1QZEA

Hhr23a protein structure based on residual dipolar coupling data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
360
structure length
214
Chain Sequence
b'SAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog A
publication title DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 51
structure length 214
sequence length 360
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF00627 UBA UBA/TS-N domain
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA04
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1qzeA02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1qzeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1qzeA01
1P1AA 1XQQA 3TBLD 1DV0A 3X23A 4II2B 2L4FA 4G50A 2LJ5A 2L05A 5JI2E 2M0XA 2BWBA 2ZPYA 3W1SA 1LM8B 2IY1B 1OEYA 3QHTA 2DZLA 3TIXA 4NAWB 2HTHA 1HT2E 2K8BA 2K0BX 2LGXA 2MX2A 3JSVA 3KW5B 4YL8A 5E6OA 1E5WA 4W9KA 3TMPB 3VVWB 2M4NA 3T9LA 4GDKA 2LZ6A 1YJ1A 1WE6A 2Z0EB 3V6EB 4IWPA 2K25A 3UINB 2DAKA 2LVPC 2N9XA 3BY4B 3GLGE 3MTNB 4DDGD 1E8XA 2LUEA 2CR5A 5DPSA 5DPRA 2KNVA 2N7EA 3M62B 3BBZA 4HDQA 3UIPB 3I3TB 3QCAA 5KHOA 2NPTA 2IY0B 1Y8RC 3LDZE 2FAZA 2L3ZA 2NBVB 2C7NB 1HJPA 3DBRI 3ECIA 5LLIA 1WGDA 1P3QQ 2OO9A 2DENB 4F1IA 1UH6A 1V5TA 2KHWB 3PRPB 4PS8A 4G0NB 3H6NA 1OGWA 2BKRB 2NPTB 3DBSA 1IM2A 2YVCA 3GLFE 2KTRB 1G3IA 1RLFA 3H7PB 4GU2A 3QWZB 2MWSB 3FE3A 2EKEC 4GMVA 5DPWA 3WAMA 4NNJB 5C23A 1IFYA 4CYEA 4ZDVA 3DVNU 1WXSA 1TBEA 2M17A 3JSVB 2GBNA 3AU4A 1GO5A 3JW0X 4NQKE 3WAOA 4HPMB 4GDKB 3RD2A 2ZEQA 4DHJD 3T8MA 4AOFA 4FA6A 5D94A 1HT1E 1WGNA 2LVOC 2PEAA 1IP9A 3P2BA 2MR9A 1G4AE 2AL6A 4DWFA 2KDBA 2KQ7A 4ZRIA 2DAFA 2KTFA 3DVGY 2HWJA 1V92A 3ML8A 1PQSA 3ZTCA 4HVBA 1YD8U 4NY0A 4DBGA 3QAQA 2BWEA 1OQYA 4W9CA 2JY5A 4UN2B 2O6VD 2FIFA 3DBHI 3ZNID 3GLIE 2KX0A 5LXHA 1WH3A 2C60A 2WX0A 4LDTB 1G6JA 1YQBA 4F8CB 2D3GA 3Q3JA 1AIPC 3NZSA 5KHQA 2CS4A 4EKUA 3UIOB 3K9OA 2WX1A 4DHZB 4GGQA 2IO0B 3RZFA 3GLHE 2KJ6A 3S2AA 2MGWA 2JZ1A 2ZNVB 3KYDD 2VRRB 3A9KA 2JZ3B 2O2VB 3HM6X 4AJWA 5E6NA 5IAAC 3LCUA 1Y8GA 1HQYE 1WGYA 2ZCBA 3PLUA 4TUUA 3CSFA 1YX6B 4F2LA 3HHMA 2EMSA 1WGLA 4BOZB 1C1YB 1C3TA 1OTRA 3B0AA 5JHBA 4TQ0A 2ZTDA 1H4RA 1WX9A 2C5LC 4BVUC 1WYWB 4IWOA 1WY8A 2QSFX 2KHHA 4FHKA 2KMCA 2DYOA 2MBEA 3RYTA 2DZKA 4ZYNA 3V61A 4PS3A 3DBLI 2MBOA 2FIDA 2FCNA 3NZUA 1KLVA 3U7DA 2C9WB 1VEKA 2KXJA 3ENEA 4HJKA 4W9HA 3QX1A 2G45B 3APDA 4DXAB 4A3PA 4N9F4 4MM3A 3EECA 4FJVB 3VFKA 4MGYE 2I1JA 3H4JA 1WXVA 3OJ4B 3FRHA 1UELA 2BF8B 2C7HA 4IM3A 1V49A 1PGYA 2KC1A 2Z0DB 2KNBA 4DK5A 3M3JA 3PT2B 4K7SA 3SHQA 4IW0A 4G3OA 1ZKHA 2MBHA 1FXTB 3V60A 4ANWA 1L2NA 2JT4B 1WI0A 3W1YA 4KZ0A 1OEYJ 4E71A 1L7YA 2DYBA 2MCNB 4HPLB 4BBNF 2CHZA 1OTRB 3WA0A 2BKFA 1UBQA 2KFKA 2N9PC 3A33B 3N32A 3TCAA 2JRHA 1WIVA 1V5OA 2K8CA 5D6JB 2R2OA 4BKSA 5JH5C 2FUHB 2N7DA 2MSED 3OJ3A 4BBNC 2O25A 3DOWA 2REXA 3LJ3A 1I35A 2DAGA 1WGGA 5EDSA 1WR1B 3F92A 2GBMA 1GNUA 3VTVA 2PPHA 2OOAA 4XC2A 4MSMB 2JVCA 1SIFA 3QJZA 2JPHA 4BOSC 1WJNA 1Z2MA 2G4SA 2KTRA 2WDTB 3H7PA 5TR5A 1UBIA 1V80A 4KIKB 1WXMA 2D10A 1VCBA 2L0TA 4MJSB 2JY6B 1ZMWA 4MDKE 3U30A 1TTEA 3RULA 2FCQA 1R4NI 3L08A 3H1UA 1MG8A 1TZ1A 2V1YA 4KZCA 2DAIA 1WGRA 4IM2A 4LJPB 4X57B 5C1ZA 1LFDA 3A4SC 3JVZX 5D7GA 1E90A 2LVQD 4JL9A 5AZHA 3SDLC 4HEOA 2KWVB 4M8MA 4MELA 3UF8A 2OJRA 3R7QA 3ZLZA 2W9NA 1WIAA 3AULA 2K6DB 3EFUA 4WJQA 1RFAA 3ZVVA 1NDDA 2EKFA 1VG5A 1S3SG 1ZMUA 1WGHA 2R0IA 2DZIA 2LVOA 4I6LB 2JY7A 2KFKB 2L0FA 2F4MB 2YLMA 3PGEA 4NJ7A 1GJZA 2K39A 5JZEB 3MMPA 4HLEA 1KOTA 3R3MA 1WJUA 3WIMA 1F4IA 3WANA 2KDFB 2D07B 3IFWB 2KWUB 4EOYA 1EUVB 4EEWA 4IUMB 2J0JA 1NBFC 4WP2A 2AWTA 4WWOA 4FJZA 3ZNGC 2CU1A 2JZZA 2KNZA 1OKSA 2MROB 2OOBB 3QC8B 1SE9A 1YX5B 3N30A 4ANXA 1V81A 3ZIMA 2QSHX 1X3ZB 1RRBA 1ZW7A 3VAWA 2V3SA 2O2VA 4ZRJA 1ZMVA 4KVGB 2DAJA 5CX3A 2KZRA 5IA7A 4WAAA 3B89A 1MN3A 1CMXB 4IM0A 4KSLC 2QHOB 2ASQA 3VTUA 1A5RA 2LGDA 1IPGA 1NV9A 4I6PA 2LWPA 4WQOB 2LRUA 4EZLA 3NOBA 4TKNA 2GBRA 5DPTA 3QA8A 4ANVA 2L8JA 2D2QA 1I42A 3PV1A 2L4EA 3APCA 5CHVC 2DNAA 4I6NB 2DZMA 2LASA 2PE9A 1XD3B 4B6WA 3Q3FA 1M94A 3PSEB 2GMIC 4DHZE 2LGYA 3L16A 3PHWB 1R4GA 3ZNZB 2EKKA 2JUJA 1NV8A 2BWES 1YIWA 2A5UA 4PS7A 3L13A 2MW5A 3VH4B 1VD2A 3ZDTA 3C0RB 2HE7A 4IC7B 3SD5A 2MRPA 4K81A 2KDEB 3KVFB 1GG3A 1SGHA 3NY5A 1XXHE 4DHJB 2DI0A 3SU8X 2ZZPB 3A4RA 5DCNA 3UGBB 2KOXA 3IHPC 4HK2A 4EZKA 1V6EA 1P98A 2AEHA 4II3B 2G3QB 1WXAA 2KK8A 4OVUA 4YIRX 1KM7A 1VDLA 4A3OA 3O65B 4B9KA 2N1VA 2AYOB 2ZVNA 2ZTCA 2GOWA 3A1QA 1WFYA 2O6VB 2WWZA 2IO2B 4ASWC 4E3CA 4G11A 1WR1A 4KSKC 2N4FA 4GIVA 3DVGX 1T0YA 3APFA 3DQVA 3L0WB 1JRUA 1Q0WB 2MJ5B 2MA9B 2NS5A 3PHXB 3QQ8B 4W9LA 4AUQC 4F7ZA 2NBWB 5J2RA 4KIKA 2J7QB 4BFRA 2RRUA 2GBKA 2IBIB 1IYFA 1UZXB 4MJSA 1WX8A 2JY6A 4P7IA 3TL5A 2K8HA 1HE8A 3EHVA 3WALA 1WX7A 2DKLA 3VHTC 3B1LX 3ZTDA 1H8CA 5AEKB 2JY8A 2CP8A 2LD9A 1WM2A 1CUKA 2BWFA 2Z59B 4GDLA 4AP4C 2CWBA 2JUOA 2XK5B 4JIOU 4Q7JA 1GC6A 2DZJA 3GOEA 3VUYA 4FHJA 2FCMA 3R7RA 2K1FA 3UQBA 3U8ZA 3L17A 5CHFA 2LVPA 3A9JB 3IECA 4WJNA 3BINA 3ZW3A 2L7RA 2LXAA 3A1QB 3H7SA 2NBUA 2XBBC 2L2DA 1V2YA 2NR2A 4K7UA 4M8NA 1C7YA 1F9JA 1Z5SB 2N9EB 2ZJDA 4G3XB 3MHSD 2KO3A 4MGKE 2OOBA 2D11A 3VQIA 2KKCA 1TP4A 1X3WB 2LBCA 2CHWA 3VH3B 4NQLB 3ZKJC 1R4MI 1PVEA 1UGMA 2LVQA 4M0WB 1VEGA 4XZ4A 1XT9B 4K1RB 2JP7A 1WR6E 2LXCA 2KFJA 4GOCA 1GUAB 3VDZA 3V62A 2KMAA 1E8WA 3PVLA 4IWQA 3DCGA 3H9DA 2K6QA 2QHOA 4FN2A 2BYFA 4BKSD 3IVFA 1T6OA 2MBBB 4URKA 2KD0A 2R2QA 2IZVB 2JNHA 3PRZA 4JQWC 1U4AA 4JLCA 4TV3A 4FULA 4HXDA 1WZ3A 1WJ7A 4WWPA 1E8ZA 2LVAA 4HCNB 3ZDMC 2AL3A 3PLVA 3DDCB 4KV2A 3ONSA 5CTRC 1IXSA 1Q02A 1WF9A 2HJ8A 2J0MA 2JF5A 3R66C 5FR6A 4EUTA 5L95C 1E8YA 3ZRFA 4NPNA 2FCSA 2Y5BB 4W9JA 3LCVB 3ZNHB 2V4LA 4ICVA 3RT3B 3FRIA 1TR8A 2ZVOA 1J19A 4B95A 4EFOA 5J18A 3AXCA 4MGIE 4FLHA 4WJOA 3DVNV 2DYMA 4AJYB 3GZNI 4LCDE 3HIZA 2UYZB 1AARA 4R71A 2I1KA 3K9PB 5DFLA 2LTUA 4HDOA 2PE6B 2K9DA 4CO7A 3JYUA 4FADA 1XB2B 1T43A 5GMVA 3MJWA 3OLMD 4A20A 2BYVE 1WM3A 2G3QA 3ZO5B 2ZCCA 2KX3A 1KJTA 3HK0A 2RGFA 3IHPA 5HKHA 1BT0A 2N1WA 4FJYA 3QARA 1P0RA 2UWQA 4GN1A 2KLCA 2KVRA 1BVSA 2L76A 3VUWA 1TGZB 4RMAA 1WMHB 3E21A 4PYUA 1ISNA 4MGZE 3W1SC 2HD5B 2MP2A 4LDTD 2O6VA 3VXWA 5J17A 1J0GA 4KDIC 5E6PA 2MQJA 2FNJB 4WJPA 4AWJA 1GC7A 3ML9A 3PTFC 2GBJA 1Q5WB 1WJ6A 1E7VA 3KUDB 5LXIB 3L54A 2KJRA 2LI5A 3L10B 5AZGA 2QSGX 3CSTA 1WRDB 1EF1A 4HCPB 1Q1OA 3D32A 3RUIB 4J6IA 2PJHA 4PYZA 4TQ1A 2JXXA 1WZ0A 4BKGA 1VEJA 2JWZA 3VTWA 2XEWA 4ZRKA 3WAPA 4GEWA 2L00B 1V9JA 2BYEA 2KDIA 2XK5A 4RM9A 3T6PA 4GSWA 4WWNA 3KUCB 2EMTA 4CHKA 3NS8A 2WYQA 4MSQB 3A9JA 1E94E 3ZUNA 2RR9A 5AZFA 2KNAA 1ZGUB 3PS6A 4XX5A 3ZRCA 3RCZA 3NHEB 4K7WA 2CKHB 4HWIB 2ZPNA 1NI2A 3AU5A 2MP2B 4ICUA 1JR3E 2ZNVC 1UFZA 3DPDA 3N3KB 1SG9A 2JRIB 3B08A 2IO1B 1A5TA 2KWCA 4LJOB 5G55A 2H5XA 4JGHB 2A4ZA 5L83A 5CHWA 1EF5A 2DX5B 3AI5A 1G41A 2DAMA 1ZV1A 4ANUA 1KYIA 4F1SA 3CF6E 2DHZA 3ALBA 3IG3A 1UD7A 4KDLB 1WE7A 4W9IA 2B3AA 2BPSA 2DAEA 3V6CB 2KANA 3KYCD 2KC2A 4GB9A 2RPQA 4W9DA 2KN5A 1OAIA 4BKTA 5G2NA 3QIJA 1WJ4A 2MBQA 1QZEA 3M63B 1V86A 1K8RB 1DO2A 2J0KA 4W9EA 1DO0A 4FBJB 3KH0A 4DBGB 3OAWA 2WZJA 1TTNA 3PZDA 3QK0A 3PREA 1D3ZA 4EZJA 2M1MA 3ESWB 2NCNA 1P9DU 3KUZA 2EJSA 5D2MB 2LVNC 3PPAA 2G4DB 4RM8A 2NVUI 2RSUA 1EFUB 2BGFA 1S1QB 2JZ0A 2CHXA 5BO4B 4GDLB 2DHYA 3EC8A 3K9OB 2M8SA 4IG7B 4NAWA 3TJPA 4W9GA 1VQ1A 1P3QU 4MH0E 2IO3B 2KLGA 4MEMA 4W9FA 2QNJA 3A9KB 2LRWA 2IYDB 3HM3A 2MLBA 3E46A 5JHAA 2KQSA 1LXDA 3X0WA 2KJHB 1EO6A 1WHCA 3RZWC 3K9PA 3IBEA 3M95A 3PRMB 2HAKA 4E74A 4NJ6A 1LQBA 1J8CA 4GXBA 4OVVA 4DDID 2B3TA 2DENA 2RD0A 3CMMB 3VUXA 1YLAA 2F4OB 3UQAA 1X1MA 2C7MB 1RAXA 1WMHA 1E7UA
chains in the Genus database with same CATH superfamily
4A2UA 3VRBB 2ZPYA 1DDNA 4NDLA 5J4YA 1E5WA 4W9KA 4GDKA 2BVCA 2UV1A 2DAKA 3DBRB 3GLGE 3WGHA 2JPCA 2NVTJ 4OU0A 1DGHA 3PNVA 3LSGA 3AG2H 2DYSH 2O8XA 3ZMZA 3FZVA 2ME6A 1XC8A 2BKRB 3VK7A 1YJJA 1VDVA 5C23A 1ZTRA 1WH5A 2CFXA 1I3QJ 2QWWA 3AE9B 4CJ6A 2VONA 1K4SA 3PO3J 3DBHB 3CC7I 1FP1D 1KF6B 1MBEA 2JY5A 2FIFA 5EP2A 3ZQ7A 4ZJZA 1FYLA 1SVOA 4DHZB 5IN7A 2FRHA 3JRGA 4Z6YA 2J7NA 1XXHB 1XF5L 2AQFA 4BS9A 2K85A 1DGGA 1WY8A 1XPXA 1WZ2A 1U8RA 3BOSA 2MBOA 3HY5A 1E9SA 3D5LA 5LHGA 4YTMB 2CRGA 3DEUA 3S16J 4CZCA 1N78A 1VTNC 4ETSA 4CXFA 2M4KA 1HCRA 1QPMA 2Z3YA 1LKXA 3FUWA 2X9DA 1U5TB 2KTRA 4AC0A 3GE8C 1W0TA 1FP2A 4KT5C 3SDBA 1XB4A 4YTPB 4GLSC 1TZ1A 2HQAA 2DAIA 3G71I 3A4SC 3UF8A 4CIZA 1TDZA 2V4JC 4G4NA 3ZLZA 4TMAB 1JALA 4PGGA 5HLTA 1TS5A 4MGRA 3KP1E 1FNVA 4HRIA 2I2YA 4HLQA 3N30A 2OD5A 3BZ6A 3ZQIA 5IA7A 3B89A 2WY8Q 4H4KC 2LRUA 1JTYA 3NOBA 4U0YA 3HOUJ 4ANVA 3H0GJ 1I42A 2JT1A 3LSPA 1M4VA 3L26A 1JB0F 5H6RA 3LAPA 2BB6A 3P63A 2VOOA 1I4XA 3BCAA 4JI3M 1V6EA 2VJJA 5F0HA 4RGMA 2B63J 1BIBA 2E7XA 3OOPA 5IOYA 2M0CA 2XKOA 2CSOA 2JA7J 1WI3A 2XFTA 3FF5A 1Z67A 1F43A 4KIKA 2HKOA 2RRUA 1Q3CA 2J5PA 2K8HA 2STTA 3MWMA 1H8CA 3KW6A 2RPVA 2BWFA 1E32A 1TWGJ 4IJFA 3OOUA 3BINA 5ICGA 3P42A 3AEGB 2R46A 1TC3C 3T3OA 2L2OA 3SYTA 4LB5A 4B7HA 2CHVA 3ERED 2VQHA 4PUSA 2Y30A 3H9DA 2K6QA 2R3SA 4FCYA 3GVAA 2QF7A 1WQ2A 3FK6A 1RNLA 2V6EA 1UHMA 5HS7A 2EA4A 3HRTA 3SHGB 1WF9A 4DXFA 4LFAM 1R23A 3ZH9B 3WHBA 3FUTA 2L9VA 2Y48A 1TR8A 3CCLI 1GAQB 3AXCA 1OR7C 4BBAA 4S0RA 2PE6B 1ON1A 2KRCA 3A0BC 3ZO5B 2LBFB 1H0MA 3AG4H 2YQZA 2J53A 3IH3A 4RMAA 4KGTA 2DDAA 1J0GA 2QKLB 5IT9Z 3BTIA 1S6LA 3GLFB 1IUYA 3MCZA 2DTZA 1PDXA 1Q1OA 4G94A 5ICEA 5EG0A 1ESFA 1WJ5A 1R1VA 2C98A 1TDHA 1FFVA 2V1DA 4UNOA 5EP1A 2RR9A 1J59A 3MJ5A 2WB1N 3N3KB 2FQ4A 3OSGA 4EQQA 1IG7A 1L5PA 2G7UA 3S1RJ 3W2AA 4F1SA 2DHZA 1JKRC 2ZCWA 4BKTA 1V86A 2VF8A 1K8RB 3KEOA 2BVLA 5K5QA 3RFWA 5L3DA 2EV5A 1VLBA 4ZDOA 3AECB 4YY3M 2M8GX 4DV7M 2IO3B 2VASA 4OWRB 3E46A 2KJHB 2LMCA 1K83J 2OU2A 2LGIA 2R7ZJ 3NVVA 5BQTA 2PKOA 2DFFA 3UQAA 3TIXA 1QUTA 2BGCA 1FEHA 4II2B 3CDLA 1PUTA 3OYHA 1Z9CA 2K0BX 3JSVA 1PUEE 4YIIA 3V6EB 4M02A 4BKXA 3UINB 4JOMA 4BB9A 4P5OA 3LOCA 2L7IA 4BAXA 1IN4A 5CYVA 1HJPA 1S7OA 1LQ1A 1AWCA 1OGWA 5FKMA 2YVCA 3KSXA 3H7PB 2MWSB 1RRJA 4NUBA 3DVNU 5IT9S 3ZXVA 4NAMA 3GFLA 3AE8B 3LB8C 3G1MA 3DVGY 1YFHA 2JVGA 3QAQA 3CF5F 3SQNA 2LY2A 2IS1A 1IC8A 1V5FA 3FUXA 5F04A 3B7ZA 4XMYA 3EA6A 2DK5A 2VRRB 3NVZA 5H8YE 2PVGC 4TUUA 4YSXB 3OL4A 4CA0A 1R7SA 2HVQA 3LA7A 4IWOA 1ZG3A 3Q8EA 1MMNA 5C2TB 3ZMUA 3NRVA 4BNCA 2G45B 1GL7A 2IA0A 2VKHA 3BT9A 5KAIC 3HJSA 2NMQA 4XGIA 4EJOA 1MNMC 4AKGA 2HVSA 1WKMA 3WA0A 2CU3A 4L0YB 4QIWN 4A0ZA 1I35A 2QC8A 4X65M 4IHSA 3KPHA 2OOAA 4G7OF 2WDTB 5C44J 3JRHA 1HXDA 2FSWA 4K3CA 1SF0A 3H1UA 3K1JA 3DXJF 2QQBA 4IDIA 2UXBM 4BQOA 2DJNA 3D5SC 1IZ1A 2ZFWA 2XAQA 2K39A 4HLEA 3L28A 3WIMA 1I3AA 2VOPA 3MMYB 2UUZA 2KQ4X 3I54A 4NBQA 1YUBA 5CLSA 2JSPA 3SZGA 2IT0A 2QSHX 4KMFA 3TMOA 4L9VA 1ZMVA 2DAJA 1ROEA 4WQOB 1W36D 2MC4A 1K78A 1VQPI 1C4AA 2DZMA 1IUEA 4A3MJ 3E56A 2LGYA 3PHWB 2OZUA 4Y7NJ 4XE0A 2STWA 4HW0A 4I6ZA 4LLLA 1WJFA 3Q9VA 4L2YA 2DOEA 1QOBA 4IJAA 1U9OA 2RDGA 4KNYA 1H6UA 1UCRA 5LEKA 2AYOB 1F2RC 1IBKM 4PFPA 4G11A 4BUPA 2WXFA 1ZAOA 3ZRGA 2VBXA 2KWDA 5J6XA 3CCQI 5JI3E 2JA5J 2V26A 1HF0A 2ZXWH 2LD9A 3JREA 3MEXA 2DZJA 4NXMM 3U8ZA 3A9JB 2B0LA 1UWXA 4J3OD 3H7SA 3R0AA 5B3SH 1YS7A 3BPXA 2QCOA 1MJDA 1ETWA 4PGHA 5JR3A 3OYGA 2D11A 1TT5B 2QKMB 5GAGJ 4KYWA 4KA4A 3VH3B 2MJEA 1IN7A 4PT5A 1YTYA 4JQFA 5F0CA 2FUG1 4LJ9A 3DCGA 3OL3A 4AYBA 2GLSA 5LHIA 2PX9A 3RI7C 3JR9A 4YTNB 4XDCA 3EUB2 4WIPA 2AL3A 3J9CA 2XGDA 3PFYA 1Y0UA 2J0MA 1YW8A 3P4PB 5D3DA 4IHVA 4LCDE 4DBQA 4NJCA 4KDPA 1I4HA 2HTJA 3QP5A 3MVPA 3CDIA 1R49A 4JX5A 2DN0A 4PYUA 4CCKA 2FNJB 3JCUC 4G4RA 2K40A 3IRRA 2F2EA 3EPZA 1Q5WB 5GPCA 3AEFB 5ITRA 3V3XA 5AZGA 3TOAA 3DWGC 3UJNA 1BI2A 3FTEA 3WAPA 2F5FA 2XK5A 3GFJA 5JLWA 4M9SA 4JI4M 1DQUA 4ENMA 2WYQA 2K9XA 3K92A 2R7TA 5AZFA 3ZUNA 1GXQA 3D8LA 3GZ5A 3KVWA 3CLQA 4U87A 4ANJA 3T38A 5FKAC 2MGQA 2W24A 2H5XA 3ZQQA 1A5JA 5C1BA 3ABUA 2E7WA 2A07F 3OG5A 4ZZLA 3F3XA 2J0KA 2OAZA 2Z1DA 1V1PB 3KH0A 4G4QA 4A3GJ 1BI3A 1T33A 3BPVA 4BEHA 1D3ZA 2FF4A 3DKYA 2NCNA 2XEPA 5FD5A 2DWQA 2J5YA 5HNHA 2V1XA 2JZ0A 4KT0F 2C5RA 3ETRA 2RDBC 4L23A 2XF6A 2QNJA 1BC7C 4DR3M 1FIQA 4UUVA 3MQ0A 1QA6A 3IBEA 4I4LA 5KO3A 3FILA 1ZPSA 1NYQA 4HYEA 1MFWA 2MC3A 4EMSA 1U5TC 1S3JA 2F4OB 2WSFF 1ZXHA 2DMQA 2NPTA 2M45A 4JX4A 4D82A 3P4SB 1VQOI 4BY1J 2L05A 2BWBA 2ZNZA 2HTHA 3R0JA 3TMPB 1JQJC 1FRDA 4HF2A 1U3EM 3VYUB 2N7EA 5AUIA 1E9RA 4FX4A 1SE2A 4JWUC 1FOKA 2KDOA 5DNYA 4G0NB 4RGXA 2RKHA 1XSDA 3HXLA 1WHUA 3RJPA 2LLKA 4PJNA 4GITA 4GDKB 2IPQX 1O7FA 2DFHA 2PMHA 2NTTA 2WV1A 4X6AJ 3GPYA 2CJOA 1DGHB 1GT0C 1YD8U 2QA4I 1ZKGA 2NOJB 3H3VK 2DFIA 4ZH4F 2JA8J 1NH3A 2KT7A 3KQ4A 3FMSA 3PNTA 3RKXA 2O2VB 4AJWA 2QYOA 2UUBM 5M5XJ 5JHBA 1WX9A 2ZNYA 4W5WA 2QSFX 2HDCA 5EE3A 3QX1A 3APDA 2XV4S 2VE8A 3VFKA 2I1JA 3U6CA 4IM3A 3F8MA 3V60A 3DKWA 5GAEJ 2KFKA 2N7DA 3OJ3A 1TT0A 4EEFG 4LF5M 4NRWA 3VTVA 3L2QA 1QYRA 1QKZA 5FLXS 5TR5A 4WXDA 2D10A 1T0RC 1WGRA 2INDC 3T8TA 3OIQA 1ZP0B 5AZHA 2KWVB 1JKQC 1IBXA 2J42A 2HYFA 1K82A 4EZJA 2R0IA 4AIHA 2L0FA 1D0YA 1GJZA 3L4PA 2QCUA 2JZPA 3FMRA 2K27A 4RCOA 3AE1B 3WANA 2NQ8C 5EXPA 3UGJA 2QPAA 1IN5A 1FX7A 1E0EA 1BOAA 1CMXB 3FKJA 2WXNA 1TH4A 2DZOB 1NV9A 2LWPA 1B1BA 2WAQA 2KDLA 2R7XA 2JUJA 4QHTA 1TWHJ 3HG9A 4YRVA 3BTCA 2V4IB 4EZKA 2X6XA 3WHCA 1XNRM 1NHWC 1I1GA 3SEZA 1I94M 4BH9A 2D7HA 2WWZA 3DLLF 4XBOA 4RF1A 1OLTA 2MJ5B 4JYKA 2ACJA 4QPQA 1YRNB 1ZYRF 2DOAA 4IJEA 1CUKA 3W67A 3H9JA 2M19A 3G73A 5CHFA 1D4BA 4ASNA 1U6GA 3S1QJ 5D5VB 2K86A 2NBUA 3GE3C 4G3XB 2KO3A 2OOBA 2KKCA 4EIWA 2M34A 1TP4A 1YJ9I 2BXZA 1PVEA 1NSFA 2KIMA 3OMYA 5EQTA 1LEBA 2JP7A 1E0ZA 3OYBA 2DT7B 1H89C 4ITVA 4JQWC 3FXOA 2J52A 1WZ3A 3HRDD 2LVAA 3ONQA 5L95C 2QUFA 4FISA 2FBWB 1BMLC 4EFOA 5IZ7D 2I1KA 3CIRB 2LTUA 1Y39A 2RGFA 2N1WA 2VQFM 3HKZA 2GWRA 3HIFA 3VODA 5D3IB 5H92C 3H5RA 4I01A 1SFEA 2K9SA 1S72I 1WJ6A 3SDGA 2BOLA 3VYSB 4AWXB 2LVSA 1V8CA 4G6ZA 2A6EF 4JX6A 4ZRKA 5M5YJ 4WWCA 4ZHOA 4F92B 2L7KA 2EMTA 5EZGA 1K6YA 2WDVB 1DP3A 3G1OA 3DFGA 4MFEA 4A8XC 3FBNB 1MBHA 5G55A 2KWCA 5T8IA 3BQYA 1PJRA 2DX5B 1D0MA 1G41A 4LK0F 1WE7A 3KYCD 4N4NB 3I5UA 1OAIA 5EG0B 1ON2A 1WJ4A 5K7FA 1QZEA 1MHXA 3BCBA 3OAWA 1K4TA 2ZC2A 2G4DB 2ZM6M 1D0XA 2A6TA 1QDTA 1IY0A 2UZKA 2M7BA 2CH0A 1FCLA 4S0HB 2XHKA 2UXCM 3FUUA 4DV6M 3ILKA 3QAHA 4E74A 2H8RA 4GXBA 3GQ4A 4C4VB 4XBFA 1Z0XA 3P4QB 3UKGA 5F08A 4V19K 1ETQA 2C6YA 4G50A 4KIGA 1OEYA 3GQ3A 1UELB 2CW8A 3W2VA 2FH0A 3U2SC 2VODA 4N0BA 3I9V1 5DPRA 1P6RA 4HDQA 2F5NA 2V6CA 2EBIA 4D81A 2WAEA 3HZJA 5GADJ 1IQPA 1O3SA 3HL2A 3TP0A 1H8AC 2IVMA 4ZDVA 3JSVB 3OIOA 2QENA 1Z1DA 3GRUA 3KWLA 1P7IA 4L78A 4N59A 3ML8A 1JE8A 4DBGA 5F3WA 2X6OA 2R92J 3J7BA 3ZNID 1XCBA 3HHGA 2WDQB 1V54H 2X6WA 2D3GA 5EE9A 3CGWA 3HTUA 2CS4A 4LF4M 3K9OA 2WX1A 3O13A 2KJ6A 2K4JA 3CP2A 3A9KA 2WXQA 3HM6X 5LD2C 4R8HA 1K50A 1OTRA 1F1HA 3A01A 1H4RA 2CQQA 2KHHA 3GWZA 3Q0WA 3VSKA 3DBLI 3PXGA 1XNQM 2MD5A 3JTHA 2JX5A 4MM3A 2QDFA 3HOXJ 4RH6A 4PDGA 1JWBD 5ITUA 2ZW1A 2K02A 1YW7A 3SFEB 3SHQA 3Q3OC 1OIPA 1VQ4I 2JT4B 2JUGA 3QYFA 1L7YA 4XONA 1UNSA 1QGPA 2G9WA 1UWMA 1GV5A 4JN6A 4Y28F 4L15A 2IGKA 4WF2A 1YO5C 2G4SA 4QNRA 1DGBA 3HDDA 2M1BA 4G6QA 4HKQA 3DLAA 2FOIC 3U52E 4HROA 3EFUA 1LDDA 2EKFA 1ZMUA 4DR1M 2ONQA 1ERDA 3TEXA 4IUMB 3PVSA 2JZZA 1T2KA 3FDYA 2O7OA 3VAWA 3A46A 4NC6A 2ECCA 4KVGB 1ITYA 3RQ4A 2ON8A 5TJJA 3QQAA 4IRGA 3J27B 2IPKD 4DHZE 3PO0A 1SAUA 3C2BA 1I1SA 1VQNI 3J7AS 2CQ7A 2A3SA 1WI9A 3CCRI 3M1CA 4K3BA 4MT5A 2YEPF 1SVLA 1JXSA 2BBYA 3KVFB 1SGHA 1XXHE 3QWLA 3FD9A 3HHWA 4II3B 4NSRA 3FXLA 2KK8A 2Z2SB 1VRAB 5DM6F 2RV8A 1C76A 5LGNA 1X1PA 3GP1A 2IO2B 4AG5A 2E5ZA 1PP8F 4C30A 3REOA 2VJ4A 2DBBA 4W9LA 5J2RA 2J7QB 1D3YA 3KYDB 3H1CA 4M0WA 2XC7A 5AEKB 3LW5F 4KIBA 2ZFUA 2M3AA 3A0HC 4CDGA 4REZA 2K3FA 2Q5WD 4LLNA 3CDHA 1Y8QB 3FXMA 4RM3A 1N33M 2EB7A 2P81A 3V8JA 1BJAA 2XSZA 1Z05A 1NYRA 4PK4A 2LVQA 3TWKA 2MBFA 1I39A 3E9SA 3HHZA 3V62A 2KMAA 2HNHA 2O3FA 1R58A 4RAGA 5F0FA 4FULA 4P17A 4YIFA 5FD6A 3CTWB 1OKRA 1GXPA 3ZNHB 3RT3B 2HZDA 3GX4X 3KXEC 3JRIA 3HIZA 3SXYA 5DFLA 3JYUA 4M6XA 4A20A 2BYVE 5K7HA 3QARA 3GTPJ 2KLCA 1BVSA 2L76A 5DM7F 1ISNA 1HR0M 1ETYA 4TSSA 1I4GA 3ZMVA 4RGSA 3HJEA 1YITI 4AUXA 1F36A 1E7VA 2HKJA 4IEJA 1HZ5A 3RUIB 4J6IA 1SJHD 3QU3A 2XSJC 5HG2A 3GZ6A 1OCTC 1ZARA 1FZPB 4WH4A 4ICUA 4XRSA 1UFZA 4LJOB 1YN4A 2BNKA 1EF5A 4ANUA 4L5JA 4US9A 5ITQA 4AYBN 3GFMA 1FYKA 2R4GA 1DO2A 4PDIA 2RDPA 1ZR4A 1L3LA 4A5MA 2QEXI 2EJSA 3KUZA 2PMUA 3PPAA 3KFUG 1EFUB 3CQZJ 5HLGA 1S1QB 5E18F 2M8SA 2GA1A 1MNDA 3I71A 2R5ZA 2PIAA 2LKXA 2XNAC 5BMGA 5M3MJ 1BBYA 1J8CA 2BJVA 4FVMA 3E6CC 1F9NA 2RD0A 1ZQ9A 4U88A 1MW7A 2SEBD 4LZJA 3DU5A 3E5XA 2AQ3B 2LUMA 1E10A 5DDGA 2WA0A 5E8IA 2XSZD 3T9LA 1YJ1A 2Q8KA 1YN3A 3I58A 1YJWI 3KLSX 3FILB 4F91B 2NBVB 2F5QA 3DTKA 4H0EA 1P4WA 2NPTB 3GLFE 5FJ8J 1HDDC 3DTEA 3FE3A 2EKEC 1SFKA 1I5ZA 4I02A 2XGXA 3HX3A 1L0VB 3J81Z 5E3OA 4AQ7A 5BYRA 1WGNA 1PJSA 3BR6A 4PCZA 4ZYEA 2HHHM 1V92A 5JXVA 2KDZA 4UN2B 2P5VA 2KX0A 4LDTB 2Y31A 1XLOA 1ACCA 1TWAJ 2KRFA 1OFHA 1HNWM 2IO0B 4LG0A 2JZ3B 4JI6M 1HQYE 2YR2A 1YX6B 3HU2A 1C1YB 3B0AA 5DCMB 4FASD 2VIIA 1WYWB 2KMCA 3LSKA 3GTJJ 4QAYA 3U7DA 2C9WB 4W9HA 4AD9A 1ZRFA 4N9F4 2O9LA 3SEQA 3G1LA 3AOGA 3GO8A 1YS6A 1TKYA 2ICWG 2KNBA 4DK5A 1OCRH 3HBLA 1DGRM 5DEQA 3Q8GA 5FSWA 3HC7A 2FUHB 3ZXSA 2REXA 3SARA 5EDSA 1WR1B 5FKKA 4BOSC 1UBIA 4IHYA 4OU7A 2EA2A 3IKTA 1ZMWA 3K2LA 3Q3NC 2V1YA 4DBRA 3AEAB 4LJPB 3H3ZA 4MQ9F 1FTZA 1N62A 3R7QA 4L8RC 2K6DB 2FNPA 1VG5A 4KT6A 2KFKB 3PGEA 3C9PA 4YHHM 1ORYB 3IFWB 1EUVB 1KFYB 1T6BX 1OYYA 2CG4A 2V6ZM 6PAXA 3VKHA 2TCTA 2A6HF 2VPLA 1IGCA 2KPMA 2R7FA 2VKVA 4DYQA 1JGGA 4XYCA 3AOEA 1IBXB 2DU9A 3PV1A 1MSEC 2FOKA 2NOGA 2OA4A 1VF9A 1QQIA 4ZOHC 4QLCU 4AU7A 1U78A 1JKPC 4B1RA 2KYWA 3SD5A 3TE6A 2XPUA 3VYTB 5BYQA 3HGIA 4HK2A 2W3SA 5BPIA 1WXAA 4A3OA 4B9KA 4ZYGA 4FT8A 3HPGA 2HGCA 4JK1X 2WP9B 4E3CA 2BY1A 1DGWY 2ZMEA 1T08B 2WC2A 3PHXB 2BS4B 2FBIA 2LHDA 2IBIB 4MJSA 3AAFA 1HE8A 4RB2C 2R61A 1EF4A 1WM2A 2K9MA 4MLOA 5A2QK 1FOXA 2FCMA 2MLGA 1AW7A 3R7RA 4MHGA 4BU2A 4AKHA 2KEBA 2UUCM 1HKTA 2BW3A 1FXIA 2N9EB 1UGJA 2IGDA 1RR8C 3K2AA 4OAYA 2W84A 4UB8C 3HOSA 1CGPA 1NY6A 3NS1A 3PVLA 1W1WE 3V42A 1V97A 2D7EA 2L7MP 5HFYA 5IOZA 4BGDA 1W0UA 3LQRA 1BOBA 1E3PA 1R2ZA 3M8EA 1IXSA 2HJ8A 2HDDA 2ZVOA 4DV5M 1P7EA 2KHMA 4FLHA 1Z7LA 4I81A 5KAFC 4HDOA 4ZC3A 4BQNA 4CO7A 4XKVA 1XB2B 4B3SM 2G1EA 4DYRA 1GJSA 3ZQLA 3IHPA 3SMPA 5F64A 2KVRA 1XWIA 1WMHB 5TGTA 2O6VA 5J17A 3L2RA 5LGTA 4KHPM 2ECBA 3FHNA 2XF7A 1ZAEA 2KRKA 2LI5A 1KU3A 1JTXA 1VEJA 4LK0M 1V9JA 2KDIA 1SBBB 1ULYA 4JI7M 4HDVA 2ZJRF 1BN5A 3QPHA 3MFKA 4UVAA 4IOIE 4C2UA 2QQ8A 4RGTA 5AUKA 2IO1B 2LXEA 2LSOA 2DAMA 3GB1A 1ZK8A 5DD8A 2Q1ZB 4GB9A 4JE3B 4RS8A 5G2NA 2XKPA 3KLNA 1LVAA 1DO0A 3JR5A 4E7LA 3J80Z 2XF5A 1QF6A 3AEDB 3OYLA 2QLZA 1LGRA 1QHGA 4L6V6 4IG7B 1GB4A 3KP6A 4W9GA 1XDUA 1P3QU 2RQPA 3BZDB 4PDKA 3CESA 3K10A 5JHAA 5JVTA 4CYDA 2YX7A 4B48A 1HA8A 4M3DA 3HKZN 3CUOA 3VDUA 1O3RA 4OVZA 2CUFA 4M00A 2XZUA 3D1NI 2KZVA 1NO1A 1IN8A 4MEYF 1BR1A 1VQLI 4YFKF 3MTNB 1E8XA 3J2PB 3BBZA 3L25A 3NAUA 1MH4A 5ILUA 3TQNA 4BDYA 3PRPB 3M0EA 4B3TM 2VQGA 3IC7A 4IKGA 2BEOA 3WAMA 3BK2A 2VE9A 3CMYA 2M17A 1GO5A 2CWEA 1LE8B 3GTOJ 3VDPA 2E35A 2FE3A 2PJRB 1K53A 3NJTA 5D94A 2MR9A 2L52A 2R7QA 4NY0A 2DT5A 2DMPA 2CV0A 3FISA 2I7NA 2O6VD 4E4HA 1TF0B 4Q47A 4IBKA 4C7YA 1ZOYB 1YQAA 3GW2A 1EH8A 2QZ8A 2Z8YM 4EKUA 1QLBB 3PZ7A 2RREA 2KMUA 4LNIA 1T0QC 1FJGM 2D3AA 3TDUC 1WGYA 2A5WA 3CCEI 5KQDA 3FIWA 5J3LA 4RAZA 3KLOA 4BVUC 2DZKA 4L4UA 3V61A 2KXJA 5H20A 2SAKA 3H4JA 1WXVA 3FRHA 1KSFX 4PZJA 3TWMA 3FBIB 3J7AY 5L3CA 5AIPA 1OTRB 4LG2A 4PJMA 1K52A 1CF7B 1SE3A 4BBNC 2DLLA 4OIRF 2D5GA 4Y33A 3EFCA 4ENJA 4D5CA 4XC2A 1G8XA 1IBLM 5FKLA 3MKWB 2MYSA 2NVXJ 3U61B 4NC7A 3H36A 2OJRA 3MKLA 3ZJUA 2C9OA 1SFUA 4P16A 2ZXJA 4PFOA 1ZGWA 2BTEA 3HJQA 2VL8A 3BLYA 2VC0A 3A4CA 2HVRA 3K4CA 1TNTA 3T0YA 1RC9A 3E6BA 1ZW7A 3GS2A 3CCVI 2KZRA 4RNAA 4XOPA 5BPDA 3EUKL 4R79A 4ESJA 1R2YA 4TKNA 2IA1A 5B66C 4QNMA 4B6WA 2X48A 5CKTA 1PYWD 1B9MA 2DYRH 3N4MA 3L16A 3T5XA 2IRFG 1NK2P 1JI8A 4UY8I 1RUNA 3NY5A 1DOYA 3ZOBA 3RZDJ 5DCNA 1UHSA 2KP6A 3DTIA 4XLNF 4LRTA 1KM7A 3KWVA 2K3PA 3PM1A 1LDKB 2JK3A 2JQ7A 2AXLA 1TWFJ 3WE2A 3U60A 3B02A 1EIJA 5G5GA 3ABMH 5DCFA 4AUQC 5GPAA 1TQPA 4EM1A 2JY6A 4FE7A 1HKQA 3WALA 4IBGA 4GO1A 4LTUA 4LIUA 4A69C 1GOZA 4FHJA 3AFHA 3ABLH 1E17A 2PG4A 2L7RA 1P9QC 5HVQC 1C7YA 1F9JA 1NEKB 2JSVX 1D0KA 3M4OJ 2RGVA 4RLQA 2LBCA 5DYGA 4CO8A 3AN1A 4M0WB 1VEGA 1FMWA 4D80A 3O8HA 3ZQGA 2QHOA 2BYFA 4ANRA 4MIMA 3I53A 2KD0A 4JLCA 1Z77A 4U0WA 4HCNB 3ONSA 5FR6A 4W9JA 3J7ZI 2E71A 3DPTA 1IJWC 4DV4M 1FIAA 3U6SA 1U9NA 1T8IA 1QAMA 4FADA 3FKEA 4P1WA 3OSFA 3E6DA 2L0KA 3BQZA 2G3QA 5A2QZ 4KITB 1NNUC 3GEZA 2QP9X 3L00A 4X1EA 3FMQA 1L2DA 3L2UA 3K1MA 1F5TA 5D8KB 4C56C 5LRSA 1JUMA 1JMLA 2G8LA 3L10B 2V3NA 1WRDB 3D32A 1RKWA 2PMZN 4HX8A 4NSOB 3Q0UA 3RQIA 1EWCA 1HC8A 2O61A 3T6PA 4II7A 4XRSG 3NS8A 3PSFA 1MMGA 4XK4A 3T1YM 2NS0A 4LLGM 1HLVA 3WU0A 3NHEB 3AU5A 3GPXA 1YN5A 5FB2A 4V2FA 1PUFA 2XRNA 2IEKA 1C0WA 4A9AA 1L6VA 3I59B 4BDZA 2RPQA 4RGUA 3SYLA 3QIJA 3L09A 3ZCOA 4W9EA 1L8QA 2CRUA 1RZ4A 1MDMA 1PGAA 3KOWE 1BR2A 2LVNC 4LFBM 3AE3B 4I7HA 2GQFA 3F8CA 4ACFA 1EH6A 1O57A 4NQWA 4R1HA 1MD0A 3K9PA 3PRMB 1SE4A 2O03A 3VRAB 4DDID 5IYBJ 2VZKB 1E7UA 1YE9A 2QBYA 5ITXE 4ITQA 3P9CA 4LJ4A 2K47A 2R5ZB 4JV5M 2AHQA 2GRIA 4NZLB 3GTMJ 3L2AA 4ITKA 4LJ7A 5EF6A 5EP4A 3WU1B 3OS2A 1QVRA 2EO2A 1L1TA 2M0MA 1DGJA 5DS9A 1FFUA 1RLFA 2NNYA 2VQEM 1FNWA 4HJGE 1IFYA 3P5JA 1H9TA 2ZXIA 2P5LC 4NQKE 3U6LA 5GKNA 1TTYA 4CZZA 4A6QA 4DHJD 4AOFA 3H5AA 2KDBA 2XASA 2X4HA 1AOYA 4OOIA 1AIPC 2I5UA 3S8PA 2GXBA 1BC8C 2YNMD 2WY7Q 3U6EA 3C3DA 3Q8XA 2ZCBA 3KCCA 4MQVA 3CSFA 1KZHA 3DBLB 1C3TA 3VEPA 3DHIC 3OYIA 2ZW0A 1IRZA 4B7FA 1V1OA 4IQ4A 1PFDA 3FK7A 2DT6A 3OJ4B 3Q3SA 2P6SA 3HSRA 3H9GA 1RESA 3I56I 1UMQA 1UFMA 4IBEA 3VDXA 3E97A 1T3QA 4RLFA 3JR4A 1NG6A 3LSMA 2FS1A 1FXAA 2R2OA 2WU2B 5IT9K 2DAOA 2JVCA 2RMMA 3QJZA 1IGNA 2H09A 2N8GA 5MPOA 5GXGB 4OIQF 2KW0A 1WXMA 2JMWA 1VCBA 1BUIC 1QANA 4HNVA 3W6JB 4X0GA 1QAOA 4ZYHA 4MELA 1HNZM 3OR1C 4WURA 3SMSA 4IIWA 1XGNA 4XRFA 1ET6A 3HHHA 1IXZA 5JZEB 2J7OA 2CW0F 4LGYA 3RYPA 1STEA 2KNZA 2MROB 1D0LA 4DOZA 2ISYA 4YFNF 2A5YB 5D4RA 1XMXA 2QM3A 3PSIA 3F6VA 5BOXA 2EILH 5DPTA 4P1CC 1LJ9A 3FKIJ 2WBMA 4A3LJ 1GVNA 2DA6A 3Q6BA 2GMIC 3K1PA 4HPQA 2L1AA 3ZNZB 2EKKA 3W6KB 4PS7A 3UNGC 1ZH5A 4WAFA 4A3FJ 2MRPA 1PDNC 1JWMD 3OR2C 2K5PA 3A4RA 2WSEF 1OIZA 2AEHA 1QILA 3WE3A 1R36A 2BZTA 4OVUA 3H5NA 1VDLA 2DW4A 3O65B 2N1VA 3A1QA 4S17A 4M71A 3QOPA 1HBXG 1JRUA 1YLFA 3WHLA 2GOMA 1WX8A 3JSOA 3AMZA 2OZ6A 2CP8A 3R6SA 2CO5A 2DO7A 1FT9A 3DV8A 3D5RC 1D1AA 4FETA 5H37D 3MZHA 4LMYA 5HS9A 3HUGA 1SXJB 5CQGA 4KICA 1V2YA 2NR2A 3U6DA 5HLIA 2IS4A 1TS3A 4RMNA 1MBKA 4JBAA 5EEGA 4ARIA 1OMIA 2CHWA 3VYRB 3ZKJC 2CS3A 5LMUM 1WJDA 3HSFA 2DBYA 1TH3A 1E8WA 4IWQA 1OYIA 4OZBA 1D5YA 1EV7A 3KOYE 5B1BH 4E7IA 2BW3B 2W25A 1MKMA 2DHRA 4XWTA 2EUCA 3OYDA 2V4LA 3V8KA 2E2JJ 3GZNI 4IBFA 2FOWA 2UYZB 4QTRA 1UG0A 4JI1M 5GMVA 3OLMD 5CVVA 2H8WA 2EIKH 4P1BC 3LA3A 2P7CB 4KDIC 4XIDA 5LLQA 3ML9A 3DHGC 4IBIA 4CGYB 2C99A 4C3JJ 3PZ8A 3TGNA 2W7NA 1EA3A 4DV1M 5B1AH 2WDRB 4K0KM 4GEWA 3ZN0A 1PJQA 3RKYA 2CUJA 4GSWA 5KQ8A 3JRBA 4LG3A 4E7KA 3ZMDA 4I8OA 3TQSA 2ZPNA 1GVJA 3QAUA 2W3RA 3OIPA 2HXOA 1TQIA 2VN2A 3ZMTA 1F0ZA 1X1DA 3I57A 3CF6E 4F55A 3RD2A 3HU1A 1MBGA 2B3AA 1WCMJ 4I0BA 4C2TA 1RYJA 5D5WB 4CYCA 1QAQA 3CMMA 3QK0A 4ABZA 4B3XA 1X2MA 1MJGM 3ESWB 4RA2A 2BS2B 2PBIA 4DIQA 1K79A 3SC3A 3BR0A 2V9VA 4LF7M 3SJMA 3UI3A 2X8XX 1JRPA 3VSLA 2GXAA 1MPEA 3P7NA 3ZCBB 5M5WJ 1EO6A 1WHCA 2LHGA 1X2NA 1FMAD 1LQBA 3UK6A 3GPPA 2INCC 4A3IJ 5E20A 5EGOB 2XAJA 3Q9SA 2KRUA 2PEXA 1KU2A 3X23A 2JPBA 4GFBA 2X85A 2ZKZA 2OPFA 4M9ZA 4CUGA 5FRMA 4YL8A 1Y1WJ 1S7AA 3VVWB 2M4NA 2LZ6A 4BL0B 2LFBA 2RC4A 3I3TB 1WVRA 3LDZE 3GPUA 3S2DJ 1WGDA 3WTVC 2OV7A 3HHYA 3DKXA 3H6NA 3NVWA 2CJJA 3OY9A 1WSUA 4GMVA 3VOEA 2DMTA 1TBEA 3E1SA 1QDRA 1C78A 3I55I 4HPMB 2ZEQA 2O5RA 1R22A 3S32A 5LEJA 1QVTA 1WPKA 2AL6A 4ZRIA 2VBYA 4OMZA 3OYEA 4LY6A 4LJ5A 2EFNA 2PQ8A 3F22A 1N25A 4XRMA 2OTJI 5J1RA 5KNLA 1TKEA 2F48A 1VJKA 5E6NA 2E1CA 1W5TA 1FOYA 3AE2B 5G5HA 5E3MA 1TWCJ 3WTXC 3RYTA 4B8XA 2PI0A 4BBRJ 4LF6M 1Z3XA 3EQLF 3IUOA 4MGYE 3FXKA 1IRGA 2VJIA 3SEBA 1CQTA 2Y0SN 3L2VA 3AE7B 3T8RA 1AN8A 3C18A 1PRBA 4G3OA 4G4OA 1OEYJ 2M0AA 1J09A 5BS6A 2Z4SA 3ZC7B 1IBMM 3EDPA 1W7PA 2VH2A 2HEOA 4OIPF 1V80A 1G3YA 4O5VA 2N0SB 4ZRPA 1BM9A 1MG8A 4KZCA 2QILA 1LFDA 1NI3A 4M8MA 1T5XD 1GABA 5BMIA 3ZVVA 2RNGA 3BR2A 1S3SG 3BTJA 3VHTC 2LVOA 2YLMA 1KOTA 1HEZE 1L6UA 4UVBA 2KDFB 3BC8A 2XAUA 3VFZA 4DQ2A 1PP7U 5E6JA 2L4MA 3KP7A 3DPUA 2GOXB 4G7ZF 2E36A 4IL6C 1N6ZA 5ICCA 3KP0E 1WJAA 2M30A 2LH0A 2EV6A 4KSLC 2G0EA 2Y2ZA 2FMLA 4I6PA 1YSYA 1PJIA 2KMMA 3K69A 2IP2A 2IS6A 3QA8A 4A3JJ 2R7UA 1T3TA 3APCA 3MN2A 2PE9A 2VDBB 4NRVA 1M94A 3ECOA 1YI2I 2DWZB 1MZBA 2BWES 2CV1A 3Q8BA 1KH0A 4IC7B 3E3VA 2M87A 4K81A 2AO9A 2BXYA 2DI0A 3DOAA 1KYWA 4CCNA 2XN9C 2ZAMA 5DYIA 1BW5A 5TRDA 5FLXK 2P8TA 1SEUA 3Q8FA 2ZTCA 4DR4M 2LKSA 1YNTE 2GLOA 4IQJA 3DQVA 1Q0WB 3QQ8B 1ZQ3P 2NBWB 1H88C 4AQYM 2DKLA 1P4XA 1L2CA 3UR3C 2XH9A 4BQQA 1IXRC 2JUOA 2F5EA 2CQKA 2K1FA 1Z21A 2DFEA 1T98A 2HZTA 2JWTA 2L2DA 2HOSA 3RNAC 2H1LA 3CCJI 3HRSA 1DOIA 1XSXA 4ZTFA 2LWXA 1XT9B 4HEA1 3K70D 4A0YA 2RDHA 4IO9F 2MBBB 1W7PD 1AHDP 4HXDA 1E3OC 1E8ZA 2NVQJ 3T1HM 3DDCB 3R2TA 4FCWA 1VQ7I 4ICVA 2KACA 3FRIA 1J19A 4AJYB 1TZLA 4HRSA 4E6KG 5E8GA 2LF7A 3MHZA 4LNFA 5CVJA 2XVCA 3D0SA 3ERMA 2TRTA 5D6FA 4FWGA 3JSPA 1T38A 1D2NA 5J4VA 3KUDB 3HOVJ 3OYNA 5KPTA 2E34A 1IV6A 2PJHA 4O1NA 1WZ0A 4OX9M 3RNCC 4JI0M 3OYAA 3TO7A 3OTOM 3PQJA 1E94E 1XSVA 4HG2A 1N75A 1XXGA 1XCVA 2X6YA 5F1RA 3GLIB 3B08A 1IAWA 1V55H 4XK8F 1UJ8A 3OS0A 5L83A 1P2FA 5FFZA 3F6OA 3JTGA 4JX1C 4CISA 4WWMA 2IDYA 3A1YA 4TUWA 4C80A 2R65A 1K7AA 2W4SA 4IF4A 2MSYA 2M1MA 2JTVA 1E9MA 9ANTA 1B72A 4Z8XA 5K1YA 2H1RA 1FRRA 3J7YJ 4HZFA 4HEA2 2MLBA 1LXDA 2OJWA 2O6GE 3FM3A 3ZJVA 2LBFA 2EZKA 4ZYAA 1CK1A 1QZZA 5CVRA 1XQQA 1DV0A 1IN6A 3U21A 4KKJA 1EH7A 4ESBA 3WTWC 1IDZA 3RPUA 3BYTB 3Q8AA 3GLFA 1B59A 1Z7UA 4UDUC 4WW0A 1RI7A 2IGOA 4CCJA 5JI6A 3FM5A 3W0LB 4KX6B 1W5SA 1ZR2A 2P4WA 4FW9A 4PS8A 2VPRA 3F72A 2XAHA 1E7PB 2QBYB 3CJRB 2APLA 4YFXF 2YS9A 3D8BA 2GBNA 3WAOA 1JHHA 3ELKA 4HX4A 1ETKA 1N5XA 3BR5A 1N5WA 3EUHC 4PSWA 2ADUA 3AG1H 4HVBA 1U8BA 1NENB 2L02A 3H9QA 4USAA 2UUAM 1D5XC 2VUMJ 5KHQA 1YW9A 2VJ5A 3BVMA 4ZZDA 2EQRA 2MGWA 2ZNVB 3DWMA 3HEFA 2QVOA 1LO5D 3AOEC 3TKYA 4TQ0A 1Y6IA 1RKTA 2FBKA 2ACZB 2LDUA 2LFIA 2COBA 3EIEA 5EXXA 2L7FP 3QRFF 2H88B 2L3DA 1SXJC 1A04A 2Z5UA 4M3EA 3N32A 4XORA 3LVWA 1WGGA 2KXEA 3F92A 1R71A 2OQGA 1GNUA 2PPHA 1GB1A 1SIFA 2EFOA 3ZQFA 3H7PA 2V0GA 3BJAA 2QQAA 1YX5A 1B6AA 2VKDA 4PJJA 1MG4A 2XIGA 3WTUC 3U30A 1WJBA 1I7HA 2ESHA 2KL4A 3L2WA 4JL9A 4HEOA 5KK1A 4WJQA 3IG8A 2EIJH 3WGGA 3M6AA 4I5SA 4ZTJA 2V1NA 3K8ZA 2KA6B 2VXDA 2XFSA 1Y8RB 4E7JA 2ZJPF 4RGRA 3RPUD 3QC8B 3RKQA 2K9QA 3IAS2 3HKPA 3JAMS 2LGSA 2LJIA 3U5ZB 3FX3A 2Z3XA 3BG9A 3CO7C 4JWSC 1LFUP 3SAVA 3WG7H 2D5VA 3GQ5A 3MHVC 4GKKM 2W55A 2DDBA 2GZWA 2FD5A 5H2FC 2D2QA 2OHFA 4I6NB 3Q3FA 1N63A 4AG6A 2D45A 2QCZA 4JPSA 3GFIA 1OCZH 2TDXA 2KZSA 3JRAA 2HE7A 2HOAA 4FCVA 3IHPC 3HRMA 4DV2M 4Q5SF 1BXTA 1I4WA 1VFCA 3BVZA 5IT3A 2B76B 3MZYA 2B7EA 1WJEA 1XG1A 2CWBA 3BDDA 1GC6A 3GOEA 3W2DA 1GKIA 1RFKA 3LFKA 1Z5AA 1K51A 4HKZE 3C7JA 1XTAA 4RF0A 2ESNA 1XEEA 2LXAA 3A1QB 4IPAA 1MNEA 3DPLC 2XBBC 5JVGF 1C4CA 4K7UA 4DUYM 3C3EA 3MC9A 5EE0A 2DMUA 1Z5BA 2ELHA 2MABA 4WX9A 4A0XA 3HUIA 2WXIA 3HB9A 4LJZF 4PD2A 2FXAA 4BJ5C 5FLXZ 4YELA 4XKCA 2R2QA 1U4AA 1A31A 1X1BA 4IHTA 5LFAA 4Y15A 2QJLA 1HW1A 2HWVA 4LGMA 1SAXA 4XM3A 3IHUA 4CHTB 1C1KA 1NHGC 2LD5A 3I01M 3E5QA 1X19A 3FHZA 4LJ8A 1MSFC 2ELJA 5FLVA 2UWQA 1MMDA 1ETVA 1GC7A 3F8NA 3L9FA 3G3ZA 1YX3A 4WK8F 2R62A 3NWSA 4G9YA 2DQRA 1TW3A 1BL0A 3KZZA 4D7NA 4LOCA 2M2EA 3C58A 3A9JA 4DJAA 1T95A 5FTMA 1B9NA 1L4DB 1NJGA 3F9KA 3QYEA 2D2WA 3RE8A 1RIOH 2VI6A 2HXIA 1FIPA 3AI5A 4EGYA 1ZV1A 3L29A 3OYKA 2DAEA 3V6CB 2FJ1A 4P6VF 1V3FA 2KN5A 2E1MB 3PZDA 1ZE3D 3WTYC 1ZLKA 5CQEA 4HQEA 2ID6A 4RM8A 4M73A 2VT3A 2GBYA 4IBCA 3HM5A 5BO4B 2DHYA 3H4MA 1S7EA 4NAWA 2OPTA 2JU6X 3VK8A 4XOTA 1TYGB 2KQSA 2IGHA 1T6SA 2XGEA 4Z2YA 4NJ6A 3I4YA 4NB5A 5FKNA 3CMMB 3SATA 3W5UB 4HNTA 1L2NA 5BYSA 1NJFA 5JI2E 4U7BA 2LGXA 1IO2A 2KN4A 1USSA 3O6BB 1WWTA 4BXXJ 3M62B 5D8LB 3NVYA 3HSEA 1WGXA 3TW6A 4DR5M 1V33A 2HPIA 2Y0QA 2WQYB 1YOVB 3DWLE 3I51A 2P7VB 2BVMA 2KTRB 3UMMA 1FBUA 4A93J 5DPWA 3GUDA 1V5GA 3FXRA 2NRAC 4UUSA 3B7QA 3SBJA 1JUSA 2K22A 4BAYA 2KQ7A 4K2EA 4IOCF 2LYCA 2O8KA 2BV6A 2BWEA 2PLYA 1R1UA 2C60A 4MB7A 2KLOA 2Y75A 1FY7A 4P96A 4MFDA 2HL7A 3Q2AC 4AW4A 4Q2JA 2R5YA 3HHMA 3IV5A 2C5LC 2V9HA 1SANA 1C77A 4ON0A 2RQQA 1D5VA 2FCNA 4L9JA 1VEKA 3CLOA 1X4OA 5K5RA 3F8BA 3ZPLA 2QEJC 1Z5CA 2ZJQF 4DXGA 2FFJA 1FNUA 3M3JA 4IW0A 2MBHA 2HKXA 3N1YC 4KZ0A 1R7JA 4HPLB 2XRLA 3A33B 1JWUD 3HYIA 3LL7A 1V5OA 3LFUA 3GF2A 3KP3A 1SVMA 4HF1A 4MTDA 3H35A 1I4RA 1C9FA 4KIKB 3TBIA 2W57A 4MDKE 3RULA 3L08A 4KN4X 1VQ8I 1VZ6A 4RAYA 3SFDB 2W9NA 1O3QA 3RFZB 1NDDA 3S2WA 1WGHA 5C18A 1LFPA 3MKYB 1W7PB 2D07B 4EOYA 5F1JA 4HSRA 2CU1A 2LREA 3GRVA 1PM5A 2DPDA 3ISPA 4O6JA 2CUEA 3DHHC 2O2VA 1FO4A 4OHJA 2UU9M 2LK2A 4A3VB 2YR0A 3WODF 4XL9A 4IBJA 4JYAM 1TL8A 1TIFA 4BJ6C 4AI6A 3FTFA 2WNMA 3CJTB 1IXCA 2CGPA 4E7HA 3L13A 2MW5A 3VB2A 3QOEA 1GG3A 5J8FA 1GHCA 5K5OA 4L9NA 4EVIA 3DCFA 3CMAI 3B6CA 2ID3A 2W85A 2Z8LA 1LFBA 1TJEA 3M8FA 2GBKA 4GH9A 1Z59A 4X64M 4NC8A 4B7GA 3RPFC 3VUYA 4A3BJ 3UQBA 3W0FA 3WHKA 4OMYA 4EJTA 4EM0B 3BR3A 1Q3BA 3ZGKA 2H6BA 5ILSA 3J81K 1YG2A 3FAHA 5GP9A 1XHBA 2CFOA 1A35A 1ZG1A 4XLHA 5GTHC 5FKOA 4FN2A 2YU9J 3KDSE 4I09A 2AQEA 3C2HA 1XGMA 2BY3A 3GZNB 2JF5A 1TNSA 4B95A 4BXFA 5J18A 3LQQA 1J0RA 4A12A 2IS2A 1KQ9A 1MIJA 3NQOA 1WGKA 1JWAD 5IREB 3E7LA 1FBQA 2L32A 2EZHA 4GN1A 1P0RA 4JXJA 2DQLA 2MH8A 3CCSI 4QPOA 3COAC 2BJWA 3TO9A 2ZSIB 1P7FA 5BMHA 4IKFA 4A5NA 3GLHA 1YRNA 4U0VA 3O8GA 1OFCX 4WCGA 3IP4B 2HCBA 5ITTA 2E19A 3KUCB 3A45A 4B0EA 4US8A 2KNAA 4LB6B 1ZGUB 2FQ3A 4BACA 3RCZA 3V05A 1NI2A 2L4AA 3L2CA 2YU3A 1FPYA 2ZNVC 4GDLA 3HWSA 1VNDA 1UG2A 1OJLA 2KIUA 2BPSA 3U9GA 4RGOS 4W9DA 2GM4A 3M63B 4BHCA 5J1UA 4DV0M 1SXJE 4BHPA 5EXTA 3SHFA 1R1TA 3PUFA 2XGNA 5D2MB 4EV0A 2D3CA 3N20C 2LC2A 5ITXA 5LNK1 4UVCA 3LYYA 1MH3A 1S9HA 3AEEB 3G6EI 2L5QA 2HPMA 1G3WA 1RAXA 3TBLD 1LEAA 2VBZA 4XWWA 1B72B 4NNJA 3VWBA 4AZFA 2R18A 5E6OA 1IY1A 3MFGA 4IWPA 2LVPC 2WHIA 1BI0A 2KFDA 1B4AA 2LY1A 1ORKA 1Y8RC 1Y1VJ 1FOWA 4IHWA 2LHCA 2C7NB 5EYRA 4G12A 3ULQB 2ZANA 4UB6C 4HDUA 5IP6A 3W6VA 1C79A 1G3IA 2XLJA 2MHJA 4CYEA 4ZDPA 1XS9A 3AU4A 3JW0X 2CU7A 4BJTA 2Y0TA 2DWNA 3ABVB 2FEZA 3ZJTA 2P5KA 3E0JB 3TOBA 3JW4A 2KTFA 5E1ZB 3ZTCA 3QPSA 3IXSA 3CD6I 4HSTA 4HQMA 1P92A 5FTJA 1VQKI 1EWYC 4GGQA 3WGIA 4AIKA 5IP4D 2JZ1A 1YYVA 3ZGZA 1L0YB 3RNEC 5CPRB 1NG7A 2D3BA 4YT0B 1Q10A 1HNXM 4P9UA 2MBEA 1K78B 4C00A 4C4VA 4RM2A 1EU4A 2FIDA 1KLVA 1J2XA 2I7PA 4DXAB 3KS4A 3AV0A 1UELA 2BF8B 4G6TB 4OW0A 5E79C 2PMZA 4OZAA 2HS5A 1L0OC 3W2WA 2CHQA 1Z6TA 4BBNF 3HVDA 2K8CA 3JRDA 2MSED 3R60A 1F1ZA 2DAGA 1XCQL 3VR8B 5E3NA 5LBQA 1V34A 2F6CA 2N9KA 2KISA 1N61A 1AU7A 2IJLA 3RNFC 4LF8M 3VFDA 2F5VA 1P4AA 1XMAA 3JVZX 4XN0A 3OWEB 2MLKA 3IH2A 4J00A 1SFOJ 4NJ7A 3HGGA 5EJCA 4L16A 4FWHA 3MAJA 3DFZA 4DGWB 3RDIA 4WP2A 2JJ7A 1QPIA 1SE9A 1YX5B 4ANXA 2EELA 3ZIMA 3GMEA 5CJ9A 3K4LA 4CICA 4ZRJA 3J80K 2QGUA 3T15A 1IPGA 4I99C 4XLFA 2K5CA 3EETA 2GBRA 1R5LA 3N1XC 3K6GA 3FYDA 3K4KA 1KU7A 3HPHA 4Y52J 2HR3A 1ET9A 3PUBA 3S14J 5IP7J 2HFHA 2KDEB 4FHTA 4IRHA 2ZB9A 3LSJA 2DTRA 1KQ0A 4RBOA 1HA5A 2IGNA 2EFWA 1WFYA 4KSKC 3C8YA 1GL6A 4BE0A 2OF7A 4LRSA 4BFRA 5AIQA 3DF8A 2X8AA 2E1MC 1VZ8A 2EPFA 4D1QA 2KAJA 4AP4C 2XK5B 1K6OA 2DA3A 1IW7F 2K7LA 3CO6C 3CZ6A 3M3YJ 2ETHA 4RGNA 3L17A 3J7AO 3URYA 4M8NA 4BBSJ 1Z5SB 3I4MJ 1XMOM 4DUZM 3BWUD 3SASA 3VQIA 3CJNA 4KIFA 1R4MI 5DUKA 1X37A 2MA3A 4M6VA 1WR6E 3GLGA 3HOTA 1TH2A 3NEUA 4AM3A 4QOZC 1QOGA 4BEHB 4YG2F 1TY2A 2IJ0A 4GYGA 2FBHA 4DZPA 4W97A 1I6XA 4I0AA 4KV2A 5CTRC 1G6NA 4C7ZA 2BB5A 1I27A 2M4GA 1T43A 4II3A 3FC4A 3NWTA 1OYWA 4DQOC 5HKHA 1N36M 4FJYA 2L83A 1TW2A 2P0WA 3VXWA 4MGHA 1G59A 3LVVA 4F52A 1OCOH 3IRQA 5LXIB 2JA2A 2QSGX 2OBPA 4P55A 3AB5A 2HI3A 1LUJB 3IKVA 2JWZA 3VTWA 2XEWA 1WRJA 5D5UB 4FD2A 1IGDA 4L5EA 3K1NA 4ZYDA 1YQ4B 3U6OA 4K7WA 1UM8A 2UXXA 3AKZA 1JR3E 1R5HA 4Y13A 2JRIB 2HTME 5CHWA 3NWLA 4W9IA 1UD7A 1E6EB 3TL4X 3S17J 4GGGA 2I8DA 1SJED 5ITYA 1JCKB 4G7HF 1P9DU 1X4PA 2RSUA 2PLPA 2CHXA 2H1KA 2KLGA 3HHXA 4W9FA 4E7ZA 1WFXA 3HM3A 1IF1A 4S12A 5HDNA 3X0WA 1SMYF 2HAKA 2XDVA 2DNFA 5HNFA 1G8PA 1JGSA 3ZP5A 1GPXA 5FLMJ 5JLXA 2EKIA 2R0QC 1FSEA 4DW6A 3W1SA 1LM8B 4BY7J 2RGHA 4NAWB 1HT2E 2K8BA 2UXNA 3IL2A 1ZREA 2Z0EB 3K70C 1O7LA 4GC5A 4XQFA 3WTTC 5LLIA 1FCCC 1P3QQ 2OO9A 1UH6A 2W1OA 2R4EA 1E3HA 4D5FA 2P6TA 5LGUA 1LPQA 3ZQJA 3BZKA 3K2ZA 1APLC 1IV8A 5DV5A 1OFIA 4DYCA 4GMQA 2VH1A 2LVOC 1IRXA 3KIOA 3SFIA 3TO6A 1G4AE 2JQRB 3EYYA 1J7CA 1HW5A 2R7OA 1LVKA 2JWSA 4M74A 1OQYA 2N35A 5FO5A 3GLIE 3CMEI 4D2KA 2WXLA 5KCMA 3I3LA 4IBBA 5ERIA 3S2AA 3KYDD 4UXNA 4B08A 3AEBB 4B0MA 4UUSB 1Y8GA 3HGYA 2EMSA 1WGLA 4BOZB 2BHZA 1ZN2A 4ZYNA 1RR7A 3BYYB 1UAAA 4B4CA 3TUOA 4HJKA 3CUQA 3B2GA 3ENEA 1OAOC 3Q69A 4KGRA 3FTDA 2CW7A 1WH7A 2WXRA 3BOQA 1OQRA 1JKOC 1K3WA 3K4NA 4LFCM 5C3JB 2MH7A 2FUG2 3KYCB 3OWTA 4ANWA 2R5YB 4E71A 2DYBA 2CHZA 1OQQA 2H6CA 1NVID 4JI5M 5IWAM 3M8JA 1B9RA 3DQVC 3LJ3A 4QWQA 3KZYA 1DYQA 1WJNA 5D5XB 2K6BA 2JYEA 1GJTA 1TTEA 3SZPA 3FKYA 2ME0A 3SDLC 4IZZA 1S29A 2KZGA 1YIJI 1D1CA 1SMTA 5IAAC 2L9RA 8CATA 1T0FA 2JY7A 4XN3A 2XAFA 4KISA 3MMPA 3K4JA 1SC7A 4DNCA 1KU9A 4EEWA 1OFFA 4L9TA 3E5UA 4YEJA 2OOBB 3V7SA 1RRBA 4CQNA 1JROA 4N9HA 2WTEA 1QHHD 4CH7A 1WYGA 2F5CA 5DCMA 2ZXHA 3PNYA 4CCMA 2M56B 2EINH 2JUCA 1MJAA 2DA2A 2L4EA 5CHVC 2FX0A 1R4GA 4L1BA 2G5GX 1NV8A 1FJLA 3S93A 2A5UA 2QIEB 1VD2A 3C0RB 3QP6A 4GCVA 1T39A 3SU8X 2F4IA 1W36C 3IWZA 2RNJA 1HQCA 4YIRX 4ZRQA 2GOWA 2Q2EA 1WR1A 2N4FA 2INNE 2R45A 1T0YA 1DU6A 4RB3C 1NVMA 3U6MA 1WX7A 2FA5A 1C4PA 3FUVA 3RSNA 4HLXA 3WG9A 2ZJ2A 2AHMA 3MHSD 3KFWX 3AE4B 1QU3A 2IXSA 3KS8A 3EIHA 2LXCA 4EE2A 2LRDA 1QT9A 3F0CA 1CQVA 5C3EJ 3RNGC 2NS8A 2DWLA 3AG3H 3W3CA 3JRCA 1SB3C 1FYMA 1WJ7A 1TQMA 1FMVA 2KJBA 1DUXC 3ASOH 2Y0SA 1FPQA 4B3MM 5D6EA 2HDEA 1CJEA 3ZN1A 5HI1A 2KX3A 5HLHA 1O4XA 2F5PA 2LF8A 1QUSA 3BG7A 3E21A 4MGZE 5AONA 3DEEA 4LDTD 4LNOA 1UUPA 1Y0NA 3H8HA 3OYCA 2MQJA 4WJPA 2EFQA 2K9LA 2GBJA 2KJRA 2WU5B 2XGCA 1QRYA 4BKGA 2OEDA 4AKIA 2L00B 4RM9A 2LP0A 4EM2A 1BI1A 3BP8A 3RI4A 4Q4ZF 4DR2M 1FSHA 2CKHB 4HWIB 3CCUI 4JGHB 4OAZA 2VBWA 4CSWA 3ALBA 3GLHB 2KANA 3MKZA 1X1AA 5KVRA 2MBQA 1U0JA 3PIOF 4LNKA 4DBGB 2KRHA 3JRFA 2LH9A 2ERCA 2V79A 3DP7A 1HSJA 2VXZA 3OYMA 2D1VA 4GDLB 3K9OB 2TSSA 2BT6A 5KPRA 2DCEA 3QU6A 3A9KB 1HQRD 1XO3A 1Q39A 3GLXA 1DU0A 3TEZA 1R7RA 3RZWC 3ABKH 1J5YA 3A01B 2PJPA 2Y20A 1HSTA 1BIAA 1X58A 2DJIA 3TW7A 1R6RA 3BROA 2C7MB 2K3UA 1WMHA 4MM3B 3NBIA 4N58A 1BW6A 2L4FA 2LJ5A 2DZLA 2OCEA 1ZUD2 2MX2A 3KW5B 3W5VB 2Z9OA 2H27A 2K25A 3TEDA 2MW8A 3K9TA 1H9GA 3KP4A 2WSCF 2K9NA 5E3LA 2FAZA 2L3ZA 3RZOJ 1S3SA 3CTAA 3DBSA 1IM2A 3P9IA 2INPE 2F5DA 3MZ8A 4NNJB 1D8KA 3KEQA 3KE2A 3GTLJ 3AE5B 4YSZB 3S15J 3DZDA 1KLUD 5C4XJ 3T8MA 2R7RA 5ILVA 2PEAA 5E26A 5L8RF 3M9AA 2UU7A 3RNBC 1PQSA 4GRIA 4C3IJ 1WH3A 2WX0A 3FXQA 4X62M 2Y9YA 4RB1A 3UIOB 2WS3B 4KO8A 3FYCA 1NTCA 5IYDJ 3PLUA 4L18B 3GRYA 3HRUA 2JZYA 1XMQM 1R5ID 1ACIA 5LRRA 2WADA 1VR9A 3A42A 3EECA 2JVHA 1FD6A 4XKBA 3ZQHA 1HOMA 4NOOB 3PJRA 2Z0DB 2KC1A 2LHEA 4B43A 1TGUA 4AIDA 1FXTB 3GP7A 1XN7A 1QVUA 3P4RB 2V7FA 3N97A 5BR8M 2R44A 2N9PC 4BE2A 3TCAA 2JRHA 1WIVA 3DOWA 2ZO4A 2RGOA 2W00A 3GTKJ 1VZ0A 3C2GA 4JP0A 4LK1F 2MJ3A 4LITA 4MO7A 1DP7P 1REPC 1R4NI 2KZUA 2A61A 4IOAF 1LE8A 4RDUA 4A3KJ 5D7GA 3W68A 2X1DA 2PN6A 2PJRA 2Z16A 5FGMA 4I6LB 2DZIA 4XLPF 1TY0A 3MC8A 3U4EG 2IW5A 3EGRA 4DV3M 2AWTA 4Y3OA 1YQ3B 1OKSA 3RGSA 3PL8A 4FQGA 1MVKA 2X38A 2R7VA 3AL0B 5B5EC 3VTUA 2PW9A 2MH9A 5J1YA 2LGDA 4N6EB 3BG5A 1XX5A 2BYTA 5FR3A 3KP5A 3M7GA 1XD3B 4KUMA 2V9KA 2WXPA 4LD5A 4XSXF 3TEWA 2WLBA 5IYCJ 2HU9A 4QHSA 5E1XA 3BXWA 2ZZPB 2KOXA 1MX0A 3T1BA 5HODA 1ZRDA 1CF7A 1XD7A 3C3WA 2X4AA 1UF0A 4UV8A 4FXCA 1SFXA 4BQAA 3Q3MC 3RCOA 4D7MA 3APFA 5IPAA 4KN7X 2CQXA 1UZXB 3KETA 1G71A 3IAM1 4YSYB 2NAZA 3EHVA 5BPVA 2JY8A 1XLNA 3U61A 4KGSA 5L3EA 1I4QA 2WXOA 2XSDC 4Y4RA 3CP8A 5E1WA 1BJZA 3SYKA 1ZHFA 4RAFA 1TZOA 2IGMA 2ZJDA 1DPRA 2Y5CA 4MEXF 1Z6RA 4NHJA 2JA6J 1VQMI 2L6OA 4HOBA 2L9SA 2B9SA 3I9V2 4XZ4A 2E3TA 2Y5PA 1NY5A 3W9CB 4GOCA 1GUAB 1ENFA 2R93J 3U7ZA 4M3GA 3QPTA 4LIVA 3ROUA 2OCCH 1WXQA 1TBXA 1N34M 2JNHA 2IZVB 3PRZA 3GTQJ 3RGPA 3HJ8A 3PLVA 2R4JA 3RIRA 3U1KA 3WTSC 3BK1A 3I4VA 2FCSA 2IAIA 5DUIA 1R9TJ 1AARA 2VLAA 3GLGB 4EJWA 4UUTA 3NARA 2YPRA 3U6QA 4EJUA 1D0ZA 1AUAA 2MP2A 3KYLA 3FWEA 4XKWA 1YHQI 1TS4A 5L3FA 1ONVA 1MU5A 2MD0A 3CSTA 2VT2A 4HCPB 4TQ1A 2V3PA 2JXXA 2NVYJ 1JT0A 5D4SA 3PFIA 4WWNA 3A02A 4CHKA 1J7BA 2JXTA 3LSHA 3ML6A 2YEPB 3PS6A 4XX5A 1L0XB 5HHDG 3DPDA 3IAM2 5FTLA 1S8NA 2DOFA 2VQLA 3BZCA 1F2RI 2DA1A 2JWUA 3BG6A 2MG4A 3G4SI 2WZJA 1TTNA 2G9HD 1JQ4A 2WXJA 1UB9A 3K4MA 2NVUI 2EZIA 1FEXA 4HPPA 4CGZA 1LV7A 4FWDA 2EA0A 1A6QA 2GI9A 4MH0E 4MEMA 1G2HA 4LG0B 2BY0A 5FK9C 2LRWA 4LCBA 2HQ5A 3LSTA 1OR7A 2J4XA 4F93B 3G2BA 1DPUA 4OVVA 3GTGJ 4C9YA 2DENA 3ASNH 2M9HA 1X1MA 2KWUB 2ZBKA 3DU6A 3AM9A 3KP2A 2RVCA 5IKCM 4LJ6A 4XLAA 4IX7A 4LGWA 3MK6A 2V1UA 1IY2A 5M3FJ 2DA4A 1WE6A 3R4KA 4DDGD 4ZPXA 2N9XA 2LUEA 2KNVA 1JHFA 3UIPB 2P5TA 2WWYA 2IY0B 3DBRI 1EJ9A 4F1IA 1OCCH 2EZLA 4E70A 3CWIA 1D1BA 1D5ZC 2Z4RA 4S04A 2A69F 1R00A 1AKHA 2Y9ZA 2XUBA 5KHDA 1K61A 3TSSA 2DWMA 1SD4A 3I59A 1HTOA 5FTKA 3P2BA 2AXTC 2DAFA 2HQNA 1QZYA 4XNFA 1KLGD 3HOZJ 2OUMA 1Z91A 2L7ZA 4XGAB 3DBHI 1G6JA 4QOSA 4R7GA 2M60A 3Q3JA 3NZSA 5H6QA 2F5SA 2Z33A 3RZFA 2YUSA 4HF0A 5F6FA 3LCUA 5EDNA 3PQKA 3P1MA 2E6XA 3U6PA 1NNJA 1OPCA 1ZRCA 1SD5A 4DZJA 3O3KA 4LLGF 4FHKA 2DYOA 2WGSA 3IH4A 2X51A 2L7HA 1YMHE 2F4VM 1MMAA 3S1MJ 1G4DA 3OS1A 4FJVB 4CHUA 2M5WA 5ED4A 2C7HA 4BHBA 4QSHA 3ABTA 2PVOD 4JI8M 4K7SA 4Q48A 2NXNB 3W1YA 4A3CJ 2HYJA 4XLEA 4RKUF 2LEKA 2BKFA 4A6DA 2MEKA 1ZG5A 2ZMEB 2A68F 2VB6A 4ZYSA 5IY5H 3CUQB 2GBMA 2ZSHB 4IVNA 3FXUA 2QZ4A 1Z2MA 2UWMA 2YFQA 4MJSB 2L0TA 3LNQA 1QQWA 1G3SA 3NRZA 2AX5A 3N9YC 3H3UA 2R7DA 4IM2A 1E90A 2LVQD 1RM6C 2JXNA 3AULA 3Q5FA 4M0DA 1HDPA 3BTLA 3RN9C 3GBGA 3R3MA 1WJUA 3TEYA 2X49A 3FXJA 4E7SA 2LY9A 1XDSA 2J0JA 1HKSA 1NBFC 4WQMA 1VDDA 4WWOA 4FJZA 3ZNGC 2Q0OA 1MBJA 5TSSA 3N1ZC 3HTSB 3V8LA 1X3ZB 1W5CC 3I4NJ 4CCLA 4EJVA 1MN3A 4IM0A 3TWLA 2DA7A 2XZFA 7CATA 4EZLA 2GA2A 3ZQCA 2HOEA 1VQ9I 2L8JA 3L7WA 4A3DJ 2CV2A 4PJLA 1Q1VA 5LHHA 1IXSB 1SIJA 1KTKA 1LNWA 3TPZA 3IT4B 3ZDTA 5FRNA 3AJIB 2IBDA 2JYTA 2QMTA 1T0SC 2LOOA 3B9PA 2IA2A 3BWGA 1PGBA 1FM0D 2HYGD 2O6VB 5IO9A 2Y69H 3DVGX 4B09A 1U2WA 2MA9B 4B47A 4F7ZA 5J8CA 1ENHA 1FC3A 1GVDA 3B1LX 3ZTDA 3Q8CA 5GAHJ 2D7GA 1KRHA 1ZLJA 4BLCA 3ZW3A 2VZKD 1X1CA 2Q2EB 3A98B 4IXAA 3GO5A 3JAMK 3BVGA 1R4MB 2HDWA 3HU3A 2W48A 5CVUA 4A90A 2C9CA 1T56A 4M01A 1J7AA 2OTLI 5FROA 2F5OA 3U2RA 2L09A 4V2GA 4XICA 1TKGA 4KJZA 4K1RB 2KFJA 3VDZA 4XLCA 1RU3A 4MTEA 2Y21A 2KQRA 4B3RM 3EUHA 2EJRA 1UZCA 4HA8A 3BR1A 1MHHE 5HS8A 1KYZA 3RPQA 3R66C 3S3OA 5C4JJ 1E8YA 4GYIA 2CUZA 3CC4I 2R6FA 2XROA 3PO2J 3E6MA 2DZNB 4WJOA 4IBDA 3GCMA 2K9DA 4X66M 2LG4A 2J5OA 5DD4A 3J81S 2ZCCA 3HK0A 4OVZB 3VLFB 2L54A 1P7JA 3CJQB 4AVZA 5HDKA 1LDJA 4ESFA 1R6BX 2E2HJ 4MACA 1FBSA 3AH7A 5JFRA 1RUOA 4YWGG 3S3NA 3ZR8X 2XPWA 4PYZA 4GKJM 3WTZA 3Q0VA 1MJBA 3C1DA 2GB1A 1FWZA 3RTRA 2GAUA 2CQNA 3SR6A 1SXJA 1B8IA 4R3DA 3IT6B 1A5TA 5LMNM 4RB0A 2A4ZA 3ZYYX 1KYIA 5L3BA 2RN7A 3QODA 2Z99A 1DGFA 2YX4A 2FMYA 5CVIA 2PMVA 2W54A 3BY6A 1XLPA 1WJCA 1POGA 3PREA 4KODA 1FLIA 1X3UA 1SXTA 1QQRA 2AQ1B 2PFBA 1WSPA 2VF7A 5EEAA 1ZGAA 1VQ1A 1TS2A 1L4ZB 1QOFA 2NTSA 1PGXA 2DLBA 3M95A 3LAJA 2BW2A 2E5NA 4FTHA 5J40A 4M3BA 2WAQN 1P1AA 3SZTA 3KZIC 4GC9A 4KMUX 2XAGA 3P9KA 1AA7A 3S2HJ 1N32M 2CR5A 3ZMSA 4A55A 3LSRA 3V7CA 3QCAA 3CF0A 3ECIA 2KHWB 1N77A 3IG5A 2H94A 3TDZC 1IDYA 2BHYA 1RPWA 1WXSA 3AL0C 3AE6B 1XLQA 5I4DA 2FU4A 3RMKC 1HT1E 4GXOA 1XXHA 1PJJA 1IP9A 4DWFA 1KA8A 1KFVA 2CEAA 2HWJA 2CYYA 1NK3P 2NS7A 4W1UA 1LTMA 4W9CA 3GXOA 1YQBA 3R8FA 2BQQA 1Q1HA 2WAFA 3IWFA 2GIZA 3LWFA 4Y17A 4F2LA 4AS1A 2K4BA 2O0YA 3BG3A 5EGOA 2DPUA 1I50J 4PS3A 1SXJD 4H2AA 3NZUA 2HTSA 2LNHC 4A3PA 1U5TA 2HJ1A 3BJOA 3WU2C 1HW2A 1V49A 2VC1A 1PGYA 4OIOF 4I76A 2OC6A 1TLHB 2OQRA 2ZAOA 1RETA 5TISC 3ECHA 1UBQA 5JH5C 3U60B 2O25A 4LFUA 4KKIA 1HTQA 4ENNA 4MSMB 2N7JA 2DA5A 2DI3A 2WV0A 2X1CA 1ZELA 1MBFA 1F4KA 3HOYJ 4UV9A 2JY6B 2FCQA 1VQ5I 5C1ZA 1ODDA 4KFCA 2MH2A 3LXFA 1WIAA 2GQQA 2OQ4A 1RFAA 4LJAA 2FNAA 4I2OA 4PCQA 1F4IA 3I63C 4BXUA 2LR8A 2CE7A 1ZDVA 2PTLA 1QNTA 1R5GA 5EE1A 3L27A 4OZCA 2CHGA 1KGSA 3DA1A 2V9PA 1XMKA 5CX3A 2QHOB 2ASQA 1D5MC 3KEYA 2G7HA 3R2IA 1MGTA 4WXHA 2EK5A 3PSEB 4HV5A 1HXYD 1BR4A 1FNNA 4FCTA 4MNUA 2HOTA 1YIWA 3VH4B 4GDFA 2M8EA 1WRIA 4M9XA 4DHJB 2E5LM 2M5ZA 2G3QB 2WXGA 1ZDXA 2Z7JA 3I4PA 2ZVNA 1D6EC 1Z3YA 3T3NA 4ASWC 4EGZA 4GIVA 1KONA 4HBLA 3OYJA 3J80S 2C96A 3MD2A 4P7IA 1YJIA 1PJTA 1VI0A 2Z59B 4XR6A 1GDTA 4JIOU 2DODA 2XB5A 2XB0X 1G3TA 4WJNA 4EATA 3PIPF 5FTNA 1XCTL 4D9JA 5EP3A 3HOWJ 1F52A 2OJED 1PUFB 2WB1A 2YSRA 5FFXA 1X3WB 1S5LC 1EM7A 4NQLB 3S1NJ 3LMMA 1D8JA 4GIPA 3V76A 2V1CA 5IP9J 3RKWA 4J01A 3R9XB 2ICIA 2GNOA 1MDMB 3IVFA 1T6OA 1RWSA 3V7RA 3M07A 3OYFA 3R61A 4WWPA 2E2IJ