1QZEA

Hhr23a protein structure based on residual dipolar coupling data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
360
structure length
214
Chain Sequence
SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog A
publication title DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 51
structure length 214
sequence length 360
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF00627 UBA UBA/TS-N domain
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA04
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1qzeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1qzeA01
2FCNA 2K8HA 2AEHA 1GC6A 1YQBA 3H9DA 3L13A 2DAJA 3L54A 2XK5B 1R4GA 4G3OA 1E94E 3CMMB 3ENEA 4ICUA 3ZO5B 4TV3A 1PVEA 2KFKA 3AU4A 2OO9A 3PLUA 1T43A 3DQVA 1MG8A 1Y8GA 3MHSD 3PT2B 2RGFA 3DVNU 4NJ7A 2RRUA 2C7NB 2EJSA 4G0NB 2R2QA 3PREA 1IPGA 1E8YA 2LZ6A 4FJYA 2PE6B 4M8NA 1PGYA 1EFUB 2KHWB 2L3ZA 3SHQA 1Q5WB 2EKFA 2LGXA 4IC7B 4LJOB 4W9IA 3L08A 3WIMA 4RM8A 1UBQA 1MN3A 2J0KA 3OLMD 4I6LB 4G3XB 4KIKA 2XBBC 3K9PA 2M0XA 1XXHE 4BVUC 1WYWB 2MA9B 1OEYA 1S1QB 1T0YA 2LRUA 2JVCA 4DHZB 3FE3A 4IWOA 4EKUA 1KOTA 1GG3A 3B08A 2RR9A 4A3OA 2JPHA 4GDLA 2GBNA 3KUZA 4BKGA 4EFOA 2JZ3B 3RZFA 3L10B 2L2DA 3QARA 1HT2E 2KWUB 4LDTD 4ZRJA 4AJWA 2IYDB 3V61A 3WAMA 3N32A 3DBRI 4DK5A 2ZPNA 4HLEA 3ZTCA 3UQAA 2DAMA 2KFKB 1OEYJ 1R4MI 4NPNA 5LLIA 5CX3A 1YD8U 2NCNA 4FADA 5J18A 3E21A 1VG5A 1WZ3A 2O2VB 2L0TA 2RD0A 4TKNA 4NQLB 1I42A 1V9JA 3APDA 1ZW7A 2PEAA 1C7YA 2LVNC 1KLVA 2BWES 3DCGA 2N9EB 2NPTB 1VEJA 2MW5A 4BKTA 4WJQA 1TTNA 4TQ0A 2HWJA 1QZEA 2JY6A 3JW0X 4KIKB 2JUJA 2L4EA 1WMHB 4OVVA 4FLHA 1IM2A 1GJZA 3MJWA 3RUIB 4NJ6A 4IM3A 2DENA 4F2LA 1X3ZB 4W9LA 4W9FA 3U8ZA 1ZKHA 2FIFA 1T6OA 4I6NB 2ZCBA 2LD9A 3QIJA 1HJPA 4E3CA 4MELA 1Z5SB 2MROB 2ZPYA 3V6CB 1ZMWA 1U4AA 1C3TA 1WE7A 2N7EA 2YVCA 3ZTDA 3RZWC 2BWFA 3ZRCA 1VQ1A 1AARA 3H1UA 3R66C 1IP9A 2IZVB 2V3SA 4W9JA 2J7QB 3VTVA 1F4IA 3N30A 2LBCA 1X3WB 4E74A 4KV2A 1AIPC 1E90A 4IW0A 2MGWA 3P2BA 3Q3FA 4WQOB 4BBNF 3PRZA 5CHVC 4TUUA 1J8CA 3W1SA 2KJRA 1VD2A 2ZCCA 1WFYA 2JNHA 2KO3A 2EKKA 3L0WB 4LJPB 5AEKB 4ANUA 3X0WA 2GBRA 2FCMA 4WJOA 3W1SC 2G45B 1E8XA 1G4AE 3OAWA 4FJZA 5DCNA 3MMPA 3B0AA 3EHVA 1UH6A 4FBJB 4LDTB 2KDFB 2BYVE 2NBVB 2IO2B 2M17A 5JHAA 2BYFA 2HTHA 2XK5A 4FHKA 1RRBA 1WX8A 1Q1OA 1WF9A 2HE7A 3A9JB 2OOBB 4WWPA 2M1MA 2J0MA 3JYUA 3IFWB 1HE8A 4WJNA 3H4JA 2FUHB 3VHTC 2IO0B 2GBMA 3ZRFA 1L2NA 2W9NA 4MM3A 2K1FA 2DYBA 3ZNGC 3DVNV 1A5RA 5L95C 1GO5A 1WJ4A 5LXHA 3C0RB 3D32A 4MGIE 2WX0A 2DKLA 4MJSB 3BY4B 2REXA 2R2OA 4URKA 2DZKA 3IHPC 3PRPB 3APCA 2KXJA 2IBIB 2IO1B 4DBGB 2L7RA 2JF5A 2B3AA 3VXWA 4MSMB 1JRUA 4WWNA 2KNVA 2AL6A 1V81A 2KFJA 2NR2A 2RSUA 1Q02A 1Q0WB 4MH0E 2CWBA 3TL5A 2BKFA 4HEOA 5J17A 2JY5A 3KUCB 2JY7A 2Z0EB 3PRMB 2MX2A 1UELA 3A1QA 4W9DA 2DAIA 3K9OA 1CUKA 3TIXA 4BBNC 2N1WA 2BYEA 2K8BA 2LRWA 2KLCA 1IYFA 2LXAA 4EZJA 2LVOA 3QQ8B 2D07B 2Z59B 3I3TB 5JI2E 1TTEA 2ZNVB 2BPSA 3AU5A 3LCUA 2EMSA 3EECA 2NBUA 2LVOC 2O2VA 3UIOB 2PE9A 1V5TA 5E6OA 2KNAA 1X1MA 3T6PA 1BT0A 4K7UA 2CHZA 4W9EA 3JSVB 3U7DA 2G3QB 5JZEB 2DAGA 2JY8A 1XB2B 1WJUA 2NPTA 1G3IA 4LCDE 3F92A 4NNJB 3BINA 1GNUA 5C23A 3TMPB 1WXVA 1WMHA 2PPHA 5LXIB 3QHTA 2DAFA 2KK8A 2L8JA 4G50A 3ZLZA 1LFDA 3JVZX 1UFZA 1E5WA 2KNBA 3ZDTA 5L83A 2RPQA 1K8RB 4GN1A 4M0WB 4A3PA 3S2AA 2DZLA 4FA6A 2G4SA 4FJVB 4GMVA 1VCBA 3FRIA 3V6EB 4AOFA 5DPWA 4RM9A 3A1QB 4KSKC 3A4RA 2AWTA 3OJ4B 3K9OB 4BFRA 4EZLA 3N3KB 3HM6X 2CR5A 3NZUA 1TP4A 2NS5A 1WY8A 1WJ7A 1WGYA 4ZRKA 1H8CA 3LCVB 3R3MA 1WXMA 4B9KA 4IUMB 2V4LA 4ANXA 4JGHB 3DBLI 3MTNB 3RYTA 1F9JA 3IVFA 4MGKE 2KDIA 3R7QA 3SU8X 2MSED 1PQSA 3KUDB 4PS8A 4DDGD 3NOBA 4Q7JA 4HDQA 4IWPA 3KVFB 1WXSA 3GLGE 3PHXB 4MEMA 3VQIA 2K39A 3OJ3A 4MSQB 3Q3JA 1JR3E 4FN2A 1WIVA 4HJKA 2QHOB 1IFYA 3HK0A 5DPTA 2KJ6A 2DZMA 1GUAB 3EFUA 2IO3B 2MQJA 1SE9A 1V49A 2B3TA 3A9JA 2JZZA 1OKSA 2OOBA 2YLMA 3VTWA 2JXXA 3LDZE 3UINB 1WGRA 3QK0A 1EF1A 1BVSA 2KDBA 3VH4B 1YIWA 1V2YA 2LI5A 2MP2B 1WIAA 2LWPA 4KSLC 2BGFA 2K6DB 3V60A 2XEWA 4F1IA 2K0BX 2MLBA 4TQ1A 2L0FA 1VEKA 1SGHA 4YIRX 2L00B 3X23A 3ZKJC 1KM7A 2KANA 2I1JA 2KOXA 2KMAA 4MJSA 5AZGA 2CHWA 4GU2A 2KQ7A 2LVPA 4WAAA 5J2RA 2MR9A 2FAZA 5CHWA 5DFLA 3SDLC 1D3ZA 5G55A 4DBGA 5C1ZA 2LVPC 3UGBB 2D11A 2F4MB 2O25A 1S3SG 2KDEB 1C1YB 2ZVNA 1KJTA 1WGDA 3GOEA 1LM8B 3ZDMC 2CS4A 3PS6A 3VVWB 1A5TA 3WAPA 2MBOA 4DWFA 1WGLA 2CU1A 4DDID 2KLGA 3E46A 1H4RA 3PLVA 2KX0A 2MBQA 3VFKA 4KZCA 2JRIB 4PYZA 1WGHA 1TZ1A 2GBKA 1WRDB 2N7DA 4GIVA 2A5UA 4NAWB 2ZEQA 4W9KA 5EDSA 2JWZA 5AZHA 2M4NA 4BOZB 2ZNVC 1RFAA 2M8SA 5HKHA 1UZXB 1UBIA 5D6JB 3JSVA 2G3QA 3UQBA 4GDKB 4HK2A 5JH5C 3IHPA 5IAAC 4NQKE 4EOYA 3M62B 3A9KB 4XX5A 1CMXB 4KDLB 3HIZA 2GMIC 2DI0A 1WM3A 2KD0A 2V1YA 2MBHA 3VUWA 2IY0B 4AJYB 4B6WA 1WM2A 4F7ZA 3AI5A 2MBEA 5CHFA 2DNAA 3L17A 4F8CB 1XQQA 4I6PA 1Z2MA 3PVLA 3L16A 1G41A 1NV8A 3KW5B 4AUQC 4FULA 4RMAA 1J19A 4CO7A 3FRHA 1ZV1A 2C7HA 2A4ZA 2GOWA 4EEWA 1WR6E 2LASA 2JT4B 1SG9A 1OTRB 2JRHA 1YX6B 2KTFA 4II3B 3GLFE 2K8CA 2WX1A 1M94A 3QX1A 3ZNZB 3PSEB 3WANA 4FHJA 2C7MB 3DBSA 3ESWB 3QWZB 4HCPB 2QNJA 1YJ1A 3IECA 1E7VA 1UD7A 2KWCA 2N9PC 3TJPA 2KC1A 4GEWA 5DPRA 4BKSD 4ANWA 5KHOA 3PGEA 3VTUA 2KJHB 2EMTA 2KQSA 2N1VA 3KYDD 4HWIB 4IWQA 1WR1B 3NS8A 2QHOA 1P1AA 3DDCB 3QA8A 2DYOA 2K25A 4WWOA 2HAKA 2FCSA 3M3JA 2C5LC 2MWSB 2KHHA 3GZNI 2NBWB 3RT3B 2KKCA 1V92A 1V80A 2GBJA 2KTRB 2KN5A 4IM2A 3R7RA 1WJ6A 2LXCA 3CSTA 4GGQA 1WGNA 2MP2A 3IBEA 4NY0A 3A4SC 4KDIC 4HDOA 3B1LX 2HD5B 4P7IA 4K7SA 1J0GA 2HJ8A 2C9WB 1ISNA 2Y5BB 1RLFA 2LUEA 3VUXA 1NDDA 4BKSA 3DPDA 3T8MA 1P0RA 1OQYA 3QJZA 2UYZB 1E8ZA 4MGZE 5BO4B 4A20A 2DYMA 1V5OA 2JZ0A 1KYIA 1NV9A 2LTUA 2ZVOA 2ZZPB 5D2MB 2KZRA 2WDTB 3M95A 2DHYA 4ASWC 2FIDA 2KVRA 2VRRB 4HCNB 1ZGUB 4GSWA 1DO2A 2MJ5B 1V86A 2WWZA 2MCNB 1NBFC 3BBZA 1E7UA 2JZ1A 4GB9A 4J6IA 3W1YA 2G4DB 3DOWA 4YL8A 1I35A 4F1SA 3DVGX 5JHBA 2K6QA 2ZTDA 3SD5A 3AXCA 4HXDA 4PS7A 1XD3B 2D2QA 2O6VD 4M8MA 3WALA 4NAWA 1L7YA 2N9XA 1Y8RC 2BWBA 4EUTA 4K1RB 3ZIMA 4DXAB 2KMCA 4ZYNA 4WP2A 1TGZB 3H6NA 2FCQA 5AZFA 3TCAA 1WH3A 2FNJB 2LGYA 4HPMB 4PS3A 4ZRIA 2L05A 2I1KA 4DHJD 3UIPB 3ONSA 2DAKA 4GDKA 1V6EA 1TR8A 3IG3A 2QSFX 4W9HA 3TBLD 2QSHX 4II2B 3RCZA 5E6PA 3ZNHB 4ANVA 1WX9A 3K9PB 4R71A 3A9KA 3PV1A 1G6JA 2KC2A 3VDZA 4GXBA 1EUVB 2D10A 5D94A 4AWJA 4HVBA 2PJHA 2UWQA 3QCAA 2AL3A 4K7WA 3H7SA 3T9LA 3ZNID 4N9F4 3GLHE 2J0JA 2CP8A 4IM0A 2DX5B 1HT1E 2L4FA 1WGGA 4GDLB 4CHKA 2O6VA 2CKHB 2LGDA 5IA7A 1FXTB 1WJNA 1WX7A 4HPLB 1HQYE 2EKEC 1EO6A 5GMVA 3RULA 2L76A 2ASQA 4G11A 2NVUI 3GLIE 2MBBB 2LVAA 2OOAA 1P98A 3NHEB 3APFA 4K81A 3UF8A 1XT9B 2DAEA 2C60A 5KHQA 1IXSA 1OTRA 3H7PA 2IY1B 3LJ3A 2BF8B 2WYQA 4W9GA 2ZTCA 1WZ0A 3PTFC 1P3QQ 3WAOA 2KNZA 1YLAA 4OVUA 1LQBA 2LJ5A 5DPSA 4ZDVA 2F4OB 3DVGY 3DBHI 2K9DA 1R4NI 4IG7B 2DHZA 3NY5A 3QC8B 4W9CA 3CSFA 5G2NA 3ALBA 3V62A 3CF6E 3ML8A 4GOCA 3ZUNA 4AP4C 3PHWB 3ZW3A 2JY6B 4X57B 2Z0DB 2LVQD 5D7GA 5FR6A 4EZKA 3KYCD 1WI0A 4ICVA 3KH0A 1TBEA 4KZ0A 1EF5A 3HM3A 4JQWC 4XZ4A 4CYEA 3ZVVA 3QAQA 4JIOU 2CHXA 3HHMA 2JUOA 1YX5B 2DENB 5TR5A 1WR1A 3A33B 4MGYE 5E6NA 2O6VB 3O65B 3ECIA 3M63B 1OGWA 1WHCA 4UN2B 2DZIA 4DHZE 2OJRA 4KVGB 1E8WA 2KTRA 2WZJA 1VDLA 3NZSA 3B89A 2KWVB 4PYUA 3U30A 4DHJB 3VUYA 3WA0A 1GC7A 4WJPA 1OAIA 1DV0A 5CTRC 3H7PB 3AULA 1ZMVA 3VAWA 4B95A 1P9DU 1P3QU 2DZJA 2LVQA 4XC2A 1UGMA 1VEGA 2QSGX 1NI2A 2MRPA 4JLCA 3PZDA 3RD2A 2BKRB 1WE6A 3EC8A 1SIFA 2AYOB 2KX3A 2D3GA 4JL9A 3VH3B 1RAXA 4E71A 2BWEA 1WXAA 2N4FA 2ZJDA 2JP7A 4MDKE 2H5XA 1LXDA 3PPAA 4BOSC 2R0IA 1ZMUA 1DO0A 3ML9A
chains in the Genus database with same CATH superfamily
1N75A 1N63A 3Q6BA 4N4OB 4ICUA 1PVEA 3AU4A 2XIGA 1JWSD 4DR2M 4RLFA 1HDPA 2A68F 2Y69H 2HOTA 4RLQA 3L26A 4GHLA 1IPGA 3KOYE 1E8YA 2LRDA 2DA6A 1SXJE 1U6GA 1Q5WB 1OFFA 1ZUD2 1I94M 2HQRA 1X1DA 1I5ZA 3Q14C 3PL8A 1T0YA 1AYFA 1UHWA 3SXYA 2LLKA 4EFOA 2M0AA 5E1XA 5HLGA 4DV7M 4HLEA 3UQAA 1BL0A 1YN4A 1YD8U 4I81A 1HKSA 3B6CA 3W0FA 1IGCA 2N9EB 2WXNA 4N4NB 3GLGA 1TTNA 1UWMA 3SEZA 4RB3C 2W3RA 3CC2I 2M8EA 1OJLA 2LFBA 3FWEA 1GVNA 1IAWA 4RDUA 2V7FA 4BJTA 1QPMA 3CF0A 4OINF 3W1SA 2VQLA 2JJ7A 2JYTA 1V97A 4GXOA 3A02A 4XICA 2JVGA 1ETXA 2QBYA 4MO7A 4A6EA 1ZRFA 3H9QA 3V4GA 3A9JB 3FXJA 4XRMA 2VKHA 4WJNA 1PUEE 3OIQA 1R23A 1STEA 2WDQB 1FIPA 1PGAA 2CS3A 3VB2A 1DYQA 2XLJA 2HKXA 5LEKA 3BY4B 2WTEA 3Q2AC 3NZ3A 4YWGG 3L25A 2LY1A 3VDXA 1BC8C 2BV6A 2CWBA 1YN5A 4XLHA 4DQ2A 4HEOA 2G8LA 3TIXA 3S2HJ 4PDIA 3C2GA 2KT7A 2OC6A 2MBFA 3HPHA 3ZMDA 1BA5A 4BACA 2D5GA 4I09A 5C23A 3FDYA 1WXVA 2ZKZA 2IVMA 3ZR8X 1E5WA 1WJDA 1DGHA 1B9RA 3S2AA 1WI3A 4GCVA 1SXJC 3LA2A 3FZVA 5JXVA 2XN9C 5FK9C 4AG5A 2XZFA 5LMUM 3JRGA 5BPDA 4DDGD 4K3CA 3KFUG 4NQWB 1DU0A 3CLOA 4MEMA 2RDHA 5CQGA 1SMTA 1V49A 3IH4A 2LREA 3VTWA 2JXXA 8CATA 5HDKA 1WGRA 1HW1A 3RQIA 3KP7A 1V2YA 4XORA 2MP2B 4C3HJ 2I5UA 3K2ZA 3UI3A 5D5UB 2K85A 2KMAA 3DEWA 3SDLC 1D3ZA 1FWZA 3FKYA 4JI6M 1EV7A 1JQ4A 5ILSA 4JI5M 2NYXA 4M6VA 2JA6J 4DWFA 2K3FA 1BW6A 1DUXC 1JRPA 4NAWB 2F4IA 4GIVA 2ZEQA 3HC7A 1QAOA 2ISZA 4K3BA 3HBLA 2KIFA 2DYRH 2B7EA 1BC7C 3U6MA 3P4QB 1ZGWA 1R71A 2FRHA 2L7KA 4AJYB 1VQ7I 2QCZA 1ETVA 3GTLJ 3S2DJ 4F8CB 1FY7A 4ZJZA 5DEQA 3AEGB 1ZV1A 1ETOA 3HOWJ 5ITQA 3HVDA 1I3AA 3HOZJ 2A5WA 3DHIC 1YX6B 2QDFA 1FXIA 4II3B 2VJ4A 1M94A 2NOGA 2JWUA 4AU7A 3ZNZB 4HCPB 3GRUA 1DP7P 4XKWA 1YUBA 3I5JC 1YFHA 2P6TA 4US9A 4WWOA 3EQLF 3X2QH 4DZJA 2R7VA 2KKCA 3CQZJ 2KPMA 4BBAA 1R6RA 3ROUA 2KDZA 2HVRA 1L5PA 2OZUA 4IBGA 1QILA 1SC7A 2C9WB 3ASNH 5H92C 2VQCA 1P0RA 4Y28F 2VT2A 2LTUA 3SBJA 2UUZA 4RAYA 1E7UA 5C4XJ 1XSDA 4DR4M 3GO8A 4B48A 2YSRA 4M8MA 2KKOA 4NXMM 4DXAB 3OYKA 3I4PA 3CUQB 2I1KA 4PCQA 4GDKA 5D4RA 5E6PA 3K9PB 3J2PB 4E6KG 3OOUA 3OR2C 2KA6B 2FEZA 2HDCA 4HRIA 1FPQA 1HNZM 4UHTA 3DKYA 1JHHA 4GH9A 2KQRA 4DIQA 2ASQA 1ETKA 3DFZA 4HAMA 3S1MJ 3FISA 3H5RA 2P7VB 5KHQA 1OTRA 3GCMA 2LC2A 4ZDVA 2DHZA 1LV7A 4AIHA 3MAJA 4EZKA 2CHXA 2DENB 3K4MA 5ERIA 2R7QA 2NTSA 4OU0A 2RKHA 5CVJA 1N5WA 3EUAA 3NZSA 1PP7U 4YG2F 2IS2A 2G9HD 3HM5A 3K9TA 1U5TA 3H7PB 3WG7H 4B95A 1VQ9I 1XN7A 3PIPF 2DMPA 4JL9A 2BWEA 4LNFA 2BW3A 5B1BH 3UGJA 5HI1A 2XK5B 1R4GA 1D0LA 3CDHA 4CHTB 2JXTA 3QU6A 3FHNA 2C7NB 4G0NB 4MM3B 3GTOJ 1QO0D 1SJED 3SHQA 3OLMD 4AI6A 1LFUP 2K3UA 4HV5A 2DOEA 4EKUA 1KOTA 2ZMEC 1BUIC 2HEOA 2WBMA 2GBNA 5BMGA 3LVWA 2E7XA 2BS3B 3WAMA 3BWGA 3HUIA 2IGOA 2LNHC 2ZC2A 2R5ZB 1ZPSA 1XMQM 1LVAA 4NQLB 1I42A 1APLC 1MVKA 2PEAA 3CCLI 2PG4A 3CCQI 2DZNB 2QM3A 1IY1A 5D6FA 1VQLI 4JPSA 1RESA 3K4JA 1NK2P 4W9LA 4W9FA 2J7NA 3SEBA 3HU3A 1WE7A 5C3JB 2IZVB 2V3SA 3WTYC 1XXHB 2ISYA 3OYCA 2LHDA 4Z2YA 1E90A 2MGWA 3Q3FA 4WQOB 5CHVC 2GB1A 3BY6A 4TUUA 2XV4S 4ZPXA 2TSSA 3RGPA 1E8XA 4PD2A 5DCNA 1QGPA 4IHYA 4LG2A 4EEFG 3PUFA 3IHUA 2QC8A 1WJ5A 2MJDA 3ABKH 3PSFA 3ZNGC 5F08A 1ZE3D 4S0HB 3EIHA 4JYKA 5FFXA 2KZSA 4FASD 4YFXF 2R62A 2KNVA 2W1OA 2R7OA 1BIAA 5D3DA 3PNVA 5E3MA 3KUCB 3HXLA 2XGNA 1TH3A 2LRWA 1IYFA 5HVQC 3T6PA 4E7HA 4XLNF 2ON8A 1GOZA 3HG9A 3E6DA 3TEDA 1HA8A 2ERCA 2DAFA 3MD2A 2YNMD 4HKQA 2KNBA 1ULYA 5DPWA 1SXJA 5EJCA 1O7LA 3OJ4B 1BJZA 1Z67A 1WJ7A 2VJIA 4G4QA 5IY5H 1WXMA 4NSRA 4B4CA 1LE8A 3EGRA 3JRDA 2C6YA 1XC8A 3KUDB 3NOBA 2WB1A 2CRGA 4L18B 1K3WA 3ILKA 2DA5A 2L6OA 5BR8M 4M9SA 5HLTA 4A3KJ 2JSVX 4RF1A 4DOZA 2AX5A 3NAUA 3HIFA 2LI5A 4KSLC 5LGUA 3SDBA 1EM7A 3URYA 5CVIA 3WAPA 4LZJA 2MBOA 2H1LA 5AIPA 3EUKL 1FOYA 2M7BA 2BT6A 1STZA 4C3JJ 3GQ3A 3MZHA 4Y7NJ 4BL0B 2MSYA 2D7HA 5KPTA 3R2TA 1LGRA 2DWZB 3TL4X 3GRRA 3FILA 4KT0F 4LGWA 1XG1A 5LRSA 1X1PA 5HDNA 4EGYA 2MBHA 3MC0B 2VQGA 1WJCA 1H9TA 3CCYA 2MBEA 3W0LB 1QANA 2DNAA 3L17A 3HRTA 3VK8A 2DHRA 1OYWA 4G7ZF 3RFZB 4NRVA 4QPOA 1P7JA 5M5WJ 2E5NA 3A0BC 2LFIA 2ICWG 5FKKA 4NXNM 2UUCM 1V5FA 4IHSA 3VTUA 1IRGA 3AE7B 2M5WA 3DDCB 4HPQA 4AIDA 1VNDA 4CDGA 4LNOA 4LJZF 2KN5A 4DR3M 5L3FA 2WXPA 1WGNA 1PJSA 5LLQA 1R1VA 4ZOHC 4M3DA 1FRRA 1FFUA 2Y5BB 3CLQA 2AHMA 3IRRA 2WV1A 3FK7A 3NARA 2KMUA 4HDUA 4XK8F 2ACJA 2FE8A 5D5VB 1I4GA 5JHBA 1KU2A 4DUZM 3KLSX 3SD5A 3WALA 4L5EA 3ZIMA 3LFKA 1F1HA 4ASNA 2WHIA 2XVCA 2FSWA 3ZNHB 3GE8C 4M73A 1K7AA 4GXBA 4HVBA 4OMZA 2PJHA 5FFZA 3TMOA 4FWDA 1HT1E 1UNSA 4G4NA 4LB6B 3SZTA 5GMVA 3AE3B 3HRDD 3DKXA 2DT5A 3IKTA 2Z4SA 3RE8A 1MH4A 1L4ZB 2LJ5A 2F4OB 2R5YB 3QC8B 1ZR2A 3TUOA 4X57B 1SD5A 2ECBA 5LGNA 3KYCD 2JRTA 4XZ4A 3F23A 1UWXA 4YFKF 3LW5F 2YEPB 1P92A 1YRNB 3GX4X 1LNWA 1CGPA 2OTJI 3WA0A 1TDHA 3VAWA 1B6AA 3DLAA 1VEGA 2QSGX 4JLCA 3RD2A 1WE6A 2D3GA 1NG7A 1U9NA 2ZJDA 3ECHA 3C3DA 1NYRA 4KX6B 4XLCA 1XWIA 1E94E 3ENEA 2XNAC 2KFKA 3PLUA 3MHSD 1RUNA 2H89B 2L0KA 1TWGJ 2PE6B 3J7AY 1GV5A 1KU3A 1XXHE 3QWLA 5EE1A 2ZMEA 1TS4A 2JVCA 2H09A 4GRIA 2R44A 2XZUA 2GA2A 1OEYJ 1R36A 1V9JA 2ZJPF 3G71I 3KETA 3HB9A 3T8RA 2LVNC 4EVIA 3M0EA 3LSIA 1GKIA 2FUG1 3HGIA 2HWJA 1AKHB 2F5PA 4QOSA 2VIIA 3E5UA 3R8BA 2VF8A 1QDTA 3DOAA 3CJRB 4A3VB 2PMZN 3FUXA 1WJBA 3S8PA 1Z3YA 1AARA 1T39A 4ZDPA 3K2AA 1F4KA 1TJEA 2K27A 3CD6I 1E0ZA 3G1MA 5HS7A 2KJRA 2JU6X 2UU9M 2TRTA 4IBCA 1G4AE 4JI3M 3MMPA 3W2DA 4NAMA 3LSTA 2E71A 1H9GA 3JYUA 3H4JA 1L2NA 2V1UA 5LXHA 1I39A 3TWKA 1YNTE 5IYCJ 3S32A 1QVTA 3L2UA 4MSMB 5BS6A 5IWAM 4MH0E 2E60A 2GM4A 3N1YC 2WDVB 2JPCA 2RGOA 2KLCA 3K6GA 3F8FA 2J5YA 4BDZA 4X6AJ 5E6OA 2ETHA 5CVVA 1N36M 3VYUB 1G3WA 5DYIA 1UJ8A 4D5FA 4NNJB 4LJ5A 1J75A 3SJMA 2DOAA 4V2FA 3A46A 5L83A 4M0WB 3ZYYX 4FA6A 4GMVA 4REZA 4IL6C 1O3TA 2XSZA 2IRFG 4GGGA 1HNXM 2X9DA 3HM6X 1I1GA 4ZRKA 3AECB 3I71A 1TWAJ 3KS8A 3TSSA 3V3XA 2KDIA 3R7QA 1GJTA 4AS1A 1PQSA 3DEUA 4IWPA 4YT0B 1Y56A 5IYDJ 2NTTA 2RV8A 5EYRA 3A9JA 4LLNA 1BVSA 3C18A 3GRYA 4CCOA 3AOEC 1D3YA 1FIQA 1CQTA 3ZJUA 1L2BA 5HLHA 5EQTA 1O4XA 2RDBC 4C00A 2I8DA 2MR9A 5DFLA 5C1ZA 3W5UB 2WA0A 2AHQA 4ZC3A 5HG2A 1OQRA 2KIQA 1HCRA 2DZOB 4PJLA 5BYQA 3VOEA 2H1RA 3A2KA 4JX1C 3MFGA 3KS4A 1KQ0A 1RI7A 1T56A 2E1MB 2L7MP 3RNEC 3G6EI 2X4HA 4EOYA 4XX5A 4LJAA 1EWYC 3ABUA 2IGNA 4QHSA 2D7EA 1QQWA 2LHGA 1FM0D 1MJGM 1WQ2A 5D5XB 3D8LA 3KP1E 1PJIA 1FNVA 1QOAA 1Y8QB 3QP5A 4NQWA 4GLSC 3HOSA 5HNFA 4IWQA 3M8EA 1P1AA 3REOA 3QA8A 2GIZA 2N0SB 4EV0A 2RKOA 1QUSA 4BQOA 2MP2A 2M30A 1BI3A 1FNUA 3ZCBB 2DTZA 2LUEA 4RGNA 4HJGE 2ZXIA 3C7JA 2KZRA 2FIDA 4HCNB 4CISA 2K7LA 2VKVA 3KXEC 1VZ6A 5CJ9A 4NAWA 5GP9A 3I51A 3DP7A 1G3TA 4UY8I 2FBHA 1J8CA 1DDNA 1ITYA 2BHYA 1GJSA 1ENFA 3VDZA 4RB2C 4M72A 3U6CA 4XKBA 3ASOH 3VR8B 2L4FA 4M3BA 2O6VA 2CO5A 3KPHA 2QSDA 2KMMA 2CSOA 3NHEB 2UXXA 1X1AA 4II3A 4ABZA 3WAOA 4AP4C 3FUWA 3FC4A 2LVQD 4ICVA 2JUOA 1YX5B 1HNWM 3RSNA 2H6CA 1VTNC 1ZAEA 1C4PA 2JZPA 2OJRA 4ON0A 3KLNA 4RGSA 1I6HJ 3F3XA 2FUG2 1SAXA 4FETA 4E71A 4M9XA 4QAYA 2ZFUA 1SXTA 3BT9A 2OD5A 3BJAA 2C96A 2ZM6M 4CGYB 3P9KA 3AG4H 3V8KA 4HDVA 3LVVA 2DPUA 1QU3A 3KEQA 3P42A 1JKPC 2JWSA 1IUEA 2L3ZA 5JI3E 1FSEA 1OYYA 3K9PA 2DT6A 1TL8A 2LRUA 3E6BA 3LAPA 1DP3A 4BY7J 2L2DA 2DWNA 1JUPA 2COMA 2DAMA 1GLNA 1N34M 2I38A 5LLIA 1AOYA 2KDOA 5J18A 2R7UA 3E3VA 3JTHA 4O3MA 3DCGA 4A3GJ 3N1ZC 3AM9A 4CCMA 1IM2A 3WTSC 1C76A 2IDYA 4DV3M 1H8AC 2DENA 1IW7F 4BLCA 5J1YA 1UM8A 4EMSA 1K79A 4W9JA 3VTVA 3IAM1 4ANJA 3P2BA 1VD2A 4NBQA 4HOBA 3NS1A 4XWWA 2PFBA 1E10A 1YHQI 2XK5A 2HTHA 2H27A 1D5YA 3WTZA 2CW8A 4H2AA 2W48A 1ET6A 4MM3A 2JWTA 3H3UA 4WWCA 4B7HA 2OEDA 4F92B 4MJSB 4UV8A 4LJ7A 3BIID 5FKOA 2B0LA 2EWNA 3PQKA 3GPUA 5IOIA 2BTEA 4RFBA 2CUEA 2GXAA 5J17A 4JWUC 5H37D 3BJ6A 1QAQA 5HFYA 1L0XB 2Y5PA 3I3TB 1U9OA 3OWTA 2R5ZA 1P9QC 1V5TA 1XGNA 4LF8M 2DA2A 2Z3YA 4TSSA 3C8YA 1ZGAA 1JKOC 5EE3A 3U21A 3QHTA 2Z1DA 3AJIB 3LQRA 4B0EA 2CR5A 1TP4A 1L0VB 2K5PA 3TWLA 2CUFA 4ZRPA 1B59A 1XXHA 1W7PD 4JGHB 4P96A 3AE4B 5KO3A 1YTYA 4XDDA 1VZ0A 5ITRA 4MQVA 1PJRA 3J81S 2IO3B 2B3TA 4LY6A 4DV5M 5J4YA 3AOEA 3MQ0A 4HKZE 3LL7A 2EIKH 4TQ1A 1D5XC 2I1JA 5J2RA 3ZJVA 1XGOA 3G73A 2DMTA 4HV6A 2ZXHA 1OYIA 4IEJA 3GS2A 3GOEA 3SYLA 5IP7J 4LK0M 4K2EA 4LF6M 1S6LA 1YQ4B 3W2AA 3KE2A 4BOZB 5E26A 3IXSA 5HKHA 5TISC 3I4NJ 1L3LA 3F6OA 1ZN2A 1NG6A 5EP3A 3KEYA 4F7ZA 4G12A 2QZ8A 3SQNA 5DTDA 5DUIA 3D5RC 4JX6A 2CQQA 3GVAA 2JRMA 3U6EA 5FROA 3AMZA 1VQ6I 5K7ZA 1W1WE 4CH7A 4ITVA 1OCZH 4BHPA 3RIRA 6PAXA 3F8BA 1P4AA 1PYWD 2KQSA 2L02A 1IBLM 3CP8A 3N97A 1HXYD 2NBWB 1JQJC 2GBJA 1Y1VJ 4IOCF 1T0FC 5KHDA 4TUWA 1OPCA 3AV8A 3V8JA 4HDOA 2HD5B 4M00A 2V6CA 3VUXA 2D7GA 4M0DA 3J7AS 1IBXB 3CUOA 1J09A 3E56A 3GZNB 2EFWA 2KVRA 3VWBA 1DO2A 2LF8A 3V8LA 2JZ1A 5H20A 2G4DB 3IH3A 1ZRCA 1G6NA 1V5EA 3Q9VA 3DEEA 2FH0A 3TBLD 3U5ZB 5IREB 1G6JA 5D94A 1R4MB 3P7NA 3QCAA 3SATA 3HX3A 3ZNID 3KP0E 2VE8A 2VL8A 2WC2A 2W57A 4I8OA 2DX5B 3FYCA 4BNCA 4FW9A 3NBXX 2INDC 4R8HA 1Y8RB 2WXFA 1IXSA 4A0ZA 1IUFA 3C3WA 3RKYA 4HF0A 2ECCA 4HSTA 1MNDA 5D5WB 4EEWA 4GKKM 2GZWA 3KH0A 3RTRA 1YE9A 1A6IA 4IO9F 3L2RA 3RZOJ 3O65B 2DZIA 1JKQC 1B8IA 1IN7A 1I7HA 1G4DA 4DV2M 2OU2A 2JPBA 3T1HM 1CK1A 4XC2A 2NS0A 2R7WA 4WURA 1USTA 5ITYA 3VH3B 2BVMA 2FXAA 2P7CB 4HF1A 3BROA 3IT4B 2E2JJ 3N05A 2J53A 1T43A 1MG8A 3B74A 1WWXA 5K5QA 2EJSA 4X0GA 2OQ4A 1ZXHA 2BS2B 2CRUA 4HF2A 3LSMA 3HZJA 2XSDC 4RM8A 3TBIA 3ZJTA 4L15A 2V1NA 1FCCC 1DGRM 2KEBA 2M0XA 3BYTB 2DK8A 3NUHB 5EP2A 2LGIA 4RGTA 4E7KA 2VPLA 3CJNA 2DAOA 1J0RA 3DFGA 2WXLA 4ZYSA 5ITXE 2VZKB 1GB1A 5CX3A 1MBEA 5GAHJ 3RKQA 3ERMA 3RZDJ 1IRFA 2R5YA 2CFOA 1SEBD 4O5VA 1T3TA 4F2LA 1YW8A 1ZKHA 2DTRA 1NEKB 1NY5A 3RPQA 4E3CA 1U4AA 1YRNA 3ZTDA 3RZWC 3ZRCA 1IP9A 5F3WA 5IPAA 1BI0A 1FX7A 2M4KA 4XDCA 1U2WA 2L2OA 3W9CB 4ITKA 3RKWA 2ZFWA 3HOVJ 2WV0A 4A6DA 2HE7A 3HYIA 1TKYA 2M1MA 1Z77A 1JROA 1IRXA 4RBOA 4Y52J 1TS3A 2H8RA 2ZXWH 3IHPC 2B76B 3COAC 3VXWA 2B3AA 1ZXIA 2F5VA 2WAQA 3ZN0A 2E1CA 3A1QA 1UELA 2DAIA 5D6EA 2HI3A 4PGGA 2GLSA 2Z8LA 1KF6B 1ZDVA 2QEXI 4W9EA 3K70D 4LFAM 2G3QB 5EXPA 4RGXA 3K10A 1G3IA 4UV9A 3M6AA 3F0CA 2X1EA 2VODA 3F9KA 1TW3A 3GPPA 3K9OB 4EZLA 3K2LA 5A2QS 3IL2A 1YS6A 1RIOH 2BY0A 3SU8X 2PMUA 2Y20A 1A31A 3KP3A 3VQIA 1FNNA 2R7ZJ 2CFXA 1WGKA 2HQNA 4HNUA 4ITQA 5M5XJ 3M8FA 3EFUA 2QEJC 2VASA 4E70A 1S29A 3I4YA 4S04A 1RKWA 1I27A 4UUVA 4M6XA 2ZO4A 1PRBA 1OCOH 1SIJA 2N9LA 1MMGA 4DBRA 1ODDA 2Y5CA 2MA3A 1P7FA 3KCCA 5EXTA 2C99A 1S3SG 3ZXRA 2FQ4A 3ERED 5GPCA 2DMNA 3WTUC 4BE0A 5GTIC 1OFIA 1WGHA 2DOFA 2GXBA 1E9RA 1BR2A 4I76A 4IVNA 3AH7A 3WTWC 1MPEA 1QAMA 1RR7A 2PMHA 1F0ZA 1OIPA 4NNJA 2STWA 3AL0B 1ZELA 2KD0A 3VUWA 4S0RA 1TQPA 1W36D 1L1TA 1QVUA 3L16A 1UG0A 3IUOA 4I0BA 2CQXA 4BEHB 3L28A 1X3UA 3HSEA 3PSEB 2C7MB 4PJ0C 5HOOA 1E7VA 4C9YA 4NDLA 2PJRB 3TJPA 2KJHB 3KSJA 1EIJA 3NS8A 2N8GA 2DYOA 2XUBA 3G1LA 3OOPA 1SSNA 3FM5A 3I9V1 1T0FA 3O2PE 4A3IJ 3IBEA 3B1LX 4KJZA 2FBWB 1JTYA 3ZOBA 2V6EA 2OAZA 2FJ1A 3PIOF 2OHFA 4GSWA 3J80S 4IJFA 4F1SA 4UVAA 2WAEA 4Y33A 1XSVA 1MBKA 4NRWA 3H6NA 5CPRB 3PUBA 1MSFC 4W9HA 3HJ8A 3GFJA 5K7HA 3WE3A 3E0JB 1AWCA 3CCVI 5FLXK 1ZREA 1TS2A 2GOMA 4LLGM 2KL4A 2EFOA 4GDLB 1XXGA 2JQRB 1JT0A 2Y21A 2P5TA 4K81A 4GYGA 3UF8A 1FLIA 2EIJH 1AU7A 3GQ5A 3NY5A 5C3EJ 2JY6B 1JJ8C 2RREA 2LBFB 2VOPA 5C2TB 3ECIA 1LFBA 3V7CA 1VDLA 2M0CA 2MG4A 3IC7A 3VFZA 5EP1A 4GDFA 1EU3A 2EIMH 3ABMH 3KP2A 4JWSC 2O3FA 2D3CA 1FZPB 3UNGC 2R7RA 2L01A 3CCJI 2AEHA 2DAJA 5EDNA 5DYGA 3DVNU 1R5ID 3J81Z 3FK6A 1W5TA 1XNQM 3DHHC 1GL6A 2GLOA 2LGXA 3GLLA 2WAFA 3S16J 4BVUC 5EGOB 1WYWB 2YEPF 3UMMA 1J2XA 2MC3A 5GPAA 5FJ8J 1LB2A 3FTEA 4AJWA 1YJNI 4NJCA 1R4MI 2OUMA 2KLOA 2VC0A 1WZ3A 2HKOA 3BQZA 1KU7A 2WDRB 2DODA 3BWUD 1MGTA 2DWMA 4KIKB 3IAS1 1YX5A 1F5TA 2XB0X 3FF5A 1KYZA 1T2KA 1YJ9I 3K4LA 2N7EA 3H36A 1JWMD 3R66C 2VH1A 3R4KA 4KMUX 1X3WB 4KV2A 4IW0A 3L0WB 3BDDA 1YI2I 2FFJA 2KISA 2GBRA 2VF7A 1X2MA 2EQRA 2KDFB 4PDKA 3DF8A 3WU0A 3GZ5A 4NC8A 3IFWB 3BLYA 4S12A 3FHZA 3TWMA 1NTCA 3R0JA 3GBGA 5E3NA 2KIMA 1HKTA 4A3JJ 2FBIA 1ORKA 4IBJA 1YW9A 1Q0WB 3R8FA 1SEUA 2JY7A 5JR3A 3QPLA 1MMNA 1B1ZA 5G5GA 3BZ6A 1IDZA 1XTAA 2V3PA 4CCNA 5H2FC 2ZNVB 2EMSA 5LMNM 3MHZA 2Y0QA 2UXNA 5JVGF 1XNRM 5EZHA 4QSHA 3HKZA 1ESFA 4G50A 1NJFA 2C98A 4D80A 1FXAA 2EA4A 4LIUA 2JA5J 2V9VA 4D0PA 3FBNB 2HTJA 4CHUA 1NHGC 2WLBA 4B9KA 4IUMB 4HX8A 1S7OA 3C58A 2RNJA 5L3GA 1M1EB 1FD6A 2R93J 2QZ4A 1OCPA 3TO7A 5F0CA 4KIFA 4A3FJ 1I4XA 3GLGE 3P4SB 1VQKI 2DA7A 3OJ3A 4MSQB 2QHOB 5ITXA 3GMEA 4LG0A 3A4CA 1JMLA 2YLMA 3UINB 3QK0A 3VH4B 1WIAA 3V60A 4DNCA 1ONVA 4JP0A 4C7ZA 2DA3A 4XM3A 4MJSA 4HQEA 4WAAA 1JJ6C 3KP4A 3K7AJ 4A2UA 2K9MA 3DTEA 3Q8CA 1IG7A 4N59A 2CU1A 5CYVA 3E9SA 1XCTL 1WRDB 3BTIA 3M4OJ 3GFIA 1RZ4A 2CV0A 4E4HA 3UQBA 5JH5C 3KVWA 4V19K 3U60B 1JTXA 3QU3A 4G8XA 2EKIA 4JE3B 2O61A 2XDVA 2O7OA 4B43A 4U7BA 1Y0NA 4ZDOA 2OA4A 1SFEA 1VQ5I 3AEAB 5E18F 4L4UA 1L6UA 2CQ7A 1Z6RA 3K1NA 2IT0A 2WX1A 2Z3XA 2LK2A 1P2FA 2XPWA 1S8NA 1WGXA 2KC1A 4L0YB 4XN0A 4BS9A 3V76A 3KYDD 3KZIC 3ZQCA 2ZSIB 1D0KA 1BMLC 5BMIA 2KTRB 1VRAB 5IP6A 1W5CC 2YFQA 2O8KA 1VJKA 2JA2A 4KDIC 3VRBB 5FKNA 4QLCU 2V9PA 2M2EA 4KGTA 2VBZA 1RKTA 2PI0A 3NG0A 2KP6A 1Q10A 4FE4A 2I2YA 3Q8AA 1EA3A 4G7OF 1FYMA 1USSA 3GEZA 1I35A 2QQAA 1Z1DA 5HODA 3HJQA 4MTEA 2N9XA 1VQ8I 4ZYNA 2V4JC 3TCAA 4D82A 3T0YA 4PS3A 4PZJA 1OAOC 1OIZA 4AD9A 1MFWA 1Y6IA 2AL3A 1FP1D 3GLHE 4JOMA 4CHKA 3KFWX 1JXSA 1EH7A 1TQIA 2LVAA 4EATA 3GP1A 5DYMA 4MHGA 2LHEA 1OLTA 3U9GA 3WHCA 2FNAA 1QBJA 4W9CA 2V3NA 3SHGB 3ZVVA 2XRNA 3AKZA 2VXDA 4GC5A 2FA5A 4FISA 1KQ9A 2CG4A 1OFCX 2WWYA 3AG1H 2DCEA 1OR7C 1FO4A 1R4NB 2VLAA 1VR9A 3CCRI 1Z6TA 5A2QZ 4HROA 5DM6F 4E7ZA 2M19A 2LVQA 1UGMA 2MRPA 1HBXG 1IBXA 3HSRA 2QCUA 2K9SA 3IAS2 2O5RA 2INNE 5EF6A 1RM6C 1GC6A 2E3TA 1SAUA 2BJVA 3L13A 5TRDA 5EP4A 4KDPA 4NJ7A 3PREA 1Z05A 2A05A 1IN6A 3J7YJ 4FJYA 3TP3A 3FD9A 2BY2A 1DPRA 4LJOB 3P1MA 2LGSA 1MN3A 2W7NA 1YS7A 2XPUA 3U5ZA 5DUKA 1QDRA 1X58A 2FE3A 4QNRA 1Z91A 3THGA 2IA2A 4IWOA 2O0YA 2LWXA 3MFKA 4ZRJA 2RAEA 3LFUA 2EINH 1ZH5A 3ABTA 4C2TA 4HPPA 2JYEA 1EF4A 2RD0A 4OAZA 4KT6A 2UWMA 1IRZA 1SFUA 3B7QA 3I64A 2CH0A 3E6CC 2W3SA 4RGRA 1XLPA 3CIRB 1XDUA 2HDWA 2R7XA 1SANA 2EO2A 4DV4M 3N4MA 2R4GA 4DGWB 1KA8A 2CJNA 2JNHA 5AEKB 5FLVA 4RM2A 4ENJA 3JRFA 3PO0A 4ZRQA 5KPRA 2M17A 4DYQA 1TIFA 1TWHJ 4L0ZB 2IO0B 1VZ8A 4IJEA 1WVRA 4B08A 3C0RB 5IT9K 3D32A 3QYEA 2REXA 3APCA 4G6QA 3ONQA 1PFDA 3QPHA 3MC9A 3RMKC 2NAZA 5E8IA 3DPTA 2Z0EB 3J80Z 4W9DA 2N1WA 4C3IJ 3B73A 3BG6A 4AIKA 4NZLB 1QOFA 2NVTJ 1ETYA 1NVMA 4HLYA 1VFCA 1T08B 4BXXJ 1BT0A 4YFNF 4LNKA 2JY8A 2Y0SA 2FD5A 4DYRA 2RQPA 2G4SA 1S72I 2BYTA 3TOBA 3F8NA 1H8CA 3K70C 3IVFA 1REPC 2JK3A 4B7GA 1C78A 2VKDA 3W6JB 4ACFA 4Q7JA 2WB1N 3FYDA 1TWCJ 4KKJA 1UMQA 2OBPA 3IV5A 1W7PA 5C18A 2K6DB 3VDPA 1FP2A 2XEWA 3CDIA 4F1IA 5AIQA 1C4AA 2M60A 2DQRA 2MLBA 1DOYA 1Z3XA 1SGHA 4MQ9F 1ZHFA 4J3OD 4K0KM 3D5LA 2VT3A 4GU2A 3K4KA 2LVPC 2O25A 2KDEB 4X62M 3ZGKA 2RGVA 3H9GA 2E1OA 2CW7A 3BOSA 5IP4D 4KZCA 4PYZA 4X66M 1JT6A 2EZHA 4IBIA 2ZNVC 1RFAA 2G3QA 4CJ6A 2JVHA 2W00A 2NVXJ 4BU2A 3JAMK 1O3SA 3A9KB 1A6QA 1QKZA 2KDMA 1XGMA 2GOXB 2XF3A 1K83J 2M0MA 3VEPA 3DKWA 2IJ0A 4MT5A 4XSXF 4CO7A 4KT5C 1WR6E 2V9HA 2DFFA 1XF5L 4FHJA 3L4PA 3QWZB 3BG3A 1G71A 1W36C 4O6JA 3AFHA 5DPRA 1I4QA 4KISA 3GE3C 3OMYA 2K25A 3RNBC 1TNTA 1I1SA 2X8AA 2K9LA 2HXOA 3SARA 1XB4A 3P63A 5DCMB 4M71A 3P4PB 5KVRA 4QIWN 3O6BB 5BO4B 2JZ0A 4E7SA 2MH2A 2DHYA 4PK4A 1PUTA 2WWZA 1LVKA 3W1YA 4OIPF 2OPTA 3GLFB 3GPXA 1WWTA 2VJ5A 2D2QA 2FBKA 3HTSB 1JHFA 1RETA 5AZFA 1WH3A 1KFYB 2DA1A 1IXCA 4GIPA 4CYCA 3E7LA 4R71A 2DO7A 2E34A 4IQ4A 2UWQA 3CMEI 3PO2J 3HPGA 2CKHB 2ZANA 5LRRA 3EYYA 4D1QA 5B3SH 3APFA 2OJED 2IY1B 4HG2A 2PN6A 3TGNA 3H9JA 2IEKA 3ZW3A 3U6PA 2D3BA 2OV7A 1EE8A 4WXHA 4KN7X 1B72B 3GTJJ 3HHMA 5TR5A 2HHHM 3R9XB 1MU5A 4B0MA 3EDPA 1OR7A 3D5SC 1OGWA 2OQGA 1ZTRA 1KZHA 2X1DA 1FFVA 4A0XA 1UHMA 4DHJB 4H0EA 5CTRC 4WK8F 4UNOA 4EJTA 1J5YA 1QA6A 1P3QU 2ACZB 3ZMVA 3EC8A 1TTYA 2K3PA 3TQSA 2G7UA 4CZCA 3PPAA 1ZRDA 1E0EA 2DMQA 4G3OA 3BG7A 4XGAB 3SMPA 3B6AA 3U61B 1RU3A 1HR0M 3BTLA 3KOXE 4JQFA 1T0SC 3P9IA 2EKFA 2EH3A 2J0KA 3JCUC 4U7DA 2JUCA 1Z21A 5ILVA 1ZDXA 2MA9B 2LNBA 3OYBA 4YEJA 2RR9A 4A3OA 4GDLA 5EG0B 4NOOB 2JZ3B 3L10B 2J4XA 4ANRA 4KNYA 4V2GA 4NPNA 1VG5A 3FX3A 2L0TA 1N77A 1U8BA 1DU6A 4D2KA 2BWES 3BR2A 2JY6A 1I50J 1PJQA 1QQIA 1NHWC 4NJ6A 4ESJA 3GTQJ 3J9CA 3MKYB 5FRMA 3L9FA 1U8RA 1ZMWA 3K4CA 2ZW1A 1MDMA 1E9MA 1E6EB 2X51A 3GLHA 3KX2A 2KHMA 1VZ7A 2JX5A 2AQFA 4JI0M 1SE4A 2FCMA 2G45B 1R5LA 4FJZA 3B0AA 2HJ1A 3NWTA 3R61A 3HUGB 4FHKA 2MJEA 3RPUD 1WF9A 1WX8A 3KOWE 4WWPA 5IT3A 5E17F 2EUCA 2DBBA 2IA0A 3HL2A 3OR1C 1IGDA 1PJJA 4I01A 5JLXA 2R2OA 5FSWA 1YG2A 2KXJA 4LITA 4WWNA 5EGOA 1SD4A 1BJAA 2WXMA 1XDSA 2VC1A 5F27A 2CWEA 3BJOA 3F6VA 3GLIB 4BAYA 4A3LJ 2EBIA 3QOPA 1JALA 2LY2A 4BBNC 3ZMTA 5IOYA 2GQFA 3FBIB 2LXAA 3SAVA 1TS5A 3AU5A 4HEA1 3GFMA 2KNAA 1X1MA 4K7UA 1R5HA 3A0HC 1SE3A 5JZEB 3RI7C 2GQQA 2XASA 3BR1A 2LXEA 1SB3C 3F92A 1FCLA 1B9NA 2HL7A 1RR8C 1K8RB 2ZAOA 4GN1A 2GI9A 2QYOA 4L1BA 4RGUA 4AOFA 1IV6A 1Q1VA 2NS5A 2JMWA 3R3MA 4S05A 1QQRA 1SFOJ 2ZSHB 1MJDA 4ENMA 3VYTB 1PDNC 3QODA 4HDQA 3P9CA 3KVFB 2HOAA 2RDGA 3ABVB 3SYKA 4YRVA 1TKEA 3HK0A 2X6XA 2L3DA 1SE9A 1FOWA 1NY6A 5HNHA 1YIWA 2L0FA 1HDDC 3DXJF 3JRCA 2LVPA 1R1UA 4LNIA 3T1BA 1R7RA 3FUUA 4IRHA 2D11A 1IJWC 1C1YB 2ZVNA 4Z6YA 5IP9J 3EIEA 2KX0A 4WWMA 2BZTA 1BM9A 1XMKA 1YQ3B 2JWZA 2XF5A 3BZKA 3OL4A 5D6JB 2PEXA 1D4BA 4NHJA 1MBHA 3HIZA 2PQ8A 4G94A 3AI5A 3R0AA 2OCCH 3HOXJ 1EWCA 2LYCA 1TF0B 3GLFE 3HJEA 1NO1A 2W82A 2NOJB 2SEBD 4M3FA 2QHOA 1Z5CA 3S1RJ 2F5DA 3M3JA 2MWSB 2KHHA 4LF5M 5EZGA 3LB8C 4ARCA 1I6XA 4EGZA 4NY0A 1WYGA 2KZUA 4MLOA 1J0GA 5IO9A 2QP9X 3DPDA 1MMAA 1E8ZA 2ZZPB 1NSFA 1NV9A 3M95A 3FXLA 4G9YA 3ZQ4A 2AQEA 4D5CA 1XCVA 4E7LA 3SZPA 1FEHA 4OX9M 4RMNA 1N32M 2KRUA 1BI2A 5HS9A 2R18A 4IBFA 5F0FA 1JWBD 4UB8C 2P5VA 4DUYM 3K92A 4P55A 3OYJA 4LIVA 5E6JA 4ENNA 4II2B 3U1KA 3U60A 4BKXA 3H7SA 3T9LA 4N9F4 2GWRA 3PNYA 4BHBA 3GTPJ 2LGDA 4EJUA 1UFMA 4XOPA 5EXXA 4G11A 2QMTA 2BHZA 3MZ8A 2Y0TA 1LTMA 1LEAA 5ICEA 2IS1A 1SVMA 5DPSA 4IG7B 5FKLA 3CF6E 5D7GA 4KZ0A 1TH2A 4A3BJ 1EF5A 4IQJA 3OS1A 2QKMB 4A3MJ 4PDGA 2W25A 3OSFA 4KVGB 2E5ZA 2KTRA 1FJGM 3H5NA 3BR5A 2KWVB 1MMDA 1OAIA 4YXDB 3Q8BA 5E1ZB 2JQ7A 2BKRB 1RAXA 1SVLA 1T0QC 3SEQA 2J7OA 2R0IA 2L09A 4L5JA 1W0UA 2XGCA 4JI8M 2LKSA 2OO9A 3DQVA 2M7AA 1OISA 1R5GA 4HNVA 3G1OA 1DGJA 2V9KA 1D8JA 4M8NA 4IXAA 4MACA 1PGYA 3TEZA 3HHXA 4IC7B 3WIMA 1R49A 1N62A 2A3SA 3GWZA 2MYSA 3Q69A 1T6BX 3H1CA 2ME6A 3QRFF 4CCLA 3B08A 2WXKA 3KUZA 4CA0A 4TMAB 3PSIA 2WQYB 2EK5A 1HF0A 3NWLA 2LTPA 4QOZC 3QOEA 4W5WA 4YIIA 4FCVA 1GJZA 2XH9A 3RUIB 4IM3A 2L4AA 2X38A 1X3ZB 2G1EA 4H4KC 2FIFA 4I6NB 4C80A 2HZTA 3UKGA 2BBCA 4HEA2 2Y31A 2VQFM 2WY7Q 2F5EA 5KCMA 2F2EA 3JREA 1CZPA 1F4IA 2EA0A 3MP9A 2Z5UA 3J7ZI 1EH6A 4LJPB 4LJ4A 2WXQA 3ZC7B 4OW0A 3GPYA 5DD4A 2DFHA 4FBJB 4LDTB 2Y2ZA 4A3EJ 4PFOA 2L9VA 3OYMA 2OOBB 2XSJC 3D1NI 1DGGA 1WSUA 2HQ5A 4IRGA 3SDGA 3U2RA 1WJ4A 1XEEA 2JA8J 7CATA 1WRJA 2EFQA 2BB5A 2L7RA 1JRUA 1V81A 3V7RA 4WIPA 5IZ7D 4KHPM 1ZGJA 2JY5A 2NS8A 5FD6A 5J8CA 2IW5A 4KKIA 3OYDA 5DDGA 1EJ9A 1A70A 1K4SA 4B3RM 1YJIA 1NHAA 1D6EC 2Y0MA 5JHUA 3B2FA 3CMYA 4ZH4F 4J19A 3BINA 4CUGA 1HW2A 4HNTA 2PPHA 2EV5A 2JUGA 4A3PA 2VH2A 4KO8A 2NXNB 2GRIA 5FTNA 3FRIA 4UB6C 2L52A 3N3KB 3KDSE 1GABA 1ACIA 2HYJA 5K5OA 2BVLA 4AM3A 4MFEA 2KRHA 3T5XA 2HPIA 2F5FA 2KZVA 3GTKJ 4DR1M 3LDZE 5D3IB 1O57A 4GC9A 5KQ8A 2ZJRF 1KM7A 1FMWA 1LE8B 2MLGA 4M9ZA 3Q8XA 3LA3A 1ZOYB 2GIVA 4D7MA 1D5VA 3DCFA 3SFDB 2IS4A 1LM8B 3GUDA 4ESFA 2GNOA 1V3FA 5KPZA 1MW7A 1QF6A 3AEDB 3B9PA 2QENA 3MVPA 4LRSA 4P17A 4Y3OA 4DXFA 1MMSA 1D0ZA 2F5SA 3L2AA 2X48A 2XAQA 2AQ1B 1ON2A 4RAGA 1D0YA 4PGHA 4AUQC 3W6VA 3Q0WA 2ZAMA 2M8GX 3KEOA 2C7HA 3HDDA 2X1CA 2TCTA 4MFDA 2O03A 3CO6C 5FTJA 1ZLJA 4GITA 2EB7A 2IPQX 4I2OA 3FM3A 1SMYF 1XCQL 1UD7A 3FILB 3PO3J 3HHHA 1VQOI 1MNEA 3R7RA 2Z8YM 4RF0A 2VONA 2D5VA 3A4SC 1B4AA 4MEYF 5J4VA 4XMYA 3JRIA 3CCUI 3CUQC 2Z4RA 3CJTB 2BQQA 2MD0A 3T8MA 3QJZA 2WDTB 1RWSA 3H4MA 1QRYA 3KWVA 4XLPF 4OAYA 3AXCA 5FB2A 1QZYA 3L1PA 2FOKA 3W6KB 2FNJB 4HRSA 3E5XA 4AQ7A 3A9KA 2P5LC 4LJ8A 5H8YE 1RC9A 1XLNA 4C4VB 1AN8A 2LOOA 1IXRC 5IKCM 2QQ9A 1BN5A 4LJ9A 1BOAA 3F8CA 2MBBB 1T0RC 1XT9B 3A42A 4Y13A 4W9GA 2O9LA 3PTFC 3LXFA 4A5NA 3HOUJ 2Y3AA 4OVUA 5KAIC 3V62A 1YLFA 4BYYA 3QAQA 2XFSA 2Q5WD 5DM7F 5FTLA 1XO3A 1FBSA 4IHWA 3BR6A 4JX4A 2X6WA 2YX7A 3U30A 4F91B 1DV0A 5DCMA 1K61A 4FCWA 1NI2A 4N58A 3PZDA 2KX3A 3VLFB 3NRZA 1TZLA 3E1SA 4RCOA 2V6ZM 2FCNA 1TZOA 2DLBA 2DVWB 2FS1A 3CP2A 2X6OA 4B3XA 3L54A 3CMMB 3ZO5B 4TV3A 3GLFA 1H88C 2RRUA 3LAJA 4XONA 2EELA 2HU9A 2KHWB 1EFUB 2CHQA 2VE9A 1XMXA 2ONQA 5ICCA 3EETA 4L5IA 4G3XB 4DV0M 3RI4A 1K82A 1I4RA 1SBBB 1YQAA 3TPZA 1GG3A 2BS4B 3ZMZA 2VJJA 1S7AA 1PUFB 1KFVA 2KFKB 2NCNA 3Q8GA 2CYYA 1ZW7A 2FMYA 1KLVA 4GO1A 2NPTB 1VEJA 3C2HA 4BKTA 1FTZA 2XAHA 3T3NA 4FLHA 2YPRA 1B72A 2ZMEB 4WQMA 2HYFA 2ADUA 1RYJA 3OV8A 1IF1A 3WG9A 4MELA 2MROB 1IBMM 4JI4M 3V6CB 3FMQA 4B47A 4UUTA 2K02A 2J7QB 1K4TA 4BBNF 2ZCCA 1WFYA 2CEAA 2PIAA 1JI8A 1JB0F 1IN5A 3U6OA 2QILA 2RVCA 2IO2B 3NEUA 2BYFA 2ZBKB 4LFUA 2FUHB 5F0HA 3ZRFA 3U61A 2KIUA 1UAAA 3BVMA 4M6YA 4FE7A 2DZKA 3I58A 3WU2C 4U87A 3MZYA 2KFJA 4WH4A 2WAQN 2EFPA 3ZQQA 5EG0A 2FQ3A 4HX4A 2MX2A 5IN7A 4HSRA 2BYEA 5L3CA 4EZJA 2KRFA 2D07B 2BPSA 3B7ZA 2R7DA 2NBUA 3UIOB 2DWQA 3F8MA 3U7DA 3AEFB 2QCOA 4PJJA 1NNJA 4IJAA 4OZBA 5DNYA 2WXRA 4KA4A 1MI0A 2L8JA 3ZLZA 3JVZX 3ZH9B 1UFZA 1Z7LA 3DWLE 3KOZE 2DZLA 5GKNA 1KU9A 1G8PA 3NQOA 5M5YJ 1VCBA 1G59A 2R6FA 4YELA 3NZUA 4NC6A 2LUMA 3VR9B 3B7NA 3LCVB 3OSGA 4FWHA 3G2BA 2V4LA 1R7JA 1XMAA 4FQGA 2B63J 4PS8A 2DN0A 2A6EF 2RMMA 2NS7A 2QA4I 2Y75A 4YTMB 2K5CA 1UG2A 2MQJA 3HUGA 5L8RF 3HHZA 4IBDA 3VSKA 1YW7A 2HS5A 3LSRA 4W1UA 2D2WA 2D45A 2VDBB 5G55A 2QF7A 1MSEC 4XRFA 3V7SA 2WSFF 4A93J 2ELKA 3GLIA 4DDID 2XF6A 1H4RA 1CF7B 3HU1A 2C9CA 1TZ1A 4W9KA 3BCBA 3U7ZA 2PBIA 5EDSA 1FOXA 1FYKA 1J7BA 1XMOM 3RNAC 3H0GJ 2VXZA 2D1VA 1WM3A 5B66C 4A55A 4B6WA 1WM2A 2E6XA 4I6PA 5CVUA 1NV8A 4Q5SF 1FEXA 3VKHA 3WGGA 4BXUA 4L16A 4AG6A 4CXFA 2IGKA 1T5XD 2KTFA 4CCKA 3ZPLA 4E7JA 5FTKA 1N61A 5BQTA 1IN8A 3S1QJ 3ESWB 1XLOA 1G3YA 2Y9YA 3WTXC 2KWCA 3Q0VA 2N9PC 4BKSD 4F55A 1S7EA 4FTHA 4LZZA 2LKPA 1Z9CA 3ETRA 2X4AA 1LQ1A 1TWFJ 2JZYA 2OZ6A 1JE8A 3CUQA 4XRSA 4P7IA 2Q0OA 1E3HA 2YUSA 2UYZB 1YOVB 2DYMA 1V5OA 3EYIA 1KYIA 3LSGA 3BVZA 2MCNB 4R7GA 4IHVA 1GL7A 3NRVA 3W2VA 4EQQA 1R7SA 3V42A 1WJFA 4XSZF 4K1RB 1K51A 1A04A 3LYYA 1WZ2A 1T38A 2BXZA 5IOZA 1PGBA 1ZYRF 2HXIA 2QSFX 4LF7M 3IH2A 5DCFA 3T1YM 2KT0A 4KYWA 3RYPA 1HTQA 2K4BA 1EO6A 4IHXA 3GLXA 3KIOA 4OU7A 2ZXJA 1V34A 3SFIA 3H7PA 4BQQA 2CV2A 4XYCA 3GFLA 1WZ0A 4CICA 3S2WA 1MX0A 2IGGA 3OYEA 3CO7C 3CSFA 2HTME 4GOCA 3JSPA 4IBEA 1TBEA 4JQWC 1XC5A 1F77A 1WXQA 1JKRC 4A90A 3U2SC 3U6LA 2O6VB 2Y30A 2E19A 2WSCF 2WXGA 2VZKD 4JV5M 4Q47A 2DZJA 3Q3SA 2CMPA 5L3EA 4L6V6 4IOAF 4AQYM 1WH7A 3ZN1A 1ZMUA 5TJJA 1DO0A 4AYBA 1QT9A 3H35A 3TDUC 3RNCC 2VQHA 1JWUD 2LZ6A 3CMAI 4FVMA 2APLA 3OYLA 3L08A 3T8TA 4I6LB 4RGMA 4II2A 1YJWI 2XBBC 3AE5B 2L5QA 2OQRA 1EU4A 2DNFA 4YTNB 2VBWA 3U6QA 5LHGA 2AQ2B 3OS0A 1C7YA 2YU3A 1K78B 4WJQA 4L23A 3Q5FA 1QZEA 2KYWA 1JR3A 3MN2A 2UXDM 4OMYA 4PSWA 4BE2A 4WX9A 1TY2A 2BE5F 2XAGA 3L2VA 1F43A 3BK2A 1TH4A 2ID3A 2KJCA 2YVCA 2KAJA 3I01M 1IQPA 3TEYA 1AIPC 1HQCA 3VKGA 3X0WA 2F48A 1UH6A 1IY2A 2BYVE 4CSWA 4B3TM 1KSFX 3MK6A 1GV2A 3EUHC 1HTOA 1G8XA 2W9NA 4DYCA 5D8LB 5AONA 5CQEA 4B7FA 2VQEM 3PRPB 1IN4A 4LCBA 2WXIA 2IO1B 4FCTA 3BOQA 3U52E 2AL6A 2Z99A 5D4SA 3RPUA 4PCZA 2V1DA 4I5SA 3Q3NC 5E3LA 2IXSA 3WGIA 1POGA 3AE2B 3PRMB 3S14J 1UHSA 1KH0A 3P4RB 3DPUA 4HLQA 4LOCA 2CUZA 2DAGA 2XEPA 1WJUA 1GXPA 2HYGD 3FIWA 3HKZN 3DPLC 5J3LA 1DOIA 4OVZB 2XFTA 2LD5A 1HLVA 1YYVA 3SASA 4RM9A 4BFRA 4DR7M 1WGYA 4D9JA 4NB5A 4YSXB 3CF5F 1IO2A 1F9JA 2MSED 5H6RA 1OMIA 3PNTA 1E3OC 1WXSA 4B09A 2UU7A 3WODF 4O1NA 2H6BA 4FN2A 2KJ6A 2V0GA 3ML6A 2R92J 2OOBA 5JLWA 3S15J 3Q0UA 1XLQA 2E1MC 4XGIA 2KOXA 2KFDA 1J5EM 1MBFA 1JGSA 2L7ZA 1MJBA 3HKPA 4GYIA 3VDUA 1T33A 2HCBA 3VVWB 5BPIA 1WGLA 1ACCA 1A36A 3N9YC 2KXEA 4QWQA 2JRIB 4DR5M 4MB7A 2A5UA 1NNUC 3E4RA 5AZHA 3T15A 2I10A 1FRDA 2SAKA 4FX0A 1UBIA 1HQRD 2OF7A 3QPSA 5ICGA 3SZGA 2CV1A 4XWTA 5BPVA 1QPIA 1UF0A 3S3MA 2R45A 4CQNA 2F6CA 3D0SA 4PUSA 4XQFA 1F9NA 1J19A 2A4ZA 2VI6A 1DQUA 4OOIA 1T98A 2K8CA 3QX1A 2L54A 2QNJA 3KW6A 3EFCA 1T6SA 3SFZA 2A69F 4ANWA 3KP5A 1OKRA 4C56C 1UGJA 1WR1B 1Z5AA 2P6SA 4BDYA 2L83A 3NJTA 5ITTA 2FCSA 2C5LC 4RAFA 3Q8FA 4BAXA 1WJ6A 4GGQA 2VBYA 3S1NJ 1K3XA 3FTDA 3AAFA 2CHVA 3JR4A 2P81A 4BY1J 4XLEA 3SC3A 2V79A 5D2MB 4ASWC 1BI1A 3D8BA 3N20C 4GB9A 4J6IA 2KWDA 2W84A 1T95A 2JTVA 2INPE 2E35A 4HL4A 1JCKB 1K52A 2LGYA 1RFKA 1V6EA 2PTLA 4AKHA 2D10A 4K7WA 3TP0A 1IZ1A 1VDDA 2J0JA 2DDAA 2CP8A 3B02A 4P16A 2BJWA 2X6YA 2WSEF 3NVYA 4EE2A 2HWVA 1AA7A 3GYHX 2R0QC 3LJ3A 3PFYA 3ZQIA 2A6TA 5DV5A 3ML8A 4JN6A 3HM3A 4XIDA 2VOOA 4B8XA 4MGYE 4R3DA 5E6NA 2IP2A 1VQMI 1SD7A 3MMYB 3ZQ7A 3CCMI 1E8WA 2ZJ2A 2V1XA 3MKWB 1GC7A 4LLLA 2KZGA 1IXSB 1U78A 4KN4X 1IGNA 2MJ3A 3K4NA 4L9JA 1UB9A 3NVZA 2X8XX 2H5XA 2L7IA 3SYTA 1PDXA 1J7KA 3WHBA 3O13A 2R3SA 4LG3A 2WU2B 2HVSA 1KRHA 1B8IB 1R6BX 3IP4B 1MBGA 4AVZA 4P1CC 1UBQA 1P7IA 2L7FP 1AKHA 1ROEA 3K69A 1S1QB 2M1BA 2L7HA 5LD2C 3H5AA 3TDZC 4CZZA 2UZKA 4C4VA 4U0WA 2VIXA 1T3QA 5EEHA 3DWGC 2O2VB 4L9NA 2CU3A 2DQLA 4HBLA 3BR3A 3HHGA 1NJGA 5KQDA 3GW2A 4TQ0A 3SFEB 2WP9B 3AEEB 1HSJA 4TV7A 1P7EA 2K86A 3U8ZA 2XGXA 1QHHD 1BIBA 3DLLF 3I54A 1ZARA 1YMHE 4CYDA 1C3TA 1VQ1A 3ZRGA 4EJOA 3HU2A 1L1ZA 4IX7A 4P1WA 1ZG5A 1Y1WJ 1L2DA 5FLXS 3OAWA 3EUHA 3CMMA 1MJ9A 4A9AA 1E3PA 4L9TA 1WSPA 1MJAA 3KWLA 5LFAA 1OCTC 4YIFA 3HRSA 2LF7A 1WRIA 4I02A 2JF5A 4LRTA 2P0WA 1Z7UA 5FD5A 1MHHE 4M0WA 4MGRA 2BKFA 3U4EG 3B2GA 2HVQA 1CUKA 1C79A 2WS3B 3S93A 4HW0A 1PUFA 2EJRA 2AS5F 1GHCA 1TTEA 2LVOC 1LPQA 3GZ6A 3F72A 2WXOA 4A5MA 3JSVB 2E2IJ 4F52A 2NPTA 4OIQF 3E6MA 2DMUA 4AKIA 4IHTA 2Y0SN 4LCDE 3TMPB 2RPQA 5JVTA 3FMSA 3CGWA 1RPWA 3Q3OC 1SJHD 3A1QB 1UELB 4X1EA 2ZB9A 2E1NA 3MTNB 3IWZA 2QLZA 3MKLA 4UVCA 5FGMA 1ZQ9A 4BQNA 2YU9J 2TDXA 1WIVA 3L29A 2ZBKA 1VLBA 1OKSA 1LDJA 1EF1A 4WCGA 4W97A 3M07A 1JW9D 2K0BX 4UVBA 3ZKJC 1D1CA 4IRIA 2R46A 2CHWA 2KRCA 1ZR4A 1HC8A 2GXGA 1H0MA 2LDUA 1LO5D 1W4MA 1KJTA 1L6VA 3RFWA 3VYSB 3ZDMC 1X1CA 2ZCWA 2KLGA 3PLVA 1KGSA 3OYAA 2MBQA 4YSZB 3GQ4A 5ILUA 3KLOA 5M3MJ 4B3SM 2BB6A 1V1PB 2HFHA 3M62B 2NVUB 2A07F 4KDLB 2PVOD 4GMQA 2HPMA 3HY5A 1D5ZC 1S3JA 4KODA 2ZJQF 1Z2MA 3A1YA 4N6EB 4KGSA 4RMAA 4IZZA 2QGUA 4OZCA 2GOWA 1EH8A 2LASA 5L3BA 1Q1HA 2CE7A 2MD5A 3SAWA 5B5EC 2JRHA 4M74A 2X85A 2QJLA 5E8GA 2Z7JA 4L9VA 3S3NA 2DFEA 2M3AA 4KIGA 3PGEA 2CW0F 4MIMA 3HGGA 2WU5B 2ZNZA 3GZNI 1ZAOA 3I4VA 3ZQJA 4GKJM 2F5OA 1VDVA 3PQJA 4LK1F 3ZCOA 2L1AA 3I0TA 3A45A 2ZVOA 3GB1A 4Q4ZF 4B3MM 4JI7M 1J59A 2QWWA 3HTUA 1QHGA 2QUFA 3M1CA 4CGZA 4GHAA 4FWGA 1CF7A 1SFXA 2M45A 1Y8RC 5BOXA 2XPVA 2LG4A 2XRLA 4HZFA 2R7FA 4ZDLA 2DAKA 1I4PA 1TR8A 4ANVA 3RCZA 2DJNA 4M02A 1IUYA 1EUVB 4AWJA 3W68A 3RKXA 3DWMA 4I4LA 2P4WA 4IM0A 5LHIA 1GXQA 1C77A 3CTAA 3W2WA 1E7PB 1F36A 3GTMJ 3ABLH 3CC4I 3RULA 4KLNA 1K6YA 3BPVA 2BXYA 4PFPA 1E32A 2ZTCA 2KNZA 1FMVA 2K9DA 2ME0A 5LXIB 5G2NA 3VPRA 4BXFA 4RKUF 4JIOU 1X37A 2Q2EB 4OIRF 5F1RA 3I53A 3HWSA 2Y48A 5DS9A 1WHCA 3T3OA 4BJ6C 4PYUA 3UK6A 1TBXA 1P9DU 4I7HA 3Q8EA 4UUSB 5FLMJ 1X19A 5E20A 3ZXSA 1P4WA 4WF2A 3OYHA 3PZ8A 2K8HA 3PM1A 3A98B 1YQBA 2VN2A 1Y8GA 4I98B 3PJRA 2RGFA 1Y39A 1NI3A 1I4WA 4HLXA 3QQAA 2MHJA 3J7BA 3KYCB 1H89C 2YQZA 2BEOA 3I55I 4JK1X 3BP8A 3AE8B 3TOAA 1U3EM 3FE3A 4WXCA 5FTMA 2KWUB 3TEWA 3N32A 2VB6A 2Z9OA 3ZTCA 5FKAC 3EUB2 3APDA 3M1EA 4KIBA 1LEBA 1KQ8A 3SMSA 5G5HA 4ZZDA 4PT5A 2BY3A 5GTHC 2DI3A 1E17A 1HJPA 3QIJA 1Z5SB 2ZPYA 2ID6A 1K50A 3LOCA 2RQQA 1X1BA 5ITUA 3BVGA 1NH3A 1RRBA 2OJWA 3U6DA 4MNUA 4QHTA 1UUPA 5K7FA 2PX9A 2F5NA 3K1JA 1K53A 1BBYA 2QIEB 2GBMA 2RGHA 2IA1A 2L9NA 2XC7A 3DVNV 5L95C 4MGIE 4N9HA 3U1DA 4AWXB 3U6SA 4DBGB 1XD7A 1IXZA 5DD8A 2RDPA 5BYSA 3ZMSA 2M34A 4BUPA 2K8BA 1WI9A 2LVOA 2CQNA 2VBXA 2FNPA 4XOTA 1MBJA 1QZMA 5J40A 4L8RC 2G5GX 1K78A 1TKGA 2KACA 4XE0A 4LK0F 1HKQA 2KK8A 1TYGB 5LEJA 1V33A 1SVOA 1X2NA 4FJVB 3V6EB 1VQNI 4C30A 3FXRA 2H8WA 1JUSA 5FKMA 4MTDA 5EE9A 2EV0A 4AVPA 1BR4A 3RYTA 1S5LC 4GFBA 1W5SA 4MGKE 2DLLA 3LNQA 1HA5A 4XKVA 3EA6A 4G6ZA 1KYWA 2J42A 5JFRA 1VF9A 2DZMA 3VRAB 1B1BA 2LMCA 3DU6A 4BJ5C 4FXCA 4LGMA 4KICA 1MG4A 2LWPA 2M87A 3C9PA 3O8HA 2BGFA 5F6FA 2L4MA 2L00B 4YIRX 2CQKA 2LEKA 3ECOA 3QYBA 2DW4A 1WJEA 3AL0C 3PFIA 3TW6A 4YTPB 4LJ6A 4FX4A 3JR5A 3E46A 4LG0B 5J1UA 4CCJA 5FRNA 3I4MJ 2GBKA 5L3DA 3L7WA 4EIWA 1LFPA 4HK2A 3GO5A 1GUUA 2LH0A 1CMXB 3MC8A 2N7JA 1R00A 3AOGA 2GMIC 1OQQA 1KONA 2OCEA 1PYVA 4OVZA 1WCMJ 1L4DB 2G0EA 3OTOM 1FBQA 1ZQ3P 1HXDA 4J01A 2D1HA 3WU1B 2JT4B 4KITB 4XN3A 3VFDA 3FKJA 1TQMA 5IT9S 3WANA 1YJ1A 4US8A 4I6ZA 3LSJA 4HWIB 3TKYA 5LNK1 3I04M 2HAKA 1K6OA 4DV6M 2K9NA 1D8KA 4OZAA 4CIZA 3K4BA 3BPXA 4K7SA 2HJ8A 3H3ZA 4BKSA 3KQ4A 2WGSA 1OQYA 3KSXA 3DTKA 4A20A 3UR3C 4WAFA 4PK1A 1ZGUB 2MJ5B 3C2BA 2DPDA 4YL8A 5FLXZ 1IY0A 3ZQHA 2EV6A 2PW9A 1B9MA 2G9WA 2BOLA 4HXDA 5EEGA 1HZ5A 4XKCA 3RJPA 2BBYA 3FMRA 4DHJD 4ZRIA 1ZG3A 4A8XC 1FTTA 3BYYB 3ZQLA 2KC2A 3VODA 4FHTA 3K1PA 2JN6A 1C1KA 3CDLA 2QQ8A 2IBDA 1NYQA 2STTA 1FXTB 1WJNA 4HPLB 2RPVA 2KW0A 2BGCA 1GAQB 2GAUA 3SAUA 2NVUI 2DT7B 3IT6B 3FXUA 5GXGB 1P98A 1TNSA 3BCAA 2HNHA 5ED4A 3L2QA 1L2CA 3JRBA 1YN3A 3ALBA 2MEKA 3PHWB 3P5JA 2FOWA 4E7IA 4CYEA 4ENKA 3OL3A 2K6BA 3V05A 4IOIE 1WR1A 2DK5A 1F2RC 1R22A 2JSCA 4LD5A 4ZHOA 1J9IA 1F2RI 3IKVA 4WJPA 3NVWA 1ZMVA 4LFBM 2M5ZA 3JAMS 3M7GA 2E36A 2FX0A 1G2HA 1XX5A 2AYOB 3NBIA 4NL4H 1A5JA 4MDKE 1D1AA 1TGUA 3IRQA 4LF4M 5JHFA 1N5XA 2CGPA 1R2ZA 2R7TA 3WHKA 2XHKA 4NUBA 2EFNA 2R2QA 4JX5A 4Z8XA 3GRVA 2XAFA 2Q8KA 1OEYA 4A3DJ 2HOEA 2JPHA 4BKGA 3J81K 3CJQB 4G6DA 4DK5A 2ZPNA 1L8QA 5J1RA 3RDIA 3K0LA 3I5UA 1MZBA 4EM0B 1KTKA 1MD0A 3OIPA 3JW0X 2D3AA 1O3RA 2JUJA 2XGEA 1WMHB 3RNFC 4Q2JA 2PMZA 4KUMA 1T6OA 4BH9A 1U0JA 4ZYHA 3TW7A 3ZMUA 3H0DA 4BE1A 1AW7A 1XSXA 2BWFA 1BOBA 2Z33A 5JI6A 3WTTC 2M4GA 3DHGC 3HGYA 3PRZA 4ANUA 2COBA 4XR6A 4WJOA 4C2MJ 3A01B 1V4RA 3EHVA 1ET9A 4ESBA 1E2XA 4RNAA 3AG2H 1Q1OA 1Z0XA 3GP7A 4II7A 3VHTC 2DFIA 4PJMA 4RAZA 1GO5A 3MCZA 2R61A 2DDBA 3BTJA 4B44A 3HJSA 3BZCA 1JGGA 2HR3A 1SF0A 4AZFA 2IGMA 3I59B 3TL5A 3DZDA 3CWIA 5AUKA 1QUTA 5J8FA 1JUMA 3K9OA 4EJVA 1G3SA 4LNNA 3QQ8B 4BGDA 2Z59B 5JI2E 4ZTFA 3IG8A 2O2VA 4YHHM 3IAM2 1XB2B 3WHLA 3VK7A 3FTCA 1FMAD 1C0WA 2FU4A 3L00A 2W55A 1XHBA 2G7HA 2DWLA 1QLBB 4ARIA 2JA7J 4YY3M 4BQAA 1QYRA 4QTRA 1LKXA 3RCOA 5LHHA 2R7SA 3PHXB 3RN9C 2LHCA 4HJKA 5LGTA 1QVRA 3CESA 3F22A 5BYRA 3C1DA 1YO5C 2JZZA 4DXGA 3JR9A 1XGSA 2UUBM 1IDYA 1QOBA 4I99C 4IBBA 4HQMA 3X23A 4OHJA 2KANA 3AE9B 2F5QA 3UGBB 2F4MB 2MH9A 2NRAC 3OYIA 4BBSJ 2WNMA 1PM5A 4ZHPA 2LJIA 2N7DA 4D81A 4X65M 1W7PB 1C9FA 4BEHA 2M4NA 4RM3A 1M4VA 3JSVA 4AW4A 4NQKE 2PJRA 3J27B 2DI0A 4XBOA 3BTCA 3MKZA 2RNGA 5EE0A 1G41A 4X64M 1A35A 4QNMA 3HSFA 3HOYJ 4OIOF 1ETQA 3DU5A 2RC4A 5EEAA 4LLGF 1E9SA 2PVGC 1XPXA 3TE6A 5I4DA 2PJPA 2F4VM 1VQPI 2E5LM 3QAUA 3DQVC 3Q3MC 2K0PA 2XAJA 3OYFA 1RUOA 1ISNA 4A0YA 1P6RA 1NDDA 1GVDA 4BZAA 4HYEA 3OYGA 3W5VB 4P5OA 3HOTA 1JR3D 3BBZA 3LSPA 3DOWA 2AXLA 1WJAA 1F1ZA 4QPQA 1XD3B 2IJLA 3JRHA 9ANTA 4EUTA 4XLAA 4RB0A 1LUJB 1TGZB 1W0TA 1ZP0B 2X49A 3FKEA 1EKEA 1V1PA 3ONSA 3HVZA 1ON1A 3DBRB 3MJ5A 5J47A 2OTLI 4Y15A 4P1BC 2XGDA 2I7PA 2LBFA 2UV1A 1DGBA 3R2IA 2UXBM 1HQYE 2EKEC 1ZG1A 2B9SA 3RGSA 4AUXA 3OY9A 4A69C 2DAEA 1N78A 5CKTA 3H3VK 1R58A 1BW5A 1MH3A 1R4NI 3GLGB 3AE6B 4CYCB 2PKOA 1BXTA 2HDEA 2VPRA 1V1OA 2XF7A 3M63B 3M8JA 3E5QA 3B89A 4LGYA 3IG5A 2K40A 1MKMA 1Q39A 3UZUA 2BVCA 3WGHA 4G7HF 3FKIJ 2ICIA 1SIFA 4L78A 4C7YA 3KZZA 1LXDA 4IDIA 2DXIA 2QBYB 1SFKA 3NVVA 3I3LA 3FAHA 4LB5A 3RPFC 2ESHA 4EM1A 5TGTA 1H6UA 5J6XA 1X4OA 5A2QK 1C4CA 1T8IA 5M3FJ 2LKXA 4M3GA 4KIKA 2LY9A 2R4EA 4DHZB 2KQ4X 4RA2A 3QARA 1HT2E 3TQNA 5BNGA 4LDTD 2IYDB 1OCCH 1WHUA 2L9SA 4FADA 3E21A 2BW2A 2OPFA 3JW4A 1PP8F 3FXKA 2J52A 2MW5A 3FXQA 3FUTA 4NC7A 1GPXA 4FT8A 2AQ3B 2L4EA 4BHCA 3VSLA 1S9HA 3MJWA 4AKGA 2Q2EA 1DGHB 3DBLB 4BBRJ 4DW6A 1TDZA 3QP6A 2ZCBA 3OYNA 2LD9A 3GTGJ 4P9FA 1FT9A 1DGWY 2HDDA 2LBCA 3ZQGA 1GVJA 4E74A 1UCRA 4UUSA 2E2HJ 5IT9Z 2KO3A 4DJAA 2EKKA 1FYLA 4HX7A 4PSXA 4M01A 1HE8A 1UZCA 2K1FA 1MDMB 1A5RA 3JRAA 1FIAA 5IYBJ 2V1CA 1NVID 2WX0A 2DKLA 4R79A 4J00A 2IBIB 3GLHB 2MFZA 2MH7A 2NR2A 2RSUA 2NNNA 1Q02A 3RNGC 2XKOA 4L2YA 2E7WA 2UXCM 1TLHB 3LCUA 5ICFA 1GB4A 2I7NA 1SXJD 3L27A 2CHZA 4B1RA 2W85A 2W24A 1YIOA 2CU7A 1IV8A 2IPKD 1GNUA 4AIJA 2EZIA 4JYAM 2K4JA 1LFDA 1L0YB 3ZDTA 3O3KA 3J80K 2EA2A 4RS8A 2RN7A 1YIJI 4KSKC 3W3CA 2AWTA 4I0AA 1WY8A 1YSYA 2VKEA 5HS8A 3BK1A 1D2NA 4ANXA 1BR1A 2F5CA 1R1TA 4A6QA 4XBFA 2QKLB 1LDDA 2HKJA 3T38A 3AG3H 1Q3BA 4B3AA 2K39A 2MC4A 2O6GE 3K1MA 4G4RA 2KDBA 3TEXA 3PVSA 4DQOC 4DZPA 4USAA 1V54H 3BG9A 2LVSA 3ZXVA 3OS2A 2FAZA 5CHWA 1YX3A 4DBGA 3LSHA 2IAIA 2N35A 3JAMZ 5FR3A 1VI0A 3F21A 2CS4A 3PS6A 1A5TA 1N6ZA 1QZZA 3CC7I 3VFKA 1PGXA 3C3EA 4IIWA 2LP0A 2HQAA 3IWFA 4ZYDA 4HA8A 2M8SA 1O3QA 2KRKA 1Y0UA 3BZDB 4GDKB 3O8GA 3IHPA 1FNWA 2V4IB 3OIOA 1N33M 1ORYB 3L2CA 2V1YA 3CCEI 5E1WA 4P9UA 3EPZA 5HDGA 5CHFA 1LDKB 1FJLA 1D1BA 4DBQA 3UJNA 5KNLA 2HGCA 5BMZA 3PVLA 3A03A 3J7AO 3KW5B 1I4HA 3DBHB 4XRSG 3FRHA 3DV8A 1FPYA 3BQYA 3I57A 3KYLA 1SG9A 1OTRB 2L32A 3QPTA 4OWRB 1L0OC 5GADJ 2LR8A 2HTSA 2J5OA 2DU9A 3BR0A 3FUVA 5KHOA 2XROA 2EMTA 2N1VA 1O7FA 2VUMJ 1ENHA 1V80A 4IM2A 1HOMA 2LXCA 4U0VA 3CSTA 3ZP5A 2K47A 5CLSA 2GA1A 1U5TB 3MHVC 3WCQA 1V8CA 2LH9A 4G4OA 4WXDA 2N9KA 3S3OA 3QYFA 3KZYA 1ZLKA 3KP6A 2VRRB 2BW3B 4LMYA 3N1XC 4DV1M 1NBFC 4Y17A 5F64A 3DVGX 2K6QA 2ESNA 5T8IA 2ZTDA 3VYRB 1L7YA 1R9TJ 2KMCA 4WP2A 2DJIA