1GO5A

Structure of the c-terminal fg-binding domain of human tap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
PAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIP ASSOCIATING PROTEIN
publication title Structure of the C-Terminal Fg-Nucleoporin Binding Domain of Tap/Nxf1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1go5A00
1TR8A 2BWEA 2JUJA 1T6OA 3K9OA 2JY5A 1OTRA 1ZV1A 2L4FA 2RRUA 4G3OA 2CP8A 1AIPC 2MJ5B 2LVQD 4F2LA 2OOAA 1EFUB 3IHPA 2ZTCA 2DI0A 1OAIA 2LVOC 1VG5A 2LVAA 1DV0A 3MMPA 3FE3A 2JNHA 1G4AE 1P3QQ 3LCVB 1Y8GA 1YLAA 2JY8A 2DAEA 1G3IA 2DAKA 1HT2E 1BVSA 1WGNA 3FRIA 2G3QA 2KHHA 1IM2A 1VEGA 1WHCA 1T43A 1XXHE 2CWBA 2KNZA 1SG9A 2HWJA 3FRHA 1IXSA 1WR1B 2JY7A 1QZEA 1E94E 3H4JA 4F1IA 2DKLA 2LVPC 3GLGE 1G41A 2DZLA 2OOBA 2OO9A 2DNAA 1PGYA 2QNJA 2DHYA 1MN3A 1WGLA 1C7YA 2JY6B 2R0IA 1UFZA 2DENA 1F4IA 2MGWA 1OQYA 1WIVA 2JP7A 1A5TA 2K0BX 1R4GA 2KNAA 2QHOB 1NV8A 2LVNC 3E21A 2LBCA 2MR9A 3LCUA 1Q02A 2QSFX 1ZMUA 1V92A 1VEKA 1DO2A 4GEWA 1IFYA 1JR3E 4HEOA 3B89A 2WZJA 2DAGA 4WP2A 1VDLA 1DO0A 2O25A 3E46A 2MROB 2LTUA 1VEJA 2KNVA 1GO5A 4R71A 3K9PA 3T6PA 1ZMVA 2L2DA 5JI2E 1OKSA 1VQ1A 1HJPA 1WJ7A 1XB2B 3BBZA 5DFLA 1CUKA 2H5XA 4Q7JA 1HT1E 3F92A 1ZMWA 2ZTDA 2BWBA 1KYIA 2HAKA 3GLHE 2JZ1A 2EKKA 2L4EA 1HQYE 2EKFA 2EJSA 3IECA 2JZ0A 2K9DA 3GLIE 4UN2B 1NV9A 1TTEA 3GLFE 4DBGB 2B3TA 2DAMA 2DAIA
chains in the Genus database with same CATH superfamily
3AOEA 5C18A 4DR5M 2XGNA 4B3RM 1IY0A 1TR8A 4GKKM 1W5SA 2QQ8A 4B7GA 5KPRA 2L4FA 1ZV1A 1Z6TA 1NNJA 2UUBM 4B3TM 2VF8A 3AKZA 4R7GA 1AUAA 4GC9A 2MJ5B 3FUVA 3U6EA 2OOAA 3UGJA 4IBKA 3CGWA 2KXEA 3GRYA 3IHPA 3PNVA 5KQ8A 2K47A 2F5OA 2D7GA 3UZUA 1IN4A 3IG8A 1YE9A 4IBDA 4GIPA 1QUTA 3FUTA 3LCVB 1PM5A 1SXJB 1GJTA 1YLAA 3M7GA 3W0LB 1GL7A 1IBMM 1G3IA 3K2LA 3GPUA 3U5ZA 4D80A 2R45A 5KQDA 3KS4A 4QNMA 4P16A 1OIZA 2XLJA 1G8PA 3FRIA 2VF7A 4XBOA 4I5SA 2FFJA 3KP0E 4MGZE 5LMUM 1K82A 2KHHA 3SHGB 2M5ZA 3FYCA 5ITXE 2DZNB 2KNZA 1SG9A 3ZQJA 1OFHA 1R7RA 4QOZC 3HJ8A 4NOOB 1WR1B 3SFZA 2JY7A 1NY5A 1QZEA 3HHYA 4JI1M 4LG2A 1E94E 2UU9M 4FCWA 3H4JA 3QWLA 4R3DA 4F1IA 5IREB 3GLGE 4DUYM 3LVWA 4GHLA 5FTNA 3HY5A 3GPXA 2DZLA 2V1CA 3OTOM 3VKGA 1QQWA 3E9SA 2DNAA 1PGYA 2ZAMA 3HHXA 3VK7A 4ITQA 4TUWA 5DNYA 1XWIA 3TQSA 4PDGA 1SXJD 1NJGA 4G6ZA 3HGIA 1UFZA 3GLFA 3AOGA 3J80S 1QANA 2C98A 4IBJA 3KXEC 4LF8M 4M9ZA 3C3EA 3CF0A 2MGWA 3W67A 2DXIA 1TDHA 2C5RA 2JP7A 5ITXA 3SMSA 1HR0M 2KNAA 1NV8A 3E21A 4P17A 4DV6M 4XK8F 4IJFA 2ZANA 5A2QS 1PJTA 4CISA 1FJGM 2HL7A 1VEKA 4GEWA 1DO2A 1NHWC 2XZFA 1IFYA 3DFZA 2DZOB 2D7HA 3B89A 3KP1E 4BLCA 3GLGA 2OPFA 1DGFA 4GMQA 4AG6A 2DAGA 5ITUA 3U6MA 2C9CA 4MGKE 2MROB 2CV0A 2KW0A 1QZMA 2KNVA 4OW0A 4X64M 4DR7M 2JXNA 1RU3A 5EXTA 4EIWA 3T1YM 2KRUA 3Q8GA 3KOZE 5JI2E 3GRUA 1WJ7A 1XB2B 2KA6B 4I8OA 5DFLA 3VK8A 1IN6A 3UJNA 1TH4A 2DWNA 4LJ9A 3RGPA 4REZA 1R6BX 1PJQA 4LJ5A 4Q7JA 1HT1E 1GABA 2EA0A 2A5YB 1Q3CA 3B7NA 2CUZA 2J5YA 2JZ1A 1K3WA 1JQJC 1UM8A 4RKUF 3IECA 2JZ0A 4UN2B 1D0LA 2R4EA 4NC6A 1IY2A 4DR6M 2DAMA 1IN7A 2BNKA 4HL4A 2BWEA 4G3OA 3M6AA 3U6DA 2CP8A 1AIPC 3L29A 5E26A 2CV2A 5ITRA 1Q39A 1Z5BA 2XEPA 4PD2A 2Y0QA 4DR3M 1QYRA 3SYKA 3L26A 4QHTA 1G59A 4G4RA 3U60A 1EFUB 2YFQA 3SAUA 4L16A 3AFHA 1NY6A 3HX3A 3TPZA 2LHCA 4OVZA 1PRBA 2X8AA 3SBJA 5KPZA 2VDBB 2QCUA 1G4AE 1P3QQ 3CTWB 2W82A 3RE8A 4LF7M 4XGIA 4NXNM 5FLXS 1L2CA 4L8RC 3HU3A 4KHPM 4DUZM 4DR2M 2DAEA 2DAKA 3K8ZA 4IBCA 3ILKA 1D2NA 1IN8A 1BVSA 2GNOA 2RKOA 3LQQA 2XZUA 2FOIC 2EUCA 2G3QA 3SAWA 3U5ZB 1Q3BA 3SMPA 2X49A 1IM2A 3BOSA 3SC3A 4B7FA 5ITYA 1T43A 1XXHE 2CWBA 2E5LM 3HU2A 2WSCF 3HZJA 4PT5A 2G8LA 2QENA 5BR8M 4FVMA 4KO8A 2XSZA 5EQTA 3EIHA 5FSWA 1L2DA 3MK6A 1ORYB 3LQRA 3TWLA 5FTKA 1G41A 4L6V6 4QNRA 1L8QA 1TH3A 2CHVA 4D81A 2VQEM 3I4VA 3GLHA 1NO1A 3NBXX 2QNJA 2DHYA 7CATA 1R2ZA 4I81A 3U61A 2XSZD 1HNWM 3VDPA 4IBEA 1XMOM 4B3MM 1C7YA 3KS8A 2JY6B 4LJAA 4L78A 2R0IA 3C9PA 3GPYA 2QBYB 1E32A 2YQZA 2DENA 2F5NA 4LZJA 3GLIA 1DGGA 1N36M 2Y21A 1L1TA 4CIZA 1QAOA 3QYEA 1WIVA 3GLFB 3C58A 4DR1M 1A5TA 2I7NA 1R4GA 2QHOB 4FWDA 3HU1A 4DR4M 5E6JA 1OIPA 4KODA 3KOXE 3VKHA 3V76A 2QSFX 3WHKA 4II7A 4CGYB 2F5SA 1V92A 4LF5M 1I4WA 3B7QA 2KEBA 5KPTA 1JR3E 4HEOA 4ANRA 3W0FA 2WZJA 4LJ7A 3GQ5A 1D0MA 1DGHA 1VDLA 2L7IA 2O25A 4MH0E 2QBYA 2LXEA 4JN6A 3K1JA 2LTUA 3GLGB 3K92A 4X62M 4IBIA 1HQCA 2RGOA 4RF1A 4ZPXA 2FNAA 2L2DA 3B9PA 4JI2M 4FW9A 3J81S 3JR4A 1OKSA 2VIIA 3JAMS 1VQ1A 1HJPA 2KZSA 2X4AA 4IBGA 4LRSA 4LGMA 3I04M 2EO2A 3M0EA 2N35A 3VLFB 5GKNA 5JI3E 3GQ3A 4Y28F 3U6SA 4G4QA 2ZTDA 2R6FA 3AV0A 3FUWA 4FWGA 4GRIA 3T1HM 3FKEA 3VDUA 2KRKA 2EKKA 1Z5AA 4DV0M 3FD9A 2CHQA 1LTMA 3FUXA 1E9SA 1MU5A 5EJCA 3LW5F 3UMMA 1TF0B 1EE8A 2UUAM 2M60A 1QAMA 2C9OA 3U6OA 1T6OA 2JY5A 1OTRA 3U6CA 3L2AA 4JV5M 5F3WA 5L8RF 4RNAA 2C96A 4BB9A 4AW4A 3A46A 4KT0F 4FCTA 1JB0F 2R46A 1I94M 2FE8A 1IN5A 2QPAA 4LF9M 1GVNA 2YNMD 2FS1A 3IG5A 3ZCBB 2APLA 4AZFA 1IXZA 3GP1A 3FTFA 2LVAA 1DV0A 3QAUA 3U60B 4NSRA 5EXXA 2JNHA 4L4UA 1Y8GA 4DV2M 1HNZM 4OVZB 2F4VM 2L7HA 1NHGC 2JY8A 4FD2A 2Y0TA 4LFCM 2R62A 3FTDA 4YY3M 1KFVA 3H4MA 1HT2E 2CV1A 3LMMA 1V33A 1HNXM 5ITTA 2F5QA 1N32M 1D0KA 3C3DA 3TWMA 3T38A 1IQPA 4LZZA 5KO3A 1R2YA 1L2BA 2HWJA 2H1RA 3SHFA 2JWSA 4JI4M 1IXSA 3I51A 2XH9A 1G71A 3GRVA 4I4LA 1H6UA 3U6QA 5EP3A 1QVRA 4FWHA 5H37D 3L27A 1S3SA 3JR5A 4MB7A 1N34M 4HLQA 4JXJA 4QHSA 2O5RA 4JI3M 1QUSA 4GHAA 1MN3A 1WGLA 1QAQA 1OFIA 3DZDA 4IBBA 3R8FA 3GLHB 2QZ4A 2HHHM 3NBIA 4NSOB 4RF0A 4YHHM 3U61B 5LMNM 3PVSA 2CE7A 4DV7M 5EXPA 3SASA 3FUUA 1OQYA 1XHBA 2LHGA 3PFIA 2MH8A 3GLIB 2KDLA 3CF6E 5IWAM 4IJEA 3AOEC 3J2PB 2O01F 2Z4RA 2LBCA 2MR9A 3T15A 3LCUA 1NNUC 1X37A 3I01M 3UK6A 1GL6A 1ZMUA 2GQFA 3LVVA 1Z5CA 1NJFA 4OU7A 5IZ7D 4B7HA 1TH2A 1PJIA 3HJSA 4M0WA 4WP2A 5ITQA 3KFUG 5DYIA 1TGUA 2R18A 3FTCA 2BJVA 3HJQA 1VEJA 4B3SM 4R71A 4WURA 4G4OA 1DGHB 1NSFA 1ZAEA 1ZMVA 3A45A 1ZQ9A 4MGHA 1N77A 3FYDA 2Z4SA 3I4YA 3TWKA 3U6LA 2Z8YM 2XF3A 1SXJE 2HCBA 4GC5A 5FTLA 1V34A 1OJLA 1XXHA 1PJSA 2ZBKB 1CUKA 8CATA 2P5TA 3RFWA 3RGSA 4PDIA 3DA1A 3A98B 2Z3XA 2BWBA 4LCBA 4LJ4A 3A42A 2DWLA 1DGBA 3L28A 2HAKA 3HWSA 1TDZA 2RGHA 1C1KA 1HQYE 2L4EA 4DV3M 1GKIA 1J09A 1NV9A 3GLFE 4DBGB 5IT9S 2ERCA 2B3TA 2LWXA 2R65A 4Z8XA 4A3VB 4CHTB 1SXJC 3HKPA 5EP2A 4AQYM 4MM3B 4DV5M 1J7KA 1YUBA 2JUJA 2K6BA 4AKHA 3K9OA 3Q8XA 2NQ8C 2RRUA 3D8BA 1E9RA 3DOAA 4F2LA 2LVQD 2J7OA 4PCZA 3B7ZA 1J5EM 2OQ4A 2L09A 2D7EA 2Y20A 4IBFA 2LH0A 4L15A 5EP1A 2ZTCA 4WW0A 5EXSA 3GPPA 2DI0A 1OAIA 1SXJA 3VFDA 4LFAM 2LVOC 4LGYA 1VG5A 2ZM6M 3HHWA 3MMPA 3FE3A 3THGA 3KW6A 2ZAOA 4FCVA 1GLNA 1WXQA 3KSXA 2I7PA 4JYAM 5FTMA 1MJGM 4LJ8A 4NL4H 2AHMA 2VQFM 1JR3A 4GH9A 2QP9X 4LJ6A 3ZC7B 4K0KM 4KLNA 1WGNA 4DV1M 3GO8A 4LF4M 4S12A 3KDSE 3PNYA 2C99A 4D82A 2XFSA 1OAOC 1VEGA 5BPVA 4LF6M 1WHCA 5C1BA 3GQ4A 4AKGA 4CJ6A 2UXDM 3NWLA 3ZH9B 3FRHA 3MJ5A 1FNNA 4GITA 4JI0M 4AG5A 1XC8A 2FH0A 4W5WA 1XNQM 1JR3D 3KSJA 1QDRA 2DWMA 1GJSA 3TL4X 2V6ZM 2DKLA 1W5TA 2Q2EB 1IXSB 1N33M 3AJIB 2LVPC 4MGYE 4LRTA 3U6PA 2UXBM 1XNRM 3WHLA 2JA2A 1N75A 2OOBA 2OO9A 4JI8M 3SATA 2CEAA 1MX0A 2R44A 4AKIA 3CF2A 5FTJA 2L6OA 2YR0A 3HHZA 1PJJA 5DYGA 2J7NA 2WSEF 3EIEA 2HKJA 1LV7A 3R9XB 1IY1A 4GKJM 3B74A 3J27B 2BJWA 1F4IA 2UUCM 5EP4A 4NXMM 1NVMA 1QDTA 2G5GX 3D8LA 2K0BX 1T3TA 4X66M 2LVNC 2WSFF 3FTEA 4BBAA 1IBKM 3BXWA 1Q02A 2DVWB 1XMQM 4NRWA 2R4JA 4JI7M 4OX9M 3AL0C 1VDDA 4QOSA 1IBLM 1DO0A 3E46A 4MGIE 4JI5M 4IIWA 3J7AS 4B08A 3SARA 1GO5A 4M0DA 3J7BA 3K9PA 3MHVC 3T6PA 2Z7JA 2UXCM 2KZUA 3QYBA 3W68A 4LFBM 3KOWE 1R5LA 4NRVA 2CRUA 1IXRC 2LNHC 3KVWA 3BBZA 4M9XA 1YSYA 4Z6YA 3E4RA 4LY6A 4JI6M 1Z59A 4X65M 2H5XA 1N78A 3F92A 1KSFX 1ZMWA 2DWZB 3L25A 1L1ZA 3PXGA 1KYIA 2F5PA 2V1UA 3GLHE 1XXHB 3GRRA 4AI6A 2XFTA 3SAVA 4G4NA 3KOYE 1EIJA 3TE6A 2EKFA 2EJSA 4DV4M 2DHRA 2K9DA 2CFOA 4M9SA 1K3XA 1TTEA 2CHGA 3SYLA 3GLIE 2DAIA
chains in the Genus database with same CATH topology
1TR8A 2BWEA 2JUJA 1T6OA 3K9OA 2JY5A 1OTRA 1ZV1A 2L4FA 2RRUA 4G3OA 2CP8A 1AIPC 2MJ5B 2LVQD 4F2LA 2OOAA 1EFUB 3IHPA 2ZTCA 2DI0A 1OAIA 2LVOC 1VG5A 2LVAA 1DV0A 3MMPA 3FE3A 2JNHA 1G4AE 1P3QQ 3LCVB 1Y8GA 1YLAA 2JY8A 2DAEA 1G3IA 2DAKA 1HT2E 1BVSA 1WGNA 3FRIA 2G3QA 2KHHA 1IM2A 1VEGA 1WHCA 1T43A 1XXHE 2CWBA 2KNZA 1SG9A 2HWJA 3FRHA 1IXSA 1WR1B 2JY7A 1QZEA 1E94E 3H4JA 4F1IA 2DKLA 2LVPC 3GLGE 1G41A 2DZLA 2OOBA 2OO9A 2DNAA 1PGYA 2QNJA 2DHYA 1MN3A 1WGLA 1C7YA 2JY6B 2R0IA 1UFZA 2DENA 1F4IA 2MGWA 1OQYA 1WIVA 2JP7A 1A5TA 2K0BX 1R4GA 2KNAA 2QHOB 1NV8A 2LVNC 3E21A 2LBCA 2MR9A 3LCUA 1Q02A 2QSFX 1ZMUA 1V92A 1VEKA 1DO2A 4GEWA 1IFYA 1JR3E 4HEOA 3B89A 2WZJA 2DAGA 4WP2A 1VDLA 1DO0A 2O25A 3E46A 2MROB 2LTUA 1VEJA 2KNVA 1GO5A 4R71A 3K9PA 3T6PA 1ZMVA 2L2DA 5JI2E 1OKSA 1VQ1A 1HJPA 1WJ7A 1XB2B 3BBZA 5DFLA 1CUKA 2H5XA 4Q7JA 1HT1E 3F92A 1ZMWA 2ZTDA 2BWBA 1KYIA 2HAKA 3GLHE 2JZ1A 2EKKA 2L4EA 1HQYE 2EKFA 2EJSA 3IECA 2JZ0A 2K9DA 3GLIE 4UN2B 1NV9A 1TTEA 3GLFE 4DBGB 2B3TA 2DAMA 2DAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR8 A;  2BWE A;  2JUJ A;  1T6O A;  3K9O A;  2JY5 A;  1OTR A;  1ZV1 A;  2L4F A;  2RRU A;  4G3O A;  2CP8 A;  1AIP C;  2MJ5 B;  2LVQ D;  4F2L A;  2OOA A;  1EFU B;  3IHP A;  2ZTC A;  2DI0 A;  1OAI A;  2LVO C;  1VG5 A;  2LVA A;  1DV0 A;  3MMP A;  3FE3 A;  2JNH A;  1G4A E;  1P3Q Q;  3LCV B;  1Y8G A;  1YLA A;  2JY8 A;  2DAE A;  1G3I A;  2DAK A;  1HT2 E;  1BVS A;  1WGN A;  3FRI A;  2G3Q A;  2KHH A;  1IM2 A;  1VEG A;  1WHC A;  1T43 A;  1XXH E;  2CWB A;  2KNZ A;  1SG9 A;  2HWJ A;  3FRH A;  1IXS A;  1WR1 B;  2JY7 A;  1QZE A;  1E94 E;  3H4J A;  4F1I A;  2DKL A;  2LVP C;  3GLG E;  1G41 A;  2DZL A;  2OOB A;  2OO9 A;  2DNA A;  1PGY A;  2QNJ A;  2DHY A;  1MN3 A;  1WGL A;  1C7Y A;  2JY6 B;  2R0I A;  1UFZ A;  2DEN A;  1F4I A;  2MGW A;  1OQY A;  1WIV A;  2JP7 A;  1A5T A;  2K0B X;  1R4G A;  2KNA A;  2QHO B;  1NV8 A;  2LVN C;  3E21 A;  2LBC A;  2MR9 A;  3LCU A;  1Q02 A;  2QSF X;  1ZMU A;  1V92 A;  1VEK A;  1DO2 A;  4GEW A;  1IFY A;  1JR3 E;  4HEO A;  3B89 A;  2WZJ A;  2DAG A;  4WP2 A;  1VDL A;  1DO0 A;  2O25 A;  3E46 A;  2MRO B;  2LTU A;  1VEJ A;  2KNV A;  1GO5 A;  4R71 A;  3K9P A;  3T6P A;  1ZMV A;  2L2D A;  5JI2 E;  1OKS A;  1VQ1 A;  1HJP A;  1WJ7 A;  1XB2 B;  3BBZ A;  5DFL A;  1CUK A;  2H5X A;  4Q7J A;  1HT1 E;  3F92 A;  1ZMW A;  2ZTD A;  2BWB A;  1KYI A;  2HAK A;  3GLH E;  2JZ1 A;  2EKK A;  2L4E A;  1HQY E;  2EKF A;  2EJS A;  3IEC A;  2JZ0 A;  2K9D A;  3GLI E;  4UN2 B;  1NV9 A;  1TTE A;  3GLF E;  4DBG B;  2B3T A;  2DAM A;  2DAI A; 
#chains in the Genus database with same CATH topology
 3AOE A;  5C18 A;  4DR5 M;  2XGN A;  4B3R M;  1IY0 A;  1TR8 A;  4GKK M;  1W5S A;  2QQ8 A;  4B7G A;  5KPR A;  2L4F A;  1ZV1 A;  1Z6T A;  1NNJ A;  2UUB M;  4B3T M;  2VF8 A;  3AKZ A;  4R7G A;  1AUA A;  4GC9 A;  2MJ5 B;  3FUV A;  3U6E A;  2OOA A;  3UGJ A;  4IBK A;  3CGW A;  2KXE A;  3GRY A;  3IHP A;  3PNV A;  5KQ8 A;  2K47 A;  2F5O A;  2D7G A;  3UZU A;  1IN4 A;  3IG8 A;  1YE9 A;  4IBD A;  4GIP A;  1QUT A;  3FUT A;  3LCV B;  1PM5 A;  1SXJ B;  1GJT A;  1YLA A;  3M7G A;  3W0L B;  1GL7 A;  1IBM M;  1G3I A;  3K2L A;  3GPU A;  3U5Z A;  4D80 A;  2R45 A;  5KQD A;  3KS4 A;  4QNM A;  4P16 A;  1OIZ A;  2XLJ A;  1G8P A;  3FRI A;  2VF7 A;  4XBO A;  4I5S A;  2FFJ A;  3KP0 E;  4MGZ E;  5LMU M;  1K82 A;  2KHH A;  3SHG B;  2M5Z A;  3FYC A;  5ITX E;  2DZN B;  2KNZ A;  1SG9 A;  3ZQJ A;  1OFH A;  1R7R A;  4QOZ C;  3HJ8 A;  4NOO B;  1WR1 B;  3SFZ A;  2JY7 A;  1NY5 A;  1QZE A;  3HHY A;  4JI1 M;  4LG2 A;  1E94 E;  2UU9 M;  4FCW A;  3H4J A;  3QWL A;  4R3D A;  4F1I A;  5IRE B;  3GLG E;  4DUY M;  3LVW A;  4GHL A;  5FTN A;  3HY5 A;  3GPX A;  2DZL A;  2V1C A;  3OTO M;  3VKG A;  1QQW A;  3E9S A;  2DNA A;  1PGY A;  2ZAM A;  3HHX A;  3VK7 A;  4ITQ A;  4TUW A;  5DNY A;  1XWI A;  3TQS A;  4PDG A;  1SXJ D;  1NJG A;  4G6Z A;  3HGI A;  1UFZ A;  3GLF A;  3AOG A;  3J80 S;  1QAN A;  2C98 A;  4IBJ A;  3KXE C;  4LF8 M;  4M9Z A;  3C3E A;  3CF0 A;  2MGW A;  3W67 A;  2DXI A;  1TDH A;  2C5R A;  2JP7 A;  5ITX A;  3SMS A;  1HR0 M;  2KNA A;  1NV8 A;  3E21 A;  4P17 A;  4DV6 M;  4XK8 F;  4IJF A;  2ZAN A;  5A2Q S;  1PJT A;  4CIS A;  1FJG M;  2HL7 A;  1VEK A;  4GEW A;  1DO2 A;  1NHW C;  2XZF A;  1IFY A;  3DFZ A;  2DZO B;  2D7H A;  3B89 A;  3KP1 E;  4BLC A;  3GLG A;  2OPF A;  1DGF A;  4GMQ A;  4AG6 A;  2DAG A;  5ITU A;  3U6M A;  2C9C A;  4MGK E;  2MRO B;  2CV0 A;  2KW0 A;  1QZM A;  2KNV A;  4OW0 A;  4X64 M;  4DR7 M;  2JXN A;  1RU3 A;  5EXT A;  4EIW A;  3T1Y M;  2KRU A;  3Q8G A;  3KOZ E;  5JI2 E;  3GRU A;  1WJ7 A;  1XB2 B;  2KA6 B;  4I8O A;  5DFL A;  3VK8 A;  1IN6 A;  3UJN A;  1TH4 A;  2DWN A;  4LJ9 A;  3RGP A;  4REZ A;  1R6B X;  1PJQ A;  4LJ5 A;  4Q7J A;  1HT1 E;  1GAB A;  2EA0 A;  2A5Y B;  1Q3C A;  3B7N A;  2CUZ A;  2J5Y A;  2JZ1 A;  1K3W A;  1JQJ C;  1UM8 A;  4RKU F;  3IEC A;  2JZ0 A;  4UN2 B;  1D0L A;  2R4E A;  4NC6 A;  1IY2 A;  4DR6 M;  2DAM A;  1IN7 A;  2BNK A;  4HL4 A;  2BWE A;  4G3O A;  3M6A A;  3U6D A;  2CP8 A;  1AIP C;  3L29 A;  5E26 A;  2CV2 A;  5ITR A;  1Q39 A;  1Z5B A;  2XEP A;  4PD2 A;  2Y0Q A;  4DR3 M;  1QYR A;  3SYK A;  3L26 A;  4QHT A;  1G59 A;  4G4R A;  3U60 A;  1EFU B;  2YFQ A;  3SAU A;  4L16 A;  3AFH A;  1NY6 A;  3HX3 A;  3TPZ A;  2LHC A;  4OVZ A;  1PRB A;  2X8A A;  3SBJ A;  5KPZ A;  2VDB B;  2QCU A;  1G4A E;  1P3Q Q;  3CTW B;  2W82 A;  3RE8 A;  4LF7 M;  4XGI A;  4NXN M;  5FLX S;  1L2C A;  4L8R C;  3HU3 A;  4KHP M;  4DUZ M;  4DR2 M;  2DAE A;  2DAK A;  3K8Z A;  4IBC A;  3ILK A;  1D2N A;  1IN8 A;  1BVS A;  2GNO A;  2RKO A;  3LQQ A;  2XZU A;  2FOI C;  2EUC A;  2G3Q A;  3SAW A;  3U5Z B;  1Q3B A;  3SMP A;  2X49 A;  1IM2 A;  3BOS A;  3SC3 A;  4B7F A;  5ITY A;  1T43 A;  1XXH E;  2CWB A;  2E5L M;  3HU2 A;  2WSC F;  3HZJ A;  4PT5 A;  2G8L A;  2QEN A;  5BR8 M;  4FVM A;  4KO8 A;  2XSZ A;  5EQT A;  3EIH A;  5FSW A;  1L2D A;  3MK6 A;  1ORY B;  3LQR A;  3TWL A;  5FTK A;  1G41 A;  4L6V 6;  4QNR A;  1L8Q A;  1TH3 A;  2CHV A;  4D81 A;  2VQE M;  3I4V A;  3GLH A;  1NO1 A;  3NBX X;  2QNJ A;  2DHY A;  7CAT A;  1R2Z A;  4I81 A;  3U61 A;  2XSZ D;  1HNW M;  3VDP A;  4IBE A;  1XMO M;  4B3M M;  1C7Y A;  3KS8 A;  2JY6 B;  4LJA A;  4L78 A;  2R0I A;  3C9P A;  3GPY A;  2QBY B;  1E32 A;  2YQZ A;  2DEN A;  2F5N A;  4LZJ A;  3GLI A;  1DGG A;  1N36 M;  2Y21 A;  1L1T A;  4CIZ A;  1QAO A;  3QYE A;  1WIV A;  3GLF B;  3C58 A;  4DR1 M;  1A5T A;  2I7N A;  1R4G A;  2QHO B;  4FWD A;  3HU1 A;  4DR4 M;  5E6J A;  1OIP A;  4KOD A;  3KOX E;  3VKH A;  3V76 A;  2QSF X;  3WHK A;  4II7 A;  4CGY B;  2F5S A;  1V92 A;  4LF5 M;  1I4W A;  3B7Q A;  2KEB A;  5KPT A;  1JR3 E;  4HEO A;  4ANR A;  3W0F A;  2WZJ A;  4LJ7 A;  3GQ5 A;  1D0M A;  1DGH A;  1VDL A;  2L7I A;  2O25 A;  4MH0 E;  2QBY A;  2LXE A;  4JN6 A;  3K1J A;  2LTU A;  3GLG B;  3K92 A;  4X62 M;  4IBI A;  1HQC A;  2RGO A;  4RF1 A;  4ZPX A;  2FNA A;  2L2D A;  3B9P A;  4JI2 M;  4FW9 A;  3J81 S;  3JR4 A;  1OKS A;  2VII A;  3JAM S;  1VQ1 A;  1HJP A;  2KZS A;  2X4A A;  4IBG A;  4LRS A;  4LGM A;  3I04 M;  2EO2 A;  3M0E A;  2N35 A;  3VLF B;  5GKN A;  5JI3 E;  3GQ3 A;  4Y28 F;  3U6S A;  4G4Q A;  2ZTD A;  2R6F A;  3AV0 A;  3FUW A;  4FWG A;  4GRI A;  3T1H M;  3FKE A;  3VDU A;  2KRK A;  2EKK A;  1Z5A A;  4DV0 M;  3FD9 A;  2CHQ A;  1LTM A;  3FUX A;  1E9S A;  1MU5 A;  5EJC A;  3LW5 F;  3UMM A;  1TF0 B;  1EE8 A;  2UUA M;  2M60 A;  1QAM A;  2C9O A;  3U6O A;  1T6O A;  2JY5 A;  1OTR A;  3U6C A;  3L2A A;  4JV5 M;  5F3W A;  5L8R F;  4RNA A;  2C96 A;  4BB9 A;  4AW4 A;  3A46 A;  4KT0 F;  4FCT A;  1JB0 F;  2R46 A;  1I94 M;  2FE8 A;  1IN5 A;  2QPA A;  4LF9 M;  1GVN A;  2YNM D;  2FS1 A;  3IG5 A;  3ZCB B;  2APL A;  4AZF A;  1IXZ A;  3GP1 A;  3FTF A;  2LVA A;  1DV0 A;  3QAU A;  3U60 B;  4NSR A;  5EXX A;  2JNH A;  4L4U A;  1Y8G A;  4DV2 M;  1HNZ M;  4OVZ B;  2F4V M;  2L7H A;  1NHG C;  2JY8 A;  4FD2 A;  2Y0T A;  4LFC M;  2R62 A;  3FTD A;  4YY3 M;  1KFV A;  3H4M A;  1HT2 E;  2CV1 A;  3LMM A;  1V33 A;  1HNX M;  5ITT A;  2F5Q A;  1N32 M;  1D0K A;  3C3D A;  3TWM A;  3T38 A;  1IQP A;  4LZZ A;  5KO3 A;  1R2Y A;  1L2B A;  2HWJ A;  2H1R A;  3SHF A;  2JWS A;  4JI4 M;  1IXS A;  3I51 A;  2XH9 A;  1G71 A;  3GRV A;  4I4L A;  1H6U A;  3U6Q A;  5EP3 A;  1QVR A;  4FWH A;  5H37 D;  3L27 A;  1S3S A;  3JR5 A;  4MB7 A;  1N34 M;  4HLQ A;  4JXJ A;  4QHS A;  2O5R A;  4JI3 M;  1QUS A;  4GHA A;  1MN3 A;  1WGL A;  1QAQ A;  1OFI A;  3DZD A;  4IBB A;  3R8F A;  3GLH B;  2QZ4 A;  2HHH M;  3NBI A;  4NSO B;  4RF0 A;  4YHH M;  3U61 B;  5LMN M;  3PVS A;  2CE7 A;  4DV7 M;  5EXP A;  3SAS A;  3FUU A;  1OQY A;  1XHB A;  2LHG A;  3PFI A;  2MH8 A;  3GLI B;  2KDL A;  3CF6 E;  5IWA M;  4IJE A;  3AOE C;  3J2P B;  2O01 F;  2Z4R A;  2LBC A;  2MR9 A;  3T15 A;  3LCU A;  1NNU C;  1X37 A;  3I01 M;  3UK6 A;  1GL6 A;  1ZMU A;  2GQF A;  3LVV A;  1Z5C A;  1NJF A;  4OU7 A;  5IZ7 D;  4B7H A;  1TH2 A;  1PJI A;  3HJS A;  4M0W A;  4WP2 A;  5ITQ A;  3KFU G;  5DYI A;  1TGU A;  2R18 A;  3FTC A;  2BJV A;  3HJQ A;  1VEJ A;  4B3S M;  4R71 A;  4WUR A;  4G4O A;  1DGH B;  1NSF A;  1ZAE A;  1ZMV A;  3A45 A;  1ZQ9 A;  4MGH A;  1N77 A;  3FYD A;  2Z4S A;  3I4Y A;  3TWK A;  3U6L A;  2Z8Y M;  2XF3 A;  1SXJ E;  2HCB A;  4GC5 A;  5FTL A;  1V34 A;  1OJL A;  1XXH A;  1PJS A;  2ZBK B;  1CUK A;  8CAT A;  2P5T A;  3RFW A;  3RGS A;  4PDI A;  3DA1 A;  3A98 B;  2Z3X A;  2BWB A;  4LCB A;  4LJ4 A;  3A42 A;  2DWL A;  1DGB A;  3L28 A;  2HAK A;  3HWS A;  1TDZ A;  2RGH A;  1C1K A;  1HQY E;  2L4E A;  4DV3 M;  1GKI A;  1J09 A;  1NV9 A;  3GLF E;  4DBG B;  5IT9 S;  2ERC A;  2B3T A;  2LWX A;  2R65 A;  4Z8X A;  4A3V B;  4CHT B;  1SXJ C;  3HKP A;  5EP2 A;  4AQY M;  4MM3 B;  4DV5 M;  1J7K A;  1YUB A;  2JUJ A;  2K6B A;  4AKH A;  3K9O A;  3Q8X A;  2NQ8 C;  2RRU A;  3D8B A;  1E9R A;  3DOA A;  4F2L A;  2LVQ D;  2J7O A;  4PCZ A;  3B7Z A;  1J5E M;  2OQ4 A;  2L09 A;  2D7E A;  2Y20 A;  4IBF A;  2LH0 A;  4L15 A;  5EP1 A;  2ZTC A;  4WW0 A;  5EXS A;  3GPP A;  2DI0 A;  1OAI A;  1SXJ A;  3VFD A;  4LFA M;  2LVO C;  4LGY A;  1VG5 A;  2ZM6 M;  3HHW A;  3MMP A;  3FE3 A;  3THG A;  3KW6 A;  2ZAO A;  4FCV A;  1GLN A;  1WXQ A;  3KSX A;  2I7P A;  4JYA M;  5FTM A;  1MJG M;  4LJ8 A;  4NL4 H;  2AHM A;  2VQF M;  1JR3 A;  4GH9 A;  2QP9 X;  4LJ6 A;  3ZC7 B;  4K0K M;  4KLN A;  1WGN A;  4DV1 M;  3GO8 A;  4LF4 M;  4S12 A;  3KDS E;  3PNY A;  2C99 A;  4D82 A;  2XFS A;  1OAO C;  1VEG A;  5BPV A;  4LF6 M;  1WHC A;  5C1B A;  3GQ4 A;  4AKG A;  4CJ6 A;  2UXD M;  3NWL A;  3ZH9 B;  3FRH A;  3MJ5 A;  1FNN A;  4GIT A;  4JI0 M;  4AG5 A;  1XC8 A;  2FH0 A;  4W5W A;  1XNQ M;  1JR3 D;  3KSJ A;  1QDR A;  2DWM A;  1GJS A;  3TL4 X;  2V6Z M;  2DKL A;  1W5T A;  2Q2E B;  1IXS B;  1N33 M;  3AJI B;  2LVP C;  4MGY E;  4LRT A;  3U6P A;  2UXB M;  1XNR M;  3WHL A;  2JA2 A;  1N75 A;  2OOB A;  2OO9 A;  4JI8 M;  3SAT A;  2CEA A;  1MX0 A;  2R44 A;  4AKI A;  3CF2 A;  5FTJ A;  2L6O A;  2YR0 A;  3HHZ A;  1PJJ A;  5DYG A;  2J7N A;  2WSE F;  3EIE A;  2HKJ A;  1LV7 A;  3R9X B;  1IY1 A;  4GKJ M;  3B74 A;  3J27 B;  2BJW A;  1F4I A;  2UUC M;  5EP4 A;  4NXM M;  1NVM A;  1QDT A;  2G5G X;  3D8L A;  2K0B X;  1T3T A;  4X66 M;  2LVN C;  2WSF F;  3FTE A;  4BBA A;  1IBK M;  3BXW A;  1Q02 A;  2DVW B;  1XMQ M;  4NRW A;  2R4J A;  4JI7 M;  4OX9 M;  3AL0 C;  1VDD A;  4QOS A;  1IBL M;  1DO0 A;  3E46 A;  4MGI E;  4JI5 M;  4IIW A;  3J7A S;  4B08 A;  3SAR A;  1GO5 A;  4M0D A;  3J7B A;  3K9P A;  3MHV C;  3T6P A;  2Z7J A;  2UXC M;  2KZU A;  3QYB A;  3W68 A;  4LFB M;  3KOW E;  1R5L A;  4NRV A;  2CRU A;  1IXR C;  2LNH C;  3KVW A;  3BBZ A;  4M9X A;  1YSY A;  4Z6Y A;  3E4R A;  4LY6 A;  4JI6 M;  1Z59 A;  4X65 M;  2H5X A;  1N78 A;  3F92 A;  1KSF X;  1ZMW A;  2DWZ B;  3L25 A;  1L1Z A;  3PXG A;  1KYI A;  2F5P A;  2V1U A;  3GLH E;  1XXH B;  3GRR A;  4AI6 A;  2XFT A;  3SAV A;  4G4N A;  3KOY E;  1EIJ A;  3TE6 A;  2EKF A;  2EJS A;  4DV4 M;  2DHR A;  2K9D A;  2CFO A;  4M9S A;  1K3X A;  1TTE A;  2CHG A;  3SYL A;  3GLI E;  2DAI A; 
#chains in the Genus database with same CATH homology
 1TR8 A;  2BWE A;  2JUJ A;  1T6O A;  3K9O A;  2JY5 A;  1OTR A;  1ZV1 A;  2L4F A;  2RRU A;  4G3O A;  2CP8 A;  1AIP C;  2MJ5 B;  2LVQ D;  4F2L A;  2OOA A;  1EFU B;  3IHP A;  2ZTC A;  2DI0 A;  1OAI A;  2LVO C;  1VG5 A;  2LVA A;  1DV0 A;  3MMP A;  3FE3 A;  2JNH A;  1G4A E;  1P3Q Q;  3LCV B;  1Y8G A;  1YLA A;  2JY8 A;  2DAE A;  1G3I A;  2DAK A;  1HT2 E;  1BVS A;  1WGN A;  3FRI A;  2G3Q A;  2KHH A;  1IM2 A;  1VEG A;  1WHC A;  1T43 A;  1XXH E;  2CWB A;  2KNZ A;  1SG9 A;  2HWJ A;  3FRH A;  1IXS A;  1WR1 B;  2JY7 A;  1QZE A;  1E94 E;  3H4J A;  4F1I A;  2DKL A;  2LVP C;  3GLG E;  1G41 A;  2DZL A;  2OOB A;  2OO9 A;  2DNA A;  1PGY A;  2QNJ A;  2DHY A;  1MN3 A;  1WGL A;  1C7Y A;  2JY6 B;  2R0I A;  1UFZ A;  2DEN A;  1F4I A;  2MGW A;  1OQY A;  1WIV A;  2JP7 A;  1A5T A;  2K0B X;  1R4G A;  2KNA A;  2QHO B;  1NV8 A;  2LVN C;  3E21 A;  2LBC A;  2MR9 A;  3LCU A;  1Q02 A;  2QSF X;  1ZMU A;  1V92 A;  1VEK A;  1DO2 A;  4GEW A;  1IFY A;  1JR3 E;  4HEO A;  3B89 A;  2WZJ A;  2DAG A;  4WP2 A;  1VDL A;  1DO0 A;  2O25 A;  3E46 A;  2MRO B;  2LTU A;  1VEJ A;  2KNV A;  1GO5 A;  4R71 A;  3K9P A;  3T6P A;  1ZMV A;  2L2D A;  5JI2 E;  1OKS A;  1VQ1 A;  1HJP A;  1WJ7 A;  1XB2 B;  3BBZ A;  5DFL A;  1CUK A;  2H5X A;  4Q7J A;  1HT1 E;  3F92 A;  1ZMW A;  2ZTD A;  2BWB A;  1KYI A;  2HAK A;  3GLH E;  2JZ1 A;  2EKK A;  2L4E A;  1HQY E;  2EKF A;  2EJS A;  3IEC A;  2JZ0 A;  2K9D A;  3GLI E;  4UN2 B;  1NV9 A;  1TTE A;  3GLF E;  4DBG B;  2B3T A;  2DAM A;  2DAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...