2DAMA

Solution structure of the novel identified uba-like domain in the n-terminal of human etea protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human ETEA Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ETEA protein
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2damA00
2LBCA 3E21A 4HEOA 2H5XA 1OQYA 2DAGA 2LVPC 2WZJA 1WGNA 3K9PA 4GEWA 1ZV1A 2DAEA 2MJ5B 2JY6B 1XB2B 2DI0A 1TR8A 2KNZA 1P3QQ 2RRUA 3IHPA 2HWJA 2DKLA 3GLFE 1WR1B 4F2LA 1A5TA 2JY7A 2OO9A 3E46A 2EJSA 1VDLA 2QNJA 5JI2E 3K9OA 1TTEA 1VEJA 2DENA 1DO2A 4DBGB 1Y8GA 2R0IA 1HT2E 1T43A 1OTRA 1QZEA 4F1IA 1SG9A 1WJ7A 1WIVA 1DO0A 4G3OA 2JUJA 1OAIA 2DHYA 2O25A 1NV9A 2CWBA 1HJPA 2L4EA 3BBZA 3F92A 3GLHE 1T6OA 2OOBA 1G41A 2L4FA 1NV8A 3FE3A 3B89A 2DZLA 1YLAA 3MMPA 3LCVB 3LCUA 2K9DA 1G4AE 1CUKA 1V92A 2G3QA 3H4JA 2JY5A 2QHOB 2BWBA 1OKSA 1HT1E 1BVSA 1IXSA 2MROB 2MGWA 1IFYA 1EFUB 1VEGA 1C7YA 1WGLA 1WHCA 4R71A 2JY8A 2BWEA 2B3TA 2DAIA 5DFLA 2JZ1A 1VQ1A 1F4IA 3IECA 1XXHE 1DV0A 2LTUA 2KNVA 1AIPC 2ZTCA 2DAKA 2L2DA 2LVQD 2QSFX 2LVOC 1ZMVA 2DNAA 1PGYA 1HQYE 1E94E 2LVNC 3FRIA 1UFZA 2KHHA 3GLGE 1JR3E 1MN3A 2EKKA 2LVAA 1Q02A 1ZMWA 2OOAA 4UN2B 4WP2A 1IM2A 1VEKA 1ZMUA 4Q7JA 3GLIE 1KYIA 2JP7A 2JZ0A 2KNAA 2ZTDA 3T6PA 2DAMA 2JNHA 1G3IA 2EKFA 1R4GA 1GO5A 2CP8A 3FRHA 2MR9A 2K0BX 2HAKA 1VG5A
chains in the Genus database with same CATH superfamily
2XFTA 1K82A 4CISA 1N75A 2K47A 3VDPA 3SAVA 1H6UA 1OQYA 1GJTA 2WZJA 4DUYM 4GEWA 1R5LA 4JI4M 2DAEA 1ZQ9A 1N32M 1PJSA 2G8LA 2KDLA 2R65A 4NSRA 2DI0A 2XLJA 1S3SA 2EUCA 2H1RA 4PDIA 3HHZA 3CF2A 2KNZA 3IHPA 2ZBKB 5FLXS 1QVRA 1A5TA 2OO9A 5ITQA 1OFHA 1J5EM 1YUBA 4M0DA 5ITXE 2FE8A 5C18A 3I4VA 3W0FA 4JI5M 5JI2E 5EXSA 1IQPA 4JYAM 4DV5M 3HJ8A 3ZH9B 1EIJA 5ITXA 4RF0A 1JB0F 4DBGB 4M0WA 3GLIB 1I94M 3KS4A 2R0IA 3B74A 1GLNA 3MHVC 3RE8A 1G59A 2JA2A 5EQTA 2CUZA 1SG9A 1WIVA 1J7KA 1Z6TA 1OAIA 4Y28F 2DHYA 2C9CA 4MH0E 4DV0M 1NV9A 3QWLA 1IXRC 2QPAA 2C5RA 3KVWA 1QAMA 4D81A 5ITTA 1SXJC 3V76A 3KSXA 1QDTA 2F5NA 1T6OA 4LFBM 4HL4A 1QAQA 2OPFA 3R9XB 1G41A 2QP9X 3SFZA 3B89A 3HZJA 4KODA 3I51A 3FYCA 3KXEC 4B7FA 3GQ3A 5EXTA 2F5PA 2R18A 3DOAA 3LVVA 2YQZA 1G4AE 3L29A 1N33M 1L1ZA 1V92A 2LHGA 3SYKA 4MGKE 4AG5A 1OKSA 1XWIA 4LJ4A 1VDDA 1IXSA 2MROB 2LHCA 3K2LA 4PD2A 3SHFA 1DGHB 4NL4H 1EFUB 5GKNA 1C7YA 2R4EA 2D7EA 3L2AA 3CF6E 3KP1E 5EP1A 3GPUA 2QQ8A 3HY5A 1Z5CA 4R71A 1FJGM 4QOZC 2BJVA 1Z5BA 2JZ1A 4LZJA 3UJNA 3GLGA 1GL6A 3J2PB 1GKIA 1ZAEA 3U61B 3VDUA 4MM3B 2DVWB 3PVSA 3J27B 1Z5AA 2ZTCA 3VLFB 4HLQA 1IBMM 1TH2A 1D2NA 2F4VM 1C1KA 3T38A 2F5OA 2QSFX 4FWGA 3AKZA 1ZMVA 3KS8A 3HHYA 2CE7A 3D8LA 2ZM6M 3KW6A 4ITQA 1K3WA 4LZZA 1DGHA 2KHHA 2VF7A 3THGA 5DYGA 4KHPM 4GMQA 5IREB 1MN3A 3IG5A 5KPRA 4EIWA 4PCZA 4JI3M 1GJSA 2HCBA 3DFZA 4DV3M 2Z4SA 3KP0E 3NBIA 2LVAA 3GRYA 5IZ7D 2R4JA 1N78A 3KOZE 1IM2A 5LMNM 1ZMUA 2L7IA 2NQ8C 1KYIA 3W0LB 2JP7A 1PJTA 1IY2A 2J5YA 2JZ0A 4B08A 2HHHM 5FTKA 4YY3M 4IBDA 4LY6A 2GNOA 5C1BA 1HNXM 2QENA 2XZUA 1GO5A 4G4NA 4OVZA 2CP8A 4AQYM 2RKOA 1IXZA 3D8BA 1V34A 1I4WA 2V6ZM 2WSEF 1L2CA 4LF5M 3SHGB 3A45A 3B7ZA 4LFAM 2H5XA 1MU5A 2Y0QA 2LVPC 2VQFM 1XXHB 1LV7A 1TR8A 2KXEA 1QQWA 1P3QQ 2HWJA 5FSWA 1WR1B 1N34M 4DR3M 5EXXA 3SMPA 4F2LA 1QDRA 2EJSA 3ZQJA 7CATA 4NXMM 1VDLA 1DGBA 2KZUA 2BJWA 4DR4M 1NY6A 2KRKA 5KQDA 1V33A 4X62M 3U6MA 1DO2A 3GRVA 4M9ZA 4LF8M 4AI6A 4DV6M 3C58A 1Y8GA 1DGFA 1HT2E 5EP4A 5KPZA 2CV0A 1MX0A 4L6V6 1GABA 2R62A 1OTRA 4F1IA 2DWLA 4LCBA 1OIPA 4CIZA 3RGPA 3TL4X 2M60A 5ITRA 2JUJA 5KPTA 1QYRA 2FS1A 1G71A 3U6CA 3SAUA 4FVMA 3WHKA 4DUZM 3VFDA 3GO8A 4X65M 4BLCA 3SAWA 1Q3CA 2CEAA 3DA1A 4FCWA 3R8FA 1NHGC 3UZUA 2O01F 2VIIA 2OOBA 2QZ4A 1DGGA 2L4FA 1L8QA 4LGMA 1PM5A 5EXPA 3MMPA 3T1HM 1QAOA 3GPPA 2XF3A 1R6BX 3AOGA 1KFVA 2K9DA 3L26A 4W5WA 2QCUA 1E32A 1SXJA 1TDHA 3VKHA 2P5TA 2BWBA 2QHOB 3JR4A 4FW9A 1IN8A 3GQ4A 2QBYB 3KDSE 3L25A 4GKJM 1IY0A 1PRBA 1IFYA 1VEGA 1GVNA 1KSFX 3K1JA 3U5ZA 2JY8A 3RFWA 4RF1A 3FTCA 3C3DA 1VQ1A 2C96A 4P16A 2DWZB 3BXWA 3RGSA 4AW4A 4JV5M 5DNYA 2JWSA 1FNNA 1WXQA 2UUAM 1AIPC 1W5TA 3HHWA 2FOIC 3HGIA 5FTLA 3CTWB 3ILKA 2LVQD 2GQFA 1NVMA 1IN6A 2RGHA 3T15A 4GIPA 1JQJC 3HU1A 4OW0A 1JR3A 2L09A 4QHTA 4MB7A 2DWNA 1E94E 4B7HA 4B3SM 2CRUA 4LFCM 3FRIA 4JI0M 2AHMA 2UUCM 3M7GA 5KQ8A 1UM8A 4L78A 3GLGE 4A3VB 2EA0A 1N77A 4GC9A 4K0KM 3EIEA 3VK7A 3K8ZA 4ANRA 3K92A 4D82A 3FYDA 4JN6A 1ZMWA 2OOAA 4WP2A 3W68A 1NO1A 2V1CA 2Z8YM 2OQ4A 3QYEA 3EIHA 5IT9S 5DYIA 4G4RA 4R7GA 3PNVA 3T6PA 3HWSA 2JNHA 2L7HA 1G3IA 4WW0A 3JR5A 2C98A 4RKUF 2K6BA 1E9RA 2I7NA 2CV1A 4IBIA 2CHGA 3GLHA 3MJ5A 4I81A 1Q3BA 1NSFA 4I5SA 1XMQM 4LJAA 5F3WA 3KOYE 4REZA 2MH8A 2J7NA 3K9PA 1ORYB 2C99A 2X4AA 3LVWA 2JY6B 1XB2B 4MGZE 3GLIA 2WSCF 4II7A 3IG8A 2DXIA 1JR3D 2RRUA 3VK8A 2DKLA 3J7BA 4KO8A 3AJIB 2BNKA 1R2ZA 4M9XA 4GKKM 1D0KA 2XGNA 8CATA 2F5QA 2QNJA 4LF6M 4IBFA 3FUWA 2KA6B 4G6ZA 3E4RA 4GH9A 3TWKA 2WSFF 3UMMA 3FTDA 1Q39A 1XNQM 4G4OA 2Y21A 2G5GX 3SARA 5H37D 3CGWA 1WJ7A 3J80S 2LWXA 3TE6A 1NJFA 1YSYA 3A42A 4G3OA 4MGHA 3U6SA 1IXSB 5L8RF 3AFHA 2O25A 3MK6A 4NXNM 1N36M 1K3XA 3FKEA 2CWBA 1XMOM 1OFIA 4MGYE 1TH3A 2FH0A 4X66M 1NNUC 1TDZA 2C9OA 2L4EA 3BBZA 4GRIA 1PJJA 3GLHE 2ZAOA 3J81S 2KEBA 2JXNA 3HX3A 3AOEA 3NBXX 3ZC7B 1NV8A 2VF8A 4B7GA 1OJLA 1IY1A 1IN4A 1E9SA 2A5YB 4JI2M 4IJFA 3TPZA 3ZCBB 4GC5A 4MGIE 5FTMA 4CGYB 4NSOB 2E5LM 3SMSA 1D0MA 2LNHC 4I4LA 1RU3A 4GHAA 2G3QA 3B7QA 3H4JA 4LF9M 3J7AS 3T1YM 2V1UA 1R7RA 4M9SA 1HT1E 2Z7JA 1BVSA 3HU3A 5ITYA 2Z4RA 4DR2M 3LMMA 2VDBB 1QUTA 1XHBA 1WGLA 1WHCA 3AL0C 2BWEA 2Q2EB 2DZOB 1OIZA 5DFLA 2XFSA 1F4IA 1QZMA 2Z3XA 2CV2A 4LF7M 2J7OA 3HHXA 4FWHA 1NHWC 3SATA 1XXHE 4FCVA 1DV0A 2FFJA 4G4QA 4B3TM 2LTUA 2APLA 3LQRA 3QYBA 2DAKA 2L2DA 4QNRA 2DHRA 2HL7A 3FUVA 2UXCM 3VKGA 5LMUM 2EO2A 2N35A 4QHSA 4D80A 2LVOC 3M6AA 4DV2M 4L16A 3GPYA 4TUWA 1PGYA 1HQYE 2UXBM 1Z59A 2DZNB 4LRTA 1UFZA 3DZDA 4DV4M 3U6QA 4AG6A 1HQCA 1NNJA 3C3EA 1HR0M 1G8PA 3TQSA 1LTMA 2D7GA 2EKKA 2W82A 3BOSA 4LJ6A 1J09A 4WURA 5ITUA 3U6EA 2CHVA 5EJCA 2LH0A 3GLFB 4GITA 1VEKA 5E26A 3UK6A 4QOSA 4Q7JA 2LXEA 2X49A 3GQ5A 3FUTA 4IBJA 4Z6YA 2ZTDA 3GLIE 4NC6A 4B3MM 3H4MA 4XGIA 1PJIA 4NRVA 1R4GA 3A98B 4NRWA 2M5ZA 1HNZM 1HNWM 5E6JA 2X8AA 4LJ9A 2ERCA 2MR9A 2LVNC 3SC3A 2HAKA 1VG5A 2DWMA 2LBCA 3E21A 1R2YA 4HEOA 4JI1M 3C9PA 1EE8A 2DAGA 4YHHM 3B7NA 1WGNA 1PJQA 3E9SA 1ZV1A 1TGUA 2MJ5B 4S12A 2QBYA 4DR1M 2CHQA 3GLHB 2F5SA 3HU2A 4IJEA 3PNYA 2Y20A 2ZAMA 3FTFA 3GLFE 3GPXA 2KRUA 3PXGA 2JY7A 3E46A 3KOWE 1MJGM 3LQQA 2UUBM 3L28A 2XH9A 4PDGA 4R3DA 4IBGA 1QANA 2O5RA 4FD2A 4AZFA 3K9OA 1TTEA 1VEJA 2DENA 1W5SA 2YNMD 4IBEA 1NY5A 1OAOC 4P17A 4LGYA 1IN5A 3I4YA 5FTJA 4FWDA 4I8OA 3TWMA 3U60B 4L15A 1YE9A 1T43A 3GP1A 4AKGA 3HJSA 1TF0B 4PT5A 2Y0TA 1SXJB 2VQEM 3FUXA 1QZEA 4L4UA 2R46A 3A46A 4DV7M 2CFOA 4LJ7A 3OTOM 3SBJA 4DR5M 1DO0A 2YFQA 3QAUA 4JXJA 3LW5F 4LJ5A 5EP3A 4CJ6A 3HJQA 1D0LA 4OX9M 1QUSA 2R44A 1HJPA 3SASA 2UXDM 1L2DA 4Z8XA 2KW0A 3F92A 2ZANA 4AKIA 2YR0A 1IBKM 2XSZA 3FE3A 3FUUA 1T3TA 5EP2A 4IIWA 2DZLA 4XK8F 1YLAA 4OVZB 3KFUG 4DR7M 3LCVB 3LCUA 3GRUA 5JI3E 5A2QS 3PFIA 4RNAA 3I04M 2XZFA 4L8RC 3FD9A 1CUKA 2R6FA 3HKPA 3NWLA 2JY5A 3AOEC 4IBCA 4JI8M 1X37A 3B9PA 3SYLA 4OU7A 2L6OA 2MGWA 4JI7M 4LF4M 3M0EA 3WHLA 4B3RM 4DV1M 1SXJD 4BB9A 2B3TA 2DAIA 1IN7A 3Q8GA 4IBKA 3W67A 1XNRM 2HKJA 3IECA 3TWLA 4BBAA 4QNMA 4JI6M 4FCTA 2KNVA 3I01M 4ZPXA 3U6OA 1AUAA 4X64M 4GHLA 4AKHA 4IBBA 4KT0F 4LJ8A 1L2BA 4DR6M 3U6LA 2DNAA 4KLNA 3AV0A 5BR8M 3GLGB 3U6DA 4CHTB 4LRSA 1GL7A 3CF0A 3FTEA 2FNAA 1IBLM 1JR3E 1XXHA 3U60A 3KSJA 3U6PA 3KOXE 3UGJA 1L1TA 1XC8A 1SXJE 1Q02A 4UN2B 2KZSA 1NJGA 4XBOA 3GRRA 4LG2A 2XEPA 3L27A 2KNAA 4NOOB 5FTNA 1TH4A 3U61A 2DAMA 2EKFA 5KO3A 2UU9M 2D7HA 2XSZD 5IWAM 3U5ZB 2R45A 2I7PA 5BPVA 3JAMS 3FRHA 3GLFA 2K0BX 3Q8XA 2RGOA
chains in the Genus database with same CATH topology
2LBCA 3E21A 4HEOA 2H5XA 1OQYA 2DAGA 2LVPC 2WZJA 1WGNA 3K9PA 4GEWA 1ZV1A 2DAEA 2MJ5B 2JY6B 1XB2B 2DI0A 1TR8A 2KNZA 1P3QQ 2RRUA 3IHPA 2HWJA 2DKLA 3GLFE 1WR1B 4F2LA 1A5TA 2JY7A 2OO9A 3E46A 2EJSA 1VDLA 2QNJA 5JI2E 3K9OA 1TTEA 1VEJA 2DENA 1DO2A 4DBGB 1Y8GA 2R0IA 1HT2E 1T43A 1OTRA 1QZEA 4F1IA 1SG9A 1WJ7A 1WIVA 1DO0A 4G3OA 2JUJA 1OAIA 2DHYA 2O25A 1NV9A 2CWBA 1HJPA 2L4EA 3BBZA 3F92A 3GLHE 1T6OA 2OOBA 1G41A 2L4FA 1NV8A 3FE3A 3B89A 2DZLA 1YLAA 3MMPA 3LCVB 3LCUA 2K9DA 1G4AE 1CUKA 1V92A 2G3QA 3H4JA 2JY5A 2QHOB 2BWBA 1OKSA 1HT1E 1BVSA 1IXSA 2MROB 2MGWA 1IFYA 1EFUB 1VEGA 1C7YA 1WGLA 1WHCA 4R71A 2JY8A 2BWEA 2B3TA 2DAIA 5DFLA 2JZ1A 1VQ1A 1F4IA 3IECA 1XXHE 1DV0A 2LTUA 2KNVA 1AIPC 2ZTCA 2DAKA 2L2DA 2LVQD 2QSFX 2LVOC 1ZMVA 2DNAA 1PGYA 1HQYE 1E94E 2LVNC 3FRIA 1UFZA 2KHHA 3GLGE 1JR3E 1MN3A 2EKKA 2LVAA 1Q02A 1ZMWA 2OOAA 4UN2B 4WP2A 1IM2A 1VEKA 1ZMUA 4Q7JA 3GLIE 1KYIA 2JP7A 2JZ0A 2KNAA 2ZTDA 3T6PA 2DAMA 2JNHA 1G3IA 2EKFA 1R4GA 1GO5A 2CP8A 3FRHA 2MR9A 2K0BX 2HAKA 1VG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBC A;  3E21 A;  4HEO A;  2H5X A;  1OQY A;  2DAG A;  2LVP C;  2WZJ A;  1WGN A;  3K9P A;  4GEW A;  1ZV1 A;  2DAE A;  2MJ5 B;  2JY6 B;  1XB2 B;  2DI0 A;  1TR8 A;  2KNZ A;  1P3Q Q;  2RRU A;  3IHP A;  2HWJ A;  2DKL A;  3GLF E;  1WR1 B;  4F2L A;  1A5T A;  2JY7 A;  2OO9 A;  3E46 A;  2EJS A;  1VDL A;  2QNJ A;  5JI2 E;  3K9O A;  1TTE A;  1VEJ A;  2DEN A;  1DO2 A;  4DBG B;  1Y8G A;  2R0I A;  1HT2 E;  1T43 A;  1OTR A;  1QZE A;  4F1I A;  1SG9 A;  1WJ7 A;  1WIV A;  1DO0 A;  4G3O A;  2JUJ A;  1OAI A;  2DHY A;  2O25 A;  1NV9 A;  2CWB A;  1HJP A;  2L4E A;  3BBZ A;  3F92 A;  3GLH E;  1T6O A;  2OOB A;  1G41 A;  2L4F A;  1NV8 A;  3FE3 A;  3B89 A;  2DZL A;  1YLA A;  3MMP A;  3LCV B;  3LCU A;  2K9D A;  1G4A E;  1CUK A;  1V92 A;  2G3Q A;  3H4J A;  2JY5 A;  2QHO B;  2BWB A;  1OKS A;  1HT1 E;  1BVS A;  1IXS A;  2MRO B;  2MGW A;  1IFY A;  1EFU B;  1VEG A;  1C7Y A;  1WGL A;  1WHC A;  4R71 A;  2JY8 A;  2BWE A;  2B3T A;  2DAI A;  5DFL A;  2JZ1 A;  1VQ1 A;  1F4I A;  3IEC A;  1XXH E;  1DV0 A;  2LTU A;  2KNV A;  1AIP C;  2ZTC A;  2DAK A;  2L2D A;  2LVQ D;  2QSF X;  2LVO C;  1ZMV A;  2DNA A;  1PGY A;  1HQY E;  1E94 E;  2LVN C;  3FRI A;  1UFZ A;  2KHH A;  3GLG E;  1JR3 E;  1MN3 A;  2EKK A;  2LVA A;  1Q02 A;  1ZMW A;  2OOA A;  4UN2 B;  4WP2 A;  1IM2 A;  1VEK A;  1ZMU A;  4Q7J A;  3GLI E;  1KYI A;  2JP7 A;  2JZ0 A;  2KNA A;  2ZTD A;  3T6P A;  2DAM A;  2JNH A;  1G3I A;  2EKF A;  1R4G A;  1GO5 A;  2CP8 A;  3FRH A;  2MR9 A;  2K0B X;  2HAK A;  1VG5 A; 
#chains in the Genus database with same CATH topology
 2XFT A;  1K82 A;  4CIS A;  1N75 A;  2K47 A;  3VDP A;  3SAV A;  1H6U A;  1OQY A;  1GJT A;  2WZJ A;  4DUY M;  4GEW A;  1R5L A;  4JI4 M;  2DAE A;  1ZQ9 A;  1N32 M;  1PJS A;  2G8L A;  2KDL A;  2R65 A;  4NSR A;  2DI0 A;  2XLJ A;  1S3S A;  2EUC A;  2H1R A;  4PDI A;  3HHZ A;  3CF2 A;  2KNZ A;  3IHP A;  2ZBK B;  5FLX S;  1QVR A;  1A5T A;  2OO9 A;  5ITQ A;  1OFH A;  1J5E M;  1YUB A;  4M0D A;  5ITX E;  2FE8 A;  5C18 A;  3I4V A;  3W0F A;  4JI5 M;  5JI2 E;  5EXS A;  1IQP A;  4JYA M;  4DV5 M;  3HJ8 A;  3ZH9 B;  1EIJ A;  5ITX A;  4RF0 A;  1JB0 F;  4DBG B;  4M0W A;  3GLI B;  1I94 M;  3KS4 A;  2R0I A;  3B74 A;  1GLN A;  3MHV C;  3RE8 A;  1G59 A;  2JA2 A;  5EQT A;  2CUZ A;  1SG9 A;  1WIV A;  1J7K A;  1Z6T A;  1OAI A;  4Y28 F;  2DHY A;  2C9C A;  4MH0 E;  4DV0 M;  1NV9 A;  3QWL A;  1IXR C;  2QPA A;  2C5R A;  3KVW A;  1QAM A;  4D81 A;  5ITT A;  1SXJ C;  3V76 A;  3KSX A;  1QDT A;  2F5N A;  1T6O A;  4LFB M;  4HL4 A;  1QAQ A;  2OPF A;  3R9X B;  1G41 A;  2QP9 X;  3SFZ A;  3B89 A;  3HZJ A;  4KOD A;  3I51 A;  3FYC A;  3KXE C;  4B7F A;  3GQ3 A;  5EXT A;  2F5P A;  2R18 A;  3DOA A;  3LVV A;  2YQZ A;  1G4A E;  3L29 A;  1N33 M;  1L1Z A;  1V92 A;  2LHG A;  3SYK A;  4MGK E;  4AG5 A;  1OKS A;  1XWI A;  4LJ4 A;  1VDD A;  1IXS A;  2MRO B;  2LHC A;  3K2L A;  4PD2 A;  3SHF A;  1DGH B;  4NL4 H;  1EFU B;  5GKN A;  1C7Y A;  2R4E A;  2D7E A;  3L2A A;  3CF6 E;  3KP1 E;  5EP1 A;  3GPU A;  2QQ8 A;  3HY5 A;  1Z5C A;  4R71 A;  1FJG M;  4QOZ C;  2BJV A;  1Z5B A;  2JZ1 A;  4LZJ A;  3UJN A;  3GLG A;  1GL6 A;  3J2P B;  1GKI A;  1ZAE A;  3U61 B;  3VDU A;  4MM3 B;  2DVW B;  3PVS A;  3J27 B;  1Z5A A;  2ZTC A;  3VLF B;  4HLQ A;  1IBM M;  1TH2 A;  1D2N A;  2F4V M;  1C1K A;  3T38 A;  2F5O A;  2QSF X;  4FWG A;  3AKZ A;  1ZMV A;  3KS8 A;  3HHY A;  2CE7 A;  3D8L A;  2ZM6 M;  3KW6 A;  4ITQ A;  1K3W A;  4LZZ A;  1DGH A;  2KHH A;  2VF7 A;  3THG A;  5DYG A;  4KHP M;  4GMQ A;  5IRE B;  1MN3 A;  3IG5 A;  5KPR A;  4EIW A;  4PCZ A;  4JI3 M;  1GJS A;  2HCB A;  3DFZ A;  4DV3 M;  2Z4S A;  3KP0 E;  3NBI A;  2LVA A;  3GRY A;  5IZ7 D;  2R4J A;  1N78 A;  3KOZ E;  1IM2 A;  5LMN M;  1ZMU A;  2L7I A;  2NQ8 C;  1KYI A;  3W0L B;  2JP7 A;  1PJT A;  1IY2 A;  2J5Y A;  2JZ0 A;  4B08 A;  2HHH M;  5FTK A;  4YY3 M;  4IBD A;  4LY6 A;  2GNO A;  5C1B A;  1HNX M;  2QEN A;  2XZU A;  1GO5 A;  4G4N A;  4OVZ A;  2CP8 A;  4AQY M;  2RKO A;  1IXZ A;  3D8B A;  1V34 A;  1I4W A;  2V6Z M;  2WSE F;  1L2C A;  4LF5 M;  3SHG B;  3A45 A;  3B7Z A;  4LFA M;  2H5X A;  1MU5 A;  2Y0Q A;  2LVP C;  2VQF M;  1XXH B;  1LV7 A;  1TR8 A;  2KXE A;  1QQW A;  1P3Q Q;  2HWJ A;  5FSW A;  1WR1 B;  1N34 M;  4DR3 M;  5EXX A;  3SMP A;  4F2L A;  1QDR A;  2EJS A;  3ZQJ A;  7CAT A;  4NXM M;  1VDL A;  1DGB A;  2KZU A;  2BJW A;  4DR4 M;  1NY6 A;  2KRK A;  5KQD A;  1V33 A;  4X62 M;  3U6M A;  1DO2 A;  3GRV A;  4M9Z A;  4LF8 M;  4AI6 A;  4DV6 M;  3C58 A;  1Y8G A;  1DGF A;  1HT2 E;  5EP4 A;  5KPZ A;  2CV0 A;  1MX0 A;  4L6V 6;  1GAB A;  2R62 A;  1OTR A;  4F1I A;  2DWL A;  4LCB A;  1OIP A;  4CIZ A;  3RGP A;  3TL4 X;  2M60 A;  5ITR A;  2JUJ A;  5KPT A;  1QYR A;  2FS1 A;  1G71 A;  3U6C A;  3SAU A;  4FVM A;  3WHK A;  4DUZ M;  3VFD A;  3GO8 A;  4X65 M;  4BLC A;  3SAW A;  1Q3C A;  2CEA A;  3DA1 A;  4FCW A;  3R8F A;  1NHG C;  3UZU A;  2O01 F;  2VII A;  2OOB A;  2QZ4 A;  1DGG A;  2L4F A;  1L8Q A;  4LGM A;  1PM5 A;  5EXP A;  3MMP A;  3T1H M;  1QAO A;  3GPP A;  2XF3 A;  1R6B X;  3AOG A;  1KFV A;  2K9D A;  3L26 A;  4W5W A;  2QCU A;  1E32 A;  1SXJ A;  1TDH A;  3VKH A;  2P5T A;  2BWB A;  2QHO B;  3JR4 A;  4FW9 A;  1IN8 A;  3GQ4 A;  2QBY B;  3KDS E;  3L25 A;  4GKJ M;  1IY0 A;  1PRB A;  1IFY A;  1VEG A;  1GVN A;  1KSF X;  3K1J A;  3U5Z A;  2JY8 A;  3RFW A;  4RF1 A;  3FTC A;  3C3D A;  1VQ1 A;  2C96 A;  4P16 A;  2DWZ B;  3BXW A;  3RGS A;  4AW4 A;  4JV5 M;  5DNY A;  2JWS A;  1FNN A;  1WXQ A;  2UUA M;  1AIP C;  1W5T A;  3HHW A;  2FOI C;  3HGI A;  5FTL A;  3CTW B;  3ILK A;  2LVQ D;  2GQF A;  1NVM A;  1IN6 A;  2RGH A;  3T15 A;  4GIP A;  1JQJ C;  3HU1 A;  4OW0 A;  1JR3 A;  2L09 A;  4QHT A;  4MB7 A;  2DWN A;  1E94 E;  4B7H A;  4B3S M;  2CRU A;  4LFC M;  3FRI A;  4JI0 M;  2AHM A;  2UUC M;  3M7G A;  5KQ8 A;  1UM8 A;  4L78 A;  3GLG E;  4A3V B;  2EA0 A;  1N77 A;  4GC9 A;  4K0K M;  3EIE A;  3VK7 A;  3K8Z A;  4ANR A;  3K92 A;  4D82 A;  3FYD A;  4JN6 A;  1ZMW A;  2OOA A;  4WP2 A;  3W68 A;  1NO1 A;  2V1C A;  2Z8Y M;  2OQ4 A;  3QYE A;  3EIH A;  5IT9 S;  5DYI A;  4G4R A;  4R7G A;  3PNV A;  3T6P A;  3HWS A;  2JNH A;  2L7H A;  1G3I A;  4WW0 A;  3JR5 A;  2C98 A;  4RKU F;  2K6B A;  1E9R A;  2I7N A;  2CV1 A;  4IBI A;  2CHG A;  3GLH A;  3MJ5 A;  4I81 A;  1Q3B A;  1NSF A;  4I5S A;  1XMQ M;  4LJA A;  5F3W A;  3KOY E;  4REZ A;  2MH8 A;  2J7N A;  3K9P A;  1ORY B;  2C99 A;  2X4A A;  3LVW A;  2JY6 B;  1XB2 B;  4MGZ E;  3GLI A;  2WSC F;  4II7 A;  3IG8 A;  2DXI A;  1JR3 D;  2RRU A;  3VK8 A;  2DKL A;  3J7B A;  4KO8 A;  3AJI B;  2BNK A;  1R2Z A;  4M9X A;  4GKK M;  1D0K A;  2XGN A;  8CAT A;  2F5Q A;  2QNJ A;  4LF6 M;  4IBF A;  3FUW A;  2KA6 B;  4G6Z A;  3E4R A;  4GH9 A;  3TWK A;  2WSF F;  3UMM A;  3FTD A;  1Q39 A;  1XNQ M;  4G4O A;  2Y21 A;  2G5G X;  3SAR A;  5H37 D;  3CGW A;  1WJ7 A;  3J80 S;  2LWX A;  3TE6 A;  1NJF A;  1YSY A;  3A42 A;  4G3O A;  4MGH A;  3U6S A;  1IXS B;  5L8R F;  3AFH A;  2O25 A;  3MK6 A;  4NXN M;  1N36 M;  1K3X A;  3FKE A;  2CWB A;  1XMO M;  1OFI A;  4MGY E;  1TH3 A;  2FH0 A;  4X66 M;  1NNU C;  1TDZ A;  2C9O A;  2L4E A;  3BBZ A;  4GRI A;  1PJJ A;  3GLH E;  2ZAO A;  3J81 S;  2KEB A;  2JXN A;  3HX3 A;  3AOE A;  3NBX X;  3ZC7 B;  1NV8 A;  2VF8 A;  4B7G A;  1OJL A;  1IY1 A;  1IN4 A;  1E9S A;  2A5Y B;  4JI2 M;  4IJF A;  3TPZ A;  3ZCB B;  4GC5 A;  4MGI E;  5FTM A;  4CGY B;  4NSO B;  2E5L M;  3SMS A;  1D0M A;  2LNH C;  4I4L A;  1RU3 A;  4GHA A;  2G3Q A;  3B7Q A;  3H4J A;  4LF9 M;  3J7A S;  3T1Y M;  2V1U A;  1R7R A;  4M9S A;  1HT1 E;  2Z7J A;  1BVS A;  3HU3 A;  5ITY A;  2Z4R A;  4DR2 M;  3LMM A;  2VDB B;  1QUT A;  1XHB A;  1WGL A;  1WHC A;  3AL0 C;  2BWE A;  2Q2E B;  2DZO B;  1OIZ A;  5DFL A;  2XFS A;  1F4I A;  1QZM A;  2Z3X A;  2CV2 A;  4LF7 M;  2J7O A;  3HHX A;  4FWH A;  1NHW C;  3SAT A;  1XXH E;  4FCV A;  1DV0 A;  2FFJ A;  4G4Q A;  4B3T M;  2LTU A;  2APL A;  3LQR A;  3QYB A;  2DAK A;  2L2D A;  4QNR A;  2DHR A;  2HL7 A;  3FUV A;  2UXC M;  3VKG A;  5LMU M;  2EO2 A;  2N35 A;  4QHS A;  4D80 A;  2LVO C;  3M6A A;  4DV2 M;  4L16 A;  3GPY A;  4TUW A;  1PGY A;  1HQY E;  2UXB M;  1Z59 A;  2DZN B;  4LRT A;  1UFZ A;  3DZD A;  4DV4 M;  3U6Q A;  4AG6 A;  1HQC A;  1NNJ A;  3C3E A;  1HR0 M;  1G8P A;  3TQS A;  1LTM A;  2D7G A;  2EKK A;  2W82 A;  3BOS A;  4LJ6 A;  1J09 A;  4WUR A;  5ITU A;  3U6E A;  2CHV A;  5EJC A;  2LH0 A;  3GLF B;  4GIT A;  1VEK A;  5E26 A;  3UK6 A;  4QOS A;  4Q7J A;  2LXE A;  2X49 A;  3GQ5 A;  3FUT A;  4IBJ A;  4Z6Y A;  2ZTD A;  3GLI E;  4NC6 A;  4B3M M;  3H4M A;  4XGI A;  1PJI A;  4NRV A;  1R4G A;  3A98 B;  4NRW A;  2M5Z A;  1HNZ M;  1HNW M;  5E6J A;  2X8A A;  4LJ9 A;  2ERC A;  2MR9 A;  2LVN C;  3SC3 A;  2HAK A;  1VG5 A;  2DWM A;  2LBC A;  3E21 A;  1R2Y A;  4HEO A;  4JI1 M;  3C9P A;  1EE8 A;  2DAG A;  4YHH M;  3B7N A;  1WGN A;  1PJQ A;  3E9S A;  1ZV1 A;  1TGU A;  2MJ5 B;  4S12 A;  2QBY A;  4DR1 M;  2CHQ A;  3GLH B;  2F5S A;  3HU2 A;  4IJE A;  3PNY A;  2Y20 A;  2ZAM A;  3FTF A;  3GLF E;  3GPX A;  2KRU A;  3PXG A;  2JY7 A;  3E46 A;  3KOW E;  1MJG M;  3LQQ A;  2UUB M;  3L28 A;  2XH9 A;  4PDG A;  4R3D A;  4IBG A;  1QAN A;  2O5R A;  4FD2 A;  4AZF A;  3K9O A;  1TTE A;  1VEJ A;  2DEN A;  1W5S A;  2YNM D;  4IBE A;  1NY5 A;  1OAO C;  4P17 A;  4LGY A;  1IN5 A;  3I4Y A;  5FTJ A;  4FWD A;  4I8O A;  3TWM A;  3U60 B;  4L15 A;  1YE9 A;  1T43 A;  3GP1 A;  4AKG A;  3HJS A;  1TF0 B;  4PT5 A;  2Y0T A;  1SXJ B;  2VQE M;  3FUX A;  1QZE A;  4L4U A;  2R46 A;  3A46 A;  4DV7 M;  2CFO A;  4LJ7 A;  3OTO M;  3SBJ A;  4DR5 M;  1DO0 A;  2YFQ A;  3QAU A;  4JXJ A;  3LW5 F;  4LJ5 A;  5EP3 A;  4CJ6 A;  3HJQ A;  1D0L A;  4OX9 M;  1QUS A;  2R44 A;  1HJP A;  3SAS A;  2UXD M;  1L2D A;  4Z8X A;  2KW0 A;  3F92 A;  2ZAN A;  4AKI A;  2YR0 A;  1IBK M;  2XSZ A;  3FE3 A;  3FUU A;  1T3T A;  5EP2 A;  4IIW A;  2DZL A;  4XK8 F;  1YLA A;  4OVZ B;  3KFU G;  4DR7 M;  3LCV B;  3LCU A;  3GRU A;  5JI3 E;  5A2Q S;  3PFI A;  4RNA A;  3I04 M;  2XZF A;  4L8R C;  3FD9 A;  1CUK A;  2R6F A;  3HKP A;  3NWL A;  2JY5 A;  3AOE C;  4IBC A;  4JI8 M;  1X37 A;  3B9P A;  3SYL A;  4OU7 A;  2L6O A;  2MGW A;  4JI7 M;  4LF4 M;  3M0E A;  3WHL A;  4B3R M;  4DV1 M;  1SXJ D;  4BB9 A;  2B3T A;  2DAI A;  1IN7 A;  3Q8G A;  4IBK A;  3W67 A;  1XNR M;  2HKJ A;  3IEC A;  3TWL A;  4BBA A;  4QNM A;  4JI6 M;  4FCT A;  2KNV A;  3I01 M;  4ZPX A;  3U6O A;  1AUA A;  4X64 M;  4GHL A;  4AKH A;  4IBB A;  4KT0 F;  4LJ8 A;  1L2B A;  4DR6 M;  3U6L A;  2DNA A;  4KLN A;  3AV0 A;  5BR8 M;  3GLG B;  3U6D A;  4CHT B;  4LRS A;  1GL7 A;  3CF0 A;  3FTE A;  2FNA A;  1IBL M;  1JR3 E;  1XXH A;  3U60 A;  3KSJ A;  3U6P A;  3KOX E;  3UGJ A;  1L1T A;  1XC8 A;  1SXJ E;  1Q02 A;  4UN2 B;  2KZS A;  1NJG A;  4XBO A;  3GRR A;  4LG2 A;  2XEP A;  3L27 A;  2KNA A;  4NOO B;  5FTN A;  1TH4 A;  3U61 A;  2DAM A;  2EKF A;  5KO3 A;  2UU9 M;  2D7H A;  2XSZ D;  5IWA M;  3U5Z B;  2R45 A;  2I7P A;  5BPV A;  3JAM S;  3FRH A;  3GLF A;  2K0B X;  3Q8X A;  2RGO A; 
#chains in the Genus database with same CATH homology
 2LBC A;  3E21 A;  4HEO A;  2H5X A;  1OQY A;  2DAG A;  2LVP C;  2WZJ A;  1WGN A;  3K9P A;  4GEW A;  1ZV1 A;  2DAE A;  2MJ5 B;  2JY6 B;  1XB2 B;  2DI0 A;  1TR8 A;  2KNZ A;  1P3Q Q;  2RRU A;  3IHP A;  2HWJ A;  2DKL A;  3GLF E;  1WR1 B;  4F2L A;  1A5T A;  2JY7 A;  2OO9 A;  3E46 A;  2EJS A;  1VDL A;  2QNJ A;  5JI2 E;  3K9O A;  1TTE A;  1VEJ A;  2DEN A;  1DO2 A;  4DBG B;  1Y8G A;  2R0I A;  1HT2 E;  1T43 A;  1OTR A;  1QZE A;  4F1I A;  1SG9 A;  1WJ7 A;  1WIV A;  1DO0 A;  4G3O A;  2JUJ A;  1OAI A;  2DHY A;  2O25 A;  1NV9 A;  2CWB A;  1HJP A;  2L4E A;  3BBZ A;  3F92 A;  3GLH E;  1T6O A;  2OOB A;  1G41 A;  2L4F A;  1NV8 A;  3FE3 A;  3B89 A;  2DZL A;  1YLA A;  3MMP A;  3LCV B;  3LCU A;  2K9D A;  1G4A E;  1CUK A;  1V92 A;  2G3Q A;  3H4J A;  2JY5 A;  2QHO B;  2BWB A;  1OKS A;  1HT1 E;  1BVS A;  1IXS A;  2MRO B;  2MGW A;  1IFY A;  1EFU B;  1VEG A;  1C7Y A;  1WGL A;  1WHC A;  4R71 A;  2JY8 A;  2BWE A;  2B3T A;  2DAI A;  5DFL A;  2JZ1 A;  1VQ1 A;  1F4I A;  3IEC A;  1XXH E;  1DV0 A;  2LTU A;  2KNV A;  1AIP C;  2ZTC A;  2DAK A;  2L2D A;  2LVQ D;  2QSF X;  2LVO C;  1ZMV A;  2DNA A;  1PGY A;  1HQY E;  1E94 E;  2LVN C;  3FRI A;  1UFZ A;  2KHH A;  3GLG E;  1JR3 E;  1MN3 A;  2EKK A;  2LVA A;  1Q02 A;  1ZMW A;  2OOA A;  4UN2 B;  4WP2 A;  1IM2 A;  1VEK A;  1ZMU A;  4Q7J A;  3GLI E;  1KYI A;  2JP7 A;  2JZ0 A;  2KNA A;  2ZTD A;  3T6P A;  2DAM A;  2JNH A;  1G3I A;  2EKF A;  1R4G A;  1GO5 A;  2CP8 A;  3FRH A;  2MR9 A;  2K0B X;  2HAK A;  1VG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...