2DWMA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
b'MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*T)-3'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 16
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwmA01
2D7GA 2D7EA 2DWLA 2DWMA 4NL4H 2DWNA 2D7HA
chains in the Genus database with same CATH superfamily
3KS8A 1WR1B 2R44A 1WIVA 5IWAM 3GPXA 2EO2A 3SHFA 1MX0A 1IBLM 4LJ6A 3R8FA 2DHRA 3KVWA 3THGA 4B3MM 4F1IA 4II7A 1XC8A 3NWLA 2HL7A 2G8LA 2I7PA 3B9PA 3FYDA 3FTDA 3K9PA 5FTNA 4DBGB 2KNAA 5EQTA 2N35A 2YNMD 4RF1A 1XNQM 1W5TA 2EUCA 4IBFA 5FTLA 4M9ZA 3K9OA 3PXGA 5KQDA 4HL4A 3JR5A 4QHTA 2Y21A 2CV1A 1HT1E 1EIJA 4TUWA 4GC5A 3FUVA 1A5TA 1K82A 4DR1M 4Q7JA 3U6OA 2DZNB 5ITQA 5EXPA 4G3OA 3SC3A 1PM5A 1DGBA 3KDSE 4X65M 2HKJA 1HT2E 2J7NA 4YY3M 3BXWA 3M6AA 1XWIA 3HHYA 2DWMA 2DAMA 2QHOB 3DA1A 2VF7A 2XZUA 3H4JA 2DZOB 1GABA 2P5TA 3C58A 3KOZE 1LTMA 5ITUA 2NQ8C 4WP2A 1Z5CA 1OAIA 2QZ4A 3K8ZA 4WURA 3U61A 2DWNA 1OQYA 2QSFX 4JI4M 4ITQA 2DHYA 1P3QQ 2MR9A 1QAOA 4BB9A 3NBXX 2CFOA 2OPFA 4LFBM 4QOZC 2FFJA 3U6CA 1E9SA 1X37A 4QNMA 5KPZA 3L2AA 1Q02A 4DV6M 1VG5A 1IXRC 4LJ8A 1GVNA 3B7NA 3B7QA 2CRUA 4IBCA 4G6ZA 2O01F 1I4WA 1N33M 2MH8A 3C9PA 1WHCA 3LW5F 1CUKA 3AV0A 2B3TA 3WHKA 5EJCA 4L78A 2R46A 3U6MA 1KYIA 1NNJA 3C3EA 2F5PA 1OAOC 3AOGA 4NOOB 1N78A 4S12A 3U6LA 4QHSA 1L1TA 4IBBA 2OOBA 1N34M 3EIHA 1GL6A 2QBYA 3R9XB 4LJ7A 4X64M 1IN7A 1Q39A 3FKEA 1TTEA 3A98B 1OKSA 5A2QS 3W67A 3U61B 2LH0A 1J7KA 2CP8A 3TL4X 4KHPM 1DO0A 2JZ1A 1PJSA 2L09A 4FCTA 1XB2B 3U6EA 2CE7A 4LJ9A 3TE6A 4CHTB 1PJIA 1G71A 1L8QA 1TF0B 4UN2B 1J5EM 5ITRA 2QP9X 2XGNA 4JI1M 5EP2A 4MGYE 3KFUG 2LTUA 3FRHA 3DFZA 4AI6A 1E32A 3PNYA 4P17A 4LF5M 2LXEA 4IJFA 1IN6A 5DYGA 1MU5A 2VQFM 1ZAEA 3RE8A 3D8LA 3GPUA 4GIPA 2VF8A 3UZUA 1QDTA 1PJTA 4GEWA 3WHLA 4IBEA 2ERCA 4LJ4A 1OFHA 5DFLA 3U60A 1IFYA 3J27B 4DR3M 2QBYB 1NJFA 4L4UA 1JB0F 2VIIA 3QYEA 1IQPA 3CF0A 4XK8F 4CGYB 2CHQA 2BWBA 3LMMA 2CUZA 1YE9A 4DUYM 4AKHA 2WSFF 3HKPA 4XGIA 3HHZA 2R4JA 4NSRA 2QNJA 4OW0A 5ITXA 3KW6A 3NBIA 5E6JA 2CHGA 4LZJA 3UK6A 1TDZA 2R6FA 2DZLA 2KW0A 3CF2A 3V76A 3ZC7B 2XSZA 3T1HM 3B7ZA 2Z4SA 1PJQA 4LJAA 1V92A 4WW0A 4QNRA 4G4QA 1KFVA 1XXHA 3IG5A 1PRBA 1VEGA 3TWMA 2APLA 4KODA 3HU2A 1NO1A 2M5ZA 4CIZA 3PFIA 2ZM6M 1IN4A 2KNVA 5H37D 2MROB 2L7IA 1QYRA 4DR5M 4PDIA 1R4GA 1E9RA 4LF7M 1IXZA 4R7GA 3U60B 1FNNA 2LVQD 1D0KA 4FWDA 2GNOA 1YSYA 2JP7A 4L16A 3RGSA 5FSWA 3VFDA 3AJIB 3E21A 3LQQA 3HU1A 4B7GA 3FYCA 1NHGC 2UUAM 1TH2A 1QAQA 1T6OA 2LVPC 4OVZA 3GLGE 2UUBM 4M0WA 4LFAM 1TDHA 3IG8A 4DV5M 5FLXS 2XEPA 3HJQA 4GH9A 5JI2E 2F4VM 3HZJA 4R71A 7CATA 1XXHB 2ZTCA 5IZ7D 1NHWC 2H5XA 3BBZA 1T3TA 3CGWA 3LQRA 3LVWA 2JNHA 4DV7M 1ZQ9A 2JZ0A 2DNAA 1IBKM 3CF6E 4GC9A 3W68A 1HNZM 5KPRA 4LF8M 2R4EA 3BOSA 1R6BX 3FTCA 2LBCA 3EIEA 1Q3CA 2OO9A 3ZH9B 1DGGA 3KP1E 3GPYA 2DAIA 3KOXE 1L2DA 4NRVA 4NC6A 3GPPA 1L1ZA 4IBDA 4NXNM 2KNZA 4NXMM 1N77A 3GP1A 2D7EA 4X66M 4OU7A 2L4EA 2X4AA 3HU3A 3J80S 3UMMA 1FJGM 4OVZB 4YHHM 2OQ4A 3VKGA 2K9DA 3E46A 2F5OA 3FTFA 2F5NA 1W5SA 1SXJA 2BWEA 2KZSA 3SAVA 2DAKA 1TH4A 3K2LA 3K1JA 4FWHA 3UJNA 3A46A 1C7YA 2G3QA 4MGHA 2EA0A 3AFHA 5BPVA 3U6SA 2CV2A 4B08A 2R18A 2C5RA 1GL7A 2DI0A 1UFZA 3LVVA 1ORYB 3LCVB 3Q8XA 4M9SA 1IN5A 1JR3A 3LCUA 3FRIA 2RGOA 1BVSA 3ZQJA 1QDRA 3SFZA 2DAEA 1XMOM 4LZZA 1KSFX 3SMSA 2UU9M 3CTWB 1NVMA 4LGYA 4D81A 3SAUA 1MJGM 2WSCF 5L8RF 2F5SA 4LF6M 2RGHA 3A42A 3H4MA 2Y0QA 4RKUF 1HNWM 4FWGA 4FW9A 1VQ1A 4ANRA 2R65A 4JI3M 2LVAA 1H6UA 1TGUA 3DOAA 3KS4A 4NL4H 4GKJM 1ZMWA 1E94E 1S3SA 3MK6A 2UXBM 1QVRA 2K6BA 4I81A 4DV3M 2JY8A 2UXDM 3KSJA 2ZAOA 2Z8YM 3FUUA 1V33A 1EE8A 4IBGA 2XF3A 2L7HA 1G3IA 3GO8A 3SYKA 3L29A 1NV9A 4LJ5A 2OOAA 1VEJA 4G4NA 1SXJC 3SBJA 1ZV1A 2L2DA 3GRYA 4KLNA 2K47A 1NSFA 3U6DA 3W0FA 2BJWA 2VQEM 2ZTDA 1HQCA 3KOWE 3ZCBB 2RRUA 4AG5A 4KT0F 2DKLA 1NNUC 2KA6B 2EKKA 2ZBKB 1D2NA 2ZAMA 3GLHA 5KO3A 2KDLA 3VKHA 1VDDA 1IM2A 2YQZA 4I8OA 1Z5AA 1Y8GA 2GQFA 4Y28F 3DZDA 1IY1A 1RU3A 2RKOA 1I94M 5FTMA 1OIPA 2L4FA 3GLIA 2C96A 2DXIA 2JA2A 2KHHA 3TPZA 3E4RA 2QENA 1MN3A 3HY5A 5C18A 4LFCM 2G5GX 5BR8M 2XFTA 1QZEA 2Y0TA 3T6PA 1C1KA 2KEBA 2D7GA 3SYLA 3GLFA 3GQ3A 4Z6YA 5EXXA 2V1UA 1GLNA 5EP4A 1Q3BA 1QAMA 1R2YA 4CISA 4LG2A 4MH0E 2QPAA 3JAMS 1K3WA 1F4IA 3KSXA 4I5SA 1PJJA 4W5WA 1L2BA 1GJTA 2Z7JA 5F3WA 4MGZE 1GJSA 4PT5A 3HWSA 1OJLA 2LNHC 3GLHB 5DYIA 1YLAA 2E5LM 5EP1A 1DV0A 2C9OA 3TWKA 4ZPXA 2DENA 1G59A 2QCUA 1HR0M 4A3VB 3RFWA 4IBJA 4LRSA 3GLIB 1IY2A 1WGLA 2CHVA 2ZANA 3B89A 5EXTA 5LMNM 5ITTA 1QANA 3W0LB 2LHCA 4L6V6 3M7GA 1NV8A 3VK7A 3FTEA 1SG9A 1D0MA 4DV4M 3J7BA 1QUSA 1V34A 3GLFB 2BNKA 2V6ZM 3Q8GA 2V1CA 1OFIA 3GLHE 4R3DA 5EXSA 3AOEC 4JN6A 1ZMVA 3SARA 2R62A 3HHWA 3SHGB 2JY7A 4P16A 4JI2M 1Z59A 1Z5BA 4GITA 4AQYM 1DGHA 1N75A 4LCBA 3T38A 2XLJA 2C9CA 3GLIE 3L25A 2O5RA 2Z3XA 1PGYA 4FVMA 3J81S 4I4LA 2JY5A 4AG6A 5ITXE 4L8RC 3HX3A 2L6OA 2LVOC 4IIWA 4AKGA 3FE3A 1WGNA 3PNVA 4JXJA 4F2LA 1T43A 3GLFE 2R45A 3VK8A 1IBMM 1GKIA 2Y20A 4REZA 1LV7A 3PVSA 3OTOM 1XXHE 4MGKE 2XZFA 1K3XA 4FCVA 3FUWA 1L2CA 1R2ZA 4M0DA 3I51A 2FS1A 4CJ6A 2MGWA 2BJVA 4PCZA 2XFSA 3KXEC 1XNRM 2LHGA 1NY5A 2H1RA 5FTKA 2Q2EB 1QZMA 2QQ8A 1HJPA 2HHHM 3IHPA 4IBIA 2CWBA 2Z4RA 3T15A 1OIZA 3HHXA 4DR7M 3HJSA 1R7RA 4MB7A 1DGHB 3D8BA 4GRIA 5EP3A 4AKIA 3HJ8A 3FD9A 2JY6B 4G4RA 1OTRA 4B3SM 4MM3B 4JI0M 1N36M 1G41A 3KP0E 4RF0A 3MJ5A 4HEOA 2X49A 3UGJA 1TH3A 4D82A 4NSOB 5KPTA 5C1BA 1ZMUA 3L26A 2WZJA 4BBAA 3U6PA 1WXQA 3ILKA 2UXCM 1G4AE 4FD2A 2UUCM 4LY6A 5LMUM 4B3RM 3L27A 4B7HA 4DV1M 2DWLA 4LRTA 4JI5M 2LVNC 1SXJB 2I7NA 5KQ8A 4K0KM 5E26A 4JI6M 2A5YB 1N32M 4DR2M 3QWLA 2J7OA 3TQSA 1XHBA 2XSZD 3F92A 2HAKA 1AUAA 2KRKA 4AW4A 4IBKA 4D80A 1NY6A 4PDGA 3KOYE 1J09A 3E9SA 4DUZM 3FUXA 3I04M 2DWZB 2LWXA 3RGPA 1IXSA 1DGFA 4AZFA 3JR4A 4JI7M 4DR6M 1GO5A 3GRUA 1VEKA 2FE8A 1G8PA 2M60A 3K92A 3SASA 4GHLA 1VDLA 3GRVA 2W82A 3AL0C 1HQYE 5IREB 2JUJA 4DV0M 3TWLA 4G4OA 4Z8XA 2XH9A 1SXJE 1AIPC 3FUTA 2CV0A 1IN8A 1R5LA 2AHMA 3VLFB 2X8AA 3L28A 4JI8M 1NJGA 8CATA 4NRWA 3C3DA 3QYBA 4LGMA 1IY0A 2WSEF 3I4YA 3GLGA 3T1YM 1JR3E 2CEAA 1HNXM 3I01M 4MGIE 4B3TM 2EKFA 2HCBA 4DV2M 3AOEA 2FOIC 4FCWA 2J5YA 4IJEA 2MJ5B 4LF4M 4JYAM 2C99A 1D0LA 2DAGA 4RNAA 3U6QA 3B74A 2R0IA 2EJSA 2FNAA 2YR0A 3SAWA 4L15A 3MMPA 1YUBA 3U5ZA 1QQWA 1JQJC 4GKKM 2KRUA 1IXSB 3GRRA 4XBOA 4JV5M 2HWJA 3GQ5A 3SATA 4GHAA 1TR8A 5GKNA 1XMQM 4QOSA 2VDBB 4M9XA 3I4VA 1UM8A 4KO8A 2K0BX 2F5QA 1EFUB 2O25A 2KZUA 4HLQA 1Z6TA 1QUTA 4X62M 3SMPA 4PD2A 2JXNA 2KXEA 3VDUA 4B7FA 3A45A 3GLGB 4EIWA 4GMQA 2D7HA 5ITYA 1SXJD 4LF9M 4BLCA 1DO2A 3J7AS 3J2PB 4OX9M 5IT9S 3M0EA 3IECA 5FTJA 2DVWB 3MHVC 3VDPA 3AKZA 3QAUA 3GQ4A 5DNYA 2JWSA 5JI3E 1JR3D 3U5ZB 2C98A 2FH0A 2YFQA 3HGIA 1WJ7A 4DR4M
chains in the Genus database with same CATH topology
3KS8A 5IWAM 3GPXA 2EO2A 3SHFA 1MX0A 1IBLM 4LJ6A 3R8FA 2DHRA 3KVWA 3THGA 4B3MM 4II7A 1XC8A 3NWLA 2HL7A 2G8LA 2I7PA 3B9PA 3FYDA 3FTDA 5FTNA 5EQTA 1XNQM 2YNMD 4RF1A 1W5TA 2EUCA 4IBFA 5FTLA 4M9ZA 3PXGA 5KQDA 4HL4A 3JR5A 4QHTA 2Y21A 2CV1A 1HT1E 4TUWA 4GC5A 3FUVA 1K82A 4DR1M 3U6OA 2DZNB 5ITQA 5EXPA 3SC3A 1PM5A 1DGBA 3KDSE 4X65M 2HKJA 1HT2E 2J7NA 4YY3M 3M6AA 1XWIA 3HHYA 2DWMA 3DA1A 2XZUA 2DZOB 2P5TA 3C58A 3KOZE 5ITUA 2NQ8C 1Z5CA 2QZ4A 3K8ZA 3U61A 4WURA 2DWNA 4JI4M 4ITQA 4QOZC 4BB9A 1QAOA 2CFOA 2OPFA 4LFBM 2FFJA 3U6CA 1E9SA 1X37A 4QNMA 5KPZA 3L2AA 4DV6M 1IXRC 4LJ8A 1GVNA 4IBCA 4G6ZA 1I4WA 1N33M 3AV0A 3WHKA 5EJCA 4L78A 2R46A 3U6MA 1KYIA 1NNJA 2F5PA 3AOGA 4NOOB 1N78A 4S12A 3U6LA 4QHSA 1L1TA 4IBBA 1N34M 3EIHA 1GL6A 2QBYA 3R9XB 4LJ7A 4X64M 1IN7A 1Q39A 3FKEA 5A2QS 3A98B 3U61B 2LH0A 1J7KA 3TL4X 4KHPM 1DO0A 2L09A 4FCTA 3U6EA 2CE7A 4LJ9A 3TE6A 4CHTB 1PJIA 1L8QA 1J5EM 5ITRA 2QP9X 2XGNA 4JI1M 5EP2A 4MGYE 3KFUG 4AI6A 3DFZA 1E32A 3PNYA 4LF5M 2LXEA 4IJFA 1IN6A 5DYGA 1MU5A 2VQFM 1ZAEA 3RE8A 3D8LA 3GPUA 4GIPA 3UZUA 3WHLA 4IBEA 2ERCA 4LJ4A 1OFHA 3U60A 3J27B 4DR3M 2QBYB 1NJFA 4L4UA 2VIIA 1IQPA 3CF0A 4CGYB 2CHQA 3LMMA 4AKHA 2CUZA 1YE9A 4DUYM 3HKPA 4XGIA 3HHZA 2R4JA 4NSRA 4OW0A 5ITXA 3KW6A 3NBIA 5E6JA 2CHGA 4LZJA 3UK6A 1TDZA 2KW0A 3CF2A 3ZC7B 3T1HM 2XSZA 1KFVA 2Z4SA 4LJAA 4WW0A 4G4QA 4QNRA 1XXHA 3IG5A 3TWMA 4KODA 3HU2A 2M5ZA 2ZM6M 3PFIA 1IN4A 5H37D 2L7IA 1QYRA 4DR5M 4PDIA 1E9RA 4LF7M 1IXZA 4R7GA 3U60B 1FNNA 4L16A 4B3SM 4FWDA 5FSWA 1YSYA 3RGSA 3VFDA 3AJIB 4B7GA 3LQQA 3HU1A 3FYCA 1NHGC 2UUAM 1TH2A 1QAQA 4OVZA 2UUBM 4M0WA 4LFAM 1TDHA 3IG8A 4DV5M 5FLXS 2XEPA 3HJQA 4GH9A 5JI2E 2F4VM 7CATA 1XXHB 5IZ7D 1NHWC 4DV7M 3LQRA 1T3TA 3LVWA 1ZQ9A 1IBKM 3CF6E 4GC9A 1HNZM 5KPRA 4LF8M 2R4EA 3BOSA 1R6BX 3FTCA 3EIEA 1Q3CA 3ZH9B 1DGGA 3KP1E 3GPYA 1L2DA 3KOXE 4NRVA 3GPPA 1L1ZA 4IBDA 4NXNM 4NXMM 1N77A 3GP1A 2D7EA 4X66M 4OU7A 2X4AA 3HU3A 3J80S 3UMMA 1FJGM 4OVZB 4YHHM 2OQ4A 3VKGA 2F5OA 3FTFA 2F5NA 1W5SA 1SXJA 2KZSA 3SAVA 3UJNA 1TH4A 3K2LA 3K1JA 4FWHA 3A46A 4MGHA 2EA0A 3U6SA 3AFHA 5BPVA 2CV2A 4B08A 2R18A 2C5RA 1GL7A 3LVVA 1ORYB 3Q8XA 4M9SA 1IN5A 1JR3A 2RGOA 3SFZA 1XMOM 4LZZA 1KSFX 3SMSA 2UU9M 3CTWB 1NVMA 4LGYA 4D81A 3SAUA 2F5SA 4LF6M 2RGHA 3A42A 3H4MA 2Y0QA 1HNWM 4FWGA 4FW9A 2R65A 4JI3M 1H6UA 1TGUA 3DOAA 3KS4A 4NL4H 4GKJM 1E94E 1S3SA 3MK6A 2UXBM 1QVRA 4I81A 4DV3M 2UXDM 3KSJA 2ZAOA 3FUUA 1EE8A 4IBGA 2XF3A 2L7HA 1G3IA 3GO8A 3SYKA 3L29A 4LJ5A 4G4NA 1SXJC 3SBJA 3GRYA 4KLNA 2K47A 1NSFA 3U6DA 3W0FA 2BJWA 2VQEM 3KOWE 1HQCA 3ZCBB 4AG5A 1NNUC 2KA6B 2ZBKB 1D2NA 2ZAMA 3GLHA 5KO3A 3VKHA 1VDDA 1IM2A 2YQZA 4I8OA 1Z5AA 3DZDA 1IY1A 2RKOA 1I94M 5FTMA 3GLIA 2C96A 2DXIA 2JA2A 3TPZA 3E4RA 2QENA 5C18A 4LFCM 2G5GX 5BR8M 2XFTA 2Y0TA 1C1KA 2KEBA 2D7GA 3SYLA 3GLFA 3GQ3A 4Z6YA 5EXXA 2V1UA 1GLNA 5EP4A 1Q3BA 1QAMA 1R2YA 4CISA 4LG2A 4MH0E 2QPAA 3JAMS 1K3WA 3KSXA 4I5SA 1PJJA 4W5WA 1L2BA 2Z7JA 5F3WA 4MGZE 4PT5A 3HWSA 1OJLA 2LNHC 3GLHB 5DYIA 2E5LM 5EP1A 2C9OA 3TWKA 4ZPXA 1G59A 2QCUA 1HR0M 4A3VB 3RFWA 4IBJA 4LRSA 3GLIB 1IY2A 2CHVA 5EXTA 2ZANA 5LMNM 5ITTA 1QANA 3W0LB 3M7GA 3VK7A 3FTEA 4DV4M 3J7BA 3GLFB 2BNKA 2V6ZM 2V1CA 1OFIA 4R3DA 5EXSA 3AOEC 4JN6A 3SARA 2R62A 3HHWA 3SHGB 4P16A 4JI2M 1Z59A 1Z5BA 4GITA 4AQYM 1DGHA 1N75A 4LCBA 3T38A 2XLJA 2C9CA 3L25A 2O5RA 2Z3XA 4FVMA 3J81S 4I4LA 4AG6A 5ITXE 4L8RC 2L6OA 4IIWA 4AKGA 3PNVA 4JXJA 2R45A 3VK8A 1IBMM 1GKIA 2Y20A 4REZA 1LV7A 3PVSA 3OTOM 2XZFA 4MGKE 1K3XA 4FCVA 3FUWA 1L2CA 1R2ZA 4M0DA 3I51A 2BJVA 4PCZA 2XFSA 3KXEC 1XNRM 1NY5A 2H1RA 5FTKA 2Q2EB 1QZMA 2HHHM 4IBIA 2Z4RA 3T15A 3HHXA 4DR7M 3HJSA 1R7RA 4MB7A 1DGHB 3D8BA 4GRIA 5EP3A 4AKIA 3HJ8A 3FD9A 4G4RA 4MM3B 4JI0M 1N36M 1G41A 3KP0E 4RF0A 3MJ5A 2X49A 3UGJA 1TH3A 4D82A 4NSOB 5KPTA 5C1BA 3L26A 4BBAA 3U6PA 1WXQA 3ILKA 2UXCM 1G4AE 4FD2A 2UUCM 4LY6A 5LMUM 4B3RM 3L27A 4B7HA 4DV1M 2DWLA 4LRTA 4JI5M 1SXJB 2I7NA 5KQ8A 4K0KM 5E26A 4JI6M 2A5YB 1N32M 4DR2M 3QWLA 2J7OA 3TQSA 1XHBA 2XSZD 2KRKA 4AW4A 4IBKA 4D80A 1NY6A 4PDGA 3KOYE 1J09A 3E9SA 4DUZM 3FUXA 2DWZB 2LWXA 3RGPA 4AZFA 1DGFA 3JR4A 4JI7M 4DR6M 3GRUA 2FE8A 1G8PA 2M60A 3K92A 3SASA 4GHLA 3GRVA 2W82A 3AL0C 1HQYE 5IREB 4DV0M 3TWLA 4G4OA 4Z8XA 2XH9A 1SXJE 3FUTA 2CV0A 1IN8A 2AHMA 3VLFB 2X8AA 3L28A 4JI8M 1NJGA 8CATA 4NRWA 4LGMA 1IY0A 3T1YM 3I4YA 3GLGA 2CEAA 1HNXM 4MGIE 4B3TM 2HCBA 4DV2M 3AOEA 2FOIC 4FCWA 4IJEA 4JYAM 4LF4M 2C99A 3U6QA 4RNAA 2FNAA 2YR0A 3SAWA 4L15A 3U5ZA 1YUBA 1QQWA 1JQJC 4GKKM 2KRUA 1IXSB 3GRRA 4XBOA 4JV5M 3GQ5A 3SATA 4GHAA 5GKNA 1XMQM 4QOSA 4M9XA 3I4VA 1UM8A 4KO8A 2F5QA 2KZUA 4HLQA 1Z6TA 4X62M 3SMPA 4PD2A 2KXEA 3VDUA 4B7FA 3A45A 3GLGB 4EIWA 4GMQA 2D7HA 5ITYA 1SXJD 4LF9M 4BLCA 1DO2A 3J7AS 3J2PB 4OX9M 5IT9S 3M0EA 5FTJA 2DVWB 3MHVC 3VDPA 3AKZA 3QAUA 3GQ4A 5DNYA 5JI3E 1JR3D 3U5ZB 2C98A 2YFQA 3HGIA 4DR4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7G A;  2D7E A;  2DWL A;  2DWM A;  4NL4 H;  2DWN A;  2D7H A; 
#chains in the Genus database with same CATH topology
 3KS8 A;  1WR1 B;  2R44 A;  1WIV A;  5IWA M;  3GPX A;  2EO2 A;  3SHF A;  1MX0 A;  1IBL M;  4LJ6 A;  3R8F A;  2DHR A;  3KVW A;  3THG A;  4B3M M;  4F1I A;  4II7 A;  1XC8 A;  3NWL A;  2HL7 A;  2G8L A;  2I7P A;  3B9P A;  3FYD A;  3FTD A;  3K9P A;  5FTN A;  4DBG B;  2KNA A;  5EQT A;  2N35 A;  2YNM D;  4RF1 A;  1XNQ M;  1W5T A;  2EUC A;  4IBF A;  5FTL A;  4M9Z A;  3K9O A;  3PXG A;  5KQD A;  4HL4 A;  3JR5 A;  4QHT A;  2Y21 A;  2CV1 A;  1HT1 E;  1EIJ A;  4TUW A;  4GC5 A;  3FUV A;  1A5T A;  1K82 A;  4DR1 M;  4Q7J A;  3U6O A;  2DZN B;  5ITQ A;  5EXP A;  4G3O A;  3SC3 A;  1PM5 A;  1DGB A;  3KDS E;  4X65 M;  2HKJ A;  1HT2 E;  2J7N A;  4YY3 M;  3BXW A;  3M6A A;  1XWI A;  3HHY A;  2DWM A;  2DAM A;  2QHO B;  3DA1 A;  2VF7 A;  2XZU A;  3H4J A;  2DZO B;  1GAB A;  2P5T A;  3C58 A;  3KOZ E;  1LTM A;  5ITU A;  2NQ8 C;  4WP2 A;  1Z5C A;  1OAI A;  2QZ4 A;  3K8Z A;  4WUR A;  3U61 A;  2DWN A;  1OQY A;  2QSF X;  4JI4 M;  4ITQ A;  2DHY A;  1P3Q Q;  2MR9 A;  1QAO A;  4BB9 A;  3NBX X;  2CFO A;  2OPF A;  4LFB M;  4QOZ C;  2FFJ A;  3U6C A;  1E9S A;  1X37 A;  4QNM A;  5KPZ A;  3L2A A;  1Q02 A;  4DV6 M;  1VG5 A;  1IXR C;  4LJ8 A;  1GVN A;  3B7N A;  3B7Q A;  2CRU A;  4IBC A;  4G6Z A;  2O01 F;  1I4W A;  1N33 M;  2MH8 A;  3C9P A;  1WHC A;  3LW5 F;  1CUK A;  3AV0 A;  2B3T A;  3WHK A;  5EJC A;  4L78 A;  2R46 A;  3U6M A;  1KYI A;  1NNJ A;  3C3E A;  2F5P A;  1OAO C;  3AOG A;  4NOO B;  1N78 A;  4S12 A;  3U6L A;  4QHS A;  1L1T A;  4IBB A;  2OOB A;  1N34 M;  3EIH A;  1GL6 A;  2QBY A;  3R9X B;  4LJ7 A;  4X64 M;  1IN7 A;  1Q39 A;  3FKE A;  1TTE A;  3A98 B;  1OKS A;  5A2Q S;  3W67 A;  3U61 B;  2LH0 A;  1J7K A;  2CP8 A;  3TL4 X;  4KHP M;  1DO0 A;  2JZ1 A;  1PJS A;  2L09 A;  4FCT A;  1XB2 B;  3U6E A;  2CE7 A;  4LJ9 A;  3TE6 A;  4CHT B;  1PJI A;  1G71 A;  1L8Q A;  1TF0 B;  4UN2 B;  1J5E M;  5ITR A;  2QP9 X;  2XGN A;  4JI1 M;  5EP2 A;  4MGY E;  3KFU G;  2LTU A;  3FRH A;  3DFZ A;  4AI6 A;  1E32 A;  3PNY A;  4P17 A;  4LF5 M;  2LXE A;  4IJF A;  1IN6 A;  5DYG A;  1MU5 A;  2VQF M;  1ZAE A;  3RE8 A;  3D8L A;  3GPU A;  4GIP A;  2VF8 A;  3UZU A;  1QDT A;  1PJT A;  4GEW A;  3WHL A;  4IBE A;  2ERC A;  4LJ4 A;  1OFH A;  5DFL A;  3U60 A;  1IFY A;  3J27 B;  4DR3 M;  2QBY B;  1NJF A;  4L4U A;  1JB0 F;  2VII A;  3QYE A;  1IQP A;  3CF0 A;  4XK8 F;  4CGY B;  2CHQ A;  2BWB A;  3LMM A;  2CUZ A;  1YE9 A;  4DUY M;  4AKH A;  2WSF F;  3HKP A;  4XGI A;  3HHZ A;  2R4J A;  4NSR A;  2QNJ A;  4OW0 A;  5ITX A;  3KW6 A;  3NBI A;  5E6J A;  2CHG A;  4LZJ A;  3UK6 A;  1TDZ A;  2R6F A;  2DZL A;  2KW0 A;  3CF2 A;  3V76 A;  3ZC7 B;  2XSZ A;  3T1H M;  3B7Z A;  2Z4S A;  1PJQ A;  4LJA A;  1V92 A;  4WW0 A;  4QNR A;  4G4Q A;  1KFV A;  1XXH A;  3IG5 A;  1PRB A;  1VEG A;  3TWM A;  2APL A;  4KOD A;  3HU2 A;  1NO1 A;  2M5Z A;  4CIZ A;  3PFI A;  2ZM6 M;  1IN4 A;  2KNV A;  5H37 D;  2MRO B;  2L7I A;  1QYR A;  4DR5 M;  4PDI A;  1R4G A;  1E9R A;  4LF7 M;  1IXZ A;  4R7G A;  3U60 B;  1FNN A;  2LVQ D;  1D0K A;  4FWD A;  2GNO A;  1YSY A;  2JP7 A;  4L16 A;  3RGS A;  5FSW A;  3VFD A;  3AJI B;  3E21 A;  3LQQ A;  3HU1 A;  4B7G A;  3FYC A;  1NHG C;  2UUA M;  1TH2 A;  1QAQ A;  1T6O A;  2LVP C;  4OVZ A;  3GLG E;  2UUB M;  4M0W A;  4LFA M;  1TDH A;  3IG8 A;  4DV5 M;  5FLX S;  2XEP A;  3HJQ A;  4GH9 A;  5JI2 E;  2F4V M;  3HZJ A;  4R71 A;  7CAT A;  1XXH B;  2ZTC A;  5IZ7 D;  1NHW C;  2H5X A;  3BBZ A;  1T3T A;  3CGW A;  3LQR A;  3LVW A;  2JNH A;  4DV7 M;  1ZQ9 A;  2JZ0 A;  2DNA A;  1IBK M;  3CF6 E;  4GC9 A;  3W68 A;  1HNZ M;  5KPR A;  4LF8 M;  2R4E A;  3BOS A;  1R6B X;  3FTC A;  2LBC A;  3EIE A;  1Q3C A;  2OO9 A;  3ZH9 B;  1DGG A;  3KP1 E;  3GPY A;  2DAI A;  3KOX E;  1L2D A;  4NRV A;  4NC6 A;  3GPP A;  1L1Z A;  4IBD A;  4NXN M;  2KNZ A;  4NXM M;  1N77 A;  3GP1 A;  2D7E A;  4X66 M;  4OU7 A;  2L4E A;  2X4A A;  3HU3 A;  3J80 S;  3UMM A;  1FJG M;  4OVZ B;  4YHH M;  2OQ4 A;  3VKG A;  2K9D A;  3E46 A;  2F5O A;  3FTF A;  2F5N A;  1W5S A;  1SXJ A;  2BWE A;  2KZS A;  3SAV A;  2DAK A;  1TH4 A;  3K2L A;  3K1J A;  4FWH A;  3UJN A;  3A46 A;  1C7Y A;  2G3Q A;  4MGH A;  2EA0 A;  3AFH A;  5BPV A;  3U6S A;  2CV2 A;  4B08 A;  2R18 A;  2C5R A;  1GL7 A;  2DI0 A;  1UFZ A;  3LVV A;  1ORY B;  3LCV B;  3Q8X A;  4M9S A;  1IN5 A;  1JR3 A;  3LCU A;  3FRI A;  2RGO A;  1BVS A;  3ZQJ A;  1QDR A;  3SFZ A;  2DAE A;  1XMO M;  4LZZ A;  1KSF X;  3SMS A;  2UU9 M;  3CTW B;  1NVM A;  4LGY A;  4D81 A;  3SAU A;  1MJG M;  2WSC F;  5L8R F;  2F5S A;  4LF6 M;  2RGH A;  3A42 A;  3H4M A;  2Y0Q A;  4RKU F;  1HNW M;  4FWG A;  4FW9 A;  1VQ1 A;  4ANR A;  2R65 A;  4JI3 M;  2LVA A;  1H6U A;  1TGU A;  3DOA A;  3KS4 A;  4NL4 H;  4GKJ M;  1ZMW A;  1E94 E;  1S3S A;  3MK6 A;  2UXB M;  1QVR A;  2K6B A;  4I81 A;  4DV3 M;  2JY8 A;  2UXD M;  3KSJ A;  2ZAO A;  2Z8Y M;  3FUU A;  1V33 A;  1EE8 A;  4IBG A;  2XF3 A;  2L7H A;  1G3I A;  3GO8 A;  3SYK A;  3L29 A;  1NV9 A;  4LJ5 A;  2OOA A;  1VEJ A;  4G4N A;  1SXJ C;  3SBJ A;  1ZV1 A;  2L2D A;  3GRY A;  4KLN A;  2K47 A;  1NSF A;  3U6D A;  3W0F A;  2BJW A;  2VQE M;  2ZTD A;  1HQC A;  3KOW E;  3ZCB B;  2RRU A;  4AG5 A;  4KT0 F;  2DKL A;  1NNU C;  2KA6 B;  2EKK A;  2ZBK B;  1D2N A;  2ZAM A;  3GLH A;  5KO3 A;  2KDL A;  3VKH A;  1VDD A;  1IM2 A;  2YQZ A;  4I8O A;  1Z5A A;  1Y8G A;  2GQF A;  4Y28 F;  3DZD A;  1IY1 A;  1RU3 A;  2RKO A;  1I94 M;  5FTM A;  1OIP A;  2L4F A;  3GLI A;  2C96 A;  2DXI A;  2JA2 A;  2KHH A;  3TPZ A;  3E4R A;  2QEN A;  1MN3 A;  3HY5 A;  5C18 A;  4LFC M;  2G5G X;  5BR8 M;  2XFT A;  1QZE A;  2Y0T A;  3T6P A;  1C1K A;  2KEB A;  2D7G A;  3SYL A;  3GLF A;  3GQ3 A;  4Z6Y A;  5EXX A;  2V1U A;  1GLN A;  5EP4 A;  1Q3B A;  1QAM A;  1R2Y A;  4CIS A;  4LG2 A;  4MH0 E;  2QPA A;  3JAM S;  1K3W A;  1F4I A;  3KSX A;  4I5S A;  1PJJ A;  4W5W A;  1L2B A;  1GJT A;  2Z7J A;  5F3W A;  4MGZ E;  1GJS A;  4PT5 A;  3HWS A;  1OJL A;  2LNH C;  3GLH B;  5DYI A;  1YLA A;  2E5L M;  5EP1 A;  1DV0 A;  2C9O A;  3TWK A;  4ZPX A;  2DEN A;  1G59 A;  2QCU A;  1HR0 M;  4A3V B;  3RFW A;  4IBJ A;  4LRS A;  3GLI B;  1IY2 A;  1WGL A;  2CHV A;  2ZAN A;  3B89 A;  5EXT A;  5LMN M;  5ITT A;  1QAN A;  3W0L B;  2LHC A;  4L6V 6;  3M7G A;  1NV8 A;  3VK7 A;  3FTE A;  1SG9 A;  1D0M A;  4DV4 M;  3J7B A;  1QUS A;  1V34 A;  3GLF B;  2BNK A;  2V6Z M;  3Q8G A;  2V1C A;  1OFI A;  3GLH E;  4R3D A;  5EXS A;  3AOE C;  4JN6 A;  1ZMV A;  3SAR A;  2R62 A;  3HHW A;  3SHG B;  2JY7 A;  4P16 A;  4JI2 M;  1Z59 A;  1Z5B A;  4GIT A;  4AQY M;  1DGH A;  1N75 A;  4LCB A;  3T38 A;  2XLJ A;  2C9C A;  3GLI E;  3L25 A;  2O5R A;  2Z3X A;  1PGY A;  4FVM A;  3J81 S;  4I4L A;  2JY5 A;  4AG6 A;  5ITX E;  4L8R C;  3HX3 A;  2L6O A;  2LVO C;  4IIW A;  4AKG A;  3FE3 A;  1WGN A;  3PNV A;  4JXJ A;  4F2L A;  1T43 A;  3GLF E;  2R45 A;  3VK8 A;  1IBM M;  1GKI A;  2Y20 A;  4REZ A;  1LV7 A;  3PVS A;  3OTO M;  1XXH E;  4MGK E;  2XZF A;  1K3X A;  4FCV A;  3FUW A;  1L2C A;  1R2Z A;  4M0D A;  3I51 A;  2FS1 A;  4CJ6 A;  2MGW A;  2BJV A;  4PCZ A;  2XFS A;  3KXE C;  1XNR M;  2LHG A;  1NY5 A;  2H1R A;  5FTK A;  2Q2E B;  1QZM A;  2QQ8 A;  1HJP A;  2HHH M;  3IHP A;  4IBI A;  2CWB A;  2Z4R A;  3T15 A;  1OIZ A;  3HHX A;  4DR7 M;  3HJS A;  1R7R A;  4MB7 A;  1DGH B;  3D8B A;  4GRI A;  5EP3 A;  4AKI A;  3HJ8 A;  3FD9 A;  2JY6 B;  4G4R A;  1OTR A;  4B3S M;  4MM3 B;  4JI0 M;  1N36 M;  1G41 A;  3KP0 E;  4RF0 A;  3MJ5 A;  4HEO A;  2X49 A;  3UGJ A;  1TH3 A;  4D82 A;  4NSO B;  5KPT A;  5C1B A;  1ZMU A;  3L26 A;  2WZJ A;  4BBA A;  3U6P A;  1WXQ A;  3ILK A;  2UXC M;  1G4A E;  4FD2 A;  2UUC M;  4LY6 A;  5LMU M;  4B3R M;  3L27 A;  4B7H A;  4DV1 M;  2DWL A;  4LRT A;  4JI5 M;  2LVN C;  1SXJ B;  2I7N A;  5KQ8 A;  4K0K M;  5E26 A;  4JI6 M;  2A5Y B;  1N32 M;  4DR2 M;  3QWL A;  2J7O A;  3TQS A;  1XHB A;  2XSZ D;  3F92 A;  2HAK A;  1AUA A;  2KRK A;  4AW4 A;  4IBK A;  4D80 A;  1NY6 A;  4PDG A;  3KOY E;  1J09 A;  3E9S A;  4DUZ M;  3FUX A;  3I04 M;  2DWZ B;  2LWX A;  3RGP A;  1IXS A;  1DGF A;  4AZF A;  3JR4 A;  4JI7 M;  4DR6 M;  1GO5 A;  3GRU A;  1VEK A;  2FE8 A;  1G8P A;  2M60 A;  3K92 A;  3SAS A;  4GHL A;  1VDL A;  3GRV A;  2W82 A;  3AL0 C;  1HQY E;  5IRE B;  2JUJ A;  4DV0 M;  3TWL A;  4G4O A;  4Z8X A;  2XH9 A;  1SXJ E;  1AIP C;  3FUT A;  2CV0 A;  1IN8 A;  1R5L A;  2AHM A;  3VLF B;  2X8A A;  3L28 A;  4JI8 M;  1NJG A;  8CAT A;  4NRW A;  3C3D A;  3QYB A;  4LGM A;  1IY0 A;  2WSE F;  3I4Y A;  3GLG A;  3T1Y M;  1JR3 E;  2CEA A;  1HNX M;  3I01 M;  4MGI E;  4B3T M;  2EKF A;  2HCB A;  4DV2 M;  3AOE A;  2FOI C;  4FCW A;  2J5Y A;  4IJE A;  2MJ5 B;  4LF4 M;  4JYA M;  2C99 A;  1D0L A;  2DAG A;  4RNA A;  3U6Q A;  3B74 A;  2R0I A;  2EJS A;  2FNA A;  2YR0 A;  3SAW A;  4L15 A;  3MMP A;  1YUB A;  3U5Z A;  1QQW A;  1JQJ C;  4GKK M;  2KRU A;  1IXS B;  3GRR A;  4XBO A;  4JV5 M;  2HWJ A;  3GQ5 A;  3SAT A;  4GHA A;  1TR8 A;  5GKN A;  1XMQ M;  4QOS A;  2VDB B;  4M9X A;  3I4V A;  1UM8 A;  4KO8 A;  2K0B X;  2F5Q A;  1EFU B;  2O25 A;  2KZU A;  4HLQ A;  1Z6T A;  1QUT A;  4X62 M;  3SMP A;  4PD2 A;  2JXN A;  2KXE A;  3VDU A;  4B7F A;  3A45 A;  3GLG B;  4EIW A;  4GMQ A;  2D7H A;  5ITY A;  1SXJ D;  4LF9 M;  4BLC A;  1DO2 A;  3J7A S;  3J2P B;  4OX9 M;  5IT9 S;  3M0E A;  3IEC A;  5FTJ A;  2DVW B;  3MHV C;  3VDP A;  3AKZ A;  3QAU A;  3GQ4 A;  5DNY A;  2JWS A;  5JI3 E;  1JR3 D;  3U5Z B;  2C98 A;  2FH0 A;  2YFQ A;  3HGI A;  1WJ7 A;  4DR4 M; 
#chains in the Genus database with same CATH homology
 3KS8 A;  5IWA M;  3GPX A;  2EO2 A;  3SHF A;  1MX0 A;  1IBL M;  4LJ6 A;  3R8F A;  2DHR A;  3KVW A;  3THG A;  4B3M M;  4II7 A;  1XC8 A;  3NWL A;  2HL7 A;  2G8L A;  2I7P A;  3B9P A;  3FYD A;  3FTD A;  5FTN A;  5EQT A;  1XNQ M;  2YNM D;  4RF1 A;  1W5T A;  2EUC A;  4IBF A;  5FTL A;  4M9Z A;  3PXG A;  5KQD A;  4HL4 A;  3JR5 A;  4QHT A;  2Y21 A;  2CV1 A;  1HT1 E;  4TUW A;  4GC5 A;  3FUV A;  1K82 A;  4DR1 M;  3U6O A;  2DZN B;  5ITQ A;  5EXP A;  3SC3 A;  1PM5 A;  1DGB A;  3KDS E;  4X65 M;  2HKJ A;  1HT2 E;  2J7N A;  4YY3 M;  3M6A A;  1XWI A;  3HHY A;  2DWM A;  3DA1 A;  2XZU A;  2DZO B;  2P5T A;  3C58 A;  3KOZ E;  5ITU A;  2NQ8 C;  1Z5C A;  2QZ4 A;  3K8Z A;  3U61 A;  4WUR A;  2DWN A;  4JI4 M;  4ITQ A;  4QOZ C;  4BB9 A;  1QAO A;  2CFO A;  2OPF A;  4LFB M;  2FFJ A;  3U6C A;  1E9S A;  1X37 A;  4QNM A;  5KPZ A;  3L2A A;  4DV6 M;  1IXR C;  4LJ8 A;  1GVN A;  4IBC A;  4G6Z A;  1I4W A;  1N33 M;  3AV0 A;  3WHK A;  5EJC A;  4L78 A;  2R46 A;  3U6M A;  1KYI A;  1NNJ A;  2F5P A;  3AOG A;  4NOO B;  1N78 A;  4S12 A;  3U6L A;  4QHS A;  1L1T A;  4IBB A;  1N34 M;  3EIH A;  1GL6 A;  2QBY A;  3R9X B;  4LJ7 A;  4X64 M;  1IN7 A;  1Q39 A;  3FKE A;  5A2Q S;  3A98 B;  3U61 B;  2LH0 A;  1J7K A;  3TL4 X;  4KHP M;  1DO0 A;  2L09 A;  4FCT A;  3U6E A;  2CE7 A;  4LJ9 A;  3TE6 A;  4CHT B;  1PJI A;  1L8Q A;  1J5E M;  5ITR A;  2QP9 X;  2XGN A;  4JI1 M;  5EP2 A;  4MGY E;  3KFU G;  4AI6 A;  3DFZ A;  1E32 A;  3PNY A;  4LF5 M;  2LXE A;  4IJF A;  1IN6 A;  5DYG A;  1MU5 A;  2VQF M;  1ZAE A;  3RE8 A;  3D8L A;  3GPU A;  4GIP A;  3UZU A;  3WHL A;  4IBE A;  2ERC A;  4LJ4 A;  1OFH A;  3U60 A;  3J27 B;  4DR3 M;  2QBY B;  1NJF A;  4L4U A;  2VII A;  1IQP A;  3CF0 A;  4CGY B;  2CHQ A;  3LMM A;  4AKH A;  2CUZ A;  1YE9 A;  4DUY M;  3HKP A;  4XGI A;  3HHZ A;  2R4J A;  4NSR A;  4OW0 A;  5ITX A;  3KW6 A;  3NBI A;  5E6J A;  2CHG A;  4LZJ A;  3UK6 A;  1TDZ A;  2KW0 A;  3CF2 A;  3ZC7 B;  3T1H M;  2XSZ A;  1KFV A;  2Z4S A;  4LJA A;  4WW0 A;  4G4Q A;  4QNR A;  1XXH A;  3IG5 A;  3TWM A;  4KOD A;  3HU2 A;  2M5Z A;  2ZM6 M;  3PFI A;  1IN4 A;  5H37 D;  2L7I A;  1QYR A;  4DR5 M;  4PDI A;  1E9R A;  4LF7 M;  1IXZ A;  4R7G A;  3U60 B;  1FNN A;  4L16 A;  4B3S M;  4FWD A;  5FSW A;  1YSY A;  3RGS A;  3VFD A;  3AJI B;  4B7G A;  3LQQ A;  3HU1 A;  3FYC A;  1NHG C;  2UUA M;  1TH2 A;  1QAQ A;  4OVZ A;  2UUB M;  4M0W A;  4LFA M;  1TDH A;  3IG8 A;  4DV5 M;  5FLX S;  2XEP A;  3HJQ A;  4GH9 A;  5JI2 E;  2F4V M;  7CAT A;  1XXH B;  5IZ7 D;  1NHW C;  4DV7 M;  3LQR A;  1T3T A;  3LVW A;  1ZQ9 A;  1IBK M;  3CF6 E;  4GC9 A;  1HNZ M;  5KPR A;  4LF8 M;  2R4E A;  3BOS A;  1R6B X;  3FTC A;  3EIE A;  1Q3C A;  3ZH9 B;  1DGG A;  3KP1 E;  3GPY A;  1L2D A;  3KOX E;  4NRV A;  3GPP A;  1L1Z A;  4IBD A;  4NXN M;  4NXM M;  1N77 A;  3GP1 A;  2D7E A;  4X66 M;  4OU7 A;  2X4A A;  3HU3 A;  3J80 S;  3UMM A;  1FJG M;  4OVZ B;  4YHH M;  2OQ4 A;  3VKG A;  2F5O A;  3FTF A;  2F5N A;  1W5S A;  1SXJ A;  2KZS A;  3SAV A;  3UJN A;  1TH4 A;  3K2L A;  3K1J A;  4FWH A;  3A46 A;  4MGH A;  2EA0 A;  3U6S A;  3AFH A;  5BPV A;  2CV2 A;  4B08 A;  2R18 A;  2C5R A;  1GL7 A;  3LVV A;  1ORY B;  3Q8X A;  4M9S A;  1IN5 A;  1JR3 A;  2RGO A;  3SFZ A;  1XMO M;  4LZZ A;  1KSF X;  3SMS A;  2UU9 M;  3CTW B;  1NVM A;  4LGY A;  4D81 A;  3SAU A;  2F5S A;  4LF6 M;  2RGH A;  3A42 A;  3H4M A;  2Y0Q A;  1HNW M;  4FWG A;  4FW9 A;  2R65 A;  4JI3 M;  1H6U A;  1TGU A;  3DOA A;  3KS4 A;  4NL4 H;  4GKJ M;  1E94 E;  1S3S A;  3MK6 A;  2UXB M;  1QVR A;  4I81 A;  4DV3 M;  2UXD M;  3KSJ A;  2ZAO A;  3FUU A;  1EE8 A;  4IBG A;  2XF3 A;  2L7H A;  1G3I A;  3GO8 A;  3SYK A;  3L29 A;  4LJ5 A;  4G4N A;  1SXJ C;  3SBJ A;  3GRY A;  4KLN A;  2K47 A;  1NSF A;  3U6D A;  3W0F A;  2BJW A;  2VQE M;  3KOW E;  1HQC A;  3ZCB B;  4AG5 A;  1NNU C;  2KA6 B;  2ZBK B;  1D2N A;  2ZAM A;  3GLH A;  5KO3 A;  3VKH A;  1VDD A;  1IM2 A;  2YQZ A;  4I8O A;  1Z5A A;  3DZD A;  1IY1 A;  2RKO A;  1I94 M;  5FTM A;  3GLI A;  2C96 A;  2DXI A;  2JA2 A;  3TPZ A;  3E4R A;  2QEN A;  5C18 A;  4LFC M;  2G5G X;  5BR8 M;  2XFT A;  2Y0T A;  1C1K A;  2KEB A;  2D7G A;  3SYL A;  3GLF A;  3GQ3 A;  4Z6Y A;  5EXX A;  2V1U A;  1GLN A;  5EP4 A;  1Q3B A;  1QAM A;  1R2Y A;  4CIS A;  4LG2 A;  4MH0 E;  2QPA A;  3JAM S;  1K3W A;  3KSX A;  4I5S A;  1PJJ A;  4W5W A;  1L2B A;  2Z7J A;  5F3W A;  4MGZ E;  4PT5 A;  3HWS A;  1OJL A;  2LNH C;  3GLH B;  5DYI A;  2E5L M;  5EP1 A;  2C9O A;  3TWK A;  4ZPX A;  1G59 A;  2QCU A;  1HR0 M;  4A3V B;  3RFW A;  4IBJ A;  4LRS A;  3GLI B;  1IY2 A;  2CHV A;  5EXT A;  2ZAN A;  5LMN M;  5ITT A;  1QAN A;  3W0L B;  3M7G A;  3VK7 A;  3FTE A;  4DV4 M;  3J7B A;  3GLF B;  2BNK A;  2V6Z M;  2V1C A;  1OFI A;  4R3D A;  5EXS A;  3AOE C;  4JN6 A;  3SAR A;  2R62 A;  3HHW A;  3SHG B;  4P16 A;  4JI2 M;  1Z59 A;  1Z5B A;  4GIT A;  4AQY M;  1DGH A;  1N75 A;  4LCB A;  3T38 A;  2XLJ A;  2C9C A;  3L25 A;  2O5R A;  2Z3X A;  4FVM A;  3J81 S;  4I4L A;  4AG6 A;  5ITX E;  4L8R C;  2L6O A;  4IIW A;  4AKG A;  3PNV A;  4JXJ A;  2R45 A;  3VK8 A;  1IBM M;  1GKI A;  2Y20 A;  4REZ A;  1LV7 A;  3PVS A;  3OTO M;  2XZF A;  4MGK E;  1K3X A;  4FCV A;  3FUW A;  1L2C A;  1R2Z A;  4M0D A;  3I51 A;  2BJV A;  4PCZ A;  2XFS A;  3KXE C;  1XNR M;  1NY5 A;  2H1R A;  5FTK A;  2Q2E B;  1QZM A;  2HHH M;  4IBI A;  2Z4R A;  3T15 A;  3HHX A;  4DR7 M;  3HJS A;  1R7R A;  4MB7 A;  1DGH B;  3D8B A;  4GRI A;  5EP3 A;  4AKI A;  3HJ8 A;  3FD9 A;  4G4R A;  4MM3 B;  4JI0 M;  1N36 M;  1G41 A;  3KP0 E;  4RF0 A;  3MJ5 A;  2X49 A;  3UGJ A;  1TH3 A;  4D82 A;  4NSO B;  5KPT A;  5C1B A;  3L26 A;  4BBA A;  3U6P A;  1WXQ A;  3ILK A;  2UXC M;  1G4A E;  4FD2 A;  2UUC M;  4LY6 A;  5LMU M;  4B3R M;  3L27 A;  4B7H A;  4DV1 M;  2DWL A;  4LRT A;  4JI5 M;  1SXJ B;  2I7N A;  5KQ8 A;  4K0K M;  5E26 A;  4JI6 M;  2A5Y B;  1N32 M;  4DR2 M;  3QWL A;  2J7O A;  3TQS A;  1XHB A;  2XSZ D;  2KRK A;  4AW4 A;  4IBK A;  4D80 A;  1NY6 A;  4PDG A;  3KOY E;  1J09 A;  3E9S A;  4DUZ M;  3FUX A;  2DWZ B;  2LWX A;  3RGP A;  4AZF A;  1DGF A;  3JR4 A;  4JI7 M;  4DR6 M;  3GRU A;  2FE8 A;  1G8P A;  2M60 A;  3K92 A;  3SAS A;  4GHL A;  3GRV A;  2W82 A;  3AL0 C;  1HQY E;  5IRE B;  4DV0 M;  3TWL A;  4G4O A;  4Z8X A;  2XH9 A;  1SXJ E;  3FUT A;  2CV0 A;  1IN8 A;  2AHM A;  3VLF B;  2X8A A;  3L28 A;  4JI8 M;  1NJG A;  8CAT A;  4NRW A;  4LGM A;  1IY0 A;  3T1Y M;  3I4Y A;  3GLG A;  2CEA A;  1HNX M;  4MGI E;  4B3T M;  2HCB A;  4DV2 M;  3AOE A;  2FOI C;  4FCW A;  4IJE A;  4JYA M;  4LF4 M;  2C99 A;  3U6Q A;  4RNA A;  2FNA A;  2YR0 A;  3SAW A;  4L15 A;  3U5Z A;  1YUB A;  1QQW A;  1JQJ C;  4GKK M;  2KRU A;  1IXS B;  3GRR A;  4XBO A;  4JV5 M;  3GQ5 A;  3SAT A;  4GHA A;  5GKN A;  1XMQ M;  4QOS A;  4M9X A;  3I4V A;  1UM8 A;  4KO8 A;  2F5Q A;  2KZU A;  4HLQ A;  1Z6T A;  4X62 M;  3SMP A;  4PD2 A;  2KXE A;  3VDU A;  4B7F A;  3A45 A;  3GLG B;  4EIW A;  4GMQ A;  2D7H A;  5ITY A;  1SXJ D;  4LF9 M;  4BLC A;  1DO2 A;  3J7A S;  3J2P B;  4OX9 M;  5IT9 S;  3M0E A;  5FTJ A;  2DVW B;  3MHV C;  3VDP A;  3AKZ A;  3QAU A;  3GQ4 A;  5DNY A;  5JI3 E;  1JR3 D;  3U5Z B;  2C98 A;  2YFQ A;  3HGI A;  4DR4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...