2DAMA

Solution structure of the novel identified uba-like domain in the n-terminal of human etea protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human ETEA Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ETEA protein
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2damA00
1DO2A 2B3TA 2EKFA 2EJSA 1VG5A 2DAKA 3K9OA 3H4JA 3GLFE 1VQ1A 4F1IA 1DO0A 1C7YA 3IHPA 2OOBA 3LCVB 1OTRA 2G3QA 1ZMUA 3IECA 3BBZA 1QZEA 1OQYA 1OAIA 2DI0A 2KHHA 2O25A 1KYIA 2DHYA 2DAMA 2R0IA 3FRIA 2LVAA 1Q02A 1VEGA 5DFLA 3T6PA 1TR8A 1WJ7A 1NV9A 2DKLA 1WIVA 1HJPA 2JZ0A 4UN2B 3E21A 3GLIE 1IFYA 1V92A 1EFUB 1SG9A 1Y8GA 1AIPC 2JY5A 2KNZA 1IXSA 1HQYE 2LVOC 1MN3A 2OOAA 1IM2A 4HEOA 1XXHE 1WGLA 2CWBA 1GO5A 1WR1B 2MROB 2L2DA 2ZTCA 1YLAA 1G41A 5JI2E 1G4AE 1P3QQ 1T6OA 1CUKA 1OKSA 3MMPA 2OO9A 2JUJA 2JZ1A 2LBCA 3B89A 2ZTDA 4WP2A 1ZMVA 2L4FA 4R71A 2K9DA 2BWBA 1WHCA 2JP7A 4DBGB 1UFZA 2KNVA 1T43A 2K0BX 2JY7A 1NV8A 4G3OA 1R4GA 1G3IA 1JR3E 1ZMWA 2LVNC 2JNHA 2EKKA 1HT1E 1A5TA 2MGWA 1HT2E 1TTEA 1VEKA 2RRUA 4Q7JA 2DAEA 2LVQD 2DAIA 1DV0A 2LTUA 1BVSA 3GLGE 3FRHA 2HAKA 1F4IA 2MJ5B 3K9PA 2CP8A 1XB2B 2HWJA 2WZJA 3GLHE 2MR9A 3FE3A 1VEJA 2QNJA 2DZLA 2DAGA 1ZV1A 1VDLA 2QHOB 2JY6B 2DENA 4GEWA 4F2LA 2KNAA 3LCUA 2DNAA 1E94E 1WGNA 2BWEA 2QSFX 2LVPC 1PGYA 2L4EA 2H5XA 3F92A 3E46A 2JY8A
chains in the Genus database with same CATH superfamily
3FUTA 2B3TA 2EKFA 3GLGA 2J5YA 3MJ5A 4D80A 3UZUA 2UUCM 4LZZA 2KXEA 1D0LA 4DR6M 4ZPXA 1C7YA 1NY6A 1IXRC 2DZNB 2L09A 5FTKA 4L8RC 3LCVB 1OTRA 3NWLA 3WHKA 3J7AS 4RF1A 4X66M 1G59A 3I4VA 3IECA 1XNQM 3H4MA 1OQYA 4G4QA 3I04M 3T1YM 4JI0M 2DI0A 2KHHA 3A42A 1KYIA 3FRIA 2AHMA 2O5RA 4L4UA 3W0FA 1IBKM 5IZ7D 3KOWE 4B08A 5FTMA 3GRRA 3T6PA 4PCZA 1KSFX 1NV9A 2KZUA 4JI6M 4NXMM 4KO8A 5EP1A 3J27B 3E21A 3SAVA 2VQFM 2UXDM 4FWGA 3B9PA 3W67A 2X49A 4L6V6 1SXJC 4LJ5A 2CUZA 1AIPC 3HWSA 2CV2A 3HX3A 3AOEC 4WURA 5DYGA 4GKJM 1NHGC 3HHWA 1MN3A 2BJWA 4HEOA 4OW0A 4DR7M 2VIIA 5KO3A 4MGKE 1GO5A 2CEAA 5JI2E 1P3QQ 5ITXE 1CUKA 1OKSA 4I81A 4NC6A 3EIEA 4FVMA 4IBDA 2L4FA 4R71A 1FJGM 4JI1M 1Q3BA 4DR4M 2X4AA 4LGMA 1UFZA 1VDDA 3TWKA 3FYCA 4TUWA 2C98A 4GRIA 2KA6B 4DV1M 4LJ6A 2JY7A 1OAOC 5EQTA 1GLNA 1PJQA 1IXSB 1IY0A 3C9PA 5EXPA 1JR3E 1ZMWA 5IT9S 2XZFA 4Y28F 3GPPA 3KOXE 2K47A 1QQWA 1TTEA 4LRTA 3R8FA 3HY5A 2LTUA 4HL4A 4OVZB 4IBFA 4LF4M 2KDLA 2C96A 1F4IA 1W5SA 3K9PA 5EJCA 3HZJA 2JA2A 2WZJA 2HL7A 4L15A 2R45A 2OQ4A 2CHGA 1DGGA 1HNZM 4NSRA 2DZLA 5FTLA 2DAGA 3AV0A 5DNYA 1XC8A 3E9SA 4JYAM 3LQRA 2KEBA 4II7A 5BR8M 4IBIA 4LZJA 3FTCA 4GEWA 2EO2A 4M0WA 3ILKA 3ZC7B 3GO8A 1GJSA 1I4WA 3GLGB 4DV4M 3VDPA 2I7NA 2L7IA 3FUUA 1NNUC 2H5XA 4LFAM 4JI5M 3E46A 1JR3D 2APLA 2R62A 4I5SA 4QHSA 5EP4A 2H1RA 5FLXS 1Q3CA 2P5TA 3SBJA 1W5TA 3K9OA 3U6EA 1L8QA 1TGUA 1IN7A 2WSCF 4F1IA 3GQ5A 3CF0A 3T38A 2Z3XA 4DV3M 1NHWC 4DR1M 4PD2A 2UUBM 2LWXA 4IBJA 4I4LA 1QDTA 2OOBA 3C3EA 3LMMA 3BOSA 3KOYE 4GIPA 3GQ3A 4JI7M 4BLCA 1V34A 3UGJA 1QAMA 2R65A 5FTNA 2ZM6M 1IQPA 4LJ8A 1IN8A 5L8RF 3TWLA 3AL0C 1OAIA 4RNAA 1NJGA 2A5YB 5C1BA 2DWMA 2O25A 1GL7A 3W0LB 2R0IA 1OJLA 4G4NA 4LFBM 2LVAA 3KSXA 1QUTA 4QOSA 1Q02A 5EP3A 4A3VB 1J09A 1OIPA 1E9RA 4IIWA 3UK6A 2Y20A 2XF3A 3AOGA 5ITUA 3CF6E 4KODA 2R4JA 3SMSA 1TR8A 3TQSA 3JR5A 5ITQA 4LF5M 4MGYE 4MM3B 1HJPA 1DGBA 1E32A 1QANA 2FH0A 2CE7A 3THGA 1IN4A 2XSZD 2DZOB 4BB9A 3VK7A 2F5SA 2JY5A 3KSJA 1QAQA 3DFZA 4LY6A 3GQ4A 3HJ8A 1XWIA 4FW9A 2UUAM 4QOZC 4AG5A 2LVOC 3V76A 2G8LA 3U5ZB 2ZAOA 3HU3A 4QNMA 5GKNA 3M6AA 3QWLA 1G8PA 3FTEA 2MROB 3EIHA 2I7PA 3GLHB 1N33M 3U6PA 2G5GX 3HKPA 2YNMD 2KZSA 1T6OA 2RGHA 3TE6A 3LW5F 4LRSA 5EXXA 2L6OA 4DV5M 3T15A 3B7QA 1ZMVA 3VFDA 1TH4A 2D7EA 2NQ8C 4HLQA 4CISA 3KS8A 4YHHM 4G4OA 1XMOM 2CV1A 3FYDA 2XFTA 3CGWA 3RGSA 4DV7M 2ERCA 2DWLA 3A45A 3PFIA 1L2BA 3T1HM 1L2DA 1YUBA 1T43A 1TH2A 1XHBA 2QPAA 2OPFA 2W82A 4G3OA 1R4GA 4B7FA 2LHCA 3GPUA 2ZAMA 1QAOA 2LVNC 2LH0A 2JNHA 1SXJE 5KPZA 4B3MM 3L25A 1ORYB 2MGWA 2FFJA 3AOEA 2D7GA 4Q7JA 4CIZA 2DAEA 2LVQD 2R4EA 4IBKA 1DV0A 1QUSA 4QHTA 4LFCM 2R46A 1TDZA 3FRHA 3L29A 4MB7A 4IJFA 3U6QA 4M0DA 2C9CA 4BBAA 1GJTA 3KDSE 4YY3M 3W68A 3VKGA 3AJIB 3HGIA 1WXQA 3GP1A 2V6ZM 4G4RA 4L16A 1K3XA 4B3RM 3D8BA 4KHPM 2KRUA 3GLHE 3L26A 3FUWA 3I51A 3PNVA 3GRYA 4REZA 1NY5A 1ZV1A 1PJSA 2CHVA 4IBGA 2QHOB 1YE9A 3A46A 2JY6B 4OU7A 2Q2EB 5KQ8A 4F2LA 1IBLM 3SARA 1R5LA 8CATA 3LCUA 3SAWA 4GMQA 4IJEA 1E94E 2BWEA 2LVPC 2QBYB 1Z6TA 2KW0A 4RF0A 4MGIE 4L78A 4NXNM 3HHXA 2F5NA 2Z7JA 3UJNA 1XXHB 2GNOA 1J5EM 1X37A 3TL4X 2EJSA 1VG5A 1PJIA 2DAKA 1GL6A 2MH8A 3A98B 4IBEA 2Z4RA 1N36M 1MJGM 2F5PA 3RE8A 2QQ8A 4OX9M 5ITRA 2QBYA 2GQFA 2Z4SA 3L27A 3C58A 1K82A 3CTWB 4JI3M 3J7BA 3FD9A 2DHRA 1NO1A 4IBCA 3QYEA 1ZMUA 3GRVA 4LJAA 3BBZA 1QZEA 3E4RA 4NRWA 1N34M 3AFHA 5FTJA 1IY2A 4MH0E 2DAMA 4GC5A 3K1JA 2CHQA 3U60B 4LF8M 1GVNA 4XGIA 4P16A 1GABA 1T3TA 1AUAA 3PNYA 1DGFA 1VEGA 5DFLA 1Z5AA 5DYIA 1WJ7A 4MGZE 3DA1A 3LQQA 1H6UA 3PVSA 3GLFA 4CGYB 1QZMA 3GLIA 2DKLA 1WIVA 4UN2B 1IFYA 4LF6M 1V92A 4X65M 3SASA 1N78A 1Y8GA 4R3DA 3U6LA 2F5QA 3NBXX 1C1KA 2Z8YM 2V1UA 4LJ4A 2LXEA 2VDBB 1HQYE 2YQZA 1I94M 3ZCBB 1IM2A 2XH9A 4G6ZA 3I4YA 1GKIA 3FKEA 4B7HA 4NOOB 3HJSA 2CWBA 1WR1B 4LGYA 4PDIA 2ZTCA 4JV5M 4DV6M 4JI8M 1IN5A 2M60A 3J81S 3SYKA 1R2ZA 1QVRA 3MMPA 2OO9A 3B7NA 2JUJA 2JZ1A 2Y0TA 2ZTDA 4WP2A 1E9SA 1EIJA 4AKIA 4B7GA 3KXEC 3GLHA 3RFWA 1OFHA 1WHCA 2JP7A 3RGPA 2J7NA 4DBGB 2HCBA 4GC9A 5EXTA 4DR3M 4RKUF 4Z6YA 2VF8A 2UU9M 1XNRM 3KFUG 3SC3A 3U5ZA 3K92A 2D7HA 2E5LM 3M7GA 7CATA 2F5OA 3HU1A 4XBOA 4D82A 2BJVA 1LTMA 1IN6A 3SHGB 1PM5A 4LF9M 3HHZA 2KRKA 4W5WA 2L7HA 3KP0E 1HT2E 1VEKA 2RRUA 4R7GA 4AZFA 5A2QS 2HHHM 4QNRA 3TWMA 3TPZA 2R6FA 1BVSA 1J7KA 2QP9X 5F3WA 2QCUA 5IWAM 3D8LA 1XB2B 2HWJA 3I01M 3GPXA 3VKHA 1IY1A 2DVWB 1XMQM 1D2NA 1QDRA 2WSEF 4XK8F 4DR2M 2FOIC 2RKOA 3C3DA 4JI2M 3U60A 3UMMA 2MR9A 3Q8GA 4ANRA 1PJJA 1VEJA 2QNJA 2UXCM 4I8OA 3J2PB 2C9OA 1VDLA 4AG6A 5LMNM 3DOAA 2UXBM 4AKHA 3OTOM 5KPTA 5EP2A 5H37D 2KNAA 4KT0F 1NNJA 4LJ7A 5ITTA 4CJ6A 4FWDA 2DWZB 1WGNA 1N32M 1S3SA 2ZBKB 1NJFA 3R9XB 4DR5M 3FTFA 3F92A 1IBMM 2V1CA 3B7ZA 4NL4H 1DO2A 4P17A 5KQDA 4MGHA 2FE8A 2XSZA 3Q8XA 4K0KM 1MX0A 3FTDA 3H4JA 2CFOA 3GLFE 4DUZM 1VQ1A 3VDUA 2Y0QA 3KP1E 4M9SA 1DO0A 3GPYA 3U6SA 1R7RA 3IHPA 4AW4A 3IG8A 1HR0M 3SFZA 5LMUM 1N75A 1UM8A 2BNKA 2G3QA 4LJ9A 4DV0M 3SMPA 4FCWA 4GKKM 1FNNA 3U6OA 2O01F 2M5ZA 4EIWA 5JI3E 4NRVA 4FCTA 5IREB 2DHYA 4B3SM 1Q39A 2QZ4A 3JAMS 2LNHC 3DZDA 3NBIA 1D0MA 2F4VM 1ZQ9A 3GRUA 5FSWA 3U6CA 3MHVC 5ITXA 3AKZA 4DV2M 5EXSA 2YFQA 3KVWA 1N77A 1Z5BA 2DWNA 2JZ0A 5ITYA 3GLIE 1L1TA 2JWSA 2RGOA 3ZH9B 1KFVA 1EFUB 1SG9A 2VQEM 3K2LA 4LCBA 2XFSA 1MU5A 1V33A 4JI4M 2KNZA 1IXSA 3CF2A 4X62M 2OOAA 2EA0A 4GH9A 2J7OA 1XXHE 5E6JA 1WGLA 1LV7A 2L2DA 4X64M 5E26A 1YLAA 2K6BA 4M9XA 2N35A 1G41A 2X8AA 1JQJC 3KW6A 4FWHA 1G4AE 3WHLA 5BPVA 4AQYM 1D0KA 3U61A 1SXJB 4GHAA 3M0EA 4JXJA 2EUCA 1OIZA 2LBCA 4DUYM 3B89A 4AI6A 3KOZE 3HHYA 3BXWA 2K9DA 1HNWM 2VF7A 1Z5CA 1NVMA 2BWBA 4FD2A 1R6BX 1DGHA 1TDHA 3B74A 3SYLA 2KNVA 4IBBA 2C5RA 2K0BX 1TF0B 3VLFB 3SAUA 1NV8A 2JXNA 2CRUA 2XEPA 4KLNA 4JN6A 1L1ZA 2XGNA 1JR3A 3MK6A 3GLIB 1G3IA 3GLFB 3L28A 1JB0F 1ZAEA 4OVZA 2EKKA 1HT1E 1RU3A 1HNXM 1A5TA 1OFIA 3HJQA 3QAUA 4ITQA 1IXZA 4LF7M 2CV0A 4S12A 3IG5A 3FUVA 2DAIA 2FNAA 4D81A 3GLGE 4PDGA 2HAKA 2WSFF 3J80S 2MJ5B 3K8ZA 3QYBA 2CP8A 3LVWA 2C99A 4FCVA 4WW0A 3PXGA 4PT5A 3L2AA 2DXIA 1NSFA 1L2CA 2XZUA 4CHTB 2QENA 2Y21A 3FUXA 2FS1A 4B3TM 3KS4A 1SXJD 5C18A 1DGHB 2R44A 1QYRA 2YR0A 3FE3A 3ZQJA 1EE8A 1K3WA 1TH3A 2XLJA 4M9ZA 1R2YA 3HU2A 1Z59A 3SHFA 2DENA 4GITA 4Z8XA 4GHLA 3JR4A 1SXJA 5KPRA 2DNAA 3U61B 1YSYA 2LHGA 3VK8A 4AKGA 2QSFX 1XXHA 4NSOB 1HQCA 4LG2A 1G71A 1PGYA 3LVVA 3U6MA 2R18A 2L4EA 1PJTA 3U6DA 3SATA 2ZANA 2JY8A 1PRBA 2HKJA
chains in the Genus database with same CATH topology
1DO2A 2B3TA 2EKFA 2EJSA 1VG5A 2DAKA 3K9OA 3H4JA 3GLFE 1VQ1A 4F1IA 1DO0A 1C7YA 3IHPA 2OOBA 3LCVB 1OTRA 2G3QA 1ZMUA 3IECA 3BBZA 1QZEA 1OQYA 1OAIA 2DI0A 2KHHA 2O25A 1KYIA 2DHYA 2DAMA 2R0IA 3FRIA 2LVAA 1Q02A 1VEGA 5DFLA 3T6PA 1TR8A 1WJ7A 1NV9A 2DKLA 1WIVA 1HJPA 2JZ0A 4UN2B 3E21A 3GLIE 1IFYA 1V92A 1EFUB 1SG9A 1Y8GA 1AIPC 2JY5A 2KNZA 1IXSA 1HQYE 2LVOC 1MN3A 2OOAA 1IM2A 4HEOA 1XXHE 1WGLA 2CWBA 1GO5A 1WR1B 2MROB 2L2DA 2ZTCA 1YLAA 1G41A 5JI2E 1G4AE 1P3QQ 1T6OA 1CUKA 1OKSA 3MMPA 2OO9A 2JUJA 2JZ1A 2LBCA 3B89A 2ZTDA 4WP2A 1ZMVA 2L4FA 4R71A 2K9DA 2BWBA 1WHCA 2JP7A 4DBGB 1UFZA 2KNVA 1T43A 2K0BX 2JY7A 1NV8A 4G3OA 1R4GA 1G3IA 1JR3E 1ZMWA 2LVNC 2JNHA 2EKKA 1HT1E 1A5TA 2MGWA 1HT2E 1TTEA 1VEKA 2RRUA 4Q7JA 2DAEA 2LVQD 2DAIA 1DV0A 2LTUA 1BVSA 3GLGE 3FRHA 2HAKA 1F4IA 2MJ5B 3K9PA 2CP8A 1XB2B 2HWJA 2WZJA 3GLHE 2MR9A 3FE3A 1VEJA 2QNJA 2DZLA 2DAGA 1ZV1A 1VDLA 2QHOB 2JY6B 2DENA 4GEWA 4F2LA 2KNAA 3LCUA 2DNAA 1E94E 1WGNA 2BWEA 2QSFX 2LVPC 1PGYA 2L4EA 2H5XA 3F92A 3E46A 2JY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO2 A;  2B3T A;  2EKF A;  2EJS A;  1VG5 A;  2DAK A;  3K9O A;  3H4J A;  3GLF E;  1VQ1 A;  4F1I A;  1DO0 A;  1C7Y A;  3IHP A;  2OOB A;  3LCV B;  1OTR A;  2G3Q A;  1ZMU A;  3IEC A;  3BBZ A;  1QZE A;  1OQY A;  1OAI A;  2DI0 A;  2KHH A;  2O25 A;  1KYI A;  2DHY A;  2DAM A;  2R0I A;  3FRI A;  2LVA A;  1Q02 A;  1VEG A;  5DFL A;  3T6P A;  1TR8 A;  1WJ7 A;  1NV9 A;  2DKL A;  1WIV A;  1HJP A;  2JZ0 A;  4UN2 B;  3E21 A;  3GLI E;  1IFY A;  1V92 A;  1EFU B;  1SG9 A;  1Y8G A;  1AIP C;  2JY5 A;  2KNZ A;  1IXS A;  1HQY E;  2LVO C;  1MN3 A;  2OOA A;  1IM2 A;  4HEO A;  1XXH E;  1WGL A;  2CWB A;  1GO5 A;  1WR1 B;  2MRO B;  2L2D A;  2ZTC A;  1YLA A;  1G41 A;  5JI2 E;  1G4A E;  1P3Q Q;  1T6O A;  1CUK A;  1OKS A;  3MMP A;  2OO9 A;  2JUJ A;  2JZ1 A;  2LBC A;  3B89 A;  2ZTD A;  4WP2 A;  1ZMV A;  2L4F A;  4R71 A;  2K9D A;  2BWB A;  1WHC A;  2JP7 A;  4DBG B;  1UFZ A;  2KNV A;  1T43 A;  2K0B X;  2JY7 A;  1NV8 A;  4G3O A;  1R4G A;  1G3I A;  1JR3 E;  1ZMW A;  2LVN C;  2JNH A;  2EKK A;  1HT1 E;  1A5T A;  2MGW A;  1HT2 E;  1TTE A;  1VEK A;  2RRU A;  4Q7J A;  2DAE A;  2LVQ D;  2DAI A;  1DV0 A;  2LTU A;  1BVS A;  3GLG E;  3FRH A;  2HAK A;  1F4I A;  2MJ5 B;  3K9P A;  2CP8 A;  1XB2 B;  2HWJ A;  2WZJ A;  3GLH E;  2MR9 A;  3FE3 A;  1VEJ A;  2QNJ A;  2DZL A;  2DAG A;  1ZV1 A;  1VDL A;  2QHO B;  2JY6 B;  2DEN A;  4GEW A;  4F2L A;  2KNA A;  3LCU A;  2DNA A;  1E94 E;  1WGN A;  2BWE A;  2QSF X;  2LVP C;  1PGY A;  2L4E A;  2H5X A;  3F92 A;  3E46 A;  2JY8 A; 
#chains in the Genus database with same CATH topology
 3FUT A;  2B3T A;  2EKF A;  3GLG A;  2J5Y A;  3MJ5 A;  4D80 A;  3UZU A;  2UUC M;  4LZZ A;  2KXE A;  1D0L A;  4DR6 M;  4ZPX A;  1C7Y A;  1NY6 A;  1IXR C;  2DZN B;  2L09 A;  5FTK A;  4L8R C;  3LCV B;  1OTR A;  3NWL A;  3WHK A;  3J7A S;  4RF1 A;  4X66 M;  1G59 A;  3I4V A;  3IEC A;  1XNQ M;  3H4M A;  1OQY A;  4G4Q A;  3I04 M;  3T1Y M;  4JI0 M;  2DI0 A;  2KHH A;  3A42 A;  1KYI A;  3FRI A;  2AHM A;  2O5R A;  4L4U A;  3W0F A;  1IBK M;  5IZ7 D;  3KOW E;  4B08 A;  5FTM A;  3GRR A;  3T6P A;  4PCZ A;  1KSF X;  1NV9 A;  2KZU A;  4JI6 M;  4NXM M;  4KO8 A;  5EP1 A;  3J27 B;  3E21 A;  3SAV A;  2VQF M;  2UXD M;  4FWG A;  3B9P A;  3W67 A;  2X49 A;  4L6V 6;  1SXJ C;  4LJ5 A;  2CUZ A;  1AIP C;  3HWS A;  2CV2 A;  3HX3 A;  3AOE C;  4WUR A;  5DYG A;  4GKJ M;  1NHG C;  3HHW A;  1MN3 A;  2BJW A;  4HEO A;  4OW0 A;  4DR7 M;  2VII A;  5KO3 A;  4MGK E;  1GO5 A;  2CEA A;  5JI2 E;  1P3Q Q;  5ITX E;  1CUK A;  1OKS A;  4I81 A;  4NC6 A;  3EIE A;  4FVM A;  4IBD A;  2L4F A;  4R71 A;  1FJG M;  4JI1 M;  1Q3B A;  4DR4 M;  2X4A A;  4LGM A;  1UFZ A;  1VDD A;  3TWK A;  3FYC A;  4TUW A;  2C98 A;  4GRI A;  2KA6 B;  4DV1 M;  4LJ6 A;  2JY7 A;  1OAO C;  5EQT A;  1GLN A;  1PJQ A;  1IXS B;  1IY0 A;  3C9P A;  5EXP A;  1JR3 E;  1ZMW A;  5IT9 S;  2XZF A;  4Y28 F;  3GPP A;  3KOX E;  2K47 A;  1QQW A;  1TTE A;  4LRT A;  3R8F A;  3HY5 A;  2LTU A;  4HL4 A;  4OVZ B;  4IBF A;  4LF4 M;  2KDL A;  2C96 A;  1F4I A;  1W5S A;  3K9P A;  5EJC A;  3HZJ A;  2JA2 A;  2WZJ A;  2HL7 A;  4L15 A;  2R45 A;  2OQ4 A;  2CHG A;  1DGG A;  1HNZ M;  4NSR A;  2DZL A;  5FTL A;  2DAG A;  3AV0 A;  5DNY A;  1XC8 A;  3E9S A;  4JYA M;  3LQR A;  2KEB A;  4II7 A;  5BR8 M;  4IBI A;  4LZJ A;  3FTC A;  4GEW A;  2EO2 A;  4M0W A;  3ILK A;  3ZC7 B;  3GO8 A;  1GJS A;  1I4W A;  3GLG B;  4DV4 M;  3VDP A;  2I7N A;  2L7I A;  3FUU A;  1NNU C;  2H5X A;  4LFA M;  4JI5 M;  3E46 A;  1JR3 D;  2APL A;  2R62 A;  4I5S A;  4QHS A;  5EP4 A;  2H1R A;  5FLX S;  1Q3C A;  2P5T A;  3SBJ A;  1W5T A;  3K9O A;  3U6E A;  1L8Q A;  1TGU A;  1IN7 A;  2WSC F;  4F1I A;  3GQ5 A;  3CF0 A;  3T38 A;  2Z3X A;  4DV3 M;  1NHW C;  4DR1 M;  4PD2 A;  2UUB M;  2LWX A;  4IBJ A;  4I4L A;  1QDT A;  2OOB A;  3C3E A;  3LMM A;  3BOS A;  3KOY E;  4GIP A;  3GQ3 A;  4JI7 M;  4BLC A;  1V34 A;  3UGJ A;  1QAM A;  2R65 A;  5FTN A;  2ZM6 M;  1IQP A;  4LJ8 A;  1IN8 A;  5L8R F;  3TWL A;  3AL0 C;  1OAI A;  4RNA A;  1NJG A;  2A5Y B;  5C1B A;  2DWM A;  2O25 A;  1GL7 A;  3W0L B;  2R0I A;  1OJL A;  4G4N A;  4LFB M;  2LVA A;  3KSX A;  1QUT A;  4QOS A;  1Q02 A;  5EP3 A;  4A3V B;  1J09 A;  1OIP A;  1E9R A;  4IIW A;  3UK6 A;  2Y20 A;  2XF3 A;  3AOG A;  5ITU A;  3CF6 E;  4KOD A;  2R4J A;  3SMS A;  1TR8 A;  3TQS A;  3JR5 A;  5ITQ A;  4LF5 M;  4MGY E;  4MM3 B;  1HJP A;  1DGB A;  1E32 A;  1QAN A;  2FH0 A;  2CE7 A;  3THG A;  1IN4 A;  2XSZ D;  2DZO B;  4BB9 A;  3VK7 A;  2F5S A;  2JY5 A;  3KSJ A;  1QAQ A;  3DFZ A;  4LY6 A;  3GQ4 A;  3HJ8 A;  1XWI A;  4FW9 A;  2UUA M;  4QOZ C;  4AG5 A;  2LVO C;  3V76 A;  2G8L A;  3U5Z B;  2ZAO A;  3HU3 A;  4QNM A;  5GKN A;  3M6A A;  3QWL A;  1G8P A;  3FTE A;  2MRO B;  3EIH A;  2I7P A;  3GLH B;  1N33 M;  3U6P A;  2G5G X;  3HKP A;  2YNM D;  2KZS A;  1T6O A;  2RGH A;  3TE6 A;  3LW5 F;  4LRS A;  5EXX A;  2L6O A;  4DV5 M;  3T15 A;  3B7Q A;  1ZMV A;  3VFD A;  1TH4 A;  2D7E A;  2NQ8 C;  4HLQ A;  4CIS A;  3KS8 A;  4YHH M;  4G4O A;  1XMO M;  2CV1 A;  3FYD A;  2XFT A;  3CGW A;  3RGS A;  4DV7 M;  2ERC A;  2DWL A;  3A45 A;  3PFI A;  1L2B A;  3T1H M;  1L2D A;  1YUB A;  1T43 A;  1TH2 A;  1XHB A;  2QPA A;  2OPF A;  2W82 A;  4G3O A;  1R4G A;  4B7F A;  2LHC A;  3GPU A;  2ZAM A;  1QAO A;  2LVN C;  2LH0 A;  2JNH A;  1SXJ E;  5KPZ A;  4B3M M;  3L25 A;  1ORY B;  2MGW A;  2FFJ A;  3AOE A;  2D7G A;  4Q7J A;  4CIZ A;  2DAE A;  2LVQ D;  2R4E A;  4IBK A;  1DV0 A;  1QUS A;  4QHT A;  4LFC M;  2R46 A;  1TDZ A;  3FRH A;  3L29 A;  4MB7 A;  4IJF A;  3U6Q A;  4M0D A;  2C9C A;  4BBA A;  1GJT A;  3KDS E;  4YY3 M;  3W68 A;  3VKG A;  3AJI B;  3HGI A;  1WXQ A;  3GP1 A;  2V6Z M;  4G4R A;  4L16 A;  1K3X A;  4B3R M;  3D8B A;  4KHP M;  2KRU A;  3GLH E;  3L26 A;  3FUW A;  3I51 A;  3PNV A;  3GRY A;  4REZ A;  1NY5 A;  1ZV1 A;  1PJS A;  2CHV A;  4IBG A;  2QHO B;  1YE9 A;  3A46 A;  2JY6 B;  4OU7 A;  2Q2E B;  5KQ8 A;  4F2L A;  1IBL M;  3SAR A;  1R5L A;  8CAT A;  3LCU A;  3SAW A;  4GMQ A;  4IJE A;  1E94 E;  2BWE A;  2LVP C;  2QBY B;  1Z6T A;  2KW0 A;  4RF0 A;  4MGI E;  4L78 A;  4NXN M;  3HHX A;  2F5N A;  2Z7J A;  3UJN A;  1XXH B;  2GNO A;  1J5E M;  1X37 A;  3TL4 X;  2EJS A;  1VG5 A;  1PJI A;  2DAK A;  1GL6 A;  2MH8 A;  3A98 B;  4IBE A;  2Z4R A;  1N36 M;  1MJG M;  2F5P A;  3RE8 A;  2QQ8 A;  4OX9 M;  5ITR A;  2QBY A;  2GQF A;  2Z4S A;  3L27 A;  3C58 A;  1K82 A;  3CTW B;  4JI3 M;  3J7B A;  3FD9 A;  2DHR A;  1NO1 A;  4IBC A;  3QYE A;  1ZMU A;  3GRV A;  4LJA A;  3BBZ A;  1QZE A;  3E4R A;  4NRW A;  1N34 M;  3AFH A;  5FTJ A;  1IY2 A;  4MH0 E;  2DAM A;  4GC5 A;  3K1J A;  2CHQ A;  3U60 B;  4LF8 M;  1GVN A;  4XGI A;  4P16 A;  1GAB A;  1T3T A;  1AUA A;  3PNY A;  1DGF A;  1VEG A;  5DFL A;  1Z5A A;  5DYI A;  1WJ7 A;  4MGZ E;  3DA1 A;  3LQQ A;  1H6U A;  3PVS A;  3GLF A;  4CGY B;  1QZM A;  3GLI A;  2DKL A;  1WIV A;  4UN2 B;  1IFY A;  4LF6 M;  1V92 A;  4X65 M;  3SAS A;  1N78 A;  1Y8G A;  4R3D A;  3U6L A;  2F5Q A;  3NBX X;  1C1K A;  2Z8Y M;  2V1U A;  4LJ4 A;  2LXE A;  2VDB B;  1HQY E;  2YQZ A;  1I94 M;  3ZCB B;  1IM2 A;  2XH9 A;  4G6Z A;  3I4Y A;  1GKI A;  3FKE A;  4B7H A;  4NOO B;  3HJS A;  2CWB A;  1WR1 B;  4LGY A;  4PDI A;  2ZTC A;  4JV5 M;  4DV6 M;  4JI8 M;  1IN5 A;  2M60 A;  3J81 S;  3SYK A;  1R2Z A;  1QVR A;  3MMP A;  2OO9 A;  3B7N A;  2JUJ A;  2JZ1 A;  2Y0T A;  2ZTD A;  4WP2 A;  1E9S A;  1EIJ A;  4AKI A;  4B7G A;  3KXE C;  3GLH A;  3RFW A;  1OFH A;  1WHC A;  2JP7 A;  3RGP A;  2J7N A;  4DBG B;  2HCB A;  4GC9 A;  5EXT A;  4DR3 M;  4RKU F;  4Z6Y A;  2VF8 A;  2UU9 M;  1XNR M;  3KFU G;  3SC3 A;  3U5Z A;  3K92 A;  2D7H A;  2E5L M;  3M7G A;  7CAT A;  2F5O A;  3HU1 A;  4XBO A;  4D82 A;  2BJV A;  1LTM A;  1IN6 A;  3SHG B;  1PM5 A;  4LF9 M;  3HHZ A;  2KRK A;  4W5W A;  2L7H A;  3KP0 E;  1HT2 E;  1VEK A;  2RRU A;  4R7G A;  4AZF A;  5A2Q S;  2HHH M;  4QNR A;  3TWM A;  3TPZ A;  2R6F A;  1BVS A;  1J7K A;  2QP9 X;  5F3W A;  2QCU A;  5IWA M;  3D8L A;  1XB2 B;  2HWJ A;  3I01 M;  3GPX A;  3VKH A;  1IY1 A;  2DVW B;  1XMQ M;  1D2N A;  1QDR A;  2WSE F;  4XK8 F;  4DR2 M;  2FOI C;  2RKO A;  3C3D A;  4JI2 M;  3U60 A;  3UMM A;  2MR9 A;  3Q8G A;  4ANR A;  1PJJ A;  1VEJ A;  2QNJ A;  2UXC M;  4I8O A;  3J2P B;  2C9O A;  1VDL A;  4AG6 A;  5LMN M;  3DOA A;  2UXB M;  4AKH A;  3OTO M;  5KPT A;  5EP2 A;  5H37 D;  2KNA A;  4KT0 F;  1NNJ A;  4LJ7 A;  5ITT A;  4CJ6 A;  4FWD A;  2DWZ B;  1WGN A;  1N32 M;  1S3S A;  2ZBK B;  1NJF A;  3R9X B;  4DR5 M;  3FTF A;  3F92 A;  1IBM M;  2V1C A;  3B7Z A;  4NL4 H;  1DO2 A;  4P17 A;  5KQD A;  4MGH A;  2FE8 A;  2XSZ A;  3Q8X A;  4K0K M;  1MX0 A;  3FTD A;  3H4J A;  2CFO A;  3GLF E;  4DUZ M;  1VQ1 A;  3VDU A;  2Y0Q A;  3KP1 E;  4M9S A;  1DO0 A;  3GPY A;  3U6S A;  1R7R A;  3IHP A;  4AW4 A;  3IG8 A;  1HR0 M;  3SFZ A;  5LMU M;  1N75 A;  1UM8 A;  2BNK A;  2G3Q A;  4LJ9 A;  4DV0 M;  3SMP A;  4FCW A;  4GKK M;  1FNN A;  3U6O A;  2O01 F;  2M5Z A;  4EIW A;  5JI3 E;  4NRV A;  4FCT A;  5IRE B;  2DHY A;  4B3S M;  1Q39 A;  2QZ4 A;  3JAM S;  2LNH C;  3DZD A;  3NBI A;  1D0M A;  2F4V M;  1ZQ9 A;  3GRU A;  5FSW A;  3U6C A;  3MHV C;  5ITX A;  3AKZ A;  4DV2 M;  5EXS A;  2YFQ A;  3KVW A;  1N77 A;  1Z5B A;  2DWN A;  2JZ0 A;  5ITY A;  3GLI E;  1L1T A;  2JWS A;  2RGO A;  3ZH9 B;  1KFV A;  1EFU B;  1SG9 A;  2VQE M;  3K2L A;  4LCB A;  2XFS A;  1MU5 A;  1V33 A;  4JI4 M;  2KNZ A;  1IXS A;  3CF2 A;  4X62 M;  2OOA A;  2EA0 A;  4GH9 A;  2J7O A;  1XXH E;  5E6J A;  1WGL A;  1LV7 A;  2L2D A;  4X64 M;  5E26 A;  1YLA A;  2K6B A;  4M9X A;  2N35 A;  1G41 A;  2X8A A;  1JQJ C;  3KW6 A;  4FWH A;  1G4A E;  3WHL A;  5BPV A;  4AQY M;  1D0K A;  3U61 A;  1SXJ B;  4GHA A;  3M0E A;  4JXJ A;  2EUC A;  1OIZ A;  2LBC A;  4DUY M;  3B89 A;  4AI6 A;  3KOZ E;  3HHY A;  3BXW A;  2K9D A;  1HNW M;  2VF7 A;  1Z5C A;  1NVM A;  2BWB A;  4FD2 A;  1R6B X;  1DGH A;  1TDH A;  3B74 A;  3SYL A;  2KNV A;  4IBB A;  2C5R A;  2K0B X;  1TF0 B;  3VLF B;  3SAU A;  1NV8 A;  2JXN A;  2CRU A;  2XEP A;  4KLN A;  4JN6 A;  1L1Z A;  2XGN A;  1JR3 A;  3MK6 A;  3GLI B;  1G3I A;  3GLF B;  3L28 A;  1JB0 F;  1ZAE A;  4OVZ A;  2EKK A;  1HT1 E;  1RU3 A;  1HNX M;  1A5T A;  1OFI A;  3HJQ A;  3QAU A;  4ITQ A;  1IXZ A;  4LF7 M;  2CV0 A;  4S12 A;  3IG5 A;  3FUV A;  2DAI A;  2FNA A;  4D81 A;  3GLG E;  4PDG A;  2HAK A;  2WSF F;  3J80 S;  2MJ5 B;  3K8Z A;  3QYB A;  2CP8 A;  3LVW A;  2C99 A;  4FCV A;  4WW0 A;  3PXG A;  4PT5 A;  3L2A A;  2DXI A;  1NSF A;  1L2C A;  2XZU A;  4CHT B;  2QEN A;  2Y21 A;  3FUX A;  2FS1 A;  4B3T M;  3KS4 A;  1SXJ D;  5C18 A;  1DGH B;  2R44 A;  1QYR A;  2YR0 A;  3FE3 A;  3ZQJ A;  1EE8 A;  1K3W A;  1TH3 A;  2XLJ A;  4M9Z A;  1R2Y A;  3HU2 A;  1Z59 A;  3SHF A;  2DEN A;  4GIT A;  4Z8X A;  4GHL A;  3JR4 A;  1SXJ A;  5KPR A;  2DNA A;  3U61 B;  1YSY A;  2LHG A;  3VK8 A;  4AKG A;  2QSF X;  1XXH A;  4NSO B;  1HQC A;  4LG2 A;  1G71 A;  1PGY A;  3LVV A;  3U6M A;  2R18 A;  2L4E A;  1PJT A;  3U6D A;  3SAT A;  2ZAN A;  2JY8 A;  1PRB A;  2HKJ A; 
#chains in the Genus database with same CATH homology
 1DO2 A;  2B3T A;  2EKF A;  2EJS A;  1VG5 A;  2DAK A;  3K9O A;  3H4J A;  3GLF E;  1VQ1 A;  4F1I A;  1DO0 A;  1C7Y A;  3IHP A;  2OOB A;  3LCV B;  1OTR A;  2G3Q A;  1ZMU A;  3IEC A;  3BBZ A;  1QZE A;  1OQY A;  1OAI A;  2DI0 A;  2KHH A;  2O25 A;  1KYI A;  2DHY A;  2DAM A;  2R0I A;  3FRI A;  2LVA A;  1Q02 A;  1VEG A;  5DFL A;  3T6P A;  1TR8 A;  1WJ7 A;  1NV9 A;  2DKL A;  1WIV A;  1HJP A;  2JZ0 A;  4UN2 B;  3E21 A;  3GLI E;  1IFY A;  1V92 A;  1EFU B;  1SG9 A;  1Y8G A;  1AIP C;  2JY5 A;  2KNZ A;  1IXS A;  1HQY E;  2LVO C;  1MN3 A;  2OOA A;  1IM2 A;  4HEO A;  1XXH E;  1WGL A;  2CWB A;  1GO5 A;  1WR1 B;  2MRO B;  2L2D A;  2ZTC A;  1YLA A;  1G41 A;  5JI2 E;  1G4A E;  1P3Q Q;  1T6O A;  1CUK A;  1OKS A;  3MMP A;  2OO9 A;  2JUJ A;  2JZ1 A;  2LBC A;  3B89 A;  2ZTD A;  4WP2 A;  1ZMV A;  2L4F A;  4R71 A;  2K9D A;  2BWB A;  1WHC A;  2JP7 A;  4DBG B;  1UFZ A;  2KNV A;  1T43 A;  2K0B X;  2JY7 A;  1NV8 A;  4G3O A;  1R4G A;  1G3I A;  1JR3 E;  1ZMW A;  2LVN C;  2JNH A;  2EKK A;  1HT1 E;  1A5T A;  2MGW A;  1HT2 E;  1TTE A;  1VEK A;  2RRU A;  4Q7J A;  2DAE A;  2LVQ D;  2DAI A;  1DV0 A;  2LTU A;  1BVS A;  3GLG E;  3FRH A;  2HAK A;  1F4I A;  2MJ5 B;  3K9P A;  2CP8 A;  1XB2 B;  2HWJ A;  2WZJ A;  3GLH E;  2MR9 A;  3FE3 A;  1VEJ A;  2QNJ A;  2DZL A;  2DAG A;  1ZV1 A;  1VDL A;  2QHO B;  2JY6 B;  2DEN A;  4GEW A;  4F2L A;  2KNA A;  3LCU A;  2DNA A;  1E94 E;  1WGN A;  2BWE A;  2QSF X;  2LVP C;  1PGY A;  2L4E A;  2H5X A;  3F92 A;  3E46 A;  2JY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...