1GO5A

Structure of the c-terminal fg-binding domain of human tap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
PAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear transport
molecule keywords TIP ASSOCIATING PROTEIN
publication title Structure of the C-Terminal Fg-Nucleoporin Binding Domain of Tap/Nxf1
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1go5A00
2DAGA 2JZ0A 1PGYA 1XB2B 1IXSA 1T43A 4GEWA 2DI0A 1HQYE 1ZMVA 2EJSA 1DO0A 2EKKA 2JNHA 1ZMWA 2JY7A 1F4IA 1OQYA 1UFZA 2H5XA 4R71A 2ZTCA 1A5TA 2KNZA 2MJ5B 1E94E 2DAEA 4F1IA 5DFLA 5JI2E 4F2LA 1VEKA 1QZEA 1HT2E 1TR8A 4UN2B 2DZLA 2LVQD 4G3OA 1EFUB 3GLIE 4DBGB 1NV8A 2OO9A 3B89A 1G3IA 2LVAA 3E46A 3K9PA 1V92A 2OOAA 2L4EA 2R0IA 2MR9A 2JY6B 2ZTDA 1BVSA 1TTEA 2LVPC 2DAIA 4WP2A 3IECA 1VG5A 2JUJA 2DKLA 3E21A 2KNVA 2JY5A 3GLFE 2EKFA 1T6OA 1OKSA 2K0BX 1CUKA 1IFYA 2WZJA 1OAIA 2DHYA 2MGWA 1Y8GA 2B3TA 2HAKA 2QSFX 4Q7JA 2LVOC 2DAKA 2G3QA 1GO5A 1C7YA 1Q02A 1KYIA 2HWJA 1WIVA 2KNAA 3LCVB 3GLGE 1VEJA 1ZV1A 1MN3A 2LTUA 1HT1E 2KHHA 3F92A 2K9DA 1ZMUA 1WGNA 1DV0A 1SG9A 1HJPA 1JR3E 2LVNC 3BBZA 2BWBA 2CWBA 1R4GA 2CP8A 2RRUA 2JZ1A 2OOBA 2DAMA 1WGLA 1NV9A 3FRHA 1P3QQ 2O25A 2L4FA 2MROB 3FRIA 4HEOA 3LCUA 3H4JA 1G4AE 1VEGA 1IM2A 1OTRA 1G41A 2LBCA 1AIPC 1WR1B 2JP7A 1VDLA 1WJ7A 3IHPA 1XXHE 2QNJA 1DO2A 2QHOB 1WHCA 2DNAA 3K9OA 3GLHE 2DENA 3FE3A 2BWEA 2L2DA 3MMPA 2JY8A 1VQ1A 1YLAA 3T6PA
chains in the Genus database with same CATH superfamily
3T38A 5KPTA 1IN7A 1D0MA 1TH4A 4B3SM 2RGOA 3OTOM 1VDDA 3UK6A 4GEWA 2EJSA 1OJLA 1Z5AA 3A45A 1GJSA 3SATA 1UFZA 2R18A 1R6BX 2LWXA 3K1JA 4DV0M 1KSFX 1W5SA 2ZTCA 3GO8A 4IIWA 4CIZA 5ITRA 2K47A 4W5WA 3HHWA 2KZUA 3GLIA 1QZEA 2KZSA 3Q8GA 4D82A 2DZLA 1K3WA 2F5OA 4DV2M 4G3OA 1K82A 4JI5M 2D7EA 2UUCM 4B08A 2CE7A 3KP0E 2R4JA 3FUVA 4PDGA 2MH8A 2G8LA 2OO9A 3FUTA 4GIPA 4LJ4A 4G6ZA 2JA2A 2WSEF 2YR0A 4LJ7A 4RF1A 4G4QA 4JI8M 2LHGA 2R44A 4AKHA 1DGBA 4BLCA 4G4RA 2C96A 2R0IA 4P17A 3GRUA 2UUAM 2CV0A 3T15A 2ZTDA 3U60B 1R5LA 2L7IA 5IZ7D 4DV3M 1PJIA 2D7HA 2YNMD 2ERCA 2L09A 3J2PB 1Q3BA 3KOWE 4LFCM 2JY5A 4JV5M 3GLFE 2Z4RA 5LMUM 1T6OA 3VFDA 3L28A 4DV5M 2K0BX 1CUKA 1IFYA 4LF8M 3HHXA 4IBGA 4JXJA 5FTJA 4L6V6 2MGWA 4OVZA 4B7FA 5E26A 5JI3E 2VQEM 4LF4M 4NRVA 3SFZA 1XWIA 2G3QA 2L7HA 3IG5A 3QYEA 4DR7M 1GO5A 4RNAA 3HHZA 4Z6YA 3U6LA 3L25A 3NBIA 4LZJA 1KYIA 1E9RA 1FJGM 4B3TM 1I4WA 3TPZA 3GRVA 3HU1A 3E9SA 1QUTA 4L15A 5FTKA 2F5PA 2J7OA 2XFTA 4LJ5A 1N34M 2KHHA 3KP1E 3GRYA 2I7NA 2CHGA 4LFBM 3KSXA 1WGNA 1OIZA 1IQPA 1DGGA 5C18A 1IN5A 4IJEA 4OU7A 4L8RC 3RE8A 2LVNC 3GLIB 2RRUA 2KXEA 3EIHA 1QQWA 5H37D 5IWAM 2KDLA 4LF7M 2X49A 3T1HM 4KHPM 2RKOA 3KDSE 1OAOC 2Z4SA 1WGLA 3A46A 2E5LM 4NOOB 3LVVA 2WSCF 5EXTA 2DHRA 3FTDA 2Y0QA 2R4EA 2C98A 3C58A 8CATA 3KOZE 3JAMS 3AKZA 1PJSA 3GLHA 3ZCBB 4JN6A 1G41A 1E9SA 4FD2A 1WJ7A 1DO2A 2QHOB 1NJFA 2DNAA 3J27B 4PDIA 2NQ8C 2DXIA 1RU3A 2UXDM 2WSFF 4OVZB 4MH0E 4MGHA 5E6JA 2CV2A 1PRBA 3I51A 1YLAA 3KXEC 4MGKE 1HR0M 4XK8F 5EJCA 3PFIA 1SXJC 4TUWA 2DZNB 4DR3M 1D0KA 3B9PA 1UM8A 1T43A 5KPRA 3ZQJA 2EKKA 2JNHA 4LFAM 3VLFB 1N33M 1H6UA 4JI1M 1LV7A 5KQ8A 1TDZA 2CUZA 3HKPA 3WHKA 4IJFA 1GKIA 3HHYA 1QDTA 2KNZA 2R46A 2DAEA 4R7GA 3FKEA 2EA0A 2XSZD 3B74A 5DFLA 2R62A 4QNMA 1HNXM 2DVWB 2ZAOA 4F2LA 5EP3A 4FCVA 3L26A 1NY6A 1TR8A 3CF0A 1GJTA 1XHBA 4M0WA 2LVQD 4KLNA 1WXQA 4REZA 1OFIA 4PCZA 2XGNA 3GLIE 4DBGB 5BR8M 2FNAA 4DR2M 1N32M 1NV8A 1GVNA 3CTWB 1G3IA 1NHGC 3K9PA 3QAUA 3EIEA 1V92A 3GPPA 2D7GA 1V33A 2OOAA 3UMMA 3SYLA 3U6QA 1NJGA 4BBAA 2QBYA 4DUZM 4Z8XA 3W67A 3PVSA 2MR9A 5LMNM 1NVMA 1QUSA 2GQFA 3R8FA 3SHGB 3HJ8A 5EP2A 3FYCA 1TTEA 2I7PA 2LVPC 1NSFA 3GLHB 1R2YA 3ILKA 3MHVC 3KFUG 3HJSA 1NNUC 1QYRA 2DWNA 1OKSA 4LCBA 5GKNA 1PJQA 3AV0A 2P5TA 1TDHA 1Y8GA 2B3TA 3C9PA 3SBJA 1HQCA 4G4OA 2LVOC 4GHLA 1Q39A 5FSWA 3PXGA 2BJVA 1N75A 4MB7A 1L2CA 1C7YA 2XZUA 3SC3A 1NHWC 4ITQA 1MJGM 3THGA 3RFWA 1Z59A 1YE9A 2Z3XA 2HWJA 3C3DA 3L27A 4X64M 3U61A 3LCVB 2YFQA 2DWLA 1VEJA 1ZV1A 1IXRC 1G71A 4HLQA 3U6DA 2VDBB 3B7QA 3TL4X 5BPVA 3F92A 2K9DA 1SXJA 1QVRA 1ZMUA 1R2ZA 1ZAEA 3JR4A 4OW0A 4GC9A 1HJPA 2G5GX 3KSJA 2C99A 1KFVA 2CP8A 4GKKM 2ZANA 3UJNA 1QDRA 5DYGA 2L6OA 2XZFA 2DAMA 3SMPA 2VF8A 3L2AA 4JI2M 4RF0A 2BNKA 4NXNM 3KW6A 1NV9A 5ITXA 3GP1A 3U6PA 1SXJD 3FRHA 1P3QQ 4NSOB 2L4FA 3DZDA 2QBYB 1N77A 2X8AA 3H4JA 3LCUA 3V76A 4K0KM 4I8OA 1G59A 2EUCA 1XXHA 3VK8A 1VEGA 3PNVA 4IBEA 4X65M 4M9ZA 3SARA 4JI3M 1TF0B 1WR1B 2J5YA 1Z5BA 3NWLA 4L16A 4MGZE 5EXPA 1PJJA 4GRIA 3K9OA 4D81A 3GLHE 3TE6A 4BB9A 4PD2A 1N36M 4X62M 4IBKA 3B7NA 1L8QA 1E32A 4LJ6A 1Z5CA 2FE8A 2L2DA 3HY5A 1QAOA 1N78A 4XGIA 3T6PA 4G4NA 3KS4A 2EO2A 5ITQA 4NL4H 2CHVA 4NRWA 4YHHM 4RKUF 1XB2B 4LJ9A 2ZAMA 1HQYE 1ZMVA 4AG5A 1DO0A 2JY7A 1F4IA 1ZMWA 3U61B 3ZH9B 2BJWA 1OQYA 4FWHA 3FYDA 4L78A 2HKJA 2MJ5B 1IY0A 1E94E 1SXJB 5IREB 4DR1M 4LF9M 5L8RF 1D2NA 1GABA 2R65A 4ANRA 1VEKA 3BOSA 1HT2E 4UN2B 2F5NA 4YY3M 3GQ5A 3W0LB 3UZUA 1IY1A 1EE8A 1EFUB 3VK7A 1DGHA 4II7A 5F3WA 4DR6M 3A98B 2GNOA 3U6CA 4DR5M 2XSZA 1NNJA 4ZPXA 1X37A 3B89A 3AOEC 2LVAA 3I4VA 5IT9S 3R9XB 2UXCM 1IN4A 4Y28F 2AHMA 2L4EA 1NO1A 2QPAA 4KT0F 3T1YM 2A5YB 3I04M 5KO3A 1PJTA 4QHSA 4DV4M 2FOIC 2DWZB 2QP9X 3D8BA 2KRKA 2CHQA 1XXHB 4MGYE 4LGMA 1BVSA 3A42A 5KQDA 2V6ZM 4WP2A 3IECA 2JUJA 2DKLA 3K2LA 1GL7A 3I01M 4GITA 4JI6M 2EKFA 5ITUA 4IBJA 4GHAA 2QENA 1L2DA 5FTNA 4QNRA 3SMSA 3VDUA 4IBBA 2WZJA 4LGYA 1L1ZA 2DWMA 1IBLM 1K3XA 1OAIA 4B3RM 2C9OA 2HAKA 2QSFX 2O5RA 4FCWA 2DAKA 4DR4M 3RGPA 4QOZC 1Q02A 1T3TA 3GLGA 1S3SA 2CEAA 3K8ZA 5EP4A 1OFHA 5FTMA 2V1UA 2QQ8A 5EP1A 3W68A 1GLNA 2C9CA 2LTUA 1MN3A 2ZBKB 1DGFA 1HT1E 1JR3A 5EXSA 3W0FA 2KA6B 4DV6M 3FUUA 1LTMA 4AW4A 4AI6A 3JR5A 3TWKA 1QZMA 1GL6A 2VQFM 4WW0A 2RGHA 3BBZA 3SYKA 5EXXA 1L2BA 2CWBA 4JI0M 3TQSA 3GPUA 3DOAA 4HL4A 2F5SA 3U6EA 2XFSA 2UUBM 2JZ1A 4IBFA 3L29A 2OOBA 1W5TA 1DGHB 4LJ8A 3U6OA 4S12A 2VIIA 5DYIA 2KEBA 5ITYA 3FTEA 1JR3D 3HX3A 3MK6A 3CGWA 3SAVA 2O25A 3M7GA 4LRTA 4AZFA 3FRIA 4IBCA 5ITXE 1TH2A 3HU3A 4HEOA 2UU9M 3VKGA 2CRUA 1IN6A 2FH0A 3PNYA 4M9XA 2F5QA 3FUWA 2Z7JA 1OTRA 5DNYA 2OQ4A 3AOEA 4I4LA 2W82A 3QWLA 3CF2A 1XXHE 2QNJA 4IBDA 3BXWA 1WHCA 4B7GA 2JWSA 5C1BA 2Y21A 4GC5A 4M0DA 3FTFA 3GQ3A 2BWEA 2X4AA 1IN8A 4I81A 4MM3B 4P16A 5EQTA 4B7HA 3U6MA 1TH3A 3Q8XA 4PT5A 4NXMM 1HNWM 5FTLA 3CF6E 2DAGA 2JZ0A 2R6FA 3GLGB 3VDPA 1PGYA 2K6BA 4LF6M 4FCTA 4FW9A 1IXSA 1R7RA 2DI0A 5FLXS 2Z8YM 2O01F 1FNNA 3DA1A 2JXNA 1J09A 2H5XA 4R71A 3QYBA 1A5TA 3SASA 4F1IA 5JI2E 3U5ZA 3GRRA 3C3EA 2H1RA 2C5RA 4QHTA 2CV1A 3M6AA 2XF3A 2Y20A 4B3MM 5ITTA 1YUBA 2LH0A 2M5ZA 4JYAM 1Q3CA 4D80A 1MX0A 1OIPA 2DZOB 4LZZA 1V34A 4M9SA 4CGYB 2HHHM 4MGIE 4X66M 3RGSA 1EIJA 4A3VB 3DFZA 3E46A 3J7AS 5A2QS 4LF5M 4CHTB 1YSYA 3SAUA 1QANA 2QCUA 4KODA 3GPXA 3M0EA 3GLFA 4DV7M 3TWLA 1AUAA 2N35A 2Q2EB 2JY6B 3H4MA 3J80S 1J5EM 3UGJA 2DAIA 3KS8A 1VG5A 1TGUA 2FS1A 3E21A 2KNVA 2Y0TA 4XBOA 4AQYM 1XC8A 1PM5A 3VKHA 4GKJM 1J7KA 2KRUA 3LVWA 4R3DA 1G8PA 2DHYA 2J7NA 2YQZA 2OPFA 4AKIA 1I94M 2ZM6M 4Q7JA 2CFOA 2VF7A 2LHCA 3HU2A 4DUYM 4WURA 4LG2A 3LMMA 1IY2A 3AFHA 4QOSA 3HGIA 3FUXA 1XNRM 1IXSB 3SHFA 1Z6TA 1IBKM 1WIVA 2KNAA 4DV1M 3U6SA 1XMOM 2UXBM 2HCBA 4AG6A 1QAMA 3GLGE 3GQ4A 4AKGA 2KW0A 3AOGA 3HZJA 1DV0A 4LJAA 4NSRA 3GPYA 1SG9A 1C1KA 2LXEA 3U5ZB 3I4YA 1JR3E 3WHLA 3J81S 3SAWA 2BWBA 3B7ZA 1R4GA 3HJQA 2APLA 5KPZA 3AL0C 3MJ5A 3TWMA 2F4VM 2FFJA 2QZ4A 4CISA 1NY5A 2V1CA 1HNZM 2HL7A 3E4RA 3ZC7B 4FVMA 1ORYB 3AJIB 2MROB 3HWSA 3K92A 4LRSA 3J7BA 3LQQA 4GMQA 4GH9A 4CJ6A 4IBIA 1IBMM 4JI4M 4OX9M 3LW5F 3FD9A 3LQRA 4L4UA 3GLFB 1G4AE 1JB0F 2LNHC 2XEPA 3U60A 1XNQM 4KO8A 1IM2A 2R45A 3FTCA 2LBCA 3KOXE 2XLJA 2XH9A 1AIPC 1D0LA 2JP7A 1VDLA 3IHPA 7CATA 4JI7M 4FWGA 1MU5A 1QAQA 1IXZA 4FWDA 2DENA 3NBXX 1SXJE 4LY6A 3FE3A 1ZQ9A 3KVWA 4I5SA 1JQJC 3MMPA 2JY8A 1VQ1A 3IG8A 3KOYE 1XMQM 4EIWA 3D8LA 2M60A 1L1TA 4NC6A
chains in the Genus database with same CATH topology
2DAGA 2JZ0A 1PGYA 1XB2B 1IXSA 1T43A 4GEWA 2DI0A 1HQYE 1ZMVA 2EJSA 1DO0A 2EKKA 2JNHA 1ZMWA 2JY7A 1F4IA 1OQYA 1UFZA 2H5XA 4R71A 2ZTCA 1A5TA 2KNZA 2MJ5B 1E94E 2DAEA 4F1IA 5DFLA 5JI2E 4F2LA 1VEKA 1QZEA 1HT2E 1TR8A 4UN2B 2DZLA 2LVQD 4G3OA 1EFUB 3GLIE 4DBGB 1NV8A 2OO9A 3B89A 1G3IA 2LVAA 3E46A 3K9PA 1V92A 2OOAA 2L4EA 2R0IA 2MR9A 2JY6B 2ZTDA 1BVSA 1TTEA 2LVPC 2DAIA 4WP2A 3IECA 1VG5A 2JUJA 2DKLA 3E21A 2KNVA 2JY5A 3GLFE 2EKFA 1T6OA 1OKSA 2K0BX 1CUKA 1IFYA 2WZJA 1OAIA 2DHYA 2MGWA 1Y8GA 2B3TA 2HAKA 2QSFX 4Q7JA 2LVOC 2DAKA 2G3QA 1GO5A 1C7YA 1Q02A 1KYIA 2HWJA 1WIVA 2KNAA 3LCVB 3GLGE 1VEJA 1ZV1A 1MN3A 2LTUA 1HT1E 2KHHA 3F92A 2K9DA 1ZMUA 1WGNA 1DV0A 1SG9A 1HJPA 1JR3E 2LVNC 3BBZA 2BWBA 2CWBA 1R4GA 2CP8A 2RRUA 2JZ1A 2OOBA 2DAMA 1WGLA 1NV9A 3FRHA 1P3QQ 2O25A 2L4FA 2MROB 3FRIA 4HEOA 3LCUA 3H4JA 1G4AE 1VEGA 1IM2A 1OTRA 1G41A 2LBCA 1AIPC 1WR1B 2JP7A 1VDLA 1WJ7A 3IHPA 1XXHE 2QNJA 1DO2A 2QHOB 1WHCA 2DNAA 3K9OA 3GLHE 2DENA 3FE3A 2BWEA 2L2DA 3MMPA 2JY8A 1VQ1A 1YLAA 3T6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAG A;  2JZ0 A;  1PGY A;  1XB2 B;  1IXS A;  1T43 A;  4GEW A;  2DI0 A;  1HQY E;  1ZMV A;  2EJS A;  1DO0 A;  2EKK A;  2JNH A;  1ZMW A;  2JY7 A;  1F4I A;  1OQY A;  1UFZ A;  2H5X A;  4R71 A;  2ZTC A;  1A5T A;  2KNZ A;  2MJ5 B;  1E94 E;  2DAE A;  4F1I A;  5DFL A;  5JI2 E;  4F2L A;  1VEK A;  1QZE A;  1HT2 E;  1TR8 A;  4UN2 B;  2DZL A;  2LVQ D;  4G3O A;  1EFU B;  3GLI E;  4DBG B;  1NV8 A;  2OO9 A;  3B89 A;  1G3I A;  2LVA A;  3E46 A;  3K9P A;  1V92 A;  2OOA A;  2L4E A;  2R0I A;  2MR9 A;  2JY6 B;  2ZTD A;  1BVS A;  1TTE A;  2LVP C;  2DAI A;  4WP2 A;  3IEC A;  1VG5 A;  2JUJ A;  2DKL A;  3E21 A;  2KNV A;  2JY5 A;  3GLF E;  2EKF A;  1T6O A;  1OKS A;  2K0B X;  1CUK A;  1IFY A;  2WZJ A;  1OAI A;  2DHY A;  2MGW A;  1Y8G A;  2B3T A;  2HAK A;  2QSF X;  4Q7J A;  2LVO C;  2DAK A;  2G3Q A;  1GO5 A;  1C7Y A;  1Q02 A;  1KYI A;  2HWJ A;  1WIV A;  2KNA A;  3LCV B;  3GLG E;  1VEJ A;  1ZV1 A;  1MN3 A;  2LTU A;  1HT1 E;  2KHH A;  3F92 A;  2K9D A;  1ZMU A;  1WGN A;  1DV0 A;  1SG9 A;  1HJP A;  1JR3 E;  2LVN C;  3BBZ A;  2BWB A;  2CWB A;  1R4G A;  2CP8 A;  2RRU A;  2JZ1 A;  2OOB A;  2DAM A;  1WGL A;  1NV9 A;  3FRH A;  1P3Q Q;  2O25 A;  2L4F A;  2MRO B;  3FRI A;  4HEO A;  3LCU A;  3H4J A;  1G4A E;  1VEG A;  1IM2 A;  1OTR A;  1G41 A;  2LBC A;  1AIP C;  1WR1 B;  2JP7 A;  1VDL A;  1WJ7 A;  3IHP A;  1XXH E;  2QNJ A;  1DO2 A;  2QHO B;  1WHC A;  2DNA A;  3K9O A;  3GLH E;  2DEN A;  3FE3 A;  2BWE A;  2L2D A;  3MMP A;  2JY8 A;  1VQ1 A;  1YLA A;  3T6P A; 
#chains in the Genus database with same CATH topology
 3T38 A;  5KPT A;  1IN7 A;  1D0M A;  1TH4 A;  4B3S M;  2RGO A;  3OTO M;  1VDD A;  3UK6 A;  4GEW A;  2EJS A;  1OJL A;  1Z5A A;  3A45 A;  1GJS A;  3SAT A;  1UFZ A;  2R18 A;  1R6B X;  2LWX A;  3K1J A;  4DV0 M;  1KSF X;  1W5S A;  2ZTC A;  3GO8 A;  4IIW A;  4CIZ A;  5ITR A;  2K47 A;  4W5W A;  3HHW A;  2KZU A;  3GLI A;  1QZE A;  2KZS A;  3Q8G A;  4D82 A;  2DZL A;  1K3W A;  2F5O A;  4DV2 M;  4G3O A;  1K82 A;  4JI5 M;  2D7E A;  2UUC M;  4B08 A;  2CE7 A;  3KP0 E;  2R4J A;  3FUV A;  4PDG A;  2MH8 A;  2G8L A;  2OO9 A;  3FUT A;  4GIP A;  4LJ4 A;  4G6Z A;  2JA2 A;  2WSE F;  2YR0 A;  4LJ7 A;  4RF1 A;  4G4Q A;  4JI8 M;  2LHG A;  2R44 A;  4AKH A;  1DGB A;  4BLC A;  4G4R A;  2C96 A;  2R0I A;  4P17 A;  3GRU A;  2UUA M;  2CV0 A;  3T15 A;  2ZTD A;  3U60 B;  1R5L A;  2L7I A;  5IZ7 D;  4DV3 M;  1PJI A;  2D7H A;  2YNM D;  2ERC A;  2L09 A;  3J2P B;  1Q3B A;  3KOW E;  4LFC M;  2JY5 A;  4JV5 M;  3GLF E;  2Z4R A;  5LMU M;  1T6O A;  3VFD A;  3L28 A;  4DV5 M;  2K0B X;  1CUK A;  1IFY A;  4LF8 M;  3HHX A;  4IBG A;  4JXJ A;  5FTJ A;  4L6V 6;  2MGW A;  4OVZ A;  4B7F A;  5E26 A;  5JI3 E;  2VQE M;  4LF4 M;  4NRV A;  3SFZ A;  1XWI A;  2G3Q A;  2L7H A;  3IG5 A;  3QYE A;  4DR7 M;  1GO5 A;  4RNA A;  3HHZ A;  4Z6Y A;  3U6L A;  3L25 A;  3NBI A;  4LZJ A;  1KYI A;  1E9R A;  1FJG M;  4B3T M;  1I4W A;  3TPZ A;  3GRV A;  3HU1 A;  3E9S A;  1QUT A;  4L15 A;  5FTK A;  2F5P A;  2J7O A;  2XFT A;  4LJ5 A;  1N34 M;  2KHH A;  3KP1 E;  3GRY A;  2I7N A;  2CHG A;  4LFB M;  3KSX A;  1WGN A;  1OIZ A;  1IQP A;  1DGG A;  5C18 A;  1IN5 A;  4IJE A;  4OU7 A;  4L8R C;  3RE8 A;  2LVN C;  3GLI B;  2RRU A;  2KXE A;  3EIH A;  1QQW A;  5H37 D;  5IWA M;  2KDL A;  4LF7 M;  2X49 A;  3T1H M;  4KHP M;  2RKO A;  3KDS E;  1OAO C;  2Z4S A;  1WGL A;  3A46 A;  2E5L M;  4NOO B;  3LVV A;  2WSC F;  5EXT A;  2DHR A;  3FTD A;  2Y0Q A;  2R4E A;  2C98 A;  3C58 A;  8CAT A;  3KOZ E;  3JAM S;  3AKZ A;  1PJS A;  3GLH A;  3ZCB B;  4JN6 A;  1G41 A;  1E9S A;  4FD2 A;  1WJ7 A;  1DO2 A;  2QHO B;  1NJF A;  2DNA A;  3J27 B;  4PDI A;  2NQ8 C;  2DXI A;  1RU3 A;  2UXD M;  2WSF F;  4OVZ B;  4MH0 E;  4MGH A;  5E6J A;  2CV2 A;  1PRB A;  3I51 A;  1YLA A;  3KXE C;  4MGK E;  1HR0 M;  4XK8 F;  5EJC A;  3PFI A;  1SXJ C;  4TUW A;  2DZN B;  4DR3 M;  1D0K A;  3B9P A;  1UM8 A;  1T43 A;  5KPR A;  3ZQJ A;  2EKK A;  2JNH A;  4LFA M;  3VLF B;  1N33 M;  1H6U A;  4JI1 M;  1LV7 A;  5KQ8 A;  1TDZ A;  2CUZ A;  3HKP A;  3WHK A;  4IJF A;  1GKI A;  3HHY A;  1QDT A;  2KNZ A;  2R46 A;  2DAE A;  4R7G A;  3FKE A;  2EA0 A;  2XSZ D;  3B74 A;  5DFL A;  2R62 A;  4QNM A;  1HNX M;  2DVW B;  2ZAO A;  4F2L A;  5EP3 A;  4FCV A;  3L26 A;  1NY6 A;  1TR8 A;  3CF0 A;  1GJT A;  1XHB A;  4M0W A;  2LVQ D;  4KLN A;  1WXQ A;  4REZ A;  1OFI A;  4PCZ A;  2XGN A;  3GLI E;  4DBG B;  5BR8 M;  2FNA A;  4DR2 M;  1N32 M;  1NV8 A;  1GVN A;  3CTW B;  1G3I A;  1NHG C;  3K9P A;  3QAU A;  3EIE A;  1V92 A;  3GPP A;  2D7G A;  1V33 A;  2OOA A;  3UMM A;  3SYL A;  3U6Q A;  1NJG A;  4BBA A;  2QBY A;  4DUZ M;  4Z8X A;  3W67 A;  3PVS A;  2MR9 A;  5LMN M;  1NVM A;  1QUS A;  2GQF A;  3R8F A;  3SHG B;  3HJ8 A;  5EP2 A;  3FYC A;  1TTE A;  2I7P A;  2LVP C;  1NSF A;  3GLH B;  1R2Y A;  3ILK A;  3MHV C;  3KFU G;  3HJS A;  1NNU C;  1QYR A;  2DWN A;  1OKS A;  4LCB A;  5GKN A;  1PJQ A;  3AV0 A;  2P5T A;  1TDH A;  1Y8G A;  2B3T A;  3C9P A;  3SBJ A;  1HQC A;  4G4O A;  2LVO C;  4GHL A;  1Q39 A;  5FSW A;  3PXG A;  2BJV A;  1N75 A;  4MB7 A;  1L2C A;  1C7Y A;  2XZU A;  3SC3 A;  1NHW C;  4ITQ A;  1MJG M;  3THG A;  3RFW A;  1Z59 A;  1YE9 A;  2Z3X A;  2HWJ A;  3C3D A;  3L27 A;  4X64 M;  3U61 A;  3LCV B;  2YFQ A;  2DWL A;  1VEJ A;  1ZV1 A;  1IXR C;  1G71 A;  4HLQ A;  3U6D A;  2VDB B;  3B7Q A;  3TL4 X;  5BPV A;  3F92 A;  2K9D A;  1SXJ A;  1QVR A;  1ZMU A;  1R2Z A;  1ZAE A;  3JR4 A;  4OW0 A;  4GC9 A;  1HJP A;  2G5G X;  3KSJ A;  2C99 A;  1KFV A;  2CP8 A;  4GKK M;  2ZAN A;  3UJN A;  1QDR A;  5DYG A;  2L6O A;  2XZF A;  2DAM A;  3SMP A;  2VF8 A;  3L2A A;  4JI2 M;  4RF0 A;  2BNK A;  4NXN M;  3KW6 A;  1NV9 A;  5ITX A;  3GP1 A;  3U6P A;  1SXJ D;  3FRH A;  1P3Q Q;  4NSO B;  2L4F A;  3DZD A;  2QBY B;  1N77 A;  2X8A A;  3H4J A;  3LCU A;  3V76 A;  4K0K M;  4I8O A;  1G59 A;  2EUC A;  1XXH A;  3VK8 A;  1VEG A;  3PNV A;  4IBE A;  4X65 M;  4M9Z A;  3SAR A;  4JI3 M;  1TF0 B;  1WR1 B;  2J5Y A;  1Z5B A;  3NWL A;  4L16 A;  4MGZ E;  5EXP A;  1PJJ A;  4GRI A;  3K9O A;  4D81 A;  3GLH E;  3TE6 A;  4BB9 A;  4PD2 A;  1N36 M;  4X62 M;  4IBK A;  3B7N A;  1L8Q A;  1E32 A;  4LJ6 A;  1Z5C A;  2FE8 A;  2L2D A;  3HY5 A;  1QAO A;  1N78 A;  4XGI A;  3T6P A;  4G4N A;  3KS4 A;  2EO2 A;  5ITQ A;  4NL4 H;  2CHV A;  4NRW A;  4YHH M;  4RKU F;  1XB2 B;  4LJ9 A;  2ZAM A;  1HQY E;  1ZMV A;  4AG5 A;  1DO0 A;  2JY7 A;  1F4I A;  1ZMW A;  3U61 B;  3ZH9 B;  2BJW A;  1OQY A;  4FWH A;  3FYD A;  4L78 A;  2HKJ A;  2MJ5 B;  1IY0 A;  1E94 E;  1SXJ B;  5IRE B;  4DR1 M;  4LF9 M;  5L8R F;  1D2N A;  1GAB A;  2R65 A;  4ANR A;  1VEK A;  3BOS A;  1HT2 E;  4UN2 B;  2F5N A;  4YY3 M;  3GQ5 A;  3W0L B;  3UZU A;  1IY1 A;  1EE8 A;  1EFU B;  3VK7 A;  1DGH A;  4II7 A;  5F3W A;  4DR6 M;  3A98 B;  2GNO A;  3U6C A;  4DR5 M;  2XSZ A;  1NNJ A;  4ZPX A;  1X37 A;  3B89 A;  3AOE C;  2LVA A;  3I4V A;  5IT9 S;  3R9X B;  2UXC M;  1IN4 A;  4Y28 F;  2AHM A;  2L4E A;  1NO1 A;  2QPA A;  4KT0 F;  3T1Y M;  2A5Y B;  3I04 M;  5KO3 A;  1PJT A;  4QHS A;  4DV4 M;  2FOI C;  2DWZ B;  2QP9 X;  3D8B A;  2KRK A;  2CHQ A;  1XXH B;  4MGY E;  4LGM A;  1BVS A;  3A42 A;  5KQD A;  2V6Z M;  4WP2 A;  3IEC A;  2JUJ A;  2DKL A;  3K2L A;  1GL7 A;  3I01 M;  4GIT A;  4JI6 M;  2EKF A;  5ITU A;  4IBJ A;  4GHA A;  2QEN A;  1L2D A;  5FTN A;  4QNR A;  3SMS A;  3VDU A;  4IBB A;  2WZJ A;  4LGY A;  1L1Z A;  2DWM A;  1IBL M;  1K3X A;  1OAI A;  4B3R M;  2C9O A;  2HAK A;  2QSF X;  2O5R A;  4FCW A;  2DAK A;  4DR4 M;  3RGP A;  4QOZ C;  1Q02 A;  1T3T A;  3GLG A;  1S3S A;  2CEA A;  3K8Z A;  5EP4 A;  1OFH A;  5FTM A;  2V1U A;  2QQ8 A;  5EP1 A;  3W68 A;  1GLN A;  2C9C A;  2LTU A;  1MN3 A;  2ZBK B;  1DGF A;  1HT1 E;  1JR3 A;  5EXS A;  3W0F A;  2KA6 B;  4DV6 M;  3FUU A;  1LTM A;  4AW4 A;  4AI6 A;  3JR5 A;  3TWK A;  1QZM A;  1GL6 A;  2VQF M;  4WW0 A;  2RGH A;  3BBZ A;  3SYK A;  5EXX A;  1L2B A;  2CWB A;  4JI0 M;  3TQS A;  3GPU A;  3DOA A;  4HL4 A;  2F5S A;  3U6E A;  2XFS A;  2UUB M;  2JZ1 A;  4IBF A;  3L29 A;  2OOB A;  1W5T A;  1DGH B;  4LJ8 A;  3U6O A;  4S12 A;  2VII A;  5DYI A;  2KEB A;  5ITY A;  3FTE A;  1JR3 D;  3HX3 A;  3MK6 A;  3CGW A;  3SAV A;  2O25 A;  3M7G A;  4LRT A;  4AZF A;  3FRI A;  4IBC A;  5ITX E;  1TH2 A;  3HU3 A;  4HEO A;  2UU9 M;  3VKG A;  2CRU A;  1IN6 A;  2FH0 A;  3PNY A;  4M9X A;  2F5Q A;  3FUW A;  2Z7J A;  1OTR A;  5DNY A;  2OQ4 A;  3AOE A;  4I4L A;  2W82 A;  3QWL A;  3CF2 A;  1XXH E;  2QNJ A;  4IBD A;  3BXW A;  1WHC A;  4B7G A;  2JWS A;  5C1B A;  2Y21 A;  4GC5 A;  4M0D A;  3FTF A;  3GQ3 A;  2BWE A;  2X4A A;  1IN8 A;  4I81 A;  4MM3 B;  4P16 A;  5EQT A;  4B7H A;  3U6M A;  1TH3 A;  3Q8X A;  4PT5 A;  4NXM M;  1HNW M;  5FTL A;  3CF6 E;  2DAG A;  2JZ0 A;  2R6F A;  3GLG B;  3VDP A;  1PGY A;  2K6B A;  4LF6 M;  4FCT A;  4FW9 A;  1IXS A;  1R7R A;  2DI0 A;  5FLX S;  2Z8Y M;  2O01 F;  1FNN A;  3DA1 A;  2JXN A;  1J09 A;  2H5X A;  4R71 A;  3QYB A;  1A5T A;  3SAS A;  4F1I A;  5JI2 E;  3U5Z A;  3GRR A;  3C3E A;  2H1R A;  2C5R A;  4QHT A;  2CV1 A;  3M6A A;  2XF3 A;  2Y20 A;  4B3M M;  5ITT A;  1YUB A;  2LH0 A;  2M5Z A;  4JYA M;  1Q3C A;  4D80 A;  1MX0 A;  1OIP A;  2DZO B;  4LZZ A;  1V34 A;  4M9S A;  4CGY B;  2HHH M;  4MGI E;  4X66 M;  3RGS A;  1EIJ A;  4A3V B;  3DFZ A;  3E46 A;  3J7A S;  5A2Q S;  4LF5 M;  4CHT B;  1YSY A;  3SAU A;  1QAN A;  2QCU A;  4KOD A;  3GPX A;  3M0E A;  3GLF A;  4DV7 M;  3TWL A;  1AUA A;  2N35 A;  2Q2E B;  2JY6 B;  3H4M A;  3J80 S;  1J5E M;  3UGJ A;  2DAI A;  3KS8 A;  1VG5 A;  1TGU A;  2FS1 A;  3E21 A;  2KNV A;  2Y0T A;  4XBO A;  4AQY M;  1XC8 A;  1PM5 A;  3VKH A;  4GKJ M;  1J7K A;  2KRU A;  3LVW A;  4R3D A;  1G8P A;  2DHY A;  2J7N A;  2YQZ A;  2OPF A;  4AKI A;  1I94 M;  2ZM6 M;  4Q7J A;  2CFO A;  2VF7 A;  2LHC A;  3HU2 A;  4DUY M;  4WUR A;  4LG2 A;  3LMM A;  1IY2 A;  3AFH A;  4QOS A;  3HGI A;  3FUX A;  1XNR M;  1IXS B;  3SHF A;  1Z6T A;  1IBK M;  1WIV A;  2KNA A;  4DV1 M;  3U6S A;  1XMO M;  2UXB M;  2HCB A;  4AG6 A;  1QAM A;  3GLG E;  3GQ4 A;  4AKG A;  2KW0 A;  3AOG A;  3HZJ A;  1DV0 A;  4LJA A;  4NSR A;  3GPY A;  1SG9 A;  1C1K A;  2LXE A;  3U5Z B;  3I4Y A;  1JR3 E;  3WHL A;  3J81 S;  3SAW A;  2BWB A;  3B7Z A;  1R4G A;  3HJQ A;  2APL A;  5KPZ A;  3AL0 C;  3MJ5 A;  3TWM A;  2F4V M;  2FFJ A;  2QZ4 A;  4CIS A;  1NY5 A;  2V1C A;  1HNZ M;  2HL7 A;  3E4R A;  3ZC7 B;  4FVM A;  1ORY B;  3AJI B;  2MRO B;  3HWS A;  3K92 A;  4LRS A;  3J7B A;  3LQQ A;  4GMQ A;  4GH9 A;  4CJ6 A;  4IBI A;  1IBM M;  4JI4 M;  4OX9 M;  3LW5 F;  3FD9 A;  3LQR A;  4L4U A;  3GLF B;  1G4A E;  1JB0 F;  2LNH C;  2XEP A;  3U60 A;  1XNQ M;  4KO8 A;  1IM2 A;  2R45 A;  3FTC A;  2LBC A;  3KOX E;  2XLJ A;  2XH9 A;  1AIP C;  1D0L A;  2JP7 A;  1VDL A;  3IHP A;  7CAT A;  4JI7 M;  4FWG A;  1MU5 A;  1QAQ A;  1IXZ A;  4FWD A;  2DEN A;  3NBX X;  1SXJ E;  4LY6 A;  3FE3 A;  1ZQ9 A;  3KVW A;  4I5S A;  1JQJ C;  3MMP A;  2JY8 A;  1VQ1 A;  3IG8 A;  3KOY E;  1XMQ M;  4EIW A;  3D8L A;  2M60 A;  1L1T A;  4NC6 A; 
#chains in the Genus database with same CATH homology
 2DAG A;  2JZ0 A;  1PGY A;  1XB2 B;  1IXS A;  1T43 A;  4GEW A;  2DI0 A;  1HQY E;  1ZMV A;  2EJS A;  1DO0 A;  2EKK A;  2JNH A;  1ZMW A;  2JY7 A;  1F4I A;  1OQY A;  1UFZ A;  2H5X A;  4R71 A;  2ZTC A;  1A5T A;  2KNZ A;  2MJ5 B;  1E94 E;  2DAE A;  4F1I A;  5DFL A;  5JI2 E;  4F2L A;  1VEK A;  1QZE A;  1HT2 E;  1TR8 A;  4UN2 B;  2DZL A;  2LVQ D;  4G3O A;  1EFU B;  3GLI E;  4DBG B;  1NV8 A;  2OO9 A;  3B89 A;  1G3I A;  2LVA A;  3E46 A;  3K9P A;  1V92 A;  2OOA A;  2L4E A;  2R0I A;  2MR9 A;  2JY6 B;  2ZTD A;  1BVS A;  1TTE A;  2LVP C;  2DAI A;  4WP2 A;  3IEC A;  1VG5 A;  2JUJ A;  2DKL A;  3E21 A;  2KNV A;  2JY5 A;  3GLF E;  2EKF A;  1T6O A;  1OKS A;  2K0B X;  1CUK A;  1IFY A;  2WZJ A;  1OAI A;  2DHY A;  2MGW A;  1Y8G A;  2B3T A;  2HAK A;  2QSF X;  4Q7J A;  2LVO C;  2DAK A;  2G3Q A;  1GO5 A;  1C7Y A;  1Q02 A;  1KYI A;  2HWJ A;  1WIV A;  2KNA A;  3LCV B;  3GLG E;  1VEJ A;  1ZV1 A;  1MN3 A;  2LTU A;  1HT1 E;  2KHH A;  3F92 A;  2K9D A;  1ZMU A;  1WGN A;  1DV0 A;  1SG9 A;  1HJP A;  1JR3 E;  2LVN C;  3BBZ A;  2BWB A;  2CWB A;  1R4G A;  2CP8 A;  2RRU A;  2JZ1 A;  2OOB A;  2DAM A;  1WGL A;  1NV9 A;  3FRH A;  1P3Q Q;  2O25 A;  2L4F A;  2MRO B;  3FRI A;  4HEO A;  3LCU A;  3H4J A;  1G4A E;  1VEG A;  1IM2 A;  1OTR A;  1G41 A;  2LBC A;  1AIP C;  1WR1 B;  2JP7 A;  1VDL A;  1WJ7 A;  3IHP A;  1XXH E;  2QNJ A;  1DO2 A;  2QHO B;  1WHC A;  2DNA A;  3K9O A;  3GLH E;  2DEN A;  3FE3 A;  2BWE A;  2L2D A;  3MMP A;  2JY8 A;  1VQ1 A;  1YLA A;  3T6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...