1GO5A

Structure of the c-terminal fg-binding domain of human tap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
PAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-Terminal Fg-Nucleoporin Binding Domain of Tap/Nxf1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
molecule keywords TIP ASSOCIATING PROTEIN
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1go5A00
1T6OA 2LTUA 2B3TA 2RRUA 2DZLA 1F4IA 2LVQD 1YLAA 2OOAA 1VEGA 1VG5A 4UN2B 2L2DA 2LVPC 3H4JA 2G3QA 2HAKA 3FRHA 2HWJA 1QZEA 2LBCA 1ZV1A 2JNHA 1A5TA 1G41A 4Q7JA 1T43A 1PGYA 1HT2E 1TR8A 1DO0A 2EKKA 2DKLA 3LCVB 2LVNC 2EKFA 2QSFX 1WHCA 2KHHA 2MJ5B 3MMPA 1OQYA 2ZTCA 1MN3A 2DHYA 4HEOA 1Y8GA 2MGWA 2R0IA 2QHOB 4R71A 2CWBA 1HQYE 2L4EA 2BWEA 1BVSA 1P3QQ 1XB2B 2WZJA 2L4FA 1TTEA 1NV9A 2LVAA 1HJPA 2DAKA 2ZTDA 3BBZA 1G4AE 2JY7A 2JY5A 2OO9A 2JY6B 2DAEA 1WR1B 2DAIA 1VDLA 1XXHE 1WIVA 1WJ7A 4G3OA 5JI2E 3GLFE 2DI0A 2JUJA 1AIPC 2LVOC 2JZ1A 2K0BX 2QNJA 4WP2A 1V92A 1C7YA 1R4GA 2MROB 3GLGE 1NV8A 1OKSA 3E21A 3E46A 1DO2A 1WGLA 1IM2A 1OAIA 2DNAA 1E94E 3IECA 2JZ0A 3LCUA 5DFLA 3FRIA 2OOBA 1JR3E 2JP7A 3GLIE 2KNZA 1EFUB 1SG9A 1VQ1A 1VEKA 1UFZA 3GLHE 2KNVA 1HT1E 2DENA 1IFYA 2JY8A 3K9OA 1ZMWA 3B89A 1CUKA 3K9PA 2CP8A 1ZMUA 1VEJA 3T6PA 3F92A 1OTRA 2K9DA 1KYIA 1ZMVA 3FE3A 3IHPA 4GEWA 1Q02A 2BWBA 1G3IA 2MR9A 2O25A 4F1IA 1WGNA 4DBGB 1DV0A 4F2LA 2DAMA 1GO5A 1IXSA 2EJSA 2KNAA 2DAGA 2H5XA
chains in the Genus database with same CATH superfamily
3JAMS 2CV2A 1T6OA 1TDHA 1IY2A 1E9RA 2B3TA 2RRUA 2LVQD 5F3WA 1VEGA 1V34A 4UN2B 3U61B 1FNNA 4ITQA 3L26A 2G3QA 1S3SA 2EUCA 2HAKA 4LF7M 1L1ZA 3GRVA 2G5GX 2HWJA 5FTKA 1QZEA 2LBCA 2JNHA 4L8RC 1A5TA 1G41A 2D7HA 1NNJA 1OIPA 1C1KA 3EIEA 4MH0E 1YUBA 2RGOA 3GLGA 3UZUA 3J7BA 4FWDA 3GPXA 3GQ5A 1NNUC 5EQTA 2CE7A 4YY3M 3U61A 4BB9A 2KW0A 4LG2A 3LQQA 2UUBM 4KO8A 3GQ4A 1GVNA 1OQYA 2CFOA 4GRIA 4A3VB 1Z5CA 3RGSA 1NO1A 4XGIA 1N78A 3J27B 2DHYA 4HEOA 4DV0M 4FW9A 2UXDM 2X4AA 3MJ5A 5KPRA 1GLNA 4LZZA 1R2YA 2FE8A 3NBIA 2JA2A 4NRWA 3EIHA 1QUSA 4LJAA 4QOZC 1ZQ9A 5LMNM 1P3QQ 3U5ZA 2DWLA 1SXJE 2WZJA 2Y20A 4FCTA 4Y28F 2N35A 5ITXE 3BBZA 4LJ9A 5EXSA 1G4AE 2JY7A 1GKIA 1OFHA 4L4UA 2JY5A 5EP1A 5C1BA 1QQWA 4B08A 2H1RA 5FTNA 3TWMA 3DOAA 3U6EA 3L25A 1XXHE 3AOEC 4II7A 5JI2E 3J2PB 3GPPA 2L7IA 2OQ4A 2ZANA 4DUZM 4GHAA 2QNJA 2JZ1A 3L27A 4FWGA 1Z6TA 4TUWA 4FCWA 4LCBA 3SAVA 4IBIA 1W5TA 4PT5A 3C9PA 4LY6A 3U6OA 2J5YA 3VKGA 1HNWM 3B7ZA 2Y0QA 5KO3A 3MK6A 3U6PA 3HJSA 3GLFA 4LJ5A 3E46A 4LJ8A 1DO2A 3RFWA 1IM2A 3T1YM 4JI6M 2R65A 2O01F 3IECA 3FUTA 3HWSA 5DFLA 1OAOC 1IBLM 2QBYA 2KA6B 4IBKA 2J7OA 1FJGM 1VQ1A 1UFZA 3B7NA 3C3DA 4XBOA 2KRKA 3HZJA 2LXEA 4B3SM 2XSZA 2FOIC 2YFQA 1ZMWA 2OPFA 4NXMM 4AKGA 3WHLA 1NY6A 1EE8A 2CUZA 2J7NA 4AQYM 1QDRA 1ZMUA 3R9XB 1TH4A 1TH3A 3RE8A 3K1JA 1HQCA 3KS4A 4JXJA 4GKKM 2F5QA 1IY0A 3KOZE 2UU9M 2Z8YM 3IHPA 1KSFX 1IN5A 1GJSA 4LFBM 2DZOB 3HJQA 5ITTA 4QHSA 2K47A 3AOEA 3ILKA 4DV1M 5KQDA 4LFAM 2DAMA 1IXSA 2EJSA 4ANRA 4DV6M 2DAGA 3FTCA 2HHHM 4D81A 3B74A 4I81A 2DZLA 2DHRA 3FD9A 1YLAA 4LF9M 1JB0F 3FUUA 5KPTA 2L2DA 2LVPC 2Y21A 2WSEF 4G6ZA 5KPZA 4AKIA 2W82A 3FRHA 5ITXA 2R62A 2NQ8C 1JQJC 1ZV1A 4HLQA 2XH9A 1OIZA 2I7NA 4FD2A 3SAUA 4PCZA 3BOSA 4X66M 1SXJA 1IXSB 1NY5A 4Q7JA 5IREB 1Z5BA 3ZQJA 1T43A 3DA1A 1PGYA 4QNRA 1HT2E 3HHYA 3SFZA 3GO8A 4DR3M 3R8FA 4AG6A 3U6LA 4B3RM 2C96A 3GLIB 4S12A 2ZBKB 4WURA 3GRRA 3LMMA 2UUCM 4B3MM 4LF8M 1DO0A 2EKKA 3KP1E 4IBJA 2QSFX 4IJFA 2R46A 1WHCA 2MJ5B 4KLNA 4QOSA 1OJLA 1XC8A 1NHWC 1MN3A 3U6SA 2X8AA 4CGYB 2QCUA 4I5SA 1PJIA 1KFVA 4FCVA 2R0IA 3K2LA 2CRUA 2F5NA 1SXJD 2QHOB 4GIPA 4AW4A 1N33M 4G4RA 2ZM6M 2CWBA 1HQYE 1JR3A 2CV1A 1TH2A 1BVSA 2V6ZM 4NOOB 3U6CA 1PJSA 4LZJA 4Z8XA 1XB2B 2L4FA 3UMMA 3W0LB 3I04M 4AKHA 3A45A 4IBGA 2D7GA 4FVMA 3HU3A 4REZA 3QYBA 4OVZB 2BJWA 1X37A 2CHVA 3GPUA 2JY6B 3W67A 2DAEA 2DAIA 1K82A 1VDDA 4CIZA 3C58A 4OX9M 4JI3M 4IBFA 1WIVA 4G3OA 5FSWA 2LHCA 1L2CA 1IN8A 1AIPC 1G71A 2LVOC 2CHQA 3VK7A 2A5YB 3PFIA 1V33A 5IZ7D 1DGHA 2R45A 3E4RA 1YE9A 3TWKA 2QZ4A 3VLFB 3CF2A 3TE6A 1L2BA 4NSOB 1GJTA 4M9SA 4Z6YA 5FLXS 2BNKA 2LH0A 2DNAA 1E94E 3KOWE 3LCUA 3FRIA 1I4WA 3PNYA 3HHWA 4GITA 3KSXA 1LTMA 2FH0A 1IQPA 4CJ6A 2XFSA 5EXXA 1HR0M 2JP7A 4JYAM 2XLJA 1R2ZA 3GLHE 3IG5A 1HT1E 3JR4A 2L09A 3K9PA 3U6DA 4LRSA 2CP8A 2XF3A 4DV3M 1MU5A 3KXEC 3KSJA 1XNQM 4KT0F 5EJCA 3T15A 3F92A 1IY1A 1ZMVA 1N32M 4IBEA 2BWBA 1D0LA 4F1IA 1WGNA 3QWLA 3PNVA 4B7FA 3VDUA 4DUYM 1SXJB 1D0MA 3SYKA 1XNRM 4K0KM 3AOGA 1NVMA 1QDTA 3LVVA 5C18A 3FTFA 3SHGB 1GO5A 2GNOA 2Z3XA 1Z59A 1IXRC 2ZAOA 3FUXA 2DWZB 2DZNB 4NSRA 4G4NA 3NBXX 1F4IA 4LJ4A 4AI6A 1DGBA 1QZMA 3Q8XA 1VG5A 3SHFA 2KZSA 4HL4A 4XK8F 2R44A 3H4JA 4LGMA 3UK6A 5DNYA 1N36M 3CF0A 2Z7JA 2E5LM 2YNMD 3KW6A 1PJQA 1PJJA 1ORYB 2UXCM 4GC5A 4NXNM 1DGFA 3GRUA 2ZAMA 1PJTA 5GKNA 4ZPXA 2VDBB 5H37D 3CGWA 1EIJA 1TR8A 1N34M 4MGYE 4YHHM 4FWHA 4G4OA 4JI8M 2DKLA 1J5EM 2LVNC 2EKFA 1Q39A 2FS1A 2VQEM 4CHTB 2JXNA 3GLHA 3AFHA 2ZTCA 3NWLA 3FUVA 4M9ZA 1K3XA 4LRTA 4RKUF 1WXQA 3FUWA 1HNXM 2MGWA 4L6V6 4D80A 3K8ZA 3FTEA 2BJVA 2VQFM 3U6MA 1SXJC 1YSYA 3HKPA 3L28A 3I4VA 2HL7A 4BBAA 1LV7A 2L4EA 1L1TA 3SC3A 2R18A 2BWEA 4B7HA 5ITYA 4B7GA 1G59A 1E9SA 2VF8A 4WW0A 3U5ZB 2XZFA 1TTEA 2JWSA 4JI5M 2EO2A 3J7AS 1HJPA 1TDZA 2XSZD 5FTJA 2F5OA 3TPZA 4MB7A 5JI3E 3CTWB 1WR1B 1D2NA 2EA0A 4JN6A 3M0EA 1HNZM 4L15A 1IBKM 3GLFE 2JUJA 4P17A 3UJNA 1QVRA 3HJ8A 4LGYA 4RNAA 1L8QA 1Q3BA 3GLIA 3KP0E 3FYDA 4DR6M 3LVWA 4GHLA 5L8RF 4I4LA 3Q8GA 3WHKA 2MROB 4IBCA 3ZC7B 3GLGE 3GLFB 3A98B 1OKSA 1GL6A 1IXZA 3K92A 2C98A 1OAIA 2Z4RA 4R7GA 4CISA 1TF0B 1JR3D 2JZ0A 2XFTA 5EP4A 2OOBA 3PVSA 4M0DA 2KXEA 2M5ZA 2WSFF 4PD2A 3UGJA 2QBYB 3I01M 3VDPA 1JR3E 3D8BA 4IBBA 5FTLA 3GLIE 5LMUM 2QQ8A 2KNZA 1EFUB 1SG9A 1IN6A 1UM8A 4P16A 5IWAM 1R6BX 2KNVA 3T1HM 3VK8A 2DENA 1IFYA 2JY8A 3SASA 3K9OA 4D82A 3B89A 1CUKA 2APLA 3JR5A 1XHBA 3IG8A 1N77A 3HU2A 1MJGM 3B7QA 3U60B 4DR7M 4NL4H 1J7KA 1VEJA 3B9PA 3T6PA 4QNMA 1OTRA 1QAMA 1W5SA 2Q2EB 1G8PA 1N75A 4DR2M 4GEWA 2CHGA 4B3TM 3QYEA 4MGIE 2QPAA 3E9SA 3I51A 3SBJA 1G3IA 2V1UA 1PRBA 3PXGA 1QANA 2C99A 4L78A 2C9OA 3D8LA 3J81S 4DV7M 1DV0A 3HHZA 1XWIA 3SARA 3MHVC 3M7GA 4PDGA 1L2DA 5DYGA 1DGHB 1XXHB 2QP9X 3LW5F 5FTMA 4LJ6A 3L29A 4M0WA 2LTUA 4AG5A 2V1CA 3U60A 2KDLA 2GQFA 2Z4SA 2FFJA 2OOAA 3KOXE 1DGGA 4DV5M 1AUAA 4MGKE 4OU7A 1NJGA 1XMOM 1GL7A 2C9CA 4DV2M 1R7RA 1XMQM 4W5WA 2RGHA 2KRUA 4MM3B 2F4VM 8CATA 1TGUA 2UUAM 1Q3CA 4JV5M 2HCBA 2VIIA 3QAUA 2ERCA 3GPYA 3SAWA 3KFUG 1XXHA 3CF6E 1MX0A 1GABA 3H4MA 2L7HA 1NHGC 4NC6A 4DR5M 4LJ7A 5BR8M 4MGZE 3TQSA 2Y0TA 3LCVB 4LF4M 2KHHA 3MMPA 1E32A 3U6QA 1H6UA 1RU3A 1Y8GA 2HKJA 3SYLA 7CATA 4X64M 1D0KA 4JI4M 2VF7A 3AKZA 2AHMA 3AL0C 2XZUA 3I4YA 3HY5A 2CEAA 2D7EA 3C3EA 4R71A 4DV4M 4GKJM 3A42A 3KOYE 2QENA 4QHTA 5E6JA 3OTOM 4GMQA 3VKHA 3RGPA 1ZAEA 3TL4X 1NJFA 2F5SA 1NV9A 5EXPA 2XEPA 3AV0A 2LVAA 5DYIA 3W68A 2DAKA 1QUTA 2ZTDA 4JI0M 3SMSA 3GQ3A 1PM5A 2DWMA 3AJIB 4OW0A 2DWNA 2OO9A 2YQZA 3GRYA 2UXBM 2I7PA 4OVZA 4EIWA 1VDLA 5IT9S 1Z5AA 4RF0A 4R3DA 4JI2M 2P5TA 5KQ8A 1WJ7A 3LQRA 4IIWA 1QYRA 2DI0A 2R4EA 1IN4A 2G8LA 2K0BX 4PDIA 4WP2A 4DR1M 1V92A 4X65M 1OFIA 3BXWA 1C7YA 4IJEA 4DR4M 1T3TA 1QAQA 2RKOA 5EP3A 5ITQA 2CV0A 2DXIA 2DVWB 1R4GA 2K6BA 3HGIA 1QAOA 1NV8A 2LNHC 3J80S 2F5PA 3M6AA 3FYCA 3GLHB 3E21A 3A46A 1I94M 1WGLA 4NRVA 5BPVA 3DFZA 4GH9A 3T38A 2XGNA 2L6OA 5EP2A 4BLCA 2MH8A 4I8OA 4LF5M 3GP1A 3TWLA 3HHXA 2LHGA 3L2AA 5ITRA 3THGA 3VFDA 3W0FA 1VEKA 2R4JA 3V76A 3SATA 3FKEA 1IN7A 5ITUA 3KDSE 5EXTA 4JI1M 3HU1A 4KODA 4L16A 3KS8A 4MGHA 1K3WA 2WSCF 5E26A 3FTDA 2YR0A 3HX3A 2KZUA 3DZDA 4M9XA 2KEBA 4AZFA 2K9DA 1KYIA 2X49A 4X62M 4IBDA 3FE3A 1Q02A 4RF1A 1J09A 4G4QA 2MR9A 4JI7M 2O25A 4DBGB 1IBMM 1NSFA 2O5RA 3ZH9B 2C5RA 2LWXA 3KVWA 2M60A 2R6FA 2FNAA 4F2LA 4KHPM 5A2QS 4GC9A 3GLGB 4LF6M 2KNAA 3ZCBB 3SMPA 4LFCM 1R5LA 2H5XA
chains in the Genus database with same CATH topology
1T6OA 2LTUA 2B3TA 2RRUA 2DZLA 1F4IA 2LVQD 1YLAA 2OOAA 1VEGA 1VG5A 4UN2B 2L2DA 2LVPC 3H4JA 2G3QA 2HAKA 3FRHA 2HWJA 1QZEA 2LBCA 1ZV1A 2JNHA 1A5TA 1G41A 4Q7JA 1T43A 1PGYA 1HT2E 1TR8A 1DO0A 2EKKA 2DKLA 3LCVB 2LVNC 2EKFA 2QSFX 1WHCA 2KHHA 2MJ5B 3MMPA 1OQYA 2ZTCA 1MN3A 2DHYA 4HEOA 1Y8GA 2MGWA 2R0IA 2QHOB 4R71A 2CWBA 1HQYE 2L4EA 2BWEA 1BVSA 1P3QQ 1XB2B 2WZJA 2L4FA 1TTEA 1NV9A 2LVAA 1HJPA 2DAKA 2ZTDA 3BBZA 1G4AE 2JY7A 2JY5A 2OO9A 2JY6B 2DAEA 1WR1B 2DAIA 1VDLA 1XXHE 1WIVA 1WJ7A 4G3OA 5JI2E 3GLFE 2DI0A 2JUJA 1AIPC 2LVOC 2JZ1A 2K0BX 2QNJA 4WP2A 1V92A 1C7YA 1R4GA 2MROB 3GLGE 1NV8A 1OKSA 3E21A 3E46A 1DO2A 1WGLA 1IM2A 1OAIA 2DNAA 1E94E 3IECA 2JZ0A 3LCUA 5DFLA 3FRIA 2OOBA 1JR3E 2JP7A 3GLIE 2KNZA 1EFUB 1SG9A 1VQ1A 1VEKA 1UFZA 3GLHE 2KNVA 1HT1E 2DENA 1IFYA 2JY8A 3K9OA 1ZMWA 3B89A 1CUKA 3K9PA 2CP8A 1ZMUA 1VEJA 3T6PA 3F92A 1OTRA 2K9DA 1KYIA 1ZMVA 3FE3A 3IHPA 4GEWA 1Q02A 2BWBA 1G3IA 2MR9A 2O25A 4F1IA 1WGNA 4DBGB 1DV0A 4F2LA 2DAMA 1GO5A 1IXSA 2EJSA 2KNAA 2DAGA 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6O A;  2LTU A;  2B3T A;  2RRU A;  2DZL A;  1F4I A;  2LVQ D;  1YLA A;  2OOA A;  1VEG A;  1VG5 A;  4UN2 B;  2L2D A;  2LVP C;  3H4J A;  2G3Q A;  2HAK A;  3FRH A;  2HWJ A;  1QZE A;  2LBC A;  1ZV1 A;  2JNH A;  1A5T A;  1G41 A;  4Q7J A;  1T43 A;  1PGY A;  1HT2 E;  1TR8 A;  1DO0 A;  2EKK A;  2DKL A;  3LCV B;  2LVN C;  2EKF A;  2QSF X;  1WHC A;  2KHH A;  2MJ5 B;  3MMP A;  1OQY A;  2ZTC A;  1MN3 A;  2DHY A;  4HEO A;  1Y8G A;  2MGW A;  2R0I A;  2QHO B;  4R71 A;  2CWB A;  1HQY E;  2L4E A;  2BWE A;  1BVS A;  1P3Q Q;  1XB2 B;  2WZJ A;  2L4F A;  1TTE A;  1NV9 A;  2LVA A;  1HJP A;  2DAK A;  2ZTD A;  3BBZ A;  1G4A E;  2JY7 A;  2JY5 A;  2OO9 A;  2JY6 B;  2DAE A;  1WR1 B;  2DAI A;  1VDL A;  1XXH E;  1WIV A;  1WJ7 A;  4G3O A;  5JI2 E;  3GLF E;  2DI0 A;  2JUJ A;  1AIP C;  2LVO C;  2JZ1 A;  2K0B X;  2QNJ A;  4WP2 A;  1V92 A;  1C7Y A;  1R4G A;  2MRO B;  3GLG E;  1NV8 A;  1OKS A;  3E21 A;  3E46 A;  1DO2 A;  1WGL A;  1IM2 A;  1OAI A;  2DNA A;  1E94 E;  3IEC A;  2JZ0 A;  3LCU A;  5DFL A;  3FRI A;  2OOB A;  1JR3 E;  2JP7 A;  3GLI E;  2KNZ A;  1EFU B;  1SG9 A;  1VQ1 A;  1VEK A;  1UFZ A;  3GLH E;  2KNV A;  1HT1 E;  2DEN A;  1IFY A;  2JY8 A;  3K9O A;  1ZMW A;  3B89 A;  1CUK A;  3K9P A;  2CP8 A;  1ZMU A;  1VEJ A;  3T6P A;  3F92 A;  1OTR A;  2K9D A;  1KYI A;  1ZMV A;  3FE3 A;  3IHP A;  4GEW A;  1Q02 A;  2BWB A;  1G3I A;  2MR9 A;  2O25 A;  4F1I A;  1WGN A;  4DBG B;  1DV0 A;  4F2L A;  2DAM A;  1GO5 A;  1IXS A;  2EJS A;  2KNA A;  2DAG A;  2H5X A; 
#chains in the Genus database with same CATH topology
 3JAM S;  2CV2 A;  1T6O A;  1TDH A;  1IY2 A;  1E9R A;  2B3T A;  2RRU A;  2LVQ D;  5F3W A;  1VEG A;  1V34 A;  4UN2 B;  3U61 B;  1FNN A;  4ITQ A;  3L26 A;  2G3Q A;  1S3S A;  2EUC A;  2HAK A;  4LF7 M;  1L1Z A;  3GRV A;  2G5G X;  2HWJ A;  5FTK A;  1QZE A;  2LBC A;  2JNH A;  4L8R C;  1A5T A;  1G41 A;  2D7H A;  1NNJ A;  1OIP A;  1C1K A;  3EIE A;  4MH0 E;  1YUB A;  2RGO A;  3GLG A;  3UZU A;  3J7B A;  4FWD A;  3GPX A;  3GQ5 A;  1NNU C;  5EQT A;  2CE7 A;  4YY3 M;  3U61 A;  4BB9 A;  2KW0 A;  4LG2 A;  3LQQ A;  2UUB M;  4KO8 A;  3GQ4 A;  1GVN A;  1OQY A;  2CFO A;  4GRI A;  4A3V B;  1Z5C A;  3RGS A;  1NO1 A;  4XGI A;  1N78 A;  3J27 B;  2DHY A;  4HEO A;  4DV0 M;  4FW9 A;  2UXD M;  2X4A A;  3MJ5 A;  5KPR A;  1GLN A;  4LZZ A;  1R2Y A;  2FE8 A;  3NBI A;  2JA2 A;  4NRW A;  3EIH A;  1QUS A;  4LJA A;  4QOZ C;  1ZQ9 A;  5LMN M;  1P3Q Q;  3U5Z A;  2DWL A;  1SXJ E;  2WZJ A;  2Y20 A;  4FCT A;  4Y28 F;  2N35 A;  5ITX E;  3BBZ A;  4LJ9 A;  5EXS A;  1G4A E;  2JY7 A;  1GKI A;  1OFH A;  4L4U A;  2JY5 A;  5EP1 A;  5C1B A;  1QQW A;  4B08 A;  2H1R A;  5FTN A;  3TWM A;  3DOA A;  3U6E A;  3L25 A;  1XXH E;  3AOE C;  4II7 A;  5JI2 E;  3J2P B;  3GPP A;  2L7I A;  2OQ4 A;  2ZAN A;  4DUZ M;  4GHA A;  2QNJ A;  2JZ1 A;  3L27 A;  4FWG A;  1Z6T A;  4TUW A;  4FCW A;  4LCB A;  3SAV A;  4IBI A;  1W5T A;  4PT5 A;  3C9P A;  4LY6 A;  3U6O A;  2J5Y A;  3VKG A;  1HNW M;  3B7Z A;  2Y0Q A;  5KO3 A;  3MK6 A;  3U6P A;  3HJS A;  3GLF A;  4LJ5 A;  3E46 A;  4LJ8 A;  1DO2 A;  3RFW A;  1IM2 A;  3T1Y M;  4JI6 M;  2R65 A;  2O01 F;  3IEC A;  3FUT A;  3HWS A;  5DFL A;  1OAO C;  1IBL M;  2QBY A;  2KA6 B;  4IBK A;  2J7O A;  1FJG M;  1VQ1 A;  1UFZ A;  3B7N A;  3C3D A;  4XBO A;  2KRK A;  3HZJ A;  2LXE A;  4B3S M;  2XSZ A;  2FOI C;  2YFQ A;  1ZMW A;  2OPF A;  4NXM M;  4AKG A;  3WHL A;  1NY6 A;  1EE8 A;  2CUZ A;  2J7N A;  4AQY M;  1QDR A;  1ZMU A;  3R9X B;  1TH4 A;  1TH3 A;  3RE8 A;  3K1J A;  1HQC A;  3KS4 A;  4JXJ A;  4GKK M;  2F5Q A;  1IY0 A;  3KOZ E;  2UU9 M;  2Z8Y M;  3IHP A;  1KSF X;  1IN5 A;  1GJS A;  4LFB M;  2DZO B;  3HJQ A;  5ITT A;  4QHS A;  2K47 A;  3AOE A;  3ILK A;  4DV1 M;  5KQD A;  4LFA M;  2DAM A;  1IXS A;  2EJS A;  4ANR A;  4DV6 M;  2DAG A;  3FTC A;  2HHH M;  4D81 A;  3B74 A;  4I81 A;  2DZL A;  2DHR A;  3FD9 A;  1YLA A;  4LF9 M;  1JB0 F;  3FUU A;  5KPT A;  2L2D A;  2LVP C;  2Y21 A;  2WSE F;  4G6Z A;  5KPZ A;  4AKI A;  2W82 A;  3FRH A;  5ITX A;  2R62 A;  2NQ8 C;  1JQJ C;  1ZV1 A;  4HLQ A;  2XH9 A;  1OIZ A;  2I7N A;  4FD2 A;  3SAU A;  4PCZ A;  3BOS A;  4X66 M;  1SXJ A;  1IXS B;  1NY5 A;  4Q7J A;  5IRE B;  1Z5B A;  3ZQJ A;  1T43 A;  3DA1 A;  1PGY A;  4QNR A;  1HT2 E;  3HHY A;  3SFZ A;  3GO8 A;  4DR3 M;  3R8F A;  4AG6 A;  3U6L A;  4B3R M;  2C96 A;  3GLI B;  4S12 A;  2ZBK B;  4WUR A;  3GRR A;  3LMM A;  2UUC M;  4B3M M;  4LF8 M;  1DO0 A;  2EKK A;  3KP1 E;  4IBJ A;  2QSF X;  4IJF A;  2R46 A;  1WHC A;  2MJ5 B;  4KLN A;  4QOS A;  1OJL A;  1XC8 A;  1NHW C;  1MN3 A;  3U6S A;  2X8A A;  4CGY B;  2QCU A;  4I5S A;  1PJI A;  1KFV A;  4FCV A;  2R0I A;  3K2L A;  2CRU A;  2F5N A;  1SXJ D;  2QHO B;  4GIP A;  4AW4 A;  1N33 M;  4G4R A;  2ZM6 M;  2CWB A;  1HQY E;  1JR3 A;  2CV1 A;  1TH2 A;  1BVS A;  2V6Z M;  4NOO B;  3U6C A;  1PJS A;  4LZJ A;  4Z8X A;  1XB2 B;  2L4F A;  3UMM A;  3W0L B;  3I04 M;  4AKH A;  3A45 A;  4IBG A;  2D7G A;  4FVM A;  3HU3 A;  4REZ A;  3QYB A;  4OVZ B;  2BJW A;  1X37 A;  2CHV A;  3GPU A;  2JY6 B;  3W67 A;  2DAE A;  2DAI A;  1K82 A;  1VDD A;  4CIZ A;  3C58 A;  4OX9 M;  4JI3 M;  4IBF A;  1WIV A;  4G3O A;  5FSW A;  2LHC A;  1L2C A;  1IN8 A;  1AIP C;  1G71 A;  2LVO C;  2CHQ A;  3VK7 A;  2A5Y B;  3PFI A;  1V33 A;  5IZ7 D;  1DGH A;  2R45 A;  3E4R A;  1YE9 A;  3TWK A;  2QZ4 A;  3VLF B;  3CF2 A;  3TE6 A;  1L2B A;  4NSO B;  1GJT A;  4M9S A;  4Z6Y A;  5FLX S;  2BNK A;  2LH0 A;  2DNA A;  1E94 E;  3KOW E;  3LCU A;  3FRI A;  1I4W A;  3PNY A;  3HHW A;  4GIT A;  3KSX A;  1LTM A;  2FH0 A;  1IQP A;  4CJ6 A;  2XFS A;  5EXX A;  1HR0 M;  2JP7 A;  4JYA M;  2XLJ A;  1R2Z A;  3GLH E;  3IG5 A;  1HT1 E;  3JR4 A;  2L09 A;  3K9P A;  3U6D A;  4LRS A;  2CP8 A;  2XF3 A;  4DV3 M;  1MU5 A;  3KXE C;  3KSJ A;  1XNQ M;  4KT0 F;  5EJC A;  3T15 A;  3F92 A;  1IY1 A;  1ZMV A;  1N32 M;  4IBE A;  2BWB A;  1D0L A;  4F1I A;  1WGN A;  3QWL A;  3PNV A;  4B7F A;  3VDU A;  4DUY M;  1SXJ B;  1D0M A;  3SYK A;  1XNR M;  4K0K M;  3AOG A;  1NVM A;  1QDT A;  3LVV A;  5C18 A;  3FTF A;  3SHG B;  1GO5 A;  2GNO A;  2Z3X A;  1Z59 A;  1IXR C;  2ZAO A;  3FUX A;  2DWZ B;  2DZN B;  4NSR A;  4G4N A;  3NBX X;  1F4I A;  4LJ4 A;  4AI6 A;  1DGB A;  1QZM A;  3Q8X A;  1VG5 A;  3SHF A;  2KZS A;  4HL4 A;  4XK8 F;  2R44 A;  3H4J A;  4LGM A;  3UK6 A;  5DNY A;  1N36 M;  3CF0 A;  2Z7J A;  2E5L M;  2YNM D;  3KW6 A;  1PJQ A;  1PJJ A;  1ORY B;  2UXC M;  4GC5 A;  4NXN M;  1DGF A;  3GRU A;  2ZAM A;  1PJT A;  5GKN A;  4ZPX A;  2VDB B;  5H37 D;  3CGW A;  1EIJ A;  1TR8 A;  1N34 M;  4MGY E;  4YHH M;  4FWH A;  4G4O A;  4JI8 M;  2DKL A;  1J5E M;  2LVN C;  2EKF A;  1Q39 A;  2FS1 A;  2VQE M;  4CHT B;  2JXN A;  3GLH A;  3AFH A;  2ZTC A;  3NWL A;  3FUV A;  4M9Z A;  1K3X A;  4LRT A;  4RKU F;  1WXQ A;  3FUW A;  1HNX M;  2MGW A;  4L6V 6;  4D80 A;  3K8Z A;  3FTE A;  2BJV A;  2VQF M;  3U6M A;  1SXJ C;  1YSY A;  3HKP A;  3L28 A;  3I4V A;  2HL7 A;  4BBA A;  1LV7 A;  2L4E A;  1L1T A;  3SC3 A;  2R18 A;  2BWE A;  4B7H A;  5ITY A;  4B7G A;  1G59 A;  1E9S A;  2VF8 A;  4WW0 A;  3U5Z B;  2XZF A;  1TTE A;  2JWS A;  4JI5 M;  2EO2 A;  3J7A S;  1HJP A;  1TDZ A;  2XSZ D;  5FTJ A;  2F5O A;  3TPZ A;  4MB7 A;  5JI3 E;  3CTW B;  1WR1 B;  1D2N A;  2EA0 A;  4JN6 A;  3M0E A;  1HNZ M;  4L15 A;  1IBK M;  3GLF E;  2JUJ A;  4P17 A;  3UJN A;  1QVR A;  3HJ8 A;  4LGY A;  4RNA A;  1L8Q A;  1Q3B A;  3GLI A;  3KP0 E;  3FYD A;  4DR6 M;  3LVW A;  4GHL A;  5L8R F;  4I4L A;  3Q8G A;  3WHK A;  2MRO B;  4IBC A;  3ZC7 B;  3GLG E;  3GLF B;  3A98 B;  1OKS A;  1GL6 A;  1IXZ A;  3K92 A;  2C98 A;  1OAI A;  2Z4R A;  4R7G A;  4CIS A;  1TF0 B;  1JR3 D;  2JZ0 A;  2XFT A;  5EP4 A;  2OOB A;  3PVS A;  4M0D A;  2KXE A;  2M5Z A;  2WSF F;  4PD2 A;  3UGJ A;  2QBY B;  3I01 M;  3VDP A;  1JR3 E;  3D8B A;  4IBB A;  5FTL A;  3GLI E;  5LMU M;  2QQ8 A;  2KNZ A;  1EFU B;  1SG9 A;  1IN6 A;  1UM8 A;  4P16 A;  5IWA M;  1R6B X;  2KNV A;  3T1H M;  3VK8 A;  2DEN A;  1IFY A;  2JY8 A;  3SAS A;  3K9O A;  4D82 A;  3B89 A;  1CUK A;  2APL A;  3JR5 A;  1XHB A;  3IG8 A;  1N77 A;  3HU2 A;  1MJG M;  3B7Q A;  3U60 B;  4DR7 M;  4NL4 H;  1J7K A;  1VEJ A;  3B9P A;  3T6P A;  4QNM A;  1OTR A;  1QAM A;  1W5S A;  2Q2E B;  1G8P A;  1N75 A;  4DR2 M;  4GEW A;  2CHG A;  4B3T M;  3QYE A;  4MGI E;  2QPA A;  3E9S A;  3I51 A;  3SBJ A;  1G3I A;  2V1U A;  1PRB A;  3PXG A;  1QAN A;  2C99 A;  4L78 A;  2C9O A;  3D8L A;  3J81 S;  4DV7 M;  1DV0 A;  3HHZ A;  1XWI A;  3SAR A;  3MHV C;  3M7G A;  4PDG A;  1L2D A;  5DYG A;  1DGH B;  1XXH B;  2QP9 X;  3LW5 F;  5FTM A;  4LJ6 A;  3L29 A;  4M0W A;  2LTU A;  4AG5 A;  2V1C A;  3U60 A;  2KDL A;  2GQF A;  2Z4S A;  2FFJ A;  2OOA A;  3KOX E;  1DGG A;  4DV5 M;  1AUA A;  4MGK E;  4OU7 A;  1NJG A;  1XMO M;  1GL7 A;  2C9C A;  4DV2 M;  1R7R A;  1XMQ M;  4W5W A;  2RGH A;  2KRU A;  4MM3 B;  2F4V M;  8CAT A;  1TGU A;  2UUA M;  1Q3C A;  4JV5 M;  2HCB A;  2VII A;  3QAU A;  2ERC A;  3GPY A;  3SAW A;  3KFU G;  1XXH A;  3CF6 E;  1MX0 A;  1GAB A;  3H4M A;  2L7H A;  1NHG C;  4NC6 A;  4DR5 M;  4LJ7 A;  5BR8 M;  4MGZ E;  3TQS A;  2Y0T A;  3LCV B;  4LF4 M;  2KHH A;  3MMP A;  1E32 A;  3U6Q A;  1H6U A;  1RU3 A;  1Y8G A;  2HKJ A;  3SYL A;  7CAT A;  4X64 M;  1D0K A;  4JI4 M;  2VF7 A;  3AKZ A;  2AHM A;  3AL0 C;  2XZU A;  3I4Y A;  3HY5 A;  2CEA A;  2D7E A;  3C3E A;  4R71 A;  4DV4 M;  4GKJ M;  3A42 A;  3KOY E;  2QEN A;  4QHT A;  5E6J A;  3OTO M;  4GMQ A;  3VKH A;  3RGP A;  1ZAE A;  3TL4 X;  1NJF A;  2F5S A;  1NV9 A;  5EXP A;  2XEP A;  3AV0 A;  2LVA A;  5DYI A;  3W68 A;  2DAK A;  1QUT A;  2ZTD A;  4JI0 M;  3SMS A;  3GQ3 A;  1PM5 A;  2DWM A;  3AJI B;  4OW0 A;  2DWN A;  2OO9 A;  2YQZ A;  3GRY A;  2UXB M;  2I7P A;  4OVZ A;  4EIW A;  1VDL A;  5IT9 S;  1Z5A A;  4RF0 A;  4R3D A;  4JI2 M;  2P5T A;  5KQ8 A;  1WJ7 A;  3LQR A;  4IIW A;  1QYR A;  2DI0 A;  2R4E A;  1IN4 A;  2G8L A;  2K0B X;  4PDI A;  4WP2 A;  4DR1 M;  1V92 A;  4X65 M;  1OFI A;  3BXW A;  1C7Y A;  4IJE A;  4DR4 M;  1T3T A;  1QAQ A;  2RKO A;  5EP3 A;  5ITQ A;  2CV0 A;  2DXI A;  2DVW B;  1R4G A;  2K6B A;  3HGI A;  1QAO A;  1NV8 A;  2LNH C;  3J80 S;  2F5P A;  3M6A A;  3FYC A;  3GLH B;  3E21 A;  3A46 A;  1I94 M;  1WGL A;  4NRV A;  5BPV A;  3DFZ A;  4GH9 A;  3T38 A;  2XGN A;  2L6O A;  5EP2 A;  4BLC A;  2MH8 A;  4I8O A;  4LF5 M;  3GP1 A;  3TWL A;  3HHX A;  2LHG A;  3L2A A;  5ITR A;  3THG A;  3VFD A;  3W0F A;  1VEK A;  2R4J A;  3V76 A;  3SAT A;  3FKE A;  1IN7 A;  5ITU A;  3KDS E;  5EXT A;  4JI1 M;  3HU1 A;  4KOD A;  4L16 A;  3KS8 A;  4MGH A;  1K3W A;  2WSC F;  5E26 A;  3FTD A;  2YR0 A;  3HX3 A;  2KZU A;  3DZD A;  4M9X A;  2KEB A;  4AZF A;  2K9D A;  1KYI A;  2X49 A;  4X62 M;  4IBD A;  3FE3 A;  1Q02 A;  4RF1 A;  1J09 A;  4G4Q A;  2MR9 A;  4JI7 M;  2O25 A;  4DBG B;  1IBM M;  1NSF A;  2O5R A;  3ZH9 B;  2C5R A;  2LWX A;  3KVW A;  2M60 A;  2R6F A;  2FNA A;  4F2L A;  4KHP M;  5A2Q S;  4GC9 A;  3GLG B;  4LF6 M;  2KNA A;  3ZCB B;  3SMP A;  4LFC M;  1R5L A;  2H5X A; 
#chains in the Genus database with same CATH homology
 1T6O A;  2LTU A;  2B3T A;  2RRU A;  2DZL A;  1F4I A;  2LVQ D;  1YLA A;  2OOA A;  1VEG A;  1VG5 A;  4UN2 B;  2L2D A;  2LVP C;  3H4J A;  2G3Q A;  2HAK A;  3FRH A;  2HWJ A;  1QZE A;  2LBC A;  1ZV1 A;  2JNH A;  1A5T A;  1G41 A;  4Q7J A;  1T43 A;  1PGY A;  1HT2 E;  1TR8 A;  1DO0 A;  2EKK A;  2DKL A;  3LCV B;  2LVN C;  2EKF A;  2QSF X;  1WHC A;  2KHH A;  2MJ5 B;  3MMP A;  1OQY A;  2ZTC A;  1MN3 A;  2DHY A;  4HEO A;  1Y8G A;  2MGW A;  2R0I A;  2QHO B;  4R71 A;  2CWB A;  1HQY E;  2L4E A;  2BWE A;  1BVS A;  1P3Q Q;  1XB2 B;  2WZJ A;  2L4F A;  1TTE A;  1NV9 A;  2LVA A;  1HJP A;  2DAK A;  2ZTD A;  3BBZ A;  1G4A E;  2JY7 A;  2JY5 A;  2OO9 A;  2JY6 B;  2DAE A;  1WR1 B;  2DAI A;  1VDL A;  1XXH E;  1WIV A;  1WJ7 A;  4G3O A;  5JI2 E;  3GLF E;  2DI0 A;  2JUJ A;  1AIP C;  2LVO C;  2JZ1 A;  2K0B X;  2QNJ A;  4WP2 A;  1V92 A;  1C7Y A;  1R4G A;  2MRO B;  3GLG E;  1NV8 A;  1OKS A;  3E21 A;  3E46 A;  1DO2 A;  1WGL A;  1IM2 A;  1OAI A;  2DNA A;  1E94 E;  3IEC A;  2JZ0 A;  3LCU A;  5DFL A;  3FRI A;  2OOB A;  1JR3 E;  2JP7 A;  3GLI E;  2KNZ A;  1EFU B;  1SG9 A;  1VQ1 A;  1VEK A;  1UFZ A;  3GLH E;  2KNV A;  1HT1 E;  2DEN A;  1IFY A;  2JY8 A;  3K9O A;  1ZMW A;  3B89 A;  1CUK A;  3K9P A;  2CP8 A;  1ZMU A;  1VEJ A;  3T6P A;  3F92 A;  1OTR A;  2K9D A;  1KYI A;  1ZMV A;  3FE3 A;  3IHP A;  4GEW A;  1Q02 A;  2BWB A;  1G3I A;  2MR9 A;  2O25 A;  4F1I A;  1WGN A;  4DBG B;  1DV0 A;  4F2L A;  2DAM A;  1GO5 A;  1IXS A;  2EJS A;  2KNA A;  2DAG A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...