2DAMA

Solution structure of the novel identified uba-like domain in the n-terminal of human etea protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'GSSGSSGAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETEA protein
molecule tags Structural genomics, unknown function
source organism Homo sapiens
publication title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human ETEA Protein
rcsb
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2damA00
3FE3A 2DI0A 2ZTDA 1GO5A 3LCVB 1OAIA 2EJSA 2LVPC 5DFLA 2DHYA 2EKFA 1P3QQ 1MN3A 1IM2A 1A5TA 2DNAA 3K9PA 1V92A 2B3TA 3B89A 3IHPA 1OQYA 2CP8A 1R4GA 3GLFE 4UN2B 2BWBA 2G3QA 1DO2A 2LVOC 2K0BX 1SG9A 2DZLA 3GLHE 2LVQD 1Y8GA 2DAIA 1TTEA 2MR9A 3T6PA 1NV9A 1VEKA 1VG5A 1VEGA 2LVNC 1HQYE 2DAKA 2DAGA 1C7YA 2LBCA 2R0IA 1KYIA 2KNAA 1G3IA 1XB2B 1TR8A 2ZTCA 1Q02A 1OKSA 4F1IA 1G41A 3GLGE 5JI2E 2DENA 2KNVA 3F92A 4WP2A 2JY5A 2CWBA 1ZV1A 4GEWA 2L4EA 2JUJA 1WGNA 4R71A 3GLIE 1AIPC 1T43A 2OO9A 1HT2E 3K9OA 1WGLA 2BWEA 1T6OA 2JY6B 1WHCA 2DKLA 2HWJA 1G4AE 1ZMUA 3H4JA 4F2LA 3LCUA 2KNZA 1PGYA 2JY8A 2OOBA 2JZ1A 1ZMVA 2RRUA 1BVSA 2JY7A 1F4IA 1QZEA 4G3OA 1EFUB 1WJ7A 2EKKA 2MJ5B 2QSFX 3MMPA 4DBGB 2KHHA 2JNHA 2QHOB 2JP7A 2HAKA 1IFYA 1XXHE 2MGWA 2LTUA 2O25A 2OOAA 2JZ0A 1CUKA 1VEJA 2H5XA 2K9DA 3E21A 1DV0A 2L4FA 1JR3E 2WZJA 3BBZA 1IXSA 3FRIA 1DO0A 1E94E 2DAEA 2DAMA 1OTRA 4HEOA 2QNJA 1YLAA 1UFZA 3FRHA 1ZMWA 3E46A 3IECA 1HT1E 1NV8A 1VQ1A 2MROB 1VDLA 1WIVA 4Q7JA 2LVAA 1WR1B 2L2DA 1HJPA
chains in the Genus database with same CATH superfamily
2XF3A 3KP0E 1GO5A 2X49A 3LCVB 4G6ZA 4DR2M 3GPYA 2EJSA 5GKNA 2LHCA 2UUCM 5IREB 2BJWA 5EXTA 1V34A 4G4OA 2XZFA 2RGOA 1Z6TA 3ZH9B 2ERCA 1SXJE 4QHTA 3DA1A 3VLFB 3AKZA 2KZSA 4X66M 1MN3A 1QAMA 1HR0M 1EIJA 1XXHB 3J27B 3K9PA 4Z8XA 2QBYB 2B3TA 3D8LA 4OU7A 4M0WA 4KT0F 3M7GA 5DYIA 4UN2B 1L2DA 4DR7M 5KPRA 3SMPA 1L2CA 1NVMA 1DO2A 2LVOC 4JYAM 1DGHB 2G5GX 1XMQM 2D7GA 3RGPA 2KDLA 2ZANA 4AQYM 1NNJA 1RU3A 5ITXA 4LCBA 4NRVA 1GKIA 1J7KA 1VEGA 2LVNC 3K2LA 5KPZA 2DAKA 1C7YA 1KYIA 3UZUA 5EP4A 2VQFM 3FTCA 2VDBB 2O01F 1XB2B 3RGSA 2QCUA 4OVZB 3KOXE 4F1IA 1PJTA 4GC9A 4GEWA 2J7OA 2JUJA 5EP3A 1E32A 3L27A 2LWXA 4FVMA 2HL7A 4R71A 2F5PA 5FTKA 3ZCBB 1NJGA 2OO9A 3GRYA 3GLGA 1ZAEA 2L6OA 3J80S 1TF0B 1T6OA 3FYDA 4LJ4A 4RNAA 5DNYA 2DKLA 4LJ6A 2Y21A 2HWJA 3TQSA 2JWSA 1ZMUA 5EXPA 1KSFX 4EIWA 4JI5M 3CGWA 4XGIA 4F2LA 4M9SA 3GLHB 5F3WA 4IBIA 1PGYA 1G59A 3HWSA 1BVSA 3FTDA 4QNMA 4JI3M 4GHLA 4I8OA 1F4IA 5BPVA 1EFUB 1N36M 2DWNA 3MMPA 3SBJA 2HCBA 4NSOB 4DR3M 1YSYA 2F4VM 4DR4M 4QOZC 4KLNA 3GP1A 2MGWA 3M0EA 3KW6A 4GC5A 3W68A 4NXNM 3V76A 1DGFA 4DV0M 2H5XA 2WSFF 1IXZA 2DZOB 1TGUA 4AKHA 1JR3E 2WZJA 2O5RA 3GLHA 3U6OA 3FD9A 3K8ZA 3KOZE 4YHHM 5FLXS 4M0DA 2APLA 1IBMM 4D81A 3TWKA 5KPTA 1I4WA 1GVNA 2DAEA 2DAMA 4LJ5A 1R2YA 3GPXA 2GNOA 4LGYA 2UUAM 3AFHA 4LZZA 4NOOB 3VKGA 5FTMA 2JXNA 3GO8A 1VDDA 3W0FA 2GQFA 1NV8A 1HNXM 2VF8A 2RGHA 1DGGA 1VDLA 3U60B 1WXQA 3PNYA 4Q7JA 2CHQA 1N78A 3KS4A 4X62M 1WR1B 3HJQA 4FWGA 1ZQ9A 4MGIE 4OVZA 1XNQM 3RE8A 3MK6A 4QHSA 2ZTDA 1KFVA 4MH0E 4NXMM 3U5ZA 1JB0F 2A5YB 2DWLA 3SATA 4JI2M 3FTEA 3GLGB 1MU5A 1TDHA 2I7PA 5E6JA 2LVPC 3HHWA 2JA2A 1P3QQ 2QZ4A 2L09A 2QP9X 4B7HA 4RF1A 1IM2A 4PDGA 3DFZA 2DNAA 3LW5F 1V92A 4RF0A 2DZNB 4LFBM 1R4GA 3LVWA 3CF6E 2ZAMA 4B3SM 2DVWB 2XSZA 4WW0A 1FJGM 4GRIA 2Z4SA 4CJ6A 2QBYA 4LF9M 1SG9A 2DZLA 4CISA 1Q39A 3M6AA 1G8PA 2CV2A 2KRKA 1IY2A 2LVQD 2QQ8A 4LJ8A 2DAIA 1PJQA 1TTEA 3KDSE 1NV9A 3I4VA 4R3DA 3T6PA 1YE9A 1PJSA 1NHWC 4JI6M 2LBCA 1GABA 3ILKA 3L2AA 5KO3A 3NBXX 4YY3M 1TR8A 1IN5A 2X4AA 3LMMA 2DWZB 1DGBA 5EP2A 2R4EA 1S3SA 2D7HA 3GLGE 4DR6M 1K82A 2CV1A 2ZM6M 5IT9S 4IIWA 2KNVA 3F92A 4WP2A 3K1JA 4DV1M 1IBLM 2R4JA 2CWBA 1ZV1A 4B3RM 2L4EA 3FKEA 4L4UA 3U6EA 3MHVC 4L78A 5ITQA 3SAUA 4JI0M 4AZFA 1HT2E 4CIZA 2EUCA 3TPZA 1NY6A 1WGLA 4ANRA 3HX3A 3LVVA 4PCZA 3UGJA 3KS8A 3U6MA 4I4LA 4LGMA 2DHRA 3HGIA 4AW4A 4NSRA 3MJ5A 1XMOM 2L7IA 2R62A 4OW0A 1OFHA 3KOYE 1XC8A 3I01M 2XLJA 3H4JA 2QENA 4GKKM 2JY8A 1IN7A 3ZC7B 2RRUA 4Y28F 1NY5A 3JAMS 2XH9A 1DGHA 3U6SA 1JR3D 3SAVA 4TUWA 2L7HA 2EKKA 3GPPA 4LY6A 2JNHA 5ITUA 2QHOB 2F5OA 3JR4A 1XXHE 4IBEA 3SASA 1K3WA 2O25A 1I94M 2CFOA 2OOAA 5A2QS 1XXHA 1VEJA 3C3EA 3QWLA 1R5LA 3E21A 3VDPA 2L4FA 3K92A 3GRVA 3UJNA 2ZAOA 4IJFA 4IBGA 4KO8A 5ITTA 1IY0A 4L16A 5EXXA 3TWMA 1N34M 1E94E 2C9OA 2CV0A 2NQ8C 3L29A 3LQQA 1XWIA 1J09A 2QNJA 2DXIA 4JI8M 1GJSA 7CATA 4OX9M 3HU1A 2E5LM 1YLAA 3L26A 3FUVA 2F5NA 3FRHA 5C1BA 3VK8A 1HT1E 4LJAA 4LJ9A 3U6PA 3KFUG 2CRUA 1IN4A 2KEBA 4L8RC 1R6BX 1WIVA 2FOIC 1LTMA 3LQRA 3GQ3A 3HHZA 4MGYE 4LFAM 2M60A 1V33A 2L2DA 3SFZA 3IG8A 5ITRA 2KZUA 1NNUC 3QAUA 2DI0A 1Z5CA 3AV0A 4HLQA 5LMNM 4LRTA 2VIIA 3SMSA 3GLIB 4DV3M 4LF8M 5FTNA 2FFJA 1QDTA 3TWLA 2UXCM 2DHYA 2XFSA 2MH8A 1QAQA 2D7EA 3QYEA 3J81S 4MB7A 1X37A 4NC6A 1A5TA 1K3XA 3KSJA 4IBDA 3VDUA 1D0KA 3C3DA 5EJCA 1NHGC 3WHLA 4PD2A 5FSWA 3GLFE 4LFCM 3HU2A 2G3QA 3GQ4A 2K47A 1G71A 3SHFA 3B7QA 3SAWA 2XEPA 3NWLA 3Q8XA 1Y8GA 1OIPA 4QOSA 1GL6A 2Y20A 4GITA 4LRSA 4MGKE 3TE6A 5KQ8A 3NBIA 2DAGA 2KNAA 3RFWA 4FCTA 4Z6YA 3HJ8A 3U61A 1TDZA 2ZTCA 1LV7A 4IBFA 4QNRA 3VK7A 4JXJA 1OKSA 3I04M 3PNVA 5BR8M 1W5SA 2KRUA 1W5TA 5JI2E 1SXJC 2YQZA 4JV5M 1E9SA 4ITQA 1TH2A 3T15A 2N35A 3AOEA 2CHVA 1ORYB 2UU9M 1PJIA 1OAOC 1AIPC 1QYRA 4HL4A 2UXDM 4PT5A 2FNAA 4BLCA 4LF5M 1N32M 2BWEA 1Z5AA 2I7NA 3CTWB 2KW0A 4P17A 3GRUA 3GLFA 4G4NA 1SXJB 5DYGA 4AKIA 3SC3A 3WHKA 3D8BA 1IXSB 1XNRM 3W0LB 4JI4M 5FTJA 4W5WA 1R7RA 3AJIB 3LCUA 4R7GA 2OOBA 2JZ1A 1ZMVA 2HHHM 1AUAA 2RKOA 2JY7A 3KXEC 5ITXE 2R18A 2C9CA 3U60A 4G3OA 2XFTA 2R46A 1MJGM 2MJ5B 1JR3A 3A46A 1N75A 1J5EM 4B7GA 5KQDA 2LH0A 2JP7A 3B7NA 1HNZM 1EE8A 3FUXA 3U6QA 1NJFA 4B3MM 5L8RF 2HKJA 4G4QA 4GHAA 1DV0A 4AI6A 4IJEA 4DV5M 3KSXA 2YR0A 3R9XB 4S12A 1GJTA 1Z5BA 1IXSA 3U6CA 4B3TM 1DO0A 4D80A 1PM5A 1OTRA 4AG6A 4HEOA 2OPFA 3SARA 1QZMA 2YNMD 4M9ZA 3J2PB 3GPUA 4FWDA 3A45A 2C5RA 2W82A 3PXGA 2QPAA 4IBKA 4ZPXA 5IWAM 1QUSA 3GLIA 3FTFA 4X65M 3PFIA 3KVWA 2C99A 2MROB 4KHPM 5H37D 4GKJM 4MGZE 3SYLA 1L8QA 3J7AS 2V1CA 4FCVA 2H1RA 3EIHA 5E26A 2EA0A 4DR5M 3CF0A 4DV6M 3T1HM 5EP1A 3BOSA 3KOWE 4DUZM 2BJVA 1IY1A 1D0MA 1SXJA 2CE7A 1E9RA 3FE3A 4WURA 5LMUM 3U5ZB 2Y0QA 4FD2A 4XBOA 1L1TA 3U6DA 3U61B 3I4YA 3B7ZA 1OAIA 3FUWA 3VFDA 1QDRA 3GRRA 4CGYB 4DUYM 5DFLA 3VKHA 2EKFA 3I51A 3U6LA 4AKGA 4I5SA 3QYBA 4LZJA 3DZDA 1IQPA 2UUBM 4LJ7A 4LF7M 1TH4A 1HNWM 2KA6B 4IBCA 3B89A 3PVSA 3IHPA 2FH0A 1OQYA 3FUTA 2CP8A 1GL7A 1D0LA 4RKUF 2LXEA 2XSZD 2Y0TA 4IBJA 2OQ4A 4DV7M 4G4RA 1N77A 2BWBA 1TH3A 4P16A 3A42A 4MM3B 4CHTB 2Z7JA 2K0BX 2VQEM 1YUBA 4JN6A 1N33M 4I81A 3E4RA 1OIZA 1T3TA 3A98B 3B74A 3GLHE 2MR9A 3SHGB 3BXWA 3T38A 5ITYA 4FW9A 4DV2M 5FTLA 3HJSA 1VEKA 1VG5A 1HQYE 2R0IA 2V1UA 1H6UA 4GMQA 2J5YA 2P5TA 2LNHC 2WSEF 3H4MA 1NSFA 1G3IA 3EIEA 1JQJC 1OJLA 3J7BA 3KP1E 4II7A 4GH9A 1Q02A 1QAOA 5EXSA 1QUTA 4MGHA 3FYCA 3UK6A 3E9SA 2C96A 1G41A 3HHXA 3IG5A 4FCWA 1HQCA 4B7FA 2DENA 2R65A 3HY5A 3OTOM 2JY5A 2CUZA 1WGNA 3B9PA 3TL4X 2ZBKB 2KXEA 3L25A 4A3VB 3GLIE 4DV4M 4NRWA 1T43A 4LG2A 3K9OA 1XHBA 3ZQJA 4BBAA 4GIPA 2JY6B 3GLFB 1WHCA 2WSCF 4JI7M 4XK8F 2C98A 1FNNA 2G8LA 5JI3E 1G4AE 5C18A 4D82A 3HKPA 1Q3BA 4K0KM 1L1ZA 1QVRA 2KNZA 3HU3A 2BNKA 2AHMA 2XZUA 3L28A 1C1KA 4REZA 2J7NA 4IBBA 1UM8A 1QZEA 2Q2EB 4KODA 1WJ7A 4NL4H 3T1YM 1PJJA 2F5SA 2F5QA 3R8FA 2QSFX 4AG5A 4DBGB 2KHHA 3C9PA 4L6V6 2K6BA 1L2BA 1Z59A 3DOAA 2VF7A 3GQ5A 2HAKA 1IFYA 2CEAA 4LF6M 2XGNA 3THGA 1QQWA 2LTUA 2JZ0A 1Q3CA 1CUKA 3HZJA 3Q8GA 2K9DA 1OFIA 4L15A 4B08A 2M5ZA 3SYKA 1GLNA 2X8AA 3C58A 2DWMA 1IN6A 1IBKM 3BBZA 4FWHA 2Z3XA 1SXJD 3FRIA 4JI1M 2LHGA 2Z8YM 4PDIA 2FS1A 5IZ7D 4BB9A 4X64M 4DR1M 2UXBM 4LF4M 1R2ZA 3UMMA 1UFZA 2CHGA 1ZMWA 2V6ZM 3E46A 3IECA 1D2NA 1IN8A 2R6FA 2R45A 1VQ1A 2YFQA 4M9XA 1MX0A 2FE8A 3CF2A 3JR5A 2R44A 3W67A 2LVAA 1QANA 1PRBA 3AOEC 1NO1A 2EO2A 3HHYA 3AOGA 2Z4RA 3AL0C 8CATA 3FUUA 1HJPA 5EQTA 1IXRC
chains in the Genus database with same CATH topology
3FE3A 2DI0A 2ZTDA 1GO5A 3LCVB 1OAIA 2EJSA 2LVPC 5DFLA 2DHYA 2EKFA 1P3QQ 1MN3A 1IM2A 1A5TA 2DNAA 3K9PA 1V92A 2B3TA 3B89A 3IHPA 1OQYA 2CP8A 1R4GA 3GLFE 4UN2B 2BWBA 2G3QA 1DO2A 2LVOC 2K0BX 1SG9A 2DZLA 3GLHE 2LVQD 1Y8GA 2DAIA 1TTEA 2MR9A 3T6PA 1NV9A 1VEKA 1VG5A 1VEGA 2LVNC 1HQYE 2DAKA 2DAGA 1C7YA 2LBCA 2R0IA 1KYIA 2KNAA 1G3IA 1XB2B 1TR8A 2ZTCA 1Q02A 1OKSA 4F1IA 1G41A 3GLGE 5JI2E 2DENA 2KNVA 3F92A 4WP2A 2JY5A 2CWBA 1ZV1A 4GEWA 2L4EA 2JUJA 1WGNA 4R71A 3GLIE 1AIPC 1T43A 2OO9A 1HT2E 3K9OA 1WGLA 2BWEA 1T6OA 2JY6B 1WHCA 2DKLA 2HWJA 1G4AE 1ZMUA 3H4JA 4F2LA 3LCUA 2KNZA 1PGYA 2JY8A 2OOBA 2JZ1A 1ZMVA 2RRUA 1BVSA 2JY7A 1F4IA 1QZEA 4G3OA 1EFUB 1WJ7A 2EKKA 2MJ5B 2QSFX 3MMPA 4DBGB 2KHHA 2JNHA 2QHOB 2JP7A 2HAKA 1IFYA 1XXHE 2MGWA 2LTUA 2O25A 2OOAA 2JZ0A 1CUKA 1VEJA 2H5XA 2K9DA 3E21A 1DV0A 2L4FA 1JR3E 2WZJA 3BBZA 1IXSA 3FRIA 1DO0A 1E94E 2DAEA 2DAMA 1OTRA 4HEOA 2QNJA 1YLAA 1UFZA 3FRHA 1ZMWA 3E46A 3IECA 1HT1E 1NV8A 1VQ1A 2MROB 1VDLA 1WIVA 4Q7JA 2LVAA 1WR1B 2L2DA 1HJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE3 A;  2DI0 A;  2ZTD A;  1GO5 A;  3LCV B;  1OAI A;  2EJS A;  2LVP C;  5DFL A;  2DHY A;  2EKF A;  1P3Q Q;  1MN3 A;  1IM2 A;  1A5T A;  2DNA A;  3K9P A;  1V92 A;  2B3T A;  3B89 A;  3IHP A;  1OQY A;  2CP8 A;  1R4G A;  3GLF E;  4UN2 B;  2BWB A;  2G3Q A;  1DO2 A;  2LVO C;  2K0B X;  1SG9 A;  2DZL A;  3GLH E;  2LVQ D;  1Y8G A;  2DAI A;  1TTE A;  2MR9 A;  3T6P A;  1NV9 A;  1VEK A;  1VG5 A;  1VEG A;  2LVN C;  1HQY E;  2DAK A;  2DAG A;  1C7Y A;  2LBC A;  2R0I A;  1KYI A;  2KNA A;  1G3I A;  1XB2 B;  1TR8 A;  2ZTC A;  1Q02 A;  1OKS A;  4F1I A;  1G41 A;  3GLG E;  5JI2 E;  2DEN A;  2KNV A;  3F92 A;  4WP2 A;  2JY5 A;  2CWB A;  1ZV1 A;  4GEW A;  2L4E A;  2JUJ A;  1WGN A;  4R71 A;  3GLI E;  1AIP C;  1T43 A;  2OO9 A;  1HT2 E;  3K9O A;  1WGL A;  2BWE A;  1T6O A;  2JY6 B;  1WHC A;  2DKL A;  2HWJ A;  1G4A E;  1ZMU A;  3H4J A;  4F2L A;  3LCU A;  2KNZ A;  1PGY A;  2JY8 A;  2OOB A;  2JZ1 A;  1ZMV A;  2RRU A;  1BVS A;  2JY7 A;  1F4I A;  1QZE A;  4G3O A;  1EFU B;  1WJ7 A;  2EKK A;  2MJ5 B;  2QSF X;  3MMP A;  4DBG B;  2KHH A;  2JNH A;  2QHO B;  2JP7 A;  2HAK A;  1IFY A;  1XXH E;  2MGW A;  2LTU A;  2O25 A;  2OOA A;  2JZ0 A;  1CUK A;  1VEJ A;  2H5X A;  2K9D A;  3E21 A;  1DV0 A;  2L4F A;  1JR3 E;  2WZJ A;  3BBZ A;  1IXS A;  3FRI A;  1DO0 A;  1E94 E;  2DAE A;  2DAM A;  1OTR A;  4HEO A;  2QNJ A;  1YLA A;  1UFZ A;  3FRH A;  1ZMW A;  3E46 A;  3IEC A;  1HT1 E;  1NV8 A;  1VQ1 A;  2MRO B;  1VDL A;  1WIV A;  4Q7J A;  2LVA A;  1WR1 B;  2L2D A;  1HJP A; 
#chains in the Genus database with same CATH topology
 2XF3 A;  3KP0 E;  1GO5 A;  2X49 A;  3LCV B;  4G6Z A;  4DR2 M;  3GPY A;  2EJS A;  5GKN A;  2LHC A;  2UUC M;  5IRE B;  2BJW A;  5EXT A;  1V34 A;  4G4O A;  2XZF A;  2RGO A;  1Z6T A;  3ZH9 B;  2ERC A;  1SXJ E;  4QHT A;  3DA1 A;  3VLF B;  3AKZ A;  2KZS A;  4X66 M;  1MN3 A;  1QAM A;  1HR0 M;  1EIJ A;  1XXH B;  3J27 B;  3K9P A;  4Z8X A;  2QBY B;  2B3T A;  3D8L A;  4OU7 A;  4M0W A;  4KT0 F;  3M7G A;  5DYI A;  4UN2 B;  1L2D A;  4DR7 M;  5KPR A;  3SMP A;  1L2C A;  1NVM A;  1DO2 A;  2LVO C;  4JYA M;  1DGH B;  2G5G X;  1XMQ M;  2D7G A;  3RGP A;  2KDL A;  2ZAN A;  4AQY M;  1NNJ A;  1RU3 A;  5ITX A;  4LCB A;  4NRV A;  1GKI A;  1J7K A;  1VEG A;  2LVN C;  3K2L A;  5KPZ A;  2DAK A;  1C7Y A;  1KYI A;  3UZU A;  5EP4 A;  2VQF M;  3FTC A;  2VDB B;  2O01 F;  1XB2 B;  3RGS A;  2QCU A;  4OVZ B;  3KOX E;  4F1I A;  1PJT A;  4GC9 A;  4GEW A;  2J7O A;  2JUJ A;  5EP3 A;  1E32 A;  3L27 A;  2LWX A;  4FVM A;  2HL7 A;  4R71 A;  2F5P A;  5FTK A;  3ZCB B;  1NJG A;  2OO9 A;  3GRY A;  3GLG A;  1ZAE A;  2L6O A;  3J80 S;  1TF0 B;  1T6O A;  3FYD A;  4LJ4 A;  4RNA A;  5DNY A;  2DKL A;  4LJ6 A;  2Y21 A;  2HWJ A;  3TQS A;  2JWS A;  1ZMU A;  5EXP A;  1KSF X;  4EIW A;  4JI5 M;  3CGW A;  4XGI A;  4F2L A;  4M9S A;  3GLH B;  5F3W A;  4IBI A;  1PGY A;  1G59 A;  3HWS A;  1BVS A;  3FTD A;  4QNM A;  4JI3 M;  4GHL A;  4I8O A;  1F4I A;  5BPV A;  1EFU B;  1N36 M;  2DWN A;  3MMP A;  3SBJ A;  2HCB A;  4NSO B;  4DR3 M;  1YSY A;  2F4V M;  4DR4 M;  4QOZ C;  4KLN A;  3GP1 A;  2MGW A;  3M0E A;  3KW6 A;  4GC5 A;  3W68 A;  4NXN M;  3V76 A;  1DGF A;  4DV0 M;  2H5X A;  2WSF F;  1IXZ A;  2DZO B;  1TGU A;  4AKH A;  1JR3 E;  2WZJ A;  2O5R A;  3GLH A;  3U6O A;  3FD9 A;  3K8Z A;  3KOZ E;  4YHH M;  5FLX S;  4M0D A;  2APL A;  1IBM M;  4D81 A;  3TWK A;  5KPT A;  1I4W A;  1GVN A;  2DAE A;  2DAM A;  4LJ5 A;  1R2Y A;  3GPX A;  2GNO A;  4LGY A;  2UUA M;  3AFH A;  4LZZ A;  4NOO B;  3VKG A;  5FTM A;  2JXN A;  3GO8 A;  1VDD A;  3W0F A;  2GQF A;  1NV8 A;  1HNX M;  2VF8 A;  2RGH A;  1DGG A;  1VDL A;  3U60 B;  1WXQ A;  3PNY A;  4Q7J A;  2CHQ A;  1N78 A;  3KS4 A;  4X62 M;  1WR1 B;  3HJQ A;  4FWG A;  1ZQ9 A;  4MGI E;  4OVZ A;  1XNQ M;  3RE8 A;  3MK6 A;  4QHS A;  2ZTD A;  1KFV A;  4MH0 E;  4NXM M;  3U5Z A;  1JB0 F;  2A5Y B;  2DWL A;  3SAT A;  4JI2 M;  3FTE A;  3GLG B;  1MU5 A;  1TDH A;  2I7P A;  5E6J A;  2LVP C;  3HHW A;  2JA2 A;  1P3Q Q;  2QZ4 A;  2L09 A;  2QP9 X;  4B7H A;  4RF1 A;  1IM2 A;  4PDG A;  3DFZ A;  2DNA A;  3LW5 F;  1V92 A;  4RF0 A;  2DZN B;  4LFB M;  1R4G A;  3LVW A;  3CF6 E;  2ZAM A;  4B3S M;  2DVW B;  2XSZ A;  4WW0 A;  1FJG M;  4GRI A;  2Z4S A;  4CJ6 A;  2QBY A;  4LF9 M;  1SG9 A;  2DZL A;  4CIS A;  1Q39 A;  3M6A A;  1G8P A;  2CV2 A;  2KRK A;  1IY2 A;  2LVQ D;  2QQ8 A;  4LJ8 A;  2DAI A;  1PJQ A;  1TTE A;  3KDS E;  1NV9 A;  3I4V A;  4R3D A;  3T6P A;  1YE9 A;  1PJS A;  1NHW C;  4JI6 M;  2LBC A;  1GAB A;  3ILK A;  3L2A A;  5KO3 A;  3NBX X;  4YY3 M;  1TR8 A;  1IN5 A;  2X4A A;  3LMM A;  2DWZ B;  1DGB A;  5EP2 A;  2R4E A;  1S3S A;  2D7H A;  3GLG E;  4DR6 M;  1K82 A;  2CV1 A;  2ZM6 M;  5IT9 S;  4IIW A;  2KNV A;  3F92 A;  4WP2 A;  3K1J A;  4DV1 M;  1IBL M;  2R4J A;  2CWB A;  1ZV1 A;  4B3R M;  2L4E A;  3FKE A;  4L4U A;  3U6E A;  3MHV C;  4L78 A;  5ITQ A;  3SAU A;  4JI0 M;  4AZF A;  1HT2 E;  4CIZ A;  2EUC A;  3TPZ A;  1NY6 A;  1WGL A;  4ANR A;  3HX3 A;  3LVV A;  4PCZ A;  3UGJ A;  3KS8 A;  3U6M A;  4I4L A;  4LGM A;  2DHR A;  3HGI A;  4AW4 A;  4NSR A;  3MJ5 A;  1XMO M;  2L7I A;  2R62 A;  4OW0 A;  1OFH A;  3KOY E;  1XC8 A;  3I01 M;  2XLJ A;  3H4J A;  2QEN A;  4GKK M;  2JY8 A;  1IN7 A;  3ZC7 B;  2RRU A;  4Y28 F;  1NY5 A;  3JAM S;  2XH9 A;  1DGH A;  3U6S A;  1JR3 D;  3SAV A;  4TUW A;  2L7H A;  2EKK A;  3GPP A;  4LY6 A;  2JNH A;  5ITU A;  2QHO B;  2F5O A;  3JR4 A;  1XXH E;  4IBE A;  3SAS A;  1K3W A;  2O25 A;  1I94 M;  2CFO A;  2OOA A;  5A2Q S;  1XXH A;  1VEJ A;  3C3E A;  3QWL A;  1R5L A;  3E21 A;  3VDP A;  2L4F A;  3K92 A;  3GRV A;  3UJN A;  2ZAO A;  4IJF A;  4IBG A;  4KO8 A;  5ITT A;  1IY0 A;  4L16 A;  5EXX A;  3TWM A;  1N34 M;  1E94 E;  2C9O A;  2CV0 A;  2NQ8 C;  3L29 A;  3LQQ A;  1XWI A;  1J09 A;  2QNJ A;  2DXI A;  4JI8 M;  1GJS A;  7CAT A;  4OX9 M;  3HU1 A;  2E5L M;  1YLA A;  3L26 A;  3FUV A;  2F5N A;  3FRH A;  5C1B A;  3VK8 A;  1HT1 E;  4LJA A;  4LJ9 A;  3U6P A;  3KFU G;  2CRU A;  1IN4 A;  2KEB A;  4L8R C;  1R6B X;  1WIV A;  2FOI C;  1LTM A;  3LQR A;  3GQ3 A;  3HHZ A;  4MGY E;  4LFA M;  2M60 A;  1V33 A;  2L2D A;  3SFZ A;  3IG8 A;  5ITR A;  2KZU A;  1NNU C;  3QAU A;  2DI0 A;  1Z5C A;  3AV0 A;  4HLQ A;  5LMN M;  4LRT A;  2VII A;  3SMS A;  3GLI B;  4DV3 M;  4LF8 M;  5FTN A;  2FFJ A;  1QDT A;  3TWL A;  2UXC M;  2DHY A;  2XFS A;  2MH8 A;  1QAQ A;  2D7E A;  3QYE A;  3J81 S;  4MB7 A;  1X37 A;  4NC6 A;  1A5T A;  1K3X A;  3KSJ A;  4IBD A;  3VDU A;  1D0K A;  3C3D A;  5EJC A;  1NHG C;  3WHL A;  4PD2 A;  5FSW A;  3GLF E;  4LFC M;  3HU2 A;  2G3Q A;  3GQ4 A;  2K47 A;  1G71 A;  3SHF A;  3B7Q A;  3SAW A;  2XEP A;  3NWL A;  3Q8X A;  1Y8G A;  1OIP A;  4QOS A;  1GL6 A;  2Y20 A;  4GIT A;  4LRS A;  4MGK E;  3TE6 A;  5KQ8 A;  3NBI A;  2DAG A;  2KNA A;  3RFW A;  4FCT A;  4Z6Y A;  3HJ8 A;  3U61 A;  1TDZ A;  2ZTC A;  1LV7 A;  4IBF A;  4QNR A;  3VK7 A;  4JXJ A;  1OKS A;  3I04 M;  3PNV A;  5BR8 M;  1W5S A;  2KRU A;  1W5T A;  5JI2 E;  1SXJ C;  2YQZ A;  4JV5 M;  1E9S A;  4ITQ A;  1TH2 A;  3T15 A;  2N35 A;  3AOE A;  2CHV A;  1ORY B;  2UU9 M;  1PJI A;  1OAO C;  1AIP C;  1QYR A;  4HL4 A;  2UXD M;  4PT5 A;  2FNA A;  4BLC A;  4LF5 M;  1N32 M;  2BWE A;  1Z5A A;  2I7N A;  3CTW B;  2KW0 A;  4P17 A;  3GRU A;  3GLF A;  4G4N A;  1SXJ B;  5DYG A;  4AKI A;  3SC3 A;  3WHK A;  3D8B A;  1IXS B;  1XNR M;  3W0L B;  4JI4 M;  5FTJ A;  4W5W A;  1R7R A;  3AJI B;  3LCU A;  4R7G A;  2OOB A;  2JZ1 A;  1ZMV A;  2HHH M;  1AUA A;  2RKO A;  2JY7 A;  3KXE C;  5ITX E;  2R18 A;  2C9C A;  3U60 A;  4G3O A;  2XFT A;  2R46 A;  1MJG M;  2MJ5 B;  1JR3 A;  3A46 A;  1N75 A;  1J5E M;  4B7G A;  5KQD A;  2LH0 A;  2JP7 A;  3B7N A;  1HNZ M;  1EE8 A;  3FUX A;  3U6Q A;  1NJF A;  4B3M M;  5L8R F;  2HKJ A;  4G4Q A;  4GHA A;  1DV0 A;  4AI6 A;  4IJE A;  4DV5 M;  3KSX A;  2YR0 A;  3R9X B;  4S12 A;  1GJT A;  1Z5B A;  1IXS A;  3U6C A;  4B3T M;  1DO0 A;  4D80 A;  1PM5 A;  1OTR A;  4AG6 A;  4HEO A;  2OPF A;  3SAR A;  1QZM A;  2YNM D;  4M9Z A;  3J2P B;  3GPU A;  4FWD A;  3A45 A;  2C5R A;  2W82 A;  3PXG A;  2QPA A;  4IBK A;  4ZPX A;  5IWA M;  1QUS A;  3GLI A;  3FTF A;  4X65 M;  3PFI A;  3KVW A;  2C99 A;  2MRO B;  4KHP M;  5H37 D;  4GKJ M;  4MGZ E;  3SYL A;  1L8Q A;  3J7A S;  2V1C A;  4FCV A;  2H1R A;  3EIH A;  5E26 A;  2EA0 A;  4DR5 M;  3CF0 A;  4DV6 M;  3T1H M;  5EP1 A;  3BOS A;  3KOW E;  4DUZ M;  2BJV A;  1IY1 A;  1D0M A;  1SXJ A;  2CE7 A;  1E9R A;  3FE3 A;  4WUR A;  5LMU M;  3U5Z B;  2Y0Q A;  4FD2 A;  4XBO A;  1L1T A;  3U6D A;  3U61 B;  3I4Y A;  3B7Z A;  1OAI A;  3FUW A;  3VFD A;  1QDR A;  3GRR A;  4CGY B;  4DUY M;  5DFL A;  3VKH A;  2EKF A;  3I51 A;  3U6L A;  4AKG A;  4I5S A;  3QYB A;  4LZJ A;  3DZD A;  1IQP A;  2UUB M;  4LJ7 A;  4LF7 M;  1TH4 A;  1HNW M;  2KA6 B;  4IBC A;  3B89 A;  3PVS A;  3IHP A;  2FH0 A;  1OQY A;  3FUT A;  2CP8 A;  1GL7 A;  1D0L A;  4RKU F;  2LXE A;  2XSZ D;  2Y0T A;  4IBJ A;  2OQ4 A;  4DV7 M;  4G4R A;  1N77 A;  2BWB A;  1TH3 A;  4P16 A;  3A42 A;  4MM3 B;  4CHT B;  2Z7J A;  2K0B X;  2VQE M;  1YUB A;  4JN6 A;  1N33 M;  4I81 A;  3E4R A;  1OIZ A;  1T3T A;  3A98 B;  3B74 A;  3GLH E;  2MR9 A;  3SHG B;  3BXW A;  3T38 A;  5ITY A;  4FW9 A;  4DV2 M;  5FTL A;  3HJS A;  1VEK A;  1VG5 A;  1HQY E;  2R0I A;  2V1U A;  1H6U A;  4GMQ A;  2J5Y A;  2P5T A;  2LNH C;  2WSE F;  3H4M A;  1NSF A;  1G3I A;  3EIE A;  1JQJ C;  1OJL A;  3J7B A;  3KP1 E;  4II7 A;  4GH9 A;  1Q02 A;  1QAO A;  5EXS A;  1QUT A;  4MGH A;  3FYC A;  3UK6 A;  3E9S A;  2C96 A;  1G41 A;  3HHX A;  3IG5 A;  4FCW A;  1HQC A;  4B7F A;  2DEN A;  2R65 A;  3HY5 A;  3OTO M;  2JY5 A;  2CUZ A;  1WGN A;  3B9P A;  3TL4 X;  2ZBK B;  2KXE A;  3L25 A;  4A3V B;  3GLI E;  4DV4 M;  4NRW A;  1T43 A;  4LG2 A;  3K9O A;  1XHB A;  3ZQJ A;  4BBA A;  4GIP A;  2JY6 B;  3GLF B;  1WHC A;  2WSC F;  4JI7 M;  4XK8 F;  2C98 A;  1FNN A;  2G8L A;  5JI3 E;  1G4A E;  5C18 A;  4D82 A;  3HKP A;  1Q3B A;  4K0K M;  1L1Z A;  1QVR A;  2KNZ A;  3HU3 A;  2BNK A;  2AHM A;  2XZU A;  3L28 A;  1C1K A;  4REZ A;  2J7N A;  4IBB A;  1UM8 A;  1QZE A;  2Q2E B;  4KOD A;  1WJ7 A;  4NL4 H;  3T1Y M;  1PJJ A;  2F5S A;  2F5Q A;  3R8F A;  2QSF X;  4AG5 A;  4DBG B;  2KHH A;  3C9P A;  4L6V 6;  2K6B A;  1L2B A;  1Z59 A;  3DOA A;  2VF7 A;  3GQ5 A;  2HAK A;  1IFY A;  2CEA A;  4LF6 M;  2XGN A;  3THG A;  1QQW A;  2LTU A;  2JZ0 A;  1Q3C A;  1CUK A;  3HZJ A;  3Q8G A;  2K9D A;  1OFI A;  4L15 A;  4B08 A;  2M5Z A;  3SYK A;  1GLN A;  2X8A A;  3C58 A;  2DWM A;  1IN6 A;  1IBK M;  3BBZ A;  4FWH A;  2Z3X A;  1SXJ D;  3FRI A;  4JI1 M;  2LHG A;  2Z8Y M;  4PDI A;  2FS1 A;  5IZ7 D;  4BB9 A;  4X64 M;  4DR1 M;  2UXB M;  4LF4 M;  1R2Z A;  3UMM A;  1UFZ A;  2CHG A;  1ZMW A;  2V6Z M;  3E46 A;  3IEC A;  1D2N A;  1IN8 A;  2R6F A;  2R45 A;  1VQ1 A;  2YFQ A;  4M9X A;  1MX0 A;  2FE8 A;  3CF2 A;  3JR5 A;  2R44 A;  3W67 A;  2LVA A;  1QAN A;  1PRB A;  3AOE C;  1NO1 A;  2EO2 A;  3HHY A;  3AOG A;  2Z4R A;  3AL0 C;  8CAT A;  3FUU A;  1HJP A;  5EQT A;  1IXR C; 
#chains in the Genus database with same CATH homology
 3FE3 A;  2DI0 A;  2ZTD A;  1GO5 A;  3LCV B;  1OAI A;  2EJS A;  2LVP C;  5DFL A;  2DHY A;  2EKF A;  1P3Q Q;  1MN3 A;  1IM2 A;  1A5T A;  2DNA A;  3K9P A;  1V92 A;  2B3T A;  3B89 A;  3IHP A;  1OQY A;  2CP8 A;  1R4G A;  3GLF E;  4UN2 B;  2BWB A;  2G3Q A;  1DO2 A;  2LVO C;  2K0B X;  1SG9 A;  2DZL A;  3GLH E;  2LVQ D;  1Y8G A;  2DAI A;  1TTE A;  2MR9 A;  3T6P A;  1NV9 A;  1VEK A;  1VG5 A;  1VEG A;  2LVN C;  1HQY E;  2DAK A;  2DAG A;  1C7Y A;  2LBC A;  2R0I A;  1KYI A;  2KNA A;  1G3I A;  1XB2 B;  1TR8 A;  2ZTC A;  1Q02 A;  1OKS A;  4F1I A;  1G41 A;  3GLG E;  5JI2 E;  2DEN A;  2KNV A;  3F92 A;  4WP2 A;  2JY5 A;  2CWB A;  1ZV1 A;  4GEW A;  2L4E A;  2JUJ A;  1WGN A;  4R71 A;  3GLI E;  1AIP C;  1T43 A;  2OO9 A;  1HT2 E;  3K9O A;  1WGL A;  2BWE A;  1T6O A;  2JY6 B;  1WHC A;  2DKL A;  2HWJ A;  1G4A E;  1ZMU A;  3H4J A;  4F2L A;  3LCU A;  2KNZ A;  1PGY A;  2JY8 A;  2OOB A;  2JZ1 A;  1ZMV A;  2RRU A;  1BVS A;  2JY7 A;  1F4I A;  1QZE A;  4G3O A;  1EFU B;  1WJ7 A;  2EKK A;  2MJ5 B;  2QSF X;  3MMP A;  4DBG B;  2KHH A;  2JNH A;  2QHO B;  2JP7 A;  2HAK A;  1IFY A;  1XXH E;  2MGW A;  2LTU A;  2O25 A;  2OOA A;  2JZ0 A;  1CUK A;  1VEJ A;  2H5X A;  2K9D A;  3E21 A;  1DV0 A;  2L4F A;  1JR3 E;  2WZJ A;  3BBZ A;  1IXS A;  3FRI A;  1DO0 A;  1E94 E;  2DAE A;  2DAM A;  1OTR A;  4HEO A;  2QNJ A;  1YLA A;  1UFZ A;  3FRH A;  1ZMW A;  3E46 A;  3IEC A;  1HT1 E;  1NV8 A;  1VQ1 A;  2MRO B;  1VDL A;  1WIV A;  4Q7J A;  2LVA A;  1WR1 B;  2L2D A;  1HJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...