2DAMA

Solution structure of the novel identified uba-like domain in the n-terminal of human etea protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETEA protein
publication title Solution Structure of the Novel Identified UBA-like Domain in the N-terminal of Human ETEA Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2damA00
2K0BX 2DAGA 4G3OA 1OQYA 3IECA 1MN3A 1TR8A 3H4JA 1WIVA 2L2DA 4HEOA 1WJ7A 1CUKA 1GO5A 1G41A 1VEGA 2RRUA 3B89A 1HT2E 2LVPC 3GLGE 2DNAA 1DO0A 3T6PA 3MMPA 1IFYA 2DENA 1WHCA 2L4EA 1OAIA 4F1IA 2OOAA 2MGWA 1E94E 3LCVB 1T43A 2QNJA 1VDLA 2JP7A 4UN2B 2B3TA 2O25A 1NV8A 3K9OA 2ZTDA 1YLAA 1Y8GA 1PGYA 1G3IA 2CP8A 1C7YA 1AIPC 2KHHA 1OTRA 1VG5A 2DHYA 1ZMWA 1F4IA 2LVOC 2LVQD 2DAIA 4WP2A 1UFZA 2KNVA 1IXSA 1OKSA 2KNZA 2EKFA 2LTUA 2K9DA 3GLIE 2DKLA 2JZ0A 1T6OA 2EJSA 2KNAA 1VEJA 1DO2A 3F92A 3GLHE 1DV0A 4DBGB 2MJ5B 2LVAA 2QSFX 1SG9A 2LVNC 5DFLA 3K9PA 1HQYE 3GLFE 2G3QA 2DZLA 4Q7JA 1XB2B 1R4GA 2EKKA 1HT1E 2OOBA 2CWBA 2BWBA 2JY6B 3E21A 1NV9A 2DI0A 2L4FA 1XXHE 1IM2A 1EFUB 2H5XA 1Q02A 2DAEA 2LBCA 1JR3E 2MR9A 2OO9A 4GEWA 2DAKA 2DAMA 1VQ1A 5JI2E 2MROB 2ZTCA 2WZJA 3FE3A 2QHOB 4F2LA 3E46A 1P3QQ 1HJPA 2JY8A 1A5TA 1WGLA 1WGNA 1G4AE 2JNHA 3FRIA 4R71A 1TTEA 1WR1B 2BWEA 2JY7A 2JZ1A 1QZEA 1VEKA 2HWJA 1KYIA 1ZV1A 2JY5A 3IHPA 3BBZA 2HAKA 2R0IA 2JUJA 1ZMVA 3FRHA 1BVSA 3LCUA 1V92A 1ZMUA
chains in the Genus database with same CATH superfamily
3SARA 3IECA 3SYKA 2KW0A 5IREB 4FVMA 1WXQA 2L2DA 3KP0E 3UK6A 1WJ7A 4ZPXA 1W5SA 1CUKA 1GO5A 1XXHA 2J7OA 3KDSE 1QAMA 2EO2A 2RRUA 4GITA 1UM8A 3ILKA 3VDPA 2QBYB 1SXJB 2AHMA 5L8RF 3HHZA 1TDHA 2DNAA 3GLGB 3HHXA 3PNVA 3SMSA 4NOOB 3MMPA 2VF8A 3T6PA 1NJFA 2QCUA 1WHCA 2L4EA 1QDTA 1IN4A 1DGHB 1I4WA 2Z4RA 4DR6M 2MGWA 2UXDM 4G6ZA 1E9RA 3L2AA 4I8OA 3JAMS 4JI8M 3L25A 3EIEA 2QP9X 3HJQA 2R4EA 1PJTA 4MGZE 5EP4A 2JP7A 2Z4SA 3PNYA 1OFHA 4REZA 3LMMA 3TL4X 4X65M 4LFBM 3FTEA 1H6UA 1NSFA 2DHRA 2QPAA 2P5TA 2VDBB 3K9OA 3QYBA 4LF4M 2ZAMA 3GLIA 1Y8GA 2CP8A 3VLFB 4AKHA 5FTJA 2FOIC 3OTOM 1DGBA 4WW0A 2DHYA 1ZMWA 2C98A 4PD2A 2LVOC 4CGYB 3GRUA 2L09A 4OU7A 2DZNB 4CISA 2VIIA 3KS8A 1UFZA 4MGYE 1K3XA 5LMUM 2KNVA 1IXSA 4D80A 1J09A 5ITRA 4JI7M 1OKSA 2KNZA 3HWSA 2XH9A 3RGSA 5E6JA 1MU5A 1N33M 2KXEA 1VEJA 1Q3BA 3FYDA 5C18A 3HU2A 3GPUA 3SYLA 2XGNA 4B7GA 2C96A 3GLHE 2HKJA 2MJ5B 3SHFA 2R45A 4X62M 4FWHA 2QSFX 3QYEA 1R5LA 4G4NA 3KP1E 1XC8A 2BJWA 2LVNC 5EQTA 3FUWA 2D7EA 3K9PA 3RE8A 4CIZA 2LH0A 2G3QA 2F5QA 4PDGA 3LQQA 1QANA 2CRUA 1IXRC 2UUAM 3GQ5A 2JY6B 3L29A 1NV9A 4IBEA 4GRIA 4DR7M 1D0KA 3L28A 4HL4A 3W68A 4LJ4A 2H5XA 2ZBKB 3HKPA 3HHWA 3TWKA 3KSJA 1PRBA 2DAKA 4IBGA 3QAUA 1VQ1A 2QENA 3A98B 3U6EA 3C58A 1SXJD 1G59A 2XFTA 4QHTA 3CGWA 2LNHC 2C9OA 3FD9A 5ITUA 1L8QA 4KT0F 3TPZA 3U6QA 1E32A 2XFSA 3HY5A 5LMNM 1WR1B 2BWEA 2X4AA 3J7BA 4CHTB 3ZCBB 1PJQA 2EA0A 1VEKA 1GLNA 4AG5A 1KYIA 3U61A 5EXSA 2O5RA 3IHPA 2Y0TA 3BBZA 2APLA 4Y28F 5JI3E 2LWXA 3U5ZA 2CV2A 2JUJA 1NO1A 4M9ZA 3GLIB 1BVSA 3DFZA 1KFVA 2K0BX 4MGIE 1C1KA 1MN3A 1QUTA 1TR8A 2I7NA 4DR4M 2UXBM 4X64M 3BOSA 2BNKA 4M9SA 2HCBA 3B74A 4LZJA 4LCBA 5EXXA 5BR8M 5FTLA 4HEOA 1L1TA 4B3MM 3HX3A 3JR5A 3L26A 4AKGA 1IN8A 2R44A 1IXSB 1VEGA 4JI2M 4QOZC 2G8LA 4PT5A 3KVWA 1HT2E 1JR3A 4ITQA 2DZOB 3J7AS 3Q8XA 1N77A 3GLGE 1IBKM 4HLQA 4W5WA 3GPPA 2RKOA 1NHGC 2Z8YM 3U60A 1IFYA 2W82A 4R3DA 1HNZM 1XHBA 4F1IA 3R9XB 2CHQA 3VFDA 1TDZA 2HL7A 1T43A 1R7RA 4I81A 4RF0A 2F5OA 2XF3A 3W0LB 3BXWA 1GABA 1K3WA 7CATA 3U6LA 5EP2A 1V33A 4DV3M 3FTFA 2CV1A 4XK8F 2V1UA 4GIPA 4IBIA 3MK6A 3KFUG 3GQ4A 3SMPA 2FFJA 4AI6A 3VK8A 5FTMA 4LF8M 5BPVA 1G3IA 3KOZE 4RKUF 3UGJA 3HJ8A 1AIPC 2KHHA 1OTRA 2J7NA 4AW4A 5KPRA 3I01M 4IIWA 4L4UA 4OX9M 5H37D 5IWAM 3D8LA 1N34M 2ZM6M 1HNWM 2EKFA 2DKLA 2JZ0A 2Z7JA 3C3DA 4GC5A 4PCZA 1T6OA 1XNQM 2RGOA 1TF0B 3AV0A 1IN5A 1QAQA 5FSWA 3I4VA 3FTDA 4DV4M 1I94M 3SAVA 4LF6M 4LF9M 4GHAA 1GL6A 4FCVA 1DV0A 2M5ZA 3AOEA 1Z5BA 3NBIA 5DNYA 4LJ8A 2CE7A 3GPYA 2Q2EB 1R6BX 2BJVA 4GC9A 2VQEM 4LGMA 3B7NA 3HU3A 2UUCM 3H4MA 5ITXE 5DFLA 3U5ZB 2XSZA 1HQYE 3GLFE 3CTWB 2DZLA 3I4YA 3M7GA 1T3TA 2EKKA 2I7PA 1HT1E 3T38A 3FKEA 1PM5A 2CWBA 3GP1A 2EUCA 2F5SA 2DVWB 2YNMD 2ZANA 1QDRA 4KODA 4B7HA 4OVZA 1EE8A 3HGIA 5FTNA 1XXHE 5FLXS 2KEBA 2XEPA 1Q02A 4D82A 3U6PA 2LBCA 3J2PB 2DAMA 2L7HA 2F5PA 4WURA 3K2LA 3AJIB 2C5RA 3EIHA 3A46A 3U60B 3E4RA 2WZJA 3T1YM 1TH3A 4QNRA 3TE6A 1D0MA 2JWSA 1HJPA 2JY8A 3E46A 4IBCA 5DYIA 1A5TA 1WGLA 2DWZB 4R71A 2D7HA 5KPZA 2OQ4A 2XZFA 2CHVA 4AG6A 4MGHA 3PFIA 4KLNA 1TTEA 2K6BA 4QHSA 3GLFB 2DWNA 1GL7A 3C3EA 1E9SA 1XNRM 1Z6TA 2FNAA 3AOEC 3CF2A 3VKHA 4MB7A 2A5YB 2R0IA 3FRHA 3GLIE 1XXHB 1V92A 1QVRA 2YFQA 2K47A 1OQYA 4RF1A 3RGPA 3H4JA 4JI1M 3K92A 1HR0M 3KOYE 2O01F 4LJ9A 2V1CA 5KQ8A 1FJGM 3B89A 1L2CA 4P17A 4K0KM 4DV0M 4FD2A 2V6ZM 2R62A 4DUYM 2KDLA 1XMOM 4S12A 2UUBM 4CJ6A 4LF7M 3NBXX 2DENA 2VQFM 2R4JA 4M0DA 4RNAA 3FUXA 4NSOB 1YSYA 3Q8GA 1E94E 1NVMA 1SXJA 5C1BA 3GLFA 2WSEF 3GRYA 4LJAA 5KQDA 2QNJA 4TUWA 1TH4A 1VDLA 1Z5CA 4YHHM 3HZJA 5E26A 1PJIA 5DYGA 5EXTA 3K8ZA 4QOSA 1DGHA 1OIPA 3KXEC 1QZMA 3K1JA 2B3TA 2O25A 2WSCF 4DV5M 2H1RA 3I04M 1XMQM 2ZTDA 4MH0E 3ZC7B 4BBAA 1IY1A 3LQRA 2HHHM 1PGYA 1C7YA 3NWLA 4OVZB 4LF5M 3M0EA 4DR1M 1VG5A 1F4IA 3J27B 3A42A 4WP2A 1OAOC 1IN6A 3TQSA 3U6CA 2NQ8C 2Y0QA 3FUVA 4MM3B 3SFZA 3GQ3A 4DV6M 4G4OA 4JI5M 3C9PA 3PVSA 1JR3D 1W5TA 3TWMA 2LTUA 1IBLM 4LFCM 1PJSA 3LVWA 3DA1A 2DXIA 1GKIA 2N35A 1N36M 4LGYA 2EJSA 1LV7A 3AKZA 2KNAA 2FS1A 4LJ7A 3VDUA 3F92A 3B7QA 1Q39A 3M6AA 2KA6B 1V34A 3DOAA 4L78A 1MX0A 1QUSA 2CHGA 4JN6A 3KOWE 4FW9A 4LJ6A 1D0LA 4FWDA 5IT9S 4GMQA 2CFOA 4L6V6 1GJSA 1QQWA 4B3RM 1JB0F 4Q7JA 1XB2B 3T1HM 1NY5A 2FH0A 2OOBA 4IJFA 2BWBA 3RFWA 3GRVA 3E21A 2CEAA 4FWGA 1OFIA 5KPTA 1NY6A 1Z5AA 3KOXE 3WHLA 1D2NA 4NRWA 4DR2M 1LTMA 2Y20A 5ITYA 1VDDA 4M0WA 5EXPA 4M9XA 3W0FA 3W67A 1JR3E 2MR9A 2OO9A 4GEWA 2DWLA 4LG2A 1QAOA 5KO3A 3KS4A 3E9SA 4JV5M 2MROB 2ZTCA 3B7ZA 2UXCM 1G71A 1YE9A 3KSXA 4X66M 1NJGA 4JI6M 4I5SA 2DWMA 3SHGB 4JI0M 1P3QQ 2F5NA 3U61B 1WGNA 3HU1A 2JNHA 1KSFX 3FRIA 4DV7M 4DR5M 2R6FA 3LW5F 4MGKE 3U6DA 2RGHA 1YUBA 1IXZA 3GLHA 4L16A 3J80S 8CATA 2JY7A 3D8BA 4DV2M 2KRUA 1QZEA 4KO8A 3SASA 2HWJA 1AUAA 1ZV1A 1ORYB 3I51A 2JY5A 1NNJA 5GKNA 2XSZD 2LXEA 1ZQ9A 2Y21A 4II7A 3VKGA 4NSRA 4NRVA 3IG8A 2MH8A 2DAGA 4G3OA 3SATA 1S3SA 3AFHA 3GPXA 1NHWC 2E5LM 2KZSA 4A3VB 1WIVA 3HHYA 4Z6YA 1HNXM 1OIZA 3PXGA 1QYRA 1Q3CA 1G41A 1HQCA 3SC3A 4IBBA 1IY0A 1RU3A 2JXNA 3TWLA 4AKIA 3FTCA 4NL4H 1R2YA 4B08A 2LVPC 2GNOA 3FUUA 4LJ5A 4LY6A 4ANRA 4KHPM 4B3SM 4JYAM 1DO0A 1OJLA 2X8AA 1ZAEA 3IG5A 1OAIA 2ERCA 4L15A 3CF0A 3GO8A 2CV0A 2OOAA 2L6OA 2L7IA 1DGFA 3LCVB 3KW6A 4IBKA 3AOGA 4IBJA 4OW0A 4R7GA 4NXNM 4DV1M 4G4QA 2C9CA 4D81A 4UN2B 4I4LA 1L2DA 2J5YA 3MJ5A 2XZUA 1EIJA 3R8FA 5A2QS 4G4RA 1L2BA 4B3TM 2GQFA 1IY2A 1NV8A 2VF7A 2G5GX 5ITTA 3UMMA 3SBJA 1YLAA 5EP1A 4BB9A 3SAUA 2XLJA 2JA2A 4L8RC 2C99A 2YR0A 3DZDA 2WSFF 4LRTA 4QNMA 2LVQD 2DAIA 4GKKM 1Z59A 3LVVA 2LHCA 1MJGM 3GRRA 2KZUA 4IBFA 4JXJA 1J5EM 3ZH9B 1FNNA 3HJSA 3U6OA 3VK7A 1GJTA 2K9DA 2QZ4A 2QBYA 2R46A 1IBMM 3GLGA 4EIWA 3U6MA 1DO2A 1JQJC 4P16A 4PDIA 2D7GA 3GLHB 4DBGB 5EP3A 1TH2A 2LVAA 4FCTA 4YY3M 1N32M 4IJEA 4JI4M 3THGA 3UJNA 4LRSA 4AZFA 1G8PA 1SG9A 1L1ZA 4AQYM 2KRKA 5EJCA 4NXMM 2YQZA 2OPFA 3B9PA 1R4GA 3MHVC 3FUTA 4XBOA 1N78A 2ZAOA 4IBDA 2Z3XA 4GHLA 1X37A 4BLCA 4XGIA 4JI3M 2DI0A 2UU9M 1NNUC 4FCWA 3T15A 2L4FA 4DUZM 1IM2A 3UZUA 1EFUB 1DGGA 4GKJM 1J7KA 2DAEA 3A45A 3AL0C 3V76A 5F3WA 3FYCA 5JI2E 1GVNA 1IQPA 4B7FA 4LZZA 3FE3A 5FTKA 2QHOB 5IZ7D 1R2ZA 4F2LA 1K82A 2QQ8A 2M60A 2FE8A 1TGUA 4Z8XA 1SXJE 1G4AE 3L27A 3ZQJA 4GH9A 1SXJC 2R65A 3JR4A 1XWIA 1N75A 5ITQA 2JZ1A 3CF6E 3QWLA 2R18A 3WHKA 4DR3M 2F4VM 3J81S 1PJJA 1IN7A 4NC6A 3U6SA 2HAKA 3SAWA 2LHGA 5ITXA 1ZMVA 4LFAM 2X49A 3LCUA 2CUZA 1ZMUA
chains in the Genus database with same CATH topology
2K0BX 2DAGA 4G3OA 1OQYA 3IECA 1MN3A 1TR8A 3H4JA 1WIVA 2L2DA 4HEOA 1WJ7A 1CUKA 1GO5A 1G41A 1VEGA 2RRUA 3B89A 1HT2E 2LVPC 3GLGE 2DNAA 1DO0A 3T6PA 3MMPA 1IFYA 2DENA 1WHCA 2L4EA 1OAIA 4F1IA 2OOAA 2MGWA 1E94E 3LCVB 1T43A 2QNJA 1VDLA 2JP7A 4UN2B 2B3TA 2O25A 1NV8A 3K9OA 2ZTDA 1YLAA 1Y8GA 1PGYA 1G3IA 2CP8A 1C7YA 1AIPC 2KHHA 1OTRA 1VG5A 2DHYA 1ZMWA 1F4IA 2LVOC 2LVQD 2DAIA 4WP2A 1UFZA 2KNVA 1IXSA 1OKSA 2KNZA 2EKFA 2LTUA 2K9DA 3GLIE 2DKLA 2JZ0A 1T6OA 2EJSA 2KNAA 1VEJA 1DO2A 3F92A 3GLHE 1DV0A 4DBGB 2MJ5B 2LVAA 2QSFX 1SG9A 2LVNC 5DFLA 3K9PA 1HQYE 3GLFE 2G3QA 2DZLA 4Q7JA 1XB2B 1R4GA 2EKKA 1HT1E 2OOBA 2CWBA 2BWBA 2JY6B 3E21A 1NV9A 2DI0A 2L4FA 1XXHE 1IM2A 1EFUB 2H5XA 1Q02A 2DAEA 2LBCA 1JR3E 2MR9A 2OO9A 4GEWA 2DAKA 2DAMA 1VQ1A 5JI2E 2MROB 2ZTCA 2WZJA 3FE3A 2QHOB 4F2LA 3E46A 1P3QQ 1HJPA 2JY8A 1A5TA 1WGLA 1WGNA 1G4AE 2JNHA 3FRIA 4R71A 1TTEA 1WR1B 2BWEA 2JY7A 2JZ1A 1QZEA 1VEKA 2HWJA 1KYIA 1ZV1A 2JY5A 3IHPA 3BBZA 2HAKA 2R0IA 2JUJA 1ZMVA 3FRHA 1BVSA 3LCUA 1V92A 1ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0B X;  2DAG A;  4G3O A;  1OQY A;  3IEC A;  1MN3 A;  1TR8 A;  3H4J A;  1WIV A;  2L2D A;  4HEO A;  1WJ7 A;  1CUK A;  1GO5 A;  1G41 A;  1VEG A;  2RRU A;  3B89 A;  1HT2 E;  2LVP C;  3GLG E;  2DNA A;  1DO0 A;  3T6P A;  3MMP A;  1IFY A;  2DEN A;  1WHC A;  2L4E A;  1OAI A;  4F1I A;  2OOA A;  2MGW A;  1E94 E;  3LCV B;  1T43 A;  2QNJ A;  1VDL A;  2JP7 A;  4UN2 B;  2B3T A;  2O25 A;  1NV8 A;  3K9O A;  2ZTD A;  1YLA A;  1Y8G A;  1PGY A;  1G3I A;  2CP8 A;  1C7Y A;  1AIP C;  2KHH A;  1OTR A;  1VG5 A;  2DHY A;  1ZMW A;  1F4I A;  2LVO C;  2LVQ D;  2DAI A;  4WP2 A;  1UFZ A;  2KNV A;  1IXS A;  1OKS A;  2KNZ A;  2EKF A;  2LTU A;  2K9D A;  3GLI E;  2DKL A;  2JZ0 A;  1T6O A;  2EJS A;  2KNA A;  1VEJ A;  1DO2 A;  3F92 A;  3GLH E;  1DV0 A;  4DBG B;  2MJ5 B;  2LVA A;  2QSF X;  1SG9 A;  2LVN C;  5DFL A;  3K9P A;  1HQY E;  3GLF E;  2G3Q A;  2DZL A;  4Q7J A;  1XB2 B;  1R4G A;  2EKK A;  1HT1 E;  2OOB A;  2CWB A;  2BWB A;  2JY6 B;  3E21 A;  1NV9 A;  2DI0 A;  2L4F A;  1XXH E;  1IM2 A;  1EFU B;  2H5X A;  1Q02 A;  2DAE A;  2LBC A;  1JR3 E;  2MR9 A;  2OO9 A;  4GEW A;  2DAK A;  2DAM A;  1VQ1 A;  5JI2 E;  2MRO B;  2ZTC A;  2WZJ A;  3FE3 A;  2QHO B;  4F2L A;  3E46 A;  1P3Q Q;  1HJP A;  2JY8 A;  1A5T A;  1WGL A;  1WGN A;  1G4A E;  2JNH A;  3FRI A;  4R71 A;  1TTE A;  1WR1 B;  2BWE A;  2JY7 A;  2JZ1 A;  1QZE A;  1VEK A;  2HWJ A;  1KYI A;  1ZV1 A;  2JY5 A;  3IHP A;  3BBZ A;  2HAK A;  2R0I A;  2JUJ A;  1ZMV A;  3FRH A;  1BVS A;  3LCU A;  1V92 A;  1ZMU A; 
#chains in the Genus database with same CATH topology
 3SAR A;  3IEC A;  3SYK A;  2KW0 A;  5IRE B;  4FVM A;  1WXQ A;  2L2D A;  3KP0 E;  3UK6 A;  1WJ7 A;  4ZPX A;  1W5S A;  1CUK A;  1GO5 A;  1XXH A;  2J7O A;  3KDS E;  1QAM A;  2EO2 A;  2RRU A;  4GIT A;  1UM8 A;  3ILK A;  3VDP A;  2QBY B;  1SXJ B;  2AHM A;  5L8R F;  3HHZ A;  1TDH A;  2DNA A;  3GLG B;  3HHX A;  3PNV A;  3SMS A;  4NOO B;  3MMP A;  2VF8 A;  3T6P A;  1NJF A;  2QCU A;  1WHC A;  2L4E A;  1QDT A;  1IN4 A;  1DGH B;  1I4W A;  2Z4R A;  4DR6 M;  2MGW A;  2UXD M;  4G6Z A;  1E9R A;  3L2A A;  4I8O A;  3JAM S;  4JI8 M;  3L25 A;  3EIE A;  2QP9 X;  3HJQ A;  2R4E A;  1PJT A;  4MGZ E;  5EP4 A;  2JP7 A;  2Z4S A;  3PNY A;  1OFH A;  4REZ A;  3LMM A;  3TL4 X;  4X65 M;  4LFB M;  3FTE A;  1H6U A;  1NSF A;  2DHR A;  2QPA A;  2P5T A;  2VDB B;  3K9O A;  3QYB A;  4LF4 M;  2ZAM A;  3GLI A;  1Y8G A;  2CP8 A;  3VLF B;  4AKH A;  5FTJ A;  2FOI C;  3OTO M;  1DGB A;  4WW0 A;  2DHY A;  1ZMW A;  2C98 A;  4PD2 A;  2LVO C;  4CGY B;  3GRU A;  2L09 A;  4OU7 A;  2DZN B;  4CIS A;  2VII A;  3KS8 A;  1UFZ A;  4MGY E;  1K3X A;  5LMU M;  2KNV A;  1IXS A;  4D80 A;  1J09 A;  5ITR A;  4JI7 M;  1OKS A;  2KNZ A;  3HWS A;  2XH9 A;  3RGS A;  5E6J A;  1MU5 A;  1N33 M;  2KXE A;  1VEJ A;  1Q3B A;  3FYD A;  5C18 A;  3HU2 A;  3GPU A;  3SYL A;  2XGN A;  4B7G A;  2C96 A;  3GLH E;  2HKJ A;  2MJ5 B;  3SHF A;  2R45 A;  4X62 M;  4FWH A;  2QSF X;  3QYE A;  1R5L A;  4G4N A;  3KP1 E;  1XC8 A;  2BJW A;  2LVN C;  5EQT A;  3FUW A;  2D7E A;  3K9P A;  3RE8 A;  4CIZ A;  2LH0 A;  2G3Q A;  2F5Q A;  4PDG A;  3LQQ A;  1QAN A;  2CRU A;  1IXR C;  2UUA M;  3GQ5 A;  2JY6 B;  3L29 A;  1NV9 A;  4IBE A;  4GRI A;  4DR7 M;  1D0K A;  3L28 A;  4HL4 A;  3W68 A;  4LJ4 A;  2H5X A;  2ZBK B;  3HKP A;  3HHW A;  3TWK A;  3KSJ A;  1PRB A;  2DAK A;  4IBG A;  3QAU A;  1VQ1 A;  2QEN A;  3A98 B;  3U6E A;  3C58 A;  1SXJ D;  1G59 A;  2XFT A;  4QHT A;  3CGW A;  2LNH C;  2C9O A;  3FD9 A;  5ITU A;  1L8Q A;  4KT0 F;  3TPZ A;  3U6Q A;  1E32 A;  2XFS A;  3HY5 A;  5LMN M;  1WR1 B;  2BWE A;  2X4A A;  3J7B A;  4CHT B;  3ZCB B;  1PJQ A;  2EA0 A;  1VEK A;  1GLN A;  4AG5 A;  1KYI A;  3U61 A;  5EXS A;  2O5R A;  3IHP A;  2Y0T A;  3BBZ A;  2APL A;  4Y28 F;  5JI3 E;  2LWX A;  3U5Z A;  2CV2 A;  2JUJ A;  1NO1 A;  4M9Z A;  3GLI B;  1BVS A;  3DFZ A;  1KFV A;  2K0B X;  4MGI E;  1C1K A;  1MN3 A;  1QUT A;  1TR8 A;  2I7N A;  4DR4 M;  2UXB M;  4X64 M;  3BOS A;  2BNK A;  4M9S A;  2HCB A;  3B74 A;  4LZJ A;  4LCB A;  5EXX A;  5BR8 M;  5FTL A;  4HEO A;  1L1T A;  4B3M M;  3HX3 A;  3JR5 A;  3L26 A;  4AKG A;  1IN8 A;  2R44 A;  1IXS B;  1VEG A;  4JI2 M;  4QOZ C;  2G8L A;  4PT5 A;  3KVW A;  1HT2 E;  1JR3 A;  4ITQ A;  2DZO B;  3J7A S;  3Q8X A;  1N77 A;  3GLG E;  1IBK M;  4HLQ A;  4W5W A;  3GPP A;  2RKO A;  1NHG C;  2Z8Y M;  3U60 A;  1IFY A;  2W82 A;  4R3D A;  1HNZ M;  1XHB A;  4F1I A;  3R9X B;  2CHQ A;  3VFD A;  1TDZ A;  2HL7 A;  1T43 A;  1R7R A;  4I81 A;  4RF0 A;  2F5O A;  2XF3 A;  3W0L B;  3BXW A;  1GAB A;  1K3W A;  7CAT A;  3U6L A;  5EP2 A;  1V33 A;  4DV3 M;  3FTF A;  2CV1 A;  4XK8 F;  2V1U A;  4GIP A;  4IBI A;  3MK6 A;  3KFU G;  3GQ4 A;  3SMP A;  2FFJ A;  4AI6 A;  3VK8 A;  5FTM A;  4LF8 M;  5BPV A;  1G3I A;  3KOZ E;  4RKU F;  3UGJ A;  3HJ8 A;  1AIP C;  2KHH A;  1OTR A;  2J7N A;  4AW4 A;  5KPR A;  3I01 M;  4IIW A;  4L4U A;  4OX9 M;  5H37 D;  5IWA M;  3D8L A;  1N34 M;  2ZM6 M;  1HNW M;  2EKF A;  2DKL A;  2JZ0 A;  2Z7J A;  3C3D A;  4GC5 A;  4PCZ A;  1T6O A;  1XNQ M;  2RGO A;  1TF0 B;  3AV0 A;  1IN5 A;  1QAQ A;  5FSW A;  3I4V A;  3FTD A;  4DV4 M;  1I94 M;  3SAV A;  4LF6 M;  4LF9 M;  4GHA A;  1GL6 A;  4FCV A;  1DV0 A;  2M5Z A;  3AOE A;  1Z5B A;  3NBI A;  5DNY A;  4LJ8 A;  2CE7 A;  3GPY A;  2Q2E B;  1R6B X;  2BJV A;  4GC9 A;  2VQE M;  4LGM A;  3B7N A;  3HU3 A;  2UUC M;  3H4M A;  5ITX E;  5DFL A;  3U5Z B;  2XSZ A;  1HQY E;  3GLF E;  3CTW B;  2DZL A;  3I4Y A;  3M7G A;  1T3T A;  2EKK A;  2I7P A;  1HT1 E;  3T38 A;  3FKE A;  1PM5 A;  2CWB A;  3GP1 A;  2EUC A;  2F5S A;  2DVW B;  2YNM D;  2ZAN A;  1QDR A;  4KOD A;  4B7H A;  4OVZ A;  1EE8 A;  3HGI A;  5FTN A;  1XXH E;  5FLX S;  2KEB A;  2XEP A;  1Q02 A;  4D82 A;  3U6P A;  2LBC A;  3J2P B;  2DAM A;  2L7H A;  2F5P A;  4WUR A;  3K2L A;  3AJI B;  2C5R A;  3EIH A;  3A46 A;  3U60 B;  3E4R A;  2WZJ A;  3T1Y M;  1TH3 A;  4QNR A;  3TE6 A;  1D0M A;  2JWS A;  1HJP A;  2JY8 A;  3E46 A;  4IBC A;  5DYI A;  1A5T A;  1WGL A;  2DWZ B;  4R71 A;  2D7H A;  5KPZ A;  2OQ4 A;  2XZF A;  2CHV A;  4AG6 A;  4MGH A;  3PFI A;  4KLN A;  1TTE A;  2K6B A;  4QHS A;  3GLF B;  2DWN A;  1GL7 A;  3C3E A;  1E9S A;  1XNR M;  1Z6T A;  2FNA A;  3AOE C;  3CF2 A;  3VKH A;  4MB7 A;  2A5Y B;  2R0I A;  3FRH A;  3GLI E;  1XXH B;  1V92 A;  1QVR A;  2YFQ A;  2K47 A;  1OQY A;  4RF1 A;  3RGP A;  3H4J A;  4JI1 M;  3K92 A;  1HR0 M;  3KOY E;  2O01 F;  4LJ9 A;  2V1C A;  5KQ8 A;  1FJG M;  3B89 A;  1L2C A;  4P17 A;  4K0K M;  4DV0 M;  4FD2 A;  2V6Z M;  2R62 A;  4DUY M;  2KDL A;  1XMO M;  4S12 A;  2UUB M;  4CJ6 A;  4LF7 M;  3NBX X;  2DEN A;  2VQF M;  2R4J A;  4M0D A;  4RNA A;  3FUX A;  4NSO B;  1YSY A;  3Q8G A;  1E94 E;  1NVM A;  1SXJ A;  5C1B A;  3GLF A;  2WSE F;  3GRY A;  4LJA A;  5KQD A;  2QNJ A;  4TUW A;  1TH4 A;  1VDL A;  1Z5C A;  4YHH M;  3HZJ A;  5E26 A;  1PJI A;  5DYG A;  5EXT A;  3K8Z A;  4QOS A;  1DGH A;  1OIP A;  3KXE C;  1QZM A;  3K1J A;  2B3T A;  2O25 A;  2WSC F;  4DV5 M;  2H1R A;  3I04 M;  1XMQ M;  2ZTD A;  4MH0 E;  3ZC7 B;  4BBA A;  1IY1 A;  3LQR A;  2HHH M;  1PGY A;  1C7Y A;  3NWL A;  4OVZ B;  4LF5 M;  3M0E A;  4DR1 M;  1VG5 A;  1F4I A;  3J27 B;  3A42 A;  4WP2 A;  1OAO C;  1IN6 A;  3TQS A;  3U6C A;  2NQ8 C;  2Y0Q A;  3FUV A;  4MM3 B;  3SFZ A;  3GQ3 A;  4DV6 M;  4G4O A;  4JI5 M;  3C9P A;  3PVS A;  1JR3 D;  1W5T A;  3TWM A;  2LTU A;  1IBL M;  4LFC M;  1PJS A;  3LVW A;  3DA1 A;  2DXI A;  1GKI A;  2N35 A;  1N36 M;  4LGY A;  2EJS A;  1LV7 A;  3AKZ A;  2KNA A;  2FS1 A;  4LJ7 A;  3VDU A;  3F92 A;  3B7Q A;  1Q39 A;  3M6A A;  2KA6 B;  1V34 A;  3DOA A;  4L78 A;  1MX0 A;  1QUS A;  2CHG A;  4JN6 A;  3KOW E;  4FW9 A;  4LJ6 A;  1D0L A;  4FWD A;  5IT9 S;  4GMQ A;  2CFO A;  4L6V 6;  1GJS A;  1QQW A;  4B3R M;  1JB0 F;  4Q7J A;  1XB2 B;  3T1H M;  1NY5 A;  2FH0 A;  2OOB A;  4IJF A;  2BWB A;  3RFW A;  3GRV A;  3E21 A;  2CEA A;  4FWG A;  1OFI A;  5KPT A;  1NY6 A;  1Z5A A;  3KOX E;  3WHL A;  1D2N A;  4NRW A;  4DR2 M;  1LTM A;  2Y20 A;  5ITY A;  1VDD A;  4M0W A;  5EXP A;  4M9X A;  3W0F A;  3W67 A;  1JR3 E;  2MR9 A;  2OO9 A;  4GEW A;  2DWL A;  4LG2 A;  1QAO A;  5KO3 A;  3KS4 A;  3E9S A;  4JV5 M;  2MRO B;  2ZTC A;  3B7Z A;  2UXC M;  1G71 A;  1YE9 A;  3KSX A;  4X66 M;  1NJG A;  4JI6 M;  4I5S A;  2DWM A;  3SHG B;  4JI0 M;  1P3Q Q;  2F5N A;  3U61 B;  1WGN A;  3HU1 A;  2JNH A;  1KSF X;  3FRI A;  4DV7 M;  4DR5 M;  2R6F A;  3LW5 F;  4MGK E;  3U6D A;  2RGH A;  1YUB A;  1IXZ A;  3GLH A;  4L16 A;  3J80 S;  8CAT A;  2JY7 A;  3D8B A;  4DV2 M;  2KRU A;  1QZE A;  4KO8 A;  3SAS A;  2HWJ A;  1AUA A;  1ZV1 A;  1ORY B;  3I51 A;  2JY5 A;  1NNJ A;  5GKN A;  2XSZ D;  2LXE A;  1ZQ9 A;  2Y21 A;  4II7 A;  3VKG A;  4NSR A;  4NRV A;  3IG8 A;  2MH8 A;  2DAG A;  4G3O A;  3SAT A;  1S3S A;  3AFH A;  3GPX A;  1NHW C;  2E5L M;  2KZS A;  4A3V B;  1WIV A;  3HHY A;  4Z6Y A;  1HNX M;  1OIZ A;  3PXG A;  1QYR A;  1Q3C A;  1G41 A;  1HQC A;  3SC3 A;  4IBB A;  1IY0 A;  1RU3 A;  2JXN A;  3TWL A;  4AKI A;  3FTC A;  4NL4 H;  1R2Y A;  4B08 A;  2LVP C;  2GNO A;  3FUU A;  4LJ5 A;  4LY6 A;  4ANR A;  4KHP M;  4B3S M;  4JYA M;  1DO0 A;  1OJL A;  2X8A A;  1ZAE A;  3IG5 A;  1OAI A;  2ERC A;  4L15 A;  3CF0 A;  3GO8 A;  2CV0 A;  2OOA A;  2L6O A;  2L7I A;  1DGF A;  3LCV B;  3KW6 A;  4IBK A;  3AOG A;  4IBJ A;  4OW0 A;  4R7G A;  4NXN M;  4DV1 M;  4G4Q A;  2C9C A;  4D81 A;  4UN2 B;  4I4L A;  1L2D A;  2J5Y A;  3MJ5 A;  2XZU A;  1EIJ A;  3R8F A;  5A2Q S;  4G4R A;  1L2B A;  4B3T M;  2GQF A;  1IY2 A;  1NV8 A;  2VF7 A;  2G5G X;  5ITT A;  3UMM A;  3SBJ A;  1YLA A;  5EP1 A;  4BB9 A;  3SAU A;  2XLJ A;  2JA2 A;  4L8R C;  2C99 A;  2YR0 A;  3DZD A;  2WSF F;  4LRT A;  4QNM A;  2LVQ D;  2DAI A;  4GKK M;  1Z59 A;  3LVV A;  2LHC A;  1MJG M;  3GRR A;  2KZU A;  4IBF A;  4JXJ A;  1J5E M;  3ZH9 B;  1FNN A;  3HJS A;  3U6O A;  3VK7 A;  1GJT A;  2K9D A;  2QZ4 A;  2QBY A;  2R46 A;  1IBM M;  3GLG A;  4EIW A;  3U6M A;  1DO2 A;  1JQJ C;  4P16 A;  4PDI A;  2D7G A;  3GLH B;  4DBG B;  5EP3 A;  1TH2 A;  2LVA A;  4FCT A;  4YY3 M;  1N32 M;  4IJE A;  4JI4 M;  3THG A;  3UJN A;  4LRS A;  4AZF A;  1G8P A;  1SG9 A;  1L1Z A;  4AQY M;  2KRK A;  5EJC A;  4NXM M;  2YQZ A;  2OPF A;  3B9P A;  1R4G A;  3MHV C;  3FUT A;  4XBO A;  1N78 A;  2ZAO A;  4IBD A;  2Z3X A;  4GHL A;  1X37 A;  4BLC A;  4XGI A;  4JI3 M;  2DI0 A;  2UU9 M;  1NNU C;  4FCW A;  3T15 A;  2L4F A;  4DUZ M;  1IM2 A;  3UZU A;  1EFU B;  1DGG A;  4GKJ M;  1J7K A;  2DAE A;  3A45 A;  3AL0 C;  3V76 A;  5F3W A;  3FYC A;  5JI2 E;  1GVN A;  1IQP A;  4B7F A;  4LZZ A;  3FE3 A;  5FTK A;  2QHO B;  5IZ7 D;  1R2Z A;  4F2L A;  1K82 A;  2QQ8 A;  2M60 A;  2FE8 A;  1TGU A;  4Z8X A;  1SXJ E;  1G4A E;  3L27 A;  3ZQJ A;  4GH9 A;  1SXJ C;  2R65 A;  3JR4 A;  1XWI A;  1N75 A;  5ITQ A;  2JZ1 A;  3CF6 E;  3QWL A;  2R18 A;  3WHK A;  4DR3 M;  2F4V M;  3J81 S;  1PJJ A;  1IN7 A;  4NC6 A;  3U6S A;  2HAK A;  3SAW A;  2LHG A;  5ITX A;  1ZMV A;  4LFA M;  2X49 A;  3LCU A;  2CUZ A;  1ZMU A; 
#chains in the Genus database with same CATH homology
 2K0B X;  2DAG A;  4G3O A;  1OQY A;  3IEC A;  1MN3 A;  1TR8 A;  3H4J A;  1WIV A;  2L2D A;  4HEO A;  1WJ7 A;  1CUK A;  1GO5 A;  1G41 A;  1VEG A;  2RRU A;  3B89 A;  1HT2 E;  2LVP C;  3GLG E;  2DNA A;  1DO0 A;  3T6P A;  3MMP A;  1IFY A;  2DEN A;  1WHC A;  2L4E A;  1OAI A;  4F1I A;  2OOA A;  2MGW A;  1E94 E;  3LCV B;  1T43 A;  2QNJ A;  1VDL A;  2JP7 A;  4UN2 B;  2B3T A;  2O25 A;  1NV8 A;  3K9O A;  2ZTD A;  1YLA A;  1Y8G A;  1PGY A;  1G3I A;  2CP8 A;  1C7Y A;  1AIP C;  2KHH A;  1OTR A;  1VG5 A;  2DHY A;  1ZMW A;  1F4I A;  2LVO C;  2LVQ D;  2DAI A;  4WP2 A;  1UFZ A;  2KNV A;  1IXS A;  1OKS A;  2KNZ A;  2EKF A;  2LTU A;  2K9D A;  3GLI E;  2DKL A;  2JZ0 A;  1T6O A;  2EJS A;  2KNA A;  1VEJ A;  1DO2 A;  3F92 A;  3GLH E;  1DV0 A;  4DBG B;  2MJ5 B;  2LVA A;  2QSF X;  1SG9 A;  2LVN C;  5DFL A;  3K9P A;  1HQY E;  3GLF E;  2G3Q A;  2DZL A;  4Q7J A;  1XB2 B;  1R4G A;  2EKK A;  1HT1 E;  2OOB A;  2CWB A;  2BWB A;  2JY6 B;  3E21 A;  1NV9 A;  2DI0 A;  2L4F A;  1XXH E;  1IM2 A;  1EFU B;  2H5X A;  1Q02 A;  2DAE A;  2LBC A;  1JR3 E;  2MR9 A;  2OO9 A;  4GEW A;  2DAK A;  2DAM A;  1VQ1 A;  5JI2 E;  2MRO B;  2ZTC A;  2WZJ A;  3FE3 A;  2QHO B;  4F2L A;  3E46 A;  1P3Q Q;  1HJP A;  2JY8 A;  1A5T A;  1WGL A;  1WGN A;  1G4A E;  2JNH A;  3FRI A;  4R71 A;  1TTE A;  1WR1 B;  2BWE A;  2JY7 A;  2JZ1 A;  1QZE A;  1VEK A;  2HWJ A;  1KYI A;  1ZV1 A;  2JY5 A;  3IHP A;  3BBZ A;  2HAK A;  2R0I A;  2JUJ A;  1ZMV A;  3FRH A;  1BVS A;  3LCU A;  1V92 A;  1ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...