQR A;  4DC4 A;  1GBO A;  1YAP A;  1JJ0 A;  1NQI A;  1XGP C;  2DQF C;  1DZB X;  1JIT A;  4WL7 A;  3B0O A;  4GCB A;  2ZNW Y;  3RW8 A;  2XBS A;  1OUG A;  1IWY A;  5APE A;  5HLL A;  4WG7 A;  4GCD A;  2ZNX Y;  1DI3 A;  4C3W A;  1GHL A;  4H9E A;  1GBX A;  1LMC A;  1LSD A;  1LYY A;  3W6C A;  4H9C A;  4DDC A;  2AUB A;  5KY1 A;  4H92 A;  1IVM A;  1BGI A;  5KXM A;  3TMV A;  5LVJ A;  5APC A;  4PJ2 C;  3ZEK A;  3A91 A;  4ML7 A;  1BB6 A;  1ZVY B; 
#chains in the Genus database with same CATH topology
 1LWK A;  1QZM A;  1LKR A;  1QTD A;  1L61 A;  126L A;  3ZC7 B;  4GBR B;  3SYK A;  5F81 A;  3KS8 A;  3NWL A;  3TWM A;  2LXE A;  4RF0 A;  1IOS A;  1LWG A;  3DN2 A;  4I0C A;  3LYM A;  4ZPX A;  4QEQ A;  2LZT A;  3HBH A;  2A7F A;  155L A;  5JI2 E;  3AYQ A;  3SC3 A;  1QUD A;  4PGJ B;  3QAK A;  3TXF A;  3QE8 A;  1L21 A;  3WL2 A;  3DKE X;  4G4O A;  4RNA A;  4B0D A;  2KZU A;  1GO5 A;  1C10 A;  172L A;  1NNU C;  1VDP A;  1WGN A;  4R71 A;  3SAU A;  4NHT A;  3R9X B;  3N9E A;  2Z39 A;  3GUJ A;  4J1B A;  1CJ9 A;  5EXX A;  2CDS A;  2FOI C;  1WGL A;  2LVQ D;  1C6A A;  4QNR A;  4NXN M;  200L A;  4CIZ A;  3L29 A;  2UUB M;  3CF2 A;  2O01 F;  5LIN A;  4NFV A;  1L73 A;  3DN8 A;  1L05 A;  4EKS A;  1JKC A;  1DKJ A;  2HEA A;  2XFS A;  4WM4 A;  218L A;  1DXJ A;  5HMV A;  1BWJ A;  4NGW A;  222L A;  4NOO B;  1NY6 A;  4H9F A;  2KRK A;  2H1R A;  1WJ7 A;  2EUC A;  3DOA A;  3T6P A;  1LHJ A;  1GKI A;  1L85 A;  1BB3 A;  232L A;  4AI6 A;  5FCP A;  163L A;  3TMX A;  1NV8 A;  4LG2 A;  4BAF A;  4XJB A;  3SBB C;  1LMT A;  1GVN A;  3TXB A;  4WM3 A;  5KXT A;  3AGH A;  1FLQ A;  1LSC A;  3LW5 F;  1V33 A;  4ETD A;  1IOT A;  4PRU A;  5FDJ A;  159L A;  3BXW A;  1LJF A;  5AMY A;  2DKL A;  170L A;  1L68 A;  1E8L A;  1QTZ A;  4IAT A;  5LVI A;  5EBH A;  1HEQ A;  133L A;  1L77 A;  1L51 A;  5DFL A;  4LJ9 A;  4B4J A;  151L A;  1LMP A;  5M1Y A;  1B9O A;  2M5Z A;  3GLF A;  239L A;  4H90 A;  1W6Z A;  5HNL A;  209L A;  1YQV Y;  1ZMY L;  4IBK A;  2DEN A;  1LSG A;  3NYA A;  4NHP A;  4RW2 A;  1RFP A;  3WVY A;  1REY A;  1C61 A;  1YIL A;  2QP9 X;  2HEB A;  3C9P A;  1JTT L;  4W55 A;  1LOZ A;  1IN7 A;  4I7P A;  2QQ8 A;  1UBZ A;  5KXP A;  3BKV A;  1UIG A;  3J6K A;  240L A;  3TXJ A;  1IX0 A;  1L49 A;  4Z8X A;  2NQ8 C;  5FLX S;  4EOF A;  3HH6 A;  4YXC A;  4NGV A;  4GLA A;  1UIF A;  1LZR A;  2CHV A;  4REZ A;  2HHH M;  1G0L A;  2H5Z A;  2DWM A;  4IBD A;  4H93 A;  4KLN A;  4RF1 A;  1LYO A;  5C1B A;  253L A;  1JTO L;  4UWN A;  3M7G A;  4BLC A;  261L A;  2BQF A;  1XEK A;  2ZYC A;  2Y0Q A;  4WMG A;  1C6E A;  3TMU A;  4M9Z A;  1L15 A;  1DGH B;  1K28 A;  3D9A C;  1L36 A;  1R4G A;  1L28 A;  3FTD A;  2V6Z M;  1L92 A;  1L1Z A;  2R18 A;  3FTC A;  4HTK A;  1JQU A;  1P37 A;  1V7S A;  4RW1 A;  4FCT A;  2DQD Y;  3HDE A;  1NBY C;  4B7H A;  1LZ5 A;  1G4A E;  1BB7 A;  3ZVQ B;  3SB5 A;  4XJH A;  1LI6 A;  1FBI X;  1LHM A;  3L25 A;  1JUG A;  5JEN B;  4CIS A;  1B6I A;  2XJW A;  3TXE A;  3A8Z A;  4HJV A;  1EQ5 A;  1C64 A;  1TF0 B;  1G41 A;  5LAF A;  4OWC A;  5GKN A;  1CTW A;  1LSZ A;  4XJF A;  3P66 A;  1D0L A;  1G7J C;  4BAP A;  1CKH A;  3KOZ E;  1VED A;  5D5F A;  4JI0 M;  5EP3 A;  3SBJ A;  1CNS A;  4ET8 A;  3TXI A;  152L A;  3B0K A;  2YBJ A;  3FE0 A;  3OE9 A;  4DV7 M;  1J5E M;  1AKI A;  1BVK C;  4J1A A;  1LZ1 A;  1D2N A;  5F9X A;  4I8O A;  4W53 A;  1SX7 A;  4QNM A;  2Z3X A;  2LWX A;  4LF4 M;  1IR8 A;  1BWI A;  1G0M A;  4II8 A;  2F47 A;  1ZV1 A;  1TCY A;  3NBX X;  4L8R C;  1QSQ A;  2D4J A;  2O79 A;  3GXK A;  3RU5 A;  4TSC A;  2DQJ Y;  1F4I A;  4DD1 A;  4IAP A;  2DKV A;  4D81 A;  1LTM A;  3VWO A;  2VF8 A;  1LZ6 A;  3ATN A;  4OW0 A;  4TX7 A;  2R0I A;  3AJN A;  2RBO A;  1XWI A;  1B7M A;  4I7Q A;  1CU5 A;  4BS7 A;  5ILF A;  4PT5 A;  4GN3 A;  2MEG A;  4XJI A;  4FWG A;  4NSO B;  3IJV A;  238L A;  1L84 A;  2QHO B;  1LCN A;  1WQM A;  1FLY A;  3PNY A;  2FBB A;  5T3F A;  1L30 A;  3OK0 A;  1FDL Y;  5KXX A;  4W52 A;  5DN5 A;  1PQJ A;  1L2C A;  1F6R A;  2VQF M;  1L57 A;  4I81 A;  2R65 A;  5HMJ A;  3LVW A;  1A4V A;  2YBN A;  1NF5 A;  1J1P Y;  2MEE A;  1B5V A;  1HEO A;  2FYD A;  1GF4 A;  1SQ2 L;  1OQM A;  2Z18 A;  1PQO A;  2V1U A;  1FNN A;  4I4L A;  1GFR A;  1EL1 A;  1HNW M;  4KPM A;  3ILK A;  3CQL A;  4NIJ A;  2RBS A;  233L A;  1LYH A;  2O7A A;  1QUH A;  1XJU A;  3WXU A;  3GQ4 A;  4ARL A;  2Y20 A;  3A45 A;  1JHL A;  1NV9 A;  3TQS A;  1T8A A;  3UJN A;  1KXW A;  2YSS C;  1HSW A;  3TMW A;  1D3N A;  4LZJ A;  1XJT A;  4CGE A;  4UN2 B;  1L14 A;  1L62 A;  1IN8 A;  4H9A A;  3TL4 X;  4G3O A;  2DAM A;  3LYO A;  3DA1 A;  3RE8 A;  4LFP A;  3LVV A;  2I7N A;  1J1O Y;  1HNX M;  3HU1 A;  2LZ2 A;  4TUW A;  2ZIL A;  2LHG A;  166L A;  4JN6 A;  1GAB A;  156L A;  1L63 A;  1LSA A;  4NGI A;  1OVH A;  1HFZ A;  1EQ4 A;  2BQD A;  3GLI A;  2QSF X;  4IBJ A;  3K9O A;  1LSN A;  3OE0 A;  4II7 A;  1CUK A;  3T1Y M;  1L07 A;  1VDL A;  5EXS A;  4H9B A;  4CGY B;  249L A;  212L A;  4WG1 A;  4WLT A;  1IEE A;  1L58 A;  2JNH A;  4LF5 M;  5DM9 A;  3TXK A;  1L87 A;  4IBF A;  2EKS C;  1LZE A;  1GEV A;  1OFH A;  1IR7 A;  1Z5B A;  3UZU A;  2JUJ A;  1LYS A;  1QT4 A;  4EKP A;  2UUC M;  1Q3C A;  3W0L B;  5IEL A;  4DV6 M;  1L79 A;  1C62 A;  4AG5 A;  2HU3 A;  2Z19 A;  3J27 B;  199L A;  1YKY X;  1VAU A;  1QT8 A;  2D7G A;  4DR5 M;  3CDR A;  1DPW A;  1FJG M;  1L2D A;  1PQD A;  3EIE A;  131L A;  1NJG A;  3KOX E;  1L34 A;  3CT0 A;  4GRV A;  1LYD A;  255L A;  2B7X A;  3PFI A;  4S0W A;  1LGX A;  1L1T A;  2DQH Y;  4W94 A;  3T36 A;  1GBZ A;  3VK8 A;  2H9J A;  4QY9 A;  4I7T A;  4JI1 M;  4GIT A;  1IWT A;  5E9R A;  103L A;  1GB7 A;  5A3E A;  2RKO A;  1GE1 A;  2BLY A;  2KDL A;  2I6Z A;  3K3T A;  2DHY A;  5F16 A;  4ETA A;  186L A;  1CU0 A;  3SBA A;  1AUA A;  5EXT A;  3HU8 A;  1KW7 A;  3U61 B;  3IHP A;  1JQJ C;  2FE8 A;  3FA0 A;  3B7Z A;  1B0D A;  1QUG A;  4GHA A;  2F4G A;  3U6L A;  3FI7 A;  2HUM A;  4IAS A;  3OTO M;  3CTW B;  4JYA M;  1XMO M;  4XK8 F;  4I7N A;  3HDF A;  3LYZ A;  2ZIJ A;  1GBY A;  3PBL A;  1HT1 E;  3IEC A;  1BB5 A;  4B3R M;  1C6M A;  1IOQ A;  1VDQ A;  3VDP A;  2DI0 A;  1DYE A;  3LQR A;  1IWZ A;  2BNK A;  3FUW A;  4JI2 M;  236L A;  4IBI A;  4R3D A;  4GH9 A;  1QTK A;  1GFU A;  1L98 A;  1O23 A;  2WSE F;  1Z6T A;  1UAC Y;  1B7Q A;  4Z98 A;  4X62 M;  4W56 A;  2DQC Y;  1UID A;  1L46 A;  5B06 A;  1LSP A;  3A96 A;  189L A;  1AT5 A;  1WQR A;  1D9W A;  3K2R A;  1OFI A;  4DC4 A;  1YAP A;  1NO1 A;  1JJ0 A;  1DZB X;  5LMN M;  2H5X A;  4GHL A;  130L A;  1D3M A;  2RBN A;  4WL7 A;  2YFQ A;  1IWY A;  1KFV A;  181L A;  1E32 A;  1K3W A;  1DI3 A;  2K0B X;  1GHL A;  1PJQ A;  1LYY A;  3W6C A;  5KY1 A;  4H92 A;  1L75 A;  1C67 A;  1BGI A;  5LVJ A;  3I51 A;  3IG5 A;  1L67 A;  2DWZ B;  3GUL A;  1ZMW A;  4NGK A;  1LZS A;  2F4A A;  1L99 A;  3W6A A;  1B5U A;  2DNA A;  2BQG A;  5LIO A;  1GL6 A;  5ILC A;  3U6M A;  4CJ2 A;  3HHW A;  5C18 A;  3K8Z A;  1IXS A;  4DV0 M;  1DYD A;  2BQI A;  214L A;  4GC9 A;  1PZY A;  1L53 A;  2Z7J A;  5FTL A;  3H4M A;  4MST A;  208L A;  4OVZ A;  3SAW A;  1YLA A;  4M9S A;  129L A;  1LHH A;  4WL6 A;  1G1V A;  1MLC E;  4QHS A;  2BQB A;  1NJF A;  256L A;  1IWU A;  5FST A;  3FE3 A;  1IY0 A;  1TH3 A;  1HHL A;  3KP0 E;  2B5Z A;  2A5Y B;  1LKS A;  2J5Y A;  1L11 A;  3SN6 R;  4DR7 M;  4DDB A;  5LA8 A;  1V7T A;  2YBL A;  3JR4 A;  1SXJ A;  3CDO A;  4HL4 A;  4WO9 A;  4LDL A;  3SMS A;  2DHR A;  3SB6 A;  1LJJ A;  1C65 A;  1G0Q A;  3A94 A;  4ZFP A;  4IJF A;  4LGK A;  3G3B B;  1GF8 A;  1P3N A;  1VDT A;  1I94 M;  182L A;  1GWD A;  1N75 A;  1OUD A;  2R45 A;  4DR6 M;  4IBC A;  4Q7J A;  4HSF A;  4IBG A;  3MJ5 A;  196L A;  1VG5 A;  1HJP A;  247L A;  5F9U A;  1GXX A;  1YAN A;  4LF6 M;  4W5W A;  3D8B A;  185L A;  1XXH E;  5KXL A;  1CJ6 A;  1JJ1 A;  2L4E A;  3G3A B;  2WSF F;  2DQG Y;  242L A;  3KOW E;  219L A;  2QEN A;  1HEN A;  1G06 A;  4H9H A;  5IHG A;  5IRE B;  1L10 A;  5ITX E;  3F8V A;  5FEL A;  4FCV A;  5L9J A;  4DR4 M;  3BKH A;  2KNV A;  3GPP A;  1Z59 A;  4J0L A;  4I7L A;  3WUM A;  4WM5 A;  3J80 S;  3HFM Y;  4HTN A;  1VDD A;  3L2X A;  4NWH A;  1P2R A;  2BJV A;  3AFH A;  1GB3 A;  2HEF A;  1KIQ C;  3WUN A;  5ITR A;  3CSQ A;  2MEH A;  3GUN A;  1L89 A;  2F2Q A;  3RZE A;  5LYT A;  1IC4 Y;  1L86 A;  3NY8 A;  4DD2 A;  3GXR A;  4NG1 A;  1QT3 A;  3CT5 A;  4ARJ A;  2G3Q A;  1C6J A;  1NSF A;  2F32 A;  1YE9 A;  1C6G A;  5APD A;  2QNJ A;  3A3Q A;  2HUB A;  4ARM A;  4KOD A;  1CU3 A;  1C43 A;  1OAO C;  1QAM A;  2L7I A;  1L96 A;  5KKJ A;  3HJQ A;  2VII A;  2XSZ D;  3WHK A;  2BQO A;  4PDG A;  4XJD A;  1XGQ C;  1RI8 B;  3C8Q A;  5C6I A;  4NEB A;  1GD6 A;  2I25 L;  5JI3 E;  1L27 A;  1AIP C;  1GFK A;  4DT3 A;  4NSH A;  2EKF A;  1GB8 A;  4ITQ A;  2XH9 A;  5IT9 S;  3WUA A;  7CAT A;  5A2Q S;  128L A;  2WZJ A;  3T1H M;  4JI6 M;  4ARP A;  4KT0 F;  3GQ5 A;  1LJI A;  4EMN A;  3CF6 E;  3SB8 A;  4UWU A;  2RGH A;  1XEI A;  110L A;  262L A;  3DNA A;  1EQE A;  1LI3 A;  188L A;  2OO9 A;  1IN4 A;  1L04 A;  2MEB A;  5KO3 A;  2XLJ A;  2OQ4 A;  4WM6 A;  1NHB A;  5FTN A;  1GAY A;  1L66 A;  2QAR C;  1OQY A;  1L80 A;  1YAQ A;  220L A;  4LRS A;  1HNZ M;  1C46 A;  3HGI A;  2LNH C;  3U6C A;  1L2B A;  3KW6 A;  1JSF A;  3VW7 A;  2CP8 A;  1FKQ A;  4B7F A;  5DL9 A;  3B7Q A;  3J2P B;  4C5F A;  5KQD A;  4BB9 A;  1LYI A;  3ATO A;  4YXA C;  1L81 A;  3U5Z B;  1T6O A;  1I6S A;  4JI4 M;  4BAD A;  3FI5 A;  4ET9 A;  132L A;  2ZAN A;  3BOS A;  1NVM A;  5C6J A;  2Q9D A;  1L83 A;  4G6Z A;  1AM7 A;  3M0E A;  2R46 A;  137L A;  1IY1 A;  2B72 A;  1LZB A;  2OTY X;  1PQM A;  4N1E I;  3CSZ A;  1H87 A;  1NNJ A;  3SP3 A;  1LJK A;  2JZ1 A;  3C3D A;  1DYG A;  2OU8 A;  1Q3B A;  4LZM A;  3FYD A;  1KYI A;  1HC0 A;  3KS4 A;  2E5L M;  4LJA A;  1WXQ A;  4F2L A;  1CJ7 A;  4DDA A;  2L2D A;  3AV0 A;  2D4K A;  3LZM A;  2B6W A;  1IWW A;  2D6B A;  5KXZ A;  4MH0 E;  1NWG A;  2Q2E B;  1CKF A;  4E3U A;  1LSM A;  1UCO A;  4HPI A;  1YSY A;  2JY6 B;  2G4N A;  3SAR A;  3B6L A;  1CV3 A;  3RT5 X;  2OU0 X;  3CB7 A;  157L A;  2WSC F;  4OW1 A;  2CHQ A;  2R62 A;  3MGW A;  3VKG A;  1C68 A;  1LGU A;  4HTQ A;  1GEZ A;  1IWX A;  1L8Q A;  1WQO A;  1XGU C;  5KQ8 A;  4OWB A;  5DYG A;  1L24 A;  4HV1 A;  3A34 A;  1E9S A;  1SSY A;  2Q9E A;  2HUL A;  1UM8 A;  1C6D A;  1WTM A;  5C6L A;  2B74 A;  5II3 A;  1YIK A;  4LJ8 A;  3U6P A;  1CKG A;  1LZN A;  5FEK A;  4R0F A;  4NHI A;  251L A;  3F9L A;  1IP1 A;  107L A;  1GDX A;  1OUC A;  1J7K A;  3GRY A;  1VAT A;  3HH4 A;  4XN6 A;  1IXZ A;  1G7H C;  5LYM A;  1L39 A;  3HUK A;  1A2Y C;  1L42 A;  1QT6 A;  5KXS A;  1JTM A;  5KXO A;  1IY3 A;  1LV7 A;  3HTB A;  2KZS A;  2XBR A;  4WP2 A;  227L A;  3GQ3 A;  1GF5 A;  1MN3 A;  1XEJ A;  3SYL A;  1PRB A;  3C82 A;  2ZWB A;  123L A;  1TDY A;  1F6S A;  3GLG E;  1HEL A;  3WHL A;  3A92 A;  3HWL A;  144L A;  1L00 A;  2KRU A;  1LJE A;  2VB1 A;  1T3T A;  229L A;  4IJE A;  3C3E A;  1LZT A;  1SWY A;  5I14 A;  1Z5C A;  2C8O A;  5KJ9 A;  3F6Z A;  1OIP A;  4NGJ A;  4DV2 M;  4OWH A;  2RGO A;  1QT5 A;  2D7H A;  2C99 A;  4IIW A;  1HNL A;  3SFZ A;  4L6V 6;  1WR1 B;  4AQY M;  1DPX A;  5HQ1 A;  2YVB A;  3TXH A;  1YRO A;  2A4T A;  3P65 A;  1LSY A;  1CU2 A;  1I20 A;  235L A;  3GLH E;  2YDG A;  3WW5 A;  3TWL A;  1D6P A;  201L A;  4GCF A;  1P2L A;  1R5L A;  244L A;  3HU9 A;  1CKC A;  3C8R A;  2WAR A;  1DI5 A;  4ZIX A;  4LFA M;  216L A;  2JY7 A;  3HT7 A;  3I04 M;  3C81 A;  1QTB A;  1GB5 A;  2PC2 A;  3WXT A;  2MRO B;  4QHT A;  3THG A;  195L A;  4XGI A;  4WLX A;  193L A;  1OUF A;  4I7O A;  4L78 A;  3QWL A;  3TE6 A;  3DN0 A;  3HBE X;  3LZ2 A;  1ZQ9 A;  3QYE A;  1C6T A;  3G3X A;  1HR0 M;  2V1C A;  4EKQ A;  3N9C A;  3R8F A;  3E46 A;  4ETB A;  1LPI A;  4GMQ A;  4DUZ M;  5LVK A;  2VDB B;  1GE0 A;  1XXH B;  1C6Q A;  1WQQ A;  1P7S A;  2ANV A;  3CDV A;  4L15 A;  1HFY A;  5LXW A;  3GRR A;  1MX0 A;  4QGZ A;  2ZTD A;  3G3W A;  1GFE A;  3IG8 A;  8LYZ A;  4DUY M;  2F5P A;  4B4E A;  2EPE A;  1REX A;  5J7C A;  3JAM S;  3U6D A;  1B7S A;  2RH1 A;  1LYG A;  1KNI A;  4HPE A;  1GE2 A;  4LYM A;  1J1X Y;  5KXR A;  3DN4 A;  1R6B X;  2XZU A;  5EQT A;  2XF3 A;  4FCW A;  2DZN B;  2K47 A;  3W68 A;  4H8X A;  1LZA A;  4A7D A;  1YUB A;  2YR0 A;  1OUI A;  4F1I A;  2B73 A;  2I7P A;  3F92 A;  3SAT A;  4H8Y A;  3FRI A;  2HUK A;  2UUA M;  1GFG A;  4RLM A;  1KY0 A;  1DGH A;  4DV1 M;  4OX9 M;  206L A;  3AOG A;  3A6B Y;  1GF3 A;  2CV2 A;  2O5R A;  250L A;  1SXJ D;  5EP4 A;  3C7Y A;  1K82 A;  192L A;  3KSJ A;  108L A;  1JR3 A;  3ZVQ A;  1QS9 A;  3A98 B;  3ZQJ A;  4LZZ A;  2MJ5 B;  1HMK A;  3AL0 C;  184L A;  1OVK A;  2DAK A;  3HT9 A;  4NRW A;  5DNY A;  1C66 A;  1TH2 A;  3OE8 A;  1L94 A;  2ZM6 M;  2B70 A;  1GF0 A;  1R2Z A;  3WW6 A;  3C8S A;  1LJ4 A;  1G0K A;  1SG9 A;  2BAA A;  1QQW A;  252L A;  4LGM A;  1LSE A;  1OTR A;  1KXX A;  5KPR A;  1I56 A;  2XGN A;  1H6M A;  114L A;  1L71 A;  2ZIK A;  2HL7 A;  2C9C A;  2MH8 A;  3HJS A;  4GN5 C;  1L76 A;  4X64 M;  4X3B A;  3GUI A;  168L A;  5H37 D;  3HUQ A;  5ITX A;  1JIT A;  1G1W A;  3B0O A;  1QTC A;  3RW8 A;  2XBS A;  3B9P A;  5APE A;  2GQF A;  5HLL A;  4DQ5 A;  4G4Q A;  4C3W A;  2J7N A;  1SWZ A;  4H9C A;  2CEA A;  1IVM A;  3B74 A;  5KXM A;  3HY5 A;  228L A;  1BB6 A;  5ITU A;  2KW0 A;  2LCB A;  2QBY B;  146L A;  1IOC A;  5EP2 A;  1JKA A;  4AXT A;  4FJR A;  4B4I A;  2R4J A;  1C1K A;  1OVJ A;  2Z12 A;  4L16 A;  4I8S A;  2Z4S A;  4J7V A;  5KPT A;  1JB0 F;  1LJH A;  3LN2 A;  1ZMV A;  2LVP C;  1XNQ M;  4DAJ A;  1DO2 A;  1WVV A;  2MEC A;  2YBH A;  3P64 A;  3WMK A;  4I7J A;  1L22 A;  2RB1 X;  1L44 A;  246L A;  1OWY A;  2YQZ A;  4B49 A;  3B89 A;  2FBD A;  3UON A;  4PCZ A;  4AKH A;  1D0K A;  3M3U A;  1L82 A;  3AKZ A;  1C7Y A;  3K2L A;  4KXI A;  4GIP A;  2B6X A;  4LYC A;  1QT7 A;  4DR2 M;  1DYB A;  2OE7 X;  3G3V A;  1L25 A;  2Y0T A;  4FD2 A;  177L A;  1LMA A;  2Z37 A;  4S12 A;  1KS3 A;  1P5C A;  3W6D A;  1L19 A;  3C83 A;  4WW0 A;  4QOZ C;  2BWE A;  1QAN A;  3QYB A;  1PM5 A;  4NL4 H;  2Z2E A;  4JI5 M;  1SX2 A;  1NBZ C;  1WTH A;  3N9A A;  2DAG A;  4MGY E;  4W58 A;  3W3E A;  2C8P A;  1IXR C;  3AW6 A;  3GLF E;  1I1Z A;  1B7R A;  2RSC A;  4M6D A;  5ITQ A;  3TXG A;  1C6N A;  4PRQ A;  1REZ A;  1D2Y A;  3L26 A;  176L A;  2EA0 A;  2R44 A;  2R6F A;  147L A;  3HT8 A;  1LLH A;  2ZTC A;  1CX6 A;  1TBY A;  3HX3 A;  4I5S A;  1MEL L;  2DQE Y;  4OWE A;  4DV4 M;  231L A;  4EPI A;  5I4Y A;  4LZT A;  2X4A A;  2CUU A;  3FAD A;  1IY2 A;  5K7O A;  2LHM A;  1TTE A;  1ZAE A;  1GE4 A;  1HSX A;  4GCE A;  6LYZ A;  3IJU A;  5B07 A;  1OUB A;  3A3R X;  2CV1 A;  1G7L C;  2L78 A;  3WH1 A;  142L A;  4NHS A;  3PDS A;  5I4W A;  4YHH M;  4LFC M;  1IC5 Y;  4M0W A;  4LDO A;  5LVH A;  3FRH A;  2DWL A;  4G9S A;  3W67 A;  1GL7 A;  3GO8 A;  1L69 A;  1DGB A;  1LHI A;  1DYA A;  3GLG B;  2OPF A;  1C63 A;  230L A;  223L A;  1DYF A;  1IN6 A;  5I54 A;  2DVW B;  1VFB C;  1IP4 A;  1Q02 A;  194L A;  1NDG C;  1QTE A;  2UXB M;  2W1M A;  2HTX A;  1CVK A;  3Q8G A;  4GRI A;  2C96 A;  1CUP A;  4LF8 M;  2HAK A;  3PNV A;  5LMU M;  1LZY A;  3CDQ A;  1PQK A;  1EIJ A;  2CHG A;  1ZUR A;  1Y8G A;  2FYC A;  4LF9 M;  3EXD A;  5IDD A;  4NRV A;  4L4U A;  2L6O A;  3GLH B;  1WIV A;  1GAZ A;  1UUZ C;  257L A;  1G8P A;  4LYZ A;  3OJP A;  3CF0 A;  2CFO A;  1KY1 A;  3FUV A;  4P16 A;  1VQ1 A;  1IY4 A;  2RB0 X;  2X0A A;  1L40 A;  3V2Y A;  1B7L A;  2W1X A;  4HV2 A;  2QPA A;  3DN3 A;  1C7P A;  1G3I A;  5BR8 M;  1PJJ A;  4LFB M;  190L A;  1GFA A;  2QB0 B;  5LA5 A;  1G7I C;  1OKS A;  3AGI A;  3FUU A;  2FS1 A;  3U61 A;  4BBA A;  3ODU A;  2BQH A;  1LZ8 A;  1QIO A;  1DYC A;  1F0W A;  1XGR C;  1OUJ A;  4PD2 A;  1RE2 A;  2ZAO A;  161L A;  1L13 A;  1PGY A;  2JY5 A;  4U3X B;  2LZM A;  1JIS A;  1YKZ X;  5DYI A;  4JI3 M;  1CX7 A;  1L16 A;  1B5Y A;  4Z3M A;  3TPZ A;  4B1A A;  2C9O A;  1JTP L;  4FWH A;  1N34 M;  4ARQ B;  4NGL A;  1C6K A;  5E4P A;  4NSI A;  1CUQ A;  1QQY A;  4WM1 A;  3AOE A;  4PJZ A;  2ZYP A;  3RZ4 A;  164L A;  169L A;  1LSB A;  2UU9 M;  4GKK M;  3MMP A;  1WHC A;  3E21 A;  5B05 A;  4FWD A;  4LYO A;  1JJ3 A;  2JXN A;  1L50 A;  1LZD A;  2QCU A;  1KIP C;  1UIA A;  1LMO A;  4MGH A;  2ERC A;  3CT1 A;  4NG8 A;  2G5G X;  1L0J A;  1PS5 A;  3RNX A;  4NXM M;  4D82 A;  167L A;  1IFY A;  4LT2 A;  3D4S A;  3DZD A;  2LVA A;  4KHP M;  1L91 A;  1JSE A;  4IBE A;  122L A;  1NHW C;  2GNO A;  1D3J A;  4L41 A;  1SLY A;  4AG6 A;  4B7G A;  1L97 A;  4P2E A;  1LYE A;  2MEF A;  145L A;  5LZM A;  3HTG A;  3VLF B;  1IWV A;  2LC9 A;  3HTF A;  1CU6 A;  4I7R A;  2C98 A;  2MEI A;  2NTG A;  3I01 M;  3U60 B;  1DI4 A;  3HUA A;  1L12 A;  4MCK A;  148L E;  1L54 A;  4W54 A;  5HNC A;  4ARQ A;  5FHW A;  1L23 A;  180L A;  1XGT C;  2I26 L;  3B72 A;  1N77 A;  3GPY A;  1P2C C;  4DR3 M;  3SB9 A;  2OE4 X;  1MU5 A;  3H4J A;  3KOY E;  3SAV A;  4EXM A;  3A90 A;  3WU8 A;  5B59 A;  4QDN A;  2QZ4 A;  1XMQ M;  1IP6 A;  4X65 M;  1UIE A;  4LRT A;  1KIR C;  5KXY A;  4I7K A;  2BWB A;  1CV5 A;  1T8G A;  1DGG A;  4MB7 A;  5BPV A;  4NWE A;  1P56 A;  187L A;  3GLI E;  2JP7 A;  1UFZ A;  1WTN A;  153L A;  3AOE C;  2OTZ X;  4UWV A;  3UMM A;  2Y21 A;  2B6T A;  135L A;  4AQN A;  4B3S M;  4XJG A;  1JKB A;  4WO6 A;  2D7E A;  165L A;  1JPO A;  234L A;  1GFH A;  1BB4 A;  3HTD A;  3BBZ A;  1HF4 A;  1WQN A;  1L0K A;  1JR3 D;  1WVU A;  1GJT A;  3A6C Y;  4LJ5 A;  119L A;  2B6Y A;  1GFT A;  2CGI A;  1IM2 A;  3WPJ A;  2W82 A;  5KKI A;  1XHB A;  4M4O A;  1G0J A;  226L A;  1GDW A;  1FLW A;  4B08 A;  2N5Z A;  4N5R A;  3FTE A;  2DBT A;  1PJI A;  4ANR A;  1HQY E;  4LJ6 A;  1VEJ A;  1L47 A;  1QUS A;  3U60 A;  140L A;  237L A;  1N36 M;  4W51 A;  258L A;  5KXW A;  254L A;  3DN6 A;  1LYZ A;  4W57 A;  1LW9 A;  3TWK A;  1X37 A;  1JEF A;  4TUN A;  3WPK A;  3V2W A;  7LYZ A;  4GCC A;  3VKH A;  3HHZ A;  1IOR A;  2RAZ X;  1F10 A;  3HHX A;  3AZ4 A;  4P17 A;  5L3H A;  3GUO A;  4CFP A;  1L72 A;  2CJL A;  2Q0M X;  2VF7 A;  4Z46 A;  2VQE M;  2LVN C;  149L A;  1L74 A;  4YY3 M;  2F4V M;  5A3Z A;  4MGZ E;  3NBI A;  1ORY B;  217L A;  3GLF B;  1UIB A;  4I7M A;  4NSR A;  1UIC A;  1BQL Y;  3W6B A;  2OEA X;  2O4W A;  1KXY A;  4NSG A;  1XFP L;  7LZM A;  1L38 A;  3EBA B;  4TWS A;  3WU9 A;  4YEM A;  4YEN A;  1LAA A;  2YBI A;  3A42 A;  2B6Z A;  2BQL A;  3CSR A;  4AKG A;  3EML A;  2F2N A;  3E9S A;  2DWN A;  1H6U A;  224L A;  4LFX A;  1P46 A;  1NDM C;  3QAU A;  2LTU A;  2BQE A;  1YL0 X;  1C6I A;  3LCV B;  4LT1 A;  3RGS A;  2JZ0 A;  2L7H A;  3GUK A;  1IP7 A;  3FKE A;  3FTF A;  2EQL A;  4N0J A;  3FYC A;  1LI2 A;  4H91 A;  1D9U A;  3VFD A;  3FUT A;  2XTH A;  5KXK A;  4OOT A;  3KVW A;  1G59 A;  2F5O A;  4IJ4 A;  1QSB A;  4HJZ A;  1JTN A;  4YX7 C;  173L A;  1ZMU A;  1OUH A;  4OO9 A;  1TH4 A;  1CKD A;  2BPU A;  1L35 A;  1NKH A;  3T38 A;  1TAY A;  4ETE A;  4H8Z A;  3TXD A;  1QSA A;  2OOB A;  3WUL A;  2G8L A;  2D91 A;  2XFT A;  4HEO A;  4N9R A;  4YOP A;  3ZCB B;  115L A;  1QAQ A;  1P3Q Q;  2L09 A;  3U5Z A;  3GUP A;  1QUT A;  2HCB A;  1NY5 A;  2RRU A;  1L93 A;  1P64 A;  4NY5 A;  4ZPU A;  3EO5 A;  4WLD A;  102L A;  1OAI A;  1LJG A;  5F14 A;  4EJ4 A;  4PK0 A;  1CV6 A;  1ZWN A;  158L A;  1UC0 A;  3HH3 A;  4PPO A;  3M6A A;  4K0K M;  2KA6 B;  2Z8Y M;  4GEW A;  2DQF C;  5FTM A;  3V76 A;  4GCB A;  1IBL M;  2ZNW Y;  1OUG A;  4WG7 A;  1LGW A;  1SXJ E;  1C60 A;  2ZNX Y;  4B3M M;  1GBX A;  1LSD A;  1A5T A;  221L A;  2KEB A;  1KSF X;  2ZAM A;  4JXJ A;  5EXP A;  4LJ7 A;  5APC A;  3A91 A;  4ML7 A;  3W0F A;  1ZVY B;  5EP1 A;  150L A;  1IP3 A;  3DMV A;  1HEP A;  2K9D A;  1VEK A;  3Q8X A;  1E9R A;  1EFU B;  3KFU G;  1T6H A;  4AZF A;  1CJ8 A;  1Q39 A;  3GUM A;  1Z5A A;  4LYB A;  2GV0 A;  5L8R F;  1LZ9 A;  1T97 A;  1L03 A;  1D3F A;  112L A;  160L A;  1L31 A;  4KO8 A;  4H9I A;  4CJ6 A;  2DZL A;  3B7N A;  2UXD M;  4G49 A;  113L A;  205L A;  2ZQ3 A;  3AZ6 A;  2F5N A;  4EIW A;  4FDY A;  109L A;  1L48 A;  1TDH A;  4MGI E;  4KL7 A;  1OYU A;  3L28 A;  2IFF Y;  3K9P A;  134L A;  3KXE C;  1L17 A;  4DV3 M;  4RDS A;  1BVS A;  1HEW A;  2HED A;  4RLN A;  4YM8 A;  1B7O A;  1L56 A;  3AJI B;  2YNM D;  4WUR A;  141L A;  1FN5 A;  2P5T A;  3C80 A;  2FNA A;  4GKJ M;  1L29 A;  2KXE A;  1LHL A;  1B7N A;  4O34 A;  4FVM A;  2CRU A;  1JIY A;  1GF9 A;  1L06 A;  2LYM A;  1LZC A;  3L2A A;  241L A;  3EIH A;  2DQI Y;  4H1P A;  1HQC A;  5FTJ A;  1GF7 A;  1GBW A;  3GPX A;  3WVX A;  2FFJ A;  2BQN A;  3DMZ A;  2HKJ A;  1L95 A;  1R2Y A;  1GFJ A;  4DD9 A;  3LZT A;  1FLU A;  1TR8 A;  2XSZ A;  1IP2 A;  1L65 A;  1QDT A;  4W59 A;  2C5R A;  2DXI A;  4R6C A;  5ITT A;  2KHH A;  3ULR A;  4N8Z A;  1GF6 A;  1DKK A;  2X8A A;  2N35 A;  1GBS A;  6LYT A;  3AW7 A;  1LSF A;  2BLX A;  1ZYT A;  2LYO A;  3DFZ A;  1L02 A;  1N33 M;  1KW5 A;  1XEP A;  1C45 A;  4NSJ A;  2ANX A;  111L A;  4R7G A;  1RJC B;  5IZ7 D;  1D6Q A;  1XSF A;  1L60 A;  1W5T A;  4N1C C;  4KT3 A;  2HU1 A;  2BQJ A;  2Z4R A;  1QTV A;  2XZF A;  3DMX A;  5I4X A;  1L33 A;  1QYR A;  1XXH A;  3GLI B;  4GN4 A;  5LVG A;  5APF A;  5F3W A;  1ALC A;  1CV0 A;  4XBO A;  2CUZ A;  3L27 A;  178L A;  3SMP A;  1C6C A;  4DR1 M;  4AGA A;  2DAE A;  2G4P A;  2A7D A;  3B0I A;  5L3I A;  4H94 A;  120L A;  1W5S A;  1G7M C;  4DQ7 A;  4LT3 A;  2AHM A;  3K92 A;  3IWR A;  2NTH A;  1QSW A;  9LYZ A;  5LAG A;  1MJG M;  4G4B A;  4TTD A;  3PXG A;  2RAY X;  2KNA A;  5E6J A;  4TSB A;  1JWR A;  3C58 A;  1GFV A;  1L32 A;  1QTH A;  3T15 A;  243L A;  3NY9 A;  2F5S A;  1W08 A;  1L64 A;  143L A;  1EPY A;  3D8L A;  3E3D A;  5EJC A;  4JI8 M;  4IBB A;  1B7P A;  3J81 S;  118L A;  1Z55 A;  4DYG A;  3J4G A;  1G0G A;  4DV5 M;  3P4Z A;  3C7W A;  1BWH A;  2LH0 A;  1LPY A;  2B75 A;  4XYY A;  1LJ3 A;  245L A;  2JY8 A;  4XEN A;  2EKK A;  4EPF A;  4GLV A;  1DGF A;  2M60 A;  4W96 A;  1IR9 A;  1ZV5 L;  1T3P A;  1BHZ A;  3LHM A;  4DWX A;  4LF7 M;  3D3D A;  5I53 A;  1L01 A;  4WOA A;  4E97 A;  1HFX A;  1XC8 A;  183L A;  3LMM A;  1QS5 A;  2F30 A;  1NHE A;  2IHL A;  3K1J A;  4HJY A;  2MR9 A;  4Z41 A;  2D4I A;  3P68 A;  154L A;  3W6F A;  1IC7 Y;  3RGP A;  2JA2 A;  260L A;  1C6L A;  1OUA A;  1GB6 A;  3KDS E;  3HH5 A;  2BQC A;  1OUE A;  175L A;  1BVX A;  3M18 B;  3WU7 A;  1DQJ C;  4PDI A;  1L59 A;  1T43 A;  1N32 M;  5D5C A;  2RBR A;  1XB2 B;  3FD9 A;  4DKL A;  1GJS A;  1OV5 A;  2MED A;  3DN1 A;  4M9X A;  2O25 A;  1LHK A;  1TGU A;  2H9K A;  1R7R A;  1L18 A;  1HER A;  4ETC A;  4G4R A;  4HLQ A;  191L A;  2K6B A;  2BQA A;  3PVS A;  4A3V B;  1LYJ A;  2L4F A;  1L55 A;  2QBY A;  8CAT A;  2HWJ A;  2KNZ A;  3U6S A;  5DN4 A;  2OU9 A;  2DQA A;  2J7O A;  1L20 A;  4NHQ A;  1L26 A;  2LVO C;  4OU7 A;  2DAI A;  3UGJ A;  2UXC M;  259L A;  1C6B A;  3RUN A;  4Y28 F;  4DD3 A;  4CFO A;  5B1F A;  1HML A;  4DQJ A;  3J7B A;  1DO0 A;  1B2K A;  1REM A;  2HEC A;  1GB0 A;  3EMS A;  4CHX A;  4NGY A;  3L64 A;  4MGK E;  4XAD A;  1IXS B;  104L A;  4LY6 A;  1IN5 A;  4G4C A;  1B5X A;  125L A;  4LGY A;  1CV1 A;  4OVZ B;  5LYZ A;  3OE6 A;  1TLA A;  4MM3 B;  5I5Q A;  4JI7 M;  2CE7 A;  2APL A;  3VK7 A;  4K5Y A;  1DV0 A;  3T6U A;  4YEO A;  3KAM A;  1E94 E;  3SHF A;  2OOA A;  1LMQ A;  3SAS A;  1NMM A;  4DJH A;  2EIZ C;  3GPU A;  213L A;  198L A;  1SXJ B;  1LYF A;  3HU3 A;  4Z6Y A;  4LYT A;  5IWA M;  1LZG A;  1UIH A;  211L A;  3HWS A;  5KPZ A;  2ZBK B;  1C6H A;  1P36 A;  3A67 Y;  1JKD A;  3HHY A;  1N78 A;  3KP1 E;  1G0P A;  1PJS A;  127L A;  1YAM A;  2Y8P A;  3JR6 A;  207L A;  1LZ4 A;  248L A;  4X66 M;  1L88 A;  2XEP A;  3KSX A;  4DD0 A;  3AZ7 A;  6LZM A;  1TEW A;  1QDR A;  1P6Y A;  1N4F A;  1L41 A;  1YKX X;  2DZO B;  3GRU A;  1QUO A;  210L A;  4G4N A;  1GB2 A;  3U6E A;  1LMN A;  3CDT A;  1L52 A;  2X49 A;  1GLN A;  1B5W A;  4MR1 A;  2EO2 A;  1IQP A;  1C6P A;  2BQM A;  4RKU F;  3SHG B;  225L A;  2YBM A;  4M0D A;  4NC6 A;  4I7S A;  5FSW A;  3HBD A;  3JR5 A;  1T8F A;  4EKR A;  139L A;  1D0M A;  2IGC A;  2BQK A;  2G4Q A;  1QAO A;  2MEA A;  3GRV A;  1L70 A;  1LJN A;  1EE8 A;  1V92 A;  3I4Y A;  4OOO A;  5B1G A;  1ZVH L;  3MHV C;  2CV0 A;  3C7Z A;  3FUX A;  3MK6 A;  4AKI A;  4HP0 A;  1S3S A;  3QNG A;  3GLG A;  1T6V L;  1OWZ A;  4D80 A;  3HT6 A;  1C08 C;  3VDU A;  2Z2F A;  4FW9 A;  1OP9 B;  4ZEE A;  1QVR A;  1IBM M;  3LCU A;  1XNR M;  1CV4 A;  1L45 A;  2RBP A;  4PHI A;  4G4H A;  1YL1 X;  3E4R A;  3J7A S;  1IP5 A;  138L A;  1OJL A;  3A46 A;  2LHC A;  5DLA A;  1FKV A;  1J09 A;  3CGW A;  1JR3 E;  4ARM B;  1GXV 2;  2W1L A;  3QY4 A;  1G07 A;  1AZF A;  1PJT A;  1NHG C;  2Z6B A;  3SB7 A;  2BJW A;  3GLH A;  1IO5 A;  1VDS A;  2CWI A;  1GB9 A;  4LCB A;  1IIZ A;  1L09 A;  4GC5 A;  1SSW A;  4LT0 A;  1I4W A;  1IBK M;  1WQP A;  4DBG B;  3W6E A;  1PQI A;  2Z38 A;  1HT2 E;  171L A;  197L A;  1B5Z A;  2JWS A;  3U6Q A;  2OE9 X;  3WPL A;  215L A;  1L90 A;  4LDE A;  2LYZ A;  2XQO A;  1VEG A;  3HZJ A;  3AB6 A;  1RU3 A;  1G71 A;  1AT6 A;  2W1Y A;  2RB2 X;  2F5Q A;  2ZQ4 A;  4YF2 A;  1C6F A;  2B3T A;  3A93 A;  1C69 A;  1V34 A;  4LJ4 A;  1YAO A;  3AZ5 A;  3LYT A;  3WYH A;  3HKP A;  2MGW A;  1GE3 A;  1D2W A;  1L37 A;  4JV5 M;  2CWB A;  1INU A;  162L A;  1GPQ C;  4CHT B;  174L A;  4NGZ A;  4AW4 A;  4NGO A;  2EJS A;  4DD7 A;  2HEE A;  5ITY A;  1L43 A;  3LQQ A;  5FTK A;  4OWA A;  3AGG G;  4WLY A;  3GP1 A;  2NWD X;  5E26 A;  3ZH9 B;  1HEM A;  5KXN A;  4D9Z A;  2RBQ A;  4B3T M;  4QOS A;  4WM2 A;  3A95 A;  1UA6 Y;  3UK6 A;  3HJ8 A;  1L08 A;  1RCM A;  3U6O A;  3HU2 A;  1OIZ A;  1GBO A;  1QZE A;  1NQI A;  1XGP C;  1OV7 A;  2LBC A;  1SXJ C;  2FH0 A;  3RFW A;  1TDZ A;  4GCD A;  2R4E A;  4H9E A;  1LMC A;  4DDC A;  3I4V A;  2AUB A;  3TMV A;  4PJ2 C;  3ZEK A;  1K3X A; 
#chains in the Genus database with same CATH homology
 1LWK A;  1LKR A;  1QTD A;  1L61 A;  126L A;  4GBR B;  5F81 A;  1IOS A;  1LWG A;  3DN2 A;  4I0C A;  3LYM A;  4QEQ A;  2LZT A;  3HBH A;  2A7F A;  155L A;  3AYQ A;  1QUD A;  4PGJ B;  3QAK A;  3TXF A;  3QE8 A;  1L21 A;  3WL2 A;  3DKE X;  4B0D A;  1C10 A;  172L A;  1VDP A;  4NHT A;  3N9E A;  2Z39 A;  3GUJ A;  4J1B A;  1CJ9 A;  2CDS A;  1C6A A;  200L A;  5LIN A;  4NFV A;  1L73 A;  3DN8 A;  1L05 A;  4EKS A;  1JKC A;  1DKJ A;  2HEA A;  4WM4 A;  218L A;  1DXJ A;  5HMV A;  1BWJ A;  4NGW A;  222L A;  4H9F A;  1LHJ A;  1L85 A;  1BB3 A;  232L A;  5FCP A;  163L A;  3TMX A;  4BAF A;  4XJB A;  3SBB C;  1LMT A;  3TXB A;  4WM3 A;  5KXT A;  3AGH A;  1FLQ A;  1LSC A;  4ETD A;  1IOT A;  4PRU A;  5FDJ A;  159L A;  1LJF A;  5AMY A;  170L A;  1L68 A;  1E8L A;  1QTZ A;  4IAT A;  5LVI A;  5EBH A;  1HEQ A;  133L A;  1L77 A;  1L51 A;  4B4J A;  151L A;  1LMP A;  5M1Y A;  1B9O A;  239L A;  4H90 A;  1W6Z A;  5HNL A;  209L A;  1YQV Y;  1ZMY L;  3NYA A;  1LSG A;  4NHP A;  4RW2 A;  1RFP A;  3WVY A;  1REY A;  1C61 A;  1YIL A;  2HEB A;  1JTT L;  4W55 A;  1LOZ A;  4I7P A;  1UBZ A;  5KXP A;  3BKV A;  1UIG A;  3J6K A;  240L A;  3TXJ A;  1IX0 A;  1L49 A;  4EOF A;  3HH6 A;  4YXC A;  4NGV A;  4GLA A;  1UIF A;  1LZR A;  1G0L A;  2H5Z A;  4H93 A;  1LYO A;  253L A;  1JTO L;  4UWN A;  261L A;  2BQF A;  1XEK A;  2ZYC A;  4WMG A;  1C6E A;  3TMU A;  1L15 A;  1K28 A;  3D9A C;  1L36 A;  1L28 A;  1L92 A;  4HTK A;  1JQU A;  1P37 A;  1V7S A;  4RW1 A;  2DQD Y;  3HDE A;  1NBY C;  1LZ5 A;  1BB7 A;  3ZVQ B;  3SB5 A;  4XJH A;  1LI6 A;  1FBI X;  1LHM A;  1JUG A;  5JEN B;  1B6I A;  2XJW A;  3TXE A;  3A8Z A;  4HJV A;  1EQ5 A;  1C64 A;  5LAF A;  4OWC A;  1CTW A;  1LSZ A;  4XJF A;  3P66 A;  1D0L A;  1G7J C;  4BAP A;  1CKH A;  1VED A;  5D5F A;  1CNS A;  4ET8 A;  3TXI A;  152L A;  3B0K A;  2YBJ A;  3FE0 A;  3OE9 A;  1BVK C;  1AKI A;  4J1A A;  1LZ1 A;  5F9X A;  4W53 A;  1SX7 A;  1IR8 A;  1BWI A;  1G0M A;  4II8 A;  2F47 A;  1TCY A;  1QSQ A;  2D4J A;  3GXK A;  2O79 A;  3RU5 A;  4TSC A;  2DQJ Y;  4DD1 A;  4IAP A;  2DKV A;  1LTM A;  3VWO A;  1LZ6 A;  3ATN A;  4TX7 A;  3AJN A;  2RBO A;  1B7M A;  4I7Q A;  1CU5 A;  4BS7 A;  5ILF A;  4GN3 A;  2MEG A;  4XJI A;  3IJV A;  238L A;  1L84 A;  1LCN A;  1WQM A;  1FLY A;  2FBB A;  5T3F A;  1L30 A;  3OK0 A;  1FDL Y;  5KXX A;  4W52 A;  5DN5 A;  1PQJ A;  1F6R A;  1L57 A;  5HMJ A;  1A4V A;  2YBN A;  1NF5 A;  1J1P Y;  2MEE A;  1B5V A;  1HEO A;  2FYD A;  1GF4 A;  1SQ2 L;  1OQM A;  2Z18 A;  1PQO A;  1GFR A;  1EL1 A;  4KPM A;  3CQL A;  4NIJ A;  2RBS A;  233L A;  1LYH A;  2O7A A;  1QUH A;  1XJU A;  3WXU A;  4ARL A;  1JHL A;  1T8A A;  2YSS C;  1KXW A;  1HSW A;  3TMW A;  1D3N A;  1XJT A;  4CGE A;  1L14 A;  1L62 A;  4H9A A;  3LYO A;  4LFP A;  1J1O Y;  2LZ2 A;  2ZIL A;  166L A;  156L A;  1L63 A;  1LSA A;  4NGI A;  1OVH A;  1HFZ A;  1EQ4 A;  2BQD A;  1LSN A;  3OE0 A;  1L07 A;  4H9B A;  249L A;  212L A;  4WG1 A;  4WLT A;  1IEE A;  1L58 A;  5DM9 A;  3TXK A;  1L87 A;  2EKS C;  1LZE A;  1GEV A;  4EKP A;  1IR7 A;  1QT4 A;  1LYS A;  5IEL A;  1L79 A;  1C62 A;  2HU3 A;  2Z19 A;  199L A;  1YKY X;  1VAU A;  1QT8 A;  3CDR A;  1DPW A;  1PQD A;  131L A;  1L34 A;  3CT0 A;  4GRV A;  1LYD A;  255L A;  2B7X A;  4S0W A;  1LGX A;  2DQH Y;  4W94 A;  3T36 A;  1GBZ A;  2H9J A;  4QY9 A;  4I7T A;  1IWT A;  5E9R A;  103L A;  1GB7 A;  5A3E A;  1GE1 A;  2BLY A;  2I6Z A;  3K3T A;  5F16 A;  4ETA A;  186L A;  1CU0 A;  3SBA A;  3HU8 A;  1KW7 A;  3FA0 A;  1B0D A;  1QUG A;  3FI7 A;  2F4G A;  4IAS A;  2HUM A;  4I7N A;  3HDF A;  3LYZ A;  2ZIJ A;  1GBY A;  3PBL A;  1BB5 A;  1IOQ A;  1C6M A;  1VDQ A;  1DYE A;  1IWZ A;  236L A;  1QTK A;  1GFU A;  1L98 A;  1O23 A;  1UAC Y;  1B7Q A;  4Z98 A;  4W56 A;  2DQC Y;  1UID A;  1L46 A;  5B06 A;  1LSP A;  3A96 A;  189L A;  1AT5 A;  1WQR A;  1D9W A;  3K2R A;  4DC4 A;  1YAP A;  1JJ0 A;  1DZB X;  4WL7 A;  130L A;  1D3M A;  2RBN A;  1IWY A;  181L A;  1DI3 A;  1GHL A;  1LYY A;  3W6C A;  5KY1 A;  4H92 A;  1L75 A;  1C67 A;  1BGI A;  5LVJ A;  3GUL A;  1L67 A;  4NGK A;  1LZS A;  2F4A A;  1L99 A;  3W6A A;  1B5U A;  2BQG A;  5LIO A;  5ILC A;  4CJ2 A;  1DYD A;  2BQI A;  214L A;  1PZY A;  1L53 A;  4MST A;  208L A;  1LHH A;  129L A;  4WL6 A;  1G1V A;  1MLC E;  2BQB A;  256L A;  1IWU A;  5FST A;  1HHL A;  2B5Z A;  1LKS A;  1L11 A;  3SN6 R;  4DDB A;  5LA8 A;  1V7T A;  2YBL A;  3CDO A;  4WO9 A;  4LDL A;  3SB6 A;  1LJJ A;  1C65 A;  1G0Q A;  3A94 A;  4ZFP A;  4LGK A;  3G3B B;  1GF8 A;  1P3N A;  1VDT A;  182L A;  1GWD A;  1OUD A;  4HSF A;  196L A;  247L A;  5F9U A;  1GXX A;  1YAN A;  185L A;  5KXL A;  1CJ6 A;  1JJ1 A;  3G3A B;  2DQG Y;  242L A;  219L A;  4H9H A;  1HEN A;  1G06 A;  5IHG A;  1L10 A;  3F8V A;  5FEL A;  5L9J A;  3BKH A;  4J0L A;  4I7L A;  3WUM A;  4WM5 A;  3HFM Y;  4HTN A;  3L2X A;  4NWH A;  1P2R A;  1GB3 A;  2HEF A;  1KIQ C;  3WUN A;  3CSQ A;  2MEH A;  3GUN A;  1L89 A;  2F2Q A;  3RZE A;  5LYT A;  1IC4 Y;  1L86 A;  3NY8 A;  4DD2 A;  3GXR A;  4NG1 A;  1QT3 A;  3CT5 A;  4ARJ A;  1C6J A;  2F32 A;  1C6G A;  5APD A;  3A3Q A;  2HUB A;  4ARM A;  1CU3 A;  1C43 A;  1L96 A;  5KKJ A;  2BQO A;  4XJD A;  1XGQ C;  1RI8 B;  3C8Q A;  5C6I A;  4NEB A;  1GD6 A;  2I25 L;  1L27 A;  1GFK A;  4DT3 A;  4NSH A;  1GB8 A;  3WUA A;  128L A;  4ARP A;  1LJI A;  4EMN A;  3SB8 A;  4UWU A;  1XEI A;  110L A;  3DNA A;  262L A;  1EQE A;  1LI3 A;  188L A;  1L04 A;  2MEB A;  4WM6 A;  1NHB A;  1GAY A;  1L66 A;  2QAR C;  1L80 A;  1YAQ A;  220L A;  1C46 A;  1JSF A;  3VW7 A;  1FKQ A;  5DL9 A;  4C5F A;  1LYI A;  3ATO A;  4YXA C;  1L81 A;  1I6S A;  4BAD A;  3FI5 A;  4ET9 A;  132L A;  5C6J A;  2Q9D A;  1L83 A;  1AM7 A;  137L A;  2B72 A;  1LZB A;  2OTY X;  1PQM A;  4N1E I;  3CSZ A;  1H87 A;  3SP3 A;  1LJK A;  2OU8 A;  1DYG A;  4LZM A;  1HC0 A;  1CJ7 A;  4DDA A;  2D4K A;  3LZM A;  2B6W A;  1IWW A;  2D6B A;  5KXZ A;  1NWG A;  1CKF A;  4E3U A;  1LSM A;  1UCO A;  4HPI A;  2G4N A;  3B6L A;  1CV3 A;  3RT5 X;  2OU0 X;  3CB7 A;  157L A;  4OW1 A;  3MGW A;  1C68 A;  1LGU A;  4HTQ A;  1GEZ A;  1IWX A;  1WQO A;  1XGU C;  4OWB A;  1L24 A;  4HV1 A;  3A34 A;  1SSY A;  2Q9E A;  2HUL A;  1C6D A;  1WTM A;  5C6L A;  2B74 A;  5II3 A;  1YIK A;  1CKG A;  1LZN A;  5FEK A;  4R0F A;  4NHI A;  251L A;  3F9L A;  1IP1 A;  107L A;  1GDX A;  1OUC A;  1VAT A;  3HH4 A;  4XN6 A;  1G7H C;  5LYM A;  1L39 A;  3HUK A;  1A2Y C;  1L42 A;  1QT6 A;  5KXS A;  1JTM A;  5KXO A;  1IY3 A;  3HTB A;  2XBR A;  227L A;  1GF5 A;  1XEJ A;  3C82 A;  2ZWB A;  123L A;  1TDY A;  1F6S A;  1HEL A;  3A92 A;  3HWL A;  144L A;  1L00 A;  1LJE A;  2VB1 A;  229L A;  1SWY A;  1LZT A;  5I14 A;  2C8O A;  5KJ9 A;  3F6Z A;  4NGJ A;  4OWH A;  1QT5 A;  1HNL A;  1DPX A;  5HQ1 A;  2YVB A;  3TXH A;  1YRO A;  2A4T A;  1LSY A;  1CU2 A;  1I20 A;  235L A;  2YDG A;  3WW5 A;  201L A;  1D6P A;  4GCF A;  1P2L A;  244L A;  3HU9 A;  1CKC A;  3C8R A;  2WAR A;  1DI5 A;  4ZIX A;  216L A;  3HT7 A;  3C81 A;  1QTB A;  1GB5 A;  2PC2 A;  3WXT A;  195L A;  4WLX A;  193L A;  1OUF A;  4I7O A;  3HBE X;  3LZ2 A;  3DN0 A;  1C6T A;  3G3X A;  4EKQ A;  3N9C A;  4ETB A;  1LPI A;  5LVK A;  1GE0 A;  1C6Q A;  1WQQ A;  1P7S A;  2ANV A;  3CDV A;  1HFY A;  5LXW A;  4QGZ A;  3G3W A;  1GFE A;  8LYZ A;  4B4E A;  2EPE A;  1REX A;  5J7C A;  1B7S A;  2RH1 A;  1LYG A;  4HPE A;  1KNI A;  1GE2 A;  4LYM A;  1J1X Y;  5KXR A;  3DN4 A;  4H8X A;  1LZA A;  4A7D A;  1OUI A;  2B73 A;  4H8Y A;  2HUK A;  1GFG A;  4RLM A;  1KY0 A;  206L A;  3A6B Y;  1GF3 A;  250L A;  3C7Y A;  192L A;  3ZVQ A;  108L A;  1QS9 A;  1HMK A;  184L A;  1OVK A;  3HT9 A;  1C66 A;  3OE8 A;  1L94 A;  2B70 A;  1GF0 A;  3WW6 A;  3C8S A;  1LJ4 A;  1G0K A;  2BAA A;  252L A;  1LSE A;  1KXX A;  1I56 A;  1H6M A;  1L71 A;  114L A;  2ZIK A;  4GN5 C;  1L76 A;  4X3B A;  3GUI A;  168L A;  3HUQ A;  1JIT A;  1G1W A;  3B0O A;  1QTC A;  3RW8 A;  2XBS A;  5APE A;  5HLL A;  4DQ5 A;  4C3W A;  1SWZ A;  4H9C A;  1IVM A;  5KXM A;  228L A;  1BB6 A;  2LCB A;  146L A;  1IOC A;  1JKA A;  4AXT A;  4FJR A;  4B4I A;  1OVJ A;  2Z12 A;  4I8S A;  4J7V A;  1LJH A;  3LN2 A;  4DAJ A;  1WVV A;  2MEC A;  2YBH A;  3P64 A;  3WMK A;  4I7J A;  1L22 A;  2RB1 X;  1L44 A;  246L A;  1OWY A;  4B49 A;  2FBD A;  3UON A;  1D0K A;  3M3U A;  1L82 A;  4KXI A;  2B6X A;  4LYC A;  1QT7 A;  1DYB A;  2OE7 X;  3G3V A;  1L25 A;  177L A;  1LMA A;  2Z37 A;  1KS3 A;  1P5C A;  3W6D A;  1L19 A;  3C83 A;  2Z2E A;  1SX2 A;  1NBZ C;  1WTH A;  3N9A A;  4W58 A;  3W3E A;  2C8P A;  3AW6 A;  1I1Z A;  1B7R A;  2RSC A;  4M6D A;  3TXG A;  1C6N A;  4PRQ A;  1REZ A;  1D2Y A;  176L A;  147L A;  3HT8 A;  1LLH A;  1CX6 A;  1TBY A;  1MEL L;  2DQE Y;  4OWE A;  231L A;  4EPI A;  5I4Y A;  4LZT A;  2CUU A;  3FAD A;  5K7O A;  2LHM A;  4GCE A;  1HSX A;  1GE4 A;  6LYZ A;  3IJU A;  5B07 A;  1OUB A;  3A3R X;  1G7L C;  2L78 A;  3WH1 A;  142L A;  4NHS A;  3PDS A;  5I4W A;  1IC5 Y;  4LDO A;  5LVH A;  4G9S A;  1L69 A;  1LHI A;  1DYA A;  223L A;  1C63 A;  230L A;  1DYF A;  5I54 A;  1VFB C;  1IP4 A;  194L A;  1NDG C;  1QTE A;  2W1M A;  2HTX A;  1CVK A;  1CUP A;  1LZY A;  3CDQ A;  1PQK A;  1ZUR A;  2FYC A;  3EXD A;  5IDD A;  257L A;  1GAZ A;  1UUZ C;  4LYZ A;  3OJP A;  1KY1 A;  2RB0 X;  1IY4 A;  2X0A A;  1L40 A;  3V2Y A;  1B7L A;  2W1X A;  4HV2 A;  3DN3 A;  1C7P A;  2QB0 B;  190L A;  1GFA A;  5LA5 A;  1G7I C;  3AGI A;  3ODU A;  2BQH A;  1LZ8 A;  1QIO A;  1F0W A;  1DYC A;  1XGR C;  1OUJ A;  1RE2 A;  161L A;  1L13 A;  4U3X B;  2LZM A;  1JIS A;  1YKZ X;  1CX7 A;  1L16 A;  1B5Y A;  4Z3M A;  4B1A A;  1JTP L;  4ARQ B;  4NGL A;  1C6K A;  5E4P A;  4NSI A;  1CUQ A;  1QQY A;  4WM1 A;  4PJZ A;  2ZYP A;  3RZ4 A;  164L A;  169L A;  1LSB A;  5B05 A;  4LYO A;  1JJ3 A;  1L50 A;  1LZD A;  1KIP C;  1UIA A;  1LMO A;  3CT1 A;  4NG8 A;  1L0J A;  1PS5 A;  3RNX A;  167L A;  4LT2 A;  3D4S A;  1L91 A;  1JSE A;  122L A;  1D3J A;  4L41 A;  1SLY A;  1L97 A;  4P2E A;  1LYE A;  2MEF A;  145L A;  5LZM A;  3HTG A;  1IWV A;  2LC9 A;  3HTF A;  1CU6 A;  4I7R A;  2MEI A;  2NTG A;  1DI4 A;  3HUA A;  1L12 A;  4MCK A;  148L E;  1L54 A;  4W54 A;  5HNC A;  4ARQ A;  5FHW A;  1L23 A;  180L A;  1XGT C;  2I26 L;  3B72 A;  1P2C C;  3SB9 A;  2OE4 X;  4EXM A;  3A90 A;  3WU8 A;  5B59 A;  4QDN A;  1IP6 A;  1UIE A;  1KIR C;  5KXY A;  4I7K A;  1CV5 A;  1T8G A;  4NWE A;  1P56 A;  187L A;  1WTN A;  153L A;  2OTZ X;  4UWV A;  2B6T A;  135L A;  4AQN A;  4XJG A;  1JKB A;  4WO6 A;  165L A;  1JPO A;  234L A;  1GFH A;  1BB4 A;  3HTD A;  1HF4 A;  1WQN A;  1L0K A;  1WVU A;  3A6C Y;  119L A;  2B6Y A;  1GFT A;  2CGI A;  3WPJ A;  5KKI A;  4M4O A;  1G0J A;  226L A;  1GDW A;  1FLW A;  2N5Z A;  4N5R A;  2DBT A;  4ANR A;  1L47 A;  1QUS A;  140L A;  237L A;  4W51 A;  258L A;  5KXW A;  254L A;  3DN6 A;  1LYZ A;  4W57 A;  1LW9 A;  1JEF A;  3WPK A;  4TUN A;  7LYZ A;  3V2W A;  4GCC A;  1IOR A;  2RAZ X;  1F10 A;  3AZ4 A;  5L3H A;  3GUO A;  4CFP A;  1L72 A;  2CJL A;  2Q0M X;  4Z46 A;  149L A;  1L74 A;  5A3Z A;  217L A;  1UIB A;  4I7M A;  1UIC A;  1BQL Y;  3W6B A;  2OEA X;  2O4W A;  1KXY A;  4NSG A;  1XFP L;  7LZM A;  1L38 A;  3EBA B;  4TWS A;  3WU9 A;  4YEM A;  4YEN A;  1LAA A;  2YBI A;  2B6Z A;  2BQL A;  3CSR A;  3EML A;  2F2N A;  224L A;  4LFX A;  1P46 A;  1NDM C;  2BQE A;  1YL0 X;  1C6I A;  4LT1 A;  3GUK A;  1IP7 A;  2EQL A;  4N0J A;  1LI2 A;  4H91 A;  1D9U A;  2XTH A;  5KXK A;  4OOT A;  4IJ4 A;  1QSB A;  4HJZ A;  1JTN A;  4YX7 C;  173L A;  1OUH A;  4OO9 A;  1CKD A;  2BPU A;  1L35 A;  1NKH A;  1TAY A;  4ETE A;  4H8Z A;  3TXD A;  1QSA A;  3WUL A;  2D91 A;  4N9R A;  4YOP A;  115L A;  3GUP A;  1QUT A;  1L93 A;  1P64 A;  4NY5 A;  4ZPU A;  3EO5 A;  4WLD A;  102L A;  1LJG A;  5F14 A;  4EJ4 A;  4PK0 A;  1CV6 A;  1ZWN A;  158L A;  1UC0 A;  3HH3 A;  4PPO A;  2DQF C;  4GCB A;  2ZNW Y;  1OUG A;  4WG7 A;  1LGW A;  1C60 A;  2ZNX Y;  1GBX A;  1LSD A;  221L A;  5APC A;  3A91 A;  4ML7 A;  1ZVY B;  150L A;  1IP3 A;  3DMV A;  1HEP A;  1T6H A;  1CJ8 A;  3GUM A;  4LYB A;  2GV0 A;  1LZ9 A;  1T97 A;  1L03 A;  1D3F A;  112L A;  160L A;  1L31 A;  4H9I A;  4G49 A;  113L A;  205L A;  2ZQ3 A;  3AZ6 A;  4FDY A;  109L A;  1L48 A;  4KL7 A;  1OYU A;  2IFF Y;  134L A;  1L17 A;  4RDS A;  1HEW A;  2HED A;  4RLN A;  4YM8 A;  1B7O A;  1L56 A;  141L A;  3P65 A;  1FN5 A;  3C80 A;  1L29 A;  1LHL A;  1B7N A;  4O34 A;  1JIY A;  1GF9 A;  1L06 A;  2LYM A;  1LZC A;  241L A;  2DQI Y;  4H1P A;  1GF7 A;  1GBW A;  3WVX A;  2BQN A;  3DMZ A;  1L95 A;  1GFJ A;  4DD9 A;  3LZT A;  1FLU A;  1IP2 A;  1L65 A;  1QDT A;  4W59 A;  4R6C A;  3ULR A;  4N8Z A;  1GF6 A;  1DKK A;  1GBS A;  6LYT A;  3AW7 A;  1LSF A;  2BLX A;  1ZYT A;  2LYO A;  1L02 A;  1KW5 A;  1XEP A;  1C45 A;  4NSJ A;  2ANX A;  111L A;  1RJC B;  1D6Q A;  1XSF A;  1L60 A;  4N1C C;  4KT3 A;  2HU1 A;  2BQJ A;  1QTV A;  3DMX A;  5I4X A;  1L33 A;  4GN4 A;  5LVG A;  5APF A;  1ALC A;  1CV0 A;  178L A;  1C6C A;  4AGA A;  2G4P A;  2A7D A;  3B0I A;  5L3I A;  4H94 A;  120L A;  1G7M C;  4DQ7 A;  4LT3 A;  3IWR A;  2NTH A;  1QSW A;  9LYZ A;  5LAG A;  4G4B A;  4TTD A;  2RAY X;  4TSB A;  1JWR A;  1GFV A;  1L32 A;  1QTH A;  243L A;  3NY9 A;  1W08 A;  1L64 A;  143L A;  1EPY A;  3E3D A;  4DYG A;  118L A;  1B7P A;  1Z55 A;  3J4G A;  1G0G A;  3P4Z A;  3C7W A;  1BWH A;  1LPY A;  2B75 A;  4XYY A;  1LJ3 A;  245L A;  4XEN A;  4EPF A;  4GLV A;  4W96 A;  1IR9 A;  1ZV5 L;  1T3P A;  1BHZ A;  3LHM A;  4DWX A;  3D3D A;  5I53 A;  1L01 A;  4WOA A;  4E97 A;  1HFX A;  183L A;  2F30 A;  1QS5 A;  1NHE A;  2IHL A;  4HJY A;  4Z41 A;  2D4I A;  3P68 A;  154L A;  3W6F A;  1IC7 Y;  260L A;  1C6L A;  1OUA A;  1GB6 A;  3HH5 A;  2BQC A;  1OUE A;  175L A;  1BVX A;  3M18 B;  3WU7 A;  1DQJ C;  1L59 A;  5D5C A;  2RBR A;  4DKL A;  1OV5 A;  2MED A;  3DN1 A;  1LHK A;  2H9K A;  1L18 A;  1HER A;  4ETC A;  191L A;  2BQA A;  1LYJ A;  1L55 A;  5DN4 A;  2OU9 A;  2DQA A;  1L20 A;  4NHQ A;  1L26 A;  259L A;  1C6B A;  3RUN A;  4DD3 A;  4CFO A;  5B1F A;  1HML A;  4DQJ A;  1B2K A;  1REM A;  2HEC A;  1GB0 A;  3EMS A;  4CHX A;  4NGY A;  3L64 A;  4XAD A;  104L A;  4G4C A;  1B5X A;  125L A;  1CV1 A;  5LYZ A;  3OE6 A;  1TLA A;  5I5Q A;  4K5Y A;  3T6U A;  4YEO A;  3KAM A;  1LMQ A;  4DJH A;  1NMM A;  2EIZ C;  213L A;  198L A;  1LYF A;  4LYT A;  1LZG A;  1UIH A;  211L A;  1C6H A;  1P36 A;  3A67 Y;  1JKD A;  1G0P A;  1YAM A;  127L A;  2Y8P A;  3JR6 A;  207L A;  1LZ4 A;  248L A;  1L88 A;  4DD0 A;  3AZ7 A;  6LZM A;  1TEW A;  1QDR A;  1P6Y A;  1N4F A;  1L41 A;  1YKX X;  210L A;  1QUO A;  1GB2 A;  1LMN A;  3CDT A;  1L52 A;  1B5W A;  4MR1 A;  1C6P A;  2BQM A;  2YBM A;  225L A;  4I7S A;  3HBD A;  1T8F A;  4EKR A;  139L A;  1D0M A;  2IGC A;  2BQK A;  2G4Q A;  2MEA A;  1L70 A;  1LJN A;  5B1G A;  4OOO A;  1ZVH L;  3C7Z A;  4HP0 A;  3QNG A;  1T6V L;  1OWZ A;  3HT6 A;  1C08 C;  2Z2F A;  1OP9 B;  4ZEE A;  1L45 A;  1CV4 A;  2RBP A;  4PHI A;  4G4H A;  1YL1 X;  1IP5 A;  138L A;  5DLA A;  1FKV A;  4ARM B;  1GXV 2;  2W1L A;  3QY4 A;  1G07 A;  1AZF A;  2Z6B A;  3SB7 A;  1IO5 A;  1VDS A;  2CWI A;  1GB9 A;  1IIZ A;  1L09 A;  1SSW A;  4LT0 A;  1WQP A;  3W6E A;  1PQI A;  2Z38 A;  171L A;  197L A;  1B5Z A;  2OE9 X;  3WPL A;  215L A;  1L90 A;  4LDE A;  2LYZ A;  2XQO A;  3AB6 A;  1AT6 A;  2W1Y A;  2RB2 X;  2ZQ4 A;  4YF2 A;  1C6F A;  3A93 A;  1C69 A;  1YAO A;  3AZ5 A;  3LYT A;  3WYH A;  1GE3 A;  1D2W A;  1L37 A;  162L A;  1INU A;  1GPQ C;  4NGZ A;  174L A;  4NGO A;  4DD7 A;  2HEE A;  1L43 A;  4OWA A;  3AGG G;  4WLY A;  2NWD X;  1HEM A;  5KXN A;  4D9Z A;  2RBQ A;  4WM2 A;  3A95 A;  1UA6 Y;  1L08 A;  1RCM A;  1GBO A;  1NQI A;  1XGP C;  1OV7 A;  4GCD A;  4H9E A;  1LMC A;  4DDC A;  2AUB A;  3TMV A;  4PJ2 C;  3ZEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...