1GO5A

Structure of the c-terminal fg-binding domain of human tap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
PAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-Terminal Fg-Nucleoporin Binding Domain of Tap/Nxf1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
molecule keywords TIP ASSOCIATING PROTEIN
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1go5A00
2ZTCA 3K9PA 1T6OA 1WGLA 1P3QQ 2DENA 2L4FA 1DV0A 2B3TA 2EKKA 4Q7JA 4GEWA 2O25A 2MROB 1EFUB 1V92A 2LVAA 1E94E 1G41A 2LVPC 5JI2E 1WHCA 2LVOC 2WZJA 2ZTDA 2DZLA 2OOBA 1CUKA 3K9OA 1G4AE 1VEKA 1HT1E 4G3OA 2DAEA 3FRIA 4HEOA 2KNVA 1OAIA 2JY6B 2K0BX 1WR1B 2CWBA 1VEJA 2KHHA 2L4EA 3FE3A 3BBZA 2LVQD 2KNZA 1GO5A 2MJ5B 3LCUA 1PGYA 2JNHA 3GLFE 3IECA 1TTEA 2DAIA 3F92A 1HT2E 2DKLA 4UN2B 3H4JA 1IM2A 1MN3A 1AIPC 2OO9A 2G3QA 1VEGA 2DAGA 2KNAA 1VQ1A 2BWEA 3IHPA 2JY8A 1VG5A 2JY5A 2MGWA 1WJ7A 1IFYA 3FRHA 3LCVB 1ZMWA 1JR3E 2DAMA 2QSFX 2DNAA 1VDLA 3GLHE 4DBGB 2JY7A 2MR9A 2QNJA 2EKFA 1R4GA 3T6PA 1G3IA 2OOAA 2HWJA 3MMPA 1IXSA 2BWBA 1KYIA 2L2DA 2JP7A 5DFLA 4R71A 1A5TA 1NV9A 1OTRA 2DHYA 1WIVA 4WP2A 1Q02A 1HJPA 1HQYE 1NV8A 1Y8GA 3E21A 2CP8A 2JUJA 2R0IA 1QZEA 2JZ1A 1F4IA 1WGNA 4F2LA 2K9DA 2H5XA 2LTUA 3GLIE 1XXHE 2HAKA 2LVNC 1C7YA 1UFZA 1YLAA 1DO2A 2DI0A 1BVSA 1ZV1A 3GLGE 2LBCA 1OKSA 2JZ0A 1SG9A 1T43A 2DAKA 1ZMUA 4F1IA 2EJSA 1ZMVA 1DO0A 1OQYA 2RRUA 1TR8A 3E46A 2QHOB 1XB2B 3B89A
chains in the Genus database with same CATH superfamily
5EP1A 2C5RA 2M60A 1XNQM 3VLFB 4M0WA 4KLNA 3HX3A 1T6OA 1WGLA 2WSFF 1P3QQ 2EUCA 1MX0A 2L6OA 2P5TA 3KOXE 4Q7JA 4YY3M 2CV0A 5IT9S 3PXGA 1C1KA 1L8QA 2MROB 3W67A 3U5ZB 1IN6A 2BNKA 2JWSA 1IY1A 4X65M 1QDRA 3AV0A 4DV5M 2LXEA 4GIPA 2UXCM 1QAMA 2R46A 1WHCA 2D7HA 4BLCA 4JI4M 4DV4M 2FE8A 3VKGA 2WZJA 1GJSA 1J7KA 3FKEA 1IXZA 2DZLA 2CHQA 1PJIA 1PJTA 3C3DA 1FNNA 3B7QA 2OPFA 4G6ZA 4GKJM 2V6ZM 2KHHA 4NSOB 2L4EA 3FE3A 2VF7A 3HHWA 1TDZA 3BBZA 2KNZA 3GRUA 2XH9A 2LH0A 4M9XA 3T38A 3U5ZA 3KSJA 2KA6B 4NRVA 1Q3BA 3GLHA 5IZ7D 4B3MM 3RFWA 2YR0A 1TTEA 4B7GA 2F5PA 4DR4M 2DKLA 3GRYA 3LQQA 4BB9A 2KDLA 3W0FA 2F5NA 4LJ4A 3U6MA 3FTFA 1IM2A 2C99A 3M6AA 1AIPC 4LY6A 3GLGA 3I04M 1L1TA 3SMSA 1VQ1A 1X37A 5JI3E 4M9ZA 3BOSA 4NOOB 2JY8A 3VK7A 4KHPM 3D8BA 3FUXA 5FTLA 2JY5A 3GPUA 5BPVA 2QZ4A 1YE9A 4JI2M 2RGOA 4GC5A 4PCZA 2DZOB 4LF7M 3T1YM 4FD2A 4EIWA 3B74A 1D0MA 3NBXX 1E9RA 4LJ7A 4RKUF 2JY7A 3TWLA 3W68A 1XXHA 4DV1M 2QNJA 3HHXA 1R4GA 2FOIC 2OOAA 3SAUA 3KFUG 3KS8A 4JV5M 5E6JA 3SYLA 4DR3M 4LZJA 2R45A 3LMMA 5EP2A 4AKGA 3W0LB 2Q2EB 1NV9A 3QWLA 5EXTA 1NHGC 3K92A 2D7EA 3RE8A 1NNJA 1IXRC 1HJPA 3L29A 1HQYE 4GH9A 5ITQA 4DR1M 1FJGM 1DGGA 3QAUA 4REZA 2CV1A 4DUZM 4PD2A 4LJ5A 2F4VM 1OFIA 4G4QA 4GRIA 3GP1A 4D81A 1IY2A 3SATA 3K8ZA 2CUZA 2HCBA 1IN5A 2JZ1A 1E9SA 1WGNA 1QDTA 2D7GA 2G5GX 4DR7M 1PJSA 1GVNA 3AOEA 4F2LA 2UU9M 1SXJC 1R5LA 2LTUA 4S12A 1YSYA 3KOYE 3I4VA 5FTKA 5EP4A 2LVNC 1EE8A 1DO2A 4PDGA 1HQCA 4XK8F 3GPYA 1QQWA 4FCVA 2CEAA 5C18A 5DNYA 1QUTA 3E9SA 4LCBA 3J27B 4JI3M 3B7NA 3Q8XA 1T43A 1VDDA 4MGHA 3I01M 4HL4A 3PVSA 1EIJA 1W5SA 1ZMVA 2RRUA 4DR5M 3L26A 1I94M 3U6SA 3THGA 2L7HA 3K1JA 2G8LA 2Y21A 3IG8A 2CRUA 2O5RA 3KOZE 1OIPA 3V76A 2ZTCA 4G4NA 3HKPA 1IBMM 4I5SA 1T3TA 3RGPA 3TL4X 2DENA 3ZC7B 5BR8M 2B3TA 2EKKA 2VIIA 1JB0F 4IBKA 1Z6TA 3TPZA 3NWLA 3AKZA 4L8RC 2V1UA 2LVAA 1WXQA 4GHLA 2MH8A 2LVPC 1Z5AA 1XWIA 3MHVC 5KPRA 5JI2E 1JR3D 2UUCM 3ZCBB 2WSCF 1NSFA 1XMQM 3FUWA 5L8RF 3HU2A 2ZTDA 3KP0E 3J81S 4RNAA 1CUKA 7CATA 1VEKA 4HEOA 1OAOC 2JY6B 2CWBA 4D82A 2DWMA 4MGIE 3U6EA 2KEBA 5EXSA 1GO5A 2DWZB 2ZANA 5ITRA 3LCUA 2JNHA 4LRSA 3TWMA 1XMOM 3IG5A 4JYAM 3OTOM 4B3TM 3FUUA 1Q3CA 1NJFA 2XZUA 2Y0QA 3DA1A 4KO8A 4G4OA 3M7GA 2LHCA 2Z4RA 1HT2E 3A46A 4MGYE 4B7FA 4UN2B 4JI5M 3PFIA 2QCUA 3U6PA 1MN3A 4R3DA 4K0KM 4JI0M 2G3QA 2K47A 2YQZA 4A3VB 2GNOA 1MJGM 4IIWA 4QHTA 4WURA 1VG5A 5IWAM 2LWXA 1K82A 1R7RA 2ZBKB 5ITUA 4IBBA 2C9OA 3FRHA 2XFTA 4B7HA 4LF4M 1HNWM 3ZQJA 4MM3B 2FH0A 2Z4SA 1ZMWA 2I7NA 2QSFX 4DV0M 2DNAA 2KW0A 4AKIA 3FYDA 4L6V6 4JI8M 2Y20A 4AG5A 3GPXA 3SHGB 3FTEA 4ANRA 2UXDM 4P17A 1TH3A 3VKHA 2JP7A 5GKNA 4II7A 5DFLA 2J5YA 1A5TA 2JXNA 4I81A 2RKOA 2LNHC 4JN6A 1PM5A 3GQ5A 1KFVA 4BBAA 3KS4A 3JR5A 5EXPA 3A42A 2UUAM 1Z5CA 1OJLA 2QBYA 3R8FA 3CTWB 1NJGA 2DZNB 1N32M 3HHYA 1QANA 2R0IA 4R7GA 3U61A 1QVRA 1QZMA 4AG6A 3Q8GA 4L16A 2H5XA 3SBJA 4OX9M 1XXHE 1OFHA 2HAKA 4LFBM 1C7YA 1UFZA 5H37D 5ITTA 1YLAA 1K3WA 4I4LA 1BVSA 1ZV1A 4LF6M 2J7NA 1NY5A 2VF8A 1TDHA 4ITQA 3UJNA 2R18A 5F3WA 2HL7A 1OQYA 1ZQ9A 1TR8A 3VDUA 2I7PA 2DVWB 3CF2A 3AJIB 4DV3M 3DFZA 4CJ6A 3BXWA 2QHOB 5EQTA 1XB2B 4X62M 4JI1M 2R44A 1GABA 2EA0A 2XFSA 3ZH9B 4MGKE 2VQFM 3U60A 4G4RA 3AOEC 1NY6A 2NQ8C 2CE7A 1J5EM 4IBCA 3J2PB 1L2DA 4NL4H 1DV0A 3WHLA 2R4JA 4FCWA 3U6CA 5KQDA 2L09A 4GEWA 2X49A 4Z6YA 2O25A 1DGHB 4IBIA 2UUBM 3NBIA 2HHHM 1E94E 1JQJC 4IBEA 3WHKA 5FTJA 1G41A 2KRUA 2CFOA 1N36M 1J09A 3KSXA 4AQYM 1GKIA 4FWDA 2LVOC 2XSZD 3U61B 3FTCA 3U6DA 1W5TA 1TH2A 3EIHA 3HHZA 2M5ZA 2E5LM 3K9OA 1G4AE 3TE6A 1HT1E 4G3OA 2DAEA 1R2ZA 1OAIA 2K0BX 1VEJA 2R65A 4CGYB 1HNXM 1TF0B 4AKHA 1V34A 1YUBA 2EO2A 3H4MA 4L78A 2MJ5B 3D8LA 4NXNM 4AW4A 2QENA 4QOZC 1PGYA 5FSWA 3FUVA 3PNYA 2W82A 1L2CA 4QOSA 1QUSA 1R6BX 3U6LA 3IECA 1RU3A 2C9CA 2VQEM 1IXSB 3VDPA 3VK8A 2UXBM 4DR2M 3GLIB 3J7BA 4IJEA 2RGHA 1QYRA 3H4JA 1D0LA 3HWSA 4JI7M 1NVMA 2C98A 4AZFA 2CHVA 2APLA 4D80A 2R4EA 4FVMA 1TGUA 2KZUA 3LVVA 2MGWA 1UM8A 1IBLM 3HGIA 3LW5F 2ZAOA 2OQ4A 3GRRA 3L27A 1N75A 3A45A 3SFZA 1DGBA 3KVWA 2DAMA 3HU3A 2DXIA 3SYKA 1XNRM 1GL6A 3K2LA 4LRTA 4LFAM 2FNAA 4LF9M 2MR9A 5IREB 3GLIA 2L7IA 2EKFA 3T6PA 1G3IA 2HWJA 2H1RA 3MMPA 4QNMA 5KPTA 1IXSA 3EIEA 4GMQA 4M9SA 2L2DA 4DUYM 3L28A 2J7OA 3GLHB 3RGSA 4Z8XA 1OTRA 2DHYA 4OVZA 3JR4A 3SARA 1WIVA 1SXJA 4IBGA 4LZZA 3AL0C 3JAMS 1Q02A 1NV8A 4DR6M 8CATA 3FUTA 3T15A 2QBYB 1G59A 5KQ8A 1NHWC 1S3SA 2A5YB 2N35A 2XEPA 3E21A 2DWLA 2CP8A 5LMUM 1LV7A 4W5WA 1SXJB 1QAQA 4OVZB 1GJTA 2BJVA 1L2BA 2YNMD 5DYIA 1N77A 1IQPA 3C3EA 4XBOA 2R6FA 1GLNA 1I4WA 2K9DA 4LFCM 4LG2A 1IFYA 4CIZA 2C96A 4LF5M 1SXJE 3SC3A 2DWNA 1DGHA 3FTDA 2DI0A 1K3XA 3FYCA 3J7AS 3U6OA 3GLFB 5KPZA 3GLGE 1TH4A 4NRWA 4AI6A 4MB7A 2JZ0A 2CHGA 2ZAMA 4LGMA 4QNRA 5FTMA 4NXMM 1N33M 3GO8A 3CGWA 4FW9A 2EJSA 1KSFX 4X66M 3GQ4A 1DO0A 3HY5A 4IJFA 2Y0TA 1IN8A 3E46A 5C1BA 4DV7M 2WSEF 3DOAA 3SMPA 2QPAA 3QYEA 3B89A 1ORYB 4NC6A 4B3RM 4TUWA 1ZAEA 3M0EA 2BJWA 4LJ6A 4KT0F 3K9PA 1H6UA 4RF1A 5A2QS 3UMMA 4DV6M 4CISA 1Z59A 2L4FA 2YFQA 4M0DA 3GLFA 3U6QA 1LTMA 3UZUA 5ITXA 1EFUB 3T1HM 1V92A 3B9PA 2GQFA 3KOWE 3L2AA 1HR0M 4ZPXA 4DV2M 1XHBA 2O01F 3C9PA 2Z7JA 4NSRA 1PJJA 4HLQA 1E32A 2Z8YM 2LHGA 2OOBA 4FWGA 2ERCA 3TWKA 3FRIA 1IN4A 2KNVA 4LGYA 2F5OA 2XZFA 1WR1B 4MH0E 2XF3A 4GITA 4RF0A 2Z3XA 1QAOA 3UGJA 3L25A 1IY0A 2XSZA 2LVQD 2KZSA 3HZJA 3HJ8A 3GQ3A 3GLFE 1PRBA 2KXEA 2VDBB 1IBKM 2DAIA 3F92A 2JA2A 5EP3A 1N78A 3E4RA 3KP1E 1NNUC 1GL7A 3J80S 3U60B 1XXHB 4B08A 2FS1A 2F5QA 4GHAA 3UK6A 4GKKM 3KW6A 3MJ5A 3C58A 2OO9A 1VEGA 4JXJA 2DAGA 4LJ8A 2KNAA 1Q39A 2BWEA 3GRVA 1JR3A 2X8AA 4LJAA 3IHPA 1N34M 2HKJA 5EJCA 4YHHM 3AOGA 2ZM6M 1WJ7A 1Z5BA 4L4UA 3GPPA 3KDSE 4P16A 3SAVA 1OIZA 3LCVB 1XC8A 1DGFA 1JR3E 3LQRA 3I51A 2AHMA 3GLGB 4LJ9A 4X64M 4OW0A 1VDLA 2R62A 3GLHE 2X4AA 3ILKA 3HJSA 4DBGB 5LMNM 1R2YA 5FLXS 4L15A 1PJQA 2FFJA 4FCTA 3VFDA 4GC9A 2BWBA 2V1CA 4PDIA 1KYIA 1V33A 4Y28F 3TQSA 4R71A 4IBDA 2QQ8A 2DHRA 4WP2A 4LF8M 1MU5A 4PT5A 2XLJA 3I4YA 1Y8GA 5E26A 2CV2A 3R9XB 1D2NA 4WW0A 1L1ZA 3HJQA 2F5SA 3HU1A 5FTNA 4JI6M 4FWHA 2JUJA 4I8OA 1QZEA 1D0KA 1SXJD 5KO3A 1F4IA 4OU7A 4B3SM 1NO1A 3FD9A 5DYGA 4IBFA 3CF0A 2XGNA 3GLIE 1AUAA 2KRKA 4MGZE 4CHTB 1G71A 3KXEC 3PNVA 1G8PA 3B7ZA 4XGIA 5ITXE 4KODA 3SHFA 2K6BA 2LBCA 1OKSA 3SAWA 3LVWA 1SG9A 2DAKA 3A98B 3DZDA 1ZMUA 4IBJA 4F1IA 3MK6A 5EXXA 5ITYA 4QHSA 3CF6E 3QYBA 2QP9X 3SASA 1IN7A 3AFHA 1HNZM
chains in the Genus database with same CATH topology
2ZTCA 3K9PA 1T6OA 1WGLA 1P3QQ 2DENA 2L4FA 1DV0A 2B3TA 2EKKA 4Q7JA 4GEWA 2O25A 2MROB 1EFUB 1V92A 2LVAA 1E94E 1G41A 2LVPC 5JI2E 1WHCA 2LVOC 2WZJA 2ZTDA 2DZLA 2OOBA 1CUKA 3K9OA 1G4AE 1VEKA 1HT1E 4G3OA 2DAEA 3FRIA 4HEOA 2KNVA 1OAIA 2JY6B 2K0BX 1WR1B 2CWBA 1VEJA 2KHHA 2L4EA 3FE3A 3BBZA 2LVQD 2KNZA 1GO5A 2MJ5B 3LCUA 1PGYA 2JNHA 3GLFE 3IECA 1TTEA 2DAIA 3F92A 1HT2E 2DKLA 4UN2B 3H4JA 1IM2A 1MN3A 1AIPC 2OO9A 2G3QA 1VEGA 2DAGA 2KNAA 1VQ1A 2BWEA 3IHPA 2JY8A 1VG5A 2JY5A 2MGWA 1WJ7A 1IFYA 3FRHA 3LCVB 1ZMWA 1JR3E 2DAMA 2QSFX 2DNAA 1VDLA 3GLHE 4DBGB 2JY7A 2MR9A 2QNJA 2EKFA 1R4GA 3T6PA 1G3IA 2OOAA 2HWJA 3MMPA 1IXSA 2BWBA 1KYIA 2L2DA 2JP7A 5DFLA 4R71A 1A5TA 1NV9A 1OTRA 2DHYA 1WIVA 4WP2A 1Q02A 1HJPA 1HQYE 1NV8A 1Y8GA 3E21A 2CP8A 2JUJA 2R0IA 1QZEA 2JZ1A 1F4IA 1WGNA 4F2LA 2K9DA 2H5XA 2LTUA 3GLIE 1XXHE 2HAKA 2LVNC 1C7YA 1UFZA 1YLAA 1DO2A 2DI0A 1BVSA 1ZV1A 3GLGE 2LBCA 1OKSA 2JZ0A 1SG9A 1T43A 2DAKA 1ZMUA 4F1IA 2EJSA 1ZMVA 1DO0A 1OQYA 2RRUA 1TR8A 3E46A 2QHOB 1XB2B 3B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTC A;  3K9P A;  1T6O A;  1WGL A;  1P3Q Q;  2DEN A;  2L4F A;  1DV0 A;  2B3T A;  2EKK A;  4Q7J A;  4GEW A;  2O25 A;  2MRO B;  1EFU B;  1V92 A;  2LVA A;  1E94 E;  1G41 A;  2LVP C;  5JI2 E;  1WHC A;  2LVO C;  2WZJ A;  2ZTD A;  2DZL A;  2OOB A;  1CUK A;  3K9O A;  1G4A E;  1VEK A;  1HT1 E;  4G3O A;  2DAE A;  3FRI A;  4HEO A;  2KNV A;  1OAI A;  2JY6 B;  2K0B X;  1WR1 B;  2CWB A;  1VEJ A;  2KHH A;  2L4E A;  3FE3 A;  3BBZ A;  2LVQ D;  2KNZ A;  1GO5 A;  2MJ5 B;  3LCU A;  1PGY A;  2JNH A;  3GLF E;  3IEC A;  1TTE A;  2DAI A;  3F92 A;  1HT2 E;  2DKL A;  4UN2 B;  3H4J A;  1IM2 A;  1MN3 A;  1AIP C;  2OO9 A;  2G3Q A;  1VEG A;  2DAG A;  2KNA A;  1VQ1 A;  2BWE A;  3IHP A;  2JY8 A;  1VG5 A;  2JY5 A;  2MGW A;  1WJ7 A;  1IFY A;  3FRH A;  3LCV B;  1ZMW A;  1JR3 E;  2DAM A;  2QSF X;  2DNA A;  1VDL A;  3GLH E;  4DBG B;  2JY7 A;  2MR9 A;  2QNJ A;  2EKF A;  1R4G A;  3T6P A;  1G3I A;  2OOA A;  2HWJ A;  3MMP A;  1IXS A;  2BWB A;  1KYI A;  2L2D A;  2JP7 A;  5DFL A;  4R71 A;  1A5T A;  1NV9 A;  1OTR A;  2DHY A;  1WIV A;  4WP2 A;  1Q02 A;  1HJP A;  1HQY E;  1NV8 A;  1Y8G A;  3E21 A;  2CP8 A;  2JUJ A;  2R0I A;  1QZE A;  2JZ1 A;  1F4I A;  1WGN A;  4F2L A;  2K9D A;  2H5X A;  2LTU A;  3GLI E;  1XXH E;  2HAK A;  2LVN C;  1C7Y A;  1UFZ A;  1YLA A;  1DO2 A;  2DI0 A;  1BVS A;  1ZV1 A;  3GLG E;  2LBC A;  1OKS A;  2JZ0 A;  1SG9 A;  1T43 A;  2DAK A;  1ZMU A;  4F1I A;  2EJS A;  1ZMV A;  1DO0 A;  1OQY A;  2RRU A;  1TR8 A;  3E46 A;  2QHO B;  1XB2 B;  3B89 A; 
#chains in the Genus database with same CATH topology
 5EP1 A;  2C5R A;  2M60 A;  1XNQ M;  3VLF B;  4M0W A;  4KLN A;  3HX3 A;  1T6O A;  1WGL A;  2WSF F;  1P3Q Q;  2EUC A;  1MX0 A;  2L6O A;  2P5T A;  3KOX E;  4Q7J A;  4YY3 M;  2CV0 A;  5IT9 S;  3PXG A;  1C1K A;  1L8Q A;  2MRO B;  3W67 A;  3U5Z B;  1IN6 A;  2BNK A;  2JWS A;  1IY1 A;  4X65 M;  1QDR A;  3AV0 A;  4DV5 M;  2LXE A;  4GIP A;  2UXC M;  1QAM A;  2R46 A;  1WHC A;  2D7H A;  4BLC A;  4JI4 M;  4DV4 M;  2FE8 A;  3VKG A;  2WZJ A;  1GJS A;  1J7K A;  3FKE A;  1IXZ A;  2DZL A;  2CHQ A;  1PJI A;  1PJT A;  3C3D A;  1FNN A;  3B7Q A;  2OPF A;  4G6Z A;  4GKJ M;  2V6Z M;  2KHH A;  4NSO B;  2L4E A;  3FE3 A;  2VF7 A;  3HHW A;  1TDZ A;  3BBZ A;  2KNZ A;  3GRU A;  2XH9 A;  2LH0 A;  4M9X A;  3T38 A;  3U5Z A;  3KSJ A;  2KA6 B;  4NRV A;  1Q3B A;  3GLH A;  5IZ7 D;  4B3M M;  3RFW A;  2YR0 A;  1TTE A;  4B7G A;  2F5P A;  4DR4 M;  2DKL A;  3GRY A;  3LQQ A;  4BB9 A;  2KDL A;  3W0F A;  2F5N A;  4LJ4 A;  3U6M A;  3FTF A;  1IM2 A;  2C99 A;  3M6A A;  1AIP C;  4LY6 A;  3GLG A;  3I04 M;  1L1T A;  3SMS A;  1VQ1 A;  1X37 A;  5JI3 E;  4M9Z A;  3BOS A;  4NOO B;  2JY8 A;  3VK7 A;  4KHP M;  3D8B A;  3FUX A;  5FTL A;  2JY5 A;  3GPU A;  5BPV A;  2QZ4 A;  1YE9 A;  4JI2 M;  2RGO A;  4GC5 A;  4PCZ A;  2DZO B;  4LF7 M;  3T1Y M;  4FD2 A;  4EIW A;  3B74 A;  1D0M A;  3NBX X;  1E9R A;  4LJ7 A;  4RKU F;  2JY7 A;  3TWL A;  3W68 A;  1XXH A;  4DV1 M;  2QNJ A;  3HHX A;  1R4G A;  2FOI C;  2OOA A;  3SAU A;  3KFU G;  3KS8 A;  4JV5 M;  5E6J A;  3SYL A;  4DR3 M;  4LZJ A;  2R45 A;  3LMM A;  5EP2 A;  4AKG A;  3W0L B;  2Q2E B;  1NV9 A;  3QWL A;  5EXT A;  1NHG C;  3K92 A;  2D7E A;  3RE8 A;  1NNJ A;  1IXR C;  1HJP A;  3L29 A;  1HQY E;  4GH9 A;  5ITQ A;  4DR1 M;  1FJG M;  1DGG A;  3QAU A;  4REZ A;  2CV1 A;  4DUZ M;  4PD2 A;  4LJ5 A;  2F4V M;  1OFI A;  4G4Q A;  4GRI A;  3GP1 A;  4D81 A;  1IY2 A;  3SAT A;  3K8Z A;  2CUZ A;  2HCB A;  1IN5 A;  2JZ1 A;  1E9S A;  1WGN A;  1QDT A;  2D7G A;  2G5G X;  4DR7 M;  1PJS A;  1GVN A;  3AOE A;  4F2L A;  2UU9 M;  1SXJ C;  1R5L A;  2LTU A;  4S12 A;  1YSY A;  3KOY E;  3I4V A;  5FTK A;  5EP4 A;  2LVN C;  1EE8 A;  1DO2 A;  4PDG A;  1HQC A;  4XK8 F;  3GPY A;  1QQW A;  4FCV A;  2CEA A;  5C18 A;  5DNY A;  1QUT A;  3E9S A;  4LCB A;  3J27 B;  4JI3 M;  3B7N A;  3Q8X A;  1T43 A;  1VDD A;  4MGH A;  3I01 M;  4HL4 A;  3PVS A;  1EIJ A;  1W5S A;  1ZMV A;  2RRU A;  4DR5 M;  3L26 A;  1I94 M;  3U6S A;  3THG A;  2L7H A;  3K1J A;  2G8L A;  2Y21 A;  3IG8 A;  2CRU A;  2O5R A;  3KOZ E;  1OIP A;  3V76 A;  2ZTC A;  4G4N A;  3HKP A;  1IBM M;  4I5S A;  1T3T A;  3RGP A;  3TL4 X;  2DEN A;  3ZC7 B;  5BR8 M;  2B3T A;  2EKK A;  2VII A;  1JB0 F;  4IBK A;  1Z6T A;  3TPZ A;  3NWL A;  3AKZ A;  4L8R C;  2V1U A;  2LVA A;  1WXQ A;  4GHL A;  2MH8 A;  2LVP C;  1Z5A A;  1XWI A;  3MHV C;  5KPR A;  5JI2 E;  1JR3 D;  2UUC M;  3ZCB B;  2WSC F;  1NSF A;  1XMQ M;  3FUW A;  5L8R F;  3HU2 A;  2ZTD A;  3KP0 E;  3J81 S;  4RNA A;  1CUK A;  7CAT A;  1VEK A;  4HEO A;  1OAO C;  2JY6 B;  2CWB A;  4D82 A;  2DWM A;  4MGI E;  3U6E A;  2KEB A;  5EXS A;  1GO5 A;  2DWZ B;  2ZAN A;  5ITR A;  3LCU A;  2JNH A;  4LRS A;  3TWM A;  1XMO M;  3IG5 A;  4JYA M;  3OTO M;  4B3T M;  3FUU A;  1Q3C A;  1NJF A;  2XZU A;  2Y0Q A;  3DA1 A;  4KO8 A;  4G4O A;  3M7G A;  2LHC A;  2Z4R A;  1HT2 E;  3A46 A;  4MGY E;  4B7F A;  4UN2 B;  4JI5 M;  3PFI A;  2QCU A;  3U6P A;  1MN3 A;  4R3D A;  4K0K M;  4JI0 M;  2G3Q A;  2K47 A;  2YQZ A;  4A3V B;  2GNO A;  1MJG M;  4IIW A;  4QHT A;  4WUR A;  1VG5 A;  5IWA M;  2LWX A;  1K82 A;  1R7R A;  2ZBK B;  5ITU A;  4IBB A;  2C9O A;  3FRH A;  2XFT A;  4B7H A;  4LF4 M;  1HNW M;  3ZQJ A;  4MM3 B;  2FH0 A;  2Z4S A;  1ZMW A;  2I7N A;  2QSF X;  4DV0 M;  2DNA A;  2KW0 A;  4AKI A;  3FYD A;  4L6V 6;  4JI8 M;  2Y20 A;  4AG5 A;  3GPX A;  3SHG B;  3FTE A;  4ANR A;  2UXD M;  4P17 A;  1TH3 A;  3VKH A;  2JP7 A;  5GKN A;  4II7 A;  5DFL A;  2J5Y A;  1A5T A;  2JXN A;  4I81 A;  2RKO A;  2LNH C;  4JN6 A;  1PM5 A;  3GQ5 A;  1KFV A;  4BBA A;  3KS4 A;  3JR5 A;  5EXP A;  3A42 A;  2UUA M;  1Z5C A;  1OJL A;  2QBY A;  3R8F A;  3CTW B;  1NJG A;  2DZN B;  1N32 M;  3HHY A;  1QAN A;  2R0I A;  4R7G A;  3U61 A;  1QVR A;  1QZM A;  4AG6 A;  3Q8G A;  4L16 A;  2H5X A;  3SBJ A;  4OX9 M;  1XXH E;  1OFH A;  2HAK A;  4LFB M;  1C7Y A;  1UFZ A;  5H37 D;  5ITT A;  1YLA A;  1K3W A;  4I4L A;  1BVS A;  1ZV1 A;  4LF6 M;  2J7N A;  1NY5 A;  2VF8 A;  1TDH A;  4ITQ A;  3UJN A;  2R18 A;  5F3W A;  2HL7 A;  1OQY A;  1ZQ9 A;  1TR8 A;  3VDU A;  2I7P A;  2DVW B;  3CF2 A;  3AJI B;  4DV3 M;  3DFZ A;  4CJ6 A;  3BXW A;  2QHO B;  5EQT A;  1XB2 B;  4X62 M;  4JI1 M;  2R44 A;  1GAB A;  2EA0 A;  2XFS A;  3ZH9 B;  4MGK E;  2VQF M;  3U60 A;  4G4R A;  3AOE C;  1NY6 A;  2NQ8 C;  2CE7 A;  1J5E M;  4IBC A;  3J2P B;  1L2D A;  4NL4 H;  1DV0 A;  3WHL A;  2R4J A;  4FCW A;  3U6C A;  5KQD A;  2L09 A;  4GEW A;  2X49 A;  4Z6Y A;  2O25 A;  1DGH B;  4IBI A;  2UUB M;  3NBI A;  2HHH M;  1E94 E;  1JQJ C;  4IBE A;  3WHK A;  5FTJ A;  1G41 A;  2KRU A;  2CFO A;  1N36 M;  1J09 A;  3KSX A;  4AQY M;  1GKI A;  4FWD A;  2LVO C;  2XSZ D;  3U61 B;  3FTC A;  3U6D A;  1W5T A;  1TH2 A;  3EIH A;  3HHZ A;  2M5Z A;  2E5L M;  3K9O A;  1G4A E;  3TE6 A;  1HT1 E;  4G3O A;  2DAE A;  1R2Z A;  1OAI A;  2K0B X;  1VEJ A;  2R65 A;  4CGY B;  1HNX M;  1TF0 B;  4AKH A;  1V34 A;  1YUB A;  2EO2 A;  3H4M A;  4L78 A;  2MJ5 B;  3D8L A;  4NXN M;  4AW4 A;  2QEN A;  4QOZ C;  1PGY A;  5FSW A;  3FUV A;  3PNY A;  2W82 A;  1L2C A;  4QOS A;  1QUS A;  1R6B X;  3U6L A;  3IEC A;  1RU3 A;  2C9C A;  2VQE M;  1IXS B;  3VDP A;  3VK8 A;  2UXB M;  4DR2 M;  3GLI B;  3J7B A;  4IJE A;  2RGH A;  1QYR A;  3H4J A;  1D0L A;  3HWS A;  4JI7 M;  1NVM A;  2C98 A;  4AZF A;  2CHV A;  2APL A;  4D80 A;  2R4E A;  4FVM A;  1TGU A;  2KZU A;  3LVV A;  2MGW A;  1UM8 A;  1IBL M;  3HGI A;  3LW5 F;  2ZAO A;  2OQ4 A;  3GRR A;  3L27 A;  1N75 A;  3A45 A;  3SFZ A;  1DGB A;  3KVW A;  2DAM A;  3HU3 A;  2DXI A;  3SYK A;  1XNR M;  1GL6 A;  3K2L A;  4LRT A;  4LFA M;  2FNA A;  4LF9 M;  2MR9 A;  5IRE B;  3GLI A;  2L7I A;  2EKF A;  3T6P A;  1G3I A;  2HWJ A;  2H1R A;  3MMP A;  4QNM A;  5KPT A;  1IXS A;  3EIE A;  4GMQ A;  4M9S A;  2L2D A;  4DUY M;  3L28 A;  2J7O A;  3GLH B;  3RGS A;  4Z8X A;  1OTR A;  2DHY A;  4OVZ A;  3JR4 A;  3SAR A;  1WIV A;  1SXJ A;  4IBG A;  4LZZ A;  3AL0 C;  3JAM S;  1Q02 A;  1NV8 A;  4DR6 M;  8CAT A;  3FUT A;  3T15 A;  2QBY B;  1G59 A;  5KQ8 A;  1NHW C;  1S3S A;  2A5Y B;  2N35 A;  2XEP A;  3E21 A;  2DWL A;  2CP8 A;  5LMU M;  1LV7 A;  4W5W A;  1SXJ B;  1QAQ A;  4OVZ B;  1GJT A;  2BJV A;  1L2B A;  2YNM D;  5DYI A;  1N77 A;  1IQP A;  3C3E A;  4XBO A;  2R6F A;  1GLN A;  1I4W A;  2K9D A;  4LFC M;  4LG2 A;  1IFY A;  4CIZ A;  2C96 A;  4LF5 M;  1SXJ E;  3SC3 A;  2DWN A;  1DGH A;  3FTD A;  2DI0 A;  1K3X A;  3FYC A;  3J7A S;  3U6O A;  3GLF B;  5KPZ A;  3GLG E;  1TH4 A;  4NRW A;  4AI6 A;  4MB7 A;  2JZ0 A;  2CHG A;  2ZAM A;  4LGM A;  4QNR A;  5FTM A;  4NXM M;  1N33 M;  3GO8 A;  3CGW A;  4FW9 A;  2EJS A;  1KSF X;  4X66 M;  3GQ4 A;  1DO0 A;  3HY5 A;  4IJF A;  2Y0T A;  1IN8 A;  3E46 A;  5C1B A;  4DV7 M;  2WSE F;  3DOA A;  3SMP A;  2QPA A;  3QYE A;  3B89 A;  1ORY B;  4NC6 A;  4B3R M;  4TUW A;  1ZAE A;  3M0E A;  2BJW A;  4LJ6 A;  4KT0 F;  3K9P A;  1H6U A;  4RF1 A;  5A2Q S;  3UMM A;  4DV6 M;  4CIS A;  1Z59 A;  2L4F A;  2YFQ A;  4M0D A;  3GLF A;  3U6Q A;  1LTM A;  3UZU A;  5ITX A;  1EFU B;  3T1H M;  1V92 A;  3B9P A;  2GQF A;  3KOW E;  3L2A A;  1HR0 M;  4ZPX A;  4DV2 M;  1XHB A;  2O01 F;  3C9P A;  2Z7J A;  4NSR A;  1PJJ A;  4HLQ A;  1E32 A;  2Z8Y M;  2LHG A;  2OOB A;  4FWG A;  2ERC A;  3TWK A;  3FRI A;  1IN4 A;  2KNV A;  4LGY A;  2F5O A;  2XZF A;  1WR1 B;  4MH0 E;  2XF3 A;  4GIT A;  4RF0 A;  2Z3X A;  1QAO A;  3UGJ A;  3L25 A;  1IY0 A;  2XSZ A;  2LVQ D;  2KZS A;  3HZJ A;  3HJ8 A;  3GQ3 A;  3GLF E;  1PRB A;  2KXE A;  2VDB B;  1IBK M;  2DAI A;  3F92 A;  2JA2 A;  5EP3 A;  1N78 A;  3E4R A;  3KP1 E;  1NNU C;  1GL7 A;  3J80 S;  3U60 B;  1XXH B;  4B08 A;  2FS1 A;  2F5Q A;  4GHA A;  3UK6 A;  4GKK M;  3KW6 A;  3MJ5 A;  3C58 A;  2OO9 A;  1VEG A;  4JXJ A;  2DAG A;  4LJ8 A;  2KNA A;  1Q39 A;  2BWE A;  3GRV A;  1JR3 A;  2X8A A;  4LJA A;  3IHP A;  1N34 M;  2HKJ A;  5EJC A;  4YHH M;  3AOG A;  2ZM6 M;  1WJ7 A;  1Z5B A;  4L4U A;  3GPP A;  3KDS E;  4P16 A;  3SAV A;  1OIZ A;  3LCV B;  1XC8 A;  1DGF A;  1JR3 E;  3LQR A;  3I51 A;  2AHM A;  3GLG B;  4LJ9 A;  4X64 M;  4OW0 A;  1VDL A;  2R62 A;  3GLH E;  2X4A A;  3ILK A;  3HJS A;  4DBG B;  5LMN M;  1R2Y A;  5FLX S;  4L15 A;  1PJQ A;  2FFJ A;  4FCT A;  3VFD A;  4GC9 A;  2BWB A;  2V1C A;  4PDI A;  1KYI A;  1V33 A;  4Y28 F;  3TQS A;  4R71 A;  4IBD A;  2QQ8 A;  2DHR A;  4WP2 A;  4LF8 M;  1MU5 A;  4PT5 A;  2XLJ A;  3I4Y A;  1Y8G A;  5E26 A;  2CV2 A;  3R9X B;  1D2N A;  4WW0 A;  1L1Z A;  3HJQ A;  2F5S A;  3HU1 A;  5FTN A;  4JI6 M;  4FWH A;  2JUJ A;  4I8O A;  1QZE A;  1D0K A;  1SXJ D;  5KO3 A;  1F4I A;  4OU7 A;  4B3S M;  1NO1 A;  3FD9 A;  5DYG A;  4IBF A;  3CF0 A;  2XGN A;  3GLI E;  1AUA A;  2KRK A;  4MGZ E;  4CHT B;  1G71 A;  3KXE C;  3PNV A;  1G8P A;  3B7Z A;  4XGI A;  5ITX E;  4KOD A;  3SHF A;  2K6B A;  2LBC A;  1OKS A;  3SAW A;  3LVW A;  1SG9 A;  2DAK A;  3A98 B;  3DZD A;  1ZMU A;  4IBJ A;  4F1I A;  3MK6 A;  5EXX A;  5ITY A;  4QHS A;  3CF6 E;  3QYB A;  2QP9 X;  3SAS A;  1IN7 A;  3AFH A;  1HNZ M; 
#chains in the Genus database with same CATH homology
 2ZTC A;  3K9P A;  1T6O A;  1WGL A;  1P3Q Q;  2DEN A;  2L4F A;  1DV0 A;  2B3T A;  2EKK A;  4Q7J A;  4GEW A;  2O25 A;  2MRO B;  1EFU B;  1V92 A;  2LVA A;  1E94 E;  1G41 A;  2LVP C;  5JI2 E;  1WHC A;  2LVO C;  2WZJ A;  2ZTD A;  2DZL A;  2OOB A;  1CUK A;  3K9O A;  1G4A E;  1VEK A;  1HT1 E;  4G3O A;  2DAE A;  3FRI A;  4HEO A;  2KNV A;  1OAI A;  2JY6 B;  2K0B X;  1WR1 B;  2CWB A;  1VEJ A;  2KHH A;  2L4E A;  3FE3 A;  3BBZ A;  2LVQ D;  2KNZ A;  1GO5 A;  2MJ5 B;  3LCU A;  1PGY A;  2JNH A;  3GLF E;  3IEC A;  1TTE A;  2DAI A;  3F92 A;  1HT2 E;  2DKL A;  4UN2 B;  3H4J A;  1IM2 A;  1MN3 A;  1AIP C;  2OO9 A;  2G3Q A;  1VEG A;  2DAG A;  2KNA A;  1VQ1 A;  2BWE A;  3IHP A;  2JY8 A;  1VG5 A;  2JY5 A;  2MGW A;  1WJ7 A;  1IFY A;  3FRH A;  3LCV B;  1ZMW A;  1JR3 E;  2DAM A;  2QSF X;  2DNA A;  1VDL A;  3GLH E;  4DBG B;  2JY7 A;  2MR9 A;  2QNJ A;  2EKF A;  1R4G A;  3T6P A;  1G3I A;  2OOA A;  2HWJ A;  3MMP A;  1IXS A;  2BWB A;  1KYI A;  2L2D A;  2JP7 A;  5DFL A;  4R71 A;  1A5T A;  1NV9 A;  1OTR A;  2DHY A;  1WIV A;  4WP2 A;  1Q02 A;  1HJP A;  1HQY E;  1NV8 A;  1Y8G A;  3E21 A;  2CP8 A;  2JUJ A;  2R0I A;  1QZE A;  2JZ1 A;  1F4I A;  1WGN A;  4F2L A;  2K9D A;  2H5X A;  2LTU A;  3GLI E;  1XXH E;  2HAK A;  2LVN C;  1C7Y A;  1UFZ A;  1YLA A;  1DO2 A;  2DI0 A;  1BVS A;  1ZV1 A;  3GLG E;  2LBC A;  1OKS A;  2JZ0 A;  1SG9 A;  1T43 A;  2DAK A;  1ZMU A;  4F1I A;  2EJS A;  1ZMV A;  1DO0 A;  1OQY A;  2RRU A;  1TR8 A;  3E46 A;  2QHO B;  1XB2 B;  3B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...