2DAMA

Solution structure of the novel identified uba-like domain in the n-terminal of human etea protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human ETEA Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ETEA protein
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2damA00
1HQYE 2JY6B 2ZTCA 3B89A 1ZMWA 1QZEA 1MN3A 1XXHE 2CP8A 1T6OA 2OO9A 4DBGB 3MMPA 1CUKA 2HWJA 4HEOA 3GLHE 2H5XA 2JZ0A 2R0IA 2KNAA 2QNJA 1T43A 1E94E 1OAIA 2JY5A 1R4GA 2DAMA 1VEGA 3GLGE 2OOAA 2JY7A 2ZTDA 2LBCA 2DI0A 2G3QA 1G41A 1HT2E 3E21A 2KNVA 1C7YA 2LTUA 1UFZA 2MGWA 1WR1B 2OOBA 2JNHA 1NV9A 1JR3E 1VEJA 2B3TA 2K0BX 1P3QQ 1HJPA 1V92A 1OTRA 1DO0A 2DAEA 2JP7A 1KYIA 2LVPC 4GEWA 2JY8A 5DFLA 2QHOB 2QSFX 1WHCA 1HT1E 1WGNA 4F2LA 3FRIA 2DKLA 1G3IA 2O25A 1PGYA 2MROB 1XB2B 3K9PA 1TR8A 1VQ1A 1OKSA 2DAKA 1IXSA 2LVOC 3FE3A 1A5TA 2EKKA 2DAGA 2DAIA 1EFUB 2LVNC 2HAKA 1Y8GA 3H4JA 2BWEA 3IECA 1BVSA 2KNZA 3K9OA 1F4IA 4Q7JA 4R71A 1VG5A 2MJ5B 2L4EA 1WIVA 1VDLA 2WZJA 3T6PA 1YLAA 1SG9A 2K9DA 2BWBA 1IM2A 3GLFE 3GLIE 2RRUA 1DV0A 3LCVB 2LVQD 3LCUA 1WGLA 1DO2A 1Q02A 1TTEA 2L2DA 2MR9A 2EJSA 1NV8A 2DHYA 2CWBA 2KHHA 1GO5A 2L4FA 1AIPC 1G4AE 3E46A 2JZ1A 3IHPA 3FRHA 4WP2A 3BBZA 1IFYA 1VEKA 1ZV1A 2DNAA 3F92A 4F1IA 1ZMVA 1WJ7A 2JUJA 4UN2B 1OQYA 2DZLA 2EKFA 4G3OA 2DENA 2LVAA 5JI2E 1ZMUA
chains in the Genus database with same CATH superfamily
1G71A 3HU2A 4QHTA 1H6UA 4DV7M 4B3TM 1IY0A 1MN3A 1IXSB 3GRRA 1R7RA 4HL4A 3U60B 2CP8A 2VF8A 3J27B 3KVWA 5IZ7D 2DZNB 3WHLA 1IY1A 3AOEC 2R0IA 3QWLA 4B3SM 1SXJE 2CHGA 2QPAA 1JR3D 3T1HM 2DAMA 4YY3M 4LJAA 1GLNA 3KFUG 1R5LA 3SAUA 4AG6A 2KXEA 4FCTA 4FW9A 3W0FA 2CHVA 3I04M 2JWSA 2LBCA 2R4JA 4BLCA 4X66M 4IBIA 3GPPA 1HR0M 3WHKA 2ERCA 3B7ZA 3ZCBB 1JQJC 1HT2E 4GKJM 2LTUA 1TF0B 4IIWA 4B7HA 3EIHA 3M0EA 2KEBA 4OVZB 5LMUM 3GPYA 3JAMS 2B3TA 3J7AS 1AUAA 4KHPM 1HJPA 1V92A 3U6MA 2I7PA 1OTRA 3HU3A 2CUZA 1XC8A 3FD9A 3PNVA 2BJVA 4GMQA 1YSYA 4G4OA 5BR8M 3U5ZA 3LQQA 1K82A 4AKHA 2JY8A 5C18A 2R62A 2QHOB 2QP9X 2QSFX 3T38A 1NY5A 1N78A 1HT1E 1QAMA 2G8LA 3FUTA 3IG8A 4F2LA 3FRIA 3GRYA 4KODA 4DV0M 3SASA 2Z4RA 3AL0C 2P5TA 2K47A 2ZAOA 2YQZA 1KFVA 2X4AA 1NHWC 5KPTA 1G8PA 4LGYA 4D82A 3U5ZB 3U6LA 1IXSA 4GITA 4NL4H 5DYGA 2BNKA 5EP4A 2MH8A 1ZAEA 2DAGA 2LVNC 2F5PA 2XSZD 2R46A 1Y8GA 4CHTB 4LF4M 4ZPXA 4RNAA 2M5ZA 4CIZA 5EXPA 2L7HA 4OVZA 2KNZA 4AKGA 4JI5M 4JI7M 2E5LM 4JI0M 1ZQ9A 4JYAM 3FYDA 4QNMA 4MH0E 1GL6A 1IQPA 2N35A 3A45A 1L1ZA 1SXJD 2L4EA 1VDLA 3I51A 1YLAA 3T6PA 3VLFB 4GHAA 4TUWA 2OQ4A 5KPRA 3A42A 3GLFE 4DR4M 4AZFA 2CRUA 3KS4A 1N36M 3U6OA 1TGUA 2FE8A 1WGLA 4NRVA 4L78A 1TTEA 2LXEA 3FTCA 1S3SA 3CGWA 3AKZA 2HL7A 2VQEM 4NOOB 2XF3A 3C3EA 1NJFA 1T3TA 1Z6TA 2JZ1A 3E46A 3IHPA 4MGYE 4D81A 2XZUA 5IWAM 2DWLA 2KDLA 1SXJC 1ZV1A 2DNAA 3L2AA 1PJJA 3CTWB 1SXJB 4REZA 2DWZB 5KQ8A 3D8LA 3ZC7B 4QOZC 4XK8F 4R3DA 4XBOA 2DVWB 2QENA 1OIZA 1Q3BA 3ZQJA 2DENA 1V34A 1XMOM 2LVAA 1ORYB 2D7EA 4LF7M 2O01F 4PT5A 5EXSA 2R65A 3GO8A 3B89A 1ZMWA 3W67A 3GPUA 5EP3A 1XXHE 2OO9A 1GKIA 3AOGA 4LJ7A 3V76A 4ANRA 4MM3B 1N32M 5IREB 3H4MA 2ZM6M 2HCBA 3M6AA 2JZ0A 1OAOC 1QDTA 1WXQA 1NSFA 2KNAA 4GC9A 4LZJA 1N34M 2G5GX 3LMMA 1E94E 2UXCM 3KOXE 1R4GA 2FNAA 5GKNA 1VEGA 1L2CA 1N75A 2ZTDA 1TH3A 3W0LB 2YNMD 4LFBM 3UMMA 2J7NA 1MU5A 4NSOB 4FCWA 3E21A 2KNVA 3SHFA 4DV1M 2RKOA 1OJLA 1J5EM 4I5SA 3VK8A 1WR1B 4LF9M 2OOBA 1NHGC 8CATA 2C99A 5EQTA 1JR3E 4PDIA 2F5QA 1Q39A 3KXEC 1VEJA 2DZOB 3NBXX 2KRKA 4L6V6 4MB7A 4MGIE 3U6EA 4M9ZA 2LVPC 1OFIA 1KYIA 2EO2A 4CGYB 1IN7A 4GEWA 3L27A 5DFLA 2X8AA 3PNYA 1WHCA 3U6SA 1E9RA 1L8QA 1NY6A 1WGNA 3LW5F 1JR3A 1NO1A 2XH9A 3E9SA 4DR5M 3FTEA 1QYRA 1Z59A 1IN8A 3LQRA 5E26A 2OPFA 3VDPA 4KT0F 2C9CA 3R9XB 3FE3A 3DA1A 3MK6A 3SATA 2FS1A 4I4LA 4NRWA 2DAIA 4LZZA 1TDZA 3PFIA 2BWEA 2XEPA 3KSJA 1TDHA 2M60A 2KRUA 4W5WA 5KPZA 2JXNA 4LY6A 4WW0A 4DR1M 4I81A 3HX3A 4JN6A 1WIVA 4Z8XA 1QVRA 4DV3M 3FKEA 2K9DA 2O5RA 3HJSA 3GLGA 2VF7A 2BWBA 2Q2EB 3KOWE 3LVWA 2Z3XA 1HNWM 2XFSA 2R6FA 3K92A 4OX9M 4GC5A 4LFAM 3U60A 4RKUF 3VKGA 4LJ9A 3HHYA 3U6PA 4JI8M 1Q3CA 3GRVA 3GLFA 1Q02A 1XXHB 3BOSA 5A2QS 1NNJA 1K3XA 5ITUA 2DHYA 4AI6A 2CWBA 3HZJA 5E6JA 1DGHB 5FTKA 3VDUA 2Y0QA 1AIPC 5ITYA 1IXRC 3CF6E 3PXGA 3FRHA 2R18A 2R44A 2RGOA 2FH0A 3BBZA 3GLFB 1R2YA 4JI6M 3F92A 2FOIC 4B3RM 2QBYB 3R8FA 4QHSA 1WJ7A 2GNOA 2FFJA 4UN2B 1NNUC 2DZLA 2EKFA 2KZSA 1PJSA 2WSEF 4KLNA 4LGMA 3A98B 3AFHA 3UGJA 1NVMA 1QANA 1D0MA 5JI2E 4DR2M 1ZMUA 4KO8A 3L28A 4FWDA 4IJFA 3QYBA 5EXTA 1HQYE 2DHRA 1TH2A 3UJNA 1QZEA 3B7QA 3NBIA 2XSZA 3J80S 3MMPA 1DGFA 4HEOA 3SYKA 3GLHE 3KOZE 3L26A 3D8BA 4IBGA 4DR3M 2QNJA 1QQWA 2JY5A 1IBMM 1XMQM 3JR5A 4GIPA 1G59A 4B3MM 2QCUA 3DFZA 3GLGE 4FWHA 4DUYM 2LNHC 2XGNA 3HHXA 2DI0A 4AW4A 5ITTA 4G4RA 4X64M 1C7YA 2MGWA 1N33M 2H1RA 3GLHA 4PDGA 3GQ5A 3SYLA 3FUXA 4FVMA 1IY2A 1R6BX 1KSFX 3CF2A 5JI3E 5KQDA 3U61A 3AJIB 3SMPA 4QOSA 1QUTA 1FJGM 1Z5BA 3GLHB 4QNRA 4A3VB 3PVSA 1E9SA 4DV6M 3HY5A 4AKIA 1TH4A 2K0BX 5DYIA 3TPZA 1C1KA 1QAQA 3AV0A 1QDRA 2DAEA 2RGHA 5F3WA 3I4VA 4CISA 4GHLA 3TQSA 4IBJA 1W5SA 4LF5M 2CHQA 1EIJA 2DKLA 1G3IA 3CF0A 5ITRA 2WSFF 2R45A 2MROB 2V6ZM 4X62M 2J5YA 4L8RC 1Z5AA 4G4NA 5FTNA 2R4EA 1TR8A 2JA2A 1VQ1A 3LVVA 2DAKA 4MGZE 2LVOC 4NSRA 4YHHM 4LG2A 1A5TA 3BXWA 2LHGA 2UUCM 3FUWA 3TWKA 2EKKA 2NQ8C 1EFUB 1MX0A 3QAUA 2F5NA 1PJTA 3H4JA 3TE6A 2YR0A 3IECA 3U6QA 4G4QA 3U6DA 3U61B 3K9OA 3C9PA 3NWLA 4PCZA 4GH9A 4LCBA 4Q7JA 4MGKE 4RF0A 3UZUA 4BBAA 3FUVA 2CFOA 2C96A 3GLIA 5IT9S 4I8OA 1IN4A 4DUZM 1PM5A 2WZJA 3GPXA 2ZBKB 2CV0A 4LFCM 3TWLA 1XNRM 4M0DA 4JI4M 1IM2A 4NXNM 2RRUA 4LRSA 5L8RF 2Y0TA 1DV0A 2F5OA 2XFTA 4D80A 5EXXA 1SXJA 4P16A 5BPVA 3HKPA 1L1TA 2KW0A 4LJ6A 4JI2M 3M7GA 3GRUA 5C1BA 1GVNA 4CJ6A 1D0KA 1XXHA 3RGPA 2MR9A 2L2DA 2LH0A 4M0WA 4XGIA 3QYEA 4M9XA 3KS8A 4IBFA 2KHHA 1GJSA 2J7OA 1GABA 1GO5A 3K1JA 3SHGB 1G4AE 1EE8A 4WP2A 1J7KA 1DGGA 1XWIA 3GLGB 3T1YM 2CEAA 2GQFA 2YFQA 1VEKA 4L15A 3TWMA 2XLJA 2UU9M 1ZMVA 3E4RA 3I4YA 4FD2A 3VKHA 3KSXA 3C3DA 1V33A 2AHMA 4MGHA 1I94M 4GRIA 1IBLM 4DV5M 3HJ8A 2UUBM 4G3OA 2QBYA 5FTLA 1VDDA 2KZUA 2C98A 2D7GA 4NXMM 2LWXA 4BB9A 2JY6B 4IBKA 1DGHA 2ZTCA 4GKKM 3DZDA 5ITQA 1DGBA 4B7GA 1IN6A 3SBJA 1T6OA 2Z8YM 4DBGB 3OTOM 2APLA 2CE7A 3KP0E 2EUCA 1CUKA 1MJGM 2HWJA 3U6CA 4AQYM 2H5XA 3Q8XA 1HQCA 4Z6YA 4IJEA 3FTDA 1T43A 1OAIA 4K0KM 1D0LA 3GLIB 2QZ4A 2QQ8A 3HJQA 3UK6A 2OOAA 3HWSA 5ITXE 4RF1A 2JY7A 2VIIA 2HKJA 2Y21A 3KW6A 4G6ZA 5FTJA 4EIWA 1HNXM 4LF6M 3KDSE 2CV1A 3HHZA 2K6BA 3RFWA 2G3QA 3W68A 1G41A 5FTMA 1N77A 2UXBM 1OIPA 4AG5A 1UFZA 3C58A 2LHCA 2L09A 4JV5M 2F5SA 4S12A 2JNHA 3B9PA 1NV9A 1J09A 1JB0F 2F4VM 1XHBA 4R7GA 1QUSA 4L16A 3MHVC 2D7HA 1IN5A 1P3QQ 2DWNA 1Z5CA 1DO0A 5DNYA 2JP7A 3I01M 4LJ5A 3SAVA 4ITQA 7CATA 1FNNA 4LRTA 4IBCA 4FCVA 4L4UA 2C9OA 4DR7M 2A5YB 2O25A 2V1CA 1PGYA 1YUBA 1LTMA 1PRBA 5LMNM 2ZANA 2XZFA 1XB2B 3K9PA 3KP1E 1D2NA 3RE8A 5H37D 1E32A 1GL7A 3L29A 1OKSA 2ZAMA 3JR4A 3FUUA 3K2LA 3B7NA 4P17A 5KO3A 2C5RA 2KA6B 3THGA 3AOEA 3SAWA 3FYCA 4DV2M 1UM8A 1NJGA 1HNZM 3MJ5A 2VQFM 2HAKA 1OFHA 3IG5A 2X49A 2DWMA 1XNQM 3EIEA 4OW0A 3B74A 1BVSA 1F4IA 3SARA 3HGIA 4B7FA 1PJQA 4R71A 2UXDM 4HLQA 1VG5A 2MJ5B 3GQ3A 1PJIA 2Y20A 4IBBA 1QZMA 4NC6A 1SG9A 4WURA 4X65M 3L25A 4LF8M 1I4WA 2W82A 3GLIE 3KOYE 3DOAA 3LCVB 3GP1A 2DXIA 2LVQD 5EP2A 1YE9A 2Z7JA 3LCUA 2WSCF 3SFZA 4M9SA 3J81S 1DO2A 2I7NA 4OU7A 4JXJA 3GQ4A 3TL4X 2EA0A 2EJSA 1IXZA 1RU3A 2Z4SA 1NV8A 3HU1A 3J2PB 4II7A 1L2BA 1IBKM 1GJTA 4PD2A 4IBEA 1QAOA 1W5TA 4B08A 2L4FA 4Y28F 4LJ8A 2V1UA 3ILKA 1LV7A 1IFYA 3RGSA 2CV2A 1K3WA 3ZH9B 3FTFA 1R2ZA 3A46A 4F1IA 3VK7A 5ITXA 5FSWA 2VDBB 5EJCA 3SC3A 5EP1A 2JUJA 2L7IA 3J7BA 1OQYA 3VFDA 4JI1M 2HHHM 3SMSA 1L2DA 2L6OA 3T15A 4JI3M 4FWGA 3Q8GA 3HHWA 4DR6M 4LJ4A 3K8ZA 4IBDA 1X37A 4DV4M 2UUAM 5FLXS 2BJWA
chains in the Genus database with same CATH topology
1HQYE 2JY6B 2ZTCA 3B89A 1ZMWA 1QZEA 1MN3A 1XXHE 2CP8A 1T6OA 2OO9A 4DBGB 3MMPA 1CUKA 2HWJA 4HEOA 3GLHE 2H5XA 2JZ0A 2R0IA 2KNAA 2QNJA 1T43A 1E94E 1OAIA 2JY5A 1R4GA 2DAMA 1VEGA 3GLGE 2OOAA 2JY7A 2ZTDA 2LBCA 2DI0A 2G3QA 1G41A 1HT2E 3E21A 2KNVA 1C7YA 2LTUA 1UFZA 2MGWA 1WR1B 2OOBA 2JNHA 1NV9A 1JR3E 1VEJA 2B3TA 2K0BX 1P3QQ 1HJPA 1V92A 1OTRA 1DO0A 2DAEA 2JP7A 1KYIA 2LVPC 4GEWA 2JY8A 5DFLA 2QHOB 2QSFX 1WHCA 1HT1E 1WGNA 4F2LA 3FRIA 2DKLA 1G3IA 2O25A 1PGYA 2MROB 1XB2B 3K9PA 1TR8A 1VQ1A 1OKSA 2DAKA 1IXSA 2LVOC 3FE3A 1A5TA 2EKKA 2DAGA 2DAIA 1EFUB 2LVNC 2HAKA 1Y8GA 3H4JA 2BWEA 3IECA 1BVSA 2KNZA 3K9OA 1F4IA 4Q7JA 4R71A 1VG5A 2MJ5B 2L4EA 1WIVA 1VDLA 2WZJA 3T6PA 1YLAA 1SG9A 2K9DA 2BWBA 1IM2A 3GLFE 3GLIE 2RRUA 1DV0A 3LCVB 2LVQD 3LCUA 1WGLA 1DO2A 1Q02A 1TTEA 2L2DA 2MR9A 2EJSA 1NV8A 2DHYA 2CWBA 2KHHA 1GO5A 2L4FA 1AIPC 1G4AE 3E46A 2JZ1A 3IHPA 3FRHA 4WP2A 3BBZA 1IFYA 1VEKA 1ZV1A 2DNAA 3F92A 4F1IA 1ZMVA 1WJ7A 2JUJA 4UN2B 1OQYA 2DZLA 2EKFA 4G3OA 2DENA 2LVAA 5JI2E 1ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQY E;  2JY6 B;  2ZTC A;  3B89 A;  1ZMW A;  1QZE A;  1MN3 A;  1XXH E;  2CP8 A;  1T6O A;  2OO9 A;  4DBG B;  3MMP A;  1CUK A;  2HWJ A;  4HEO A;  3GLH E;  2H5X A;  2JZ0 A;  2R0I A;  2KNA A;  2QNJ A;  1T43 A;  1E94 E;  1OAI A;  2JY5 A;  1R4G A;  2DAM A;  1VEG A;  3GLG E;  2OOA A;  2JY7 A;  2ZTD A;  2LBC A;  2DI0 A;  2G3Q A;  1G41 A;  1HT2 E;  3E21 A;  2KNV A;  1C7Y A;  2LTU A;  1UFZ A;  2MGW A;  1WR1 B;  2OOB A;  2JNH A;  1NV9 A;  1JR3 E;  1VEJ A;  2B3T A;  2K0B X;  1P3Q Q;  1HJP A;  1V92 A;  1OTR A;  1DO0 A;  2DAE A;  2JP7 A;  1KYI A;  2LVP C;  4GEW A;  2JY8 A;  5DFL A;  2QHO B;  2QSF X;  1WHC A;  1HT1 E;  1WGN A;  4F2L A;  3FRI A;  2DKL A;  1G3I A;  2O25 A;  1PGY A;  2MRO B;  1XB2 B;  3K9P A;  1TR8 A;  1VQ1 A;  1OKS A;  2DAK A;  1IXS A;  2LVO C;  3FE3 A;  1A5T A;  2EKK A;  2DAG A;  2DAI A;  1EFU B;  2LVN C;  2HAK A;  1Y8G A;  3H4J A;  2BWE A;  3IEC A;  1BVS A;  2KNZ A;  3K9O A;  1F4I A;  4Q7J A;  4R71 A;  1VG5 A;  2MJ5 B;  2L4E A;  1WIV A;  1VDL A;  2WZJ A;  3T6P A;  1YLA A;  1SG9 A;  2K9D A;  2BWB A;  1IM2 A;  3GLF E;  3GLI E;  2RRU A;  1DV0 A;  3LCV B;  2LVQ D;  3LCU A;  1WGL A;  1DO2 A;  1Q02 A;  1TTE A;  2L2D A;  2MR9 A;  2EJS A;  1NV8 A;  2DHY A;  2CWB A;  2KHH A;  1GO5 A;  2L4F A;  1AIP C;  1G4A E;  3E46 A;  2JZ1 A;  3IHP A;  3FRH A;  4WP2 A;  3BBZ A;  1IFY A;  1VEK A;  1ZV1 A;  2DNA A;  3F92 A;  4F1I A;  1ZMV A;  1WJ7 A;  2JUJ A;  4UN2 B;  1OQY A;  2DZL A;  2EKF A;  4G3O A;  2DEN A;  2LVA A;  5JI2 E;  1ZMU A; 
#chains in the Genus database with same CATH topology
 1G71 A;  3HU2 A;  4QHT A;  1H6U A;  4DV7 M;  4B3T M;  1IY0 A;  1MN3 A;  1IXS B;  3GRR A;  1R7R A;  4HL4 A;  3U60 B;  2CP8 A;  2VF8 A;  3J27 B;  3KVW A;  5IZ7 D;  2DZN B;  3WHL A;  1IY1 A;  3AOE C;  2R0I A;  3QWL A;  4B3S M;  1SXJ E;  2CHG A;  2QPA A;  1JR3 D;  3T1H M;  2DAM A;  4YY3 M;  4LJA A;  1GLN A;  3KFU G;  1R5L A;  3SAU A;  4AG6 A;  2KXE A;  4FCT A;  4FW9 A;  3W0F A;  2CHV A;  3I04 M;  2JWS A;  2LBC A;  2R4J A;  4BLC A;  4X66 M;  4IBI A;  3GPP A;  1HR0 M;  3WHK A;  2ERC A;  3B7Z A;  3ZCB B;  1JQJ C;  1HT2 E;  4GKJ M;  2LTU A;  1TF0 B;  4IIW A;  4B7H A;  3EIH A;  3M0E A;  2KEB A;  4OVZ B;  5LMU M;  3GPY A;  3JAM S;  2B3T A;  3J7A S;  1AUA A;  4KHP M;  1HJP A;  1V92 A;  3U6M A;  2I7P A;  1OTR A;  3HU3 A;  2CUZ A;  1XC8 A;  3FD9 A;  3PNV A;  2BJV A;  4GMQ A;  1YSY A;  4G4O A;  5BR8 M;  3U5Z A;  3LQQ A;  1K82 A;  4AKH A;  2JY8 A;  5C18 A;  2R62 A;  2QHO B;  2QP9 X;  2QSF X;  3T38 A;  1NY5 A;  1N78 A;  1HT1 E;  1QAM A;  2G8L A;  3FUT A;  3IG8 A;  4F2L A;  3FRI A;  3GRY A;  4KOD A;  4DV0 M;  3SAS A;  2Z4R A;  3AL0 C;  2P5T A;  2K47 A;  2ZAO A;  2YQZ A;  1KFV A;  2X4A A;  1NHW C;  5KPT A;  1G8P A;  4LGY A;  4D82 A;  3U5Z B;  3U6L A;  1IXS A;  4GIT A;  4NL4 H;  5DYG A;  2BNK A;  5EP4 A;  2MH8 A;  1ZAE A;  2DAG A;  2LVN C;  2F5P A;  2XSZ D;  2R46 A;  1Y8G A;  4CHT B;  4LF4 M;  4ZPX A;  4RNA A;  2M5Z A;  4CIZ A;  5EXP A;  2L7H A;  4OVZ A;  2KNZ A;  4AKG A;  4JI5 M;  4JI7 M;  2E5L M;  4JI0 M;  1ZQ9 A;  4JYA M;  3FYD A;  4QNM A;  4MH0 E;  1GL6 A;  1IQP A;  2N35 A;  3A45 A;  1L1Z A;  1SXJ D;  2L4E A;  1VDL A;  3I51 A;  1YLA A;  3T6P A;  3VLF B;  4GHA A;  4TUW A;  2OQ4 A;  5KPR A;  3A42 A;  3GLF E;  4DR4 M;  4AZF A;  2CRU A;  3KS4 A;  1N36 M;  3U6O A;  1TGU A;  2FE8 A;  1WGL A;  4NRV A;  4L78 A;  1TTE A;  2LXE A;  3FTC A;  1S3S A;  3CGW A;  3AKZ A;  2HL7 A;  2VQE M;  4NOO B;  2XF3 A;  3C3E A;  1NJF A;  1T3T A;  1Z6T A;  2JZ1 A;  3E46 A;  3IHP A;  4MGY E;  4D81 A;  2XZU A;  5IWA M;  2DWL A;  2KDL A;  1SXJ C;  1ZV1 A;  2DNA A;  3L2A A;  1PJJ A;  3CTW B;  1SXJ B;  4REZ A;  2DWZ B;  5KQ8 A;  3D8L A;  3ZC7 B;  4QOZ C;  4XK8 F;  4R3D A;  4XBO A;  2DVW B;  2QEN A;  1OIZ A;  1Q3B A;  3ZQJ A;  2DEN A;  1V34 A;  1XMO M;  2LVA A;  1ORY B;  2D7E A;  4LF7 M;  2O01 F;  4PT5 A;  5EXS A;  2R65 A;  3GO8 A;  3B89 A;  1ZMW A;  3W67 A;  3GPU A;  5EP3 A;  1XXH E;  2OO9 A;  1GKI A;  3AOG A;  4LJ7 A;  3V76 A;  4ANR A;  4MM3 B;  1N32 M;  5IRE B;  3H4M A;  2ZM6 M;  2HCB A;  3M6A A;  2JZ0 A;  1OAO C;  1QDT A;  1WXQ A;  1NSF A;  2KNA A;  4GC9 A;  4LZJ A;  1N34 M;  2G5G X;  3LMM A;  1E94 E;  2UXC M;  3KOX E;  1R4G A;  2FNA A;  5GKN A;  1VEG A;  1L2C A;  1N75 A;  2ZTD A;  1TH3 A;  3W0L B;  2YNM D;  4LFB M;  3UMM A;  2J7N A;  1MU5 A;  4NSO B;  4FCW A;  3E21 A;  2KNV A;  3SHF A;  4DV1 M;  2RKO A;  1OJL A;  1J5E M;  4I5S A;  3VK8 A;  1WR1 B;  4LF9 M;  2OOB A;  1NHG C;  8CAT A;  2C99 A;  5EQT A;  1JR3 E;  4PDI A;  2F5Q A;  1Q39 A;  3KXE C;  1VEJ A;  2DZO B;  3NBX X;  2KRK A;  4L6V 6;  4MB7 A;  4MGI E;  3U6E A;  4M9Z A;  2LVP C;  1OFI A;  1KYI A;  2EO2 A;  4CGY B;  1IN7 A;  4GEW A;  3L27 A;  5DFL A;  2X8A A;  3PNY A;  1WHC A;  3U6S A;  1E9R A;  1L8Q A;  1NY6 A;  1WGN A;  3LW5 F;  1JR3 A;  1NO1 A;  2XH9 A;  3E9S A;  4DR5 M;  3FTE A;  1QYR A;  1Z59 A;  1IN8 A;  3LQR A;  5E26 A;  2OPF A;  3VDP A;  4KT0 F;  2C9C A;  3R9X B;  3FE3 A;  3DA1 A;  3MK6 A;  3SAT A;  2FS1 A;  4I4L A;  4NRW A;  2DAI A;  4LZZ A;  1TDZ A;  3PFI A;  2BWE A;  2XEP A;  3KSJ A;  1TDH A;  2M60 A;  2KRU A;  4W5W A;  5KPZ A;  2JXN A;  4LY6 A;  4WW0 A;  4DR1 M;  4I81 A;  3HX3 A;  4JN6 A;  1WIV A;  4Z8X A;  1QVR A;  4DV3 M;  3FKE A;  2K9D A;  2O5R A;  3HJS A;  3GLG A;  2VF7 A;  2BWB A;  2Q2E B;  3KOW E;  3LVW A;  2Z3X A;  1HNW M;  2XFS A;  2R6F A;  3K92 A;  4OX9 M;  4GC5 A;  4LFA M;  3U60 A;  4RKU F;  3VKG A;  4LJ9 A;  3HHY A;  3U6P A;  4JI8 M;  1Q3C A;  3GRV A;  3GLF A;  1Q02 A;  1XXH B;  3BOS A;  5A2Q S;  1NNJ A;  1K3X A;  5ITU A;  2DHY A;  4AI6 A;  2CWB A;  3HZJ A;  5E6J A;  1DGH B;  5FTK A;  3VDU A;  2Y0Q A;  1AIP C;  5ITY A;  1IXR C;  3CF6 E;  3PXG A;  3FRH A;  2R18 A;  2R44 A;  2RGO A;  2FH0 A;  3BBZ A;  3GLF B;  1R2Y A;  4JI6 M;  3F92 A;  2FOI C;  4B3R M;  2QBY B;  3R8F A;  4QHS A;  1WJ7 A;  2GNO A;  2FFJ A;  4UN2 B;  1NNU C;  2DZL A;  2EKF A;  2KZS A;  1PJS A;  2WSE F;  4KLN A;  4LGM A;  3A98 B;  3AFH A;  3UGJ A;  1NVM A;  1QAN A;  1D0M A;  5JI2 E;  4DR2 M;  1ZMU A;  4KO8 A;  3L28 A;  4FWD A;  4IJF A;  3QYB A;  5EXT A;  1HQY E;  2DHR A;  1TH2 A;  3UJN A;  1QZE A;  3B7Q A;  3NBI A;  2XSZ A;  3J80 S;  3MMP A;  1DGF A;  4HEO A;  3SYK A;  3GLH E;  3KOZ E;  3L26 A;  3D8B A;  4IBG A;  4DR3 M;  2QNJ A;  1QQW A;  2JY5 A;  1IBM M;  1XMQ M;  3JR5 A;  4GIP A;  1G59 A;  4B3M M;  2QCU A;  3DFZ A;  3GLG E;  4FWH A;  4DUY M;  2LNH C;  2XGN A;  3HHX A;  2DI0 A;  4AW4 A;  5ITT A;  4G4R A;  4X64 M;  1C7Y A;  2MGW A;  1N33 M;  2H1R A;  3GLH A;  4PDG A;  3GQ5 A;  3SYL A;  3FUX A;  4FVM A;  1IY2 A;  1R6B X;  1KSF X;  3CF2 A;  5JI3 E;  5KQD A;  3U61 A;  3AJI B;  3SMP A;  4QOS A;  1QUT A;  1FJG M;  1Z5B A;  3GLH B;  4QNR A;  4A3V B;  3PVS A;  1E9S A;  4DV6 M;  3HY5 A;  4AKI A;  1TH4 A;  2K0B X;  5DYI A;  3TPZ A;  1C1K A;  1QAQ A;  3AV0 A;  1QDR A;  2DAE A;  2RGH A;  5F3W A;  3I4V A;  4CIS A;  4GHL A;  3TQS A;  4IBJ A;  1W5S A;  4LF5 M;  2CHQ A;  1EIJ A;  2DKL A;  1G3I A;  3CF0 A;  5ITR A;  2WSF F;  2R45 A;  2MRO B;  2V6Z M;  4X62 M;  2J5Y A;  4L8R C;  1Z5A A;  4G4N A;  5FTN A;  2R4E A;  1TR8 A;  2JA2 A;  1VQ1 A;  3LVV A;  2DAK A;  4MGZ E;  2LVO C;  4NSR A;  4YHH M;  4LG2 A;  1A5T A;  3BXW A;  2LHG A;  2UUC M;  3FUW A;  3TWK A;  2EKK A;  2NQ8 C;  1EFU B;  1MX0 A;  3QAU A;  2F5N A;  1PJT A;  3H4J A;  3TE6 A;  2YR0 A;  3IEC A;  3U6Q A;  4G4Q A;  3U6D A;  3U61 B;  3K9O A;  3C9P A;  3NWL A;  4PCZ A;  4GH9 A;  4LCB A;  4Q7J A;  4MGK E;  4RF0 A;  3UZU A;  4BBA A;  3FUV A;  2CFO A;  2C96 A;  3GLI A;  5IT9 S;  4I8O A;  1IN4 A;  4DUZ M;  1PM5 A;  2WZJ A;  3GPX A;  2ZBK B;  2CV0 A;  4LFC M;  3TWL A;  1XNR M;  4M0D A;  4JI4 M;  1IM2 A;  4NXN M;  2RRU A;  4LRS A;  5L8R F;  2Y0T A;  1DV0 A;  2F5O A;  2XFT A;  4D80 A;  5EXX A;  1SXJ A;  4P16 A;  5BPV A;  3HKP A;  1L1T A;  2KW0 A;  4LJ6 A;  4JI2 M;  3M7G A;  3GRU A;  5C1B A;  1GVN A;  4CJ6 A;  1D0K A;  1XXH A;  3RGP A;  2MR9 A;  2L2D A;  2LH0 A;  4M0W A;  4XGI A;  3QYE A;  4M9X A;  3KS8 A;  4IBF A;  2KHH A;  1GJS A;  2J7O A;  1GAB A;  1GO5 A;  3K1J A;  3SHG B;  1G4A E;  1EE8 A;  4WP2 A;  1J7K A;  1DGG A;  1XWI A;  3GLG B;  3T1Y M;  2CEA A;  2GQF A;  2YFQ A;  1VEK A;  4L15 A;  3TWM A;  2XLJ A;  2UU9 M;  1ZMV A;  3E4R A;  3I4Y A;  4FD2 A;  3VKH A;  3KSX A;  3C3D A;  1V33 A;  2AHM A;  4MGH A;  1I94 M;  4GRI A;  1IBL M;  4DV5 M;  3HJ8 A;  2UUB M;  4G3O A;  2QBY A;  5FTL A;  1VDD A;  2KZU A;  2C98 A;  2D7G A;  4NXM M;  2LWX A;  4BB9 A;  2JY6 B;  4IBK A;  1DGH A;  2ZTC A;  4GKK M;  3DZD A;  5ITQ A;  1DGB A;  4B7G A;  1IN6 A;  3SBJ A;  1T6O A;  2Z8Y M;  4DBG B;  3OTO M;  2APL A;  2CE7 A;  3KP0 E;  2EUC A;  1CUK A;  1MJG M;  2HWJ A;  3U6C A;  4AQY M;  2H5X A;  3Q8X A;  1HQC A;  4Z6Y A;  4IJE A;  3FTD A;  1T43 A;  1OAI A;  4K0K M;  1D0L A;  3GLI B;  2QZ4 A;  2QQ8 A;  3HJQ A;  3UK6 A;  2OOA A;  3HWS A;  5ITX E;  4RF1 A;  2JY7 A;  2VII A;  2HKJ A;  2Y21 A;  3KW6 A;  4G6Z A;  5FTJ A;  4EIW A;  1HNX M;  4LF6 M;  3KDS E;  2CV1 A;  3HHZ A;  2K6B A;  3RFW A;  2G3Q A;  3W68 A;  1G41 A;  5FTM A;  1N77 A;  2UXB M;  1OIP A;  4AG5 A;  1UFZ A;  3C58 A;  2LHC A;  2L09 A;  4JV5 M;  2F5S A;  4S12 A;  2JNH A;  3B9P A;  1NV9 A;  1J09 A;  1JB0 F;  2F4V M;  1XHB A;  4R7G A;  1QUS A;  4L16 A;  3MHV C;  2D7H A;  1IN5 A;  1P3Q Q;  2DWN A;  1Z5C A;  1DO0 A;  5DNY A;  2JP7 A;  3I01 M;  4LJ5 A;  3SAV A;  4ITQ A;  7CAT A;  1FNN A;  4LRT A;  4IBC A;  4FCV A;  4L4U A;  2C9O A;  4DR7 M;  2A5Y B;  2O25 A;  2V1C A;  1PGY A;  1YUB A;  1LTM A;  1PRB A;  5LMN M;  2ZAN A;  2XZF A;  1XB2 B;  3K9P A;  3KP1 E;  1D2N A;  3RE8 A;  5H37 D;  1E32 A;  1GL7 A;  3L29 A;  1OKS A;  2ZAM A;  3JR4 A;  3FUU A;  3K2L A;  3B7N A;  4P17 A;  5KO3 A;  2C5R A;  2KA6 B;  3THG A;  3AOE A;  3SAW A;  3FYC A;  4DV2 M;  1UM8 A;  1NJG A;  1HNZ M;  3MJ5 A;  2VQF M;  2HAK A;  1OFH A;  3IG5 A;  2X49 A;  2DWM A;  1XNQ M;  3EIE A;  4OW0 A;  3B74 A;  1BVS A;  1F4I A;  3SAR A;  3HGI A;  4B7F A;  1PJQ A;  4R71 A;  2UXD M;  4HLQ A;  1VG5 A;  2MJ5 B;  3GQ3 A;  1PJI A;  2Y20 A;  4IBB A;  1QZM A;  4NC6 A;  1SG9 A;  4WUR A;  4X65 M;  3L25 A;  4LF8 M;  1I4W A;  2W82 A;  3GLI E;  3KOY E;  3DOA A;  3LCV B;  3GP1 A;  2DXI A;  2LVQ D;  5EP2 A;  1YE9 A;  2Z7J A;  3LCU A;  2WSC F;  3SFZ A;  4M9S A;  3J81 S;  1DO2 A;  2I7N A;  4OU7 A;  4JXJ A;  3GQ4 A;  3TL4 X;  2EA0 A;  2EJS A;  1IXZ A;  1RU3 A;  2Z4S A;  1NV8 A;  3HU1 A;  3J2P B;  4II7 A;  1L2B A;  1IBK M;  1GJT A;  4PD2 A;  4IBE A;  1QAO A;  1W5T A;  4B08 A;  2L4F A;  4Y28 F;  4LJ8 A;  2V1U A;  3ILK A;  1LV7 A;  1IFY A;  3RGS A;  2CV2 A;  1K3W A;  3ZH9 B;  3FTF A;  1R2Z A;  3A46 A;  4F1I A;  3VK7 A;  5ITX A;  5FSW A;  2VDB B;  5EJC A;  3SC3 A;  5EP1 A;  2JUJ A;  2L7I A;  3J7B A;  1OQY A;  3VFD A;  4JI1 M;  2HHH M;  3SMS A;  1L2D A;  2L6O A;  3T15 A;  4JI3 M;  4FWG A;  3Q8G A;  3HHW A;  4DR6 M;  4LJ4 A;  3K8Z A;  4IBD A;  1X37 A;  4DV4 M;  2UUA M;  5FLX S;  2BJW A; 
#chains in the Genus database with same CATH homology
 1HQY E;  2JY6 B;  2ZTC A;  3B89 A;  1ZMW A;  1QZE A;  1MN3 A;  1XXH E;  2CP8 A;  1T6O A;  2OO9 A;  4DBG B;  3MMP A;  1CUK A;  2HWJ A;  4HEO A;  3GLH E;  2H5X A;  2JZ0 A;  2R0I A;  2KNA A;  2QNJ A;  1T43 A;  1E94 E;  1OAI A;  2JY5 A;  1R4G A;  2DAM A;  1VEG A;  3GLG E;  2OOA A;  2JY7 A;  2ZTD A;  2LBC A;  2DI0 A;  2G3Q A;  1G41 A;  1HT2 E;  3E21 A;  2KNV A;  1C7Y A;  2LTU A;  1UFZ A;  2MGW A;  1WR1 B;  2OOB A;  2JNH A;  1NV9 A;  1JR3 E;  1VEJ A;  2B3T A;  2K0B X;  1P3Q Q;  1HJP A;  1V92 A;  1OTR A;  1DO0 A;  2DAE A;  2JP7 A;  1KYI A;  2LVP C;  4GEW A;  2JY8 A;  5DFL A;  2QHO B;  2QSF X;  1WHC A;  1HT1 E;  1WGN A;  4F2L A;  3FRI A;  2DKL A;  1G3I A;  2O25 A;  1PGY A;  2MRO B;  1XB2 B;  3K9P A;  1TR8 A;  1VQ1 A;  1OKS A;  2DAK A;  1IXS A;  2LVO C;  3FE3 A;  1A5T A;  2EKK A;  2DAG A;  2DAI A;  1EFU B;  2LVN C;  2HAK A;  1Y8G A;  3H4J A;  2BWE A;  3IEC A;  1BVS A;  2KNZ A;  3K9O A;  1F4I A;  4Q7J A;  4R71 A;  1VG5 A;  2MJ5 B;  2L4E A;  1WIV A;  1VDL A;  2WZJ A;  3T6P A;  1YLA A;  1SG9 A;  2K9D A;  2BWB A;  1IM2 A;  3GLF E;  3GLI E;  2RRU A;  1DV0 A;  3LCV B;  2LVQ D;  3LCU A;  1WGL A;  1DO2 A;  1Q02 A;  1TTE A;  2L2D A;  2MR9 A;  2EJS A;  1NV8 A;  2DHY A;  2CWB A;  2KHH A;  1GO5 A;  2L4F A;  1AIP C;  1G4A E;  3E46 A;  2JZ1 A;  3IHP A;  3FRH A;  4WP2 A;  3BBZ A;  1IFY A;  1VEK A;  1ZV1 A;  2DNA A;  3F92 A;  4F1I A;  1ZMV A;  1WJ7 A;  2JUJ A;  4UN2 B;  1OQY A;  2DZL A;  2EKF A;  4G3O A;  2DEN A;  2LVA A;  5JI2 E;  1ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...