1QZEA

Hhr23a protein structure based on residual dipolar coupling data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
360
structure length
214
Chain Sequence
SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords UV excision repair protein RAD23 homolog A
total genus 51
structure length 214
sequence length 360
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF00627 UBA UBA/TS-N domain
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA04
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1qzeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1qzeA01
3DBLI 3DVNV 4YIRX 5G55A 1WXSA 1G4AE 4PYUA 1VCBA 1ZMVA 2WX0A 1WXMA 1X1MA 3EC8A 1VEJA 2V1YA 3UF8A 3DBHI 2O2VA 3WA0A 1LXDA 2GBKA 4B9KA 1WRDB 1GUAB 2C7MB 2AEHA 1P3QQ 3ML8A 3KYCD 1EFUB 4LDTB 4GDKA 4HPMB 2L4FA 4ZRJA 4K7UA 4JL9A 5G2NA 4RM9A 3UIOB 3W1SC 3ESWB 1P9DU 3KYDD 3PRMB 4DWFA 4EEWA 3HHMA 1WXAA 3A33B 2PE9A 2EMTA 2KWUB 3M62B 4KIKA 4LJPB 3FE3A 1V2YA 2KZRA 2L7RA 2NBUA 2O6VB 3GLIE 4LJOB 3ZRFA 2LGDA 4KVGB 2B3TA 2CWBA 4K81A 3FRIA 1FXTB 3R66C 3QJZA 4FLHA 2ZCBA 2XK5A 3IHPC 2EMSA 4G11A 2GBJA 5DPWA 1E5WA 4K7WA 3RZFA 2LGYA 4CYEA 2KMCA 4BKGA 2J0MA 1SE9A 2JZ1A 2O6VA 2J0JA 3Q3JA 2QSGX 4YL8A 3U7DA 4TQ1A 2DZIA 1UELA 2KFJA 1OAIA 2GOWA 1Q0WB 1R4MI 4BOSC 3T9LA 2AL3A 2Y5BB 5L83A 1WJ7A 3PREA 2LRUA 4ICVA 3PVLA 5EDSA 1WHCA 1PVEA 4ZRKA 1DV0A 4OVUA 4BBNF 3V6EB 1S1QB 1L2NA 3E21A 1TR8A 2R2OA 4MGYE 1MG8A 3NZSA 2L00B 1WR1A 2LWPA 4FHKA 1GC7A 4XX5A 2M17A 3H7SA 4HJKA 2O6VD 3HK0A 2OJRA 3NHEB 4TV3A 2IO0B 3GLHE 2MQJA 3H1UA 4HWIB 3WAPA 4MGZE 1YD8U 1KJTA 2N7DA 2RSUA 5D2MB 2DNAA 2N9XA 2KD0A 5DPRA 2KO3A 2LTUA 3UQBA 4F2LA 2QSFX 3AXCA 3GOEA 1WMHA 3PT2B 3NS8A 1AARA 4G50A 2PE6B 3HM6X 4B6WA 4DHZE 2RR9A 4EOYA 2LUEA 2QHOA 3N3KB 5CHFA 4IW0A 3PPAA 2JP7A 4F8CB 3VUWA 2JF5A 3WAMA 1KYIA 2ZNVC 1KM7A 1L7YA 2EJSA 3PLVA 1SG9A 4M8NA 2KTRB 3DPDA 4KZ0A 3VXWA 2MCNB 1J8CA 4MM3A 5D7GA 2M8SA 4BOZB 1YIWA 4GGQA 2MJ5B 2UYZB 3M3JA 1Z2MA 5AZGA 1ZMUA 4WJPA 1TP4A 1WJ6A 4BKSD 3VDZA 4HLEA 4ZRIA 2JY8A 3JVZX 1WZ3A 2MP2A 5E6PA 2KDIA 4OVVA 1X3ZB 3L10B 3AULA 1V92A 3KUZA 4MSMB 5FR6A 2O25A 2KX0A 4MGKE 2CP8A 1E7UA 4II3B 2IBIB 2ZEQA 4K1RB 1XT9B 4FHJA 2G45B 5DPTA 4NNJB 1IXSA 2MSED 3B1LX 4DHZB 1F9JA 4WJQA 2HWJA 4W9DA 4HDQA 1V5TA 2KDEB 1HJPA 4MJSA 1NI2A 3B08A 3H7PB 4FULA 2DAGA 3HM3A 2DAIA 4HXDA 2JY7A 1UD7A 4J6IA 2GMIC 4KV2A 3ZRCA 1VG5A 3HIZA 2MBHA 4WWPA 5KHQA 3K9OB 1WGHA 1WR6E 1EF5A 2RD0A 3QARA 3WIMA 1SIFA 2ASQA 1UBQA 3C0RB 2DI0A 2MLBA 1E8XA 1P0RA 1V49A 2G3QB 2LBCA 4CHKA 1WX8A 1A5TA 3ZW3A 5J18A 1JRUA 4NJ7A 2IO2B 2L0TA 2MBQA 3A9KA 2RPQA 2WWZA 3CSTA 2BYEA 4WWNA 2O2VB 3L08A 1G6JA 3K9OA 2V4LA 4KDLB 2FCNA 3OJ3A 2CHXA 4W9FA 2KNVA 2MBEA 3ZTCA 5LXIB 1E94E 4M0WB 3ZO5B 4G3OA 2GBNA 5DFLA 1V86A 1J0GA 3KH0A 3NY5A 1RRBA 4R71A 4FJVB 4FJYA 2N7EA 4AP4C 4URKA 1F4IA 3LJ3A 1SGHA 2ZPNA 3QAQA 2L4EA 3JW0X 4NQKE 2JRHA 3TIXA 4GOCA 2MW5A 2ZCCA 5AEKB 2FAZA 2CKHB 2CHWA 3OJ4B 1D3ZA 3U8ZA 1Q5WB 2K6DB 1YLAA 1WYWB 2IYDB 1WI0A 4GDLB 1VD2A 2DYMA 1EUVB 2DZLA 3ONSA 4X57B 1GC6A 3DQVA 3RUIB 2FIDA 4E74A 3ZNZB 4ANUA 3IHPA 4W9LA 3PHWB 5L95C 1WH3A 3ZKJC 1WE7A 2ZVNA 4TQ0A 4EZJA 2WDTB 3A4SC 2IY0B 2OOAA 2BKRB 2N9PC 4G0NB 5CX3A 2DAKA 5JI2E 2DKLA 5D6JB 3VAWA 3VHTC 4ANWA 3DBSA 2JZ0A 2OOBB 1WGDA 2EKFA 2NBVB 4AJYB 5CHWA 4EFOA 2GBRA 2K8CA 3APCA 4BFRA 1YX5B 2LVQA 2KQSA 2LASA 2HJ8A 2M4NA 2KHHA 1P3QU 3PRPB 1E8WA 1WXVA 5JHBA 4MDKE 1DO2A 4DXAB 3AU4A 4MGIE 3VTUA 4NQLB 1Z5SB 3AU5A 1JR3E 3OLMD 2K9DA 3ZIMA 2L05A 4GN1A 1T6OA 1E90A 2BWES 2ZNVB 4I6LB 1AIPC 3AI5A 3FRHA 2IZVB 1I42A 2CS4A 2ZTDA 2KDBA 2BF8B 1RFAA 2JPHA 1T43A 3R3MA 3IFWB 1V9JA 2JNHA 1WGYA 2LGXA 3T6PA 3UINB 4E3CA 4FADA 2H5XA 2C60A 3V6CB 2L3ZA 2K25A 1RLFA 1OGWA 3H6NA 1Y8GA 2JY5A 3U30A 1X3WB 2NVUI 1WJNA 3L16A 2LVPC 2F4OB 2KJRA 1GJZA 2BWBA 1XB2B 3SHQA 2JY6B 3BBZA 1BVSA 2KVRA 4ZYNA 2K0BX 1J19A 3QX1A 1HE8A 4M8MA 2XBBC 1G41A 3PRZA 1VEGA 4CO7A 3PZDA 3VUXA 3DVGY 3MJWA 3ML9A 1V5OA 4GB9A 4PS7A 2MROB 2K8HA 3NOBA 2HAKA 4HEOA 1LQBA 2NCNA 5GMVA 1E8YA 5AZFA 1IPGA 3GLGE 4RM8A 3T8MA 2JT4B 2K6QA 2F4MB 3A9JB 3APDA 3SDLC 1I35A 1VDLA 4MSQB 3IVFA 1WGNA 1IFYA 2PEAA 2KJHB 2KTFA 2KLGA 1TZ1A 3DBRI 3APFA 3S2AA 4A3PA 4HVBA 2KANA 2KKCA 5TR5A 4ASWC 4TKNA 4ZDVA 2N9EB 2D2QA 2CR5A 4HPLB 2MX2A 1OEYJ 2KX3A 3H9DA 1WIVA 1UBIA 3K9PA 3R7RA 2BPSA 5J2RA 2RRUA 4LDTD 1K8RB 2ZJDA 3DCGA 2KOXA 1HQYE 3JSVA 4N9F4 1Q02A 2MGWA 4WWOA 3ZNGC 4EZLA 2MBOA 2DAFA 2LXCA 4W9JA 2G3QA 1H8CA 4TUUA 4Q7JA 4IM3A 3QIJA 2KFKA 2ZZPB 4HDOA 2KWVB 3R7QA 1OKSA 5J17A 2BWEA 3ZVVA 2WZJA 3PV1A 3ZNHB 2JVCA 2K8BA 4MJSB 1WZ0A 3H7PA 2NS5A 4K7SA 1MN3A 2ZPYA 2LVOA 2NPTB 1YQBA 2B3AA 4NAWB 3WAOA 3L54A 1R4NI 3LDZE 2A5UA 5E6NA 2DYOA 1OEYA 2REXA 2KFKB 5E6OA 3V60A 3E46A 2L76A 4GDKB 1LFDA 1NBFC 4AWJA 4DBGA 2HTHA 4EUTA 2MP2B 3RCZA 2ZVOA 3CSFA 1PQSA 1WGRA 5CTRC 1CUKA 2NPTA 4BBNC 3QQ8B 2YVCA 3A4RA 2N4FA 3W1YA 4IC7B 1WJ4A 2KK8A 1YX6B 4IM2A 2KLCA 3OAWA 4BKTA 2FNJB 3EECA 1Y8RC 3BINA 4HCNB 2JUJA 2DENB 2OO9A 1BT0A 1GG3A 3TL5A 5IA7A 2KNAA 4F1SA 3ZDMC 2PPHA 3N32A 3P2BA 2NBWB 1ZMWA 3PHXB 2DAJA 1UGMA 2JZZA 3TBLD 4ICUA 4XZ4A 5LXHA 1PGYA 1XD3B 2DZKA 4KDIC 3DDCB 2J7QB 3UGBB 3L13A 1C3TA 3Q3FA 3ZLZA 3A1QB 1E7VA 4JLCA 2LVOC 4PYZA 3GLFE 2D07B 1TTNA 5BO4B 1WMHB 2GBMA 1A5RA 2AL6A 3L17A 3VQIA 4W9HA 2L8JA 2D11A 4WP2A 2G4SA 4GSWA 1WM2A 2D10A 1WM3A 2KC2A 4BVUC 1CMXB 1WE6A 3ECIA 3DVGX 1IP9A 2LVQD 2YLMA 2Z0DB 4FN2A 2A4ZA 2QSHX 3W1SA 3QC8B 4W9KA 2DZMA 1IYFA 2K1FA 3PGEA 3RULA 1E8ZA 4KSKC 4NY0A 4DDGD 3EFUA 1EO6A 1OTRA 4WQOB 1WF9A 1V80A 4MH0E 2JWZA 1DO0A 3X0WA 4I6NB 2DENA 3PS6A 3RYTA 2I1JA 3IG3A 2V3SA 3F92A 2C7HA 3SD5A 4G3XB 1V6EA 5DPSA 2UWQA 2EKKA 3ZDTA 2MR9A 2CU1A 1WJUA 4JQWC 1XQQA 2PJHA 1T0YA 2XEWA 4KIKB 4IWOA 3WALA 4DK5A 3ENEA 5IAAC 2LI5A 5JH5C 3QA8A 4AJWA 3M63B 2L0FA 2XK5B 3RZWC 2FCSA 4PS8A 3TJPA 3CF6E 4F1IA 4NPNA 4W9IA 4FJZA 2DX5B 4MEMA 2JXXA 2IO1B 3UIPB 3QWZB 3EHVA 2FCQA 2L2DA 1V81A 4W9CA 2RGFA 3B89A 1IM2A 4WAAA 4F7ZA 1UZXB 4MELA 3ZNID 2WX1A 3JYUA 3L0WB 4NAWA 4GU2A 4B95A 2DAMA 3RT3B 1OTRB 4IWPA 4IUMB 1WFYA 3ZUNA 1ZW7A 2FIFA 2QHOB 2MA9B 2AWTA 2JY6A 4GMVA 4HCPB 2WYQA 2IY1B 3PSEB 4JGHB 3PTFC 5AZHA 4EZKA 2KN5A 2LXAA 1QZEA 3V62A 4DBGB 1M94A 2C7NB 3A1QA 5LLIA 3X23A 3IBEA 2KMAA 1WY8A 2KC1A 4DHJB 4W9GA 2KTRA 3I3TB 2BKFA 3JSVB 4LCDE 1Q1OA 2FCMA 4PS3A 3KUCB 4AOFA 2C5LC 3PLUA 1HT1E 1G3IA 2JRIB 4E71A 4FA6A 1OQYA 3SU8X 4ANXA 2DYBA 2KNBA 2QNJA 2IO3B 2R0IA 2BWFA 2I1KA 4WJNA 3KVFB 3LCVB 3LCUA 3ALBA 1NV8A 2KQ7A 1ZV1A 2N1WA 2LJ5A 3NZUA 3QHTA 1WGGA 1ZGUB 4KZCA 2KXJA 1UFZA 3VFKA 3O65B 4HK2A 3IECA 3ZTDA 1ZKHA 5JHAA 2M1MA 2BGFA 2LVPA 3WANA 2DAEA 1P1AA 3TCAA 4A20A 5C1ZA 3GZNI 4JIOU 4GDLA 2DHYA 2C9WB 1C1YB 2Z59B 3D32A 1S3SG 1YJ1A 5DCNA 3VTVA 1XXHE 3QCAA 1WR1B 2KJ6A 3VTWA 1KOTA 1P98A 1TTEA 2LVAA 3RD2A 2BYFA 3TMPB 1GO5A 1WIAA 2EKEC 4IM0A 4GEWA 3KUDB 4KSLC 1H4RA 2LRWA 4RMAA 3VUYA 1C7YA 2KWCA 4DHJD 1LM8B 4IWQA 3MHSD 4FBJB 1VEKA 2LVNC 2HE7A 2MRPA 2MWSB 2HD5B 1KLVA 2BYVE 3KW5B 2R2QA 3CMMB 2OOBA 5HKHA 1UH6A 1TGZB 3QK0A 1TBEA 1WX7A 2DHZA 1EF1A 2CHZA 2M0XA 3A9JA 3B0AA 3VVWB 5JZEB 3MTNB 1WGLA 3BY4B 3VH4B 5C23A 2KNZA 2G4DB 1VQ1A 3MMPA 3DVNU 4DDID 4EKUA 2DZJA 2KDFB 1HT2E 3M95A 4I6PA 1R4GA 4BKSA 2J0KA 2NR2A 2K39A 2Z0EB 2JZ3B 4P7IA 4IG7B 3V61A 1NV9A 2W9NA 3A9KB 4GIVA 1ISNA 4A3OA 4ANVA 3N30A 4NJ6A 5KHOA 4AUQC 3K9PB 4W9EA 2VRRB 3UQAA 3DOWA 5CHVC 2KHWB 4GXBA 2ZTCA 2D3GA 1GNUA 1NDDA 4UN2B 2MBBB 4II2B 5D94A 3VH3B 1WX9A 4XC2A 2JUOA 3H4JA 2LZ6A 1U4AA 4WJOA 1RAXA 2AYOB 2N1VA 2FUHB 2LD9A
chains in the Genus database with same CATH superfamily
2Y0MA 4PYUA 4LJ7A 4JBAA 3BVMA 1ZXIA 4XNFA 5J8CA 3FKYA 1O7LA 3IWZA 1WXAA 2VPRA 2YR0A 4DR7M 3E97A 3H0DA 1HZ6A 3TDUC 4M6XA 4ZYHA 2K27A 2DPDA 1IGDA 2DT6A 2QSGX 2RGVA 4EE2A 1IUYA 3I57A 5AUKA 1YTYA 3HVZA 1V97A 2Y5BB 2FMYA 2VC0A 5DEQA 1FIPA 4ICVA 2NS0A 4NZLB 1TWGJ 2DCEA 1QNTA 3RZDJ 2SEBD 2K9XA 1HNWM 2KQ4X 1ZN2A 4MFDA 2MC4A 5DD8A 1TH2A 4OX9M 2KD0A 1E17A 3UQBA 4F2LA 2AXLA 2Y2ZA 3RGPA 3NS8A 3AEFB 4IW0A 4S05A 3VEPA 5HODA 1SMTA 3HDDA 2A6HF 1GL7A 4D5CA 2EJSA 4DV7M 1ZQ3P 1K82A 1I1SA 1WKMA 4MM3A 1NHWC 2H8WA 4IQ4A 4BKSD 1FX7A 4DR2M 1GABA 3CCUI 2IBIB 3ZRGA 3V42A 4B7FA 1T0FC 3T8RA 3BZDB 4KN7X 2B76B 1HJPA 4FULA 4KV2A 1GUUA 4ZZLA 1Z6TA 2WGSA 1R71A 2UWMA 4WAFA 1UBQA 3HSRA 3AEGB 4G7HF 4WWNA 2XAHA 5ITYA 3K9OA 3TEWA 4YT0B 1R6BX 3PO0A 2R7SA 1JWAD 2WNMA 1BI3A 3SXYA 5IZ7D 2EFOA 2O01F 3TIXA 1Y56A 3IP4B 2CKHB 1JJ8C 1MZBA 1B1BA 1XDUA 1T98A 3QP6A 1EUVB 3DFGA 4C3HJ 1QLBB 2RPVA 3C2HA 4CISA 4AJYB 2W48A 2LVQA 2L5QA 2LASA 1JR3A 4F55A 1NENB 3M7GA 2Q1ZB 1F9NA 4MDKE 1Z9CA 3L27A 1Z91A 4DV0M 3OLMD 2K9DA 5EYRA 3M8JA 2ZNVB 1E10A 3K69A 2L9RA 4JI0M 5HS9A 3UINB 4XK4A 4MB7A 3WTTC 1X3WB 5CYVA 1T33A 1IDYA 3MD2A 2NNYA 3RDIA 4Y17A 4B3SM 3BZ6A 5TSSA 1MJDA 1Y6IA 1LEBA 4BE0A 1XXHB 3WTVC 4GCVA 4LFAM 3E9SA 4UUTA 5DUIA 1MDMB 3EYIA 3KEYA 2JQRB 1E8YA 2MBFA 4XK8F 4HJGE 2KJHB 2KTFA 3J80Z 3W0LB 4V2GA 1O3SA 2CMPA 3K2AA 3IUOA 1F43A 1VQOI 5FKMA 4Y15A 3R7RA 1JXSA 1UNSA 3CWIA 3J9CA 2GXGA 1I4QA 4OMZA 4I2OA 4S0RA 1S72I 2FBKA 5L3CA 5J17A 2EFWA 3ZVVA 2ETHA 2NS5A 4XICA 5E6NA 2K02A 4E7JA 3N1YC 1XCBA 1L4DB 2L76A 3IXSA 3SEBA 5EXPA 1MH3A 3AL0C 1YJIA 4HF2A 1DOIA 1G59A 3OAWA 5F64A 1K3WA 4HCNB 3NEUA 2WY7Q 3BR2A 4F1SA 4A3VB 3A03A 1UGMA 1FNUA 4RH6A 3L13A 1QAOA 5C1BA 1LDKB 2DT5A 4B09A 3ZLZA 2XUBA 1MBKA 3BOQA 4DJAA 4G9YA 4DV4M 4A6QA 3HUIA 2ZFWA 3VB2A 3J27B 3DKWA 4L16A 3GZ6A 4UHTA 1KU3A 2V1NA 2ELJA 5DCMA 2CUJA 2NS8A 1ENFA 3K92A 2CYYA 5J40A 2E2JJ 2NVQJ 3WALA 4LFUA 3Q3SA 3M6AA 1T0QC 2ZJQF 3LWFA 4D80A 4PCQA 3PTFC 2KN5A 3IAM2 2E19A 1IRFA 3BTLA 1DGWY 4AOFA 3BTCA 3JRGA 2DYBA 1R5GA 2PIAA 1U5TC 3HYIA 2K3FA 2OQRA 1ZGUB 3VFKA 3IECA 2EZLA 4HF1A 1I4WA 1ZKHA 5H37D 3A98B 4A69C 1ETOA 3CP2A 4ZZDA 1E9SA 1WH5A 2ZMEA 3R61A 3ZJTA 1SC7A 3HRTA 1I94M 2LRWA 2H6BA 3HHHA 2OCEA 4PZJA 2KWCA 3MHSD 4CYDA 3TE6A 5JZEB 3VVWB 3C2BA 4DDID 2CQKA 2D7HA 1JKRC 5ED4A 3F21A 1ISNA 2BEOA 2PVOD 4NJ6A 3P4PB 1K83J 4GYGA 1VQ5I 3MZ8A 2XIGA 2VL8A 3FILB 1YRNB 4OVZA 3THGA 3FHZA 4EMSA 2O61A 1SJHD 3DBLI 2C5RA 3SBJA 2YEPF 2FBIA 4M71A 4EV0A 4B47A 3BLYA 4NQWA 3W1SC 3KYDD 1P9DU 3A33B 2Z7JA 5FKLA 1TNSA 5FSWA 2F5PA 4G7OF 2LOOA 5F3WA 3KPHA 3QJZA 4FLHA 4BJ5C 5FLMJ 1MBEA 1FWZA 2OZ6A 1UELA 5EE0A 4XKBA 1PM5A 2HJ1A 4OAZA 3FXLA 3PVLA 1IBLM 1IBMM 2ZNZA 1L2NA 3AEAB 1X1PA 3NRVA 3JREA 3H0GJ 3FWEA 4M9ZA 1S6LA 3FDYA 2OJRA 2LMCA 3HRDD 2N7DA 2R4GA 2QKLB 3NBIA 5FTMA 5DUKA 2UUAM 2DOFA 2IDYA 1WYGA 4DXGA 3GPYA 5E18F 3VUWA 4Y4RA 2ZNVC 3OIQA 4KZ0A 3VXWA 1AWDA 3HHGA 5FKAC 1Z2MA 2FU4A 1D0MA 4HLEA 2XAUA 1LEAA 3GRYA 4B0MA 5C3EJ 1MI0A 2V4IB 3S3MA 2L7MP 4HXDA 2JY7A 5K1YA 1MIJA 3WGHA 4UVAA 3AB5A 4HPPA 3U6LA 4Q2JA 1R7SA 2L9SA 1PFDA 2DI0A 4M9XA 2UU7A 2A5YB 2V4LA 2EO2A 1QPIA 1CF7B 3OYHA 3JRBA 3C58A 4YEJA 1J0GA 2PQ8A 1GVDA 4G6ZA 1EWYC 1O4XA 2IYDB 3U60A 5HNFA 1VD2A 3P4SB 1HQRD 2HVQA 3I59B 1S5LC 2XFSA 4TQ0A 4IBKA 4RAFA 1HSJA 2OOBB 3EUAA 1DU6A 2RDHA 2GBRA 3ZQ4A 3GBGA 4HDUA 2KQSA 2Y48A 2M4NA 1LNWA 2FSWA 2W3RA 2IA2A 2KXEA 1UELB 2QQAA 2P6TA 5JFRA 1XS9A 2WDQB 1IN8A 2CEAA 2JNHA 4E3CA 2LHCA 2OQ4A 2OC6A 2WXOA 2C60A 1R9TJ 3SR6A 2NVUI 3V8JA 4XGAB 4L78A 1ZLKA 2V9KA 1JCKB 4JX1C 2A61A 3CUOA 4R8HA 5LBQA 4XL9A 3PZDA 4MO7A 3L25A 4OIQF 3ML9A 3TBIA 4LITA 3T0YA 1Z0XA 2INNE 4PDGA 3C1DA 1K79A 5TRDA 3H9QA 1PRBA 2D2QA 4N59A 5F08A 2V1DA 5J2RA 2RRUA 4LOCA 2K9QA 2MBOA 2LXCA 3BPXA 2R61A 3M1CA 4AKGA 3T1BA 1NO1A 3BPVA 3GQ4A 3Q69A 4LIVA 3SAWA 2DFEA 3SZPA 1AKHA 4RLFA 5EEHA 3K4BA 2Z3YA 3K70D 4XWWA 3QQ8B 1JALA 3A4RA 2KT7A 1I3QJ 2P4WA 2E5NA 2FNJB 2JUJA 1B9NA 3P2BA 1SVMA 1PGYA 1XD3B 2J52A 1KA8A 4MNUA 1R7JA 3DWLE 4IRGA 2E35A 2H09A 2HYGD 2MLKA 3VODA 2O5RA 3UR3C 4PJ0C 4TV7A 4JI7M 4KISA 3GTGJ 1PJTA 4AM3A 2M9HA 3QC8B 4Z2YA 5EG0B 1FRRA 3V76A 2HU9A 2D3BA 2QIEB 5ILUA 1JWMD 1TY0A 3D5RC 3ZDTA 3R8BA 3LYYA 4ITVA 3B02A 3VOEA 5A2QS 3N97A 2CV0A 4AJWA 3FUVA 2G7UA 2FCSA 2XRNA 5B3SH 4KITB 3MP9A 3EHVA 1VQ4I 2XEPA 2R5ZB 1NVID 2VBXA 2WYQA 1TZLA 2C7NB 2QCUA 3IBEA 3WHLA 4W9GA 4LB6B 1HT1E 4QNRA 5FO5A 1XGSA 1DGGA 2DZNB 2I1KA 4NC8A 2WDRB 4HF0A 1U8RA 1G3SA 3BR6A 4JI8M 1VI0A 1C4PA 2Z59B 3I4PA 3D32A 1T0FA 3HHYA 3ZGKA 4RMAA 1ZK8A 4FW9A 1JKPC 2OD5A 3ROUA 2WXKA 3REOA 4E7ZA 2KNZA 1ONVA 2G4DB 2Q5WD 4OU7A 2JZ3B 1ZAEA 2VF8A 4LJ9A 2JSVX 3K1MA 3UQAA 1D5MC 2ZJ2A 4GXBA 1PGBA 4II2B 2VUMJ 3IKTA 4K2EA 4XC2A 4A2UA 3CD6I 3TL4X 3DVNV 1OQRA 2MW8A 1ACIA 2O2VA 3WA0A 2E36A 2ZNYA 4GC5A 4LDTB 2BB6A 5KQDA 3FE3A 2HOEA 1MW7A 1YW8A 3OYJA 2P5TA 2CGPA 2DDBA 2GBJA 3TO7A 5M5WJ 2XAQA 4OZAA 3Q3JA 2N9LA 4TQ1A 2PG4A 1R4MI 1H9GA 3PREA 2LRUA 1VNDA 5CVJA 1S1QB 3HJ8A 1IXZA 3JRFA 4CIZA 2L52A 1TT5B 5EE3A 2QSFX 4P1BC 2PE6B 4M0WA 3R4KA 2KIUA 2WXLA 1PJQA 1RZ4A 2QHOA 5K5OA 4ZDLA 4ZJZA 5LD2C 4PJNA 3F6VA 2DO7A 2YS9A 5D7GA 3M3JA 5FRMA 2STWA 2LKPA 5GADJ 1QOGA 3KVWA 4QHSA 2PJRA 1UWXA 3L2VA 4IBEA 3W6VA 1OFFA 3H7PB 2OU2A 2XC7A 2G7HA 3HOVJ 4DNCA 3AN1A 3K70C 4ZRPA 2IW5A 3EA6A 1X58A 2MBHA 4WWPA 2BB5A 2R5ZA 3WIMA 1SIFA 2CHVA 1A5TA 3VDUA 3A9KA 2KISA 1GJTA 5LFAA 4IKFA 1IXRC 3GTKJ 2N7EA 3QAQA 2L4EA 1UB9A 2O8XA 1YYVA 4LLGF 4UV8A 2M7BA 5C18A 5BMHA 4A6EA 2UXXA 3ZNZB 5L95C 4NL4H 3PHWB 7CATA 3L29A 2OCCH 1C9FA 5EE9A 3Q6BA 2NVUB 1EIJA 1D0YA 2DLBA 2DAKA 5ITUA 4ANWA 2OTJI 2R44A 3LAPA 1TF0B 4C2UA 1XGNA 1YMHE 4A3KJ 1EE8A 5C2TB 1F52A 3CTAA 4I6LB 3AI5A 1V5FA 2ZTDA 1Z3XA 3HBLA 4B3TM 2L0KA 4M02A 5FTKA 4OWRB 4OZCA 2R18A 2LVPC 4AW4A 4U7DA 4DV2M 1XCVA 2NYXA 2WU5B 5TISC 3MMYB 3J7AY 2FE8A 1BVSA 3SDBA 2R7VA 2V9VA 1IBKM 3RPQA 4XORA 3A01B 1MH4A 3N20C 1CGPA 3GRVA 3TGNA 1I35A 4JV5M 2LG4A 5TR5A 4YSYB 3H9DA 2XGEA 2IJLA 4W9JA 5ICFA 2KFKA 2ZPYA 1R4NI 2A5UA 3ZMSA 4OINF 4HOBA 2BHZA 2DWMA 4AWJA 2KIFA 4DYRA 2V1CA 3W1YA 4ZOHC 3G4SI 3K0LA 3HOTA 1VQLI 2KNAA 2L02A 3SEQA 4UNOA 4ICUA 1FEXA 4I8OA 5B5EC 1ZRDA 3F8FA 4D82A 2PJRB 4IRIA 4WP2A 2D10A 4LFCM 1E32A 2A4ZA 1WRJA 2AHQA 4BEHB 3I0TA 1SFKA 3IAM1 4J00A 3J7AS 1VZ0A 3AAFA 1X2MA 2HNHA 2EIMH 2JPBA 2Z4SA 5HI1A 3OYFA 2MJ3A 5ITXE 5JH5C 4ZYAA 1EU4A 1YSYA 2UUZA 2N8GA 5D5VB 2KW0A 4LJ5A 2KFDA 2N0SB 1ON2A 1IV8A 2TRTA 3IH2A 1UZXB 3FUUA 1QHHD 1N61A 1T0RC 1L5PA 2VLAA 1ZW7A 2QDFA 1DGHA 1OAOC 2IT0A 3I3TB 5ITRA 4PS3A 1SVOA 4LIUA 2CH0A 4AIDA 1B1ZA 2R0IA 2BWFA 3BWUD 1AOYA 1ZV1A 1TQIA 1O57A 1J2XA 2LJ5A 3WG7H 3WANA 1MD0A 2R6FA 4AQ7A 4RGTA 1R5LA 2DW4A 1H4RA 1XB4A 2FNAA 1PJIA 1C7YA 4LD5A 4RGXA 5HKHA 1TBEA 2CHZA 2CSOA 2R7DA 2W25A 1VQ1A 2KDFB 5E17F 4D1QA 4P7IA 5EXTA 3G2BA 2UXBM 2PMZN 2CV2A 4A3OA 2VI6A 3N30A 3GP7A 1FSEA 3DOWA 3BZCA 2Z4RA 3GUDA 4PT5A 1GDTA 1ZR2A 3DZDA 3EIEA 2KZVA 3FXRA 3HOYJ 1L6UA 3EC8A 1AUAA 3A0HC 5FD6A 1TWHJ 4B44A 3FK7A 2H1RA 3U6DA 4DWFA 3ESWB 4IOCF 2WXRA 2ZCWA 4LJOB 2CWBA 4LZJA 2ZCBA 4IPAA 1ZREA 1NK2P 1SE9A 2X4HA 3IG5A 1BW6A 2PBIA 1R2ZA 5F0HA 5K5RA 3MC0B 1WJ7A 1RESA 5EDSA 3U1KA 2FJ1A 1KQ9A 2COBA 1IY2A 5HDKA 3NUHB 4C4VB 5IT3A 1EF4A 5EGOB 2V0GA 3HOXJ 2I38A 4XX5A 3HK0A 3CCVI 3AOGA 3A2KA 4FCVA 3HOSA 3MZHA 1FNNA 3WAPA 4ETSA 4RAYA 2XKOA 1BI1A 1B4AA 1W7PA 2K3UA 3WGGA 4FT8A 3NRZA 4WXHA 4HBLA 5BR8M 2VPLA 3NAUA 1TS2A 1YS7A 2M8SA 2KIMA 3ZYYX 2MP2A 3I59A 2A05A 5KK1A 4MSMB 2VIIA 2O25A 3H3VK 4II3B 1XT9B 3P1MA 5DPTA 5ILSA 3GLXA 2JA2A 3HTUA 1YX5A 4ACFA 1SIJA 1TWFJ 2OF7A 3HIZA 3VDXA 1CK1A 1FIAA 2K4JA 3VLFB 2LBCA 2ZKZA 2UXNA 3H5NA 1U3EM 4NJ7A 2BYEA 1I4GA 4RBOA 3FUXA 3ZO5B 1DDNA 3BZKA 4DW6A 1Z05A 4MEXF 1P7JA 4DR6M 3Q8FA 1IJWC 2C98A 5DCMB 1QYRA 3OY9A 4CGYB 4BKXA 1JI8A 2J5YA 1RIOH 1Q5WB 1WYWB 1IY1A 1AHDP 2R5YA 2WXFA 1TKYA 4N9HA 3RUIB 2MH7A 1W5CC 3G71I 2N9PC 4IBGA 4J3OD 1DGFA 1FTZA 1E3HA 3ABKH 2WAFA 5BPIA 2VJIA 3VYSB 1W36D 3R9XB 1RPWA 2BJVA 2CS4A 2KT0A 2HXOA 3L00A 3NVYA 3ZXSA 3U6PA 3CMMA 4E6KG 4GC9A 2K25A 1GAQB 1RLFA 3U30A 3URYA 1XMAA 1MMSA 3B7QA 3SZGA 1MNEA 5K5QA 2LY9A 3U2RA 1IPGA 4F3QA 2F4MB 3A9JB 2QF7A 2M87A 3AV8A 1PDXA 1VDLA 3AG4H 1FBQA 1MMAA 4HAMA 5IOIA 1K50A 4TKNA 2HQAA 3QAHA 2MX2A 2FMLA 4ENMA 1UBIA 4DQOC 1HA8A 3OWEB 2R65A 2BY2A 3LL7A 1H8CA 2QMTA 1JTXA 1OKSA 5L8RF 1J59A 3RJPA 3E6BA 4PGHA 1HW5A 2HGCA 2TCTA 1OCOH 2JUGA 1PYVA 4DBQA 2KFKB 5D3IB 4GDKB 4DR3M 4B3RM 3DWGC 2AX5A 3ZQGA 4IC7B 3TL5A 1GG3A 3ZDMC 4RS8A 2J7QB 4QHTA 1ITYA 2AHMA 3GLFE 4FTHA 4DZJA 3SMPA 2M60A 3J80K 4V19K 2D11A 5KPRA 1WJAA 1X1DA 2JZYA 5FLVA 2CHGA 4GITA 3C3WA 1QVUA 4ESFA 4IJFA 3D0SA 3OSGA 2EV0A 4Y33A 4LNIA 3CIRB 1G8XA 1V6EA 3RZOJ 2EKKA 1T39A 2CE7A 5KVRA 4CICA 4JQWC 2W82A 5CVUA 2YEPB 4DK5A 3V8KA 3GFMA 4EJOA 4LJ6A 1RR7A 1L3LA 1VLBA 3B9JA 3ILKA 3GPXA 2X38A 1D5VA 4QIWN 2D3AA 2EILH 1N6ZA 3H5AA 3OYGA 1CZPA 1IN4A 2F4VM 4IHSA 3BXWA 2Z5UA 4YIIA 1H9TA 4G6TB 3RYRA 1AN8A 3OYEA 4ANXA 5M3MJ 2L4AA 5BS6A 3LA3A 1SFUA 1I4XA 4LK0M 1LTMA 4D9JA 3UK6A 2KXJA 3DHGC 2DAEA 2IXSA 2EUCA 2DMUA 3S2WA 1RFKA 1WR1B 2JA7J 1UMQA 2ISYA 1B8IA 2LRDA 2ICIA 3BR0A 3EETA 1DGHB 4HQMA 2L54A 3OL3A 3LSPA 2R7TA 3ZMTA 2DZJA 4Y28F 4HX4A 3M95A 2J0KA 2Q2EA 5LLQA 1BW5A 2WAEA 2O3FA 5EZHA 2KN4A 5CHVC 2D3GA 1DPRA 2VE9A 2HS5A 3EQLF 2YPRA 2LD9A 3SQNA 5J4YA 3U2SC 3S3NA 3UNGC 2I2YA 3DBHI 1RR8C 3V7CA 1SEUA 3QOEA 2BS3B 3GWZA 3UIOB 5GP9A 3CUQA 4L5JA 2EA0A 1WXQA 4FE4A 3U4EG 2IEKA 3CJQB 3GO5A 3WCQA 4XGIA 2R46A 2DVWB 1EV7A 2EFPA 3HOZJ 3B73A 2PKOA 3OOUA 1X1AA 3ZJVA 3TPZA 4OAYA 4KMFA 5LEKA 4D7MA 1O3QA 1ZGWA 4FVMA 2V79A 1ZGAA 2XVCA 4R7GA 5CVIA 4F93B 2VQHA 1KJTA 2WXPA 1PJJA 5EP2A 3BP8A 4E7IA 3F22A 3SATA 1AKHB 3H9GA 3V4GA 3VKHA 3H5RA 3WU0A 1KYIA 1L7YA 3RPUA 2H1LA 3GE3C 5GTHC 1YQ3B 2YX4A 2JT1A 2HPIA 1OLTA 1I6HJ 3QP5A 3MKZA 5E6PA 2M0AA 4OVVA 5FR6A 2CP8A 2TSSA 3SEZA 2MSED 3B1LX 2Y20A 2VXDA 1E7PB 4RNAA 1OKRA 3U61A 4IBIA 3E0JB 1JT6A 3DPTA 2JYTA 1KGSA 2ZXHA 2WXJA 4HEA1 1WR6E 4US9A 4U0VA 1WJCA 3ZR8X 1Z6RA 4YY3M 2V6ZM 5J18A 1WJDA 1J75A 3LA2A 3OJ3A 2HKXA 2M5WA 1XN7A 3FTFA 2OEDA 3JW0X 3FHNA 2CWEA 5EZGA 1WI0A 5JR3A 2DZLA 2FIDA 2P0WA 3F23A 3B74A 4X6AJ 1MKMA 4B4CA 1WGDA 1O3TA 4XLNF 2KIQA 2HJ8A 2V4JC 3ZMUA 1E8WA 2PFBA 1YOVB 3KYLA 3LSMA 2L05A 4GN1A 5HFYA 2M30A 1I39A 2BVCA 1NY5A 3T6PA 2LDUA 4MH8A 1HKTA 3H6NA 1Y8GA 2Z99A 2A07F 2OJED 3COAC 1GJZA 1FT9A 2Y0TA 3SHQA 4PJMA 3BJAA 3OOPA 4DYQA 4CO7A 2VB6A 1F77A 1ET9A 2ZM6M 2L3DA 3S15J 2GI9A 2X8AA 2N9KA 1WGNA 1TZ1A 1NHAA 3LSKA 4DGWB 2HQRA 2EK5A 3BWGA 1U8BA 3HZJA 1IRZA 3S14J 3SZTA 4EZLA 3ZNGC 4HEA2 2B0LA 4BU2A 2MH8A 3SFDB 3ZQLA 2W84A 1WZ0A 3NVVA 5BNGA 1TS4A 1ZDXA 4L1BA 3QAUA 2REXA 3PVSA 4KDPA 3E46A 2M56B 3FTEA 4DBGA 4USAA 4EUTA 4II7A 4IQJA 2NPTA 2XSZD 1GVJA 4IM2A 4LNFA 3P9IA 4MTDA 1T95A 3TBLD 4KICA 2LY2A 3ZCBB 1LDJA 3AEDB 1ZDVA 3A1QB 3BDDA 4PK4A 4A9AA 2LVOC 3LNQA 1UM8A 4HDVA 4KGTA 3ZQIA 2CUEA 3MC9A 1QGPA 3KP6A 1C79A 2ID3A 4KGRA 4AI6A 1EO6A 3CF5F 1N75A 2Z3XA 4JXJA 1N78A 1DO0A 2E34A 1QKZA 3RYTA 3SD5A 5BMIA 1JRPA 2JZPA 5FJ8J 1MHXA 5FKKA 5H92C 2PJHA 2C9OA 2XSZA 2IAIA 3ENEA 2QYOA 2M4GA 3M63B 5HLTA 1NNJA 1WI3A 1J5EM 2XNAC 1RKTA 2V1UA 1YN4A 1V81A 2CQ7A 2FRHA 1HR0M 5LHHA 1OTRB 4IWPA 3QODA 2YNMD 1C4CA 2KHMA 1M94A 5LLIA 1MNDA 3LQRA 4M74A 3KUCB 1XMKA 1I6XA 5DM7F 1M4VA 2HFHA 4JI1M 2HVRA 3K1NA 1USSA 2ZJRF 4FXCA 1P6RA 2WS3B 3JR5A 2GIVA 3NARA 2JA8J 2KJ6A 3KOZE 3S32A 1VQ7I 2EKEC 1L4ZB 2DN0A 5GKNA 2EKIA 4C9YA 3RKQA 2W85A 2Z8LA 1G8PA 1SXTA 1WX7A 4JYKA 2L83A 2R92J 3LVWA 3F9KA 4XKVA 2GQQA 3SHGB 1BUIC 3RMKC 1LE8B 4BACA 3K9PB 1J0RA 3FKEA 2KMMA 2VZKB 1TYGB 3C3EA 1MJGM 4Q4ZF 2DJNA 3PO3J 1U4AA 4WJOA 4FASD 1IAWA 4L23A 2N1VA 3LSHA 2W55A 1UWMA 2WB1A 1WXMA 4D2KA 3GLHB 1LXDA 3FXMA 4EM0B 2AQEA 5GAEJ 4GO1A 2LY1A 2L4FA 4IRHA 2MH9A 4BHCA 3HGIA 3KZYA 3HHMA 1WJBA 1MSFC 2VZKD 3P63A 2O6VB 2FBWB 1FXTB 3HUGB 2JUCA 3TWLA 3ZN1A 3IHPC 2EMSA 2Y69H 3RZFA 4BKGA 1MX0A 1XGOA 3D8BA 3HRUA 4YL8A 3TEXA 3RQIA 2RREA 4BOSC 3T9LA 2CHQA 1W0UA 1IZ1A 4BZAA 4WK8F 5DDGA 3B6AA 1QZMA 3E21A 2IS4A 1TR8A 4LJAA 5DCFA 1WR1A 1F1ZA 4HRIA 3DA1A 2O6VD 2IO0B 4LJ4A 1ETYA 2MQJA 3HHZA 1N32M 4A3BJ 4XN3A 2LWXA 3MCZA 4MACA 4DHZE 5CQGA 2LUEA 2E3TA 2OV7A 2YUSA 4L15A 2DA7A 1V5EA 4LCBA 1TL8A 2DA1A 4PJJA 4X66M 2IA0A 3VPRA 4HV6A 4JPSA 2L7KA 2KX0A 2ZEQA 1RC9A 5E3LA 4FHJA 2X0LA 1F9JA 2LFBA 3I9V2 1L0OC 4JX4A 4YTPB 3Q8CA 3Q8EA 3KP1E 4GGGA 4QPOA 2CS3A 5EQTA 1E8XA 3ZW3A 4UVBA 3CSTA 1UJ8A 2O2VB 3L08A 1G6JA 1IV6A 1E3OC 2FCNA 3CF0A 4QWQA 1E94E 2ESHA 2EB7A 1WPKA 3G1MA 4LK1F 4LJZF 4HSTA 2D3CA 2IS6A 5K7FA 2AS5F 1YLAA 2FX0A 2VJ5A 4X57B 3DQVA 4PK1A 4KX6B 3HJQA 2V9HA 5H20A 2Y30A 1W1WE 1PP8F 4HSRA 1XDSA 3APCA 2RC4A 1U5TA 1HCRA 1P3QU 1R7RA 2P5LC 1DO2A 3VTUA 3W6KB 1R1TA 3Q9SA 2HDDA 3TP3A 4ESBA 2VBZA 2FOWA 3QPTA 2KDBA 2VIXA 3J81K 4Q47A 3DHIC 2L3ZA 1OGWA 2XB0X 4KODA 4M01A 4ZYNA 3N4MA 4KIFA 3KDSE 5FK9C 3VUXA 3NOBA 2RNGA 5GMVA 2NCNA 1ULYA 3QYEA 1PGAA 4X0GA 2CW0F 2M8GX 2I5UA 3FM5A 5E1ZB 4UB8C 3EGRA 1DYQA 1ZRFA 4BE1A 4N58A 4N9F4 2EPFA 4A6DA 2Z33A 4IM3A 3QIJA 4HRSA 4U0YA 2K8BA 3NBXX 3PO2J 3H7PA 2BW2A 1FP2A 3UKGA 3LDZE 3IRRA 2HTME 2M8EA 3CSFA 1H6UA 3ZN0A 4BBNC 1WQ2A 1Y8RC 3GS2A 2JZZA 3UGBB 4KDIC 1ETXA 5D5WB 4US8A 1F5TA 4O3MA 3A1YA 3RNAC 3DKYA 6PAXA 5CQEA 1KH0A 3RKWA 1PJRA 2P5VA 2QC8A 4WURA 3RNCC 3H3ZA 2GIZA 3BG5A 3H1CA 1QBJA 3X0WA 3QYBA 1S7AA 1BR2A 4CUGA 2K9SA 1XTAA 2VKHA 4B3AA 1TQPA 4ITQA 2MR9A 2LF7A 3FXUA 3TWKA 2XGXA 3UGJA 4D0PA 5HOOA 4C2TA 4NPNA 2R7WA 1EH6A 1TS3A 1MG4A 2IGGA 4DYCA 3R2TA 2LBFB 1IM2A 3IHUA 4WWCA 4L2YA 4BAXA 2FIFA 4HCPB 1D0KA 3PSEB 3RI7C 4NDLA 3QQAA 3KFWX 4XRSA 3ZXRA 2LXEA 2RKHA 3DU5A 1UHWA 2F6CA 3AOEA 2IO3B 1UAAA 3MKLA 3TW6A 2CW7A 1TNTA 1XMQM 1ESFA 1MBGA 4D7NA 4EEFG 3S1RJ 4A20A 1XXHE 1HXYD 5LMUM 4KSLC 4FBJB 4Q48A 2M0XA 2P7CB 4FCYA 1VQMI 2C6YA 5LNK1 3KFUG 1QZYA 2K9MA 5F6FA 3L2AA 2DA2A 1HNXM 3ASOH 3KLNA 1WX9A 4RAZA 3TDZC 1XMOM 1DU0A 2WDVB 1HEZE 4A12A 3KOWE 4WF2A 2CO5A 3LAJA 1SSNA 2V1YA 3ZMVA 3I3LA 1KZHA 4ZTFA 2JPCA 4BQNA 2BJWA 4BHBA 1V2YA 2RGOA 4AG5A 3GLHA 1GKIA 1BIBA 2Y5CA 2COMA 1E5WA 1JB0F 1P4XA 4PGGA 3HGGA 2JZ1A 2PTLA 3BOSA 2NOGA 4BXUA 1VR9A 3VK8A 2GOWA 4LG3A 4AUXA 3HUGA 3EIHA 1WJEA 3SARA 1DV0A 1ACCA 1UG0A 1K7AA 3GTQJ 4Y52J 4A3FJ 3HJSA 4EVIA 2M17A 3K4LA 3MWMA 3NHEB 3W2WA 3VR8B 2XGDA 1NHGC 4NBQA 4IIWA 4A0ZA 3F8CA 4G8XA 5D8KB 1MHHE 2WQYB 2IRFG 5BYSA 1XNRM 2CUZA 3U1DA 1FBUA 2H6CA 2X8XX 2V26A 2EBIA 1ETQA 4AWXB 4BJTA 3VR9B 3U9GA 1RUNA 5KCMA 2FE3A 3CZ6A 5CKTA 4CCMA 3F8MA 2G45B 4NNJB 1U9NA 5ITTA 4OOIA 5FTLA 1VZ7A 1B9MA 5H6QA 3DU6A 2B7EA 3EUKL 4M3FA 4QAYA 5IPAA 3SMSA 3MFKA 3I63C 2G3QB 1WX8A 1D3YA 1JKOC 5JLWA 1XD7A 2INDC 1NEKB 4W9FA 2D7EA 3VRAB 2ZBKA 5LXIB 2KJBA 1LVKA 2PMZA 2CFXA 2YFQA 2CQQA 1QOAA 2E1NA 1RRBA 2WXNA 1A70A 1VQNI 4HKZE 1N63A 1TS5A 3CC2I 1CJEA 1HZ5A 3DTEA 2CHWA 3ONSA 1SD5A 4C30A 4P9UA 1C78A 3SDGA 1KSFX 1WE7A 2R7XA 2ZVNA 3RSNA 1F2RC 3RPFC 2F4IA 5FR3A 4C4VA 2BY1A 2CUFA 4UUSA 5JHBA 2KMUA 4DZPA 4HW0A 1FFUA 5EEGA 1FMAD 2B9SA 2ISZA 4B43A 4M00A 2PVGC 4A0XA 3DEWA 2H5XA 4KLNA 3V6CB 3GLFB 4B8XA 3L16A 3BK2A 1OJLA 1ZELA 5IT9S 1J19A 3PUFA 4LLGM 3PRZA 4CHUA 2M19A 4LNKA 2OPFA 2WAQN 1OISA 5AZFA 1JQ4A 5GPCA 4HNUA 3WTWC 2PEAA 3P42A 4YWGG 3H9JA 4HPQA 2HPMA 3I55I 2AQ3B 3GFIA 4ZYEA 4LDTD 9ANTA 1L8QA 1P9QC 3FD9A 2WHIA 3GMEA 3CUQB 3AE3B 2E5LM 1XNQM 2IP2A 3WE2A 1YO5C 4NAWB 2DYOA 1FBSA 5EJCA 1K4TA 5E6OA 1I5ZA 2F5QA 3RCZA 4P5OA 4M9SA 3ZQCA 1FTTA 1TH4A 2FS1A 4BKTA 3EECA 2DENB 1BT0A 3BG9A 2Q0OA 1W0TA 2NBWB 1A5JA 2VJ4A 1U78A 1K78A 3CP8A 2QJLA 5J6XA 4PYZA 5J1YA 1ZHFA 4GSWA 1N25A 1WM2A 2IGDA 2CJOA 2RN7A 4QOSA 1JHHA 3PGEA 3JTGA 3KIOA 2O7OA 3AE9B 2FH0A 3E6CC 4L18B 2JVHA 5IP7J 1BI2A 3CO7C 4K0KM 3HM5A 4LRTA 3DXJF 3LB8C 1ZAOA 3QPLA 5EEAA 1Z1DA 3FC4A 4B7HA 5JXVA 1F0ZA 4EM2A 4RGSA 1L0VB 4CSWA 3RFWA 3VSLA 5J4VA 1ZOYB 1JQJC 2QHOB 2AWTA 5AZHA 4HZFA 5CLSA 4EZKA 4XBFA 4DR4M 4ZC3A 4RFBA 1SFOJ 2KMAA 2I7PA 3V7SA 3GLLA 2QPAA 1G3IA 3SU8X 2ECCA 2R45A 3TQNA 3DWMA 2DAOA 3FUTA 1P1AA 3TCAA 5JHUA 1YJ1A 5DCNA 1CF7A 3AFHA 4ENNA 1WIAA 1KFVA 1FYLA 3PNTA 1J7KA 1YJWI 1KLVA 2HD5B 2BYVE 3EUHC 4L8RC 3EFCA 1E6EB 3WGIA 2C96A 3V61A 1RU3A 2IGHA 1W7PD 3W5VB 2DWQA 3UMMA 2MBBB 1B72B 2JUOA 4ZHPA 3LQQA 2FUHB 3T5XA 4ARCA 2Z16A 4RB3C 1FXAA 3BR3A 4ZYSA 3W68A 2QBYA 3RIRA 3FM3A 5LMNM 1EFUB 4KA4A 2VC1A 2ECBA 4AG6A 4ZYDA 1PUEE 4BNCA 4KVGB 2DNFA 4K81A 2KEBA 2QEJC 2L32A 2BNKA 1PUFA 3OG5A 2HQNA 2DZIA 1OAIA 5L83A 1ZKGA 3BIID 3SASA 1REPC 2H8RA 4ZRKA 4OVUA 3AEEB 5EXSA 1MJBA 3I9V1 2M0CA 3PQKA 4TV3A 1Y1WJ 3H1UA 1BI0A 3G3ZA 3FILA 1DGRM 5IT9K 2DZOB 4S17A 4NB5A 3IT6B 4WCGA 2BXYA 1HW1A 1FJLA 3ZQJA 3GTJJ 4M6VA 5K7HA 4GGQA 1S3SA 1Z5AA 1ZMUA 4EJTA 3FXOA 2DOAA 1YS6A 4LF6M 1XMXA 3W6JB 3Q8XA 2KDIA 2DWNA 4P1CC 1C4AA 4MGKE 3OV8A 3DBRB 2IPKD 4BDZA 2INPE 3D5SC 3KP4A 1ROEA 1W5SA 5BPVA 2DAGA 5GAGJ 2ACJA 2DOEA 3K1JA 4RM2A 3K9OB 2RD0A 3GTPJ 4B1RA 2I10A 2VT2A 1T08B 2L0TA 2EFQA 4KKIA 5HS8A 1M1EB 3BVZA 4GYIA 3JRDA 1DOXA 4E4HA 4UDUC 4G3OA 5DFLA 1K51A 3NY5A 4ZYGA 2F5EA 5DYIA 3E56A 2JSCA 1YJNI 4FJYA 1F4IA 4NQKE 5AEKB 1V8CA 1D3ZA 2EELA 1SEBD 4XLFA 4BDYA 2D5VA 3KCCA 1A31A 2EJRA 3OS0A 2AQ2B 3DBSA 1DUXC 1KLGD 2EKFA 4CXFA 1D0XA 1A6QA 2XZUA 3ZQHA 3JAMS 4NXMM 2BXZA 3CLQA 4O6JA 4W97A 3A46A 2JWSA 1V9JA 3M0EA 3KS4A 4LZZA 2G9HD 3OYNA 1NYQA 5CPRB 3RGSA 4I02A 4IOAF 2BWBA 2K86A 3LSGA 1XB2B 2ZC2A 3AOEC 1LE8A 2XBBC 1TBXA 1HTQA 3EUB2 4YG2F 1QF6A 4GB9A 1VDDA 3I71A 2HOTA 3SYLA 3RKYA 1Z59A 2ZBKB 3IVFA 1YNTE 4HVBA 3U6MA 1XLPA 4NAMA 4ZDVA 1OEYJ 3U5ZA 3K9PA 5FKNA 2DYRH 2XLJA 4KIGA 1F2RI 4Q7JA 5AIPA 2ZZPB 4RB2C 2XH9A 3JCUC 1T5XD 1SANA 3S17J 4C3IJ 1G2HA 5DTDA 1TLHB 4BH9A 1SB3C 4AKIA 3HOWJ 2R0QC 4KKJA 1HC8A 4AYBA 4RKUF 3GTOJ 2QILA 2MSYA 3BINA 4I6ZA 2MFZA 3DOAA 2PPHA 2L2OA 1J7BA 2DAJA 4WWMA 4EJWA 2JQ7A 2NQ8C 4QOZC 2CU7A 2KPMA 5FKOA 3FK6A 2G4SA 4MEYF 2BBYA 1KQ0A 3ECIA 2LVSA 2YLMA 4FN2A 4W9KA 4G7ZF 3RULA 3E5QA 5D4RA 3ELKA 4BY1J 1V3FA 3MAJA 2I1JA 2JRTA 3F92A 1WJUA 1KONA 1XQQA 2XEWA 2WAQA 1D6EC 4IWOA 3PFYA 1D0ZA 2GLSA 2A5WA 3AE4B 5M5YJ 2L0FA 4J01A 4F1IA 1L0YB 3UIPB 4XDCA 2PN6A 1XXGA 4BAYA 3L7WA 4WX9A 4U87A 1Z7LA 3B89A 2EIJH 1R58A 4MELA 2RGHA 4GU2A 2DAMA 1U5TB 4IUMB 4GMVA 1IGCA 1XPXA 3GQ3A 3A1QA 1IN7A 2BYTA 1Q1OA 4ZDOA 2KRUA 1HKQA 3LCVB 3NZUA 5FB2A 5F27A 1S3SG 3VYTB 1QDRA 4IX7A 4E71A 4XBOA 2PEXA 1KOTA 1UH6A 2DHZA 5G5GA 4EKUA 3MMPA 5KHOA 3HY5A 4AUQC 1BBYA 4MQ9F 3LXFA 2KHWB 5AUIA 5TGTA 1QDTA 4UN2B 4XR6A 1RAXA 4NHJA 2FUG2 4YIRX 1VCBA 2KDOA 3AE7B 4LK0F 4LG0A 1KYWA 5E8GA 2WSFF 1D5YA 2M34A 5KPTA 3HSFA 2DODA 2PE9A 2KZRA 5CJ9A 3WU2C 3R66C 2XK5A 4G11A 1JTYA 5E8IA 2K7LA 4I76A 2R5YB 4BJ6C 2KFJA 3A01A 4BBNF 4BHPA 4I01A 1MG8A 2G8LA 4FHKA 3FX3A 2M45A 4HX8A 1ZARA 2DXIA 1YD8U 5D2MB 2N9XA 4AVZA 3J81Z 3GOEA 2JP7A 3JR9A 3U6SA 4F8CB 3HEFA 3WAMA 4ZPXA 4M8NA 2X6WA 1YIWA 1KYZA 3KWVA 1MGTA 2W00A 1VJKA 3JVZX 4N0BA 1WH7A 4IO9F 4N9IA 1XG1A 5H6RA 1IXSA 4W9DA 4PD2A 4F91B 4N4NB 2VXZA 2KRKA 2IA1A 4JQFA 4PSWA 2HOAA 1WJ5A 4XQFA 3C0RB 1SXJA 3OR2C 4EM1A 4U7BA 1NSFA 3LSIA 1VQ6I 5E6JA 2LYCA 4R71A 3JTHA 1PP7U 1YJ9I 3F8BA 1SAXA 3TOBA 2W57A 2K6DB 2JK3A 3T1YM 4W9LA 4RF0A 4AD9A 4BUPA 2DA5A 2IY0B 5L3BA 2DQRA 1YI2I 4A93J 2KHHA 1G4DA 3ABMH 3HG9A 1FSHA 3W2AA 3AECB 1RWSA 4XMYA 3BTJA 4GFBA 2HZTA 1HKSA 1VZ8A 2JMWA 1SD6A 1JHFA 3PNVA 3MHZA 5JLXA 2I7NA 1R1VA 2GQFA 2KJRA 4IHVA 5BYRA 2WXQA 3R2IA 3BY6A 2KVRA 3RQ4A 2KZSA 4M8MA 4X1EA 1WZ2A 1QOBA 2KDZA 3PL8A 3BROA 1LQBA 2JT4B 2VE8A 1G3YA 5JI6A 3BG3A 3D8LA 2KRHA 2CR5A 3WE3A 1GOZA 4KT6A 4EQQA 3CCRI 4W5WA 2X6YA 1K8RB 4PCZA 3ZNHB 3BR5A 4IJAA 2QKMB 2D1HA 1KFYB 2BVLA 4KYWA 1C77A 3Q3MC 2V1XA 2DTRA 5DD4A 1ETWA 1X1BA 5B1BH 1VQ8I 5IYBJ 3FISA 4WQMA 3HPHA 2ESNA 1HNZM 4M0DA 4O5VA 1ZMWA 2EZIA 2DZKA 1N5XA 5EXXA 4E7SA 4RB0A 2AL6A 2EWNA 3RNGC 4A8XC 1Y8RB 1D8JA 2M0MA 4BVUC 3CDHA 2L4MA 2DZMA 2W7NA 4KSKC 4DDGD 3SJMA 2GZWA 1OTRA 1NG7A 4WQOB 3TQSA 1WF9A 1SBBB 1K6YA 3IG3A 2O6GE 3CCQI 2F48A 2Y9YA 1T0YA 4KIKB 3TMOA 1WSUA 3A02A 3AG1H 3QU6A 2N35A 4L9NA 4P96A 4FJZA 4MEMA 2OHFA 2IVMA 1IDZA 4Q5SF 4OIRF 2WX1A 3L0WB 1YJJA 4LRSA 4A3MJ 2BBCA 3HX3A 2KC1A 4AKHA 2FCMA 4FA6A 4XLCA 2KNBA 3JSOA 2WXIA 1UHMA 1UF0A 4WJNA 3P5JA 3KVFB 5M5XJ 2KQ7A 3QHTA 4ZRQA 3O65B 3ZTDA 3B2GA 4OU0A 2DWZB 3PXGA 3VTVA 1O3RA 5L3DA 4QTRA 3VTWA 2LVAA 2BYFA 1BJAA 2WSEF 4IM0A 1FO4A 1BL0A 3R60A 1Z3YA 1PUFB 1VEKA 2LVNC 2E1OA 3SYTA 4S0HB 2OOBA 3MC8A 3A9JA 3MTNB 5C4JJ 3RFZB 2MJEA 3EPZA 2QLZA 2V9PA 1SFXA 1T38A 2OQGA 3ISPA 4I81A 1GNUA 3A42A 4B3MM 3VH3B 3HKZN 3E5UA 2GBYA 4L9TA 2GRIA 1UHSA 3V05A 4UUSB 1G4AE 2MHJA 3QPSA 2P81A 1X1MA 1DOYA 2GBKA 1GUAB 4AZFA 4GDKA 4XONA 4LF8M 2BY3A 1N62A 2X6XA 1AW7A 2W1OA 3PIPF 2RV8A 5DPWA 4K7WA 1V1OA 1SE2A 3SYKA 3U7DA 1N77A 2ACZB 1Z67A 3IV5A 3KETA 3HTSB 1W36C 4NRVA 2R2OA 5L3GA 4AIHA 1GC7A 2CW8A 3KW6A 2K85A 3K9TA 1BXTA 1Y0UA 3T15A 4FWGA 3AXCA 1MBFA 1AARA 4LMYA 3HM6X 1Z5BA 4KNYA 3CF2A 1QILA 4BYYA 4IL6C 1JUMA 1SG9A 1QQRA 1OCZH 1BC8C 3ZC7B 3QYFA 2F5OA 2VQFM 5AZGA 4WJPA 3MFGA 3JRAA 1KU2A 2W3SA 1OMIA 3KXEC 4AQYM 3L10B 1YQ4B 3ABUA 4XLAA 1FIQA 1ZUD2 4M3DA 3DEEA 3HC7A 4DHZB 1NG6A 2PLPA 2MJDA 3Q0VA 1B9RA 5KHQA 3DTIA 2WWYA 3M07A 3L2QA 2K4BA 3CMAI 2DMPA 3LVVA 4RA2A 2RPQA 4YIFA 2ZW1A 2LF8A 3DBLB 4LGYA 3F8NA 1AA7A 1QHGA 2APLA 2ADUA 2L09A 1B8IB 3OYCA 4FJVB 3TEDA 4S04A 4AP4C 3TEZA 4P16A 3T38A 3OJ4B 3U8ZA 2IGKA 2VASA 3ZKJC 3HU2A 4CYCB 2V3NA 3O2PE 2L6OA 2CQXA 3GF2A 4EFOA 3V8LA 2K8CA 4BFRA 1YX5B 2LR8A 1YHQI 3PJRA 4Y13A 3CMYA 4H0EA 2HHHM 1O7FA 3HJEA 4XSZF 3Q0UA 2CG4A 1V33A 1IXSB 2M5ZA 3IFWB 1WGYA 1PJSA 4B3XA 3B7NA 1WJNA 3J7YJ 3HRSA 4I7HA 3K2ZA 2JY6B 2FUG1 3QX1A 2R7ZJ 4E7KA 1OR7C 3I5UA 1VEGA 1V5OA 4W1UA 3JW4A 3U5ZB 4RM8A 4WXDA 2BS2B 1VQ9I 4XSXF 2HZDA 2KKCA 3V3XA 1NVMA 1KU9A 4OIPF 4AC0A 1IUEA 2ZJDA 2XPVA 3KOXE 1IF1A 1JR3D 3R7QA 3JSPA 2BWEA 2WZJA 4JP0A 1H8AC 3LSJA 2EV5A 5IWAM 3KZZA 1MN3A 3EYYA 2QENA 3HL2A 1OEYA 1R5HA 2OJWA 3JR4A 1LFUP 3CUQC 2E1MC 4L0YB 1FLIA 3I4NJ 4OZBA 3N32A 2PI0A 5ICCA 3JAMZ 1NNUC 3B7ZA 3SFEB 4JLCA 3H35A 3MVPA 3ZQFA 2ZAMA 3OYKA 1ENHA 1R4NB 4C80A 2LVQD 3K1PA 1PUTA 3W1SA 2LBFA 2VQCA 2K1FA 4NY0A 3EFUA 2NS7A 1YITI 3L09A 2P8TA 3PS6A 3SHFA 2BHYA 4G3XB 1D1AA 3ECHA 1OCPA 2XGCA 4N4OB 3TOAA 4XLPF 1TY2A 3RZWC 3NWTA 3VWBA 5HNHA 4HLQA 4G6QA 2MA3A 2DA6A 5ITQA 1Q1VA 2JY6A 2IY1B 1QZEA 3X23A 1FMVA 2STTA 3JSVB 1FMWA 2QM3A 1OQYA 3SAVA 1KTKA 2EZKA 3GLIB 1ZQ9A 1GVNA 1R2YA 1FJGM 4B48A 1ZLJA 1D4BA 2VKDA 4CCLA 1TW2A 3RD2A 3TMPB 2P7VB 3PSIA 4HNTA 3KUDB 1NI3A 5E1WA 3C19A 1EA3A 4RAGA 1RM6C 4ABZA 3PZ8A 1R4GA 2GXBA 4IG7B 3A9KB 4BQAA 4BQQA 2A69F 4W9EA 2KJCA 3K4CA 4A3CJ 2BQQA 2LREA 4PJLA 2VBWA 2Y21A 2L7HA 4FX4A 2AYOB 3PZ7A 2ZANA 2ZMEB 1S29A 1R00A 3MHVC 1TDHA 3UF8A 4B9KA 3ZMZA 2C7MB 4ZRJA 4K7UA 1EKEA 2HDCA 4EGYA 1HXDA 2KWUB 2LH9A 1ZR4A 2L7RA 4WW0A 1ODDA 3FRIA 2LLKA 2LSOA 5GPAA 2VONA 3IRQA 3KSJA 4CH7A 3R8FA 3FBIB 3BJOA 1YRNA 3DFZA 2BTEA 2NXNB 3I51A 3CJNA 4ANJA 3V6EB 1OFIA 2J7OA 1HLVA 4NJCA 2LWPA 2OPTA 1S3JA 3GYHX 5FGMA 1SE3A 3GLHE 4MGZE 4KIBA 2DFFA 4JI6M 5DNYA 2Y5PA 1Q3BA 3LMMA 3OYLA 4ZDPA 5BMGA 2MH2A 2UUBM 3DPDA 1OIPA 3HRMA 3RNBC 3AKZA 1WJ6A 1H89C 2ME6A 3CC4I 2DQLA 1T8IA 1R4MB 1V92A 4JYAM 4YFKF 2E1MB 2V6CA 2HWJA 2LMDA 4IHTA 1QPMA 2DAIA 2ZB9A 1SF0A 2SAKA 3S2HJ 1JROA 3ZPLA 1TJEA 1WGHA 1ZXHA 1XXHA 3Q8GA 1GT0C 2MLBA 2DK5A 2ZXIA 4CJ6A 4CHKA 1YIJI 4IXAA 1LFPA 2JWUA 4ON0A 4CCOA 2MBEA 2VH1A 1BR4A 2C9CA 4M3EA 4DUYM 4XM3A 5C4XJ 2E60A 4URKA 4ESJA 2JRHA 4GOCA 4JWSC 1LDDA 1DGJA 2QBYB 5D6EA 3KSXA 1MMDA 2HTSA 4GDLB 4HYEA 3VDPA 2JYEA 1JMLA 3KP0E 3GLFA 1VFCA 1QU3A 4X62M 4CDGA 2AQ1B 3A4SC 2FFJA 4DV3M 3TUOA 2HEOA 3T3OA 2JZ0A 3I58A 2NBVB 1YQAA 4I0AA 1N34M 2C99A 1GHCA 3UZUA 4KMUX 1WXVA 4MGIE 1Z5SB 3AU5A 3CCYA 1JR3E 2NOJB 3ZIMA 1VTNC 3W5UB 1E90A 2LKSA 1I42A 1GLNA 3FIWA 2BF8B 1RFAA 1T43A 1SMYF 4FADA 4JI4M 2RAEA 3I53A 1ETKA 2Y0SN 1XSDA 2K3PA 3CJRB 2NTTA 2M2EA 1SVLA 2HTJA 2K0BX 4CHTB 1OFCX 2K5CA 3H92A 3DLAA 1V1PA 3AE6B 3NQOA 5JVGF 4PFPA 3HU1A 1QO0D 2MG4A 2DI3A 4L6V6 1Q10A 3SDLC 2EH3A 1IFYA 3S2AA 1E0EA 3APFA 2KANA 4ASWC 4FE7A 1EH7A 3VFZA 1Q1HA 2KOXA 1R23A 1WJFA 4RLQA 4TUUA 3OR1C 2KWVB 3C3DA 3J7BA 5C44J 3K8ZA 1JT0A 4FHTA 2PMVA 2UXDM 2WXHA 1TH3A 3L54A 4FWDA 4GIPA 1SAUA 3V60A 4LF7M 4F52A 2ZVOA 3FYDA 2DYSH 3FAHA 3DTKA 4DQ2A 3E1SA 3K10A 3MEXA 2BGCA 3OL4A 4A3JJ 2QZ4A 4XOPA 5IREB 3QPHA 4KHPM 2XSDC 1MMGA 2FQ4A 1BIAA 3BCAA 1X4PA 2GBMA 4IHWA 5IP9J 1TZOA 3DCFA 3QOPA 3MKWB 1V4RA 2FA5A 4GMQA 1TDZA 4MH0E 3U6EA 2DENA 2EV6A 2ZMEC 2C7HA 2VH2A 4YHHM 5DPSA 4G94A 3S8PA 3J7AO 3GQ5A 3ZQ7A 2YQZA 4OVZB 3GP1A 5EGOA 4PS8A 1BR1A 1IQPA 3QWZB 2L2DA 1U6GA 3PIOF 4Y7NJ 3ZNID 2GA2A 3JYUA 3RT3B 5KPZA 5FFXA 1I4RA 1WY8A 2R7RA 4XYCA 1FNWA 4LCDE 2NRAC 4LLLA 2JRIB 3IAS2 2H27A 2D2WA 3FBNB 1WGGA 1SJED 1S9HA 3P4RB 2KKOA 2M1MA 1B72A 3J81S 4D81A 3FF5A 1C1YB 2BZTA 4KGSA 3JRIA 2DWLA 1GO5A 2PMUA 1NY6A 2P5KA 4IOIE 3IG8A 3OYIA 3Q2AC 1X19A 1SXJD 2JU6X 1IBXB 5FFZA 1TW3A 4CZCA 2HYJA 3GE8C 1OR7A 2VOPA 1VQPI 2O0YA 3L1PA 4Z8XA 5IO9A 1V1PB 1MBHA 3C18A 2FOIC 1XLOA 3S93A 1YE9A 2QUFA 1OCRH 2MD0A 1SFEA 2ELKA 1JKQC 5LRRA 5G55A 4RM3A 1ZMVA 4IEJA 3NG0A 2VT3A 4MFEA 1P3QQ 3WTXC 3OS2A 1FYKA 4XIDA 4RM9A 1UFMA 3NWLA 4EIWA 5L3FA 2E2IJ 4B7GA 1FPYA 3KEOA 5BOXA 2L7IA 2Y9ZA 3RKXA 3O8HA 1XGMA 4RB1A 5ICEA 4AVPA 4RGMA 2KMCA 1E3PA 5KAFC 2KZGA 5B1AH 1D5XC 1C1KA 3M3YJ 1Q0WB 3ERMA 1PGXA 3A45A 1G3WA 1T6SA 2CFOA 2LC2A 1MFWA 2P6SA 2MABA 4LF5M 3N1XC 1TT0A 3PNYA 2WA0A 3OSFA 4QSHA 5J3LA 5F1RA 3S2DJ 5DPRA 1ZYRF 3AM9A 1T56A 3ETRA 3PT2B 4XRSG 1BMLC 2DFHA 3SAUA 3T3NA 3WTYC 3PLVA 3FKJA 4LNOA 1F4KA 4BOZB 3CCLI 4TUWA 2BOLA 2J5OA 3LOCA 1EU3A 4HL4A 1WZ3A 3S1QJ 3D5LA 1E7UA 4EATA 1D0LA 3M8EA 1ON1A 3TW7A 1D1BA 1S8NA 4IZZA 2J4XA 1UD7A 1N5WA 5FLXK 4XLHA 1IBXA 4KUMA 1CQVA 2WC2A 2ONQA 3CLOA 2QA4I 1V49A 4DR1M 3BTIA 2AO9A 3K4MA 4H4KC 3ZTCA 2DJIA 1RI7A 5LGNA 4KT5C 1Q39A 4CA0A 3LJ3A 3R6SA 2FAZA 1G3TA 4RGUA 4HLXA 3IAS1 2WLBA 1TQMA 2RKOA 3LFKA 2V7FA 4ANUA 1VDVA 5J8FA 3ZJUA 1WH3A 3C8YA 2DMTA 3KP5A 3VHTC 2DKLA 4G4OA 5IP4D 5CHWA 4D5FA 1Z21A 3E5XA 2HDEA 5D3DA 5IY5H 1XHBA 2FEZA 4NQLB 1NTCA 4BGDA 4IKGA 2BE5F 4GH9A 3VK7A 3N1ZC 3KLSX 2IGOA 2CU3A 1I7HA 1X4OA 3GEZA 3P9CA 4A3DJ 1HW2A 1W7PB 1HE8A 4ANRA 3UI3A 1K78B 2XN9C 3MJWA 4GRIA 3GLGE 2NVYJ 1R36A 4XN0A 2K6QA 3APDA 2ZO4A 4MSQB 1GV2A 2YU9J 2KLGA 4FX0A 1QQWA 3RCOA 1P7EA 2QCZA 2BPSA 2NAZA 2CJNA 3IL2A 2JX5A 2LUMA 5E3NA 3SFZA 1IO2A 3KX2A 2LD5A 5CVRA 2PJPA 1Z5CA 2PMHA 4NQWB 4E7HA 1NYRA 2HI3A 1X37A 1CUKA 2XHKA 2KK8A 3A0BC 1P4AA 2KLCA 1XWIA 2MEKA 2OO9A 4GKKM 4I0BA 2WTEA 1GB4A 5HHDG 3I04M 4UUVA 5J1RA 4PDIA 2GLOA 2TDXA 3IKVA 3ZGZA 2K47A 4CCNA 4W9HA 3WG9A 4NNJA 3MK6A 4I09A 1CMXB 3KZIC 2FQ3A 3V7RA 3MQ0A 3L26A 4AIJA 2KRCA 4A3GJ 1V80A 2WXMA 1SD4A 2LNBA 2V3SA 3FZVA 3HIFA 2UWQA 2FD5A 2INCC 5KNLA 1WHUA 2RQPA 2VDBB 1JWSD 3G1LA 3JAMK 2IO1B 2CJJA 3J2PB 4CYCA 3H3UA 2X1EA 3ZMDA 3S1MJ 3BK1A 1YN5A 5D5XB 3ZUNA 3RN9C 1SE4A 2DMQA 2G9WA 2KTRA 4XRFA 1NK3P 5M3FJ 3T8TA 2HVSA 4V2FA 3L2UA 1X1CA 3G73A 5T8IA 4I4LA 3ALBA 3LCUA 5HVQC 4NC7A 1JE8A 1BC7C 4HK2A 5JHAA 1P4WA 4JIOU 3F72A 3I4YA 3T1HM 2C9WB 3U6OA 2HDWA 5K7ZA 1TTEA 1P2FA 4GEWA 2KRFA 1HBXG 2XB5A 3LW5F 1MVKA 4IWQA 3NZ3A 3CMMB 4BEHA 1RETA 4QPQA 3BY4B 5FD5A 5KHDA 3PSFA 4RGOS 4I6PA 3TO9A 3GCMA 1NV9A 4DBRA 1KU7A 3GO8A 1QT9A 4NSOB 3OWTA 1K52A 3H4JA 2R7UA 4BS9A 3AE5B 3DLLF 4I98B 3TP0A 3TWMA 3QU3A 1TTYA 1SD7A 4IF4A 3ONQA 1STZA 1I27A 4JE3B 3KYCD 4A5NA 2DHRA 1IRXA 1P7IA 2EMTA 4KIKA 3M8FA 2NBUA 1DGBA 1U0JA 3OYMA 1TGUA 4YSXB 2LGDA 2B3TA 2EA2A 3MKYB 2AQFA 4I5SA 3OS1A 3AH7A 3ERED 5FLXS 3CGWA 3FXJA 3NVWA 1PDNC 2F5FA 3KQ4A 3AE8B 2Y3AA 1QAMA 1FZPB 2I8DA 1GJSA 4LJ8A 4HJKA 1G6NA 1L1TA 2BW3B 3RYPA 2G5GX 2KO3A 2M4KA 4BBAA 4EOYA 1Z7UA 1V34A 3FTCA 2A68F 2XAGA 4LTUA 1IUFA 4ENKA 5CHFA 2RDPA 4MQVA 2R62A 3E4RA 2X9DA 2KTRB 1FPQA 4LFBM 2WB1N 3VFDA 2YR2A 2MJ5B 2WV1A 2K22A 4LB5A 1FD6A 4ZRIA 2JY8A 3I4VA 3KUZA 5J47A 2LHDA 1JWBD 2CRUA 3ZH9B 1S7EA 4IBCA 1WWTA 3DP7A 2XROA 3O8GA 3K6GA 4P55A 4G12A 1L1ZA 3I56I 2EQRA 1YW9A 1EF5A 3QARA 4FCWA 1T3TA 4TMAB 2F5CA 1UG2A 4XRMA 2MBQA 1YN3A 1EWCA 3NVZA 1X3UA 2VBYA 3KH0A 2YU3A 2KZUA 3AL0B 1E9MA 3KE2A 3J7ZI 1JWUD 3BQZA 2MW5A 3L2WA 2ZCCA 5E20A 4RGRA 2X51A 2DYMA 1XSXA 2M3AA 4DV6M 4GHAA 1R5ID 2KL4A 1UCRA 4JX5A 2BKRB 5CX3A 2XPUA 3VAWA 4AU7A 1E0ZA 2WV0A 5BPDA 2DPUA 1XCTL 2GOMA 3GZNB 1TWCJ 4DXAB 3R0JA 2KA6B 2LGIA 2LGXA 1FOXA 2LEKA 4IBFA 2BW3A 2JWTA 5L3EA 3GZ5A 4IHYA 1R22A 1HF0A 1WI9A 4R3DA 4R79A 4AIKA 3DVGY 1XCQL 2XF7A 4PS7A 1A35A 2HAKA 4HEOA 1LJ9A 4ZHOA 2QCOA 2ELHA 3K7AJ 4BXFA 2IBDA 4MTEA 3NJTA 5LRSA 2MD5A 5EP1A 3GPPA 1SXJC 4K7SA 3H4MA 2KDLA 2J42A 3WAOA 2ZSHB 3MJ5A 4L9VA 4DUZM 1WGRA 2YVCA 2O9LA 1MSEC 2IS1A 1YX6B 1L0XB 3IT4B 3Q3NC 1MMNA 2OAZA 4K3BA 4R1HA 2FNPA 1GL6A 3AG3H 3FKIJ 1EH8A 1B6AA 4X64M 2MC3A 3S16J 3FXKA 5GTIC 2GB1A 1X2NA 4UV9A 3HHXA 4JK1X 2KDMA 3JRCA 3DVGX 1KQ8A 4JI5M 1NH3A 4DV5M 1IC8A 4S12A 4ITKA 4OMYA 1L2CA 4C56C 1DPUA 4JN6A 2WXGA 4I6NB 3RE8A 4A5MA 1I4HA 4UVCA 4TSSA 1ETVA 4AS1A 2JRMA 4XOTA 2H1KA 1TIFA 4JI2M 2GNOA 2A3SA 2E7XA 1LB2A 2JXXA 1OCCH 2OUMA 2FCQA 3BJ6A 2WADA 3CDIA 3BCBA 5IYCJ 2RGFA 4F7ZA 2M1BA 2JXNA 4NAWA 4G4RA 2VJJA 4JGHB 2D45A 5FTJA 3D1NI 3V62A 1IN6A 1GV5A 2WBMA 2LNHC 2R3SA 3H36A 3O3KA 2ERCA 3CDLA 2JXTA 4EGZA 2VKVA 4KJZA 1XSVA 1NV8A 4IBBA 3U21A 1ORYB 4A55A 1YLFA 2FOKA 4WXCA 4BQOA 1LPQA 2LVPA 2N7JA 2HOSA 4GDLA 4C2MJ 2LKXA 2DDAA 1P98A 2LHGA 3HGYA 1KRHA 1UZCA 3M4OJ 3I64A 2HE7A 4QLCU 5D8LB 1LGRA 1TGZB 3QK0A 3B0AA 3CQZJ 1T0SC 1D2NA 3DVNU 4BKSA 5HDNA 3AE2B 2Z0EB 2XAJA 1APLC 1BOAA 4ANVA 3SC3A 2LFIA 3I5JC 2O03A 2ZTCA 2DA3A 3Q9VA 3ML6A 2QZ8A 1XF5L 3TO6A 1SXJB 1WXSA 4IBJA 1LUJB 1HDPA 2DU9A 1VEJA 1ZPSA 2QVOA 2K5PA 2VQLA 1Y39A 2KP6A 5I4DA 4JL9A 2ZXWH 5ILVA 4HA8A 2MYSA 3EUHA 2QWWA 5EDNA 3GLIE 5DYGA 4PUSA 5IOYA 5GXGB 1FM0D 3RNFC 1U9OA 1QAQA 4ZTJA 2XAFA 2Z8YM 3IWFA 3KWLA 2AL3A 3LA7A 3Q3OC 1N36M 4L9JA 2GAUA 1V55H 4MGYE 3KYDB 2RNJA 4LGMA 5LHIA 3H7SA 4ARIA 1I3AA 1WFXA 2WY8Q 2FBHA 5TJJA 2Y75A 3CTWB 4HWIB 3L2RA 2DNAA 8CATA 3DKXA 3P9KA 1LFBA 3ECOA 2XF3A 2L01A 2NVTJ 4RF1A 1R6RA 2XZFA 5LGUA 1JUSA 2LP0A 2Y0QA 2JF5A 3BG7A 1VZ6A 5F04A 2WP9B 3GRUA 3L2CA 4JX6A 3J80S 3DF8A 3RNEC 1TP4A 3DQVC 1HA5A 3AULA 1Y1VJ 3GPUA 2DA4A 2BS4B 2VN2A 1QZZA 1QUTA 4WJQA 2KDEB 3W67A 3MN2A 1V5GA 1VG5A 3CJTB 1JJ6C 2K9LA 2ASQA 4FWHA 4NOOB 1P0RA 4B08A 4YTNB 2IO2B 2WWZA 5B66C 4CGZA 4LY6A 2CHXA 4N6EB 2JTVA 2ZFUA 4M0WB 3HXLA 4YFXF 1BJZA 1MPEA 3U61B 1J7AA 5LGTA 2OA4A 4XKWA 1SGHA 2VF7A 3NS1A 5E3OA 3M1EA 2QSDA 4NUBA 1YW7A 2XASA 3CMEI 2ME0A 4BL0B 4G0NB 3DBHB 5D6JB 5JI2E 2H88B 1NJGA 4X65M 3GLGB 3Q0WA 4IDIA 3B6CA 2LTPA 3PRPB 5EF6A 2F5DA 1MJ9A 3JRHA 5EP3A 4XLEA 1E2XA 4A0YA 1IXCA 3FRHA 2B63J 3E7LA 1YIOA 2JN6A 2JY5A 3DPLC 2QP9X 1Y8QB 1VRAB 4DV1M 1S7OA 1XX5A 2RDBC 3AG2H 3KYCB 1A04A 3HOUJ 3K4KA 3BVGA 1N33M 3L4PA 4BBSJ 1QVTA 2K8HA 3VRBB 2CRGA 1ET6A 3DBRI 4HLYA 2E71A 4EJVA 4HPLB 2H89B 2RQQA 4M72A 4WWOA 3FUWA 1Q02A 3PM1A 3GB1A 2F5VA 3PUBA 2HXIA 4YXDB 4ASNA 4GLSC 1FRDA 4L0ZB 4KT0F 5BMZA 2VOOA 1KF6B 2LVOA 4MM3B 3U6CA 3BC8A 3HSEA 5D5UB 2HKJA 5HLHA 2QEXI 2MP2B 4M3GA 1XO3A 3WHKA 4II3A 2N4FA 1WJ4A 5FTNA 3P4QB 5KO3A 2HL7A 3C9PA 2E6XA 2O8KA 3CO6C 4E7LA 4XZ4A 3O13A 3Q3FA 3BT9A 1RNLA 1QOFA 1ZE3D 3LSRA 1TTNA 2X85A 2UXCM 2ZJPF 3VQIA 2L8JA 1VQKI 2UZKA 4G6DA 1IP9A 5JI3E 5CVVA 2QSHX 1NJFA 4DXFA 1USTA 2Q2EB 1XC5A 2JWZA 2RVCA 4PDKA 1LO5D 3OIPA 3BYYB 1HTOA 3ABLH 5DS9A 4HKQA 1L6VA 2X49A 4BY7J 4HV5A 2FXAA 3VYUB 1TKGA 2D5GA 4W9CA 2GWRA 4Y3OA 3B9PA 1ZG1A 1HOMA 4B95A 4JWUC 5A2QZ 1JGGA 2EZHA 5IYDJ 2Y0SA 1C0WA 3X2QH 4DBGB 1DP3A 2RMMA 3E6MA 2BKFA 4LNNA 4GHLA 3PLUA 3HHWA 2QNJA 1LQ1A 3RPUD 1R1UA 4CCKA 5BQTA 4KZCA 1UFZA 4XE0A 4E70A 2E1CA 2FF4A 2DHYA 3G1OA 3BYTB 2X48A 3AMZA 1WSPA 3F0CA 1LM8B 3K4NA 3HKZA 1P92A 1FYMA 1T6BX 2OTLI 1R49A 2BT6A 5EP4A 5F1JA 2K39A 3GW2A 5LHGA 2W9NA 2R4EA 3GFJA 4KFCA 1GXPA 4YFNF 1NDDA 3I01M 3FMQA 4A3LJ 2JVGA 3DV8A 1L2BA 2L1AA 5ITXA 3QRFF 3WU1B 1ZG5A 3WTZA 1WRDB 2DTZA 4A3EJ 5HLIA 3PRMB 1K6OA 4EEWA 5F0FA 3W3CA 3M62B 4LJPB 3WTSC 2CV1A 3ZRFA 1FC3A 2KLOA 4UXNA 3M9AA 2QQ8A 4HG2A 2LGYA 4AYBN 3O6BB 2J0MA 4HQEA 2F2EA 5IN7A 2O6VA 5DM6F 5E1XA 4FISA 3ABTA 5D6FA 2LH0A 1WHCA 1PVEA 1L2DA 3AE1B 3P7NA 4U88A 5E79C 3F3XA 2XV4S 2QQ9A 4GDFA 5HLGA 2J5PA 3MZYA 2ICWG 5AIQA 4GKJM 1TKEA 3ZQQA 2UV1A 3BG6A 2LTUA 2KACA 4CZZA 4G50A 4B6WA 2RR9A 1ZGJA 1FCLA 1FNVA 1IG7A 3PPAA 4LG0B 1WVRA 2NVXJ 4LG2A 1Y0NA 1ZH5A 2MCNB 2NTSA 4I99C 4HROA 2UYZB 2DBYA 5HS7A 1K4SA 2RDGA 3Q5FA 1X3ZB 4K1RB 2EFNA 4MJSA 1MJAA 1YUBA 1NI2A 3B08A 3HM3A 4J6IA 3ZRCA 4BXXJ 2HYFA 3HKPA 1FFVA 2X1DA 1G71A 1WCMJ 2OZUA 4PSXA 4REZA 1PYWD 2GXAA 1JRUA 2Z9OA 3AJIB 4YELA 4KDLB 2KNVA 3S1NJ 2GBNA 3B2FA 1FP1D 2L9NA 3VSKA 3PQJA 2WU2B 2WSCF 4DOZA 5HG2A 1IN5A 2JA5J 4RGNA 1GC6A 4E74A 3WHCA 5F0CA 1A6IA 4FETA 2WDTB 2OOAA 4UY8I 1P7FA 1Z77A 2XDVA 2YX7A 2LK2A 3LFUA 3AU4A 3LSTA 5DYMA 2BWES 3C7JA 4O1NA 2IZVB 2X4AA 2E7WA 2JPHA 3R3MA 2NMQA 3F6OA 5IOZA 4P17A 2F4OB 3ZCOA 4IJEA 4Z6YA 4YSZB 2R7QA 5FROA 3BBZA 2PW9A 5J1UA 4MT5A 3HU3A 1D1CA 4M6YA 1ZRCA 1I4PA 2MROB 2UUCM 1J5YA 2VQEM 1MBJA 1OCTC 2A6EF 2G0EA 3OTOM 5FRNA 4HX7A 2N9EB 2KX3A 4CO8A 4J19A 1N60A 1HQYE 2JA6J 3JSVA 2MGWA 1I50J 2ZW0A 2G3QA 4HDOA 3U6QA 1QA6A 1XLQA 5HDGA 3GLIA 2L7ZA 2MLGA 2JVCA 3PV1A 4MJSB 1GPXA 4IVNA 5H2FC 4OIOF 1QUSA 2NPTB 4P1WA 2GA1A 5EE1A 2KVZA 1LKXA 3W0FA 2K0PA 1OIZA 1LFDA 1NBFC 1XEEA 2ZSIB 4M3BA 5CTRC 3KOYE 4XDDA 3E3VA 3ULQB 2QQBA 3VDZA 5IA7A 3W2VA 1AWCA 4C3JJ 1B59A 4C7YA 1BA5A 3ZP5A 5LXHA 1E9RA 1TC3C 1FEHA 1E7VA 1W5TA 1DP7P 5IKCM 1XC8A 4L5IA 2D07B 3GTLJ 1WMHB 1A5RA 3L17A 2Z0DB 4NXNM 1IYFA 2HR3A 2E2HJ 4BBRJ 2QGUA 1V54H 1OPCA 3N9YC 4DR5M 3AEBB 1H88C