1QZEA

Hhr23a protein structure based on residual dipolar coupling data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
360
structure length
214
Chain Sequence
SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog A
publication title DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 51
structure length 214
sequence length 360
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF00627 UBA UBA/TS-N domain
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA04
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1qzeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1qzeA01
1V81A 4JIOU 3L16A 4FJZA 2FCNA 1E8YA 2L00B 1ISNA 4K81A 4NAWA 3TJPA 2WWZA 1RAXA 2NCNA 3R7QA 3FRIA 2PEAA 3OJ4B 1SGHA 1WR6E 3NZSA 1LM8B 2CR5A 2DAGA 4AJWA 4MGKE 1DO0A 4AP4C 2CHXA 2JWZA 3CSFA 3DQVA 4ICVA 1KLVA 2BF8B 5DPWA 2FNJB 4TQ1A 4KZCA 4ANUA 5J17A 2MCNB 2QSFX 4KSLC 1T43A 2N7EA 1V9JA 4WJQA 1UH6A 2KC1A 4FBJB 2MGWA 4NQLB 2IYDB 4NY0A 4MJSB 2LUEA 3DBRI 3C0RB 2WYQA 2CKHB 5IA7A 4WWPA 3K9PB 3HK0A 2JY6B 2G3QA 3F92A 4I6PA 4CHKA 1GC7A 2JXXA 2A4ZA 2MWSB 4EOYA 5LLIA 4W9JA 2CP8A 2LD9A 2FCQA 5L95C 3DPDA 2DZKA 1WIAA 3QJZA 1R4MI 4W9LA 1X3WB 1YQBA 3KUCB 4X57B 2MRPA 4HLEA 3GLHE 4KIKA 2KX0A 1E7UA 3UF8A 2MLBA 3VH4B 2AWTA 2BKRB 1UD7A 1CMXB 2JVCA 2MR9A 3A1QA 4GMVA 1E7VA 2HWJA 4WJNA 3B1LX 2DAMA 1UBQA 3DCGA 1BVSA 1G6JA 3PLVA 2KTRB 1VDLA 2V4LA 2KHWB 3KYCD 2L7RA 3M3JA 3PRMB 3ZTDA 4NNJB 2HD5B 2KVRA 3A9JB 2IO2B 3BINA 1WE7A 2CHWA 1V80A 4GEWA 2O25A 2LWPA 2KNBA 2LZ6A 4MEMA 4OVUA 4DBGA 2OOBA 2LRUA 4FADA 1KJTA 3ALBA 1EF1A 2IY0B 2BYVE 4I6LB 2BWEA 4F1IA 3M62B 3U7DA 5CX3A 1OTRB 3WA0A 4DHZE 1D3ZA 4HPMB 3V60A 2C9WB 2KQ7A 1WF9A 1MN3A 4YIRX 3PHXB 2NBUA 3Q3JA 1WMHB 3SD5A 4ASWC 4IC7B 1WZ0A 1G4AE 2QSHX 1GG3A 4PYZA 1Z5SB 4LJOB 3QWZB 1T6OA 1K8RB 1S3SG 3EHVA 4GN1A 2KDBA 3OLMD 1KOTA 4JGHB 2PE6B 5CHVC 3UINB 2KJRA 4DXAB 2LASA 5AEKB 4FLHA 4TQ0A 1V5TA 4HXDA 4FN2A 2KWUB 3VUYA 2JY5A 2KX3A 3BY4B 3IHPC 3W1SC 3ZTCA 3ZRFA 3MMPA 2BPSA 1ZMUA 3NHEB 3K9OB 2NPTB 3GLFE 2KOXA 2REXA 3T6PA 3GZNI 3N3KB 4W9EA 2XEWA 4GSWA 5JHBA 3O65B 2FCMA 3VVWB 3RZWC 4W9CA 2IO0B 3UIOB 4E71A 3R7RA 2O6VB 4FULA 4LDTB 2D2QA 1H4RA 4GOCA 4EZJA 2HE7A 1OKSA 2M1MA 4MJSA 2QHOB 2DAFA 1LFDA 4HPLB 3QA8A 1WIVA 4EEWA 3K9PA 4B95A 1JR3E 1IXSA 2JY6A 2VRRB 2JNHA 5G55A 2JZ0A 4AWJA 3A9KB 1WY8A 3NZUA 2Y5BB 3TMPB 1WJ7A 1E8XA 1OEYA 3ESWB 3HM6X 2KXJA 1OQYA 4WQOB 2O2VB 3WAPA 1XQQA 3A33B 5LXHA 2GMIC 2DNAA 2JRHA 4MDKE 4ANVA 3SDLC 3BBZA 2D11A 5E6PA 3APFA 4PYUA 2BWBA 2DZLA 2GBMA 3H7PB 4ZRKA 3IVFA 2V1YA 1G3IA 3H1UA 3EFUA 2OO9A 4F2LA 5C23A 4MGZE 5KHOA 2ZTDA 2C7MB 1NBFC 1V6EA 1I35A 2I1KA 4IUMB 1KM7A 2J0MA 4PS8A 1WFYA 2KTRA 4G3OA 2LGXA 2PPHA 4KSKC 2ZCCA 2ZVOA 2K39A 2LVQD 1XD3B 2OOAA 3QIJA 3H9DA 2K8CA 2D07B 3DVGX 3A9JA 1HQYE 3E46A 1WHCA 1VD2A 4JL9A 4MGIE 3JYUA 2L76A 2CWBA 3Q3FA 3AXCA 2CHZA 1U4AA 1E8ZA 1J19A 2G4SA 3VTVA 2XK5B 3KW5B 2KK8A 1OTRA 1EUVB 4W9FA 4BKTA 1XT9B 2GBKA 4OVVA 1YJ1A 2KFKB 3L08A 2JUJA 1Z2MA 2KDFB 4IM0A 1WMHA 3U30A 1TBEA 3QCAA 2G45B 3VHTC 2LXCA 3VUWA 2ZNVB 2JY8A 2G4DB 5J2RA 1C3TA 1E8WA 4MGYE 2KLCA 1EO6A 4ZYNA 1T0YA 1E5WA 4HDOA 2LVOC 2C7HA 3APCA 2K1FA 3RCZA 1LQBA 4ICUA 2HTHA 4YL8A 2DENB 2YLMA 1H8CA 2QSGX 2N1VA 1WH3A 2BWFA 1X3ZB 4KZ0A 3RT3B 3JSVB 3X23A 1J0GA 5E6OA 2BYEA 3R3MA 1RRBA 1Q02A 2ZPYA 1WGRA 2NPTA 5GMVA 2M0XA 3ECIA 3B89A 3PT2B 2L2DA 2B3TA 3ZKJC 3V62A 3ZVVA 2LXAA 4F1SA 2DKLA 1WJ6A 2W9NA 2BKFA 3L0WB 5DPRA 2N9EB 4GDLB 2V3SA 5CTRC 1YIWA 2KD0A 3PSEB 3V6EB 4GU2A 1F4IA 5JZEB 1L2NA 2FIFA 3MJWA 4G3XB 2ZTCA 4M0WB 2DAIA 2LVNC 2LVPC 2QHOA 3DVNV 1WI0A 2DHZA 2DX5B 3VH3B 4A3PA 3PPAA 3E21A 4W9KA 4HVBA 2EKKA 3QHTA 3GLIE 4ANWA 2KNAA 3A9KA 3P2BA 2EMTA 3PRZA 3RUIB 1V92A 2M8SA 4BKGA 3IHPA 2F4OB 1WM2A 3W1SA 2O2VA 1TZ1A 2KJHB 2NBWB 2BWES 3QARA 2AYOB 4W9HA 3APDA 1Y8RC 2K6DB 2NVUI 4MSMB 4MM3A 3H7PA 4G50A 3IECA 1UZXB 3FRHA 4FHKA 2GBJA 2NR2A 2I1JA 4DK5A 3AI5A 3QC8B 3ZLZA 2YVCA 4PS3A 3VFKA 2MA9B 1WJ4A 5DFLA 3PTFC 1G41A 3L13A 3PVLA 1RLFA 4E3CA 1UELA 2LVQA 4W9DA 2WZJA 4WWNA 3DBHI 1ZV1A 1LXDA 1UBIA 2KANA 2RPQA 2RD0A 3PREA 3QK0A 1TR8A 2UWQA 1SE9A 1WGYA 3IFWB 1A5RA 5AZGA 2ASQA 1DO2A 2OJRA 2XK5A 4RM9A 1GUAB 3OAWA 3ZNID 1NV8A 3X0WA 1Q0WB 1DV0A 1P0RA 1X1MA 1IYFA 2KFKA 3DVNU 5DPSA 2K25A 5KHQA 3KUZA 2HAKA 4AOFA 2JZ1A 2MBOA 3T9LA 4IWQA 3TIXA 5IAAC 4K7WA 2C5LC 3FE3A 4G11A 4DDGD 1Q5WB 1E90A 3PZDA 2O6VD 1WE6A 2M17A 4LDTD 3DDCB 4N9F4 5DCNA 4GDKB 1QZEA 3V61A 2DENA 1E94E 4ZRIA 2ZCBA 2LVAA 4W9IA 2KHHA 3T8MA 1GC6A 3JSVA 2AEHA 2UYZB 4KDIC 4BFRA 1YX5B 2MBBB 2G3QB 5CHFA 2GBRA 1WZ3A 4GDLA 4GXBA 5LXIB 2WX1A 2C7NB 3ZNHB 4HDQA 2ZNVC 1WR1B 2K8BA 5BO4B 2DAKA 3PRPB 4F8CB 4HCPB 3AULA 4EFOA 2KLGA 2LGDA 2LVOA 3A1QB 4II2B 4JQWC 4MSQB 1WGHA 3MTNB 3QAQA 5G2NA 1R4NI 3JW0X 2JPHA 3LJ3A 4XX5A 1C1YB 4KVGB 3UIPB 2LTUA 3LDZE 3RD2A 4IWOA 1TTEA 1TTNA 2BYFA 2KQSA 2MBEA 2MSED 4DHJB 4LJPB 2D10A 3ZRCA 4ZDVA 2RGFA 1L7YA 1R4GA 1CUKA 1A5TA 1WYWB 2MJ5B 2MBHA 2N4FA 4W9GA 4DWFA 4RM8A 1S1QB 1Y8GA 2JUOA 1EFUB 1TGZB 2LRWA 5D94A 2CS4A 3RYTA 4BBNC 5HKHA 1ZMVA 1WXAA 2KNVA 2L05A 1VG5A 2D3GA 2LGYA 2LVPA 4K1RB 1WXSA 2FIDA 3L17A 1JRUA 1YX6B 3TCAA 1I42A 2EKFA 3HM3A 4BKSA 2R2QA 4HK2A 4B9KA 2JZZA 3WIMA 3QX1A 1IM2A 1V5OA 3L10B 2M4NA 2MBQA 4CYEA 1PVEA 1M94A 3PHWB 2CU1A 1ZGUB 2DZIA 2IBIB 2WX0A 2ZZPB 4GB9A 5EDSA 3AU5A 4GGQA 3CMMB 1NV9A 1GO5A 3R66C 2F4MB 2IO3B 2MQJA 1ZMWA 4XC2A 3K9OA 2GOWA 3VDZA 1VCBA 3VQIA 4CO7A 3H4JA 2EKEC 3N30A 3HIZA 1BT0A 1VEKA 2DYBA 3KVFB 4IW0A 4KV2A 1WXMA 3I3TB 3PV1A 4A20A 5D7GA 2J7QB 2J0JA 2O6VA 4HEOA 1V49A 2ZVNA 1AIPC 2ZPNA 4GDKA 5TR5A 2MP2B 3TBLD 1VQ1A 2JT4B 4FJYA 3D32A 4K7SA 2L0TA 2PJHA 1OEYJ 2L3ZA 4XZ4A 1WGDA 2JP7A 1WX9A 2KTFA 1KYIA 1P3QQ 4TUUA 2KMAA 1WXVA 2Z59B 2DHYA 3KUDB 3VTWA 1SIFA 1WJUA 3V6CB 1RFAA 3JVZX 3ZUNA 4E74A 3A4SC 1PGYA 1P1AA 3LCUA 2L8JA 2WDTB 3ZNGC 3ML9A 4DDID 3VTUA 4URKA 3DBLI 4WP2A 1GNUA 2AL3A 2HJ8A 2DYMA 1MG8A 2ZJDA 4P7IA 1HJPA 3N32A 2ZEQA 3L54A 1F9JA 3PGEA 4M8NA 1NI2A 4HWIB 3RULA 1TP4A 1AARA 1WGNA 2Z0DB 4J6IA 3U8ZA 1WR1A 3EC8A 4KDLB 1WGLA 1YLAA 3B0AA 2FUHB 1PQSA 1IFYA 1XXHE 3AU4A 3WAOA 2LBCA 2XBBC 3ML8A 4IM3A 1NDDA 2MROB 3CF6E 5AZHA 2LJ5A 4EZLA 4G0NB 3UQAA 2RR9A 4A3OA 4B6WA 1XB2B 4BBNF 1HT1E 3WAMA 3M95A 2EMSA 2DAEA 3UGBB 4BKSD 2KFJA 4HCNB 1IP9A 2IZVB 3DVGY 2LI5A 4NAWB 2R0IA 1V2YA 3NS8A 1EF5A 1UGMA 2KDEB 4FHJA 2JY7A 2K6QA 1HE8A 2N9XA 3NOBA 4WJPA 3RZFA 3ZDMC 2MX2A 3PLUA 3H6NA 4GIVA 2DAJA 2RSUA 1VEGA 4IG7B 4NQKE 4NJ6A 1P3QU 3IG3A 4ANXA 4F7ZA 1J8CA 3EECA 3IBEA 5JH5C 3ZW3A 3ZNZB 3HHMA 3CSTA 3A4RA 4DHZB 3B08A 2KNZA 2AL6A 4R71A 2KMCA 5D2MB 2N9PC 2JZ3B 5C1ZA 3TL5A 4M8MA 1WX7A 4NJ7A 5J18A 4NPNA 2JF5A 4MH0E 2K9DA 3ZIMA 1YD8U 2Z0EB 3MHSD 4K7UA 4TKNA 5E6NA 4BOZB 4EKUA 3LCVB 4AUQC 1WX8A 4MELA 4TV3A 1SG9A 3S2AA 4BVUC 2EJSA 2K8HA 4IM2A 5L83A 2JRIB 1FXTB 1Q1OA 3DOWA 4LCDE 2FAZA 2KWVB 2KC2A 2N7DA 4EZKA 1GJZA 2R2OA 1WJNA 2B3AA 2KKCA 2MP2A 3GLGE 2PE9A 4AJYB 4KIKB 1UFZA 2KWCA 5JHAA 2KO3A 2KN5A 2MW5A 1WRDB 2L4EA 3OJ3A 4FJVB 2L4FA 3ONSA 2A5UA 3H7SA 1IPGA 1C7YA 3GOEA 1ZW7A 2FCSA 5D6JB 3WALA 3UQBA 5CHWA 2DZJA 2DI0A 2BGFA 5JI2E 2IY1B 3KYDD 3NY5A 3QQ8B 4HJKA 4RMAA 4IWPA 4DBGB 1OGWA 1WGGA 3PS6A 3SHQA 2J0KA 3SU8X 2QNJA 4DHJD 4ZRJA 4UN2B 2NS5A 1VEJA 2OOBB 3WANA 1P9DU 4Q7JA 2DZMA 3VUXA 1OAIA 2NBVB 5AZFA 3W1YA 4FA6A 2N1WA 2RRUA 2C60A 2L0FA 2DYOA 1HT2E 2K0BX 2GBNA 2KJ6A 3VAWA 4BOSC 2IO1B 4JLCA 1ZKHA 3ZO5B 3VXWA 1P98A 2KZRA 4EUTA 5FR6A 3M63B 4WAAA 4WWOA 5DPTA 1V86A 4PS7A 1WM3A 3KH0A 2KDIA 3ENEA 2H5XA 4I6NB 3ZDTA 3DBSA 4II3B 4WJOA
chains in the Genus database with same CATH superfamily
1K61A 3BROA 3L4PA 3LW5F 1V81A 3ZYYX 3MZ8A 1I3QJ 2DPUA 2G5GX 4I02A 1O3TA 1TBXA 2K3PA 3C18A 2BF8B 2COBA 3OSGA 2MCNB 2N7EA 4ETSA 5IT9S 4NZLB 1WFXA 3OL4A 2UXXA 2ZXWH 3HU3A 3V8KA 3LL7A 2O0YA 3QJZA 1VDDA 1N60A 1O4XA 1YQBA 2R7OA 1GV5A 3D0SA 2MR9A 3HVDA 2M30A 1RR7A 1F2RC 1XHBA 3T5XA 2L7RA 5F08A 3DFGA 1SFKA 2XROA 3VRBB 2RDPA 3GTQJ 2DFFA 4YFXF 2RMMA 3CJTB 2NYXA 1WZ0A 1K3WA 1K8RB 2VT3A 1VFCA 4QNRA 5ITRA 1HSJA 3ZRFA 3AB5A 3J7BA 4BLCA 1W36C 4IL6C 3S15J 1IRZA 4RF0A 4W9CA 5ITXA 3UIOB 2KA6B 2TRTA 3B6AA 1JJ6C 3KP0E 2X48A 4E7IA 2GLOA 5G55A 5EEGA 2O01F 3TMPB 4KUMA 2WAQA 1KZHA 5BPDA 4LF7M 2GMIC 1AW7A 1WCMJ 2HXIA 3H1UA 5ED4A 4GKJM 2P5KA 4LFUA 1V6EA 1I35A 3RI7C 3QPSA 1IGNA 3QP6A 5J40A 4JL9A 4MGIE 4YG2F 1N5XA 1KQ9A 2EINH 3HX3A 3A46A 4IEJA 2EIKH 3TEWA 2DJIA 3FD9A 3GRVA 5DYGA 4JI2M 1I27A 2QBYB 4B7GA 2QP9X 1BA5A 3O6BB 3RCZA 1XXHA 1W0TA 3QYFA 3A1YA 2C96A 1O7FA 3JSVB 2LBFA 5CVRA 1RRBA 2MH2A 1BC7C 4J3OD 2NPTA 3U6SA 1Z6RA 3Q9SA 1YIJI 3PT2B 4XRSA 4BY7J 2XGNA 4FTHA 2INDC 4GU2A 5JZEB 1K79A 3SR6A 2QHOA 3RKWA 2EKKA 3FHNA 2KNAA 3PRZA 2QDFA 3NWLA 5J8FA 1MJBA 2O2VA 3T15A 2KJHB 3LSTA 2BS2B 3BLYA 4UVBA 2JJ7A 2R5YA 4IXAA 1UZXB 5B1AH 2KKOA 5J1RA 1OYIA 1UZCA 3ZJUA 5F0HA 2LVQA 3LQQA 2GOXB 1R4NB 2QIEB 3IP4B 1DO2A 1DPRA 3J81K 2QQ9A 5GPCA 2BS3B 2QA4I 2VQHA 4ABZA 5IAAC 2F5EA 2C5LC 5FTKA 2DHRA 2M17A 2KZSA 1KQ8A 1PJRA 2ZCBA 1HNZM 1YLFA 2W00A 4Q2JA 1SXTA 3ZN1A 1YX5B 4HKQA 3CF0A 3I57A 3PZ7A 2J5PA 4A3KJ 3ZMVA 4HDQA 4M01A 3Q6BA 4FHTA 4I8OA 3OG5A 4NC7A 5D6FA 1L7YA 5ITXE 1WYWB 4GIPA 1OCRH 1XLPA 3IWZA 5JVTA 3RYTA 2PFBA 1TT5B 3GLHA 3KZYA 2L7IA 2DA2A 1NEKB 2XF6A 2P0WA 1PVEA 2CU1A 1TQIA 3VKHA 3N1XC 3SJMA 5M3FJ 2WXKA 4D2KA 1UG2A 2PTLA 2MP2B 2JT4B 1X58A 3SZGA 4IIWA 3JR5A 3ZUNA 4E74A 3LCUA 2L8JA 4YTNB 2AL3A 4KT0F 1SD6A 4M8NA 3OL3A 2IGOA 1AARA 2LEKA 1B59A 1XXHE 1R6RA 1TWFJ 5AZHA 2LJ5A 1E3PA 2L01A 1YHQI 1DOIA 2M0MA 4KNYA 1Z6TA 3Q8AA 2EMSA 3L7WA 1E7PB 4XKBA 3NBIA 1FD6A 4MEYF 3EUHA 1LQ1A 2KMMA 4GIVA 4IBEA 2KIMA 3BXWA 2CYYA 1E32A 1AWDA 3IBEA 4YTPB 1J5YA 2ZXJA 1G3WA 3A4RA 3S3MA 4DHZB 1Z5AA 2KMCA 3VSLA 2KACA 2ICWG 1D8KA 3LXFA 2H6CA 2HDCA 4G6TB 2JXTA 3UZUA 4DV4M 1FBQA 5LNK1 2NTSA 2EJSA 2R0QC 3J7AO 3DOWA 4ZOHC 1I4GA 2KO3A 2GQQA 2XDVA 4XKWA 3S1RJ 1W7PB 2Y0TA 1C7YA 1ZW7A 1L2CA 1R6BX 4ZRJA 1VEJA 1SD7A 1OAIA 3A98B 4CYCA 3CWIA 3NRVA 1TS5A 2JA5J 4MQVA 3VXWA 2XNAC 5E79C 5CVJA 3N1ZC 3L16A 3GF2A 5DTDA 3M3YJ 4MGKE 2G1EA 3WTZA 1L3LA 1Z67A 4ICVA 2CHQA 2GXAA 1T43A 2WNMA 3DBHB 4BNCA 1UM8A 3K2AA 3H3VK 2V9PA 4KYWA 1MSEC 5GKNA 1HKSA 2MSYA 4Z8XA 4B08A 1FNUA 3GLHE 3Q3MC 4A12A 4BH9A 3VH4B 3BR3A 1VQNI 2Y31A 3OV8A 4NJCA 1G6JA 1XCQL 4OW0A 1VRAB 4JN6A 3Q8FA 3EUB2 4UHTA 2WXGA 2JSVX 3ZQHA 1TYGB 1J75A 3RIRA 2BYVE 3CP8A 4JI0M 1ETVA 1ENHA 4FE7A 1MN3A 4MTEA 3ZXVA 2XGCA 3AE9B 4RA2A 3MP9A 3QWZB 2IPQX 4J01A 2LASA 1ZOYB 2K3FA 1C0WA 3HZJA 3CJQB 3T6PA 3RZWC 2W48A 3ZGKA 3U4EG 1USSA 4CCNA 2JK3A 3A42A 1O3QA 3A02A 2M1MA 2YEPB 1WIVA 2WC2A 3GS2A 1WY8A 4DV5M 3ECHA 3OYEA 5GP9A 3HOVJ 4B43A 3BBZA 2D11A 1W36D 4ZRKA 1ZQ9A 2R92J 1G3IA 2E7XA 1ROEA 2HVRA 1BM9A 2DMQA 3G71I 2VKHA 1D5VA 4NBQA 5E1XA 1BW5A 4FT8A 4U88A 3I64A 4DOZA 2R7WA 2PPHA 1NENB 1TWHJ 2NOGA 1VD2A 3TEXA 3HHZA 4B0EA 3GLIA 3AEDB 2CHZA 1S7EA 4HF2A 4KGRA 1XDSA 1OTRA 1VQ9I 1ZP0B 2GBKA 2BOLA 2WB1N 1Z5CA 3K1PA 3Q8EA 3CCSI 2DT6A 2K9LA 1IV8A 5MPOA 5D5VB 1FSEA 3DPUA 3FK6A 2DWNA 3R3MA 1D5MC 1VNDA 5IZ7D 5GMVA 3BIID 2K9MA 3GTGJ 1YX3A 5HHDG 5J8CA 4IJAA 1KLGD 2KD0A 1LVAA 2CWEA 3K4CA 5E20A 2LRDA 2XB5A 3HRUA 4YXDB 1WM2A 5J6XA 2O3FA 1OCTC 1STZA 2P5TA 5HNHA 2HEOA 4PJLA 3VOEA 1SAUA 4II3A 4K3BA 5IOYA 2LG4A 1DQUA 1FXIA 3UGJA 2Y0QA 4R79A 4RM9A 3OYIA 3RI4A 1SB3C 3K0LA 2E1MC 3HOWJ 3DVNU 2CS3A 1FPQA 4G11A 5FLXZ 3ONQA 2R61A 1G8XA 5HS9A 3LQRA 1EM7A 2L4AA 3GTKJ 2ACJA 1FC3A 4BHPA 1ZPSA 2I8DA 2GLSA 4M0WA 1WH5A 3I5UA 3MN2A 2LGDA 2CQ7A 3EETA 4IHWA 4PDGA 1M4VA 2IS4A 1ZREA 3IH3A 3F23A 5DV5A 1PFDA 2WXLA 4W97A 1IW7F 3CUQC 2OTJI 1CQVA 2MBHA 1XNRM 1O3SA 1S1QB 2VJ5A 3S2HJ 3D5RC 1WXAA 2KIQA 5CLSA 2KPMA 1TKGA 2D45A 2G9HD 1MNMC 3W68A 3AU5A 3Q14C 3Q0WA 1REPC 4ZYSA 3ECOA 3I3TB 1V49A 3T3NA 2V3NA 2M4KA 3CJNA 2L3ZA 1XMXA 2QYOA 1R7JA 4BJTA 4AIJA 2J52A 1ETWA 2ZFWA 2ZJQF 1FYLA 3U5ZB 1WJDA 4GHLA 1OQQA 3PGEA 3W3CA 3ABUA 4YSYB 1WGLA 4HNUA 3EDPA 3HTSB 2WXOA 5F04A 2F5OA 4F91B 5IPAA 1IG7A 1EH6A 2JT1A 4NQWA 3NS8A 4E7ZA 3KDSE 3PLUA 1JUPA 3LA7A 1QVRA 3EGRA 4D80A 4Y33A 3EUKL 5LLQA 3CCQI 2FOIC 4B3SM 3ZNZB 3MD2A 4PZJA 1WZ2A 4AWXB 2ONQA 1DP3A 3JRGA 3S2AA 5CQGA 1T39A 5IO9A 5DUIA 2APLA 1F9NA 4XOPA 2UUZA 4P16A 2FD5A 4RLQA 4XLAA 3CMEI 2FCSA 4DR2M 4G4OA 2KQRA 2J0KA 3C2HA 3JRBA 3WANA 3FF5A 2IS1A 4HL4A 2N1WA 2DYOA 1HT2E 4RB2C 3D5SC 1EIJA 4EUTA 4LNIA 5FR6A 4P17A 3Q8GA 3JRCA 1NSFA 3LSPA 4II3B 1DGHA 1UWMA 2IW5A 2NCNA 2BHZA 3MKWB 5C18A 1TF0B 4M73A 3DQVA 5EG0A 2CRGA 4KZCA 1POGA 3CCUI 1V9JA 3T3OA 1I4RA 4N0BA 5HODA 3BJOA 4WWPA 1PUTA 4CDGA 5GTHC 1VI0A 5ILVA 3EUAA 4MGHA 1I6XA 2LD9A 1JWSD 3VLFB 3URYA 2MRPA 4AI6A 2AWTA 1UD7A 4I99C 1V80A 2O8XA 2XVCA 2F4IA 4QIWN 2DQLA 3DHHC 5M5WJ 3BC8A 1D0ZA 3V60A 2R7FA 2VH2A 3M8FA 2DZNB 3PHXB 3SD5A 4K0KM 1Z5SB 1Y0NA 4A0ZA 1HTQA 3MCZA 3E6BA 1XN7A 2OA4A 5E1ZB 2VJ4A 3LNQA 2PVGC 1WYGA 4AM3A 1UF0A 3GLFE 3CCRI 5FR3A 2L9VA 1QOFA 4FULA 4I7HA 3RGSA 2A6EF 1OKSA 1KF6B 1Q10A 3HHWA 3G73A 3AL0B 3WAPA 1MU5A 1MMNA 5HLHA 1GVDA 2DZLA 3G6EI 1RZ4A 2YQZA 2CEAA 1T0QC 1YOVB 2X51A 1PJJA 3OSFA 4RFBA 4NNJA 3MKYB 2EFPA 3U6EA 4RLFA 1QOGA 2LOOA 1CQTA 3W9CB 2VC1A 2KFKB 2C9CA 4ZRPA 3KP2A 3VHTC 3VUWA 3AFHA 1T0YA 3W2VA 2VE9A 1QAQA 2YLMA 1KGSA 3H1CA 3J7YJ 1FJLA 4HPPA 4YHHM 5FKLA 4FCTA 3L0WB 5D5XB 1KU9A 2DK5A 3GE8C 3RKQA 3BPVA 1WI0A 2DHZA 2E36A 3A9KA 2KDOA 2EMTA 1MVKA 5CVUA 3K4NA 3R61A 2D7HA 2RKOA 4MSMB 2K6DB 3IV5A 4WAFA 3KX2A 2GBJA 4D5CA 1JKOC 3QC8B 3JAMK 2W24A 3J81Z 2L7FP 3TEDA 2Z7JA 1YS7A 1SE9A 1VTNC 1MW7A 4AUXA 3ZMDA 4U7BA 3TIXA 3HEFA 1R71A 2VODA 2DA3A 2KT0A 1IXCA 4AKIA 1GPXA 4XN0A 1F43A 2Q2EB 1U78A 1NHGC 2KJCA 1G71A 4NDLA 1XTAA 1B6AA 4EFOA 3FUWA 4MSQB 1Y1VJ 2JVGA 3BYTB 1LFUP 1C1YB 3UIPB 3WU2C 2ZMEC 4O1NA 3B7ZA 4LJPB 2FBWB 1E17A 3DHGC 1KU7A 4ZYAA 2XEPA 2L05A 2QPAA 1I42A 3NAUA 4BKSA 3OYNA 4BBAA 4HK2A 4B9KA 4RB1A 1HZ6A 4GGQA 4TV7A 1U3EM 1GO5A 4XC2A 2QVOA 4ENJA 3HIZA 2GXBA 1T0SC 3KVFB 5KPTA 1P7FA 4L9TA 2ZPNA 3IT6B 2HVQA 2XAFA 1QA6A 1YTYA 1R7SA 3ZQLA 1W5CC 3V6CB 5BMGA 2Q1ZB 2NS7A 2OBPA 2WAQN 3N32A 1T08B 1HC8A 1FWZA 4YT0B 3B0AA 3WAOA 3J7AS 1MI0A 3FBIB 1XPXA 4BKSD 1QHGA 3ZRGA 4XIDA 1YN3A 3I58A 4LLGM 2LKPA 1R7RA 3NOBA 3ZDMC 1P6RA 2HI3A 1BXTA 2N9PC 5BYRA 4CZCA 1LEAA 3K7AJ 1BR4A 3BG5A 3Q69A 4TKNA 2KDMA 3SEQA 4G7HF 3HHHA 3MHVC 3J7ZI 1MNEA 3H0GJ 3QYBA 1JKRC 2CW0F 1OIZA 5D8LB 5HI1A 2KRKA 1I6HJ 1YO5C 2CUEA 3ONSA 2P5VA 4UXNA 5HDGA 2HXOA 4L9JA 5IT9K 3A2KA 1PGXA 3RCOA 3VAWA 3VYSB 3GRUA 3ELKA 3PUBA 3ENEA 4I6NB 2K22A 3RNBC 4L18B 1C4CA 2XF5A 3ZOBA 3PSFA 3B6CA 2DAGA 3CTWB 1ZGAA 2JWZA 2XSDC 3O8GA 4ESJA 1N32M 2P81A 5CVVA 3TBIA 1L8QA 3DEUA 2IEKA 1I39A 5FLMJ 4NSRA 2CKHB 4B3AA 1F0ZA 3K9PB 2BTEA 2JY6B 2G3QA 4I6PA 1I1GA 2XAJA 4A0YA 3HOTA 3HXLA 4JI1M 2JA7J 2OTLI 2PMUA 5IYDJ 2VF7A 3DCGA 1BVSA 1YQAA 2KTRB 5ICGA 1FFUA 2N9KA 2LZ6A 4HDVA 3SC3A 4BBRJ 1PUFA 1N61A 5LRRA 1WKMA 1S6LA 3HYIA 3IAS1 3TQNA 3OYCA 2LR8A 3OLMD 3C8YA 4AVZA 5GADJ 3OYMA 3RNFC 1V5TA 1E0ZA 1JT6A 2DWQA 4DYCA 2JY5A 2HR3A 3U60B 4RGXA 1T5XD 3ERMA 2O61A 3CP2A 2EA0A 5DD4A 3C2BA 3H5AA 1LFBA 2Y69H 2YNMD 1J2XA 3V4GA 2RGOA 2HE7A 1JB0F 2HNHA 1QVUA 4ZDOA 2INNE 1IXSA 5AUKA 4DZJA 4AWJA 1MJDA 4EJWA 1IBKM 2KDZA 4QAYA 4IBFA 1JWAD 3I56I 3I63C 2IA1A 4WWCA 1G6NA 1T33A 1WGXA 4Y15A 4G3OA 3K1NA 1PM5A 3DVGX 2FUG2 1A6IA 2CWBA 4JV5M 1E2XA 1TC3C 3E5UA 4HW0A 3MAJA 1IV6A 5E3OA 3ZQJA 4YRVA 1QT9A 2KRFA 3LYYA 3DF8A 3DWGC 1ZXIA 4I2OA 5LEJA 2N1VA 1PGAA 4KZ0A 5D4RA 4G6DA 3G2BA 5IWAM 5EDNA 2BKFA 1FYMA 2JX5A 1C4PA 2Z9OA 3BZ6A 2XZFA 2IS2A 5KQDA 2CFOA 3P2BA 2N0SB 2PEXA 5C4XJ 4EQQA 2BWES 3GPXA 1ETXA 4GKKM 5L3CA 2B63J 4YTMB 4NRVA 2NR2A 1KSFX 5FSWA 3OWTA 1TDZA 5ICFA 4PFPA 3WTUC 4ZDPA 1RLFA 2L52A 3PVLA 2WZJA 2XFTA 3FMRA 4XNFA 2G7UA 1JI8A 1ZV1A 2CQQA 2D7GA 4BU2A 4YSXB 4RGUA 1DV0A 4RGSA 3VRAB 3QRFF 3P7NA 3V3XA 3KOXE 3ASNH 5E18F 2G3QB 4L5IA 5CHFA 2MGQA 3AM9A 4E6KG 3IAM2 2QJLA 5JVGF 2SAKA 1DOXA 2WX1A 3BTCA 1VR9A 1MDMB 1LTMA 3H92A 1BOAA 2DAKA 1UCRA 4DZPA 5C3JB 3SFIA 3KSJA 2KLGA 2DA5A 1R4NI 2HDEA 1QZMA 2MEKA 5J1UA 4ANJA 2MSED 4DHJB 3FZVA 5D8KB 1PGBA 1OMIA 2I5UA 4I6ZA 1EFUB 5E6JA 2X6OA 4M00A 2YR0A 3CF5F 1YITI 3SHFA 2FMYA 4Y17A 2EKFA 2P5LC 1DOYA 1XF5L 1T0RC 2ZSHB 2IBIB 4O3MA 4KHPM 1I1SA 3N30A 1PJIA 3E9SA 1BL0A 3C3DA 4GDKA 3FTCA 1G3TA 3D32A 3HRSA 1WX9A 2DHYA 4U0YA 5IT3A 3A4SC 1PGYA 3HUGB 3ML9A 4URKA 1GNUA 1HJPA 5KCMA 4A3BJ 5FKAC 1NI2A 5TSSA 2MH8A 1TP4A 2MROB 4LB5A 2RR9A 3NQOA 3M95A 4HCNB 3V05A 3AMZA 2R0IA 1TH2A 5E1WA 1HE8A 2N9XA 3QPLA 3NUHB 2CW7A 4NQKE 1IUEA 2XPUA 1ODDA 2DBBA 4HX7A 1IJWC 2WLBA 4B7HA 2JF5A 1YD8U 1VF9A 2EH3A 2XPVA 4AUQC 4MELA 2A69F 2K8HA 5L83A 4G4RA 3KVWA 2K6BA 1ACIA 4EZKA 5JI6A 3TW6A 1C79A 4HJGE 1WWXA 3R0AA 2KN5A 2L4EA 2AXLA 2JPCA 4MTDA 4HSRA 5D6JB 2KP6A 1USTA 4LZJA 3H3ZA 3DKXA 4IWPA 1HDPA 1RNLA 3VB2A 1DGGA 2NBVB 2J53A 4REZA 2KJ6A 3S16J 2K0BX 4QNMA 4C7ZA 2W1OA 2AHMA 3ZO5B 4ON0A 3N20C 4PS7A 4KN4X 2H5XA 2HYGD 4WJOA 1T56A 2Q0OA 2DOAA 1JJ8C 1JWBD 2NRAC 2DFIA 3WTWC 2Y30A 2RVCA 2JU6X 1IBLM 2VOPA 4MT5A 4IO9F 2BEOA 3NS1A 2HOEA 3CF2A 2ZM6M 4UDUC 1D0LA 3K4LA 3MFGA 1YJNI 1T3TA 2MWSB 2RGVA 4KFCA 4WF2A 4KIKA 5HFYA 4G4NA 4L9VA 2DFHA 4JWSC 1TY2A 2CUZA 1NI3A 4HV5A 1O57A 3GVAA 3M3JA 3GRYA 3C3EA 2WXQA 5L3FA 3NJTA 4AG6A 1JWMD 4EE2A 1FJGM 3EQLF 1FSHA 1O3RA 3OMYA 2DT5A 1JW9D 1J5EM 4RF1A 4FN2A 3ULQB 3AEBB 2NMQA 3T0YA 3NRZA 3W2WA 5LMUM 1XO3A 2REXA 4GSWA 3O65B 3GFLA 1YFHA 4E71A 4UV9A 3W0LB 1Q1HA 3CIRB 2VZKB 4WXHA 4XMYA 3KLNA 4PGGA 3HM6X 2R93J 3C7JA 4PJ0C 4B3MM 2UV1A 5LXHA 4CICA 5DD8A 3UR3C 4XLFA 3H5RA 4US8A 1T2KA 5KHOA 4OHJA 2GXGA 1JKPC 2LGXA 2PG4A 2K39A 4V19K 3HVZA 1BC8C 3NWTA 4OZBA 1QOAA 4DQ2A 1V5EA 1WMHA 2RREA 2BB6A 4QOZC 4L16A 3UMMA 1E5WA 2C7HA 4ICUA 1JRPA 2ZBKA 1H8CA 3H9JA 3P1MA 3X23A 4B7FA 3WGIA 4IRHA 2A3SA 2J5OA 1VQ5I 4BQOA 2W55A 3QWLA 3G1LA 1WJFA 3I01M 4C80A 2LD5A 2LHGA 1RYJA 4PUSA 1IDZA 3EIHA 2M8SA 1JTYA 3JAMZ 3A0BC 2XAQA 3WE2A 2K86A 3ZLZA 3QQAA 4XGAB 4PCQA 1J7CA 3CCYA 5FKKA 5KPZA 1X1DA 3I4NJ 1D0MA 1GV2A 2RD0A 4U87A 5AZGA 3L29A 3OAWA 2VBXA 2KZUA 2BBCA 2K25A 3LSHA 3JREA 3T9LA 4C4VA 5E3NA 3HTUA 2VIIA 5D4SA 1E94E 3PO3J 3CGWA 3BQZA 2G0EA 3RMKC 3KOWE 3GB1A 1BOBA 4GXBA 3FKEA 1WI3A 4BB9A 2BW3A 1SE2A 5BO4B 1MZBA 3QAUA 3MTNB 3QAQA 5G2NA 2JWSA 1BIAA 4Y4RA 4LGMA 1TTEA 2D10A 2FQ3A 3ISPA 1V1OA 1RUNA 3K2ZA 4BAXA 5FTMA 3PL8A 2LVPA 3FILB 2E34A 1F1ZA 2F5DA 3TMOA 3QX1A 1TS3A 4ZDLA 4KITB 2MBQA 2WX0A 1FBUA 2FE3A 3GO5A 3J2PB 3VDZA 3H4JA 1J9IA 3SMPA 1XC5A 3CQZJ 4HZFA 1ORKA 3PV1A 2JQ7A 3JRHA 2LY1A 1DGJA 3R2IA 4GMQA 5HLGA 2X4AA 1DGWY 1QILA 4NSOB 2PJHA 4CUGA 3P42A 1SVMA 1KYIA 2KMAA 4BQNA 1QZZA 1G8PA 2RV8A 2W25A 3OIQA 1FCLA 1YW8A 2ZEQA 3L54A 3KFUG 2LYCA 4B09A 3A01A 4RM3A 3RNCC 2BS4B 4J6IA 2TCTA 4LLLA 1BJZA 2R44A 3SYKA 1HT1E 4NAMA 1X1CA 3K4JA 2M34A 3CDIA 2IZVB 2WP9B 2I2YA 4OAYA 4FWDA 4OMZA 2MH9A 2X1EA 3GPYA 3GE3C 2N35A 4OU7A 2V1XA 3GMEA 4GLSC 3SFZA 4EJOA 3HGGA 3TL5A 2ZBKB 2CJJA 1GB4A 1SMYF 2KDLA 4UVAA 3KOZE 4HQMA 4KMUX 2YUSA 1WJNA 2K0PA 5LBQA 2V6CA 2QSDA 3GLFB 2HOSA 3EFCA 4FXCA 1WRDB 3OJ3A 1B1ZA 4JPSA 2L4FA 3FXJA 5IT9Z 2V79A 3P63A 3WALA 4KX6B 3G1OA 4I81A 2KJBA 2VBWA 2R6FA 4EM2A 2IY1B 3KYDD 2Z4RA 3SHQA 4HKZE 1DDNA 3LFUA 3PS6A 5FKMA 2M1BA 1S9HA 3RZDJ 3ZP5A 1XXGA 3TWKA 2ZFUA 1V86A 1NY6A 1N62A 4M6XA 3TJPA 2CV1A 3R7QA 3FRIA 4IBBA 5EXTA 1IDYA 2HL7A 1RC9A 2VJIA 3K92A 2VXZA 1UHWA 5J17A 3W6VA 3ZQQA 2ERCA 2MGWA 1J59A 5EZHA 5IYCJ 1SFUA 3GZ5A 2JXXA 3SATA 1XSXA 2FCQA 4W9LA 1MBHA 3PO2J 3HWSA 2MLBA 1NHAA 1OCOH 1CMXB 3RSNA 3ZTDA 3K1JA 3HHYA 2RKHA 3A9JB 4OVUA 2C9OA 4MEMA 1NG7A 2OOBA 1KJTA 4CA0A 3RJPA 1FFVA 2J4XA 3HGYA 4ENMA 3TPZA 2V4JC 3DP7A 4XM3A 3Q0VA 1I4XA 3WGHA 4HPMB 1YMHE 3E3VA 1XMQM 2Z4SA 1LEBA 4RGTA 1S3SG 5T8IA 3K4BA 4BQQA 1OFHA 1MBGA 1R1UA 2KX3A 2BJVA 3P9KA 1RM6C 3T38A 3C2GA 4RMNA 4RCOA 1U9OA 4IQJA 3VVWB 4MGRA 2QMTA 4LOCA 4LDTB 1FOYA 4HYEA 3FUXA 2D1HA 2ZNYA 2GRIA 2VRRB 2JNHA 5KK1A 3IG8A 3OS1A 3S93A 3FTEA 5ILUA 1W5TA 4OZCA 5C2TB 2EIJH 3H7PB 5M3MJ 3G3ZA 2MJDA 3KP1E 3EFUA 3HKPA 2V1DA 2ZTDA 1WXQA 1S3JA 4PS8A 2OHFA 2L1AA 5DYMA 4BDZA 1D0XA 1B8IA 3PFYA 1U4AA 2CHVA 1SFXA 1XT9B 4OVVA 2HKXA 1YJ1A 4ZHPA 3LAJA 3MZYA 4JI6M 2ZW1A 1PUEE 2A6HF 5FFXA 4XKCA 4HDOA 2LVOC 4GRIA 1LQBA 4C3IJ 3OYJA 1NO1A 2EA4A 4DUZM 3TDZC 1TWGJ 3ZKJC 2GNOA 4LD5A 3PZ8A 5DPRA 2INCC 4UUSA 4LZZA 4MEXF 2PX9A 4C2UA 2VOOA 5B1BH 4A5NA 4L78A 3FXLA 2BYTA 5DUKA 4JI3M 2AYOB 4W9HA 2VC0A 3U1DA 2QLZA 2W82A 3V42A 3K9TA 4PS3A 3VFKA 1GB1A 1F1HA 3ZQGA 2DN0A 3FTDA 3W5VB 3R60A 2X8XX 2GWRA 2DO7A 1FTTA 4IVNA 2ID3A 1A5RA 1A5JA 2XK5A 4M9XA 3X0WA 4DV0M 2WB1A 2DPDA 3IRRA 5HOOA 3WTTC 2HAKA 1KFVA 1HA8A 3HKZN 3K4KA 2KISA 5EXSA 1WE6A 4RAZA 4K3CA 5CVIA 1R2ZA 3HU2A 1OAOC 4X66M 3BWUD 1XCVA 3PQKA 4PFOA 2OV7A 2UYZB 5BMHA 2GM4A 2UXNA 1SF0A 2UXBM 1HXYD 5K5RA 1YUBA 1JT0A 4HCPB 3AV0A 4JQWC 5HDKA 3ZXSA 2V6EA 2LTUA 3QP5A 2G7HA 3CTAA 4ZDVA 2RGFA 1R4GA 1A5TA 3TEYA 1U2WA 1NJFA 5HKHA 2DA7A 3L2UA 4K1RB 1WXSA 1KFYB 3PHWB 3W5UB 4GB9A 2BNKA 2JSPA 2BW2A 4YY3M 3CUQB 4BHCA 5D7GA 2UXDM 1VQ1A 1PRBA 4XZ4A 1XSDA 2WY7Q 4QPQA 3KLSX 1LB2A 2WDTB 4DDID 4WP2A 1XMAA 3IXSA 3G1MA 1Z77A 1MG8A 2A61A 1Z7LA 3W6JB 1OJLA 4HQEA 3RULA 2DI3A 4BE2A 2VONA 1MJGM 4A3VB 1BW6A 3KW6A 4Y7NJ 1ZG5A 4PJJA 3JRFA 4EZLA 4QOSA 3GLGA 1XB2B 4G94A 2BY0A 2PMZA 4GYIA 3VDUA 1IBXB 5FRMA 2DCEA 2JRTA 2Y3AA 3F6VA 2M0CA 5E17F 4F7ZA 1QPIA 2UU9M 2R7QA 4NJ7A 5J18A 3ZIMA 2K9DA 3TE6A 4A0XA 3KCCA 3JRAA 5E6NA 3VK8A 1LGRA 4D82A 2H1RA 2LNHC 4FWGA 2KIFA 1FXTB 4AJYB 3FTFA 3L2RA 5IN7A 3JSOA 3VH3B 2R5ZA 1X4PA 1GL7A 4F3QA 1F77A 3FBNB 3Q8CA 2STWA 4FCYA 5CPRB 5AZFA 3W1YA 1P2FA 4IJEA 2WTEA 2F5QA 5EXXA 5FLXS 1OKRA 1E0EA 4KGSA 1K78A 5D5UB 1CZPA 4IPAA 4LMYA 2Y0MA 4WWMA 4PDKA 1FO4A 4G12A 2YU9J 3F8BA 3U2SC 4MH8A 2H94A 2E7WA 2A68F 2FNJB 1JXSA 1TW2A 1RFKA 2ESHA 2JZPA 4NQLB 4A6DA 1VQPI 2OC6A 5AONA 2RNGA 3H9GA 3TOAA 1J7BA 1C9FA 2CP8A 3GZNB 3KP6A 4W1UA 2JYEA 2L9RA 1VZ8A 2Y2ZA 5IP4D 2ACZB 2RAEA 5H6QA 4H4KC 1TIFA 4I0BA 5LHGA 4FW9A 3HJ8A 3E97A 4YELA 1WF9A 1A04A 4J19A 4ARCA 3RNEC 2FU4A 1KYZA 5IYBJ 4OVZB 4GN1A 2R45A 3IUOA 1KOTA 3FXRA 1JE8A 1VQKI 4TQ0A 2BY3A 5DEQA 5C44J 2WXPA 1ZMUA 4HV6A 1HOMA 3ABTA 3HRDD 3ZQCA 2XEWA 3SMSA 1AOYA 5E26A 4BXUA 3HOXJ 2AO9A 4BUPA 3QA8A 4B95A 2Y9YA 3NZUA 1C4AA 2M7BA 3ABKH 4HLYA 2E60A 4Y28F 5G5GA 3VWBA 3U1KA 2I1KA 4IUMB 5KPRA 1WFYA 3QPTA 1WJBA 3VODA 5E3MA 3JYUA 4M74A 5M5YJ 1K83J 1J19A 5DS9A 3KSXA 3ZC7B 2FNAA 3L2VA 1Z2MA 1FOXA 3OIOA 4XLCA 4P96A 4ZZLA 2G45B 3KEQA 2YR2A 3RGPA 3RKXA 1VQOI 4EMSA 4G9YA 4OZAA 2QSGX 4RAYA 2PJRB 1TQPA 3RT3B 1FIAA 3HGIA 3B89A 3DTIA 3JCUC 2OEDA 3TOBA 3FYCA 1YIWA 1IO2A 5GAEJ 2FIFA 3MJWA 3UI3A 2DX5B 1JHHA 3QHTA 4XICA 3UKGA 3GX4X 3IHPA 3W1SA 1OCPA 3AH7A 5FO5A 5LHIA 2R5ZB 5LGNA 4HF0A 3J9CA 4HNVA 1P92A 1X2NA 5LFAA 3MKZA 2MA9B 4BQAA 5A2QS 2H1KA 1NYQA 3AG1H 1K78B 5L3GA 3D5LA 3GTOJ 4W9DA 2CG4A 1ZTRA 1HDDC 4ARIA 2KHMA 1LXDA 1D5XC 1IN8A 3GLXA 2LFIA 3FM5A 2HPIA 2OJRA 2HYFA 1R5HA 1T6BX 2QBYA 4B3XA 4RNAA 4DDGD 3DXJF 4ITQA 3HBLA 2E3TA 4A9AA 3WTXC 2KHHA 1V5FA 5F0CA 3JSVA 3GCMA 3EUHC 1WZ3A 2BVLA 3KETA 2OF7A 4QPOA 3M6AA 4JE3B 5EQTA 3HUIA 3M4OJ 3W0FA 3F21A 2HWVA 2JA2A 5IKCM 4XK8F 1ET9A 4H0EA 3BCAA 4AIKA 1NVMA 1TT0A 4W9GA 3H3UA 1Y8GA 2CS4A 3ZMUA 2KNVA 1AKHB 2IJLA 2HU9A 2VLAA 3GP7A 4ITKA 3GPPA 1T6SA 1I94M 1OYYA 4TUWA 3GXOA 3CMMB 2ZMEB 5FLVA 1BT0A 3GTJJ 4B8XA 1Y56A 3AOEA 2J0JA 2O6VA 3VKGA 3KYLA 3R8BA 2BBYA 1OEYJ 2Z59B 1RFAA 1YX5A 1SEBD 4P7IA 2WDQB 5DM6F 1F9JA 4JX5A 3HRMA 1FX7A 1K52A 5IOZA 1UG0A 1XC8A 2XBBC 3T8RA 1EU4A 1FCCC 1STEA 2V4IB 2O8KA 1AWCA 3KYCB 4P9FA 1ON1A 4X65M 1JR3A 2YPRA 2K3UA 5ICCA 2E2HJ 2RGHA 4HEA2 1SJHD 1NHWC 3QOPA 3HIFA 3E5XA 1TWCJ 4R71A 4LB6B 2JZ3B 2HOTA 3R6SA 1WJ5A 5EP2A 2MD5A 2JZYA 1SIJA 2MP2A 1JALA 3J81S 5JHAA 4BS9A 5F1JA 4JX1C 1K3XA 1KYWA 2BVMA 4HA8A 1IN5A 2DI0A 1BBYA 1WGGA 1JR3D 2NS5A 3R2TA 2YX4A 4LK0M 4AYBA 3ABMH 2PMVA 2MJ3A 4IJFA 2L00B 1WRJA 1LE8B 2V1CA 1LKXA 3LA2A 2CHXA 3CSFA 4A90A 5DPWA 2QQ8A 3F22A 1K50A 5JI3E 4FBJB 3DBRI 3C0RB 4R7GA 5E8GA 2GI9A 2R4EA 1PDNC 5HS7A 1N75A 4J00A 3DKYA 5LLIA 1HKQA 5LGTA 4BE1A 4HLEA 2OCEA 2D3BA 1UUPA 1W7PA 3DHIC 4CXFA 1V34A 2DAMA 3VDXA 3PRMB 1H88C 2W54A 4GEWA 4CCMA 1QYRA 2LRUA 1SXJA 4IBCA 1C1KA 2XSJC 3CO7C 1ZN2A 5L3EA 3WTVC 3ZQFA 3U6DA 1X37A 2WQYB 2OU2A 4BAYA 1GHCA 4HSTA 1YQ4B 3I71A 1TH4A 4XN3A 3C58A 5K5OA 2P8TA 1B72B 3N3KB 1TS2A 1D1CA 3BVZA 2FRHA 3GQ4A 3MFKA 2IO0B 2O6VB 2D2QA 4GOCA 2TSSA 4C00A 1LDDA 1W7PD 2JWTA 2MC4A 1JR3E 2FUG1 3CDLA 2ZO4A 1WJ7A 2DU9A 2NQ8C 1ORYB 2WXJA 3AE5B 2DNAA 3FXQA 1ZELA 3K70D 4L6V6 3RZOJ 2WS3B 3IG5A 1NBFC 4JI7M 4B44A 3DEWA 1RUOA 2LVQD 3WG9A 1F2RI 3OS0A 5DYIA 5FFZA 5F1RA 3S3OA 3TEZA 3KW5B 4ZJZA 1QUTA 2JUJA 2L09A 1V1PB 3U6PA 1TBEA 1E9RA 5ILSA 2HZTA 1XWIA 2GZWA 1Z21A 1F4KA 1R9TJ 1NY5A 4IKGA 3V62A 2DKLA 3H0DA 1WJ6A 1YJJA 4N4NB 3NZ3A 4ANWA 4GH9A 4RGNA 1SSNA 1SVOA 2HCBA 3BG6A 4G50A 2KL4A 3CC2I 4ZYDA 4GXOA 2AXTC 3F0CA 1WJCA 2YVCA 1VQLI 2MH7A 3HDDA 4DXFA 2WGSA 2NAZA 3PTFC 3KP4A 5K5QA 2HS5A 3B9PA 4R1HA 4IHTA 2FNPA 3IFWB 3S14J 1GUAB 1NV8A 5FK9C 3IAM1 2DK8A 3I4PA 4LF8M 2R7UA 1V3FA 1Q3BA 1QUSA 4IHVA 1Q5WB 3AE2B 2WU2B 1QZEA 1TNTA 4XWWA 2QC8A 3AV8A 4A3LJ 1OFCX 1S72I 1UHMA 2MBBB 1H0MA 3V8LA 2XAGA 4XRSG 1ZRCA 1FIPA 8CATA 3S1NJ 4QTRA 1HA5A 1WVRA 3CCJI 2LY2A 1YS6A 2JPHA 2CH0A 3K10A 2HKOA 1IF1A 1SXJB 1VQ4I 5F0FA 1ITYA 2JUOA 3HPHA 1KTKA 1FOWA 3OOUA 1VG5A 3HM3A 1ZRFA 1IM2A 1V5OA 1DUXC 1LJ9A 1HZ5A 1ZGUB 1IZ1A 2F48A 1FLIA 2GOWA 1FBSA 2M4GA 3RQIA 4Q4ZF 2BY1A 1B9NA 3AJIB 1OR7A 1EE8A 1FP2A 3GLLA 5DNYA 2KRUA 1HCRA 3PM1A 4PJMA 1QGPA 3DQVC 4XBFA 2KZVA 1HLVA 3AG2H 2LBCA 5D3DA 2P4WA 3I55I 3WAMA 3BG3A 2B0LA 2GB1A 3DVGY 4NAWB 4JBAA 2OD5A 3BR5A 5J3LA 1P3QU 3IG3A 2X1DA 2L54A 2H6BA 4CH7A 5D2MB 3VYUB 2QKLB 2WXIA 2Z0EB 3MHSD 3LCVB 2P6TA 4U7DA 4XOTA 3D1NI 3SDGA 2ICIA 4BVUC 1EKEA 2QEXI 1WJEA 2FAZA 4IBDA 2B3AA 1GVJA 1ZGWA 1UFZA 5DCMA 4X62M 4Q5SF 1V4RA 1Z9CA 3H4MA 4V2FA 1IPGA 3GOEA 2R4GA 2BGFA 4OINF 3KYDB 3OYDA 3U5ZA 4DBGB 1OGWA 3SU8X 2QWWA 1JMLA 3WHLA 2RRUA 3CC7I 2GBNA 4NHJA 3WHBA 2ESNA 4Q48A 4ANRA 1NK2P 5DPTA 1WM3A 2V1NA 3FMQA 3L28A 2D1VA 4JIOU 4K81A 1JQ4A 1ISNA 2WWZA 2Z5UA 4M9ZA 3V7CA 1PYWD 4G4QA 3HC7A 3Q0UA 2QSFX 2EB7A 2WY8Q 4M3DA 3L26A 4XYCA 2BZTA 4DV2M 1BI1A 3QU6A 2CU7A 5EP4A 1Z1DA 2I7NA 5TISC 3AE4B 1E3OC 5J47A 2VKDA 2ELHA 2IRFG 5L95C 4PSWA 4NRWA 2KX0A 2WBMA 1H6UA 4UVCA 2NTTA 3DU5A 4CGZA 4PCZA 4AU7A 1WE7A 5BPVA 3DKWA 3Q3NC 2KLOA 4FVMA 4F1IA 1MBFA 3LSIA 1KQ0A 1QRYA 2YSRA 5HS8A 4JGHB 3ERED 4KDPA 5AEKB 2SEBD 2F6CA 3O8HA 5LMNM 3M8EA 3BZCA 4UB8C 2BPSA 3L2QA 1N25A 4GITA 3GP1A 2GOMA 1ZG3A 1SBBB 2LH9A 2VDBB 4C2TA 5D3IB 1R36A 3AEFB 2E5LM 1DU6A 2C98A 4OMYA 3SASA 3SYLA 2Y5BB 1EV7A 4RGRA 4ZTJA 4TSSA 4ANVA 2DNFA 4MM3B 2BWBA 3S2DJ 4P1WA 3KP3A 2UZKA 1BI0A 3GTPJ 2ZVOA 1Z91A 3E46A 2EZKA 1JGSA 3I4VA 4R3DA 2EFWA 4NUBA 2PMZN 1E8ZA 3BDDA 3M8JA 1U5TA 1ZLJA 1RESA 4IM0A 1Z7UA 3RQ4A 2ZB9A 2I10A 4KIFA 5EZGA 2KLCA 4A93J 4B0MA 4DR6M 4KA4A 3I9V2 4XR6A 2IVMA 1ENFA 1GOZA 3OYHA 3ECIA 4E7HA 3FYDA 3N97A 2F5PA 5B66C 4GDLB 3KP7A 2ISYA 3V6EB 1L2NA 2NVXJ 3LSMA 3BP8A 3JTHA 5FTJA 3MVPA 5DCMB 4XSZF 3AE7B 3PPAA 4HF1A 4DYQA 3GLIE 5KVRA 3QARA 5I4DA 1Y8RC 4ZRQA 3A0HC 3QPHA 3IECA 3NARA 3F72A 2LH0A 1XLOA 4D0PA 1WJ4A 2E1NA 3L13A 1XMOM 2JSCA 4E3CA 5B5EC 2RPQA 1KONA 4LNFA 3GPUA 5J1YA 2UWQA 3ZNID 2KFKA 2XHKA 5H92C 2EA2A 2JZ1A 2MBOA 2EFOA 3BTJA 4DBQA 5EGOB 2K02A 4CIZA 3M0EA 4A2UA 1ZGJA 1GC6A 4OOIA 4E7LA 4BFRA 4PK1A 1N63A 2GBRA 4DR3M 3CMAI 4HRIA 3GFMA 2MJEA 3PO0A 4C9YA 1TW3A 1JROA 3RNAC 1VQ8I 4LF6M 3TP0A 4II2B 4RGOS 3HOZJ 3OYLA 4DW6A 2OCCH 2DA1A 3LDZE 3RD2A 3SFDB 5EEAA 4LF9M 3DBLB 3V76A 3ZXRA 2DOEA 1WHUA 1ZDVA 1S7AA 2F2EA 4LG0B 1OPCA 4MLOA 4BBNC 1AHDP 5BYQA 3VEPA 4QHTA 2ECBA 2AQFA 3FKJA 2PVOD 1M94A 2JUGA 3R66C 4CO7A 4XE0A 2M56B 3EPZA 4A6EA 3HHGA 1VEKA 1FXAA 4KV2A 1GXPA 4LCBA 4A20A 1Z59A 4XLNF 4HDUA 3AECB 2QILA 4CCJA 2VI6A 2JWUA 2F4VM 4K7SA 1EF4A 3PSIA 2X85A 1APLC 3N9YC 3JVZX 4AQYM 3B73A 1H9TA 2Q2EA 4JQFA 3LSGA 2LUMA 2Y5PA 1WGNA 1D5YA 2L3DA 4PDIA 2EV5A 2NVTJ 3UGBB 4EVIA 2B7EA 4LK0F 3PJRA 3L2WA 2KDEB 2JY7A 2P7CB 3REOA 1D2NA 4WJPA 5F27A 1U5TB 5ITTA 3OYBA 1GT0C 2AL6A 2M60A 1ETQA 2GA1A 4WX9A 5L3BA 2L32A 3HG9A 4ITVA 2UXCM 3CCEI 1FYKA 4BYYA 5KNLA 4MB7A 2QF7A 1WQ2A 1TNSA 1P9QC 2XRLA 2WA0A 1EU3A 1A31A 5KO3A 1U8BA 3CESA 3I5JC 4XLHA 2IJ0A 1ET6A 3BPXA 4DV3M 2L7ZA 5LEKA 2IO1B 4MFDA 1P98A 2L2OA 2KDIA 1X1BA 4FX4A 4FJZA 2FCNA 4B48A 4OIPF 1MBJA 1SGHA 2V9HA 2L7KA 2WXNA 1IXZA 4AP4C 2OJED 3CLOA 2KC1A 1B9RA 1H8AC 1L4ZB 4NY0A 4BJ5C 4MJSB 1K51A 3BOSA 3HK0A 1B1BA 5LGUA 1ERDA 1QOBA 2CW8A 1Q39A 4ENKA 1WWTA 1N34M 3OYFA 1FTZA 2C99A 2DWZB 3S1MJ 3ZPLA 4GMVA 1V55H 2FSWA 4WJNA 1UB9A 4LG2A 2HD5B 3JRIA 4LIVA 1UMQA 3FDYA 2NVQJ 4RDUA 3WGGA 3BJAA 4I6LB 2C9WB 1JCKB 4YIRX 3HL2A 3D8LA 3UINB 4GCVA 3BZKA 4RB0A 1QU3A 3GZNI 2K40A 4PSXA 4DIQA 5F3WA 3OTOM 2DAFA 3K9PA 2JY6A 2JZ0A 1X19A 2EELA 3B7QA 1G2HA 1MFWA 1VZ7A 2VL8A 4Q47A 3VYTB 2KT7A 2CHGA 1H9GA 1MJ9A 4P1CC 2C7MB 2EO2A 2H8WA 3THGA 1KM7A 2FXAA 2KTRA 3Q2AC 3QIJA 1UELB 2K8CA 2D07B 2ZAOA 2UWMA 3AXCA 3KLOA 2FBIA 1YSYA 1QVTA 3TGNA 4HX8A 5JHUA 2KDFB 2ZNVB 2XFSA 3SZTA 1BR1A 4MGYE 1XLNA 1YN5A 1I4QA 4HLQA 3ILKA 2DENB 1FEHA 3U60A 1L0XB 4GHAA 2XASA 5H6RA 4XORA 1MPEA 2L2DA 5A2QK 3LOCA 2V0GA 2R7DA 1QDTA 5CTRC 2V3SA 3PSEB 2EWNA 2J7NA 2VPRA 4RBOA 3B02A 3U6CA 2NS8A 4DQOC 1VDVA 1KRHA 2F4OB 1IUYA 2NBWB 1FMAD 3KWLA 2Z3XA 2NVUI 4FHKA 2QGUA 5KAFC 2CSOA 5J4VA 4AYBN 5CQEA 2WXMA 4W5WA 2JQRB 1HNXM 1TR8A 1WGYA 2X49A 2CGPA 1Q0WB 3QYEA 3KUZA 3E4RA 5BOXA 1D5ZC 4KO8A 3PZDA 4LF4M 3DDCB 5IP6A 2VF8A 1R23A 2E6XA 1OLTA 2K47A 2PIAA 4N4OB 2HYJA 1SJED 1WH7A 5LXIB 2K27A 2R7ZJ 5TGTA 1WR1B 2L6OA 4AVPA 4HNTA 2R18A 3E0JB 2ZJRF 2KQSA 2YEPF 1ESFA 1YIOA 3QU3A 3L1PA 4LGWA 3HHXA 1MKMA 3S1QJ 1QF6A 2X6YA 2QZ8A 4DV7M 2PN6A 1FRDA 4EZJA 2RQPA 2M4NA 4HX4A 2O03A 1N78A 3HKZA 5AIPA 2Y9ZA 1ACCA 2J42A 1IRFA 5HLIA 3J7AY 3LSJA 4HEOA 3IKVA 2GBYA 4FJYA 2L0TA 3KUDB 3TQSA 1I4WA 2WXFA 4A55A 3K6GA 3ZNGC 2YS9A 3IHUA 2HJ8A 1QNTA 3KP5A 1I3AA 3PIPF 2ZJDA 4P6VF 4O5VA 1MDMA 3CCLI 1N33M 1PQSA 1NDDA 1GUUA 3BVGA 3I59B 4PT5A 1D4BA 2RN7A 1TZLA 4CHUA 3HJEA 4I98B 1F52A 2IPKD 2STTA 1ONVA 4IOCF 5TJJA 3SQNA 1JQJC 1MHXA 1CGPA 2JA8J 4M8MA 2XSZA 1PJSA 2DAOA 5HDNA 2QEJC 5G5HA 2Y20A 2KW0A 4JI8M 5GPAA 1WGKA 4DBRA 4XL9A 1UWXA 3PNYA 1Q1OA 2ZKZA 3EA6A 3AE6B 2LF8A 2KKCA 2K5CA 4KKIA 5BR8M 2MC3A 5FRNA 1L2BA 2ELJA 1N6ZA 3HUGA 3PQJA 3H7SA 3FXKA 4KIGA 1P7EA 3UQBA 3JSPA 1G59A 4DHJD 2KMUA 2ZAMA 4UN2B 1MHHE 4Q7JA 3SEBA 1WRIA 1R4MB 3FXUA 4IBKA 2DTRA 4A8XC 3P9CA 1UNSA 1YG2A 4WAAA 2Z8LA 2DWMA 1IGCA 3FWEA 1TKEA 3DOAA 1RU3A 2XSZD 1RAXA 2HHHM 2PEAA 5H20A 4Z6YA 3GRRA 2KZGA 2FBHA 2CR5A 4AJWA 2M5ZA 4CCLA 4TQ1A 2PBIA 3WTSC 1MD0A 4KSLC 2IGMA 5DCFA 4WJQA 3I53A 3RFWA 1T0FC 1IRXA 3CUOA 3WCQA 1GC7A 2IXSA 1XLQA 2XPWA 4WH4A 4IZZA 3DPDA 1I50J 4RKUF 1E7UA 1ZAEA 3A1QA 2KRHA 3PLVA 1MSFC 3J80S 2BV6A 2LWPA 3QODA 2CQXA 3P4QB 3U7DA 3FUUA 3Q3JA 4ASWC 1GG3A 5JFRA 1T6OA 3UJNA 4LY6A 1XXHB 4HROA 5FD6A 3BR1A 3VUYA 3ZTCA 4M02A 2VASA 4M3GA 2LBFB 4E70A 2NPTB 2BQQA 2KOXA 4W9EA 3DTEA 2IGNA 3R7RA 2ZW0A 2OQRA 2QHOB 2DMUA 2BT6A 3MK6A 1BI2A 2VXDA 2CO5A 2UUAM 2O2VB 2X6WA 1XQQA 2B76B 3ROUA 1IY2A 3SEZA 1YN4A 4MNUA 2R5YB 4PYUA 3CO6C 2NVYJ 2VQLA 1HQYE 1T8IA 5JLWA 3CLQA 2LSOA 1EJ9A 2KK8A 2EJRA 3L08A 5IY5H 1VQ7I 4IKFA 4LLNA 3U30A 5J2RA 3U61A 1BJAA 2V9VA 1FNNA 1HW1A 3GQ3A 2FH0A 5F64A 4LJAA 1ETYA 2Z16A 1T95A 5JLXA 2RDBC 2B3TA 3I3LA 3KEOA 4M3BA 2EFQA 4YWGG 1MH4A 1R2YA 2LVPC 4A3PA 3ABVB 3R8FA 2L5QA 3E6CC 3S8PA 4HVBA 3DLLF 4RGMA 2JYTA 2XIGA 3RUIB 2O6GE 5IP7J 1S29A 4UNOA 2BB5A 1Y39A 1S5LC 3FRHA 1NVID 1K53A 5KHDA 2I1JA 4UV8A 2L0KA 3ASOH 3DCFA 3L00A 3P4RB 3GLHB 4WWNA 1UBIA 3PREA 3DPTA 1QQIA 1CK1A 1X1MA 2MLGA 5DPSA 2CMPA 1HBXG 5EJCA 1ZUD2 3JW4A 2DT7B 2IAIA 4N9F4 2DMTA 3V61A 2VZKD 1NK3P 4S12A 4DR5M 3GEZA 4LIUA 2NXNB 3FC4A 2C7NB 1R1TA 2K8BA 3PRPB 3LMMA 3A1QB 3T1HM 4EJTA 2XAHA 3DBRB 1ZHFA 4G7ZF 2VQFM 3LJ3A 3RFZB 3FMSA 2WV1A 2BYFA 2MBEA 1CJEA 4RB3C 2MJ5B 4BBSJ 3BWGA 3D8BA 2D3GA 3L17A 3TCAA 1T3QA 1P4WA 4EV0A 3L10B 5FGMA 2ZZPB 2MQJA 3VQIA 4IBIA 4HBLA 1FZPB 1MG4A 2XAUA 2J7QB 2V6ZM 3FUTA 4EJUA 2EFNA 2KIUA 2X6XA 3F8NA 1ZQ3P 3L27A 4Y52J 4UUVA 4X6AJ 4TUUA 1WXVA 3VTWA 3V7RA 4LFAM 3M9AA 5FKOA 1FM0D 4L1BA 4IQ4A 2PLYA 1YW7A 2I7PA 2FX0A 4HEA1 1UHSA 3BZDB 3EYIA 4KT6A 4CYCB 3IRQA 4L5EA 3X2QH 4JI5M 2VT2A 4IM3A 2XF3A 3CF6E 1VLBA 3UQAA 2DA6A 3BTIA 2RDHA 2DAEA 2XGDA 2Y75A 3IC7A 3LWFA 4FHJA 3C1DA 3SAWA 1XB4A 3H6NA 2DAJA 1VEGA 1RKWA 5EP3A 3LSRA 4C30A 3GWZA 3FILA 1IGDA 5JH5C 3U61B 1EH7A 7CATA 4OIOF 3DPLC 2KEBA 5C3EJ 3BK2A 4N58A 4PK4A 5D6EA 4FX0A 1DPUA 3TWLA 1JWUD 3F3XA 2XRNA 2K85A 2WSFF 1A35A 3NY5A 4LRTA 3VUXA 4LFBM 3PUFA 1GABA 3S3NA 4JLCA 3NVWA 1OISA 3M63B 1TY0A 4WWOA 1TKYA 1T0FA 3ZDTA 1OCZH 1E8YA 2LFBA 1VQ6I 1X1AA 2ME0A 4NL4H 2QUFA 4BGDA 5BQTA 1LM8B 3CMYA 2XV4S 2FQ4A 1XS9A 2D5VA 2JA6J 4AIHA 2OPFA 4AQ7A 3SDBA 2LUEA 3IWFA 2WYQA 1MMDA 1ZRDA 3TP3A 3MC9A 1KLUD 1X3WB 3U6QA 3KUCB 3UF8A 3GLFA 4JX4A 2BKRB 4IRGA 1UBQA 2PW9A 3H36A 2KVRA 2IO2B 2CHWA 4FISA 5C1BA 2KNBA 3KXEC 4QHSA 3OIPA 3GLIB 3M62B 1V33A 5CX3A 1OTRB 2RNJA 3BQYA 2NBUA 2QSHX 3L09A 2WAEA 3MHZA 5FB2A 2PE6B 1P4XA 3AE8B 3BY4B 3UK6A 3NHEB 2MW8A 5JHFA 1MX0A 3NWSA 5JHBA 1Q3CA 1B9MA 1L1TA 1D0KA 1Z05A 2EZHA 4BL0B 4ZYEA 4M9SA 3MQ0A 2PI0A 1L4DB 1ZG1A 2MA3A 4HPLB 1WJAA 3NBXX 1SANA 2EV6A 4D7NA 2LNBA 2K9XA 3R0JA 2LJIA 5H8YE 4N9IA 1RRJA 1R1VA 1HTOA 4M71A 3F6OA 3IVFA 1OFFA 5GXGB 2WSCF 2LMDA 3SAUA 4KSKC 1OQRA 1R5ID 3A9JA 4F52A 2AQ1B 2HVSA 1XSVA 1D3YA 4KISA 1VZ0A 4RS8A 2VBYA 3GYHX 4U0WA 1Z0XA 4LLGF 1XDUA 2LXCA 4ZYNA 5EE0A 5A2QZ 1TGUA 1ETOA 3JR9A 4S05A 5IP9J 1GLNA 4LJ4A 2PKOA 2M8EA 2ZPYA 1N36M 3ZVVA 3Q3SA 4ACFA 4F55A 4M0WB 2DAIA 1QAMA 3AKZA 3V8JA 2AX5A 4AS1A 3ZN0A 4EGYA 2CUJA 4XRFA 2QZ4A 3H7PA 1QQWA 1IY0A 2KRCA 9ANTA 1YI2I 4ZYHA 1K82A 5DFLA 5E8IA 4MO7A 1ZAOA 2LKXA 1HNWM 3F8MA 1SE4A 5HVQC 2Y0SN 4PJNA 4AKHA 1F5TA 2F5SA 2K9QA 3BTLA 4Z2YA 1IYFA 4AOFA 1J0RA 4LDTD 3HOUJ 2A6TA 5DCNA 3SAVA 1ON2A 4ZRIA 5FTNA 4E4HA 2HOAA 2INPE 2E71A 1V54H 1HW5A 4HLXA 2HPMA 3HY5A 2CQKA 3TO9A 1X3UA 3W2AA 1LDJA 2W57A 4WCGA 1AU7A 4A3IJ 4BACA 4L5JA 2HGCA 2ZXHA 1LV7A 2L02A 4XX5A 3HOSA 1E10A 1FRRA 4PGHA 4A3JJ 4NQWB 3I0TA 2IDYA 1P4AA 4CZZA 4RM8A 1VJKA 3I4MJ 2WDVB 3NG0A 4G7OF 1ZMVA 2FIDA 1JRUA 2LHDA 1Y1WJ 1L0VB 3FISA 1I4HA 2R7XA 4M3FA 1MMSA 3W67A 1EWCA 2MHJA 2DYBA 2NNYA 3EYYA 2DOFA 2X9DA 4AC0A 2DMNA 4US9A 1W5SA 3L2CA 5TR5A 3C19A 1QBJA 1X4OA 3G4SI 1P1AA 1L1ZA 3DBLI 1I5ZA 1DP7P 2Z0DB 3U8ZA 2KQ4X 3PVSA 1PJTA 1AN8A 3AU4A 2Z99A 5TRDA 4ZZDA 1TTYA 4BBNF 1L0YB 2ZC2A 1L5PA 1NJGA 1DGHB 4YFNF 3BCBA 2F5VA 3RZFA 4FD2A 4NJ6A 3EECA 2X8AA 4XDDA 5EG0B 3HHMA 2KNZA 5C1ZA 1WX7A 4NPNA 3KPHA 4K7UA 4EKUA 3CUQA 1GJZA 2X1CA 2R2OA 4A69C 3I4YA 2CQNA 2JVHA 3SHGB 2MW5A 4XRMA 4CGYB 3U6MA 3N1YC 2OQ4A 1ZR2A 4YFKF 4A3EJ 2I38A 4MQ9F 2L83A 2EKIA 1ZKHA 3LVWA 3B7NA 4M0DA 3KH0A 4DR1M 3RTRA 3DBSA 2FJ1A 2XKPA 1LDKB 1JUSA 4LK1F 5BS6A 1IBXA 3AEAB 2B9SA 3AE3B 2QKMB 3NZSA 1RKTA 3P4PB 3MJ5A 3LA3A 3M07A 1DO0A 4BZAA 5KAIC 1T98A 2FBKA 5IA7A 1FOKA 5ITYA 2BXYA 1BN5A 2OZUA 5E3LA 3OR1C 2KAJA 2MBFA 4X57B 3RNGC 4E7JA 1VDLA 2V4LA 4NNJB 2O25A 1MGTA 1XGMA 2LHCA 4N59A 4ENNA 4ZH4F 1V97A 1RPWA 3WA0A 2DQRA 3BR6A 3ZGZA 4IC7B 4DXAB 3E6DA 2KJRA 1QHHD 2HQ5A 2LKSA 3RYPA 3IHPC 1R5GA 3W1SC 2C6YA 4WIPA 4DNCA 4JYAM 3U9GA 4IHXA 1Y8QB 1K7AA 3HB9A 3C9PA 1QQRA 1EWYC 6PAXA 1LFDA 3K1MA 1RWSA 3A9KB 3ESWB 4AKGA 2BVCA 3A33B 3SDLC 5E6PA 2E1MB 2PMHA 1E9MA 2JN6A 3GQ5A 2V1YA 3DTKA 2OO9A 4F2LA 3K8ZA 2E5ZA 1D6EC 3LB8C 5BNGA 1NNJA 4ESFA 2IA2A 2OOAA 4LFCM 4F92B 3I9V1 4FQGA 1ZARA 1FIQA 2JPBA 4BE0A 3ZQIA 3VTVA 5EP1A 3CDHA 3KQ4A 4W9FA 4G8XA 3ZCBB 1LVKA 4OVZA 1EH8A 2BWFA 2HDWA 5E6OA 2BYEA 3I04M 3VYRB 1Q02A 2WXHA 2CV0A 1LUJB 2N9EB 4P1BC 5K1YA 2A5YB 2FMLA 4GC5A 2H27A 5EYRA 4MFEA 3TO7A 1JGGA 5EXPA 3SZPA 3CC4I 3O13A 4UB6C 4FWHA 1XG1A 2V1UA 1YJIA 3OWEB 5H2FC 1IN7A 5HLTA 3AOEC 2X38A 2W7NA 1UJ8A 2H09A 2XN9C 4KLNA 2XZUA 1IRGA 4BHBA 2D3CA 4LRSA 4ZYGA 2O7OA 5K7FA 1Y8RB 2OPTA 4S17A 4IWQA 4BJ6C 2D3AA 4ZPXA 2E1OA 3HOYJ 1E90A 5LD2C 2BGCA 3FIWA 3WHKA 1OCCH 2PJRA 4L4UA 2A07F 2WU5B 2DDAA 2AEHA 4KDIC 2IT0A 2K4JA 5ITUA 1HKTA 1WPKA 1KH0A 4JK1X 3Q9VA 5FTLA 3P5JA 1GDTA 1J7AA 4WXCA 1TJEA 3B74A 4KVGB 1PP8F 1UFMA 4CCKA 4IWOA 1TTNA 1TZOA 4L0YB 2DW4A 1K4TA 3VSKA 2DDBA 1M1EB 3GBGA 1PP7U 2MFZA 3K2LA 3HRTA 2LP0A 3V7SA 2FFJA 3RDIA 2WHIA 5ERIA 2A5WA 4FCWA 2HQAA 1SMTA 3CJRB 2JZZA 1U0JA 2ZSIB 5EDSA 5FJ8J 2DZIA 1ZR4A 2EK5A 4YIIA 1D1AA 5F6FA 4NXMM 2EKEC 2W4SA 3MC0B 3L2AA 2N9LA 1WXMA 2R65A 4XGIA 2DTZA 3HSEA 5J4YA 1U8RA 1AIPC 5KQ8A 4AG5A 4GDFA 4GC9A 4BXXJ 3RPQA 2KTFA 2FF4A 3BR0A 1SIFA 1ZK8A 2R7RA 2Q5WD 3VPRA 3AN1A 4UUTA 3SYTA 4HWIB 3FAHA 3OY9A 2VQCA 3B2FA 4JI4M 2BXZA 5D5WB 1HW2A 4A3MJ 4B6WA 4LJ9A 3J27B 3E5QA 1OIPA 2ISZA 3Q3OC 1XCBA 2Z2SB 3DU6A 4CYDA 2FOWA 2MX2A 3ZMSA 1UGJA 1L6VA 1AKHA 1AUAA 1J8CA 1QLBB 2E5NA 2VKVA 1P7JA 3I51A 3CMMA 1IXRC 2ZMEA 1SXJC 2ID6A 2O5RA 3BOQA 4GFBA 2ADUA 3K70C 1GL6A 3DV8A 1R49A 2OQGA 3GLGE 2AQ2B 4KKJA 1C77A 3H5NA 1J09A 2E19A 4A3DJ 4FE4A 2A5UA 4DUYM 4KODA 1YJWI 2DZJA 5CHWA 1U9NA 3K69A 4HJKA 2HFHA 2QNJA 4OIRF 2R7VA 1PUFB 3BVMA 1N5WA 1G3SA 1K6OA 3LSKA 2WSEF 1DYQA 2KZRA 5BYSA 2HTJA 3O2PE 1FPYA 2DFEA 3TO6A 2VE8A 4GO1A 1JTXA 2NVUB 4DYRA 4EATA 1MMGA 5HNFA 2FS1A 1MBEA 1X1PA 4EM1A 3J80K 1DGFA 3TUOA 2KWDA 1UH6A 3BK1A 5CYVA 5FROA 1DU0A 1HQCA 1W1WE 3PFIA 1IXSB 1D0YA 2RQQA 3F92A 1FMWA 3MKLA 4B4CA 4I09A 3E6MA 1WIAA 1R4MI 2HZDA 3W6KB 5IOIA 3KE2A 1SE3A 3P4SB 5CKTA 3KYCD 5EE3A 4EIWA 3HSFA 2QM3A 4FADA 1YJ9I 3ALBA 4EM0B 1EF1A 2BWEA 1G4DA 1TLHB 4PYZA 2R4JA 1KU2A 3ZH9B 2KDBA 5CHVC 4BY1J 4FLHA 5EEHA 2LF7A 3TL4X 3U7ZA 3MMPA 1LE8A 5EE1A 3DWLE 3B9JA 2FCMA 1YW9A 5K7HA 4NC8A 1H4RA 3F9KA 2ETHA 1IY1A 2VKEA 2LTPA 3ZQ4A 3BY6A 2DODA 4DV6M 2EV0A 1OEYA 2QCZA 1OQYA 4WQOB 1PYVA 1SAXA 3NVYA 3IKTA 2H8RA 2GBMA 4P55A 5C23A 4MGZE 2LY9A 4P5OA 1Y0UA 1SEUA 4XBOA 4CO8A 2VJJA 4A3CJ 1FNWA 1XD3B 2EPFA 1AYFA 2DZOB 2K5PA 2L76A 3Q3FA 1MMAA 2DYRH 3O3KA 3IL2A 2LREA 4BKTA 4KGTA 1IC8A 2YU3A 3W2DA 2EZLA 2COMA 1C3TA 1EO6A 3B2GA 2C5RA 2K1FA 1Z3YA 2HTHA 4YSZB 1X3ZB 1WGRA 1B72A 2M0XA 2W9NA 1TQMA 2M0AA 2H1LA 4CJ6A 3DLAA 2Q8KA 3RYRA 2MABA 3E21A 3ZR8X 2LLKA 2J7OA 4JP0A 4L23A 1V92A 4BKGA 1JHFA 2K4BA 2QENA 2F5FA 3KZIC 3HJQA 5LHHA 1Y6IA 4DK5A 4QLCU 4R8HA 3GTMJ 1OR7C 4WXDA 2M19A 3DBHI 4GGGA 2VUMJ 2KFDA 5EE9A 3QK0A 3CCVI 4A3FJ 4A3GJ 3DZDA 2R3SA 1TDHA 1V1PA 1YE9A 2WWYA 3R9XB 3CZ6A 3VFDA 1QO0D 4XDCA 2O6VD 4GDKB 2P7VB 4MACA 2G9WA 4RAGA 3DWMA 3JTGA 4EGZA 3HM5A 4DV1M 2D7EA 3FXMA 4C3JJ 2W3SA 3IH2A 3ZNHB 2LMCA 4IRIA 2PQ8A 4NXNM 2RDGA 4B3TM 3U6LA 4I4LA 4IOAF 3FX3A 1PJQA 4KICA 4I5SA 2CFXA 3L9FA 1TGZB 3NVVA 1NNUC 4LF5M 3I54A 1QANA 2OZ6A 2LGYA 2M45A 1YX6B 4NC6A 5JXVA 1NV9A 1HSTA 1ZMWA 3AE1B 4K2EA 1TS4A 2IP2A 4UY8I 4OU0A 4XLEA 4M3EA 2IGGA 5HG2A 1U6GA 3OYGA 4OIQF 1GJTA 1P3QQ 3WU0A 3VTUA 2DYMA 5L3DA 3BJ6A 4HAMA 2BE5F 3M1CA 4LNOA 4RH6A 3TDUC 3FHZA 2IBDA 1YLAA 1NYRA 1IFYA 3ML8A 4ZTFA 2RPVA 1JUMA 4LNKA 3ZJTA 4D5FA 1GKIA 2WDRB 4D9JA 1QPMA 4BXFA 2K6QA 4S0HB 1FP1D 4D1QA 2R46A 1L0OC 3OR2C 2M87A 4ANXA 1D8JA 3C3WA 2LK2A 3VR9B 2E1CA 1XGSA 4MH0E 3WTYC 4BOZB 2XUBA 4IM2A 2LGSA 2JRIB 1YYVA 2ZJ2A 3LAPA 2VN2A 2KC2A 3Q8XA 2ELKA 3LVVA 4KIKB 2KWCA 3WODF 2VIXA 1FNVA 4FJVB 2OJWA 5ITQA 3GZ6A 3QQ8B 1SXJD 4H2AA 4L15A 1BIBA 3SFEB 2PLPA 2DMPA 4XSXF 4AZFA 3AEGB 2GIZA 2ZJPF 3SARA 4DGWB 1S3SA 3PXGA 4NAWA 2IGKA 4OAZA 1WR6E 5C4JJ 3EIEA 2UUCM 2L7MP 3VDPA 3AG3H 5AIQA 2L7HA 3RKYA 1A70A 1C78A 4HRSA 3KS4A 1FY7A 2IYDB 3T1YM 1BUIC 2DXIA 2F5NA 2QCUA 1T38A 4XLPF 4EOYA 2CE7A 2DZKA 1U5TC 3QAHA 2Y5CA 4QWQA 4Y13A 4XKVA 1E7VA 2HWJA 3B1LX 1V8CA 3AG4H 2D5GA 1GVNA 3BINA 4DBGA 2YFQA 1NG6A 4RM2A 2ZCWA 4EJVA 2XH9A 1Q1VA 4CSWA 4DHZE 1D3ZA 2VQGA 2KQ7A 1WMHB 1G4AE 4ZC3A 4LJOB 2AQEA 1X2MA 3EHVA 2Y48A 4ZHOA 2JTVA 2JUCA 4HXDA 2DYSH 2KWUB 3AL0C 3HPGA 1S7OA 3OYAA 2L9NA 4Y3OA 2XKOA 3RN9C 2AQ3B 2PJPA 1K4SA 1OFIA 2DWLA 4CHTB 2DBYA 4KJZA 3MZHA 3BG9A 1GJSA 5K7ZA 1AA7A 1SXJE 1KU3A 2M7AA 2KVZA 5DM7F 2LC2A 1XGNA 2JRHA 2J5YA 1R22A 3APFA 2JRMA 2R62A 1ZDXA 2AHQA 2D2WA 3GFJA 2M5WA 2A05A 4DXGA 2J0MA 3TSSA 2NOJB 2M9HA 5AUIA 2ZCCA 3H9DA 1SFOJ 4WW0A 4D81A 4AD9A 1S8NA 2G4SA 3HSRA 2EBIA 1E9SA 2H88B 2NNNA 1R5LA 3S32A 3NVZA 4JWUC 3IH4A 4BKXA 2R7TA 2G4DB 4C4VB 1E8WA 3WU1B 4DR7M 3RPUA 2RC4A 3LFKA 2DA4A 2HDDA 4F1SA 2XF7A 2LXAA 3MEXA 3MWMA 1YRNA 1MH3A 2XB0X 1F4IA 3UNGC 4TMAB 4G3XB 2ZTCA 2BW3B 1ZKGA 2CRUA 4W9KA 1MIJA 1R58A 3KIOA 4U0VA 1TZ1A 4G6ZA 3ZJVA 3SBJA 4MM3A 3H9QA 2EQRA 4OWRB 1CF7A 2FEZA 2Y21A 3AI5A 5ICEA 2OUMA 1FEXA 4HOBA 2ME6A 4HPQA 3JR4A 2GA2A 4AIDA 3RPUD 2MLKA 2BHYA 2EZIA 2M3AA 2XGEA 1W0UA 2W84A 4XONA 2L4MA 1P0RA 5M5XJ 5KHQA 4K7WA 4DR4M 3FE3A 3WG7H 2K9SA 2MYSA 2KXEA 3ZCOA 4G6QA 4F93B 2LVAA 4JOMA 4W9IA 4LJ7A 3T8MA 2VB6A 3OS2A 1BI3A 2HQRA 1UAAA 2H89B 1RR8C 2R7SA 1WSUA 5BMZA 2FOKA 4GDLA 1MNDA 4S04A 1TL8A 3A01B 4IDIA 2IS6A 2ZNVC 5LRSA 4F8CB 4BDYA 4EEFG 3AULA 1KA8A 3ETRA 1IQPA 1VZ6A 3JRDA 4WK8F 2N7JA 2N4FA 1Z3XA 3F8FA 2LRWA 5D94A 3BT9A 2N8GA 1C76A 5B3SH 2VH1A 2VPLA 2WAFA 4KMFA 2F4MB 2IO3B 2KN4A 1VQMI 3K9OA 1VCBA 2HKJA 2IA0A 1V5GA 4KN7X 2E2JJ 4IW0A 4CISA 5EGOA 5IREB 4NB5A 3AOGA 4LG3A 2CJNA 1WGDA 2JP7A 3A45A 5FD5A 3N05A 1WJUA 3KOYE 4AW4A 5L8RF 2O9LA 2V7FA 1XGOA 4LJ8A