1QZEA

Hhr23a protein structure based on residual dipolar coupling data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
360
structure length
214
Chain Sequence
SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords UV excision repair protein RAD23 homolog A
total genus 51
structure length 214
sequence length 360
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF00627 UBA UBA/TS-N domain
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA04
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1qzeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1qzeA01
5IA7A 2NVUI 3JYUA 2HAKA 2KQ7A 3ZDMC 1F4IA 4HCPB 1IFYA 1ZV1A 1WY8A 3K9PB 1E7UA 4EZKA 4EUTA 4G3OA 1V5OA 1NV8A 3B0AA 3H1UA 1YLAA 2BKRB 2GBRA 1E5WA 5FR6A 3VTVA 4ASWC 2LGDA 2FIDA 1J19A 3L0WB 3M3JA 4DHZE 4WWPA 1GC6A 2K0BX 4UN2B 1WIAA 2V1YA 4BOSC 2PPHA 4BBNC 2WX1A 5AZFA 5TR5A 4FN2A 1TP4A 1E90A 2MWSB 4HCNB 4A3PA 1WIVA 2F4MB 4BFRA 3O65B 2KLCA 2N1VA 4AJYB 1WM2A 2GMIC 5JI2E 4W9FA 2JZ0A 3PRPB 2MSED 2DYBA 5DCNA 4BOZB 1PGYA 1DO2A 2LVNC 3QC8B 1J0GA 2HE7A 1TTEA 4WQOB 2KNAA 5CTRC 2BYEA 2KJ6A 3QHTA 1V49A 2KXJA 4CYEA 1SG9A 2DHYA 2KTRA 1Q5WB 3PHXB 4NAWB 5CHWA 1WXSA 1WGRA 2NS5A 4KSKC 2CHZA 1CUKA 3IG3A 4HDQA 4EFOA 4IWOA 3DOWA 1YIWA 4AJWA 4ANWA 1UBQA 2L76A 1VEKA 2FCSA 3GOEA 3QAQA 3RULA 2D11A 1MN3A 2XK5A 4OVVA 4KZCA 2Z59B 3RZFA 4G3XB 1EF1A 2KDBA 3QQ8B 1TZ1A 2EKFA 4MJSB 1JR3E 4NQLB 5EDSA 2MBHA 4F1IA 1RAXA 2WYQA 1R4GA 2AYOB 2IO0B 3IBEA 2K9DA 3JVZX 3DBLI 3PT2B 3RCZA 5G55A 2MBQA 2IZVB 3JSVB 1OAIA 2KZRA 1ZKHA 4W9GA 1FXTB 3GLIE 4ZRJA 4II3B 4MGIE 4URKA 4E3CA 4W9IA 2MQJA 4BKGA 1XT9B 1VQ1A 2EKEC 4ZDVA 2L4FA 1WJ4A 3MTNB 2KDEB 4M8NA 2LVOC 3MJWA 4PS3A 3NZUA 3T8MA 4AP4C 2D2QA 2C9WB 4JQWC 4MEMA 3UF8A 1VCBA 1X3WB 1A5TA 1P0RA 2DAFA 2KJHB 4KDIC 5C1ZA 3PTFC 3ENEA 1E8ZA 2KFKA 2YLMA 2LXAA 1NBFC 2UWQA 2QHOA 3D32A 3RT3B 1U4AA 1IXSA 2WX0A 1SGHA 1TGZB 3MHSD 4BBNF 3E21A 1YX6B 3EFUA 2LVQD 4B9KA 5D7GA 1V5TA 4Q7JA 4WWNA 2IO1B 1DV0A 2REXA 3IVFA 4FJZA 1Q1OA 3AI5A 4I6NB 5E6PA 4GOCA 1VEJA 4WJPA 1I35A 2MBBB 2V3SA 4G0NB 1ISNA 3A9JB 1KYIA 2JY8A 2RRUA 4DDID 1UZXB 1EO6A 1Z5SB 3N30A 3VAWA 4XZ4A 2ZEQA 2KFKB 2J0JA 2PE9A 4FHJA 1T0YA 1WH3A 1WR1B 2ZTCA 1NV9A 2IY1B 2DENA 2G45B 2KN5A 3VUXA 5AZHA 2GOWA 4ICUA 3H7PB 3P2BA 1XXHE 1EUVB 4MGZE 3GZNI 1C1YB 2NBWB 3K9PA 2KHHA 2LVPC 4DBGB 1DO0A 2BYFA 2JZ3B 3ONSA 4FA6A 3LDZE 5G2NA 4M0WB 4DHZB 3L54A 1E8WA 1ZMVA 2KNZA 5IAAC 4JLCA 1ZMUA 3A9JA 5AZGA 3DVGY 1EFUB 2KDIA 4F2LA 2HJ8A 1HT2E 1WGHA 2MX2A 4MGYE 1VDLA 3H7PA 2KWCA 2O6VB 3GLFE 3B1LX 4KVGB 3Q3FA 2O2VA 3IHPC 4FLHA 2CR5A 2BF8B 4NY0A 3FRHA 4IM0A 2MJ5B 2DZJA 4FBJB 3JW0X 1LM8B 1EF5A 3ECIA 1G3IA 2K8BA 3A4SC 1TR8A 2J7QB 1Q02A 2LASA 4IWPA 4II2B 1VD2A 3RD2A 3QK0A 3APDA 2ZVNA 1G6JA 3VDZA 2OOAA 3CSFA 4AOFA 2KNBA 2DYMA 2WZJA 2MCNB 3TJPA 2L4EA 3V61A 2C7MB 3ZKJC 2N1WA 2D07B 2M8SA 5E6NA 3WAOA 1V6EA 4MJSA 2KX0A 3PV1A 4K7UA 2C7HA 2G4DB 4K7WA 4NAWA 2EJSA 2LD9A 5C23A 1UBIA 3RUIB 2K8HA 3ML9A 2L0FA 2OOBA 1WMHA 2LRUA 1OQYA 2JUOA 4AUQC 5D6JB 5DFLA 4TQ0A 4GEWA 4HK2A 4KDLB 2LGYA 2BPSA 4TKNA 1E8XA 1K8RB 1TBEA 2QHOB 2MRPA 4HWIB 4YIRX 2KX3A 4RM9A 4MSMB 3B08A 1T6OA 4F8CB 1WM3A 2JWZA 3N3KB 3BBZA 1YD8U 4GGQA 2KK8A 2N9EB 3ZIMA 2ZCBA 4DHJB 3UIOB 3R3MA 4GU2A 4M8MA 3VH4B 1V80A 4WP2A 5GMVA 3PREA 1IM2A 5J18A 1HQYE 2DAGA 3AULA 3VUYA 4EZJA 4NJ7A 2OJRA 3SD5A 3ZNZB 3M62B 2O6VD 3HIZA 1P3QQ 1XD3B 4R71A 1IP9A 1C7YA 1Y8RC 2MP2A 2L2DA 3HM3A 2DX5B 2FCMA 5DPWA 2QSGX 1XB2B 3TMPB 3GLGE 1V9JA 3FE3A 2KTFA 4IM3A 1OKSA 2JF5A 2PE6B 4MELA 2DAKA 2L00B 4HLEA 2RGFA 2KWVB 2IY0B 1WRDB 2NCNA 3V6EB 4W9HA 2JRHA 2I1JA 1GG3A 1LQBA 2BWEA 2JXXA 3PPAA 4W9EA 2DAJA 3PHWB 1P1AA 1WR1A 3BINA 3U7DA 4MSQB 1X1MA 2JZ1A 1WZ0A 2NR2A 1V86A 1G4AE 1AARA 2FCQA 3CF6E 3QWZB 3UINB 3BY4B 1WXAA 3APFA 2KMCA 3NOBA 3TIXA 1V92A 3A9KA 3KVFB 3QARA 1WX7A 5JZEB 3K9OB 1WF9A 2DKLA 4PYZA 2FIFA 2IO3B 2LUEA 3OJ3A 3PVLA 1WR6E 4FJYA 3VHTC 4EOYA 4W9LA 4ANXA 5CX3A 2NPTB 3S2AA 3W1YA 2MP2B 2N9PC 3L08A 2JZZA 3M95A 4OVUA 1E7VA 1HT1E 3QA8A 1WGGA 4NNJB 1OEYJ 3WALA 4K81A 4CO7A 3HM6X 4DBGA 3V60A 4EKUA 1WMHB 1HJPA 1WX8A 2OOBB 1CMXB 3FRIA 1MG8A 4GSWA 3ZW3A 3PRMB 3KW5B 2LXCA 2ASQA 3ZRCA 3K9OA 1ZMWA 2O25A 3HHMA 2R2OA 5CHVC 1E94E 1UH6A 4JL9A 1P9DU 2A4ZA 4RM8A 1WE6A 2BWFA 2JY6A 2MR9A 1WHCA 2DZIA 2LRWA 3PZDA 4GXBA 4LDTB 3ZUNA 1AIPC 1WJ7A 4TV3A 4IG7B 2IBIB 2FNJB 4ANUA 5JHBA 2D3GA 1JRUA 2JY7A 3KUZA 4EZLA 3R7QA 4BKSD 1Z2MA 2G4SA 1WGYA 2I1KA 3AXCA 2ZZPB 3VFKA 5J2RA 2JP7A 1WJNA 1UFZA 3OLMD 3PS6A 4E71A 1GO5A 4RMAA 2C5LC 2DI0A 3V62A 5DPTA 3VQIA 4EEWA 3VUWA 5LLIA 2JUJA 5LXHA 3APCA 2KDFB 2YVCA 1WJ6A 3AU4A 2RR9A 5JH5C 2JRIB 3WANA 3ZO5B 1YJ1A 2LVQA 3SHQA 3PRZA 3KUCB 2PEAA 1G41A 1WX9A 2KKCA 2AL6A 4K1RB 2AL3A 3DBRI 2BWES 2EMSA 4NJ6A 4W9DA 2LZ6A 1YX5B 2ZPNA 4LCDE 2ZJDA 2JPHA 3TCAA 2M4NA 5D2MB 2WWZA 3LCVB 3NZSA 3A33B 2D10A 2WDTB 4TUUA 3VTWA 1P3QU 3ML8A 4GN1A 4DXAB 2BYVE 4HPMB 4KZ0A 4WJQA 2A5UA 2DHZA 2IO2B 3DQVA 3IFWB 3UIPB 1RLFA 1GJZA 3A1QA 3GLHE 3UQBA 2K6DB 2VRRB 2Z0DB 2FAZA 1HE8A 4I6PA 1ZW7A 4MDKE 4W9CA 4BVUC 3ZNGC 2KANA 1BVSA 4PS8A 1R4NI 2K39A 2MROB 1PQSA 2NBVB 3DBSA 4G50A 3V6CB 2QSFX 1A5RA 1Y8GA 1XQQA 5D94A 2IYDB 2L3ZA 1VEGA 3T6PA 3H9DA 3RZWC 2HTHA 1WFYA 2UYZB 5L95C 2KTRB 1GUAB 4CHKA 4F1SA 2K6QA 1OTRA 4KIKA 3VVWB 2ZCCA 3VXWA 3WIMA 4WJOA 1V2YA 3TBLD 3EHVA 2R0IA 2NPTA 3QJZA 1P98A 2R2QA 2G3QA 4W9KA 1C3TA 1VG5A 2KLGA 3PSEB 5KHOA 2XK5B 3JSVA 1UD7A 4GMVA 4ZRIA 1LXDA 5DPSA 4NQKE 1KM7A 3QIJA 2ZNVC 1J8CA 3UQAA 5E6OA 2KC2A 4GDKB 1L7YA 2CKHB 2MA9B 1UGMA 1WYWB 4J6IA 4KV2A 1PVEA 1OEYA 3PLUA 2KFJA 1BT0A 2FCNA 2M0XA 3DPDA 3NY5A 3ZLZA 3L16A 4GIVA 2CU1A 2G3QB 2K1FA 5AEKB 2KQSA 3B89A 2V4LA 3PLVA 3U30A 2LTUA 3OJ4B 2JY5A 2J0MA 2ZTDA 4WWOA 2L8JA 1T43A 2BWBA 3ZTDA 4DWFA 4LDTD 1WXMA 2N9XA 3L13A 3NS8A 3VTUA 2CWBA 2JNHA 3KYDD 2B3AA 2CS4A 3I3TB 4HPLB 3ZNID 3ZVVA 2KJRA 3N32A 1E8YA 2N7EA 2Z0EB 2HD5B 4XC2A 4TQ1A 4ZRKA 2LVPA 3F92A 4HXDA 4FHKA 3H4JA 2O2VB 4MM3A 2HWJA 2L05A 2L0TA 4GDLB 3L17A 2AWTA 2DAMA 3WAPA 2M17A 4N9F4 4GDKA 2JY6B 3A1QB 4FJVB 2F4OB 2KNVA 1YQBA 1M94A 2RD0A 3LJ3A 2GBKA 3X0WA 2LVAA 2DAIA 3HK0A 2KWUB 2MLBA 1I42A 1KLVA 2H5XA 3SU8X 4W9JA 4XX5A 4WJNA 1V81A 4G11A 2KHWB 3KUDB 3DDCB 2N7DA 3W1SC 4I6LB 1S1QB 3IECA 2LJ5A 1GC7A 2XEWA 3LCUA 1SE9A 2K25A 3DVNV 4JGHB 4FULA 5DPRA 3A9KB 2MW5A 3QCAA 2LWPA 3RYTA 1WXVA 3ZNHB 1NDDA 2Y5BB 2BKFA 5CHFA 4IM2A 4HVBA 4AWJA 1LFDA 2NBUA 2CP8A 2LVOA 2QSHX 3DVGX 3R66C 3C0RB 1ZGUB 3H6NA 4HDOA 3DCGA 3ALBA 4BKSA 2LBCA 2GBNA 3KH0A 1NI2A 3PGEA 4WAAA 4B6WA 1KOTA 2DZLA 1Q0WB 4PS7A 5JHAA 2MGWA 1WJUA 2LGXA 3ZRFA 3T9LA 2DYOA 3DVNU 3X23A 4JIOU 2GBJA 1UELA 4ICVA 4HEOA 4IUMB 4YL8A 2GBMA 1SIFA 2BGFA 2KC1A 5J17A 5LXIB 2KD0A 3IHPA 2RPQA 2B3TA 2ZNVB 4ZYNA 3U8ZA 2KMAA 5L83A 3E46A 2JVCA 4IC7B 1R4MI 1QZEA 2QNJA 2KVRA 4ANVA 2XBBC 4B95A 2ZVOA 3AU5A 3CSTA 4HJKA 4IW0A 4PYUA 2N4FA 4BKTA 1WI0A 2CHXA 1F9JA 1RRBA 3DBHI 3H7SA 3Q3JA 3QX1A 3NHEB 1WE7A 3EECA 4K7SA 3OAWA 4DHJD 5KHQA 1RFAA 1OTRB 1IPGA 2K8CA 1H4RA 2JT4B 2O6VA 4KIKB 2AEHA 2LI5A 3TL5A 1IYFA 3M63B 3L10B 1WGNA 2C7NB 1TTNA 3EC8A 4E74A 2MBEA 2RSUA 3VH3B 2KOXA 2KO3A 1KJTA 2EKKA 4MH0E 3WA0A 3KYCD 1WZ3A 3WAMA 2OO9A 2L7RA 2ZPYA 4GDLA 4GB9A 4MGKE 3W1SA 4X57B 1L2NA 3ESWB 2PJHA 1D3ZA 3MMPA 3SDLC 2EMTA 2DZMA 2DZKA 4F7ZA 4NPNA 3ZDTA 4KSLC 4LJPB 1WGDA 2CHWA 1X3ZB 3A4RA 5BO4B 4LJOB 1H8CA 2MBOA 2FUHB 2M1MA 2J0KA 3UGBB 3R7RA 1GNUA 3ZTCA 1S3SG 1OGWA 4A3OA 2DAEA 2C60A 4IWQA 2DNAA 4P7IA 4FADA 4DK5A 4DDGD 1WGLA 2W9NA 3CMMB 4A20A 2DENB 5HKHA
chains in the Genus database with same CATH superfamily
3IL2A 1N75A 4L9JA 4XBFA 4G3OA 1NV8A 3ZQFA 4UUTA 2BKRB 3TPZA 3T8TA 4IZZA 1ZQ3P 1J09A 1FNUA 4X0GA 1WM2A 5JI2E 1E32A 3SQNA 1HXDA 4G6DA 1QOFA 4TUWA 3IG3A 2UZKA 4AJWA 2UU7A 2GRIA 2L76A 3RULA 3CCMI 5F04A 5EYRA 4G3XB 3HUGA 2KWDA 4OX9M 2MBHA 4N4NB 2CRUA 3P4SB 2YFQA 1GT0C 4D7NA 4XNFA 4ENJA 2IS6A 4II3B 2FBWB 4FASD 1A6IA 4E3CA 3S8PA 3DF8A 3G6EI 4IQJA 3W9CB 3OMYA 3AOGA 1KQ9A 1YX6B 1D0KA 3D5SC 5D8LB 1Q1OA 5FTNA 2DBBA 2MBBB 5IOZA 1FMWA 1QO0D 3VK8A 2DYRH 5EEHA 1J75A 3U6EA 5ITYA 1HW2A 1ENHA 3HOTA 1TWAJ 2ERCA 3A46A 1PGAA 4GKKM 4LJ6A 2D7GA 2HVQA 2O3FA 5FTKA 1GB1A 2ME6A 3JR4A 3OYNA 3A9JA 3FXLA 3K70D 3RI4A 3GLFE 2P81A 1B9RA 3KOWE 4LNOA 1YG2A 1XXHA 3JAMK 1EF4A 2K8BA 2M8GX 1EM7A 1ZH5A 3RKQA 2INCC 4IBGA 2EO2A 2W84A 2QEXI 2VBXA 1WFXA 4XSZF 2G0EA 4YRVA 3HWSA 2BW2A 4M6YA 5BMHA 2J7NA 4ARCA 3GO5A 2C7HA 4NOOB 2QJLA 4EEFG 3K92A 1O4XA 3JAMZ 4TKNA 2E7WA 3HSFA 1ZK8A 4RBOA 4RGOS 4A5MA 3U60A 3L00A 3N3KB 2OQRA 3ZH9B 2XLJA 1AUAA 2ZCBA 1EA3A 1FZPB 4UVBA 3SEBA 2LRDA 2DWMA 4NJ7A 4L2YA 5EGOA 3HJ8A 4BJ6C 3JRIA 1C4AA 3ZMSA 1B4AA 5IP4D 4LNFA 3GLHB 2NCNA 2CW7A 1EU3A 2VN2A 2JRHA 2PLYA 2XAFA 3PHWB 4KO8A 1Z3YA 2PVOD 2RGHA 1WR1A 4DZPA 2H88B 3BQYA 1OLTA 2JK3A 2Z9OA 4ARIA 2OPFA 3RPUA 5H6QA 2LUEA 4BQOA 1FC3A 4ANXA 1AKHB 5H92C 4IO9F 1ET6A 1UWXA 4C3IJ 3TP3A 2DA1A 3OYBA 4A3BJ 4EKUA 3LSPA 4KN4X 1SEBD 5J1YA 2L52A 3H5NA 1F2RI 1FJGM 1U5TA 3ZUNA 1L1TA 2IBIB 4M9ZA 3CUQB 4PUSA 1GAQB 3BR3A 2R7RA 1I1SA 3NZ3A 2YU9J 5ILVA 2QUFA 2MH8A 3JRAA 4C9YA 1JW9D 2M4NA 3OY9A 2WWZA 2DXIA 3B9JA 2MYSA 3GLGB 1Z21A 1X58A 4LK0M 2R7QA 2AX5A 2LBFA 4F3QA 3V6CB 2KT7A 1SXTA 2A6HF 3CZ6A 4PFOA 5BYRA 2KDOA 4WJOA 1D0ZA 4BU2A 5C3JB 3JSVA 1E10A 1IZ1A 3DWGC 3BC8A 1WYWB 2CUJA 3NY5A 4GIVA 5AEKB 2LYCA 3PLVA 2OU2A 4DWFA 1WXMA 3VLFB 2CS4A 4HPLB 4TV7A 1E8YA 2JSVX 4IOCF 1Z6TA 5ERIA 4BEHB 2DFEA 2H8RA 1ZPSA 4QPQA 4FJVB 4KLNA 2GBKA 2LVAA 3TMOA 1I42A 1SJHD 5LBQA 4XLCA 5DTDA 3S32A 3T15A 1FXIA 4D81A 2BVCA 2PTLA 3ZN0A 1MZBA 1ZG3A 4FULA 1J7AA 3ZNHB 2JUCA 1E3PA 2LEKA 3DLLF 4GC9A 1WRJA 3R66C 4M0DA 2HTJA 3RKWA 1NI2A 2ONQA 2W57A 2M30A 4O3MA 3KWLA 3FM3A 5LXIB 2B3TA 2GLOA 1IN5A 1QYRA 4UVAA 2W82A 4Z6YA 1I7HA 1OKRA 1S7AA 2GXBA 2C7NB 2M5WA 2EKKA 4MH0E 2IVMA 3T1BA 3KETA 1ZRFA 1SMYF 1Y0UA 4W97A 2EELA 2XZUA 4LJPB 4RM2A 1MHHE 1JKOC 4D1QA 4WURA 2MBOA 3V7RA 2KZUA 1EJ9A 3I56I 3FYDA 1TS3A 1DGRM 5C44J 2XAQA 4EGZA 4IHSA 1X1DA 3JYUA 2LNBA 1ZV1A 3JAMS 3L1PA 1YJJA 1F9NA 1J19A 1GC6A 2HVRA 4WXDA 4HNTA 4HCNB 3IH4A 4L16A 1J0RA 1MNMC 2O8XA 3DKXA 2VKHA 1TDZA 1SG9A 3WTYC 5CHWA 1WGRA 1IW7F 3SC3A 5ITQA 2FCSA 3LMMA 1Y6IA 2KDBA 4LJAA 4HLQA 2DHRA 3HTSB 3DBLI 4CHKA 2KZSA 1H0MA 2X38A 2LWXA 3KEYA 2M19A 2K02A 5JFRA 2LY2A 4OIQF 2C9WB 3ENEA 2J7OA 2V1NA 1L4DB 4YFXF 1ITYA 3HOVJ 3VRBB 3IH2A 1O3QA 1Z5CA 1ETOA 1P9QC 5E3LA 1NV9A 4DV4M 2IY1B 2LBFB 4BL0B 1IRXA 4JXJA 4Z8XA 4UHTA 3B9PA 2A5YB 3GUDA 2JA8J 4BACA 2MX2A 1WSUA 2ISZA 1HXYD 3H4MA 3AG4H 4UVCA 5HLIA 3GRVA 3CMYA 1MPEA 1P6RA 1O3RA 3CWIA 1FEXA 1WHUA 3HIFA 4TQ0A 1D5VA 2ZXIA 1REPC 4V2FA 3ONQA 2N7JA 2DT7B 5EP1A 4JE3B 5CKTA 1SC7A 1QA6A 2QC8A 1ZDXA 3T8RA 3GP1A 3VUYA 2OJRA 4KA4A 3H3ZA 3I59B 4I0BA 3BCBA 1BL0A 2DA7A 1SE2A 4A0XA 3U2SC 4MLOA 1SD7A 1NG6A 2VBYA 4IBIA 2JYTA 5EGOB 4AW4A 3UINB 1Q3CA 4LLNA 1WXAA 2KMCA 3MKLA 1WF9A 2BY1A 3F8BA 3VWBA 3Q8AA 1NY5A 4W9LA 1EH7A 4BNCA 2NPTB 2MP2B 1N32M 4M72A 1VDDA 1XDSA 4DYCA 2GXAA 1HW5A 2VQCA 3S1NJ 2XSDC 4CQNA 2F5NA 3LQQA 4FHTA 1DYQA 1V33A 3BZ6A 2DVWB 3TOAA 3RPFC 2PBIA 2JT1A 4UV8A 2M5ZA 2L7KA 3BLYA 2BHYA 1UF0A 2A61A 2AXTC 4KISA 3DQVC 2BW3A 1XC5A 2HEOA 1FYLA 2DAOA 4ZDPA 4F52A 1Q10A 3KUCB 1VQ5I 3BP8A 3JRCA 4EEWA 2BV6A 1N25A 3DP7A 1XG1A 4YHHM 3V4GA 5JR3A 1B8IB 3R4KA 4Y13A 2BY2A 3VFZA 4C7ZA 5D6FA 2IS4A 2Z0DB 2VRRB 4W9CA 2MROB 3RQ4A 2WSCF 2FH0A 2JZPA 3DCFA 5KAFC 2BNKA 2HTHA 1B1ZA 2XV4S 1TGUA 1R2ZA 2EIMH 4CGYB 2GAUA 2M34A 2FNPA 1JROA 3KP6A 1HBXG 2JXTA 1VG5A 1Y56A 1UD7A 4ZRIA 3EFCA 1JB0F 1RNLA 5E6OA 2GIZA 4KV2A 3JW4A 5B5EC 1W5TA 2J0MA 5IY5H 3L13A 1NSFA 4NL4H 1AHDP 2GBYA 4IDIA 2YUSA 4EQQA 2AQ3B 5GAGJ 3I3TB 1FNVA 1SXJB 3V7SA 4ZDLA 5K5QA 4FHKA 1FY7A 4HX4A 2VXDA 3WAPA 3A1QB 3WGIA 1MBFA 4E7LA 3X0WA 1W36D 1ON1A 1C76A 3CCRI 3KUDB 5J1UA 5LHIA 4JGHB 2KDZA 3C3DA 2BZTA 2EFNA 4WXHA 1PJSA 3I5JC 1ZGUB 1VQKI 4HDOA 3M8FA 1USSA 2DWZB 4PS7A 5JHAA 2LF7A 4ZHOA 5H2FC 1KLUD 3IWZA 3U8ZA 2L9VA 2HTME 4BQQA 1R4MI 3VKGA 2XBBC 4FD2A 3CUQA 4AG6A 1IV6A 2RNJA 4YFNF 3LB8C 3TL5A 2CUZA 1G59A 2XH9A 2LD5A 1ESFA 4GDLA 4NC6A 3HZJA 3L2QA 1WGDA 4LJ7A 3WG9A 3HOYJ 1WXQA 2ZMEA 3ASNH 4M9XA 2IGGA 1MJAA 1B9NA 1LDKB 4IWQA 4LGWA 2F5PA 4FADA 1U8BA 3K4MA 5DM7F 2GOMA 4A69C 3I5UA 2Y21A 5KQ8A 2R3SA 4XE0A 3B73A 1DPUA 3HYIA 1IBXA 2LOOA 1YLAA 2X6WA 1H6UA 4PGHA 2R7VA 1W7PD 5AIQA 4A3PA 3OYIA 4OHJA 4G7HF 3PUFA 4JX5A 5DCNA 5BMZA 3DU6A 1B59A 2QZ4A 3G3ZA 1V49A 2C6YA 2JA5J 4YFKF 2CHGA 2XK5A 4YELA 3NBXX 3P42A 4A6QA 4XLFA 1YE9A 4URKA 1R36A 4PCQA 2FQ4A 2L7FP 1T0QC 4QIWN 2JA7J 4AP4C 1O3SA 5E3NA 3PTFC 2EFPA 1U4AA 1IXSA 4BBNF 3BG5A 4B9KA 2MC3A 3BOSA 3FXRA 4KIBA 4ZTFA 1DQUA 2KAJA 4G0NB 3W2VA 3V7CA 2ECBA 5E1WA 1FXAA 2WHIA 3ABUA 2RDPA 2R93J 4N58A 4XGIA 1KLGD 2DMTA 2GOWA 3H35A 3HSRA 3U2RA 1C1YB 1I4PA 5HS8A 4LF8M 3BJ6A 4C2TA 1ZYRF 5AZGA 2KKOA 1EFUB 5IWAM 1WQ2A 2HJ8A 1BI1A 3KZIC 2HS5A 1K7AA 4FLHA 4NY0A 1IF1A 3RI7C 1Y8QB 3R8FA 2W25A 1EF5A 2EJRA 3L28A 1SJED 4C2UA 3ILKA 3WAOA 3C3WA 2EJSA 1E9SA 1RRJA 3A0BC 2K8HA 4A90A 3T0YA 2RDBC 3WGGA 4KDLB 1JUMA 2K9MA 4G6QA 4S17A 3HHZA 1S7EA 4NSOB 4HAMA 4GHLA 4J3OD 3PNYA 3VODA 3NQOA 2UU9M 2GQFA 3L9FA 3KLSX 2A07F 4U0VA 2R7TA 2BEOA 3CDIA 1Z5AA 1YQ4B 3OL3A 3ZXSA 4G4NA 4MO7A 3AE1B 4DR4M 4IBJA 3O8GA 2FJ1A 5JZEB 2DO7A 1ULYA 2XF3A 3KWVA 4FJYA 3B6CA 4L4UA 1N62A 4K81A 4DBGA 1JWAD 5HODA 2X1DA 3L2VA 2XIGA 2W3SA 2XRNA 2DMQA 1E94E 2WY8Q 3DFGA 1WE6A 1Z6RA 4P1WA 2MR9A 4AWXB 1QOAA 3FISA 5FLXK 3NVWA 4OZCA 2I1KA 1WGYA 2H27A 3RCOA 5HFYA 3APCA 1IQPA 3AECB 2EA4A 4ANRA 3DTKA 2NVTJ 4GIPA 4OZAA 4RLQA 4KMFA 1O7LA 4TUUA 2XHKA 1YOVB 4KZ0A 2Q2EB 2DHZA 2AQ2B 1MMGA 1BR4A 4PS8A 2O01F 3P9CA 2BGCA 1OPCA 4DR5M 1JXSA 5D94A 4EJTA 1VEGA 3H0GJ 5IT9K 3C3EA 1SE4A 4ZOHC 4HQEA 1P98A 3GLLA 1RKWA 2KLGA 2JRMA 1FFVA 1VQPI 4QPOA 1PVEA 1KFVA 3L16A 2V4LA 2WXLA 1MDMA 2HNHA 1K78B 2IGDA 4HLXA 4ZRKA 4BAYA 2VDBB 1XMXA 1Z7UA 3TKYA 4C7YA 1B1BA 2JY6B 2FRHA 1BR2A 1DOIA 1Z0XA 2DAIA 2KWUB 5D3IB 2XGNA 2Z99A 2HQRA 3I4VA 3M1CA 2KMUA 2CP8A 3C0RB 2M7AA 4CDGA 3E6CC 1Z3XA 3PGEA 3E97A 4HNUA 2WXNA 4XKWA 5F1JA 2CJOA 1X1PA 2WGSA 3A01B 2M4KA 2GBJA 2KIQA 4HEOA 2PMHA 2KC1A 3OYDA 1ORYB 1UG0A 5HVQC 2JVCA 3I4YA 1VNDA 5D5UB 3SMPA 3DLAA 4S04A 2VONA 3WG7H 3THGA 4GMQA 3I57A 3VB2A 3OAWA 1RFAA 4KIKB 3I64A 3CDLA 2ZJPF 2ON8A 3KS8A 3ZCBB 4KN7X 3OIPA 2I38A 3EA6A 1B72A 2K4JA 2DZKA 2FBKA 4F7ZA 1VDVA 3PIOF 4BXFA 4BH9A 3H3UA 4NSRA 1T38A 4B3MM 1U9OA 2VE8A 1BIBA 3R0JA 2J42A 5K5OA 2OPTA 1IDYA 4DV7M 1WY8A 4EZKA 4EUTA 3HUGB 4N59A 2H6BA 1JT0A 3MC0B 4XRMA 2HOSA 1FX7A 4XYCA 3Q9SA 2FEZA 1WYGA 8CATA 1K50A 2OV7A 3MKZA 2MSED 1YMHE 4B48A 3CJQB 3D8LA 3QPTA 3GTPJ 1F1ZA 5KPTA 3HDDA 2EB7A 1WJEA 1R5GA 2K0PA 4MM3B 3AM9A 2NTTA 5EDSA 1NYRA 5FTJA 1PRBA 1R4GA 5G5HA 3TL4X 2KISA 4I6ZA 2WP9B 2EZKA 2EKEC 4ZDVA 2E2JJ 1UELB 4RAYA 3NZUA 1IJWC 2K27A 2KJHB 1S3JA 4A3JJ 1LB2A 4IBFA 2CV0A 3FUWA 4AIDA 4MEYF 1H88C 3Q8GA 1I35A 2JY8A 1S5LC 2O7OA 1Z5SB 2E71A 1QDRA 1N78A 1XMOM 3R2IA 4DJAA 5DNYA 1T0SC 4MGZE 3V42A 2VE9A 4EATA 2KHHA 1ZKGA 3WU1B 2BT6A 3GLFB 2VLAA 3LNQA 4QNRA 1XC8A 2Y31A 1LM8B 3LWFA 3S3OA 3M6AA 2LASA 4II2B 1VD2A 1I4WA 2M4GA 3APDA 1QZYA 1IBLM 4G6ZA 1QLBB 4IOIE 1LV7A 2HJ1A 3PO2J 3RUIB 2LD9A 3CMMA 1R22A 4QLCU 1OQYA 1I3QJ 5FLXZ 2CQ7A 1C4PA 5FK9C 2LFBA 3ERED 1NJFA 4JI3M 2NOJB 2N9EB 2HDEA 1FP2A 2H09A 2VF7A 1K79A 1QRYA 4EZJA 5K7HA 2HKJA 2KL4A 5HS9A 2BY0A 2QF7A 2FCMA 2Y0TA 1V9JA 2KW0A 1VI0A 3EDPA 1OFFA 3AJIB 3EQLF 4LF5M 2F5QA 4W9EA 3UKGA 3HRUA 3BY4B 3S3MA 3M3YJ 1V92A 2IO3B 3IAM1 2HQ5A 2EK5A 1QT9A 1KSFX 3L08A 4OAYA 4OVUA 1HT1E 2V4JC 4C80A 2CH0A 3S3NA 4E6KG 3OSGA 1MBHA 5DUIA 1YFHA 3FRIA 4GSWA 2H1RA 3KW5B 1L4ZB 1TWGJ 2LXCA 1R2YA 3B7QA 2HTSA 1E2XA 2E19A 1Z2MA 2K4BA 3ABKH 2WXRA 2WAQA 3PS6A 5DPTA 2E1MB 1DP7P 5LLIA 1FSHA 1V8CA 4LF6M 4USAA 3FYCA 2JU6X 2YNMD 3EYYA 3MVPA 3PQKA 3AKZA 4FTHA 2EZIA 2LJIA 1FM0D 1T5XD 4IHWA 1ROEA 3B02A 1D4BA 3ML8A 3KEOA 1DGBA 1WGKA 4PDGA 3IFWB 4EIWA 2LKXA 3GLHE 1YIOA 3JTHA 4Y33A 1PQSA 2V9HA 1BC7C 2QSFX 1VJKA 2IDYA 4WWCA 1XQQA 4XN3A 4MH8A 3K1MA 1G4DA 2K6QA 1TH3A 3EYIA 4DBRA 1XCTL 2ZCCA 3GP7A 2J5PA 2QA4I 2KRFA 3PSEB 4EM1A 3RPQA 1L0YB 3HM5A 4QNMA 2V3NA 5FKKA 2M0XA 1V5EA 1FO4A 5J8CA 1ACIA 4LF7M 1GXPA 1TY2A 1BI0A 4REZA 3JR5A 4BJTA 2HD5B 5FLMJ 5CPRB 3EUHA 1DOXA 3VDUA 1DU0A 4N9F4 1R6RA 2V0GA 3GO8A 1W36C 2C5RA 1DUXC 4W9JA 3VPRA 3AOEA 5FLVA 2K9NA 2GOXB 4I0AA 5GAHJ 2N7DA 3QCAA 5CVVA 2X85A 1LFDA 2CG4A 1FTTA 4MT5A 3O13A 1OCRH 3RPUD 2KT0A 2QWWA 2MGWA 1OCOH 3X23A 3ROUA 4YL8A 3TEDA 3P4PB 4M6VA 3DBRB 4GFBA 2XSZD 1LJ9A 5FKMA 1V1PB 4ESJA 3E46A 1FNNA 1PYVA 2TDXA 4HJKA 4AKIA 1CZPA 4BKTA 4JWSC 1WI0A 2OQ4A 5D5VB 4F55A 2YSRA 1ZG5A 4HV6A 1OTRB 3RFWA 3SHGB 4E70A 2QCUA 3S93A 2XKPA 3VH3B 1E3OC 2QENA 2KO3A 2CQKA 3KYCD 2OO9A 1LFPA 1AWDA 2MHJA 1D3ZA 2P0WA 2CQNA 2PX9A 1D3YA 2C99A 1X3ZB 2WAEA 2CHWA 5IT3A 3UGBB 1R4MB 1C77A 2BQQA 3ZTCA 4P7IA 1WRIA 4WCGA 2WNMA 3S17J 1XSVA 2WQYB 2QDFA 3WCQA 3SBJA 1BI3A 2HAKA 1PJJA 4TSSA 3H5RA 3ERMA 4U87A 3CP2A 1FRDA 3QYFA 4ZYGA 3H1UA 3OWEB 1D1BA 2R7FA 2V1YA 1W4MA 2L1AA 3VYRB 2MWSB 1O57A 2V79A 3BT9A 2L09A 2YEPB 3W6JB 2FQ3A 1C79A 3CQZJ 4DYQA 4ITKA 1JWSD 4R7GA 3PHXB 1WXSA 4DV5M 3R60A 2DQRA 3HG9A 4JI2M 5HOOA 2L5QA 3J81S 3KYLA 1TZ1A 2K7LA 3F3XA 2AYOB 2CHQA 1I39A 1TH4A 3GLIE 4CCJA 4W9IA 2KN4A 4BJ5C 3P4QB 1FCCC 2G7UA 4RH6A 3UF8A 1YS6A 1I3AA 2LXAA 4Q7JA 2LXEA 1PP8F 5IYDJ 2Y0SA 1UZXB 2VKVA 3CMEI 4P5OA 4RF0A 2KFKB 3FMQA 1YW8A 4ZYSA 2KN5A 5E17F 1G8PA 3R8BA 4A3MJ 3KEQA 1O3TA 4FA6A 2C98A 7CATA 1ZMUA 4D5CA 1HT2E 3OYEA 2FS1A 3W0LB 2MJ5B 3SAWA 2ZKZA 4FBJB 4PK4A 2EFOA 4MIMA 2I10A 4B7GA 4DQOC 2WXIA 4IWPA 1JHFA 3T1YM 4EMSA 1P4WA 1QOBA 2OOAA 1NK2P 4HF2A 4PSXA 2LGIA 2R4JA 1GJSA 2ID3A 3T38A 4GXOA 2DK5A 3WTZA 5M5XJ 1F2RC 4Y7NJ 4HWIB 1SEUA 1KYZA 3HXLA 3K4CA 1T8IA 1D1AA 4FWDA 3AULA 4MGHA 3M62B 3F21A 3AEBB 2DX5B 4YG2F 5EF6A 4IJAA 1WRDB 3Q8BA 4A55A 2H1KA 2PI0A 3K4KA 1FCLA 4UNOA 4KODA 4ENMA 4KKIA 4JYKA 3APFA 1GUUA 1HCRA 1L5PA 1PDXA 2DKLA 2KXEA 5ITXE 3PVLA 4OZBA 4EJOA 3DA1A 3EUKL 1F1HA 4WAFA 4FCWA 2RKHA 5EXXA 2CHVA 1F4KA 4UY8I 1HJPA 1W7PA 4CCNA 3DPTA 4JWUC 3BPVA 3ZRCA 2PFBA 1ZMWA 4GITA 3V3XA 4CJ6A 1WHCA 3GFLA 1WWXA 2FNJB 4BY7J 3CF5F 1JRUA 2BB5A 1VQ8I 2XRLA 3N9YC 3VFKA 2ZW0A 4WH4A 3F8CA 1YJWI 5LXHA 3AU4A 4DR7M 1W0UA 1QVUA 4W9DA 3HPHA 1LNWA 3NZSA 1YJNI 2CRGA 3VTWA 2E1OA 2BW3B 2L02A 2IJ0A 5KPRA 4MGRA 2HU9A 4C3JJ 2ECCA 2JWTA 1Y8GA 1NG7A 1TBXA 4S12A 4RFBA 3VVWB 2DNFA 3ZC7B 2CS3A 4RDUA 2NPTA 2DZNB 2AS5F 4A3VB 2QZ8A 2YQZA 3FILA 5FD5A 4GDKB 1FP1D 1V97A 4PJLA 3WGHA 2ZAOA 4P6VF 2BWBA 3ZVVA 2Z0EB 3GRYA 3IH3A 4JI0M 3RMKC 1OR7A 4RGUA 2O2VB 2V1XA 4LD5A 2M17A 1YRNA 2DFFA 1FT9A 1OCCH 2P5KA 4ZPXA 3HK0A 3JRDA 4ZRPA 3I54A 1JR3D 2ZXHA 3HOZJ 2VPLA 4LNNA 2BJWA 1M1EB 2LVSA 2LWPA 5FLXS 5CHFA 1R4NB 3MAJA 1J59A 1W5SA 3SFZA 1WJCA 2VJIA 4B6WA 2EZHA 4ICVA 1T6BX 2WDVB 1GDTA 3J7AO 5FFZA 1OYYA 5L83A 4IC7B 5BMIA 1I1GA 3Q9VA 2X1EA 4FCYA 2HVSA 1R7RA 4X1EA 3NHEB 1N60A 1IYFA 1WI3A 2AEHA 2LI5A 2B7EA 1WGNA 3TO6A 4H0EA 3QP5A 1Q1HA 2ZPYA 2OTJI 4A8XC 2Y0MA 3FTEA 3Q3NC 2UXBM 4N6EB 3C58A 5D4SA 3VYSB 1N33M 3AMZA 3ZXRA 2NVYJ 3DXJF 1A04A 1IFYA 2RMMA 1WGXA 3TW7A 1NNUC 3L2UA 3HGIA 3L0WB 5J4VA 5C2TB 4BOSC 4C56C 3MC8A 2BBYA 4KT5C 1TP4A 2W24A 3JSPA 2Z4RA 4BFRA 2KLCA 2A68F 1AYFA 3HKZN 2XFSA 1DO2A 2LVNC 3I59A 1TZLA 3TWMA 3L29A 2KTRA 1Q5WB 4IIWA 2JSCA 2NS5A 1ZN2A 1D5ZC 3FMSA 1VEKA 4RAZA 3E1SA 1MMNA 3D0SA 4DOZA 1JR3E 3ABLH 1RAXA 2VQHA 3O3KA 2DA3A 4ZRJA 1VQ1A 4G9YA 2KDEB 5GTIC 1H89C 2JZYA 2NVXJ 5EZHA 2V6CA 2MBFA 3D32A 3MHSD 3WHBA 3BR0A 1QU3A 9ANTA 2L7ZA 2ZTCA 5E1ZB 1X2MA 1H9TA 1ORKA 3H7PB 2BYFA 3FUXA 2FMLA 5F0FA 1E8WA 1ZMVA 1PGXA 2AQFA 2JTVA 2K3UA 2KWCA 4Q4ZF 2M56B 2O9LA 5GAEJ 4PJ0C 1R23A 2MJ3A 1GPXA 2V9KA 3KLOA 5D8KB 4XOPA 1GL7A 1ETVA 3B6AA 4UB8C 4A3GJ 4KT6A 4A3FJ 2O8KA 2C7MB 5EXSA 3A0HC 1R9TJ 1TYGB 3HU2A 1XWIA 3NVYA 2WU2B 5EEGA 1CF7B 3ML9A 3TEXA 1WJFA 4AUQC 3FUTA 4GEWA 2IPQX 1XHBA 3GS2A 1E8XA 1ZOYB 2COMA 2CJJA 2HFHA 2KK8A 4LFBM 3BG7A 4NB5A 3R3MA 3ZQHA 4V19K 1SD6A 4S0HB 4M8MA 4S05A 1ERDA 3K1JA 5B3SH 4KX6B 4RGSA 1JKQC 1XD3B 1UFMA 3J7BA 1C7YA 1Y8RC 4IBEA 2QSGX 5KPZA 3OR1C 2Q2EA 2Y69H 3KP7A 2DW4A 3TP0A 5FR3A 3TEWA 4NBQA 3PPAA 2DAJA 3QYEA 2I5UA 4XLPF 2LMDA 3LA3A 2HYFA 4V2GA 1BN5A 1RR7A 1CF7A 3I63C 3IWFA 3W6KB 4A9AA 5LFAA 2K86A 4M6XA 1ET9A 2RQPA 4FVMA 5FD6A 3S2AA 2W7NA 2H89B 1G8XA 3TDUC 1E7VA 4LFAM 5J4YA 3PNVA 1E3HA 1A70A 2O25A 3HHMA 1ZAOA 4RGRA 3PZDA 4HF0A 4HRIA 5A2QK 4W1UA 4M73A 2BS2B 5TGTA 5M3MJ 1Y8RB 1R6BX 1KQ0A 3AEDB 2KKCA 2AL3A 2BWES 4LCDE 2ZJDA 4B47A 2JRTA 1U0JA 2XAGA 2A5UA 3DQVA 2RN7A 1RLFA 1LVKA 1YSYA 3FHNA 3C8YA 3GWZA 1BW5A 3OYHA 3H9DA 2DMUA 3HB9A 2DA6A 4PK1A 3WIMA 2DA2A 5DYIA 1UG2A 2EWNA 3BVZA 5BS6A 1NI3A 3GF2A 3COAC 1RUOA 4PDKA 4D0PA 2KC2A 4HRSA 2CKHB 2OHFA 3VKHA 2L01A 2VT2A 3B89A 2GA1A 3U30A 3KYDD 3KYCB 4KYWA 3HKZA 4PCZA 2R18A 5DS9A 5H8YE 2HWJA 2L0TA 2W00A 1GV2A 3M4OJ 4ENNA 1YN4A 3LJ3A 2V1CA 2BS4B 4E7IA 1IY1A 3ZN1A 1KLVA 4XX5A 3LW5F 3AV0A 2MLKA 2KZGA 1GC7A 2C9CA 3LCUA 3KLNA 5DPRA 1Z05A 4JN6A 2BKFA 2MSYA 3A2KA 2WLBA 1IN6A 2DI3A 3DCGA 4WAAA 1KOTA 1SSNA 4B3XA 1T98A 1LGRA 1PFDA 5HLHA 4MQ9F 2QPAA 3I51A 1ZAEA 2PLPA 2E1NA 4HOBA 4B0MA 5ILUA 1IO2A 3G71I 2LHGA 1BC8C 2INPE 3GTOJ 2MBEA 3LOCA 2FOIC 1KJTA 3WA0A 1JALA 3S2HJ 3CLOA 3TWLA 3NRVA 5JLWA 1N5WA 4RAGA 4F93B 4XOTA 1S9HA 3KXEC 2WBMA 4K3BA 2JA6J 2LH9A 2DYSH 4IHXA 4LNKA 2STTA 3D1NI 4XMYA 1YX5A 3R6SA 3VTVA 2GBRA 2RREA 3I53A 2K5CA 3SEQA 3IRQA 5LGUA 2R7UA 1J0GA 2FUG2 5EE3A 5CTRC 2KJ6A 1G3WA 1TY0A 3Q3OC 3BTJA 3ZJVA 2E5LM 2X51A 1K6OA 2IS2A 1XMQM 4OVVA 5JI3E 2P4WA 3KPHA 2VQEM 4MJSB 1J7BA 3LFUA 4RAFA 4IRHA 5GXGB 3MP9A 4DZJA 3H0DA 4JPSA 1FXTB 1E6EB 3C2BA 3AG1H 4MEXF 4HYEA 1APLC 2B76B 2VF8A 1E8ZA 3N97A 2QHOA 3LSMA 1Y1WJ 4U7BA 3H9QA 2DWLA 4I81A 1DV0A 4R1HA 4I6NB 3K9TA 3SZPA 2RRUA 3N30A 2G7HA 3S1QJ 2J0JA 1T0YA 2ZAMA 1XSXA 2MG4A 3GX4X 5HI1A 1OR7C 4BE0A 2CQQA 4JX4A 4AKGA 2L3DA 4XKCA 3LDZE 1OIZA 2XNAC 3P1MA 3IRRA 5BOXA 4JLCA 3DFZA 1VZ0A 1EV7A 3B1LX 4J19A 1YNTE 5IOYA 3JW0X 3HJEA 3FTFA 1UB9A 1TR8A 2B0LA 1K83J 3LYYA 1HSTA 4PZJA 1SFUA 3ZKJC 2LK2A 2M8SA 1VTNC 5E6NA 4NZLB 4HV5A 1V3FA 3J7ZI 2L32A 5E18F 5BPDA 1EWCA 1GKIA 1K8RB 1T56A 3DEEA 3SYKA 3J81K 2JWZA 4IRIA 3BR6A 4GGQA 4AQYM 4AZFA 1QGPA 2V1UA 3LSTA 5ITRA 2K22A 2UV1A 3I4MJ 4II3A 2KTFA 1OKSA 4B0EA 1UHSA 5JXVA 3IHUA 3KS4A 2YS9A 4EJUA 3MFGA 4PSWA 1LDJA 3HJSA 5ITXA 4M71A 3J80Z 3ZGZA 2NVUB 1JCKB 4LNIA 3U6CA 3IAS2 2PIAA 4BUPA 5LLQA 4EOYA 4J00A 2NXNB 4AYBN 3IXSA 1PJIA 2QQ8A 4A3CJ 5J8FA 3JRBA 3HM6X 4I01A 1HTOA 4F92B 4CYCA 1PUTA 4LJZF 2IP2A 5KNLA 1I6XA 1NHAA 2HQAA 3ZJUA 1OISA 2ZBKA 2W54A 3L25A 1J9IA 1P9DU 2JY6A 3SZTA 4KT0F 2R5ZB 2W4SA 2CJNA 2EIKH 3R7QA 1VQLI 1TKGA 2DMNA 2L4MA 4BLCA 1U6GA 4DXGA 5ICEA 2KLOA 1U5TB 2HOTA 3MJ5A 2M87A 2VI6A 5MPOA 3HY5A 4BBSJ 4E4HA 1XLNA 4LK1F 4QAYA 2WAQN 4ZH4F 2XUBA 2DZOB 5EP2A 1YS7A 2KTRB 2UUBM 2RGVA 1TT5B 3IT6B 3IUOA 4G6TB 1J5YA 1C3TA 3M8EA 2G3QA 1GLNA 3IG5A 5EE1A 3U6OA 1A6QA 3RYRA 4NQKE 2ZNVC 1J8CA 2CV1A 3BG6A 5FJ8J 2LUMA 1UGMA 4LK0F 3DPDA 2FCNA 1LTMA 2HPIA 4CISA 2K5PA 1NEKB 2JY5A 4WWOA 2L8JA 1T43A 2ELKA 2CU3A 2LR8A 2CWBA 4G4RA 4MTDA 4ZYAA 4NXNM 4II7A 3F92A 5F3WA 2N9KA 1HNZM 2Z3XA 4GDLB 4XWWA 1AOYA 3FK6A 4IKFA 1QAQA 1HNWM 2HKOA 2L2OA 1OAOC 4LFCM 5KO3A 5C3EJ 2IJLA 3DDCB 2MH7A 3UR3C 3P7NA 3AE3B 1VQ6I 2FD5A 3RYTA 1RC9A 3ZGKA 2QSHX 1JMLA 2LSOA 2QLZA 3U1KA 1BA5A 3KH0A 2XKOA 1ZREA 2DZLA 1RU3A 4US8A 2LY1A 2D5GA 3KOYE 4IUMB 2BGFA 4PDIA 2X6YA 4OWRB 4XSXF 1R5HA 3CO7C 1TS4A 2ZVOA 3CSTA 1SIJA 3C19A 4PFPA 4K7SA 4DHJD 4I2OA 1ZP0B 1CGPA 3I71A 2WADA 4HX8A 3Q6BA 3OS1A 4X57B 3M9AA 2VPRA 1K82A 1MW7A 1H8CA 2FUHB 4X62M 2J0KA 4DQ2A 1E9RA 2DAEA 4ESFA 3M7GA 2KHMA 2NS7A 4HLYA 4YT0B 3G1MA 1FNWA 2X1CA 1OCPA 5IA7A 2E7XA 1F4IA 4KGRA 4FXCA 5HS7A 2NOGA 2D7EA 2E5ZA 4D7MA 1WIAA 1IGCA 1TWHJ 4RCOA 3EIEA 3GTQJ 4KDPA 4YWGG 4BOZB 1VQOI 4HEA2 1PGYA 2RQQA 1TTEA 3KDSE 1Y1VJ 4WQOB 2KXJA 1IXSB 3W0FA 4HPPA 3FHZA 3ELKA 1W5CC 4HSTA 3SYLA 3QAQA 1VRAB 2KDLA 2XF5A 3QQ8B 3TBIA 3BWGA 4NQLB 2G9WA 3QWLA 2BS3B 3F8NA 1IXZA 1YX3A 1PUFB 4M8NA 4AG5A 4RGXA 3Q2AC 3J27B 3AE6B 2J4XA 2YLMA 4B7FA 1FWZA 1SVLA 3E21A 3AOEC 4FJZA 2ZJRF 1XPXA 4KKJA 1CK1A 4DDID 2R4EA 1ETXA 3KOZE 1WH3A 1GXQA 5DD8A 2DQLA 5M3FJ 3CESA 3RJPA 3DEUA 5L3DA 3GW2A 1HNXM 1TT0A 3ONSA 1MJDA 1GB4A 3L54A 2KNZA 3P5JA 4XDDA 5L3FA 4GH9A 3QODA 4ASNA 1JJ6C 2D7HA 2CR5A 4MFEA 2YU3A 3KSJA 4GHAA 2FX0A 2WS3B 3B7ZA 2IT0A 1L2BA 3QK0A 2ZVNA 3DOAA 3B74A 5FKOA 2VL8A 2MCNB 4RLFA 3GLHA 4EJVA 1HA8A 1MI0A 1V6EA 2G4DB 4KFCA 1WMHA 3GLIB 1P7EA 3VSLA 4HK2A 1JQJC 2R5ZA 4P1BC 4JK1X 3DBLB 3W68A 4M0WA 2UWMA 2P8TA 4OU7A 1VZ7A 1I4QA 4LB6B 4GU2A 5TISC 3VR8B 2R7XA 3SD5A 5C18A 4IRGA 1E7PB 3LXFA 2L2DA 3GZNB 1XB2B 2W55A 3S2WA 1OIPA 2RGFA 4IBKA 4M3DA 2DLLA 2IY0B 2KDMA 3FK7A 1USTA 4LGMA 1OQRA 1N77A 3FM5A 5FROA 3KIOA 3KVFB 3QARA 3VSKA 5M5WJ 2Y30A 1VQNI 2DDBA 2Z33A 3VHTC 4M01A 5CX3A 2Z8YM 4CO8A 2N9PC 1G3SA 5M5YJ 3HOXJ 4YIIA 2I7PA 4A6EA 4HF1A 4RS8A 4M3GA 3K4BA 4UV9A 4X66M 3P4RB 4B7HA 2DOEA 3H5AA 4RM8A 2EKIA 2OUMA 4D9JA 1S3SA 2EIJH 2DU9A 3NJTA 2JY7A 1ENFA 3K8ZA 4HX7A 3OLMD 3GLFA 1MMSA 1JTYA 4A3IJ 1IRZA 2XB5A 2XROA 3RFZB 3WANA 4BE2A 1YJ1A 1JWBD 2PEAA 3JRFA 3BK2A 3DBRI 2WV0A 2ZPNA 4L5EA 1HDDC 1K3XA 2LHDA 3A42A 4R8HA 2V6EA 4HPMB 1ZRDA 4B43A 1GJZA 1FIPA 3UQBA 1I27A 1UGJA 1L1ZA 1K4TA 1R4NI 2C9OA 3D5LA 2L3ZA 3AH7A 1KYWA 3RZWC 3I01M 1E9MA 2R0IA 3QJZA 3AG2H 3U6QA 1QAMA 1Q1VA 2ZXJA 2HKXA 5E1XA 3DHIC 3CP8A 1T3QA 2LGSA 2KQSA 2LTUA 2Z2SB 2ZTDA 4JYAM 2VJ4A 3PZ7A 3UGJA 2LVPA 3W2WA 3Q0UA 3L17A 2KQRA 3ZMUA 4GKJM 1RESA 1GVDA 2KQ4X 4DNCA 2CO5A 3SU8X 1Z91A 3GTLJ 4BY1J 2LJ5A 2K25A 4GYGA 1BUIC 2JPCA 3QPLA 4IM2A 4D80A 1ZG1A 4DV1M 1BJZA 2LVOA 1GV5A 3FXKA 3GTJJ 2LBCA 3HOSA 1ACCA 4XKBA 2R45A 4YTMB 3OYFA 4OVZB 3ZRFA 4BXXJ 1JI8A 2EILH 1X2NA 2KMAA 1Z9CA 1MH3A 3KFUG 4EV0A 2R4GA 2XGDA 1BBYA 3AE8B 3HRTA 1YO5C 4ABZA 3H7SA 1F9JA 1RRBA 1GVJA 2DFIA 5E8GA 3BWUD 3RSNA 1QQWA 1H4RA 2MEKA 2KRUA 3FX3A 3LVWA 2WC2A 4F91B 3VR9B 2ZMEB 3LSIA 4GB9A 3A4CA 1LFUP 4DV6M 2M3AA 1MHXA 2PMVA 3TGNA 1PM5A 2Z7JA 1E17A 3MHZA 4B09A 4DDGD 2RGOA 4A0YA 4HKZE 1IY0A 3O6BB 1BR1A 1NVMA 3QQAA 2OD5A 2O0YA 3ML6A 2Y75A 1V5OA 5TRDA 1E5WA 2FIDA 2N0SB 4BBNC 2C96A 1IN4A 3SAUA 1T0FA 2WXHA 2N1VA 1NK3P 2FNAA 3CCUI 1RYJA 3QC8B 3DPLC 1IXRC 1W1WE 3QHTA 4QWQA 2K9SA 5HDGA 2PJPA 3BIID 4LGYA 1YIWA 4BB9A 2D11A 4XQFA 1MN3A 2P5LC 3ZR8X 5GPCA 1K53A 1Y39A 5EG0B 1DPRA 3X2QH 4IKGA 3G1LA 4FETA 2PMZA 2MQJA 4IBDA 3G4SI 3MTNB 3MZ8A 1X3WB 2DAFA 4IL6C 2WX0A 1AU7A 1TGZB 2VC0A 3EFUA 2LVQD 2OCEA 4X65M 1DGHB 1D8KA 1P7JA 2ZEQA 1ZGAA 5FTMA 3PFIA 3MZYA 2EQRA 3J80K 4DXFA 3PSIA 2ZC2A 2AHMA 2EV0A 1XXHE 1EUVB 3GE3C 1DO0A 3WHCA 4R3DA 2H6CA 1Z1DA 3PSFA 2XGXA 5CVUA 3PZ8A 1PUFA 2F4VM 4IM0A 2V3PA 1OFIA 2KA6B 2DJIA 1CJEA 1B9MA 1ONVA 2K47A 3LL7A 1J7KA 3DU5A 2VC1A 4N0BA 3U6DA 2DFHA 1TQMA 2NS8A 2V7FA 2KNBA 3TJPA 1ZLKA 4OOIA 3KP0E 2R7ZJ 2ME0A 3AEFB 4OIRF 4JI4M 2D45A 2YEPF 2F5SA 1U5TC 4BQAA 2LP0A 2D3CA 2ICWG 2MRPA 4IOAF 2HYJA 4MNUA 3I4NJ 4A5NA 1PGBA 4LF4M 2ZNYA 2XASA 4DHJB 4AM3A 3M0EA 4WX9A 5JHFA 1T3TA 1F43A 3CC4I 3GPUA 2UXCM 2ISYA 4HJGE 1IP9A 4L0ZB 1BMLC 1YN3A 1LEAA 4WW0A 4L0YB 2L00B 2PW9A 1IRGA 2E3TA 1VZ8A 4WXCA 2CUFA 4EJWA 4OU0A 4GGGA 4CIZA 5CYVA 4HSRA 1FTZA 4WIPA 1TC3C 5HLGA 3CCQI 5L3EA 2NR2A 4L5IA 3NOBA 3K9OB 1L8QA 5HDKA 4IF4A 2NMQA 3LSRA 4L1BA 4JV5M 4DIQA 4I5SA 3F6VA 2JZZA 1WGGA 1CMXB 1FYMA 2XF6A 4I8OA 4RF1A 2NNYA 4MFDA 2ASQA 1E0EA 4ZRQA 3E5UA 2R2OA 4YSXB 1UJ8A 4JQFA 3HHXA 4DV0M 3TW6A 2FBHA 2VJJA 2Y9YA 2ICIA 2D3GA 3BYTB 1IY2A 2E1CA 3U21A 4BKSD 2ZZPB 3QPSA 3F23A 2KDFB 3ZO5B 2AL6A 5LNK1 2EV5A 1SFXA 3ETRA 1JWUD 4HROA 1NY6A 2I7NA 2E35A 3ZMDA 3GMEA 5HHDG 5ILSA 4LIVA 3ZNGC 2X4HA 3DBSA 4OW0A 4L23A 1A5RA 2WA0A 3RNEC 3C7JA 2XGCA 1D5YA 1L6UA 2IYDB 1QPIA 4LRTA 2DT6A 1U8RA 3WTSC 3RE8A 5ITUA 4RM3A 3EHVA 2XK5B 1LXDA 2RC4A 1MVKA 3B2FA 1XSDA 2CQXA 5T8IA 1KU3A 2KFJA 2K1FA 2G3QB 2HI3A 5JI6A 3OJ4B 3E56A 2BXYA 1G2HA 3ZTDA 1NH3A 3CTWB 3ZMZA 2M9HA 3ZQJA 2KJBA 2GB1A 5AIPA 1YQ3B 1XF5L 2L7HA 1RZ4A 1NTCA 2HDDA 1YQBA 3A1YA 3GVAA 1N5XA 3ZCOA 4WJNA 2UUAM 2G8LA 2XEWA 1SVMA 1X4PA 1SE9A 1LE8A 1YJIA 2J52A 4RNAA 1FOXA 4L78A 2NBUA 1JWMD 2E60A 3OYGA 3H6NA 1FYKA 2JQ7A 2GBNA 3ISPA 2JWSA 4CZCA 4RGTA 3T3NA 4RB2C 4YTPB 3T5XA 4XRFA 5BYSA 1TKYA 1L0XB 1QZEA 2VQLA 4ANVA 5J40A 3KCCA 3MKYB 3J7AS 3P9IA 2V6ZM 2KRHA 2QEJC 3GTGJ 3U6LA 1SXJC 3PO0A 4PGGA 4HQMA 3JRHA 3CTAA 3L4PA 4L9NA 2N35A 1YITI 2BE5F 1OGWA 1YI2I 4MTEA 4DK5A 1X37A 1JGGA 4CHTB 2O5RA 3LA7A 3FXJA 1HR0M 2WDRB 2OQGA 2BXZA 4P9UA 4WWPA 1S6LA 2D1VA 1ODDA 3HRSA 2VKDA 4FN2A 5L8RF 4KGSA 1E90A 2DPUA 3O65B 1YW7A 1LVAA 1N63A 5ICGA 4N4OB 2KEBA 4YEJA 2UUZA 4ZDOA 2FSWA 1FSEA 4II2A 1ZARA 2HDCA 1TW3A 2FOKA 3BTLA 3ZMTA 2DOAA 2K6BA 3C9PA 1Y0NA 4BKXA 2WYQA 3RCZA 2Y9ZA 4LITA 1XGOA 2MBQA 1T0RC 1OAIA 2KZRA 3FZVA 4MGIE 5K1YA 3E4RA 1IBXB 2CV2A 2L4FA 4AUXA 1C9FA 3MJWA 2D2QA 3QOPA 5D3DA 3PJRA 4MB7A 4L15A 5FRNA 1SGHA 4NC7A 2J5YA 1V5TA 5LEJA 3AI5A 1EIJA 4GOCA 2V3SA 1EO6A 4M02A 3V8KA 2JUGA 5E8IA 5EE0A 3KP3A 3A45A 3E0JB 3EPZA 4DBGB 4MHGA 2YR0A 5IAAC 2O6VB 3OS2A 2R7DA 3J7YJ 2K3FA 1OJLA 1FBUA 2GZWA 1NHGC 1WVRA 2FA5A 3CCJI 3TOBA 3U6PA 2D07B 1MFWA 1UBIA 4UUVA 2L0FA 1HLVA 5CQGA 2RV8A 5LEKA 1QBJA 2R5YA 2LGYA 2BPSA 1NVID 5L3GA 3R9XB 4RM9A 2HHHM 3B08A 4MSMB 4LF9M 3CJNA 3Q0VA 3ZIMA 1FMVA 1V54H 3OS0A 1V80A 2ETHA 1IAWA 3HHWA 2DAGA 1MJBA 2LH0A 3AL0B 5DEQA 3EUAA 1QILA 4KMUX 1BW6A 1T0FC 5DYMA 3DTIA 4XN0A 1TIFA 4D82A 3TWKA 1X1AA 3MN2A 2OZUA 1LQBA 2BWEA 4ETSA 3KP5A 1FOKA 3F8MA 4C3HJ 3UNGC 2JZ1A 1VLBA 1G4AE 1AARA 3J81Z 2BYTA 2G5GX 2JYEA 1X19A 4LLLA 1F77A 2M0CA 2KIMA 3SFIA 2CMPA 3QA8A 2XSJC 4CO7A 1LUJB 3GQ4A 1KFYB 3ZW3A 2LFIA 5JLXA 3JTGA 4QTRA 2L9SA 3U60B 3WTTC 4Y3OA 3RGSA 3SYTA 5J2RA 3NWSA 5F0CA 5DCMB 3PXGA 1MBGA 3OG5A 3CF0A 3KFWX 1HKQA 1J7CA 3PRZA 1KU7A 2KPMA 4BYYA 1LEBA 4AI6A 2EBIA 5D2MB 1X3UA 4LLGF 4YY3M 2ZJ2A 5TJJA 3FIWA 4K0KM 1D5XC 2JX5A 3A1QA 2DBYA 3W3CA 2KANA 4XK4A 1R1TA 4IBBA 1MNDA 3NAUA 2E6XA 1A36A 1D0LA 2FXAA 4NUBA 1V2YA 4CUGA 3PO3J 4W9KA 1L0OC 1D2NA 2TCTA 2E5NA 3QIJA 4A3LJ 3I04M 3ABMH 1XLPA 3BJOA 3HX3A 1QAOA 3PVSA 2B3AA 3ZNID 4BGDA 4HKQA 1XMAA 5FRMA 3A98B 3DEWA 2L05A 2GIVA 2AWTA 3UMMA 2JPBA 2GQQA 2F4OB 2RD0A 1I4RA 4A2UA 3H3VK 5J6XA 4OIPF 3V05A 4FW9A 5IYCJ 5CVIA 1S1QB 3IAM2 2J53A 4HVBA 3LAJA 3MCZA 4M3EA 1ZTRA 2Z5UA 5LMUM 4IPAA 3AE9B 1WI9A 3N4MA 4C30A 3G2BA 2GBMA 1SIFA 2L83A 3H9GA 3TQNA 2X4AA 2M60A 1EWYC 1U78A 2WXOA 2MGQA 4XM3A 4HBLA 1FIQA 4RMNA 2LNHC 3QU3A 1ZGJA 3EC8A 4B3AA 5IT9S 3ECHA 4AKHA 1IC8A 4XK8F 4NPNA 2PG4A 4CSWA 2GA2A 1TQIA 3CIRB 4IHTA 2X48A 5BYQA 1GNUA 2QBYA 4A3OA 4U0WA 4Y52J 2AXLA 2W9NA 3CMMB 4NQWB 4AVPA 2DENB 1QUTA 3ZDMC 5F1RA 4CH7A 1BXTA 3B0AA 4NQWA 1T6SA 2QILA 2AO9A 2WX1A 4L18B 1SVOA 2XSZA 2F4MB 2GMIC 2Q5WD 2WB1A 4ZZLA 3BR2A 1L0VB 1PJQA 3WODF 4EVIA 3ZQGA 2BYEA 3FUUA 5IP6A 1XEEA 3OYCA 2CHZA 4DYRA 2HXOA 1UMQA 1FJLA 1WH7A 4FX0A 1EF1A 2XFTA 4DBQA 5KVRA 4RGMA 3GPYA 3CC7I 4O5VA 1XLQA 3SDLC 1ZKHA 5B1BH 4BKGA 2CFOA 1OMIA 1WJ4A 4EZLA 3T8MA 3VYUB 3GFMA 1P0RA 4UUSA 5ICFA 4BDYA 4Q48A 2VH1A 2REXA 5E6PA 2CW0F 3L09A 2IGKA 5L3CA 1IUYA 2L0KA 4L9TA 4NXMM 3K70C 4XRSA 2P5VA 2G1EA 1MKMA 5AZHA 4LRSA 1AA7A 5E3OA 2DK8A 1NENB 1K78A 5E20A 3IKTA 2KDIA 3P63A 4LJ5A 2K9QA 4HW0A 3H7PA 2F5FA 3K2LA 4KVGB 3UJNA 2KIUA 2D3AA 4A6DA 5L3BA 2ZANA 1V4RA 1I94M 2Z8LA 2FE8A 3EUHC 3HU3A 4AOFA 1TH2A 2WZJA 3HRMA 4ESBA 3SASA 3NARA 3N05A 1LE8B 3ZQQA 2ZJQF 3MZHA 4KUMA 2P5TA 4UXNA 2UUCM 1N61A 4D2KA 4IQ4A 5D6JB 2LF8A 4GLSC 3DZDA 2VZKD 3KSXA 1T6OA 1WCMJ 1S7OA 4DR1M 3VH4B 4WP2A 3EGRA 1JUPA 3AFHA 1R58A 3ZNZB 3HIZA 4IJFA 2DT5A 4E7JA 3J9CA 2ZM6M 4R79A 3QAUA 4AQ7A 3K4NA 3FE3A 3TSSA 4NHJA 2DAKA 2ELJA 2KWVB 3V6EB 2FBIA 2QSDA 3WU2C 3WTUC 2IS1A 3BINA 3CGWA 4CYCB 3AV8A 1Q3BA 4ZTJA 3F72A 4P17A 1QHGA 2D3BA 3C18A 4C4VB 5BPIA 3OJ3A 3ULQB 1WR6E 2XPVA 3LVVA 1SANA 2MFZA 2IRFG 2BB6A 3M95A 4DV3M 4BDZA 3FTCA 1WMHB 3VK7A 4BHBA 3GLGA 2XEPA 4Y28F 3PRMB 3RZDJ 3E6BA 1JKPC 2SEBD 1DGGA 2O6GE 4LDTB 2DZIA 2H94A 1AIPC 1UWMA 2KFDA 1JUSA 4JI7M 3V76A 3GFJA 2G4SA 4NC8A 3I58A 2JP7A 1GO5A 2P7VB 1GJTA 1YN5A 3G73A 5C1BA 3GB1A 2EH3A 2VODA 1HA5A 4IHYA 1H9GA 4AS1A 3WTVC 2JPHA 3H9JA 3KX2A 4B44A 2D10A 2WDTB 4QSHA 2V9PA 4B1RA 2VT3A 3OL4A 2QM3A 5H37D 4XLNF 1ZW7A 1BVSA 5LHHA 2AHQA 3L26A 2B63J 2NNNA 2ZB9A 2AQEA 1WFYA 1D0MA 4XONA 3F22A 3KW6A 2WDQB 5G5GA 2BBCA 4LIUA 3EETA 3I3LA 3K1PA 2LKPA 1K52A 4AIHA 5LGNA 1QZMA 2RVCA 1L7YA 4J6IA 4XBOA 1ZELA 4M74A 1XCBA 3VTUA 2JNHA 2KJRA 2N7EA 4KIFA 4TQ1A 3BJAA 3QU6A 2A3SA 4DUYM 3HSEA 2GWRA 3FXOA 2D2WA 1TKEA 5IYBJ 4GRIA 2K9LA 3BTCA 2MLBA 2H5XA 4UDUC 1XMKA 3CJTB 1L2DA 3DVNV 1YQAA 2L7MP 1MNEA 2WXFA 2VQGA 4H4KC 1NDDA 2WXQA 2KVZA 3BR5A 4Y15A 3K6GA 3C2GA 1DGJA 2K9XA 2OZ6A 4IHVA 5K5RA 4BBAA 5AUKA 2Z4SA 1IG7A 2DN0A 4OAZA 3CCYA 3IHPA 2KYWA 3VOEA 3QAHA 2JA2A 1T08B 1OCZH 3H1CA 1WZ2A 2QNJA 1T39A 3GE8C 2ACZB 1J2XA 1HDPA 2WXGA 1KU2A 1OFCX 2CHXA 5B1AH 3BOQA 1QANA 3LFKA 4PT5A 2QQ9A 3WAMA 3WE2A 2BJVA 4FT8A 1ZR4A 2F5CA 3R7RA 1HKTA 1HZ6A 4E7HA 3A01A 1GVNA 5LMNM 1A5JA 1ZDVA 3U61B 2NVUI 1LKXA 4KITB 3GRRA 3K0LA 5IP7J 4ASWC 2WSFF 2LGDA 1TNSA 1SD5A 3BG3A 3E5XA 2VIIA 3HEFA 3JCUC 2VBZA 5TR5A 5CLSA 2X49A 1P2FA 3PRPB 2DYBA 4PJJA 2F5EA 1I4GA 2DHYA 4KSKC 4M9SA 3DOWA 4HL4A 5JVGF 2QMTA 4ZYHA 2EKFA 1ZQ9A 1OQQA 4I76A 3A03A 1XT9B 3BDDA 1OYIA 1VCBA 3BQZA 2UWQA 1NBFC 2CE7A 4WJPA 4HPQA 1JGSA 3BR1A 4XZ4A 3WTXC 2IGNA 3SFDB 2G45B 2X9DA 3P9KA 1WPKA 5GKNA 4IBCA 4RB0A 4P55A 3S16J 1XX5A 3MK6A 3DTEA 3B2GA 1UHWA 4MGYE 2E34A 5F0HA 4NRWA 4CICA 3ZQ4A 1SMTA 2NRAC 2M1BA 3RGPA 2J7QB 3OIOA 2KRCA 3RD2A 4XL9A 1MJ9A 1TL8A 2N1WA 1VR9A 2WWYA 3DBHB 5LHGA 1N6ZA 4BZAA 5ICCA 4XKVA 1KGSA 2XPUA 3CLQA 1ETYA 2L54A 4F8CB 1BM9A 1PJTA 3K10A 2LG4A 2QVOA 3NS1A 2F6CA 2W48A 1KZHA 2DMPA 3PREA 2MJEA 2Z3YA 4CCMA 3Q69A 2FUG1 5F08A 4J01A 2BHZA 2KJCA 2TRTA 4IX7A 4P1CC 2DTRA 2QQBA 4IM3A 2JF5A 1QQIA 4HNVA 3BZKA 2MD0A 3N1XC 2MLGA 4WWMA 1A31A 3FBNB 1ZLJA 3HU1A 1PYWD 1IXCA 4ENKA 4MSQB 3IC7A 1WZ0A 1ZXHA 1STZA 3W67A 2XAHA 3A9KA 3IKVA 3ABTA 2FIFA 3GBGA 5GPAA 3HGYA 2OF7A 5CVJA 4FWGA 1FMAD 2VUMJ 5K7FA 1X1BA 4ANJA 2D1HA 1XCQL 3HRDD 2STWA 3RIRA 3K9OA 4YXDB 3Q3SA 2LRWA 2M2EA 1WJ7A 4IG7B 4ANUA 3NUHB 4L5JA 2KIFA 2FF4A 3E6DA 1K61A 1V34A 1WJNA 4E71A 3L27A 4RMAA 1QUSA 1YRNB 4Q2JA 2MA3A 2YVCA 4LZJA 5JH5C 2BVMA 1MMDA 4LFUA 3CO6C 1WX9A 4NJ6A 4K1RB 3R61A 2EMSA 3NVVA 3TCAA 2VJ5A 3PM1A 3Q8EA 5CJ9A 4EGYA 4GN1A 4DXAB 2MC4A 3M07A 2IO2B 3GEZA 2L9NA 5HNFA 1ZE3D 3KOXE 5CQEA 2MABA 1G6NA 3ECOA 2J5OA 2K39A 1Q39A 4G8XA 1CQTA 2OJED 1YW9A 2EUCA 2UYZB 5L95C 4BE1A 2X0LA 1N36M 4FE4A 1QOGA 4GMVA 5DPSA 3SXYA 2JXNA 1VQ9I 4DV2M 4JBAA 1TDHA 2O03A 3H8HA 4LJ9A 3LAPA 1FPYA 1SXJE 2EPFA 4BS9A 1QKZA 4ZZDA 3A02A 3NS8A 3N32A 1R7SA 3U4EG 3BY6A 1T2KA 4HXDA 5HG2A 2WXKA 4Q47A 3DWMA 3Q8FA 1XNQM 3TEZA 2GNOA 3GQ5A 2IA1A 2WSEF 1K4SA 3J2PB 1GHCA 3ALBA 2LKSA 3BZCA 5J17A 3AG3H 3HPGA 4ZYNA 3W5UB 1FOWA 4KJZA 4ZHPA 3U9GA 4B95A 4LJ4A 1S8NA 1HC8A 1DGHA 3K1NA 5IZ7D 3VFDA 4GDFA 1MMAA 1FFUA 3U7ZA 2UXNA 1YYVA 5KCMA 2Y48A 4XWTA 3E6MA 2PMUA 3PQJA 3SDBA 1FBSA 2M0MA 1R00A 4MGKE 1IBKM 3ESWB 3QYBA 3MMPA 2ACJA 5C4XJ 3E5QA 3A4RA 3VDXA 2KP6A 3KVWA 2Y0QA 2ZBKB 1SAUA 2L4AA 1S3SG 2YX7A 1WGLA 2LTPA 3U52E 2ADUA 4LB5A 4RB3C 1TS2A 3DWLE 4ZYDA 4UN2B 4TMAB 1HZ5A 3D8BA 1UZCA 2ESHA 3E7LA 3TE6A 2EINH 2D5VA 2F48A 3RNGC 4LOCA 1ON2A 3BROA 3I55I 5D5WB 3D5RC 2KNAA 4CYEA 4LCBA 5AONA 2BOLA 3SDGA 1JJ8C 3GTKJ 4JP0A 2P7CB 1FD6A 1NO1A 1JE8A 3AEGB 2R61A 2ZMEC 6PAXA 4F1IA 4QHTA 3I9V1 3ASOH 3OSFA 2CFXA 3F9KA 1GL6A 1HW1A 1HOMA 2X6OA 1EH6A 3OIQA 3JSOA 2KFKA 2SAKA 1FBQA 4WWNA 5EZGA 1I4XA 4OMZA 3IVFA 1R7JA 3CC2I 4HG2A 3SAVA 5ED4A 1MSFC 2A69F 2FMYA 3MEXA 2OAZA 2CU7A 4FHJA 1WR1B 1QQRA 2DENA 3KZZA 4CCOA 3P2BA 2A05A 2Y5CA 3K9PA 2MW8A 2NS0A 3AAFA 5G2NA 5EEAA 3MFKA 2HCBA 3FMRA 1IN8A 4F2LA 1WJ5A 4AYBA 1X4OA 2A5WA 2BF8B 3LSKA 2KMMA 3OYMA 1TNTA 3HHHA 3NWTA 3V61A 2L4EA 3KZYA 3MMYB 5AUIA 3IT4B 3PV1A 4LLGM 4RB1A 5DFLA 1PDNC 1D1CA 2QHOB 3E9SA 2JVHA 4YIRX 4B4CA 2DODA 2UXDM 1MBJA 1YD8U 4ZYEA 4ZC3A 4I4LA 3UI3A 5GMVA 1IM2A 1SFOJ 3VYTB 2PQ8A 3T1HM 2MP2A 4NDLA 5EXTA 2R44A 4Z2YA 3TO7A 1MBEA 3OYKA 2WAFA 3AE2B 3TDZC 1V1PA 5IO9A 5EP3A 3TUOA 3Q14C 4XORA 3VEPA 2X8XX 4KHPM 4BBRJ 3GXOA 1OEYJ 1JHHA 2VOPA 2BVLA 4DR2M 1MU5A 1GOZA 4NAMA 1FRRA 3BCAA 3DV8A 2OCCH 5CHVC 2F5OA 4GXBA 3I9V2 2OBPA 1FEHA 2HOEA 1DP3A 3AB5A 4I99C 3V62A 2XZFA 2JUJA 2RR9A 4WK8F 1G41A 1XGMA 2YPRA 5DCFA 4A3EJ 1RFKA 1P3QU 1QNTA 3HTUA 1TS5A 2DWQA 2ZFWA 3UIPB 5IN7A 2VASA 1XTAA 2K6DB 4MDKE 2FAZA 3IAS1 3IV5A 1U3EM 4KICA 4AU7A 2KRKA 5H6RA 4B3RM 3VRAB 4F1SA 1MDMB 2R62A 3VXWA 2K85A 1RETA 5FO5A 1V55H 3KYDB 3F8FA 5IP9J 2N8GA 3MQ0A 3UQAA 4RGNA 2DA4A 3RYPA 5IREB 2MA9B 2FE3A 1OEYA 1Z5BA 3ZLZA 1R5LA 3HUIA 5LRRA 2RKOA 4LDTD 3ZP5A 1HQCA 3VDPA 3HHGA 1MGTA 1XNRM 1VQ7I 2RPVA 3L2RA 3LA2A 5D4RA 3U1DA 5CVRA 1M94A 3Q5FA 1SXJA 3CUOA 2BY3A 4G11A 3HL2A 4XGAB 1F5TA 3KP4A 1OFHA 4Y17A 2MW5A 2DPDA 1WXVA 3CDHA 1XB4A 5E6JA 4BKSA 1D5MC 2M45A 1LPQA 4HEA1 2XAUA 5E3MA 2DYOA 4CA0A 4JIOU 1UELA 2APLA 1WJAA 3IG8A 3FILB 1AW7A 3AU5A 3GYHX 3PL8A 3QPHA 4B8XA 3Q3JA 1QDTA 1WE7A 1QVTA 1IPGA 2O6VA 5F6FA 1T95A 4X6AJ 5DDGA 4AC0A 3BPXA 1TTNA 2RSUA 2GXGA 4CXFA 4IXAA 2DZMA 3LQRA 3GFIA 2XN9C 4KSLC 1IGDA 1IV8A 2XB0X 2M1MA 3HC7A 2OJWA 2DNAA 4MQVA 4HZFA 1XGSA 1SFEA 3ABVB 4P9FA 1K6YA 2DOFA 2GLSA 4JX1C 4HCPB 3K9PB 5JVTA 1FPQA 4I98B 1EU4A 1WIVA 4B3TM 3PFYA 3I4PA 3GTMJ 4AJYB 2H1LA 2JZ0A 3AEEB 2HOAA 2XPWA 3FXUA 2VB6A 3TEYA 2VZKB 3ZOBA 4CCLA 3EIHA 5D6EA 4KIGA 1S72I 1JTXA 4BEHA 2JQRB 1SFKA 3FKIJ 2Z59B 1M4VA 3IP4B 2JWUA 3DKWA 5DV5A 2IA0A 1VQMI 2K9DA 3JVZX 2IZVB 2R5YB 1XCVA 2CW8A 1BI2A 2RAEA 4ITVA 3H36A 2R46A 4JQWC 5C1ZA 2WU5B 1TWCJ 5EQTA 3RT3B 3DPUA 3W2DA 4L8RC 3SATA 1VEJA 3VAWA 4L9VA 2PE9A 1TTYA 1MD0A 4HDUA 4IEJA 3FTDA 2B9SA 2WXPA 4ICUA 2FU4A 1RR8C 4WF2A 3GZNI 2NBWB 3ZXVA 2JZ3B 1ZGWA 4DHZB 2GI9A 2W3RA 3Q3FA 2HGCA 4HDVA 5HDNA 2DZJA 4KNYA 1XGNA 2PEXA 4E7KA 4OMYA 2LMCA 1SB3C 2DA5A 3ECIA 3SMSA 3SARA 3HBLA 1P7FA 2HWVA 3NBIA 1R49A 1PJRA 3QRFF 2NAZA 2WB1N 3CSFA 3NG0A 2HXIA 2R7OA 4LG2A 2WXMA 3OWTA 4G7ZF 4X64M 4MJSA 4NAWA 5C4JJ 3KE2A 4FE7A 2LRUA 2JUOA 1RM6C 5KAIC 1TBEA 3HHYA 1WM3A 1QHHD 2HQNA 5A2QZ 1AKHA 3UIOB 1S29A 2NVQJ 3RNAC 3RDIA 3OYAA 3MKWB 3CUQC 1DDNA 1IDZA 2VXZA 3O2PE 2QIEB 2O6VD 1P3QQ 4R71A 3FUVA 4RKUF 3GLGE 5D5XB 3J7AY 5GP9A 3GRUA 2OTLI 3SFEB 2HYGD 4W9HA 4FQGA 2JXXA 2I1JA 1GG3A 1R1UA 5EP4A 1WH5A 5E26A 4DW6A 4GC5A 1SD4A 2P6TA 1X1MA 3BK1A 1KU9A 1V86A 2FCQA 3CF6E 4DGWB 3WTWC 4FISA 4NNJA 3C2HA 5FTLA 3R2TA 2NTSA 2QCOA 4JI5M 3AEAB 1YJ9I 3JR9A 1JRPA 4RA2A 3V60A 3LSJA 5BNGA 4PJNA 1WX8A 4OIOF 4EE2A 3I0TA 3URYA 1C4CA 2HPMA 1SXJD 3C1DA 4JL9A 3WHLA 5EJCA 4QOSA 1UH6A 2A4ZA 4B08A 1BJAA 3L2WA 4Y4RA 4TV3A 3KUZA 4W5WA 3AL0C 3AXCA 1UFZA 3VQIA 2DI0A 1I6HJ 2IGMA 3K7AJ 4N9HA 4XIDA 1BIAA 4M3FA 2JRIB 1E0ZA 4JI6M 3UK6A 1P4AA 5BO4B 2LZ6A 3ZPLA 2MJDA 3F6OA 1LO5D 2IA2A 3LCVB 2HZDA 2JN6A 4A93J 1KF6B 2BYVE 1K3WA 1DOYA 1HE8A 4BVUC 2NBVB 3CD6I 1JQ4A 1GUAB 1OTRA 1I50J 4CYDA 1VZ6A 4MACA 1ZR2A 1UUPA 5KHOA 5TSSA 2F2EA 1L3LA 1IUEA 1RI7A 1F0ZA 4FCVA 3GLXA 3RKYA 3PLUA 3BYYB 3HGGA 2CU1A 1FOYA 4C00A 2R65A 4E7SA 2N9XA 1TWFJ 4AIKA 2KZVA 5H20A 2Z16A 2DAMA 5J47A 1L6VA 1XXGA 4GDKA 5LGTA 1YIJI 2YR2A 4U0YA 4LG0A 5KHDA 1IN7A 4A3KJ 3GPPA 4I6LB 3HJQA 1B8IA 1BOAA 3AN1A 1OCTC 3A9KB 1Z59A 2LC2A 4N9IA 3MC9A 4LJ8A 3W2AA 5J1RA 5IT9Z 3EUB2 1O7FA 2INDC 3AE7B 1T33A 3S1RJ 1WJUA 2LGXA 4GYIA 3LSGA 5E79C 2PVGC 4LY6A 4G4OA 4G7OF 2RPQA 2ZNVB 1MSEC 4BHCA 2JMWA 1KTKA 5F27A 1K51A 2XGEA 1ETQA 2JT4B 5FFXA 3L10B 4BQNA 1H8AC 1UM8A 2LHEA 3W1SA 3J80S 3RQIA 3ZDTA 1UAAA 4LJOB 2IXSA 3K2AA 1DU6A 2Q1ZB 4UB6C 2Y2ZA 2C60A 3W5VB 4LTUA 4P16A 2ID6A 3S2DJ 3MD2A 1IRFA 2Y3AA 3RNFC 3M3JA 4DHZE 2BTEA 2K0BX 3FXMA 1B72B 2ZCWA 5AZFA 2F5DA 3HVDA 2EA0A 5EXPA 2PMZN 1KONA 4W9FA 1DGFA 4ZJZA 3NWLA 1N34M 3U5ZA 2GM4A 4NAWB 1CUKA 2QP9X 4HDQA 4EFOA 3SR6A 1OYWA 1J5EM 3RKXA 3GOEA 3CF2A 5HLTA 2RDGA 3RZFA 4KZCA 3PUBA 1WJDA 3FBIB 3OOPA 1Z67A 2M8EA 2DWNA 3PT2B 5G55A 3JSVB 2DLBA 4W9GA 3G1OA 5GTHC 4O1NA 1B6AA 4PS3A 4MEMA 2F4IA 1A5TA 1QPMA 4KDIC 3T3OA 3GQ3A 4ITQA 4H2AA 3HOWJ 2QCZA 1STEA 3MHVC 2M7BA 2INNE 3KQ4A 3RN9C 5B66C 3VUXA 5EDNA 1HSJA 2E36A 1JR3A 2COBA 3FKJA 1I5ZA 4EM2A 4M0WB 3L7WA 1XXHB 3LSHA 4AIJA 3DVGY 3Q3MC 2L7IA 3WE3A 2ZNZA 1WGHA 1R5ID 2O61A 1TQPA 2IW5A 1VDLA 3IHPC 3FAHA 3ZJTA 1G3IA 3GPXA 1HF0A 4CGZA 4YTNB 5EE9A 5K7ZA 5A2QS 3W6VA 2IGHA 1NJGA 4JI1M 2EFQA 1UNSA 5C23A 2UXXA 1ZRCA 3U6MA 4K7WA 2F5VA 2OOBA 2DCEA 2Y0SN 4DR6M 3NVZA 2KX3A 3TO9A 3BBZA 2QGUA 2JVGA 1YLFA 3QP6A 3FKYA 3CCLI 3OV8A 3RNCC 1HQYE 2QBYB 2FOWA 4A12A 1G3YA 2PJRA 3K2ZA 1EKEA 3HM3A 5DPWA 3RTRA 4I7HA 3AE4B 1LDDA 4JOMA 2VBWA 2PE6B 1KQ8A 1MG4A 4HLEA 3CCEI 2M0AA 1ETKA 1RUNA 3U7DA 5DYGA 2HZTA 2NYXA 3QWZB 3TIXA 2VQFM 2CUEA 2R7SA 4PYZA 3RNBC 3L2AA 2HDWA 5HNHA 1L2CA 2X8AA 2VIXA 4UUSB 4XLHA 4M00A 3WALA 4I02A 1W0TA 1YUBA 3ZQLA 3R0AA 1Z7LA 2N9LA 5JHBA 4AD9A 1RPWA 4LG0B 3Q8CA 2EV6A 4I09A 2C5LC 3VUWA 1V1OA 4LG3A 1D6EC 3DKYA 3BXWA 2LVQA 2XC7A 3GZ5A 2Y20A 3FWEA 3FC4A 2XAJA 2LHCA 1YX5B 1D8JA 3Q0WA 5BPVA 2ZFUA 1F52A 1HKSA 3HOUJ 1POGA 4XRSG 1UHMA 2DTZA 2IGOA 4G50A 4M3BA 3K69A 3T6PA 3N20C 1WSPA 3OTOM 2ZSHB