1QZEA

Hhr23a protein structure based on residual dipolar coupling data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
360
structure length
214
Chain Sequence
SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords UV excision repair protein RAD23 homolog A
publication title DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 214
sequence length 360
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF00627 UBA UBA/TS-N domain
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA04
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1qzeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1qzeA01
1GC7A 1YD8U 1S3SG 3DDCB 3JW0X 4TUUA 2K6DB 4M8NA 3ESWB 1WIAA 2CU1A 4FJYA 1GO5A 1KJTA 5C1ZA 2K8BA 4E71A 3E21A 3ZDTA 4B95A 1WX8A 4GEWA 2JZ1A 1WIVA 3MMPA 1WR1A 4K81A 5DPSA 3NZUA 5CHFA 2GMIC 3B08A 4BKSD 2LVNC 1P3QQ 3LCVB 2B3TA 1TZ1A 1WJ7A 1R4MI 2LTUA 5AZGA 2JY6B 2I1JA 4IM2A 4FN2A 4EZLA 3QQ8B 4ZYNA 4WQOB 4FBJB 5BO4B 2KDIA 1WRDB 1T6OA 2N7DA 2FAZA 1V86A 2M1MA 2R2OA 4MM3A 2DKLA 4IWPA 5DPWA 1IXSA 1IFYA 3M95A 3DVGY 1M94A 5L83A 3JVZX 3RT3B 1JRUA 3A1QA 4R71A 4NNJB 2BPSA 4TQ1A 3WIMA 4TKNA 1WGYA 3K9PB 4K7SA 2OJRA 2KJRA 2KFKA 2O6VB 1G6JA 1R4GA 2O6VA 3WAPA 4HPMB 4Q7JA 1IYFA 1OTRA 1KYIA 1P1AA 1WGRA 2BGFA 2PE6B 4IC7B 4MJSB 4MJSA 3SU8X 4EZKA 4JIOU 2KNAA 1G4AE 2KDFB 2KLGA 2EJSA 5DPRA 4F1SA 2J0MA 1GG3A 3U8ZA 3ZNHB 1ZW7A 3RD2A 2NBWB 3OAWA 4NAWA 3QWZB 4G11A 4DXAB 1VG5A 2C60A 2JF5A 2MBHA 1AARA 2C7NB 3RZFA 1WMHB 5LXHA 4F2LA 4G3XB 5E6OA 3ZVVA 4B9KA 1WY8A 1SG9A 1WGLA 2CS4A 3H4JA 2PE9A 2DNAA 3LCUA 3CMMB 1EUVB 3EECA 2L4FA 2AL6A 1YLAA 2IBIB 3X0WA 5AZFA 1WXSA 2L0TA 1WGHA 4AP4C 4HLEA 1IP9A 3CSTA 4NQKE 2JY8A 4ZRKA 2JVCA 3DCGA 3U30A 3OJ3A 4LDTD 2BYEA 2L2DA 3PRPB 4N9F4 3EC8A 5L95C 2KK8A 2LGDA 3IECA 4AJWA 2UYZB 4I6PA 4FADA 4F8CB 3HIZA 3KVFB 2L4EA 2LVQA 1WXAA 2G3QB 2KANA 3BY4B 3PRZA 2DAIA 4GB9A 2KTFA 2MCNB 3TCAA 2AL3A 2LVAA 1E7UA 2GBMA 2K0BX 2F4OB 1S1QB 2XEWA 2ASQA 3ZRCA 2G4SA 1F9JA 2CHZA 2ZZPB 4BKGA 2JT4B 4X57B 4FJVB 3T9LA 3IBEA 3VXWA 1WJNA 2JP7A 1FXTB 2KNZA 1YIWA 1H4RA 3B1LX 4G50A 4AUQC 2MX2A 2IO2B 1HQYE 2D3GA 3L0WB 4DHZB 4W9DA 2MBOA 1DO2A 3MJWA 3PPAA 5D94A 4G3OA 3L08A 4WJOA 3H7SA 1K8RB 3VH4B 1KOTA 2W9NA 5D6JB 1LM8B 1TGZB 1TTNA 3M63B 3ML8A 4GDLB 4GN1A 4K7WA 1RRBA 3S2AA 5GMVA 2LASA 1Z2MA 5C23A 2N7EA 4RMAA 3KUCB 4FJZA 3DBRI 4WAAA 1V9JA 2LI5A 3A33B 2DAKA 3JSVB 3GLIE 4RM8A 3TL5A 1NV8A 2G4DB 2K25A 3W1SA 2CR5A 2KWUB 2XBBC 2GBRA 3X23A 4ASWC 2FIDA 3ZW3A 5D2MB 1Z5SB 4MSMB 2OOBA 3QIJA 4BOZB 4MELA 3Q3FA 3PREA 3ZNID 2L0FA 3AI5A 3RCZA 4RM9A 2AWTA 2C7HA 1E90A 2ZVOA 3A4SC 4W9JA 2M4NA 4NJ7A 1V5TA 1DO0A 1VEKA 4XC2A 4WWPA 3UQAA 3L16A 4PS7A 5JZEB 1OKSA 1E8WA 3EFUA 4HPLB 3A4RA 4LJOB 4XZ4A 2DAJA 4WJQA 4ANWA 3VFKA 3ZTCA 4UN2B 2DAMA 3GLGE 2KJ6A 3VDZA 4GDKA 1A5RA 1H8CA 5LXIB 3GOEA 2ZVNA 3VTVA 3RUIB 4DHJD 2KKCA 3PT2B 2KC1A 2FIFA 4K7UA 3F92A 2QNJA 3ALBA 4KZ0A 4MGYE 3ZNZB 1UGMA 2KDEB 1PVEA 2K39A 5E6PA 4FULA 4KDLB 2LVOA 2ZPYA 4JL9A 4W9EA 1ZKHA 5AZHA 2DYBA 1GUAB 2KMAA 2WWZA 1UD7A 2XK5B 2JUJA 1P9DU 1TP4A 2XK5A 4E3CA 1G3IA 1Q1OA 4JGHB 3KW5B 2DAFA 2JY7A 2ZTCA 1Q0WB 3QK0A 4GGQA 1WGGA 1U4AA 1KM7A 4KV2A 1OGWA 5FR6A 2D11A 4WJNA 3GLHE 2JY6A 3L10B 1OAIA 2BWES 1XD3B 2YLMA 1LQBA 3ONSA 4HCPB 4GSWA 3HM6X 4HJKA 4ANXA 5HKHA 5KHQA 2KNBA 1EO6A 5LLIA 2FCQA 2KWVB 4ZRJA 1HJPA 1YQBA 4YL8A 3TMPB 1VQ1A 3NS8A 4AWJA 1I35A 2K9DA 2RPQA 3IHPC 1WH3A 2BKRB 4EZJA 3K9PA 2CKHB 3PV1A 3PGEA 3ECIA 2LVPA 1T0YA 3QA8A 2EKKA 1X3ZB 1MG8A 4GXBA 2WX1A 3N30A 3FRIA 1L7YA 1WR6E 2M0XA 2J0JA 3L17A 2Y5BB 2LJ5A 1WZ0A 2IY0B 2LXCA 4GIVA 1OQYA 2DI0A 2JUOA 2ZCBA 2ZJDA 4KIKB 4KIKA 4E74A 4MEMA 2PEAA 2MBEA 3H6NA 3WALA 2NPTB 2LVQD 1P3QU 2RRUA 4CHKA 1RFAA 2JRHA 4NY0A 1WMHA 3VUYA 2LGXA 3APCA 3N32A 3QCAA 1C1YB 3DVGX 4BKSA 2OO9A 2FCNA 1YX6B 2GBNA 4K1RB 3H7PB 4NJ6A 1J19A 5JH5C 3EHVA 2ZTDA 4YIRX 5IAAC 1BVSA 2K6QA 4IW0A 1UFZA 3DBSA 3VH3B 3CF6E 4PYZA 1MN3A 1CUKA 2NBUA 2LRUA 3LDZE 4W9CA 5DCNA 3SDLC 3QHTA 2IZVB 3PZDA 2WZJA 3QC8B 2KTRB 2QHOB 3AXCA 3VHTC 1X3WB 2C5LC 1A5TA 3ZO5B 2KHWB 2G45B 3B0AA 2G3QA 3VUWA 1UZXB 1LFDA 4P7IA 2HAKA 4LJPB 1P98A 1KLVA 4HDOA 2N9PC 3VUXA 2KO3A 5J2RA 2KHHA 4FHKA 2DYMA 5G2NA 1SE9A 1WGDA 4URKA 2N4FA 2A4ZA 3H9DA 2BWBA 4FLHA 3SHQA 2HTHA 1YX5B 2JZ3B 1E7VA 2J0KA 3TIXA 3A9JB 4KZCA 2AEHA 3E46A 1WM2A 3GZNI 3U7DA 4TQ0A 2C7MB 4HWIB 2MGWA 4AJYB 1LXDA 2LUEA 4MSQB 1GC6A 3TJPA 2KC2A 3KUZA 1V2YA 4GDLA 3V60A 4A3PA 1Y8RC 3DPDA 1J8CA 2F4MB 2D07B 2D10A 2PPHA 4GMVA 2DZIA 2Z59B 3DQVA 2ZNVC 4ZDVA 5CTRC 4KDIC 1NI2A 3IVFA 1NDDA 2MP2B 2RGFA 2NS5A 3JSVA 2BWEA 2GOWA 5E6NA 2MP2A 2DAGA 3UIOB 3VTWA 4G0NB 1WHCA 2ZCCA 1UBIA 2DENB 2AYOB 4LDTB 2IO1B 1TBEA 2MQJA 1UH6A 1TTEA 3DOWA 3T8MA 3R3MA 4DDID 4ICVA 1XQQA 1P0RA 2KXJA 2DZLA 3R7QA 2FCMA 3QARA 3V62A 3KH0A 3PTFC 2LGYA 2V1YA 2NCNA 2WX0A 2L76A 2IO0B 3PS6A 2CHWA 2BYFA 2M17A 3JYUA 2CHXA 3VTUA 2MW5A 2K8CA 1WM3A 1Y8GA 2MSED 1WZ3A 2WYQA 2KX0A 3HM3A 3TBLD 3V6CB 4MH0E 3V6EB 1WX9A 1BT0A 2M8SA 3BBZA 2GBKA 1RLFA 3B89A 5TR5A 4EEWA 5DFLA 4PYUA 3LJ3A 2BF8B 5CHWA 4BKTA 2EKFA 5CX3A 4LCDE 3WANA 2N1WA 4ZRIA 4HVBA 2KX3A 1OEYJ 2A5UA 2CWBA 3NY5A 4BBNF 1E8YA 5KHOA 4BVUC 4EKUA 1IM2A 2MA9B 3UF8A 2VRRB 4II2B 4BBNC 4W9FA 3HHMA 2JRIB 2O6VD 3BINA 3DVNV 1AIPC 4GU2A 3WAOA 3ZNGC 1E94E 1WI0A 3APDA 1EF1A 5D7GA 1V5OA 1PQSA 3A9KB 1RAXA 2V4LA 3ZLZA 1XXHE 3A9KA 3AU4A 1J0GA 1E8ZA 1NBFC 3UQBA 2RSUA 3FE3A 4MGIE 3PHXB 1ZMWA 3APFA 2KFJA 1WR1B 4M0WB 2L00B 3VQIA 4F1IA 2ZNVB 1PGYA 4HCNB 3SD5A 2I1KA 4ANVA 4F7ZA 2KMCA 3V61A 4DHJB 1HE8A 2KDBA 4HDQA 1WJUA 1HT2E 4KSLC 4EFOA 1WFYA 2V3SA 4WWNA 4DWFA 2NBVB 3N3KB 4BFRA 2DHZA 2KWCA 2UWQA 3MTNB 4NQLB 4M8MA 4FA6A 3IG3A 3M3JA 4AOFA 2KOXA 3R7RA 4DDGD 3CSFA 3QAQA 5JI2E 4IUMB 1DV0A 2N9EB 2KLCA 2NPTA 3A1QB 2HJ8A 4W9IA 5J18A 2MR9A 1XT9B 2FNJB 4W9KA 1VEJA 2NVUI 3VVWB 3GLFE 2BYVE 1TR8A 2FUHB 2KFKB 2MLBA 4IWOA 1JR3E 2FCSA 3MHSD 4WP2A 4HK2A 4PS3A 4W9HA 4CO7A 3D32A 1R4NI 3HK0A 3W1SC 1OTRB 1SIFA 5JHBA 2QSGX 1UELA 2BKFA 2DZKA 3H7PA 3IFWB 3DBLI 4IG7B 5J17A 5CHVC 1ZMVA 4DHZE 3ZUNA 1CMXB 2Z0DB 2LBCA 1YJ1A 3NZSA 3R66C 4NAWB 2MBQA 3L13A 4EUTA 4OVVA 2KTRA 2PJHA 2QHOA 4IWQA 3M62B 2OOAA 2HE7A 3PLVA 3Q3JA 3ML9A 3VAWA 2MROB 2JPHA 3RULA 2CP8A 2MWSB 2B3AA 4DK5A 2WDTB 2JY5A 4A20A 1D3ZA 1ISNA 2NR2A 2KJHB 4II3B 1VEGA 3AULA 1ZV1A 1UBQA 2LZ6A 3PHWB 4OVUA 2JZZA 2LD9A 3FRHA 2EMSA 2YVCA 1ZGUB 2Z0EB 3ENEA 4MGKE 2C9WB 4A3OA 2KZRA 3P2BA 3UIPB 3ZKJC 2KD0A 3RZWC 2DYOA 3A9JA 4EOYA 2LVOC 2DZJA 1XB2B 2MBBB 2GBJA 1V92A 2DAEA 3O65B 2L05A 1WJ6A 2JZ0A 2L7RA 3H1UA 1OEYA 1V81A 1V49A 2IYDB 4KSKC 2ZEQA 3IHPA 1WXVA 4WJPA 5G55A 1WE6A 2DZMA 4W9GA 3ZIMA 2KNVA 1F4IA 2R0IA 1C7YA 1NV9A 2HWJA 2J7QB 1T43A 3UINB 2R2QA 2EMTA 2O2VB 4J6IA 3I3TB 2DENA 3KYDD 4MGZE 2O2VA 5AEKB 3DVNU 1HT1E 2L8JA 5IA7A 3WAMA 3L54A 4FHJA 3KYCD 1ZMUA 2JNHA 2K1FA 2LWPA 1GNUA 2QSFX 1VD2A 2L3ZA 1G41A 2RR9A 4JQWC 2QSHX 3UGBB 4BOSC 2KVRA 2O25A 1WYWB 2DX5B 2KN5A 1QZEA 3ZDMC 4MDKE 2N1VA 3OJ4B 3NOBA 1VDLA 2D2QA 2IY1B 1L2NA 3K9OB 3ZRFA 2LVPC 3C0RB 1V80A 3AU5A 3K9OA 2H5XA 1SGHA 5DPTA 1X1MA 4ANUA 1Q02A 1WX7A 4KVGB 2OOBB 4GOCA 4ICUA 4B6WA 5EDSA 3RYTA 2IO3B 2LRWA 1VCBA 1E8XA 3QX1A 4HXDA 5JHAA 1V6EA 2HD5B 1Q5WB 4PS8A 2REXA 3KUDB 3T6PA 4TV3A 3OLMD 2K8HA 2ZPNA 2DHYA 4IM0A 1IPGA 2LXAA 2BWFA 1E5WA 3NHEB 3ZTDA 1WJ4A 3PRMB 4I6NB 4NPNA 3DBHI 4DBGB 3WA0A 1WE7A 2JXXA 2RD0A 4XX5A 4GDKB 4WWOA 4IM3A 4DBGA 1GJZA 2MJ5B 2MRPA 2N9XA 3QJZA 1WGNA 3PVLA 4JLCA 4W9LA 4CYEA 3W1YA 1I42A 4HEOA 1EF5A 3PLUA 2KQ7A 1WXMA 2JWZA 1C3TA 3PSEB 1WF9A 2EKEC 2KQSA 4I6LB 1EFUB
chains in the Genus database with same CATH superfamily
1YG2A 4HLXA 3RPUD 3K70D 2ESNA 5C1ZA 3QRFF 2OQRA 4LJZF 4LMYA 3K69A 4ETSA 3KETA 3I5UA 3FXOA 5AZGA 1RFKA 4IHXA 2X51A 2QCUA 3DBRB 4UB8C 1QLBB 4IL6C 3V4GA 1F9NA 5ITQA 4XWTA 3CUOA 1I4XA 4AG6A 3I59A 4A8XC 1JWBD 2OJRA 3R61A 5KQDA 2DTRA 3RI4A 4LRSA 1MKMA 2R4GA 2ZBKB 2UXBM 1KGSA 1UB9A 3FD9A 2TDXA 3OAWA 3NVYA 4KHPM 4LD5A 2V3NA 1QOGA 2KA6B 3SEQA 3CMMB 4HNVA 3TO6A 3ERED 3ABMH 4W1UA 2EWNA 2JY8A 1YQAA 1OIPA 3CP2A 1W1WE 4KODA 2XVCA 4HAMA 2WGSA 4CHUA 4RNAA 1YNTE 1JR3A 5LNK1 4M02A 4FCTA 1T38A 3TPZA 4G3OA 4B3TM 4KNYA 4PUSA 4RAFA 3M9AA 1SAUA 2VIIA 1JKRC 1XS9A 4XR6A 3ZQCA 1SD5A 1BW6A 4CYDA 3AI5A 1MBFA 4RGSA 1K52A 4AM3A 4IKGA 4GC5A 3WTYC 2JXTA 1MSEC 3VTVA 4GLSC 4HL4A 2YNMD 4BQAA 5DUKA 1C78A 1Y39A 3A01B 4I8OA 2CRGA 1TQIA 1TP4A 4G6QA 4X62M 5IYBJ 1Q1OA 2E7XA 2EPFA 1HEZE 4KV2A 2JWSA 3EDPA 4PJJA 5DTDA 4MGRA 3KQ4A 2LOOA 1U5TA 3J80K 2Y0QA 5LEKA 4CJ6A 3NRVA 2VE8A 2RPQA 2Z2SB 2Z5UA 3AV0A 2WX1A 3GFJA 3J2PB 1WKMA 3J7ZI 4G12A 2R7UA 1ETWA 4E74A 5JVTA 3OSGA 4NY0A 3N32A 4NXMM 3Q6BA 4BU2A 4IHYA 3W2VA 3DBSA 2G7UA 4WWMA 4JI3M 4ESFA 2HAKA 1OFFA 3KP2A 3FHZA 2O01F 4HZFA 1GJSA 4XKWA 1YSYA 2OV7A 2HQRA 1FOKA 2M0MA 1VF9A 2ZSHB 5KPRA 2X6XA 4GDLA 5FTMA 1Q1VA 1J7AA 1FIAA 1YJWI 4DR3M 2DENB 3HHGA 4IBDA 3U60A 3FXLA 3DOWA 2XSDC 4F52A 1R4NB 5DM6F 4PFOA 4L6V6 1IBXB 1FTTA 2DVWB 3PS6A 3E6CC 4Y52J 3OYIA 3C2BA 2VT2A 3V6EB 3BCBA 4HOBA 5DFLA 4BEHB 2QBYA 3LJ3A 3JTGA 4J3OD 5CX3A 3T3NA 3GF2A 1SAXA 1TF0B 2A5UA 3DLAA 1J0RA 4A3EJ 4BACA 4IOAF 4J00A 1SFXA 2X4AA 3BG6A 3ABLH 5D7GA 5H92C 2KIUA 3J81S 3E6BA 1ZP0B 3T5XA 3AKZA 5K7ZA 2KMCA 1HE8A 3EUAA 4HDQA 1ZE3D 2Q2EB 3SC3A 3B73A 1HQCA 2IPKD 1UG0A 2R5ZB 3CDLA 4B44A 2FJ1A 4MFEA 3W1SC 1SIFA 2DZKA 3VSKA 2HYJA 2XRLA 5CVVA 4BJ6C 2A5WA 1O4XA 3F3XA 4BJTA 3N1YC 1UHSA 1QNTA 4HRIA 4NQWA 3KW6A 2WDTB 2BQQA 2XKOA 2D7EA 2MBFA 3A1YA 4WK8F 1E9RA 3TDUC 2XAUA 1OEYA 4FX4A 2NQ8C 2BVCA 5CQGA 1IJWC 2J7QB 2LDUA 3CLOA 2EMTA 2KRUA 2L7HA 2APLA 4MGZE 2LY2A 2L8JA 2L4MA 3WAMA 3PZ8A 5FTKA 2KJCA 1DUXC 3H4MA 2LVPC 5FKKA 2P6TA 4S04A 4KKIA 4ICUA 1E8XA 4L18B 5E3NA 3TO9A 2JU6X 4PS8A 3KUDB 1N61A 3AG1H 4JV5M 4BH9A 4X1EA 1QQWA 1ETOA 4GDKB 1JXSA 5EXSA 5BPVA 5FFZA 2ZXIA 3T1HM 1BI0A 3LW5F 3TWKA 3AOEA 3I9V2 2HPIA 1C4PA 2FFJA 3KOZE 2NNNA 1MBKA 4E71A 4B3AA 2EFQA 2LVNC 3RPQA 4IM2A 4OIQF 2HVQA 3H5AA 2N7DA 4GIPA 4MM3A 1IDZA 4GC9A 1IXSA 1OMIA 3SFDB 3S14J 2BVMA 1S29A 3A1QA 3VWBA 3DA1A 4KYWA 2DA4A 1W36C 3FWEA 4E7ZA 1ROEA 3AG2H 4USAA 2ECBA 3ZNHB 1RETA 4XSZF 3TEZA 4G11A 1P7FA 3Q8XA 3ZMZA 2MBHA 3IAM1 5E6OA 5D5UB 4P1WA 3BK2A 3EECA 2X6OA 3C2HA 1KU2A 3KVFB 2L4EA 3OR1C 4DNCA 1F1HA 1TLHB 4R79A 4M3DA 2MGQA 2KNZA 1D1AA 1A5JA 2IGKA 4ZPXA 2P7CB 3HRSA 2JK3A 4ZDPA 3GX4X 5HG2A 3FF5A 4P9FA 3GLIE 2QSDA 2K25A 4CCNA 2YEPF 3IWFA 3F0CA 3UR3C 2HDEA 3KP5A 3M8FA 2K9LA 1L2BA 3UQAA 2EZHA 5E1ZB 4XZ4A 4UN2B 1H9TA 5E3MA 4C4VA 2VZKB 1FPYA 2KDEB 1V54H 3JR4A 5E20A 3E3VA 4OHJA 2MW8A 1EH8A 4FULA 2UU9M 1UD7A 2J42A 2DXIA 5D4RA 1I7HA 1DQUA 1WHUA 3IAS2 1HSTA 2D11A 1N36M 3BWUD 3A98B 1LQBA 3IH3A 2L54A 3J81Z 2L9VA 3HSFA 5HI1A 2DWZB 2HYGD 4GO1A 2CKHB 2Z8YM 4JYKA 4CSWA 2HKXA 2KAJA 3N30A 1WR6E 2Y5BB 3K4NA 1T0SC 1UWXA 4KIKA 4UV8A 4Q4ZF 4DBRA 5H2FC 3T0YA 2RGVA 1NVMA 5F64A 4KITB 2Y21A 5J8FA 5DYIA 1V5FA 5GPCA 4IBIA 3IH2A 4PYZA 1SFUA 3V76A 3QC8B 2NVYJ 2C5LC 2J53A 3M07A 2G3QA 5A2QK 4EJUA 1KLVA 4IJEA 3VYTB 4XM3A 5HS9A 2R44A 1KQ8A 2OZ6A 4Y7NJ 4AKHA 3CP8A 4NHJA 1C9FA 1IGCA 4DV0M 2VKHA 4AJYB 4MSQB 3KUZA 5FK9C 1J8CA 2PPHA 3GRRA 2M30A 2V3PA 2KWDA 5ITTA 2UXNA 1RM6C 2VPRA 3NRZA 2IO1B 2IT0A 1VZ6A 4IVNA 5HLHA 3MC9A 2BXYA 3HUGB 2LGYA 2L76A 4KT6A 3KP0E 3QOPA 1HOMA 2KX0A 1L4ZB 5HFYA 5BYSA 1MJDA 2LF8A 1XMKA 5M5XJ 1YITI 1SVMA 1B1BA 2L4AA 4ZRIA 1OEYJ 3CCQI 1TKGA 2MA9B 1E0ZA 3DF8A 5DEQA 2X6YA 3AG3H 4GU2A 2V7FA 2L52A 1ORYB 4ZYDA 3KLSX 4QNMA 3PQJA 3OYJA 4B09A 1NNJA 2WNMA 3ERMA 2R18A 5T8IA 1JTXA 3HZJA 2KACA 5JHFA 1KLGD 2GXGA 3GQ3A 3C3WA 4DJAA 1DV0A 4AYBA 3G6EI 2FUHB 1QAQA 3FM5A 3HK0A 1DGJA 2V4JC 4BUPA 4KN4X 4DHZE 2DPDA 1JUMA 2OOAA 2XF5A 2YPRA 2BTEA 2CP8A 2A61A 3BIID 4A20A 1ISNA 4I7HA 1BW5A 3TEXA 2YVCA 2PKOA 3ZKJC 2SEBD 2DA6A 2DAEA 2MEKA 1ZELA 3K4KA 1F1ZA 4WJPA 3HIFA 1FP2A 2XPWA 3DTIA 4R3DA 1RKTA 5H37D 3L9FA 1VD2A 2L3ZA 2R7SA 1J5YA 2CYYA 3NOBA 4LOCA 4LF9M 2PG4A 1V80A 3K9OA 3HKZA 5EDSA 4K0KM 2IO3B 4HXDA 2R4JA 3ZQHA 1QPMA 2CH0A 2LY9A 4MGHA 2IRFG 2KDMA 3PRMB 2VQHA 4JI8M 3W1YA 4MEXF 2KQ7A 5F1JA 2WADA 3HOZJ 1F0ZA 1WF9A 3VR9B 2VKVA 4RGMA 3TOBA 4AVZA 3EUHA 4B1RA 1JE8A 3CO7C 4K3BA 3MFKA 3KOWE 4FASD 3MK6A 1IFYA 1FD6A 2CU3A 5M3MJ 2OJED 3RT3B 2H94A 1JRUA 3N1XC 4XK4A 3HHWA 2PMZA 3LFUA 3RJPA 2B9SA 3WCQA 2J5YA 2KDFB 2DMTA 4C2UA 2RKOA 4F1SA 3RD2A 2WAFA 5ILSA 1VG5A 2GA1A 1S7OA 4G3XB 2NYXA 2DNAA 3I58A 1PUFA 3O6BB 3HOTA 1A31A 2OPTA 1ZQ3P 2IDYA 4N9F4 4B0MA 1ZUD2 3NBXX 3HIZA 2LC2A 4HG2A 3L4PA 2F4OB 3HPHA 2LBFB 4BKGA 4D82A 4FJVB 3I54A 4QIWN 2LR8A 3L0WB 4W9DA 4DYRA 3CUQA 3CJRB 1FWZA 4GN1A 1TNSA 2CW0F 5EQTA 3DEWA 3VRAB 3Q8AA 3CGWA 1BC7C 4IBFA 2E2HJ 4FW9A 1JHFA 2UXDM 4RAZA 4IHWA 3TO7A 4WJQA 1XD7A 1OAOC 2JYEA 2FBHA 3F92A 2NAZA 3ZNZB 3OYLA 2K39A 1FCLA 4KDLB 1C76A 3AEAB 4L16A 3GRVA 2BS2B 1MJBA 3MZ8A 3KYLA 2ZJQF 1E10A 4GH9A 2Y75A 1QOBA 4XLHA 2XF7A 4EM1A 2BWES 2W82A 1DU6A 3CJQB 4HJKA 3VDUA 1SB3C 4HQEA 3TMPB 3K7AJ 1U3EM 4AWJA 2XAGA 3E0JB 3QPLA 3SZPA 4MLOA 4JI1M 2YEPB 3I9V1 3HU1A 1YW7A 3QQAA 5JI3E 3EYYA 1P92A 2RRUA 1AUAA 3CCEI 1VQ7I 4DGWB 1GXQA 3QCAA 4JWSC 4YELA 3G1MA 1RR8C 3TGNA 3RI7C 2KTRB 2WV0A 3B0AA 1LFDA 5EXXA 3OL4A 4RDUA 1R2ZA 3DV8A 5KCMA 5EEGA 4ZZLA 1FYKA 2GOMA 4N6EB 2VKDA 1TWGJ 1BIBA 3DTKA 2DZIA 2VJ4A 2W4SA 3NEUA 1NDDA 5L3BA 2GOWA 5E6NA 5KK1A 3Q0UA 1TL8A 3UIOB 1G3TA 1UH6A 1K7AA 2ELKA 3AMZA 2XGCA 5IT9K 2ZSIB 4LK0F 5DD8A 3KH0A 3CDIA 1LDJA 2CHWA 1C79A 2CHXA 2MC4A 2YUSA 2GQQA 3O8GA 4FISA 2E3TA 2R7TA 2LKPA 1ZR4A 2DA7A 1TY2A 4II2B 5EE9A 2CJJA 1T0FA 4W97A 4KDPA 1SXJA 1RI7A 1E94E 3APDA 2DMNA 1I1SA 4MO7A 5J4YA 3UQBA 1HZ5A 3WTUC 1E17A 2N35A 1ZMWA 2R7OA 4UUSA 2F5VA 4UY8I 2AS5F 1HDDC 4BAXA 1WJAA 4DWFA 5FROA 4ZYAA 3N3KB 4PGGA 3W2DA 2M8GX 2R4EA 4AOFA 3ZCBB 2KLCA 3H0DA 2KISA 2HJ8A 5IT3A 2JRTA 4M9XA 1B1ZA 1VQMI 3MHSD 4KGSA 4CO7A 2D2WA 3F21A 3IAS1 5EXTA 2DW4A 1ZDVA 4ZH4F 4HNUA 3FZVA 1XXHB 3CESA 3L13A 4OVVA 4IWQA 3BPVA 1TH4A 3HTUA 3U6LA 5CYVA 3ML9A 3JRHA 5M5WJ 2KJHB 3BR6A 4XMYA 2JZZA 4A3OA 2KYWA 3UIPB 3D1NI 2GBJA 3O65B 1E32A 4KIGA 1WXVA 3C18A 4W9GA 2KNVA 2DU9A 1IRXA 2HZDA 3LSGA 3QWLA 2V9VA 3RNGC 4UB6C 3CIRB 3MZHA 2DOAA 1L4DB 1VDLA 4U0VA 3K2ZA 3GO5A 4Q48A 1TWAJ 1TQPA 1TJEA 2WB1A 4HEA1 4CCLA 3W68A 4YSXB 2M9HA 2JZYA 1AWDA 2N9XA 2D7GA 5C2TB 5HLIA 1ZAOA 4NNJB 3HOXJ 3JW0X 5D3IB 5BMIA 1MDMB 2A07F 3VFDA 1WIVA 3MMPA 4BKSD 2KHMA 3MVPA 4YSZB 4M0DA 1STZA 1GVNA 2WAQA 5IP9J 3DVGY 5L83A 4TQ1A 3K9PB 4K7SA 2O6VB 2JMWA 1GUUA 4XGIA 2V6CA 1J59A 2H27A 2BJWA 3OOUA 2UUAM 2VONA 4IHSA 4ZDLA 4Y28F 1PYVA 2K9MA 2IBIB 1IY0A 1BA5A 4HLEA 2RDPA 1XDUA 3LSMA 3LWFA 4D7MA 3PRZA 3NUHB 2LVQA 2ZB9A 2G5GX 2VKEA 3DHGC 3H5RA 5AIQA 2QQAA 3GWZA 1HTQA 5FTNA 4LNOA 1LVAA 4CA0A 1F9JA 3GTGJ 1JGGA 1TS2A 4L5IA 1FXTB 4US8A 3BT9A 4G50A 1KF6B 2MBOA 2PMUA 5FGMA 1GV5A 1RRBA 3FILB 3SFZA 5IOIA 3GO8A 4F3QA 2XBBC 4I02A 2VDBB 4MELA 3Q3FA 2DMPA 2VUMJ 2M5WA 2AWTA 1HDPA 2DMQA 1V5TA 1DPRA 1E8WA 4HPLB 2DAJA 4JI7M 4XLCA 3WGGA 5EF6A 2GBYA 3PL8A 4M3FA 3REOA 1IN7A 2RV8A 2XLJA 3M0EA 1IN6A 4M01A 3KXEC 4C56C 4JP0A 2WSCF 4KFCA 3E1SA 2DAFA 3GZNB 4II7A 3PSIA 2DQLA 3DHIC 5IREB 1F2RI 5HKHA 3ONQA 4LG0B 2WXGA 3K92A 3TMOA 3BR3A 1VQ1A 2BBCA 2K9DA 1KH0A 1P9QC 1X3ZB 1B9MA 3OYDA 3CF5F 3SXYA 1ZRCA 1AU7A 2FE3A 2LVQD 2W84A 1OCZH 4Y33A 2E1MB 2JQRB 2OO9A 1AOYA 4RS8A 2N0SB 2RMMA 3EHVA 2JN6A 2W3RA 2V4IB 1UFZA 3KSJA 4UUTA 4W9CA 1BMLC 2WZJA 3HL2A 3VHTC 3HBLA 2KFDA 2PLYA 3D5LA 2YR2A 3OYFA 2O7OA 1B8IB 1NY6A 4OZCA 5E26A 9ANTA 4C7YA 3FUTA 2BWBA 1X3UA 3QODA 3TIXA 1TDHA 3A9JB 3HJ8A 2EA4A 2ISZA 4CZCA 5DDGA 1RUNA 3I4NJ 3GTPJ 1IRFA 2D07B 2BWEA 3TQNA 2XB5A 2RDGA 3AEFB 1P4WA 1YS6A 1D0ZA 3N1ZC 2XPUA 2K40A 3R3MA 1D5VA 2YS9A 5LHHA 1P0RA 1L2DA 4HBLA 3P63A 1T5XD 1AHDP 3VTUA 3MMYB 4CQNA 4PT5A 1MX0A 3BYTB 3E6DA 2EJRA 2QF7A 3H8HA 2F5PA 4HVBA 2JQ7A 4A93J 1D2NA 4XOPA 2HTSA 5CVRA 3DVNV 2E5NA 4LIVA 3IXSA 3MHZA 1TNTA 1YN5A 1RPWA 2GXAA 3BZ6A 5LD2C 1J0GA 3L29A 2RSUA 2JVGA 1FBUA 4ANVA 2LH9A 1XSVA 1FEXA 3OOPA 4EFOA 1WFYA 1KSFX 4DR1M 2KWCA 1OIZA 2F4VM 4G7ZF 4FA6A 2ZXWH 1WVRA 1MI0A 3I59B 1MJ9A 4F55A 2NVUI 3GLFE 3KOXE 4BGDA 4IWOA 4HK2A 3GLHB 1FIPA 3X2QH 2DO7A 3ZUNA 4LLGM 1TDZA 4CYCA 1Z7UA 2E5ZA 4C30A 1ENFA 3IRRA 2ID6A 3VAWA 2B3AA 2WXPA 3CCYA 1D3ZA 3RN9C 1HCRA 2Y30A 3AULA 2EIMH 1R71A 5TJJA 3BG3A 3K9TA 3B7QA 1QILA 2XASA 4JBAA 4KSKC 2DOFA 2Y2ZA 4LY6A 3SYLA 3MC8A 3HRMA 3G71I 5IA7A 3JRAA 4UDUC 4E70A 2K1FA 3NBIA 4JQWC 1S3SA 3FK6A 2KN5A 1QZEA 4LB6B 2CUFA 5B66C 5DPTA 1SGHA 3SARA 2IS6A 4B6WA 4IRIA 3KWLA 2L0KA 5E18F 1EJ9A 4KUMA 1E5WA 3NHEB 2V26A 1F77A 4HW0A 4DUYM 2V1CA 1WGNA 4A3JJ 1AKHA 4LLNA 5KO3A 4PZJA 3BOQA 2BOLA 3ZDTA 2JZ1A 4DV2M 2BHZA 1Z05A 3B2FA 2I1JA 2WLBA 1T6OA 2FAZA 4ZHOA 1U5TB 4LITA 3BK1A 4UVCA 3A0BC 3WIMA 3T1BA 1YX3A 4L2YA 2HHHM 2XB0X 3DKWA 1OTRA 2M60A 3WTXC 4NZLB 3PIPF 4GFBA 3DTEA 1EH6A 3HJSA 1H88C 4QTRA 1XF5L 3M4OJ 5BMGA 2DNFA 2D45A 2B7EA 4QPQA 1WY8A 1LJ9A 4OIRF 3T3OA 2LD5A 3TWLA 5CVUA 5H6RA 1AN8A 1HQRD 5AZFA 2L0TA 4AP4C 2VLAA 4ZRKA 3K1PA 3OJ3A 3IECA 2D5GA 1KFVA 1C4AA 5L3FA 2SAKA 4G9YA 4XBOA 1DO2A 1XLQA 5D94A 3L08A 1GL6A 1IF1A 4GDLB 1QHGA 1JWUD 4BAYA 3UMMA 4WQMA 1XTAA 3LSPA 4PJ0C 2OOBA 3U60B 3TE6A 1R9TJ 4WWPA 3ZXVA 1DO0A 1NTCA 4IXAA 1YOVB 4OIOF 3MCZA 3B2GA 2QBYB 1TQMA 4LLLA 1PP8F 3BLYA 5GAGJ 4UHTA 2WWZA 3R60A 3OYKA 3U52E 2ZTCA 3L10B 1TKYA 3H9JA 4CGZA 5KHQA 3GPUA 2UUCM 4JI2M 2CGPA 4YL8A 1DOIA 2IW5A 2R65A 2ID3A 2L7ZA 1MG8A 4LK1F 2XROA 1OYYA 3M7GA 1UWMA 2J0JA 2DI0A 1MNMC 4XWWA 2XSZA 4US9A 2ETHA 3KOYE 3W67A 1WMHA 3DVGX 4GKJM 4RGRA 3TUOA 2EIKH 3ZMSA 1ZLKA 3ZJVA 2K6QA 4IW0A 1CUKA 1KTKA 1FOYA 3P4QB 3ZO5B 3VKHA 2YU3A 4NQWB 5J1YA 2P5TA 1NVID 2DYRH 2JA6J 3D8BA 2RQPA 4BYYA 1GB4A 5EZHA 3ZQFA 5BNGA 2C7MB 2KZUA 1ZG3A 2EFNA 2LUEA 3KVWA 4FTHA 1GC6A 1NG6A 4GMVA 2M56B 2Z59B 2K4JA 2EB7A 2OBPA 2K5CA 2BB6A 1VNDA 1Z0XA 2KMMA 2M34A 1VQNI 1YN3A 3U61A 3WTSC 1IUYA 1PUEE 3ROUA 3CMAI 2FCMA 3KEOA 1FY7A 3FMSA 2LY1A 2ZW0A 1PJQA 4IHVA 5IO9A 3BC8A 2UXXA 2K8CA 3TBLD 1IW7F 3V6CB 2WDQB 2GZWA 1L1TA 4JWUC 2CHQA 1QOAA 3VB2A 4WH4A 5LRRA 4M6VA 2ZANA 1QVUA 1N5WA 4AKGA 4E7KA 1WI0A 2XSZD 4RBOA 2DYSH 4DR5M 3PHXB 2KFJA 4A0XA 2GM4A 4N9HA 1SANA 3CCVI 1WJUA 4ZC3A 2LTPA 2UWQA 1EKEA 3CSFA 4IUMB 3A1QB 4W9IA 1XT9B 3CWIA 3HYIA 4W9HA 2OC6A 3WTWC 1HBXG 3P4SB 1CMXB 3K4JA 4MHGA 4JYAM 2PJHA 1U9OA 1V5GA 2P5LC 1JKOC 3K2AA 2JPHA 4BHCA 1CZPA 1E2XA 4ESJA 2I10A 3PHWB 4MGKE 1I94M 5IP7J 3EQLF 2IS1A 3G2BA 4P55A 3F6VA 1MPEA 3IT4B 4I76A 1NV9A 2F6CA 4C2MJ 3GTQJ 2M4GA 2O2VB 3URYA 1APLC 3KZIC 3FYCA 3FIWA 1JT6A 2O03A 4RM3A 3AEGB 2VB6A 3IC7A 4LJ7A 1X1MA 1WX7A 4M72A 1UUPA 4YTPB 1NY5A 2HD5B 3WG9A 1SVLA 1B59A 5KAIC 4AIKA 1YQ3B 4P6VF 2WAEA 4C4VB 1I42A 3QJZA 5E1WA 2P7VB 2VF7A 1YUBA 3FTEA 3DDCB 2WSFF 2PVOD 2R7VA 2A6TA 4A0YA 1MH3A 1WR1A 4A3MJ 1HXDA 4BBAA 3RQIA 1TZ1A 2I5UA 3AB5A 4EZLA 1LFUP 4RGTA 1RR7A 3CUQC 2Z3YA 1D5ZC 3LSHA 2JUGA 2V0GA 1ZRDA 5TSSA 1W5TA 2KLOA 1IO2A 2DWNA 3S2HJ 2I8DA 4B3RM 3BR2A 2KKOA 1HA8A 5ITYA 4AQ7A 4PJLA 5DPRA 3DBHB 3SEBA 2VF8A 2L7FP 3R9XB 1HTOA 1HW1A 2AXTC 1VQ8I 3BWGA 4EGYA 2XSJC 2HPMA 1SG9A 3H4JA 2EV5A 1OCOH 2KT0A 1ZG5A 2MLGA 3FX3A 1PRBA 3ABKH 5F0HA 1WXSA 2Z4RA 1JHHA 4LDTD 2WU5B 4E7LA 1WXAA 2G3QB 1YJIA 2DAIA 2LVAA 4X6AJ 2P5VA 3ZRCA 2CHZA 1JCKB 1ULYA 4X57B 3CLQA 4OZAA 2VC0A 2HTME 4LF8M 1HQYE 4FX0A 1WCMJ 1W7PD 3MJWA 1QUSA 4B8XA 2WQYB 4RMAA 1HNWM 3OMYA 2WBMA 2JX5A 3LSRA 2L5QA 3L2QA 4LRTA 4MSMB 4Y4RA 3OWEB 2WXFA 3KLNA 2DAOA 3I0TA 3EFUA 2LNBA 4DXFA 1WQ2A 4NDLA 3T15A 3RNAC 1WGXA 5KQ8A 1AW7A 2LVSA 2V1UA 4KZ0A 2B63J 2IXSA 2DFFA 3S8PA 4HV5A 3KS8A 2IP2A 3BZDB 4REZA 4LJAA 3KEYA 1O3RA 2DA1A 1Q0WB 1Y56A 3CCRI 4XLEA 1FX7A 2VXZA 4WJNA 2R7QA 2JA5J 4HCPB 2KIMA 5FRNA 3I71A 1KQ9A 3I63C 5CPRB 2OU2A 3PGEA 4ZYSA 3VRBB 1OQQA 3DWMA 2D3CA 3OIPA 3L17A 4RM9A 2ZJDA 3K2LA 2BV6A 2LH0A 3VK8A 3J7AS 2IGOA 4K1RB 5JH5C 2QGUA 4D9JA 3DHHC 3EUB2 3AXCA 1UZXB 1VZ7A 1IAWA 4LJPB 2QKMB 4HDOA 5H20A 1JKPC 1SE9A 2CW8A 1SXJC 2Y48A 2V9PA 4ANRA 5ILVA 1WM2A 3LOCA 4HWIB 2CRUA 1Z5CA 3K8ZA 5TGTA 2R93J 2EZIA 1XWIA 1NO1A 3JCUC 1TWCJ 3NARA 4L5EA 3FKEA 2LGSA 2F5OA 1WYGA 3DFZA 3QARA 3DPTA 2FBWB 3MKWB 2D1HA 3V05A 3FYDA 1FRRA 5E8GA 2BYFA 1MIJA 1FLIA 2K3FA 3ZP5A 1WX9A 2M8SA 1LTMA 1Z21A 3HHXA 1JB0F 2ACJA 2EFPA 2E1OA 3TSSA 2BW3A 2W7NA 2N1WA 1NHWC 1BBYA 1JUSA 2EA0A 4FETA 4BBNF 2CWBA 1EIJA 3D5RC 4XL9A 4EKUA 4II2A 5JLXA 4NBQA 3F9KA 4GDFA 2O3FA 4JXJA 1XXHE 4A6QA 2NTTA 3R2TA 1QF6A 3CTAA 2BW2A 1USSA 5L3GA 1PGYA 4P17A 1ACIA 3QPHA 1YW9A 2ZCWA 3C3DA 2KOXA 1VZ8A 1QVRA 3JRBA 3VYUB 2J5PA 4RLFA 5L3DA 2IS2A 2N9EB 4J01A 2NPTA 2R62A 4MIMA 2ZMEB 1E9MA 1FBSA 4PJMA 3VVWB 4QHSA 5EP2A 3D32A 2YFQA 5JHBA 1WI3A 1D5MC 4XLNF 3OYBA 2LXEA 3ZQLA 1U8RA 4RGNA 2Z99A 3K1NA 1U9NA 2MLKA 5EP4A 1DYQA 5DYGA 5J4VA 1BJZA 1QZYA 4JI4M 1R6BX 1LVKA 2L2OA 4CZZA 5L3CA 4XKCA 1GXPA 4L1BA 1EE8A 1TY0A 4ZHPA 2Q0OA 4GITA 1XC5A 3NJTA 5AIPA 3U1KA 1OCPA 2GIVA 3EIHA 5ILUA 4G94A 5HHDG 2O25A 5ITUA 3CDHA 3OIOA 2KP6A 4BY7J 1FNUA 1L2NA 1IGDA 3RPFC 1AA7A 1LFPA 5GTHC 4ANUA 4O3MA 4TV3A 3VUYA 2LXAA 4KIFA 5FD5A 5EDNA 5GAEJ 3ZTDA 5LGTA 3DBHI 4AIHA 4M3BA 3T8RA 2IAIA 4ZOHC 4RGOS 3Q9VA 1GC7A 2BB5A 3BTJA 1ZGJA 1WGKA 4JPSA 1IUFA 2ZJPF 2HVRA 3RZOJ 2MG4A 4B95A 3DZDA 3HU3A 4EMSA 2WSEF 3S16J 1I3QJ 4K81A 4JX6A 3LCVB 4FN2A 3N20C 4CGYB 2IGNA 2DI3A 2CJOA 5F6FA 1TS3A 2BPSA 3MJ5A 2LWXA 2BS4B 4G4NA 2O6VA 2Y69H 1XDSA 4ENNA 1G4DA 1GG3A 4I99C 3VYSB 1ZW7A 1HKQA 3RMKC 3WHBA 1X4OA 2WV1A 1XC8A 4YFXF 5B1AH 1JWSD 4LIUA 4FWGA 1JW9D 2AL6A 3VPRA 1XCVA 2KANA 1WSPA 1YI2I 2MCNB 1E7UA 1ZDXA 1V8CA 5JHUA 2XEWA 4RGXA 3TKYA 3PUBA 1XNRM 2JT4B 4MACA 3ZJTA 1OR7C 2W9NA 4LJ6A 5J8CA 4MQ9F 1YYVA 2GBRA 2FIDA 3LFKA 3PREA 3E9SA 2V6EA 3GFIA 2HOEA 1VEKA 2HTJA 4MTDA 2DWLA 1XX5A 1DP3A 2F5FA 2RKHA 3VDXA 3GLGE 3S1NJ 1H8CA 3PFYA 2QPAA 3BP8A 3BXWA 2HOAA 3OS2A 2XDVA 2DYBA 1SEBD 2FOWA 1P7JA 2QM3A 5FSWA 2JUJA 3ISPA 2OCEA 2JVHA 4RF1A 5FKLA 3FBNB 4XLPF 5F27A 1U4AA 2XUBA 1OGWA 4X64M 2JY6A 3UZUA 1Q3CA 2YLMA 3R8BA 3HM6X 1XSDA 4ZTJA 2OAZA 4Y3OA 1ZXIA 1D0XA 4UUSB 3V8JA 3S17J 2ISYA 2BKRB 5LHGA 4E7JA 1JI8A 4D80A 4LG3A 1MNDA 1DDNA 2ZKZA 3ETRA 2LJ5A 1WZ0A 4GIVA 2ZCBA 1UJ8A 4MEMA 2XKPA 2E71A 4XE0A 1QDRA 3MZYA 5IAAC 3H9GA 3CF6E 1ZLJA 3LDZE 4WF2A 4G4RA 4O6JA 3OS0A 2VOOA 5CQEA 3GLFA 2W54A 4EEFG 4BKXA 1E9SA 3JRFA 2STTA 4FLHA 3SHQA 1E7VA 4EV0A 1WJ5A 1HXYD 3LMMA 1HA5A 5ICEA 2KEBA 1OFHA 2ONQA 4RM2A 4XYCA 2HI3A 2Y0SA 3ABVB 3DU5A 3PNYA 3HRTA 4I2OA 1UHWA 3FXQA 3HOVJ 4PSXA 1R36A 2PBIA 1QU3A 4EEWA 1L3LA 4G8XA 2KX3A 1IY1A 4ABZA 2L02A 2JRIB 3W0LB 2IJLA 3WAOA 4DV5M 2K9SA 4Q5SF 4EQQA 2VODA 3K4BA 6PAXA 1N6ZA 1UGJA 3BVMA 4PFPA 4U87A 5D5VB 3Q0VA 3MTNB 4DW6A 2PW9A 3OL3A 1RC9A 4DBQA 5KPTA 1Q3BA 3W0FA 4N4NB 2LEKA 1JR3E 2BXZA 4RB0A 2QSGX 3GLHA 4IG7B 1A6QA 4AVPA 2QEXI 2MBQA 2BY1A 3HOWJ 2MABA 3WGHA 4RGUA 3CMEI 3P42A 3LAJA 1EM7A 1T3QA 2VBWA 2E1NA 3OS1A 5LBQA 2KZRA 4LCBA 3RZWC 3CCSI 2DYOA 2DWMA 3HRUA 2NS7A 5K7FA 4W5WA 3FMQA 3P9IA 2E1CA 1XGSA 2XF6A 2BY3A 1POGA 3HC7A 5AEKB 2Y9YA 3H3ZA 3Q3OC 3LVWA 4C9YA 2Y0SN 3DEEA 5ITRA 5K1YA 3KZZA 1VQLI 3C9PA 2LRWA 2P8TA 2VPLA 5E3LA 1A04A 1IN8A 2OTJI 4TUWA 4BHPA 1J5EM 3DPLC 4CO8A 4JQFA 4FCWA 5D6FA 2NXNB 4B43A 1MZBA 2JWZA 1EFUB 3PVSA 5LMNM 1S3SG 2BGCA 5EYRA 1BI3A 3QYFA 5IT9S 1DGBA 3LA2A 2GMIC 1X19A 4DZJA 4XNFA 1WH7A 3F8MA 3QQ8B 3KFWX 1S3JA 3K0LA 2KRKA 5C1BA 3DFGA 4G6TB 3ZQIA 3M1CA 2AQEA 2W55A 1SFEA 2KFKA 1KYIA 4MJSB 3ZOBA 5BMHA 4EZKA 1SD6A 4C80A 4NAWA 3QWZB 4DXAB 3CF0A 5HODA 2JF5A 3KSXA 4TMAB 1UM8A 3AECB 1T2KA 1TZOA 1WGHA 1BUIC 4G4QA 1VQOI 1R5ID 2CHVA 4PGHA 2E2JJ 3CQZJ 5JFRA 2ICIA 2K9QA 1K51A 3GTKJ 1YFHA 2GWRA 3DP7A 3RCOA 2A69F 3VXWA 3B1LX 4AUQC 3NVVA 5IOZA 1R7RA 3J7AO 2E7WA 3U6QA 2N7EA 2Y3AA 2HEOA 2G4DB 3W1SA 1YS7A 1CF7A 2X4HA 2COBA 1IN5A 4B48A 2MSYA 3ZQGA 1OKSA 2EINH 4DQOC 1W5SA 5FD6A 1U0JA 2OF7A 1RKWA 5EGOA 3B6CA 1JKQC 1SVOA 5LXIB 1E0EA 2J52A 1VRAB 4KX6B 4S17A 5EE0A 5AZHA 1YO5C 1ZRFA 4XK8F 3IWZA 3AE3B 3DXJF 1I50J 3HHHA 4ZYHA 1Y1WJ 3TDZC 1J2XA 5E3OA 2KNBA 1EO6A 2H88B 4DXGA 3O3KA 1FFUA 1HC8A 4BE0A 3ECIA 2LVPA 4IPAA 2EKKA 2JUCA 1GAQB 1GB1A 3FRIA 3R4KA 4LFCM 1MJGM 4HX4A 2DFIA 2JJ7A 2F5SA 2JWUA 3K10A 1C1YB 2KMUA 2LSOA 3ZMDA 1ON1A 1GVJA 4CYCB 1A36A 4GHLA 2H8RA 1N62A 2FUG2 4ENKA 4K3CA 1XCBA 4EVIA 3L2UA 2CG4A 4L5JA 1B4AA 4IBJA 3TP0A 4PCZA 2MGWA 4FWDA 4MT5A 1LXDA 4MQVA 5D8KB 1DGHA 2XGXA 3S2WA 3RNCC 3JSVA 2LUMA 2ZCCA 1F4KA 1MVKA 3SMSA 4B47A 1FYMA 2VQGA 4JK1X 3VKGA 2V9HA 5AUIA 2VQLA 1X1CA 1PJTA 1K61A 4EIWA 2FOIC 1JUPA 3L25A 5TR5A 3GFMA 1WJEA 2CV1A 2VL8A 4LCDE 3WANA 2EO2A 3MD2A 1P4AA 3HHMA 1AKHB 3TEWA 2Y5CA 3FISA 2JZPA 4E4HA 1QZZA 3A9KB 1RAXA 3AU4A 1XMXA 1TH3A 3B6AA 1NBFC 5IT9Z 2DT5A 1MBGA 2L00B 2CU7A 3BOSA 1NENB 2QZ4A 2G9WA 1TYGB 3GTOJ 1MBJA 2M2EA 2RGHA 4M3EA 1TW3A 2CFOA 5HOOA 1QANA 4LNFA 5J18A 1VEJA 2FCSA 1L8QA 4LFUA 1OTRB 3H7PA 4NSOB 2IA0A 5CHVC 4B0EA 4XRMA 4FVMA 4HLQA 1YJ1A 5K7HA 2QHOA 1IXRC 4DV7M 1EWCA 1HR0M 4DK5A 1VFCA 2JY5A 3L2AA 5D5WB 1W36D 2LREA 5KNLA 5DYMA 2Z0EB 1FEHA 1G3WA 2K3PA 1Z7LA 2LVOC 1Z5AA 1VQ9I 3IKVA 4BLCA 4NOOB 2ZEQA 2IEKA 5C4XJ 1FFVA 2A6EF 1T43A 1SF0A 2CFXA 4WXCA 4CCMA 2GA2A 3I3TB 2O2VA 2ZNZA 2W1OA 2DDBA 3LSJA 4DV1M 3J9CA 3LA3A 2RR9A 4BOSC 3W5UB 3V7SA 2R46A 3BPXA 3HRDD 1LEBA 1YIJI 4KVGB 2OOBB 2DTZA 3G4SI 3HWSA 1X1AA 4IM0A 2ZC2A 1MSFC 2CV0A 4DBGB 4XBFA 4KISA 4CYEA 2GOXB 1IQPA 3PVLA 2Q5WD 2LHCA 3CF2A 4BDZA 2K6DB 1KJTA 3HVZA 3A2KA 2CS3A 3ZJUA 4N4OB 3Q14C 3B08A 2JRMA 5HLTA 1D0KA 1NK2P 3WU0A 2NTSA 4LJ5A 3L28A 4WQOB 2FMYA 4DR6M 1WRDB 3SYTA 3HPGA 3FTFA 3RKQA 1QVTA 2X49A 2WY7Q 1T56A 2KJBA 1G6JA 4HPMB 4AW4A 1P1AA 2A68F 2KNAA 2H6CA 3Q3MC 4EM2A 2NBWB 4DOZA 4YIFA 3U6DA 5MPOA 2A5YB 5K5OA 2QVOA 2C60A 1WMHB 2HFHA 4RB1A 2HOTA 1X1PA 2QQ9A 2RNGA 1RZ4A 3GE8C 2PMVA 3CSTA 5DCFA 3DCGA 5L95C 2L2DA 4U88A 4R7GA 4IX7A 3KFUG 2LG4A 1YIWA 1H4RA 3IV5A 4GRIA 4DHZB 4BS9A 3HGGA 4WJOA 3ZIMA 4ANXA 3A03A 3K1MA 5C23A 5AUKA 2DAKA 1CGPA 3SYKA 3X23A 4ASWC 1NJGA 1Z5SB 3U61B 5HS8A 2CEAA 2QYOA 2ZVOA 3A4SC 2R7DA 1VI0A 1P6RA 4LJOB 1SJED 1PJRA 2L83A 3GOEA 2EV0A 5H6QA 4MGYE 1MH4A 3WU2C 1FT9A 3ZQ4A 5ITXA 2OD5A 2XK5B 1T6SA 1G3IA 3TQSA 3LB8C 5EXPA 1FIQA 5D5XB 1WRJA 1F2RC 4X65M 1KM7A 3RIRA 5FR6A 2R7WA 2OHFA 4FE4A 4UV9A 3W6VA 1B9NA 4GSWA 2VJ5A 4BDYA 1NK3P 2E2IJ 1D0MA 1ZYRF 3E5QA 3IHPC 4GXBA 1G6NA 4B4CA 1HF0A 4A12A 4UUVA 1K82A 1ZOYB 2CUZA 2G9HD 4M9SA 4LJ9A 4B08A 4HLYA 5L3EA 3BDDA 1KQ0A 5D4SA 1UNSA 2RREA 2ZFWA 2FNAA 3F8CA 4JX1C 4ZRQA 3VH3B 3ELKA 3CJNA 4WURA 1X3WB 2X1DA 3DU6A 2BBYA 2C9CA 2EZKA 5J2RA 1KRHA 3F23A 5G2NA 3CMYA 1WGDA 4URKA 4D5FA 3FUXA 3WTVC 2XC7A 4KZCA 3CC2I 3E46A 3H0GJ 3I3LA 3RTRA 3U5ZA 3S3OA 3N4MA 4D1QA 2I7PA 2RGFA 1WH5A 2R6FA 1XGNA 4LDTB 2AQ2B 2MQJA 4YFNF 4DDID 1SMTA 1XQQA 1EF4A 2V1YA 4ZRPA 2F5EA 2P0WA 4N59A 4WWCA 4ON0A 2AX5A 2KPMA 3PQKA 5LEJA 3FC4A 5BOXA 2ZO4A 1KYWA 4N9IA 2XAFA 2BF8B 5CHWA 2EKFA 2OCCH 4B7FA 5HS7A 2KT7A 1CK1A 1DGRM 4HNTA 2E34A 3M1EA 4IJFA 2K0PA 1WJDA 1N63A 1PQSA 2V4LA 3TL4X 3FTCA 1WR1B 2ZNVB 3H1CA 3HXLA 1ITYA 3J7BA 4KLNA 1T33A 3KIOA 4GXOA 1GDTA 4WWNA 5JVGF 2DHZA 3BZCA 3IG3A 2WXRA 3CC4I 2X8AA 2ZMEA 1SMYF 4WP2A 1MMGA 1UELA 3DBLI 4M74A 1W0UA 3BZKA 4FT8A 5FB2A 1NHGC 4I01A 4KICA 2HE7A 3RDIA 2Y0TA 2MROB 3GRYA 4G6DA 2E5LM 3VFZA 4HROA 1OCCH 2PEXA 4ACFA 2LD9A 2KD0A 4EOYA 2JT1A 1XB2B 2DZJA 2MBBB 4A90A 1FXAA 2L05A 4G4OA 1C7YA 2R2QA 1RNLA 3W9CB 3Q8EA 4J6IA 3AE8B 3PXGA 1U78A 3F6OA 4NXNM 2DA5A 4FHJA 2IGDA 1GNUA 2FUG1 1GABA 4OU7A 3WE2A 2X8XX 4MDKE 4ANJA 3OJ4B 4V2FA 5F1RA 4KA4A 2RC4A 5BPIA 1S9HA 3BQYA 1V6EA 5J47A 1AWCA 2K8HA 3UJNA 1RIOH 4HSTA 3ABTA 2RD0A 2C9OA 4V19K 4JLCA 2L7MP 2E60A 1UMQA 3ZC7B 1R5GA 3HG9A 3AL0B 1VR9A 3L27A 2KRCA 1FCCC 3C8YA 2WXIA 4HX7A 2Z3XA 3I4VA 3GLGA 5DPSA 2VBYA 1P3QQ 4IZZA 1WJ7A 2ZJ2A 2IPQX 2KDIA 4IWPA 1ZR2A 4M9ZA 2STWA 4L15A 1MG4A 5K5RA 2X6WA 3PM1A 3DQVC 3WAPA 3L2RA 1IYFA 2BGFA 4P9UA 1G4AE 3U8ZA 1ZXHA 4XIDA 5J1RA 3VYRB 2UV1A 3RZFA 1VQ4I 4F2LA 1XLOA 2OEDA 1NNUC 1WGLA 2NVTJ 3VOEA 2EZLA 2L4FA 2Y0MA 4II3A 3X0WA 2R5YA 1FM0D 2X9DA 1FRDA 3FXMA 3SATA 3IUOA 1B72A 2AL3A 1Y0NA 2WXLA 2ASQA 4IBCA 4LNIA 5D8LB 4MNUA 2CUEA 2IO2B 2LRDA 1ACCA 3KP3A 4RKUF 1LNWA 2MH9A 3IL2A 3ILKA 3R6SA 4BE2A 1Z2MA 4A0ZA 4FJZA 3WTTC 1C77A 4WAAA 1V9JA 4GYIA 1NV8A 2CR5A 2FOKA 1M4VA 4C7ZA 1SXJE 2P4WA 5ED4A 3QIJA 2OUMA 3K70C 4AQYM 2M4NA 4A3IJ 4IQ4A 3AEEB 1ERDA 2I38A 5F0CA 4E6KG 2CWEA 4LLGF 2E1MC 3S3MA 1WRIA 2ZVNA 2Z33A 3PT2B 2KC1A 3UNGC 1WSUA 4LNNA 1TH2A 1UGMA 3BY6A 2BW3B 5E6PA 4JL9A 8CATA 1GUAB 4LTUA 1P7IA 1K3XA 4JI0M 2R7RA 2QMTA 3F8FA 2BY0A 1YW8A 5FKOA 3AE2B 4GGQA 2KZSA 3EETA 4ARCA 4A3CJ 2N7JA 1OAIA 1XB4A 3ONSA 2ZAOA 5ERIA 1TC3C 1YQBA 2EELA 3QP5A 1R5HA 3NS8A 3GPYA 1ETQA 1O3TA 4NRWA 2JXNA 4G7HF 1G8PA 4MB7A 3BQZA 3L2WA 3CO6C 1L7YA 1OQYA 2NS0A 2FE8A 2DLBA 2NPTB 1RFAA 2Q1ZB 5IKCM 2LGXA 4BKSA 4RAGA 3I64A 3JRCA 2GBNA 2DA2A 3MHVC 3Q8BA 4NJ6A 3RNEC 4YT0B 3MQ0A 3PZ7A 5LFAA 3TBIA 2NBUA 2W25A 3QU6A 4PK4A 2KN4A 2O5RA 1IBLM 2QC8A 1MMSA 3WU1B 1D5YA 3ZMUA 1JWMD 2N4FA 1Z3XA 3ZR8X 3GP7A 1YJNI 5TISC 3KDSE 2V1XA 3NAUA 1N77A 3WHLA 4RA2A 3V60A 2XPVA 2KC2A 3TJPA 1XMQM 4PDKA 2B76B 2NS5A 3OYNA 1WFXA 3ECOA 2VT3A 2N9LA 2K86A 5FLXS 3RGSA 4NC7A 2NVUB 4B3MM 2WXJA 3V62A 4RLQA 2ZNYA 3G73A 3W3CA 3FXRA 5F0FA 3HTSB 2E6XA 3JYUA 1YMHE 1ON2A 1Y8GA 1ETYA 2MSED 1Y0UA 1UCRA 4XN0A 2I2YA 4KMUX 2MD0A 1CJEA 2XAJA 3AEDB 1N5XA 1DGGA 4U0WA 1IM2A 2HQAA 4CISA 1NSFA 3HGYA 5FRMA 2NMQA 3OV8A 1XNQM 3JRDA 3GTMJ 4MGIE 1Y8RB 1E7PB 4S0RA 5EEHA 4M0WB 3CCMI 1LEAA 3BR5A 3V61A 3U6EA 4S05A 4P5OA 4ARIA 3R0JA 2WXHA 1O3QA 1GKIA 2MJDA 4BFRA 3S15J 2UUBM 3M3JA 1L1ZA 2FF4A 3PFIA 1ZREA 2PJRA 2FA5A 2E35A 2MR9A 2QILA 5J3LA 2MLBA 3GVAA 2XIGA 1Z9CA 1QBJA 1JR3D 2GRIA 5FTJA 3AE4B 1LPQA 2HQ5A 1TS4A 3IFWB 2F5DA 1ZMVA 3U9GA 4IEJA 4HQMA 2Z0DB 2HJ1A 2IVMA 2XHKA 1XCTL 2LK2A 1H0MA 4MFDA 1QPIA 1I27A 3QPSA 3FRHA 4IOCF 2C9WB 1YX5A 1XLPA 2VC1A 3PSFA 4H2AA 1ZARA 2E36A 3DOAA 1WJ6A 2JZ0A 1V81A 1IG7A 5LRSA 1WE6A 3SAWA 3H35A 3B9PA 4BBRJ 1MHXA 3C19A 1EH7A 3KYDD 5DCMB 4I98B 2INDC 1YRNA 3KYCD 1U5TC 4DR4M 3O8HA 2RNJA 2N9KA 2N1VA 4A6EA 3AN1A 4IQJA 3GRUA 4A3GJ 2Z7JA 2LJIA 1V33A 2H09A 2LP0A 1QZMA 2ZPNA 4OAYA 2Y5PA 3HDDA 2HCBA 2EFWA 1WJ4A 2YQZA 3ZQ7A 2UXCM 2BNKA 2DT6A 1WXMA 1ZGAA 2EKEC 3MN2A 1FP1D 4Q2JA 3AE5B 4V2GA 4XICA 3Q5FA 2H6BA 3TOAA 2B3TA 3UGJA 1R4MI 2JY6B 3VR8B 2EFOA 4FBJB 1NYQA 2R2OA 2DKLA 2HU9A 1S72I 2FBKA 2ELJA 4XLAA 5FKMA 4Q7JA 2VH2A 4MJSA 1TKEA 3ULQB 2KLGA 2QZ8A 2GXBA 5CLSA 4LF4M 3GW2A 1TW2A 4XOTA 2X0LA 4B9KA 2M19A 3D8LA 1JMLA 1FNWA 4P1BC 3NWLA 3B02A 4NQKE 3U30A 3PRPB 2KK8A 4IOIE 3SFEB 1PUTA 1N33M 3TCAA 4EGZA 3I56I 2K0BX 3GLFB 1XG1A 4LF5M 2G8LA 3T38A 1G71A 3HJQA 4PSWA 4ENMA 1V5EA 4K7WA 3M63B 2W00A 2GI9A 1MU5A 1K53A 1W0TA 1V4RA 2QEJC 3DBRI 3A33B 4ENJA 2IJ0A 5FLXZ 4RFBA 1XLNA 3FKYA 4KKJA 3ZW3A 2BZTA 4DR7M 1YQ4B 2C7HA 4W9JA 3B7ZA 4XC2A 2KRHA 4PS7A 3HHZA 4OINF 2XN9C 1Z6TA 2XFTA 3VFKA 4IKFA 1UHMA 4OU0A 1SC7A 4JI5M 2LYCA 2M7AA 1G59A 3ZN1A 1V55H 2ZPYA 1IUEA 2AHMA 1T0QC 3W5VB 3EUKL 4E3CA 4A5MA 5HVQC 2NVQJ 4B7HA 3HVDA 2JY7A 4S0HB 4NRVA 1LKXA 4GGGA 4HKZE 1TT5B 3FXKA 3GLXA 1RRJA 2HVSA 3PV1A 2P81A 1I5ZA 3H3UA 3OTOM 2IY0B 3R8FA 2JUOA 2D7HA 4XGAB 1PJIA 3HOUJ 2VN2A 3A42A 3OG5A 3GQ4A 2VBZA 1J9IA 1UG2A 1FNVA 4M00A 2KRFA 1VLBA 1MN3A 3SDLC 3PZDA 2TCTA 5DNYA 2NOJB 3Q8GA 2AO9A 4HKQA 3VUXA 2KO3A 4A6DA 5DUIA 2CSOA 3H9DA 1LE8A 1MMDA 3AOEC 1ET6A 2JZ3B 1OCRH 2J0KA 4MEYF 4CCKA 3DKYA 3P4RB 2AEHA 4KMFA 1ZG1A 1GOZA 3DPDA 4L0ZB 2MP2B 3VTWA 2DAGA 1WHCA 4XORA 2LNHC 1LGRA 2KXJA 3RNBC 4AU7A 1GT0C 5JLWA 1GPXA 2ACZB 1HNXM 4JX5A 4DYQA 1WM3A 1I4PA 1MMNA 4MH0E 3B89A 5HDKA 3WE3A 1L0YB 4EJVA 1SE4A 1J7KA 2J7OA 1C0WA 3RE8A 1ETKA 5J1UA 2E19A 1SFOJ 3GLIA 2JSPA 3PIOF 2V6ZM 2XGEA 4OVZA 1EF1A 1B9RA 1V5OA 5D3DA 3A9KA 5C18A 4L78A 4Z6YA 4ESBA 2BS3B 2VBXA 1H8AC 3AG4H 1DU0A 1HT2E 3AM9A 5BYRA 4M8MA 2C98A 3FUVA 2DDAA 3QAQA 2DK8A 2R3SA 2KFKB 1SE3A 2NVXJ 1R4NI 5HNFA 4OMYA 4IHTA 4IJAA 1SE2A 5DD4A 4GKKM 1TZLA 3NZSA 4NAWB 3I4MJ 1SD7A 3M62B 1BR2A 3WTZA 2MWSB 2ZM6M 3SMPA 2F48A 2C99A 4WW0A 4OVUA 2EMSA 1ZGUB 3P2BA 2CMPA 1K6OA 1LQ1A 2GQFA 4HEA2 1EWYC 1E3HA 3ZCOA 3NG0A 3H1UA 3JAMS 2IYDB 1JJ6C 1VDVA 1F4IA 5JXVA 5I4DA 3IKTA 5CVJA 2EKIA 2W48A 1JROA 3VEPA 1SSNA 3DVNU 1HT1E 3S1QJ 3GZ5A 5ICGA 2FQ4A 1G41A 3Q0WA 2XZUA 2IBDA 1PM5A 5KAFC 2O9LA 2HS5A 2H5XA 3CTWB 3IHUA 2BEOA 1LUJB 4BZAA 4IIWA 1CF7B 3VK7A 3DCFA 2REXA 3T6PA 1IN4A 4C3JJ 2XZFA 2HNHA 4A3VB 4XSXF 5EGOB 2H8WA 2JXXA 4DBGA 5GPAA 3FHNA 2D1VA 1I6XA 1F36A 4I81A 4I6LB 4RCOA 1ETXA 2WDVB 3OWTA 5BYQA 3ESWB 3ZH9B 3TEDA 2K27A 4YWGG 3UKGA 1NHAA 2O8KA 1D6EC 1D0LA 1TWFJ 2W3SA 1N75A 1XSXA 3ZRGA 1R7SA 4CXFA 4BY1J 3Q69A 2HZTA 3M95A 1M94A 3MFGA 1J09A 3RSNA 3RKXA 4TKNA 3BTIA 4IC7B 1WI9A 3SAVA 1P2FA 1KZHA 3I57A 1T08B 1PYWD 3GP1A 3OYEA 3HKPA 1R6RA 3I4PA 2VI6A 2NRAC 1AARA 5LXHA 5FKAC 3ZVVA 1PJJA 3Q2AC 1EUVB 1YLAA 3QP6A 4A3BJ 1IP9A 4QNRA 3SAUA 1I39A 2WC2A 2PI0A 2DBBA 1X37A 3JRIA 3W6KB 3ZPLA 1S1QB 1J75A 1UFMA 4AC0A 2G4SA 1FSEA 2ZZPB 4HRSA 1N32M 4YIIA 3J7YJ 5D6JB 1ZTRA 2R0QC 4M3GA 3ML8A 3S2AA 2LASA 1DGHB 4OX9M 3KUCB 2KIQA 2Z4SA 2EILH 5IPAA 1OYIA 3JSVB 1BL0A 3AH7A 2XGNA 3ZMVA 5C3EJ 2ICWG 2KDLA 3FKIJ 4XRSA 2L0FA 1WJBA 4WAFA 2HXIA 4L9NA 1LDDA 2QLZA 1L0XB 2ON8A 2FSWA 3B9JA 3ZTCA 4RAYA 1WWXA 1DPUA 4X66M 2DZNB 4DHJD 2KKCA 4IO9F 1X4PA 5BR8M 1K50A 1PVEA 3UI3A 4OMZA 3E7LA 1P9DU 2XK5A 4HX8A 3E5XA 1J7CA 1OPCA 4JGHB 5E8IA 4U0YA 3ZGKA 5FO5A 3I5JC 1OQRA 4BB9A 2MH2A 4OOIA 4QPOA 2RPVA 1KLUD 2KWVB 3V8KA 1PDNC 1Z5BA 1RUOA 1WH3A 3OYAA 1XMAA 4BJ5C 3H3VK 1T0YA 3SDGA 3F8BA 4GYGA 1NI3A 4AYBN 2WA0A 2Q8KA 1IY2A 2HL7A 2GB1A 3WALA 3FM3A 1P3QU 4CHKA 3IG8A 3APCA 2DT7B 3H5NA 2FCNA 2CQXA 2CO5A 3H7PB 3HHYA 2WTEA 2LLKA 2QHOB 1P4XA 1G8XA 3VUWA 3P7NA 4P7IA 1BIAA 3A45A 3PO3J 4NL4H 2VJIA 1J7BA 3D0SA 2HTHA 4BHBA 1Y1VJ 2VXDA 3E5UA 4HF2A 4EE2A 4GCVA 1IXZA 3JAMZ 3EUHC 2R7XA 2FQ3A 1V1OA 3DEUA 1YHQI 4XN3A 2N8GA 4KDIC 4YRVA 2H1RA 4XKVA 4G0NB 3KP1E 3AAFA 3C1DA 2LMDA 3T8MA 5ICCA 2IA2A 2DZLA 2FU4A 3H36A 3HKZN 2ZMEC 5M5YJ 3JRGA 2CUJA 3AEBB 3SBJA 3BTLA 1XPXA 1W7PA 3OYMA 3JR5A 1E8YA 1REPC 5H8YE 4CICA 4N0BA 2VRRB 2DCEA 3BJ6A 2RQQA 2LGIA 3ZQJA 3RQ4A 2C5RA 2EIJH 2K22A 3FE3A 3I4YA 3VLFB 3APFA 4QOZC 5HDNA 3LAPA 2I1KA 3AE7B 1GV2A 4KN7X 4KSLC 2QCZA 2V3SA 1R00A 3RGPA 2PMZN 2W24A 1GLNA 5JI2E 4A9AA 3CCJI 4C3IJ 1Y6IA 1O57A 2WS3B 1SBBB 3GUDA 4PS3A 2CQ7A 4IRHA 5EG0B 2BKFA 2LMCA 4F93B 4C3HJ 3R66C 1WJCA 5FLXK 3S3NA 1ZQ9A 1JGSA 2MA3A 4IBGA 1DGWY 3T8TA 2Y9ZA 1ZV1A 1UBQA 3ENEA 4B3SM 1WZ2A 3U6CA 5TRDA 1Z67A 3JSPA 3OYHA 3RKYA 5KHDA 1LFBA 4P1CC 4HA8A 5E1XA 1FTZA 1OFCX 2OQ4A 2ZW1A 2DODA 3K4LA 1MBHA 1K78A 1ZMUA 2JYTA 5FJ8J 3BJOA 4A69C 4D5CA 1WYWB 1MJAA 5G5GA 3BR1A 4JOMA 1BXTA 1V1PA 5EEAA 1QYRA 1ZPSA 2BJVA 3WHKA 1VCBA 3L26A 2JPCA 1EU4A 3O2PE 2BWFA 3E97A 3ZQQA 1L0OC 2ME6A 2JA7J 4IM3A 4WWOA 1R5LA 1OCTC 2ADUA 4LF6M 3PJRA 3QPTA 4AIDA 3PSEB 4QWQA 1OYWA 5FTLA 2ERCA 5F08A 3GFLA 4TUUA 4M8NA 1I4WA 3U6SA 4WX9A 5IN7A 4CH7A 3K4CA 4GEWA 1X58A 3JTHA 1E3OC 2KL4A 3K1JA 3Q9SA 1TGUA 2LTUA 4YEJA 4TSSA 4EJWA 1YLFA 1FO4A 2B0LA 2AQ3B 3KCCA 3JVZX 1L2CA 1WGYA 2CE7A 1WWTA 2M8EA 2KDOA 3SU8X 2MHJA 4UVAA 2J0MA 5C3JB 1Y8QB 4A3DJ 1VJKA 1BOAA 3LSIA 3RKWA 2HDDA 3S32A 1HKSA 4BXXJ 4YTNB 2BYEA 4KO8A 3WG7H 5CKTA 1JWAD 3BY4B 2Z9OA 4GB9A 1M1EB 1T0FC 2V1NA 2V1DA 1V34A 4JI6M 2DMUA 1WJNA 1I1GA 2MX2A 1MGTA 3N05A 3PPAA 2LHEA 1KOTA 1TTNA 4DR2M 3ECHA 4H0EA 1U2WA 1PP7U 3U5ZB 2DJNA 4I09A 2LI5A 2MD5A 3TL5A 4RM8A 5IOYA 1U8BA 1UZCA 4M73A 3J81K 1DGFA 2KIFA 1SXJD 5F04A 3BJAA 1VTNC 3L16A 2WWYA 3O13A 1FXIA 1VDDA 2FEZA 3MKYB 3GLLA 1A5RA 1HZ6A 4O5VA 2PN6A 4JN6A 4JX4A 3I55I 3ALBA 2P6SA 2OQGA 4NC8A 5FKNA 4W9EA 4ZTFA 1TIFA 2UWMA 2BT6A 3Q8FA 3KW5B 3P9KA 4HYEA 4QAYA 3VSLA 5EP1A 3U1DA 1UAAA 2J7NA 2FS1A 2LHDA 1SIJA 1HJPA 4NAMA 5EP3A 1I35A 4FCYA 3EPZA 4EZJA 3HM5A 2LFIA 3LQRA 2CV2A 3VDPA 3AFHA 4DIQA 1D4BA 4AG5A 2M0XA 2ZBKA 3TW7A 5JI6A 1JALA 3W2AA 3U6PA 3C3EA 3WODF 1A35A 1NG7A 3JW4A 3GZ6A 1UELB 4D7NA 2HKJA 3CMMA 1J19A 1BVSA 2QA4I 2LRUA 1FJLA 1ET9A 1V97A 3V42A 1QGPA 1FMVA 1OKRA 2M45A 4TV7A 1RYJA 1P98A 3L00A 3HJEA 4FHKA 2X1CA 3S93A 1L6UA 2XRNA 5IP4D 2W85A 5HLGA 1OISA 5K5QA 3E56A 1BM9A 3JR9A 3U7DA 2FXAA 1V2YA 2K5PA 4A3PA 1VQKI 3GPXA 4AIJA 1NI2A 1XN7A 3IVFA 4L9JA 3M3YJ 3HSRA 1YN4A 1R1TA 2LF7A 3WHCA 3SQNA 2LFBA 4NUBA 4A55A 2QQ8A 2DN0A 2WB1N 2M17A 3KX2A 2WYQA 1STEA 3HOYJ 3F8NA 2XFSA 3A01A 3NY5A 3CC7I 4N58A 1FMWA 4BBNC 2HXOA 3Q8CA 3BINA 4M71A 1WXQA 1OR7A 3LNQA 3G1OA 3KP7A 4WXHA 1IXCA 2H1LA 1E8ZA 2QUFA 1BN5A 3AV8A 3GLGB 4M0WA 3LL7A 3QAHA 4E7IA 2KDBA 4G6ZA 2WAQN 1ZHFA 1ETVA 2QJLA 4FQGA 3LSTA 4FCVA 3FTDA 2X1EA 1Z59A 4DZPA 4O1NA 1KONA 2FNJB 4W9KA 3G3ZA 1TR8A 1IRGA 4OWRB 3GCMA 2IS4A 2QP9X 5B3SH 5DS9A 2HGCA 3IRQA 3PLVA 1ZKGA 1JQ4A 2D3BA 2A05A 4II3B 2R5YB 1VEGA 1LDKB 1ODDA 2LHGA 1K83J 1Z91A 2VQEM 4AD9A 1B72B 1TS5A 4NB5A 2DZMA 3D5SC 1T3TA 2OZUA 3MC0B 4WXDA 2O0YA 5IP6A 4Y15A 2DENA 4KIBA 4OAZA 5DCMA 5F3WA 1R2YA 1MFWA 1I4QA 1VQ6I 2DX5B 1IBXA 2IY1B 4OIPF 2K7LA 3FUUA 1ONVA 2MH7A 4BEHA 2XEPA 1IPGA 3KLOA 2JA8J 2L09A 4XX5A 2EV6A 4HEOA 5EE1A 1EF5A 4AS1A 2K9XA 2DZOB 2KQSA 5GAHJ 1YD8U 2DOEA 2XAQA 1FZPB 3E21A 1IBMM 1WX8A 2EA2A 3NZUA 5CHFA 4UNOA 2DK5A 3U4EG 4EJOA 2NOGA 2M0AA 2WDRB 2Q2EA 4XDDA 5DPWA 5BMZA 1KFYB 2HOSA 2R5ZA 3NS1A 2KJRA 5BS6A 3LQQA 2OA4A 1V3FA 2QDFA 3SHFA 1QHHD 4JIOU 3JAMK 4LK0M 3ASNH 4PDIA 4I4LA 2NNYA 2CS4A 3TWMA 2KDZA 2JWTA 2DJIA 3FUWA 5JR3A 5E6JA 2JVCA 2H89B 5B1BH 1OFIA 4P16A 2LGDA 4HPPA 1WJFA 2INNE 3EGRA 1MBEA 4IBKA 3IBEA 2HR3A 4MTEA 1T39A 2O8XA 2PVGC 1FPQA 1LM8B 1TGZB 3BG5A 4OW0A 1QO0D 3DLLF 1I4RA 2PFBA 3KPHA 1O7FA 2X38A 1IV8A 4BOZB 3ZNID 4LZZA 2RAEA 4NJ7A 2UUZA 5JZEB 1TT0A 3EYIA 1HKTA 1QQIA 1YJ9I 3VDZA 4GDKA 1R23A 1QUTA 4D81A 3RUIB 4ITQA 3KYDB 2FIFA 1F5TA 3OYCA 2QNJA 2XF3A 3KYCB 2CQKA 4MH8A 3THGA 2KMAA 2MFZA 3FDYA 1N34M 2C6YA 2DQRA 1IV6A 3QK0A 1WGGA 1CQVA 3GLHE 2HWVA 4BNCA 5EZGA 1XD3B 2FCQA 5J6XA 2PQ8A 2EH3A 2QCOA 3R0AA 1F43A 1IC8A 2LKSA 1EA3A 1KU9A 4IRGA 3M8JA 3NZ3A 2L9SA 4B3XA 3BROA 4IBBA 2PJRB 1GL7A 4RF0A 3H6NA 2MBEA 5CVIA 2Z8LA 3JREA 4QSHA 1N60A 3IH4A 1YX6B 4ITKA 1QKZA 3NVWA 3HEFA 3ZMTA 4LB5A 1FBQA 2KHWB 2PJPA 4LZJA 4KGRA 4YTMB 2A4ZA 2L7IA 1YX5B 1R1UA 2WXKA 3GZNI 1SD4A 5FR3A 1CQTA 2F4MB 4L9TA 3UK6A 2MP2A 4DUZM 2ZFUA 3GTJJ 3OSFA 2NS8A 1UBIA 2MC3A 1TTEA 1YRNB 4ICVA 1H89C 1X2NA 3PTFC 2WX0A 3CCUI 4UXNA 2TSSA 4R8HA 2MH8A 1BT0A 2GBKA 1RLFA 2JSVX 5GTIC 2A6HF 1ZH5A 4U7BA 5EE3A 2QENA 2D3AA 5KHOA 3FK7A 4YSYB 3ZGZA 3UF8A 2R7FA 4WCGA 4HDVA 5KPZA 3GPPA 1FOXA 3ZXSA 1G3SA 2CQQA 3HUIA 3PUFA 2M5ZA 5FFXA 3VQIA 2G0EA 1NH3A 4F7ZA 5LGUA 3H9QA 1BI2A 3U21A 1IBKM 1FJGM 1VZ0A 2FRHA 3KE2A 2RDHA 4JE3B 4BBSJ 1S6LA 1KU3A 4K2EA 2F5CA 1HW5A 2BYVE 4L4UA 1QRYA 4FE7A 5DM7F 3AE6B 4IF4A 4XKBA 4KT5C 3SHGB 2FH0A 1TTYA 1X1BA 4AUXA 2F4IA 2OTLI 4LG2A 3N9YC 3LA7A 3LSKA 3MKLA 2YX4A 2Y31A 3A0HC 3CD6I 3FKJA 4HSRA 4KJZA 2GLOA 2HDCA 1T8IA 4G7OF 2JSCA 2WXMA 3L7WA 3IT6B 3P1MA 3RZDJ 1HW2A 2ZXHA 1V92A 2LKXA 1BC8C 2WXOA 1DP7P 3L2CA 1V49A 4BQQA 4IBEA 2HWJA 4RH6A 2VZKD 2AQ1B 3RNFC 4D2KA 3T1YM 3U2RA 4HJGE 3VODA 3CJTB 2K85A 4M6XA 2JNHA 4I0BA 2QSHX 3UGBB 4RMNA 3PNVA 3U6OA 3HUGA 3ZDMC 1NYRA 1DOXA 2VQCA 3W6JB 3AU5A 1OLTA 4PJNA 4GOCA 3QX1A 2KQRA 4DV4M 1Q5WB 2F5QA 1D3YA 1E6EB 3MP9A 2DFHA 2G7HA 1HLVA 1FNNA 1GJZA 2MJ5B 1LB2A 1VQ5I 1C3TA 4PK1A 2ESHA 1C1KA 1WIAA 4FJYA 2K8BA 5CJ9A 4HV6A 4L23A 3GQ5A 4YG2F 3PO0A 3RFZB 2WXNA 5BO4B 4MM3B 1N78A 3Q3SA 1IXSB 1LV7A 3SEZA 2L9NA 3G1LA 4XQFA 4AZFA 2YX7A 2M87A 4LF7M 2WY8Q 1WGRA 2PE6B 3AJIB 2DA3A 3EFCA 4LGMA 2VQFM 2PIAA 2C7NB 3A46A 2M1BA 3GMEA 1A6IA 2PE9A 1W4MA 3LCUA 3J80S 1ZGWA 2L7KA 3HGIA 3FXUA 1EU3A 2RVCA 4AJWA 1GVDA 2UYZB 4FADA 4F8CB 3V7CA 2P5KA 3NWTA 4HF1A 2GBMA 4Y13A 3U6MA 3T9LA 1PGBA 2JP7A 1LE8B 2L01A 1FSHA 3SZGA 2D3GA 5D6EA 1I4GA 2KZGA 3H7SA 1NJFA 2KXEA 2K02A 1F52A 1BOBA 5GMVA 2L6OA 1BI1A 3P5JA 2X48A 3GE3C 3SASA 5D2MB 2L1AA 4UVBA 1IGNA 2K3UA 3RCZA 4A5NA 2R92J 2ZJRF 3RYRA 5EJCA 2VH1A 3A4RA 1A70A 2DAMA 2KJ6A 2VASA 2XV4S 3M6AA 3BCAA 4GMQA 1AYFA 2L3DA 4B7GA 2LVOA 2AHQA 1ZKHA 4A3FJ 1PGXA 1T6BX 4QOSA 3GLIB 4YY3M 4XRSG 1GJTA 2K9NA 4CHTB 2L9RA 1ESFA 1QQRA 4OVZB 2BHYA 1PGAA 5FLMJ 1QOFA 4ZRJA 1QAMA 4Q47A 4KT0F 3V8LA 3R2IA 2JA2A 2DWQA 3L09A 4YHHM 5C44J 1UF0A 3QA8A 2YR0A 1MMAA 2X85A 4KGTA 2VE9A 3LYYA 1YIOA 4A3KJ 4IDIA 3HOSA 2LXCA 3C7JA 4KIKB 3BR0A 2PEAA 3RYPA 1D5XC 2JRHA 3EIEA 3I51A 2ZTDA 4YIRX 3WGIA 3V3XA 3ASOH 2GLSA 2EBIA 5IYDJ 2G45B 2K47A 3M8EA 3DWGC 5ICFA 1K79A 1QA6A 5IZ7D 2FBIA 1R58A 2Z16A 2N9PC 1Q1HA 5E17F 2KHHA 2LBFA 2RDBC 2J5OA 3W2WA 3DPUA 2AQFA 1QT9A 5B5EC 3MKZA 2K6BA 2RGOA 2IA1A 2HQNA 4AKIA 2D10A 4ZDVA 3ML6A 2ZNVC 4RB2C 2CW7A 5HDGA 2JPBA 2AYOB 1MHHE 1TBEA 1JJ8C 2O6GE 5E79C 3S1RJ 2MJ3A 2COMA 3DBLB 5GXGB 2FX0A 1S7EA 3GEZA 1WZ3A 3HM3A 3NWSA 2WU2B 3BBZA 3HSEA 4BKTA 3J7AY 3NVZA 5GADJ 2R45A 4BVUC 2ZXJA 1MW7A 3ZN0A 2R7ZJ 4AI6A 3KP4A 3BVGA 1MNEA 4F91B 4C2TA 3LXFA 3ZNGC 2ME0A 4R1HA 4HF0A 2PLPA 1S8NA 3ZLZA 1L5PA 4LJ4A 1D1CA 3MWMA 2A3SA 3TW6A 1MD0A 3NQOA 5GKNA 2QIEB 4F1IA 3SD5A 5C4JJ 4DHJB 1T0RC 3K4MA 1PDXA 1ZN2A 3MEXA 4ZZDA 3U7ZA 3SR6A 1SJHD 4NQLB 3IG5A 3OR2C 4E7SA 1I3AA 3C2GA 5BQTA 2IGGA 4CCOA 3B7NA 2G1EA 4ANWA 3GS2A 3I04M 5EG0A 5J17A 3PNTA 3JSOA 2LBCA 2CJNA 2KTRA 1Z6RA 3Q3JA 1DOYA 3RULA 5L8RF 1QAOA 3J80Z 1Z77A 3FXJA 4CIZA 2DPUA 4LGWA 2LZ6A 1KU7A 2EQRA 3ABUA 3AL0C 2M4KA 2DBYA 2L7RA 3BG9A