2DAMA

Solution structure of the novel identified uba-like domain in the n-terminal of human etea protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ETEA protein
publication title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human ETEA Protein
rcsb
source organism Homo sapiens
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2damA00
1DO2A 1V92A 2MROB 1VG5A 3GLGE 1DO0A 3T6PA 2CP8A 2KHHA 1DV0A 2K0BX 1IM2A 2BWBA 2KNZA 2JZ1A 2KNVA 1HQYE 4HEOA 2JY7A 2DNAA 2O25A 3K9OA 2ZTCA 3GLFE 3IECA 1NV9A 1UFZA 1IXSA 1F4IA 1VEKA 4GEWA 1G4AE 2LBCA 2DHYA 3BBZA 3FRIA 1TR8A 4F1IA 2HAKA 1P3QQ 1SG9A 2G3QA 1PGYA 2MJ5B 1T6OA 3K9PA 1WIVA 1A5TA 2LVQD 1ZMUA 2LVOC 2JNHA 4R71A 1JR3E 1XXHE 2HWJA 2DAKA 1C7YA 2LVAA 2L4FA 2JP7A 1IFYA 1EFUB 1CUKA 1WHCA 2CWBA 2WZJA 2EJSA 2B3TA 1BVSA 2DAIA 1VQ1A 1NV8A 3LCUA 1ZMWA 1E94E 1Q02A 2QHOB 2JY8A 1T43A 2L2DA 2L4EA 3MMPA 1WGNA 1VDLA 1WGLA 2LTUA 2LVNC 1WR1B 1VEGA 3E21A 2QNJA 2MGWA 2EKFA 2DAGA 4Q7JA 2OO9A 3B89A 1ZV1A 2EKKA 4F2LA 3FRHA 4UN2B 3FE3A 3H4JA 3IHPA 1XB2B 2DZLA 2DKLA 4WP2A 5DFLA 2R0IA 3GLIE 1WJ7A 1KYIA 2QSFX 2DENA 2JY6B 1YLAA 1GO5A 2K9DA 2RRUA 2DAEA 2OOAA 2OOBA 1R4GA 1G41A 2DAMA 1OKSA 2H5XA 2LVPC 2JUJA 4DBGB 2JY5A 3F92A 1AIPC 1ZMVA 2BWEA 1Y8GA 1HJPA 2KNAA 2ZTDA 2MR9A 3E46A 3LCVB 2DI0A 1HT2E 1TTEA 1G3IA 1OQYA 1VEJA 3GLHE 5JI2E 1OAIA 1MN3A 1HT1E 1OTRA 4G3OA 1QZEA 2JZ0A
chains in the Genus database with same CATH superfamily
3HJSA 1VG5A 1Z5BA 4AW4A 1DO0A 4PD2A 4LGMA 4MH0E 4DR6M 1DGGA 3GRUA 4IBBA 5ITXE 1IN4A 2C98A 3TWLA 3B7ZA 1HQYE 5E26A 3I01M 2JY7A 2HKJA 4IBKA 1L8QA 3IECA 1UFZA 3SMPA 4QHTA 1IXSA 1L2BA 1E9SA 3RFWA 4YY3M 4DV7M 1I94M 2LBCA 2Z4SA 2ZAOA 5C18A 2R4EA 4FWGA 5ITQA 4P17A 3BBZA 2K47A 4D80A 1TR8A 4F1IA 1P3QQ 3U6PA 1SG9A 4JI2M 2MJ5B 1XMOM 4M0WA 4I8OA 3VK7A 2I7PA 5IZ7D 4AQYM 2DVWB 3CF6E 2F5OA 4I81A 1DGFA 1A5TA 5FSWA 2OQ4A 4ZPXA 4LJ5A 3AL0C 1NJFA 2R6FA 2BNKA 3GRYA 2RKOA 2C5RA 2HWJA 2HHHM 3MHVC 1C7YA 2L4FA 2UUCM 4JI5M 1IXZA 3J81S 2EJSA 2R18A 1GL6A 5EQTA 1GKIA 4NRVA 4FWHA 1TH4A 4PDIA 2UXBM 1JQJC 2DAIA 2FFJA 2C96A 3CF2A 4JI7M 1ZMWA 1Q02A 2QHOB 2VF8A 4NL4H 4RF1A 2ZM6M 1T43A 2DWLA 2F5QA 1G59A 2CUZA 4KT0F 4B3TM 3TE6A 4DV1M 1VDLA 1XXHA 1WGLA 2LTUA 3VDPA 2Y0TA 4LJ8A 1WR1B 1VEGA 4Y28F 3RE8A 3KW6A 2F5NA 5FTJA 2MGWA 3W0FA 4YHHM 3LMMA 3T38A 3RGSA 1SXJA 4MGHA 4IBGA 1ZV1A 2HCBA 1PM5A 1FNNA 2C99A 1QAOA 2D7EA 4D81A 3FE3A 4D82A 1E32A 4HL4A 2XFTA 3GLHB 2DKLA 3FUTA 3SHGB 3ZQJA 4IBJA 2UXDM 1IY2A 2KDLA 3AV0A 4DR3M 2J5YA 2XSZD 2QSFX 4M9XA 1W5SA 2FNAA 4OVZA 2DWMA 3GLGB 1YLAA 2X8AA 3I04M 2K9DA 3DOAA 3BXWA 3B7QA 2DAEA 2G5GX 3AOGA 5DNYA 3GO8A 1HNZM 4JXJA 1IN7A 1PJTA 1R4GA 2L7IA 3FKEA 5ITTA 3HY5A 2Z3XA 3SAWA 5FTLA 5FTKA 2ZBKB 3CF0A 1D0LA 1W5TA 1XNRM 3KS4A 1C1KA 5EP2A 1PRBA 2JUJA 2D7HA 1MJGM 1OFIA 3FYCA 4LF6M 2QQ8A 1E9RA 3K1JA 3F92A 4S12A 2BWEA 3U6MA 3KP1E 3U6EA 3PXGA 2MR9A 3HWSA 1R2ZA 4QOZC 1TTEA 3U6CA 4IBEA 1IQPA 1QUSA 1VEJA 2YR0A 1X37A 4QNRA 3VDUA 4B7HA 4CGYB 2VQEM 4DUYM 2V1UA 3HJ8A 1QZEA 3DFZA 1IBKM 4K0KM 4MGKE 4HLQA 3K8ZA 3M0EA 3PFIA 4I5SA 5FTNA 3T6PA 1NY6A 2ZANA 3ILKA 1VDDA 3B7NA 5KPRA 4LF9M 1Q3BA 5KQDA 3GPUA 3T1YM 3HGIA 3LW5F 3VFDA 3SFZA 4LF4M 4QOSA 4M9ZA 5DYIA 4M9SA 4JI4M 3GLFE 3CTWB 1PJIA 2N35A 4B3MM 1NV9A 2F4VM 4DR5M 2A5YB 2LHGA 4KHPM 3U60A 1G4AE 2KZUA 4GMQA 1WXQA 4GKJM 5DYGA 2WSEF 5KQ8A 4MM3B 1N77A 4EIWA 5EXSA 4PDGA 3KOZE 3SAVA 1YUBA 5ITXA 3J80S 4B3SM 5EP4A 1YE9A 2CE7A 3HU2A 3KOXE 4FCTA 5BR8M 2ZAMA 3HJQA 1TDHA 4DV6M 2V6ZM 3M7GA 2XEPA 1IN5A 4CHTB 3VKGA 1Q39A 2QCUA 3KVWA 2CEAA 4I4LA 1XWIA 2R44A 4G4NA 2DXIA 3NWLA 4REZA 1L2CA 1J7KA 1DGHA 2M5ZA 2LNHC 1IFYA 1XC8A 2CWBA 1XHBA 2X49A 4IBFA 2RGHA 2Y21A 1NY5A 1BVSA 3GLIB 2QZ4A 4Z8XA 3L25A 3GPXA 2KA6B 4L16A 4OX9M 1E94E 2L2DA 3B9PA 2L4EA 3R9XB 1V34A 2Y0QA 2XLJA 2Z7JA 3E4RA 3J2PB 1NNUC 1WGNA 2R46A 1QAQA 3FTDA 4AG6A 4CISA 1QUTA 4PCZA 3EIEA 2WSFF 4BB9A 4JI6M 3SATA 4XGIA 4G4RA 4JYAM 2P5TA 2EKFA 1TH3A 3HU3A 1TF0B 5ITRA 2L09A 5ITUA 2VF7A 2O5RA 1OIZA 2LH0A 5EXPA 3H4JA 3SARA 3T1HM 3GPYA 2ERCA 2UU9M 4WP2A 3FYDA 4LRTA 4QHSA 1D0KA 1G8PA 4L15A 2L7HA 4LZJA 4X65M 2D7GA 1RU3A 1WJ7A 1KYIA 1IXRC 3U6LA 4W5WA 1R5LA 2R4JA 2DWZB 3D8LA 3KXEC 2VQFM 3KDSE 2APLA 4NSOB 3RGPA 4L8RC 4BLCA 1G41A 4LF5M 5L8RF 1OKSA 2F5PA 1G71A 4LY6A 4P16A 3LQRA 2KZSA 1Z5AA 1AUAA 1Z6TA 3SYKA 4DV5M 3UK6A 3SAUA 1KSFX 2KW0A 3A42A 1V33A 3D8BA 4PT5A 1GVNA 1UM8A 2LVPC 3IG5A 3KSJA 4DBGB 3U61A 4NRWA 2J7OA 3J7AS 1ZAEA 2JY5A 3U5ZA 4DV4M 5LMNM 2J7NA 1ZMVA 3JAMS 1HJPA 2EA0A 2Q2EB 1KFVA 3U6SA 2LHCA 3LCVB 3ZCBB 4CJ6A 4AKIA 4GITA 3U6OA 4XK8F 3GLHE 4JI1M 1QDRA 2X4AA 1OAIA 2XH9A 3GRRA 4JI0M 3VKHA 1OTRA 4G3OA 4RF0A 1QZMA 3KS8A 3I51A 1DO2A 3KOWE 1GJSA 2XSZA 3GLGE 4CIZA 3JR4A 1MU5A 4GHAA 1N33M 2K0BX 1K82A 3TPZA 2YQZA 3W0LB 1HQCA 5LMUM 4L4UA 3KOYE 3H4MA 4JI3M 1XXHB 1J09A 2GNOA 2JZ1A 2KNZA 2NQ8C 1R7RA 4NC6A 3SC3A 4AG5A 4LJ6A 4HEOA 5BPVA 3QYBA 2O25A 2EO2A 3FD9A 3L29A 3I4YA 8CATA 4JN6A 4LCBA 1SXJB 4LJ4A 4GEWA 5FTMA 3U6QA 2CV0A 1PJJA 1GABA 4NSRA 2CV1A 4L6V6 2YFQA 4KLNA 1J5EM 2CFOA 2DHRA 2L6OA 3I4VA 4BBAA 1JR3D 3E9SA 5F3WA 3WHKA 1TH2A 2CHQA 2QBYB 3GQ3A 1QANA 3GRVA 3C58A 2UXCM 2C9OA 4MGIE 1WIVA 4LGYA 2CHGA 3GLFA 2H1RA 4RNAA 2LVQD 4AI6A 1ZMUA 3TWKA 2LVOC 1MX0A 2JNHA 4LJ9A 4RKUF 4AKHA 4R71A 5KO3A 1JR3E 2LVAA 1TGUA 3NBXX 1EFUB 1OIPA 2XF3A 3FUUA 2Z8YM 4GC5A 2WZJA 4KO8A 2KRKA 1GLNA 1NSFA 2JA2A 4B08A 4X62M 1D0MA 2BJVA 1VQ1A 3LCUA 5ITYA 2E5LM 1N32M 3PVSA 3KFUG 3A46A 1HR0M 3MMPA 1L1TA 1ORYB 1HNXM 2LVNC 4NOOB 2O01F 1EE8A 3E21A 2I7NA 2VIIA 5A2QS 2BJWA 1IBLM 4IBDA 1OAOC 1NO1A 2DZNB 2DAGA 2VDBB 3B89A 3Q8XA 3A98B 3HHYA 4F2LA 3K92A 5EP1A 3UZUA 3EIHA 2W82A 1Z59A 4OU7A 1R6BX 3M6AA 4FD2A 2G8LA 2R0IA 3AJIB 3GLIE 3DA1A 4DR7M 2C9CA 4LFAM 2KXEA 3HHXA 2CRUA 1GO5A 3QYEA 3UJNA 1QDTA 4KODA 4WW0A 7CATA 2OOBA 3UMMA 3GPPA 2DAMA 3K2LA 4B3RM 3VLFB 2R62A 3HKPA 5KPTA 4AZFA 2MH8A 3HX3A 3AFHA 4G6ZA 3L27A 5IWAM 3AKZA 2XZUA 3C3DA 1OJLA 4JV5M 3J7BA 3KP0E 4GHLA 5KPZA 4GIPA 1IN6A 3C9PA 1IN8A 3FUVA 4II7A 3E46A 4LJAA 3J27B 3LVWA 2DI0A 3SHFA 3FUXA 1DGHB 2XZFA 1G3IA 1OQYA 4WURA 4B7FA 5C1BA 3HZJA 4GH9A 5EJCA 2LWXA 4LRSA 1IXSB 3CGWA 4DV3M 2KRUA 2XFSA 2JZ0A 3ZH9B 2GQFA 1V92A 4LF8M 2MROB 3MJ5A 4IJEA 3WHLA 4ITQA 2CP8A 2WSCF 2KHHA 4IBIA 4QNMA 4Z6YA 1DV0A 2LXEA 1IM2A 2BWBA 3AOEC 3ZC7B 2KNVA 5EXXA 2R65A 3FTCA 3L2AA 2DNAA 2FS1A 3GLHA 3K9OA 1Z5CA 4L78A 2ZTCA 2Z4RA 1N36M 1F4IA 4M0DA 1VEKA 4LZZA 4R7GA 2HL7A 3HHWA 4X66M 1L1ZA 1T3TA 2DWNA 3GQ4A 3SMSA 3GLGA 4NXMM 1NJGA 4MGZE 2DHYA 3UGJA 2K6BA 5E6JA 3BOSA 3FRIA 4MGYE 4G4QA 3W67A 4DV0M 3HU1A 5H37D 2HAKA 2QPAA 3TQSA 2G3QA 1PGYA 4GC9A 1T6OA 3L26A 3K9PA 1NNJA 1QVRA 2M60A 4G4OA 1NHWC 4MB7A 1JB0F 1SXJD 1PJSA 3TWMA 2DZOB 1YSYA 1OFHA 3W68A 4X64M 1NVMA 2EUCA 1XXHE 3THGA 3R8FA 1QAMA 2DAKA 3T15A 2JP7A 4FCVA 3OTOM 4FCWA 1CUKA 3HHZA 1WHCA 4LF7M 4DR2M 3U61B 1D2NA 2B3TA 1R2YA 3VK8A 2QBYA 3B74A 3NBIA 1ZQ9A 4DV2M 1SXJE 3U5ZB 2V1CA 2UUAM 4LFCM 1HNWM 5IT9S 1NV8A 1NHGC 1N78A 3PNVA 2JY8A 3MK6A 3SYLA 2FE8A 4DR1M 2FOIC 4A3VB 2QP9X 2F5SA 1K3XA 3GP1A 1JR3A 4NXNM 3KSXA 1GL7A 3A45A 3TL4X 1XMQM 4OVZB 2QNJA 3FTEA 4TUWA 4Q7JA 4LFBM 3DZDA 2OO9A 4GRIA 5FLXS 1TDZA 2EKKA 3QWLA 1QQWA 4IBCA 3IG8A 2XGNA 2JWSA 2CHVA 3FRHA 1QYRA 4UN2B 1XNQM 3GQ5A 3IHPA 4AKGA 4ANRA 1XB2B 3SBJA 2DZLA 3LQQA 4LG2A 5JI3E 1IY1A 4IJFA 5DFLA 4GKKM 3Q8GA 4JI8M 4OW0A 1N34M 1S3SA 3U6DA 3FUWA 2DENA 2JY6B 1Q3CA 5IREB 4FVMA 4IIWA 2RRUA 3SASA 1L2DA 2OOAA 3AOEA 2R45A 4B7GA 4LJ7A 1DGBA 3FTFA 1LTMA 2FH0A 2RGOA 2CV2A 2JXNA 3C3EA 4R3DA 2H5XA 3GLFB 4XBOA 5GKNA 2AHMA 3JR5A 1IY0A 4DUZM 1EIJA 3L28A 3GLIA 1AIPC 1H6UA 3LVVA 5EP3A 1FJGM 1I4WA 4DR4M 1Y8GA 1IBMM 1SXJC 3QAUA 4FWDA 1N75A 2KNAA 2YNMD 2ZTDA 1K3WA 1LV7A 1HT2E 2KEBA 1GJTA 2Y20A 5EXTA 3PNYA 5JI2E 2OPFA 2UUBM 1MN3A 3V76A 1HT1E 2QENA 4FW9A 3U60B 1PJQA
chains in the Genus database with same CATH topology
1DO2A 1V92A 2MROB 1VG5A 3GLGE 1DO0A 3T6PA 2CP8A 2KHHA 1DV0A 2K0BX 1IM2A 2BWBA 2KNZA 2JZ1A 2KNVA 1HQYE 4HEOA 2JY7A 2DNAA 2O25A 3K9OA 2ZTCA 3GLFE 3IECA 1NV9A 1UFZA 1IXSA 1F4IA 1VEKA 4GEWA 1G4AE 2LBCA 2DHYA 3BBZA 3FRIA 1TR8A 4F1IA 2HAKA 1P3QQ 1SG9A 2G3QA 1PGYA 2MJ5B 1T6OA 3K9PA 1WIVA 1A5TA 2LVQD 1ZMUA 2LVOC 2JNHA 4R71A 1JR3E 1XXHE 2HWJA 2DAKA 1C7YA 2LVAA 2L4FA 2JP7A 1IFYA 1EFUB 1CUKA 1WHCA 2CWBA 2WZJA 2EJSA 2B3TA 1BVSA 2DAIA 1VQ1A 1NV8A 3LCUA 1ZMWA 1E94E 1Q02A 2QHOB 2JY8A 1T43A 2L2DA 2L4EA 3MMPA 1WGNA 1VDLA 1WGLA 2LTUA 2LVNC 1WR1B 1VEGA 3E21A 2QNJA 2MGWA 2EKFA 2DAGA 4Q7JA 2OO9A 3B89A 1ZV1A 2EKKA 4F2LA 3FRHA 4UN2B 3FE3A 3H4JA 3IHPA 1XB2B 2DZLA 2DKLA 4WP2A 5DFLA 2R0IA 3GLIE 1WJ7A 1KYIA 2QSFX 2DENA 2JY6B 1YLAA 1GO5A 2K9DA 2RRUA 2DAEA 2OOAA 2OOBA 1R4GA 1G41A 2DAMA 1OKSA 2H5XA 2LVPC 2JUJA 4DBGB 2JY5A 3F92A 1AIPC 1ZMVA 2BWEA 1Y8GA 1HJPA 2KNAA 2ZTDA 2MR9A 3E46A 3LCVB 2DI0A 1HT2E 1TTEA 1G3IA 1OQYA 1VEJA 3GLHE 5JI2E 1OAIA 1MN3A 1HT1E 1OTRA 4G3OA 1QZEA 2JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO2 A;  1V92 A;  2MRO B;  1VG5 A;  3GLG E;  1DO0 A;  3T6P A;  2CP8 A;  2KHH A;  1DV0 A;  2K0B X;  1IM2 A;  2BWB A;  2KNZ A;  2JZ1 A;  2KNV A;  1HQY E;  4HEO A;  2JY7 A;  2DNA A;  2O25 A;  3K9O A;  2ZTC A;  3GLF E;  3IEC A;  1NV9 A;  1UFZ A;  1IXS A;  1F4I A;  1VEK A;  4GEW A;  1G4A E;  2LBC A;  2DHY A;  3BBZ A;  3FRI A;  1TR8 A;  4F1I A;  2HAK A;  1P3Q Q;  1SG9 A;  2G3Q A;  1PGY A;  2MJ5 B;  1T6O A;  3K9P A;  1WIV A;  1A5T A;  2LVQ D;  1ZMU A;  2LVO C;  2JNH A;  4R71 A;  1JR3 E;  1XXH E;  2HWJ A;  2DAK A;  1C7Y A;  2LVA A;  2L4F A;  2JP7 A;  1IFY A;  1EFU B;  1CUK A;  1WHC A;  2CWB A;  2WZJ A;  2EJS A;  2B3T A;  1BVS A;  2DAI A;  1VQ1 A;  1NV8 A;  3LCU A;  1ZMW A;  1E94 E;  1Q02 A;  2QHO B;  2JY8 A;  1T43 A;  2L2D A;  2L4E A;  3MMP A;  1WGN A;  1VDL A;  1WGL A;  2LTU A;  2LVN C;  1WR1 B;  1VEG A;  3E21 A;  2QNJ A;  2MGW A;  2EKF A;  2DAG A;  4Q7J A;  2OO9 A;  3B89 A;  1ZV1 A;  2EKK A;  4F2L A;  3FRH A;  4UN2 B;  3FE3 A;  3H4J A;  3IHP A;  1XB2 B;  2DZL A;  2DKL A;  4WP2 A;  5DFL A;  2R0I A;  3GLI E;  1WJ7 A;  1KYI A;  2QSF X;  2DEN A;  2JY6 B;  1YLA A;  1GO5 A;  2K9D A;  2RRU A;  2DAE A;  2OOA A;  2OOB A;  1R4G A;  1G41 A;  2DAM A;  1OKS A;  2H5X A;  2LVP C;  2JUJ A;  4DBG B;  2JY5 A;  3F92 A;  1AIP C;  1ZMV A;  2BWE A;  1Y8G A;  1HJP A;  2KNA A;  2ZTD A;  2MR9 A;  3E46 A;  3LCV B;  2DI0 A;  1HT2 E;  1TTE A;  1G3I A;  1OQY A;  1VEJ A;  3GLH E;  5JI2 E;  1OAI A;  1MN3 A;  1HT1 E;  1OTR A;  4G3O A;  1QZE A;  2JZ0 A; 
#chains in the Genus database with same CATH topology
 3HJS A;  1VG5 A;  1Z5B A;  4AW4 A;  1DO0 A;  4PD2 A;  4LGM A;  4MH0 E;  4DR6 M;  1DGG A;  3GRU A;  4IBB A;  5ITX E;  1IN4 A;  2C98 A;  3TWL A;  3B7Z A;  1HQY E;  5E26 A;  3I01 M;  2JY7 A;  2HKJ A;  4IBK A;  1L8Q A;  3IEC A;  1UFZ A;  3SMP A;  4QHT A;  1IXS A;  1L2B A;  1E9S A;  3RFW A;  4YY3 M;  4DV7 M;  1I94 M;  2LBC A;  2Z4S A;  2ZAO A;  5C18 A;  2R4E A;  4FWG A;  5ITQ A;  4P17 A;  3BBZ A;  2K47 A;  4D80 A;  1TR8 A;  4F1I A;  1P3Q Q;  3U6P A;  1SG9 A;  4JI2 M;  2MJ5 B;  1XMO M;  4M0W A;  4I8O A;  3VK7 A;  2I7P A;  5IZ7 D;  4AQY M;  2DVW B;  3CF6 E;  2F5O A;  4I81 A;  1DGF A;  1A5T A;  5FSW A;  2OQ4 A;  4ZPX A;  4LJ5 A;  3AL0 C;  1NJF A;  2R6F A;  2BNK A;  3GRY A;  2RKO A;  2C5R A;  2HWJ A;  2HHH M;  3MHV C;  1C7Y A;  2L4F A;  2UUC M;  4JI5 M;  1IXZ A;  3J81 S;  2EJS A;  2R18 A;  1GL6 A;  5EQT A;  1GKI A;  4NRV A;  4FWH A;  1TH4 A;  4PDI A;  2UXB M;  1JQJ C;  2DAI A;  2FFJ A;  2C96 A;  3CF2 A;  4JI7 M;  1ZMW A;  1Q02 A;  2QHO B;  2VF8 A;  4NL4 H;  4RF1 A;  2ZM6 M;  1T43 A;  2DWL A;  2F5Q A;  1G59 A;  2CUZ A;  4KT0 F;  4B3T M;  3TE6 A;  4DV1 M;  1VDL A;  1XXH A;  1WGL A;  2LTU A;  3VDP A;  2Y0T A;  4LJ8 A;  1WR1 B;  1VEG A;  4Y28 F;  3RE8 A;  3KW6 A;  2F5N A;  5FTJ A;  2MGW A;  3W0F A;  4YHH M;  3LMM A;  3T38 A;  3RGS A;  1SXJ A;  4MGH A;  4IBG A;  1ZV1 A;  2HCB A;  1PM5 A;  1FNN A;  2C99 A;  1QAO A;  2D7E A;  4D81 A;  3FE3 A;  4D82 A;  1E32 A;  4HL4 A;  2XFT A;  3GLH B;  2DKL A;  3FUT A;  3SHG B;  3ZQJ A;  4IBJ A;  2UXD M;  1IY2 A;  2KDL A;  3AV0 A;  4DR3 M;  2J5Y A;  2XSZ D;  2QSF X;  4M9X A;  1W5S A;  2FNA A;  4OVZ A;  2DWM A;  3GLG B;  1YLA A;  2X8A A;  3I04 M;  2K9D A;  3DOA A;  3BXW A;  3B7Q A;  2DAE A;  2G5G X;  3AOG A;  5DNY A;  3GO8 A;  1HNZ M;  4JXJ A;  1IN7 A;  1PJT A;  1R4G A;  2L7I A;  3FKE A;  5ITT A;  3HY5 A;  2Z3X A;  3SAW A;  5FTL A;  5FTK A;  2ZBK B;  3CF0 A;  1D0L A;  1W5T A;  1XNR M;  3KS4 A;  1C1K A;  5EP2 A;  1PRB A;  2JUJ A;  2D7H A;  1MJG M;  1OFI A;  3FYC A;  4LF6 M;  2QQ8 A;  1E9R A;  3K1J A;  3F92 A;  4S12 A;  2BWE A;  3U6M A;  3KP1 E;  3U6E A;  3PXG A;  2MR9 A;  3HWS A;  1R2Z A;  4QOZ C;  1TTE A;  3U6C A;  4IBE A;  1IQP A;  1QUS A;  1VEJ A;  2YR0 A;  1X37 A;  4QNR A;  3VDU A;  4B7H A;  4CGY B;  2VQE M;  4DUY M;  2V1U A;  3HJ8 A;  1QZE A;  3DFZ A;  1IBK M;  4K0K M;  4MGK E;  4HLQ A;  3K8Z A;  3M0E A;  3PFI A;  4I5S A;  5FTN A;  3T6P A;  1NY6 A;  2ZAN A;  3ILK A;  1VDD A;  3B7N A;  5KPR A;  4LF9 M;  1Q3B A;  5KQD A;  3GPU A;  3T1Y M;  3HGI A;  3LW5 F;  3VFD A;  3SFZ A;  4LF4 M;  4QOS A;  4M9Z A;  5DYI A;  4M9S A;  4JI4 M;  3GLF E;  3CTW B;  1PJI A;  2N35 A;  4B3M M;  1NV9 A;  2F4V M;  4DR5 M;  2A5Y B;  2LHG A;  4KHP M;  3U60 A;  1G4A E;  2KZU A;  4GMQ A;  1WXQ A;  4GKJ M;  5DYG A;  2WSE F;  5KQ8 A;  4MM3 B;  1N77 A;  4EIW A;  5EXS A;  4PDG A;  3KOZ E;  3SAV A;  1YUB A;  5ITX A;  3J80 S;  4B3S M;  5EP4 A;  1YE9 A;  2CE7 A;  3HU2 A;  3KOX E;  4FCT A;  5BR8 M;  2ZAM A;  3HJQ A;  1TDH A;  4DV6 M;  2V6Z M;  3M7G A;  2XEP A;  1IN5 A;  4CHT B;  3VKG A;  1Q39 A;  2QCU A;  3KVW A;  2CEA A;  4I4L A;  1XWI A;  2R44 A;  4G4N A;  2DXI A;  3NWL A;  4REZ A;  1L2C A;  1J7K A;  1DGH A;  2M5Z A;  2LNH C;  1IFY A;  1XC8 A;  2CWB A;  1XHB A;  2X49 A;  4IBF A;  2RGH A;  2Y21 A;  1NY5 A;  1BVS A;  3GLI B;  2QZ4 A;  4Z8X A;  3L25 A;  3GPX A;  2KA6 B;  4L16 A;  4OX9 M;  1E94 E;  2L2D A;  3B9P A;  2L4E A;  3R9X B;  1V34 A;  2Y0Q A;  2XLJ A;  2Z7J A;  3E4R A;  3J2P B;  1NNU C;  1WGN A;  2R46 A;  1QAQ A;  3FTD A;  4AG6 A;  4CIS A;  1QUT A;  4PCZ A;  3EIE A;  2WSF F;  4BB9 A;  4JI6 M;  3SAT A;  4XGI A;  4G4R A;  4JYA M;  2P5T A;  2EKF A;  1TH3 A;  3HU3 A;  1TF0 B;  5ITR A;  2L09 A;  5ITU A;  2VF7 A;  2O5R A;  1OIZ A;  2LH0 A;  5EXP A;  3H4J A;  3SAR A;  3T1H M;  3GPY A;  2ERC A;  2UU9 M;  4WP2 A;  3FYD A;  4LRT A;  4QHS A;  1D0K A;  1G8P A;  4L15 A;  2L7H A;  4LZJ A;  4X65 M;  2D7G A;  1RU3 A;  1WJ7 A;  1KYI A;  1IXR C;  3U6L A;  4W5W A;  1R5L A;  2R4J A;  2DWZ B;  3D8L A;  3KXE C;  2VQF M;  3KDS E;  2APL A;  4NSO B;  3RGP A;  4L8R C;  4BLC A;  1G41 A;  4LF5 M;  5L8R F;  1OKS A;  2F5P A;  1G71 A;  4LY6 A;  4P16 A;  3LQR A;  2KZS A;  1Z5A A;  1AUA A;  1Z6T A;  3SYK A;  4DV5 M;  3UK6 A;  3SAU A;  1KSF X;  2KW0 A;  3A42 A;  1V33 A;  3D8B A;  4PT5 A;  1GVN A;  1UM8 A;  2LVP C;  3IG5 A;  3KSJ A;  4DBG B;  3U61 A;  4NRW A;  2J7O A;  3J7A S;  1ZAE A;  2JY5 A;  3U5Z A;  4DV4 M;  5LMN M;  2J7N A;  1ZMV A;  3JAM S;  1HJP A;  2EA0 A;  2Q2E B;  1KFV A;  3U6S A;  2LHC A;  3LCV B;  3ZCB B;  4CJ6 A;  4AKI A;  4GIT A;  3U6O A;  4XK8 F;  3GLH E;  4JI1 M;  1QDR A;  2X4A A;  1OAI A;  2XH9 A;  3GRR A;  4JI0 M;  3VKH A;  1OTR A;  4G3O A;  4RF0 A;  1QZM A;  3KS8 A;  3I51 A;  1DO2 A;  3KOW E;  1GJS A;  2XSZ A;  3GLG E;  4CIZ A;  3JR4 A;  1MU5 A;  4GHA A;  1N33 M;  2K0B X;  1K82 A;  3TPZ A;  2YQZ A;  3W0L B;  1HQC A;  5LMU M;  4L4U A;  3KOY E;  3H4M A;  4JI3 M;  1XXH B;  1J09 A;  2GNO A;  2JZ1 A;  2KNZ A;  2NQ8 C;  1R7R A;  4NC6 A;  3SC3 A;  4AG5 A;  4LJ6 A;  4HEO A;  5BPV A;  3QYB A;  2O25 A;  2EO2 A;  3FD9 A;  3L29 A;  3I4Y A;  8CAT A;  4JN6 A;  4LCB A;  1SXJ B;  4LJ4 A;  4GEW A;  5FTM A;  3U6Q A;  2CV0 A;  1PJJ A;  1GAB A;  4NSR A;  2CV1 A;  4L6V 6;  2YFQ A;  4KLN A;  1J5E M;  2CFO A;  2DHR A;  2L6O A;  3I4V A;  4BBA A;  1JR3 D;  3E9S A;  5F3W A;  3WHK A;  1TH2 A;  2CHQ A;  2QBY B;  3GQ3 A;  1QAN A;  3GRV A;  3C58 A;  2UXC M;  2C9O A;  4MGI E;  1WIV A;  4LGY A;  2CHG A;  3GLF A;  2H1R A;  4RNA A;  2LVQ D;  4AI6 A;  1ZMU A;  3TWK A;  2LVO C;  1MX0 A;  2JNH A;  4LJ9 A;  4RKU F;  4AKH A;  4R71 A;  5KO3 A;  1JR3 E;  2LVA A;  1TGU A;  3NBX X;  1EFU B;  1OIP A;  2XF3 A;  3FUU A;  2Z8Y M;  4GC5 A;  2WZJ A;  4KO8 A;  2KRK A;  1GLN A;  1NSF A;  2JA2 A;  4B08 A;  4X62 M;  1D0M A;  2BJV A;  1VQ1 A;  3LCU A;  5ITY A;  2E5L M;  1N32 M;  3PVS A;  3KFU G;  3A46 A;  1HR0 M;  3MMP A;  1L1T A;  1ORY B;  1HNX M;  2LVN C;  4NOO B;  2O01 F;  1EE8 A;  3E21 A;  2I7N A;  2VII A;  5A2Q S;  2BJW A;  1IBL M;  4IBD A;  1OAO C;  1NO1 A;  2DZN B;  2DAG A;  2VDB B;  3B89 A;  3Q8X A;  3A98 B;  3HHY A;  4F2L A;  3K92 A;  5EP1 A;  3UZU A;  3EIH A;  2W82 A;  1Z59 A;  4OU7 A;  1R6B X;  3M6A A;  4FD2 A;  2G8L A;  2R0I A;  3AJI B;  3GLI E;  3DA1 A;  4DR7 M;  2C9C A;  4LFA M;  2KXE A;  3HHX A;  2CRU A;  1GO5 A;  3QYE A;  3UJN A;  1QDT A;  4KOD A;  4WW0 A;  7CAT A;  2OOB A;  3UMM A;  3GPP A;  2DAM A;  3K2L A;  4B3R M;  3VLF B;  2R62 A;  3HKP A;  5KPT A;  4AZF A;  2MH8 A;  3HX3 A;  3AFH A;  4G6Z A;  3L27 A;  5IWA M;  3AKZ A;  2XZU A;  3C3D A;  1OJL A;  4JV5 M;  3J7B A;  3KP0 E;  4GHL A;  5KPZ A;  4GIP A;  1IN6 A;  3C9P A;  1IN8 A;  3FUV A;  4II7 A;  3E46 A;  4LJA A;  3J27 B;  3LVW A;  2DI0 A;  3SHF A;  3FUX A;  1DGH B;  2XZF A;  1G3I A;  1OQY A;  4WUR A;  4B7F A;  5C1B A;  3HZJ A;  4GH9 A;  5EJC A;  2LWX A;  4LRS A;  1IXS B;  3CGW A;  4DV3 M;  2KRU A;  2XFS A;  2JZ0 A;  3ZH9 B;  2GQF A;  1V92 A;  4LF8 M;  2MRO B;  3MJ5 A;  4IJE A;  3WHL A;  4ITQ A;  2CP8 A;  2WSC F;  2KHH A;  4IBI A;  4QNM A;  4Z6Y A;  1DV0 A;  2LXE A;  1IM2 A;  2BWB A;  3AOE C;  3ZC7 B;  2KNV A;  5EXX A;  2R65 A;  3FTC A;  3L2A A;  2DNA A;  2FS1 A;  3GLH A;  3K9O A;  1Z5C A;  4L78 A;  2ZTC A;  2Z4R A;  1N36 M;  1F4I A;  4M0D A;  1VEK A;  4LZZ A;  4R7G A;  2HL7 A;  3HHW A;  4X66 M;  1L1Z A;  1T3T A;  2DWN A;  3GQ4 A;  3SMS A;  3GLG A;  4NXM M;  1NJG A;  4MGZ E;  2DHY A;  3UGJ A;  2K6B A;  5E6J A;  3BOS A;  3FRI A;  4MGY E;  4G4Q A;  3W67 A;  4DV0 M;  3HU1 A;  5H37 D;  2HAK A;  2QPA A;  3TQS A;  2G3Q A;  1PGY A;  4GC9 A;  1T6O A;  3L26 A;  3K9P A;  1NNJ A;  1QVR A;  2M60 A;  4G4O A;  1NHW C;  4MB7 A;  1JB0 F;  1SXJ D;  1PJS A;  3TWM A;  2DZO B;  1YSY A;  1OFH A;  3W68 A;  4X64 M;  1NVM A;  2EUC A;  1XXH E;  3THG A;  3R8F A;  1QAM A;  2DAK A;  3T15 A;  2JP7 A;  4FCV A;  3OTO M;  4FCW A;  1CUK A;  3HHZ A;  1WHC A;  4LF7 M;  4DR2 M;  3U61 B;  1D2N A;  2B3T A;  1R2Y A;  3VK8 A;  2QBY A;  3B74 A;  3NBI A;  1ZQ9 A;  4DV2 M;  1SXJ E;  3U5Z B;  2V1C A;  2UUA M;  4LFC M;  1HNW M;  5IT9 S;  1NV8 A;  1NHG C;  1N78 A;  3PNV A;  2JY8 A;  3MK6 A;  3SYL A;  2FE8 A;  4DR1 M;  2FOI C;  4A3V B;  2QP9 X;  2F5S A;  1K3X A;  3GP1 A;  1JR3 A;  4NXN M;  3KSX A;  1GL7 A;  3A45 A;  3TL4 X;  1XMQ M;  4OVZ B;  2QNJ A;  3FTE A;  4TUW A;  4Q7J A;  4LFB M;  3DZD A;  2OO9 A;  4GRI A;  5FLX S;  1TDZ A;  2EKK A;  3QWL A;  1QQW A;  4IBC A;  3IG8 A;  2XGN A;  2JWS A;  2CHV A;  3FRH A;  1QYR A;  4UN2 B;  1XNQ M;  3GQ5 A;  3IHP A;  4AKG A;  4ANR A;  1XB2 B;  3SBJ A;  2DZL A;  3LQQ A;  4LG2 A;  5JI3 E;  1IY1 A;  4IJF A;  5DFL A;  4GKK M;  3Q8G A;  4JI8 M;  4OW0 A;  1N34 M;  1S3S A;  3U6D A;  3FUW A;  2DEN A;  2JY6 B;  1Q3C A;  5IRE B;  4FVM A;  4IIW A;  2RRU A;  3SAS A;  1L2D A;  2OOA A;  3AOE A;  2R45 A;  4B7G A;  4LJ7 A;  1DGB A;  3FTF A;  1LTM A;  2FH0 A;  2RGO A;  2CV2 A;  2JXN A;  3C3E A;  4R3D A;  2H5X A;  3GLF B;  4XBO A;  5GKN A;  2AHM A;  3JR5 A;  1IY0 A;  4DUZ M;  1EIJ A;  3L28 A;  3GLI A;  1AIP C;  1H6U A;  3LVV A;  5EP3 A;  1FJG M;  1I4W A;  4DR4 M;  1Y8G A;  1IBM M;  1SXJ C;  3QAU A;  4FWD A;  1N75 A;  2KNA A;  2YNM D;  2ZTD A;  1K3W A;  1LV7 A;  1HT2 E;  2KEB A;  1GJT A;  2Y20 A;  5EXT A;  3PNY A;  5JI2 E;  2OPF A;  2UUB M;  1MN3 A;  3V76 A;  1HT1 E;  2QEN A;  4FW9 A;  3U60 B;  1PJQ A; 
#chains in the Genus database with same CATH homology
 1DO2 A;  1V92 A;  2MRO B;  1VG5 A;  3GLG E;  1DO0 A;  3T6P A;  2CP8 A;  2KHH A;  1DV0 A;  2K0B X;  1IM2 A;  2BWB A;  2KNZ A;  2JZ1 A;  2KNV A;  1HQY E;  4HEO A;  2JY7 A;  2DNA A;  2O25 A;  3K9O A;  2ZTC A;  3GLF E;  3IEC A;  1NV9 A;  1UFZ A;  1IXS A;  1F4I A;  1VEK A;  4GEW A;  1G4A E;  2LBC A;  2DHY A;  3BBZ A;  3FRI A;  1TR8 A;  4F1I A;  2HAK A;  1P3Q Q;  1SG9 A;  2G3Q A;  1PGY A;  2MJ5 B;  1T6O A;  3K9P A;  1WIV A;  1A5T A;  2LVQ D;  1ZMU A;  2LVO C;  2JNH A;  4R71 A;  1JR3 E;  1XXH E;  2HWJ A;  2DAK A;  1C7Y A;  2LVA A;  2L4F A;  2JP7 A;  1IFY A;  1EFU B;  1CUK A;  1WHC A;  2CWB A;  2WZJ A;  2EJS A;  2B3T A;  1BVS A;  2DAI A;  1VQ1 A;  1NV8 A;  3LCU A;  1ZMW A;  1E94 E;  1Q02 A;  2QHO B;  2JY8 A;  1T43 A;  2L2D A;  2L4E A;  3MMP A;  1WGN A;  1VDL A;  1WGL A;  2LTU A;  2LVN C;  1WR1 B;  1VEG A;  3E21 A;  2QNJ A;  2MGW A;  2EKF A;  2DAG A;  4Q7J A;  2OO9 A;  3B89 A;  1ZV1 A;  2EKK A;  4F2L A;  3FRH A;  4UN2 B;  3FE3 A;  3H4J A;  3IHP A;  1XB2 B;  2DZL A;  2DKL A;  4WP2 A;  5DFL A;  2R0I A;  3GLI E;  1WJ7 A;  1KYI A;  2QSF X;  2DEN A;  2JY6 B;  1YLA A;  1GO5 A;  2K9D A;  2RRU A;  2DAE A;  2OOA A;  2OOB A;  1R4G A;  1G41 A;  2DAM A;  1OKS A;  2H5X A;  2LVP C;  2JUJ A;  4DBG B;  2JY5 A;  3F92 A;  1AIP C;  1ZMV A;  2BWE A;  1Y8G A;  1HJP A;  2KNA A;  2ZTD A;  2MR9 A;  3E46 A;  3LCV B;  2DI0 A;  1HT2 E;  1TTE A;  1G3I A;  1OQY A;  1VEJ A;  3GLH E;  5JI2 E;  1OAI A;  1MN3 A;  1HT1 E;  1OTR A;  4G3O A;  1QZE A;  2JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...