2DWMA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 5'-D(*AP*T)-3'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwmA01
2DWMA 4NL4H 2D7EA 2DWLA 2DWNA 2D7GA 2D7HA
chains in the Genus database with same CATH superfamily
1T43A 3A45A 3KSXA 4G4RA 2OO9A 2EA0A 1TDHA 3AL0C 2KEBA 3SFZA 1D0KA 3FUXA 4I81A 5BR8M 2VDBB 1F4IA 2LVAA 4AQYM 2R6FA 5EXXA 2KHHA 1QAOA 4GH9A 4LF8M 3KOXE 4P16A 4D81A 2C99A 1DV0A 2FFJA 4XBOA 2O5RA 1HQYE 2VQEM 1ZQ9A 4FVMA 3B89A 2DWMA 2RRUA 5ITXE 2R62A 5LMUM 3FUUA 4BBAA 2KNVA 3FUTA 4AKHA 1ZMVA 3DFZA 4LJ5A 4QOZC 7CATA 3FKEA 3I01M 1D0MA 3KSJA 3LVVA 3KP1E 2MJ5B 1NO1A 2XZFA 5EP1A 4AG6A 4DV2M 4DR4M 4JI3M 3WHKA 4M9SA 2KDLA 1QYRA 2UU9M 4JN6A 2VIIA 4OW0A 4B7GA 3K1JA 4CIZA 2CUZA 4QOSA 2CRUA 4F2LA 4NSOB 2J7NA 4RF0A 2CV1A 2R18A 1ZMWA 4X65M 4B3MM 1GLNA 2V6ZM 1SXJD 3HJSA 2D7HA 4GC5A 2LVNC 3H4JA 3IG8A 4DV7M 2I7NA 4OVZB 4X66M 4LF6M 3GLFB 1Z5BA 1L1ZA 2QZ4A 1NJGA 1ZAEA 2BWEA 3J81S 2F5SA 3RGPA 1TH4A 3PXGA 3J7AS 2L09A 3MJ5A 4M9XA 3L29A 3GPUA 1XHBA 2G8LA 2MH8A 3CF6E 3ZCBB 3PFIA 3U61A 5L8RF 2NQ8C 3AFHA 3OTOM 1HQCA 1G41A 2UXCM 1G8PA 1H6UA 1QDTA 2XH9A 3PNYA 4QHSA 1L2BA 4L78A 2XF3A 2LTUA 5BPVA 3SAWA 1MJGM 3TWLA 3SBJA 1K3XA 1X37A 3SATA 1PM5A 3BBZA 4LF5M 3MMPA 3QAUA 3DZDA 1HNXM 3B7ZA 2JY7A 3U6QA 5EXSA 3GO8A 1XMQM 1NNJA 3GLIE 2Z4SA 1N77A 4IIWA 1IBMM 2CV0A 3KW6A 1IY1A 1PJIA 2JWSA 3D8BA 5KPRA 4NXNM 2DHYA 1G71A 1K3WA 2XGNA 4FCVA 1Q02A 3C3DA 4LRTA 3C9PA 1OQYA 1GO5A 3JAMS 1E94E 3A46A 4GC9A 2KZUA 4QHTA 4IBEA 4MGYE 3L25A 4NL4H 2WSCF 3K8ZA 4FWHA 1D2NA 4AKGA 1KYIA 2R4EA 3HU1A 2HL7A 3KS4A 5C1BA 1SXJA 3FUVA 2DAMA 2LVPC 4IBDA 4II7A 2DWNA 3J7BA 4FW9A 1OTRA 1ZV1A 4DV6M 4B08A 2DAEA 2G3QA 1XXHE 1OAIA 3SAVA 4L8RC 4LY6A 3EIEA 3KXEC 2X8AA 3SASA 4AG5A 5ITTA 1GABA 3NBIA 4OVZA 4JYAM 3T15A 2Z8YM 4LCBA 2HAKA 3UJNA 5EQTA 1R6BX 3HJ8A 3A42A 2JP7A 2LNHC 3J2PB 4GIPA 4Q7JA 4DUZM 3K2LA 2VF8A 3VKHA 1TR8A 1OAOC 4KO8A 5C18A 4JI1M 3SHFA 1GJSA 2CHQA 3FRIA 5GKNA 1D0LA 3LCVB 1R7RA 5EXTA 1KFVA 4IBCA 2FH0A 2Y0TA 4MM3B 4S12A 4XGIA 4CHTB 4JI6M 3KOWE 1JB0F 1YLAA 4LJ6A 2L4FA 4DV5M 1V92A 4IBIA 4RF1A 1G59A 1E32A 1FJGM 3I4YA 2RGHA 1R4GA 3TE6A 2EKKA 1RU3A 2DHRA 2JY5A 2YFQA 3W0FA 2KNZA 4ANRA 2BWBA 5ITRA 2L2DA 4AKIA 4IJEA 1I4WA 2DVWB 3E9SA 2JUJA 5JI2E 3L28A 5FSWA 1L2CA 3GLGE 4LFAM 1NJFA 2WSFF 3U5ZA 3VK7A 1DGFA 4BB9A 3HZJA 3GQ3A 2J7OA 1DGHB 1PJJA 2C98A 1J7KA 1P3QQ 2HKJA 4B3TM 1EFUB 1TGUA 3LQQA 2P5TA 1G4AE 4LRSA 3GLFE 2DWLA 4TUWA 1YE9A 2LH0A 4REZA 3VFDA 2F5OA 3VLFB 3DA1A 3T6PA 4NRWA 2ZANA 2XFSA 3RFWA 3SMPA 1DGBA 3TL4X 4AI6A 3QYBA 5JI3E 1J09A 2C96A 3B9PA 4LFBM 1QAQA 1IQPA 1PRBA 5KPZA 1DO0A 2EJSA 1NSFA 4YHHM 1MX0A 2X49A 1NV8A 1R2YA 2BJVA 4Z6YA 3RGSA 1SXJB 4OX9M 4D82A 3LW5F 2M60A 1VG5A 8CATA 1N75A 2F5PA 5IT9S 1OFHA 1IBKM 4L4UA 2EUCA 4IBKA 2K47A 4CGYB 3DOAA 3F92A 2C5RA 1JR3D 2X4AA 4LJ8A 3WHLA 4GHLA 1DGGA 5DYIA 2CE7A 3NWLA 2XFTA 3AOEC 3M7GA 4HEOA 3SYKA 1IXZA 2BNKA 2Z4RA 3KS8A 4IBGA 1QAMA 1IN6A 2MROB 3VDPA 3U6EA 4IJFA 1NY5A 2ZM6M 3U6PA 2AHMA 4W5WA 4R71A 4DV1M 1XNRM 3W68A 2DAKA 3AJIB 4GHAA 3U6SA 1N32M 2L6OA 1XWIA 3TPZA 4M0WA 3U6DA 4K0KM 1Q3CA 2LBCA 2XSZD 3CF0A 4HLQA 4G4OA 3R8FA 3MK6A 4JI8M 1PJTA 2OQ4A 2JZ1A 3D8LA 1IN8A 2K6BA 4PCZA 2DNAA 2Y0QA 4RKUF 1W5SA 1BVSA 5ITYA 2VF7A 4IBBA 2LHCA 3GRUA 2R45A 2V1UA 1DGHA 4MH0E 1VEKA 4DR5M 5DNYA 1OFIA 2R0IA 3GQ5A 3T1YM 1TDZA 2MGWA 2ZBKB 3U5ZB 1DO2A 2J5YA 1HNWM 2ERCA 3L26A 5KPTA 2APLA 1PJQA 3HHXA 3FTDA 1NHWC 3UMMA 2XLJA 2UUAM 1Q39A 4WURA 3TWKA 3MHVC 4LGMA 4B7FA 2HWJA 2D7GA 3K92A 4LJ7A 1QDRA 4LZJA 1L2DA 1IN4A 3E21A 3IECA 2JNHA 4KLNA 4L6V6 1YSYA 4RNAA 2L4EA 4MGZE 2DENA 5IZ7D 4G4NA 2VQFM 1HJPA 4ITQA 4Z8XA 4NSRA 4CISA 2DAIA 2I7PA 4AZFA 3C3EA 4LF9M 3K9PA 3THGA 4LG2A 1JR3A 4I4LA 3U6OA 1KSFX 1QANA 2B3TA 1ZMUA 2UUCM 4P17A 2UUBM 4DV0M 1I94M 4IBFA 2DZOB 3RE8A 2QQ8A 4GMQA 2DZLA 1C1KA 2CFOA 5DYGA 1UFZA 4QNMA 1QZMA 1WJ7A 2LVQD 4KHPM 1T6OA 3CGWA 1TH2A 3GLHA 4FCWA 3E4RA 3M0EA 5FTMA 2G5GX 2E5LM 4UN2B 5LMNM 1QZEA 4NOOB 2QHOB 4HL4A 2Y20A 5EP3A 2BJWA 1TF0B 2GQFA 3U6CA 3LQRA 4FWGA 5F3WA 2Z7JA 1HT2E 3U60A 3GPYA 4EIWA 1VEJA 5EP4A 2EKFA 2K9DA 3PNVA 2R65A 3HU3A 3ZQJA 2JY8A 2QSFX 3FTEA 3GPXA 3KFUG 1IXSA 1Z5CA 1WHCA 3IG5A 3QWLA 4PT5A 3SARA 2DKLA 3H4MA 2ZTCA 3CF2A 3U6LA 2OOBA 4ZPXA 4A3VB 2R46A 5H37D 4GKJM 4FWDA 3Q8GA 3BOSA 1QUTA 1Z5AA 2RKOA 1SXJE 2QNJA 3EIHA 1GL7A 3HU2A 1NHGC 2EO2A 2H1RA 1WXQA 1G3IA 3GRYA 4LFCM 4R3DA 2V1CA 4G3OA 3B74A 3FD9A 1WIVA 3HHWA 2FOIC 1W5TA 3FYDA 4GEWA 5E26A 5ITUA 4FCTA 3M6AA 1N33M 3FE3A 4DR2M 1Z6TA 5FTLA 1IY2A 3SC3A 3J80S 1YUBA 4YY3M 1LTMA 3ILKA 2CP8A 2R44A 1HNZM 1N78A 1WGLA 2HHHM 4AW4A 3T1HM 4GKKM 3UZUA 4PDGA 2QP9X 3PVSA 4JI2M 1VDLA 2QBYB 4I8OA 2C9OA 2YR0A 3UGJA 4LJ4A 2QPAA 5FLXS 2UXDM 4B3RM 2KNAA 2FS1A 2OOAA 3KDSE 3C58A 3E46A 4Y28F 1E9RA 2HCBA 4DR3M 4LF7M 3LMMA 1OIPA 3A98B 4OU7A 3FRHA 5E6JA 2K0BX 1S3SA 5IWAM 2F5QA 1PJSA 2KXEA 2CWBA 1QUSA 1QVRA 2FE8A 3W67A 2JA2A 4NXMM 3TQSA 4DUYM 3GLHB 3J27B 3BXWA 3TWMA 1K82A 4DR6M 1GJTA 1R2ZA 4NRVA 3AOEA 3KOYE 4I5SA 1IN5A 1TTEA 2RGOA 1JQJC 3LCUA 3W0LB 3B7QA 3U60B 2O25A 4PD2A 3I51A 2O01F 3GLIA 3R9XB 3GLGB 2YNMD 1WGNA 4BLCA 5FTJA 3VDUA 2DAGA 3GPPA 3FUWA 1FNNA 1IXSB 1LV7A 3L27A 1E9SA 1GL6A 4LJ9A 4DR1M 2XZUA 1HR0M 1IFYA 2W82A 3QYEA 5EP2A 4GITA 1N36M 4MGKE 2C9CA 5DFLA 2KRKA 3ZH9B 4LF4M 3KVWA 2CV2A 2JZ0A 3B7NA 4MB7A 1OIZA 2GNOA 4MGIE 1Q3BA 2JXNA 2Y21A 3ZC7B 1VQ1A 2F5NA 2DZNB 1HT1E 1Y8GA 3JR4A 4NC6A 2FNAA 2L7HA 1Z59A 4IBJA 4LJAA 5FTKA 4WP2A 4DBGB 4LGYA 1XXHA 2R4JA 1J5EM 1CUKA 5EXPA 1NY6A 2KZSA 3FYCA 4GRIA 4WW0A 2Q2EB 5IREB 3FTFA 1SG9A 4JV5M 1NVMA 4JI4M 1QQWA 1V33A 3LVWA 1NNUC 3HWSA 1MN3A 4KT0F 1VEGA 4JXJA 3V76A 4G4QA 4B7HA 2QBYA 5KO3A 2WSEF 3I04M 3VKGA 2JY6B 2LWXA 4QNRA 2UXBM 2A5YB 3GQ4A 1GVNA 3SHGB 5FTNA 3HJQA 4D80A 3HY5A 1AUAA 1IXRC 2KW0A 1TH3A 1XNQM 1R5LA 3T38A 3HHZA 4JI5M 3SAUA 1WR1B 1XB2B 4M9ZA 4CJ6A 1PGYA 2M5ZA 2YQZA 1XC8A 1IN7A 1XMOM 4B3SM 2KRUA 3HHYA 4L16A 3FTCA 4PDIA 4DV4M 1UM8A 1EE8A 2WZJA 3HX3A 1SXJC 1ORYB 1C7YA 3KP0E 3SMSA 2XEPA 2Z3XA 4G6ZA 2XSZA 3KOZE 1T3TA 2L7IA 1GKIA 3AOGA 2CEAA 2ZAOA 3JR5A 2CHVA 2D7EA 3GLGA 1VDDA 3Q8XA 4L15A 4F1IA 4JI0M 3CTWB 1AIPC 2LHGA 5ITXA 5KQDA 4X62M 3GLIB 3K9OA 2CHGA 3GP1A 3GRVA 3I4VA 3L2AA 1A5TA 4KODA 3VK8A 2KA6B 3GLFA 2DI0A 4DV3M 4FD2A 1OKSA 2ZAMA 1L1TA 1IY0A 4M0DA 3HGIA 2ZTDA 2QENA 4XK8F 1EIJA 2DWZB 5KQ8A 1IBLM 2DXIA 3UK6A 4R7GA 1JR3E 1N34M 4JI7M 1IM2A 1OJLA 3U6MA 3AV0A 5EJCA 3HKPA 2LVOC 1NV9A 2MR9A 5A2QS 3SYLA 4MGHA 2H5XA 2F4VM 1L8QA 3AKZA 2OPFA 2LXEA 3U61B 5ITQA 4X64M 4LZZA 3IHPA 1MU5A 3NBXX 3GLHE 4DR7M 2QCUA 1V34A 3GRRA 2N35A 1XXHB
chains in the Genus database with same CATH topology
3A45A 3KSXA 4G4RA 2EA0A 1TDHA 3AL0C 2KEBA 3SFZA 3FUXA 4I81A 5BR8M 4AQYM 5EXXA 4LF8M 1QAOA 4GH9A 3KOXE 4P16A 4D81A 2C99A 2FFJA 4XBOA 2O5RA 1HQYE 2VQEM 1ZQ9A 4FVMA 2DWMA 5ITXE 2R62A 5LMUM 3FUUA 4BBAA 4AKHA 3FUTA 4LJ5A 3DFZA 4QOZC 7CATA 3FKEA 3KSJA 3LVVA 3KP1E 2XZFA 5EP1A 4AG6A 4DV2M 4DR4M 4JI3M 3WHKA 4M9SA 1QYRA 2UU9M 4JN6A 2VIIA 4OW0A 4B7GA 3K1JA 2CUZA 4QOSA 4NSOB 2J7NA 4RF0A 2CV1A 2R18A 4X65M 4B3MM 1GLNA 2V6ZM 1SXJD 3HJSA 2D7HA 4GC5A 3IG8A 4DV7M 2I7NA 4OVZB 4X66M 4LF6M 3GLFB 1Z5BA 1L1ZA 2QZ4A 1NJGA 1ZAEA 2F5SA 3J81S 3RGPA 1TH4A 3PXGA 3J7AS 2L09A 3MJ5A 4M9XA 3L29A 3GPUA 1XHBA 2G8LA 3CF6E 3ZCBB 3PFIA 3U61A 2NQ8C 3AFHA 3OTOM 1HQCA 1G41A 2UXCM 1G8PA 1H6UA 2XH9A 3PNYA 4QHSA 1L2BA 4L78A 2XF3A 5BPVA 3SAWA 3TWLA 3SBJA 1K3XA 1X37A 3SATA 1PM5A 4LF5M 3QAUA 3DZDA 1HNXM 3U6QA 5EXSA 3GO8A 1XMQM 1NNJA 2CV0A 2Z4SA 1N77A 4IIWA 1IBMM 3KW6A 1IY1A 1PJIA 3D8BA 5KPRA 4NXNM 1K3WA 2XGNA 4FCVA 4LRTA 3JAMS 1E94E 3A46A 4GC9A 2KZUA 4QHTA 4IBEA 4MGYE 3L25A 4NL4H 3K8ZA 4FWHA 1D2NA 4AKGA 1KYIA 2R4EA 3HU1A 2HL7A 3KS4A 5C1BA 1SXJA 3FUVA 4IBDA 4II7A 2DWNA 3J7BA 4FW9A 4DV6M 4B08A 3SAVA 4L8RC 4LY6A 3EIEA 3KXEC 2X8AA 3SASA 4AG5A 5ITTA 3NBIA 4OVZA 4JYAM 3T15A 4LCBA 3UJNA 5EQTA 1R6BX 3HJ8A 3A42A 2LNHC 3J2PB 4GIPA 4DUZM 3K2LA 3VKHA 4KO8A 5C18A 4JI1M 3SHFA 2CHQA 5GKNA 1R7RA 5EXTA 1KFVA 4IBCA 2Y0TA 4MM3B 4S12A 4XGIA 4CHTB 4JI6M 3KOWE 4LJ6A 4DV5M 4IBIA 4RF1A 1G59A 1E32A 1FJGM 3I4YA 2RGHA 3TE6A 3W0FA 2DXIA 2DHRA 2YFQA 5ITRA 4AKIA 4IJEA 1I4WA 2DVWB 3E9SA 5JI2E 3L28A 5FSWA 1L2CA 4LFAM 1NJFA 3U5ZA 3VK7A 1DGFA 4BB9A 3GQ3A 2J7OA 1DGHB 1PJJA 2C98A 1J7KA 2HKJA 4B3TM 1TGUA 3LQQA 2P5TA 1G4AE 4LRSA 4TUWA 2DWLA 1YE9A 2LH0A 4REZA 3VFDA 2F5OA 3VLFB 3DA1A 4NRWA 2ZANA 2XFSA 3RFWA 3SMPA 1DGBA 3TL4X 4AI6A 5JI3E 1J09A 2C96A 3B9PA 4LFBM 1QAQA 1IQPA 5KPZA 1DO0A 1NSFA 1MX0A 2X49A 1R2YA 2BJVA 4Z6YA 3RGSA 1SXJB 4OX9M 4D82A 2M60A 8CATA 1N75A 2F5PA 5IT9S 1OFHA 1IBKM 4L4UA 2EUCA 4IBKA 2K47A 4CGYB 3DOAA 2C5RA 1JR3D 2X4AA 4LJ8A 3WHLA 4GHLA 1DGGA 5DYIA 2CE7A 3NWLA 2XFTA 3AOEC 3M7GA 3SYKA 1IXZA 2BNKA 2Z4RA 3KS8A 4IBGA 1QAMA 1IN6A 3VDPA 3U6EA 4IJFA 1NY5A 2ZM6M 3U6PA 2AHMA 4W5WA 4DV1M 1XNRM 3AJIB 4GHAA 1N32M 3U6SA 2L6OA 1XWIA 3TPZA 4M0WA 3U6DA 4K0KM 1Q3CA 2XSZD 3CF0A 4HLQA 4G4OA 3R8FA 3MK6A 4JI8M 2OQ4A 3D8LA 1IN8A 4PCZA 2Y0QA 1W5SA 5ITYA 4IBBA 3GRUA 2R45A 2V1UA 1DGHA 4MH0E 4DR5M 5DNYA 1OFIA 3GQ5A 1TDZA 3T1YM 2ZBKB 3U5ZB 1DO2A 1HNWM 2ERCA 3L26A 5KPTA 3HHXA 3FTDA 1NHWC 3UMMA 2XLJA 2UUAM 1Q39A 4WURA 3TWKA 3MHVC 4LGMA 4B7FA 2D7GA 3K92A 4LJ7A 4LZJA 1L2DA 1IN4A 4KLNA 4RNAA 1YSYA 4MGZE 5IZ7D 4G4NA 2VQFM 4ITQA 4Z8XA 4NSRA 4CISA 2I7PA 4AZFA 4LF9M 3THGA 4LG2A 1JR3A 4I4LA 3U6OA 1KSFX 1QANA 2UUCM 2UUBM 4DV0M 1I94M 4IBFA 2DZOB 3RE8A 4GMQA 1C1KA 2CFOA 5DYGA 4QNMA 1QZMA 4KHPM 1TH2A 3GLHA 4FCWA 3E4RA 3M0EA 5FTMA 2G5GX 2E5LM 5LMNM 4NOOB 4HL4A 2Y20A 5EP3A 2BJWA 3U6CA 3LQRA 4FWGA 5F3WA 2Z7JA 1HT2E 3U60A 3GPYA 4EIWA 5EP4A 3PNVA 2R65A 3HU3A 3FTEA 3GPXA 3KFUG 1Z5CA 3IG5A 3QWLA 4PT5A 3SARA 3H4MA 3CF2A 3U6LA 4ZPXA 4A3VB 2R46A 5H37D 4GKJM 4FWDA 3BOSA 1Z5AA 2RKOA 1SXJE 3EIHA 3HU2A 1GL7A 1NHGC 2EO2A 2H1RA 1WXQA 1G3IA 3GRYA 4LFCM 4R3DA 2V1CA 3FD9A 3HHWA 2FOIC 1W5TA 3FYDA 5E26A 5ITUA 4FCTA 3M6AA 1N33M 4DR2M 1Z6TA 5FTLA 1IY2A 3SC3A 3J80S 1YUBA 4YY3M 3ILKA 1HNZM 1N78A 2HHHM 4AW4A 3T1HM 4GKKM 3UZUA 4PDGA 2QP9X 3PVSA 4JI2M 2QBYB 4I8OA 2C9OA 2YR0A 3UGJA 4LJ4A 2QPAA 5FLXS 2UXDM 4B3RM 3KDSE 3C58A 4DR3M 1E9RA 2HCBA 4LF7M 3LMMA 3A98B 4OU7A 5E6JA 1S3SA 5IWAM 2F5QA 2KXEA 1QVRA 2FE8A 2JA2A 4NXMM 3TQSA 4DUYM 3GLHB 3J27B 3TWMA 1K82A 4DR6M 1R2ZA 4NRVA 3AOEA 3KOYE 4I5SA 1IN5A 2RGOA 1JQJC 3W0LB 3U60B 4PD2A 3I51A 3GLIA 3R9XB 3GLGB 2YNMD 4BLCA 5FTJA 3VDUA 3GPPA 3FUWA 1FNNA 1IXSB 1LV7A 3L27A 1E9SA 1GL6A 4LJ9A 4DR1M 2XZUA 1HR0M 2W82A 5EP2A 4GITA 1N36M 4MGKE 2C9CA 2KRKA 3ZH9B 4LF4M 3KVWA 2CV2A 4MB7A 4MGIE 1Q3BA 2Y21A 3ZC7B 2F5NA 2DZNB 1HT1E 3JR4A 2FNAA 2L7HA 1Z59A 4IBJA 4LJAA 5FTKA 4LGYA 1XXHA 2R4JA 1J5EM 5EXPA 1NY6A 2KZSA 3FYCA 4GRIA 4WW0A 2Q2EB 5IREB 3FTFA 4JV5M 1NVMA 4JI4M 1QQWA 3LVWA 1NNUC 3HWSA 4JXJA 4G4QA 4B7HA 2QBYA 5KO3A 3VKGA 2LWXA 4QNRA 2UXBM 2A5YB 3GQ4A 1GVNA 3SHGB 5FTNA 3HJQA 4D80A 1IXRC 2KW0A 1TH3A 1XNQM 3T38A 3HHZA 4JI5M 3SAUA 4M9ZA 2M5ZA 2YQZA 1XC8A 1IN7A 1XMOM 4B3SM 2KRUA 3HHYA 4L16A 3FTCA 4PDIA 4DV4M 1UM8A 1EE8A 1SXJC 1ORYB 3KP0E 3SMSA 2XEPA 2Z3XA 4G6ZA 2XSZA 3KOZE 1T3TA 2L7IA 1GKIA 3AOGA 2CEAA 2ZAOA 3JR5A 2CHVA 2D7EA 3GLGA 1VDDA 3Q8XA 4L15A 4JI0M 3CTWB 5ITXA 5KQDA 4X62M 3GLIB 2CHGA 3GP1A 3GRVA 3I4VA 3L2AA 4KODA 3VK8A 2KA6B 3GLFA 4DV3M 1L1TA 4FD2A 2ZAMA 1IY0A 4M0DA 3HGIA 2QENA 2DWZB 5KQ8A 1IBLM 3UK6A 4R7GA 1N34M 4JI7M 1IM2A 1OJLA 3U6MA 3AV0A 5EJCA 3HKPA 2F4VM 5A2QS 3SYLA 4MGHA 1L8QA 3AKZA 2OPFA 2LXEA 3U61B 5ITQA 4X64M 4LZZA 1MU5A 4DR7M 2QCUA 4YHHM 3GRRA 1XXHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWM A;  4NL4 H;  2D7E A;  2DWL A;  2DWN A;  2D7G A;  2D7H A; 
#chains in the Genus database with same CATH topology
 1T43 A;  3A45 A;  3KSX A;  4G4R A;  2OO9 A;  2EA0 A;  1TDH A;  3AL0 C;  2KEB A;  3SFZ A;  1D0K A;  3FUX A;  4I81 A;  5BR8 M;  2VDB B;  1F4I A;  2LVA A;  4AQY M;  2R6F A;  5EXX A;  2KHH A;  1QAO A;  4GH9 A;  4LF8 M;  3KOX E;  4P16 A;  4D81 A;  2C99 A;  1DV0 A;  2FFJ A;  4XBO A;  2O5R A;  1HQY E;  2VQE M;  1ZQ9 A;  4FVM A;  3B89 A;  2DWM A;  2RRU A;  5ITX E;  2R62 A;  5LMU M;  3FUU A;  4BBA A;  2KNV A;  3FUT A;  4AKH A;  1ZMV A;  3DFZ A;  4LJ5 A;  4QOZ C;  7CAT A;  3FKE A;  3I01 M;  1D0M A;  3KSJ A;  3LVV A;  3KP1 E;  2MJ5 B;  1NO1 A;  2XZF A;  5EP1 A;  4AG6 A;  4DV2 M;  4DR4 M;  4JI3 M;  3WHK A;  4M9S A;  2KDL A;  1QYR A;  2UU9 M;  4JN6 A;  2VII A;  4OW0 A;  4B7G A;  3K1J A;  4CIZ A;  2CUZ A;  4QOS A;  2CRU A;  4F2L A;  4NSO B;  2J7N A;  4RF0 A;  2CV1 A;  2R18 A;  1ZMW A;  4X65 M;  4B3M M;  1GLN A;  2V6Z M;  1SXJ D;  3HJS A;  2D7H A;  4GC5 A;  2LVN C;  3H4J A;  3IG8 A;  4DV7 M;  2I7N A;  4OVZ B;  4X66 M;  4LF6 M;  3GLF B;  1Z5B A;  1L1Z A;  2QZ4 A;  1NJG A;  1ZAE A;  2BWE A;  3J81 S;  2F5S A;  3RGP A;  1TH4 A;  3PXG A;  3J7A S;  2L09 A;  3MJ5 A;  4M9X A;  3L29 A;  3GPU A;  1XHB A;  2G8L A;  2MH8 A;  3CF6 E;  3ZCB B;  3PFI A;  3U61 A;  5L8R F;  2NQ8 C;  3AFH A;  3OTO M;  1HQC A;  1G41 A;  2UXC M;  1G8P A;  1H6U A;  1QDT A;  2XH9 A;  3PNY A;  4QHS A;  1L2B A;  4L78 A;  2XF3 A;  2LTU A;  5BPV A;  3SAW A;  1MJG M;  3TWL A;  3SBJ A;  1K3X A;  1X37 A;  3SAT A;  1PM5 A;  3BBZ A;  4LF5 M;  3MMP A;  3QAU A;  3DZD A;  1HNX M;  3B7Z A;  2JY7 A;  3U6Q A;  5EXS A;  3GO8 A;  1XMQ M;  1NNJ A;  3GLI E;  2Z4S A;  1N77 A;  4IIW A;  1IBM M;  2CV0 A;  3KW6 A;  1IY1 A;  1PJI A;  2JWS A;  3D8B A;  5KPR A;  4NXN M;  2DHY A;  1G71 A;  1K3W A;  2XGN A;  4FCV A;  1Q02 A;  3C3D A;  4LRT A;  3C9P A;  1OQY A;  1GO5 A;  3JAM S;  1E94 E;  3A46 A;  4GC9 A;  2KZU A;  4QHT A;  4IBE A;  4MGY E;  3L25 A;  4NL4 H;  2WSC F;  3K8Z A;  4FWH A;  1D2N A;  4AKG A;  1KYI A;  2R4E A;  3HU1 A;  2HL7 A;  3KS4 A;  5C1B A;  1SXJ A;  3FUV A;  2DAM A;  2LVP C;  4IBD A;  4II7 A;  2DWN A;  3J7B A;  4FW9 A;  1OTR A;  1ZV1 A;  4DV6 M;  4B08 A;  2DAE A;  2G3Q A;  1XXH E;  1OAI A;  3SAV A;  4L8R C;  4LY6 A;  3EIE A;  3KXE C;  2X8A A;  3SAS A;  4AG5 A;  5ITT A;  1GAB A;  3NBI A;  4OVZ A;  4JYA M;  3T15 A;  2Z8Y M;  4LCB A;  2HAK A;  3UJN A;  5EQT A;  1R6B X;  3HJ8 A;  3A42 A;  2JP7 A;  2LNH C;  3J2P B;  4GIP A;  4Q7J A;  4DUZ M;  3K2L A;  2VF8 A;  3VKH A;  1TR8 A;  1OAO C;  4KO8 A;  5C18 A;  4JI1 M;  3SHF A;  1GJS A;  2CHQ A;  3FRI A;  5GKN A;  1D0L A;  3LCV B;  1R7R A;  5EXT A;  1KFV A;  4IBC A;  2FH0 A;  2Y0T A;  4MM3 B;  4S12 A;  4XGI A;  4CHT B;  4JI6 M;  3KOW E;  1JB0 F;  1YLA A;  4LJ6 A;  2L4F A;  4DV5 M;  1V92 A;  4IBI A;  4RF1 A;  1G59 A;  1E32 A;  1FJG M;  3I4Y A;  2RGH A;  1R4G A;  3TE6 A;  2EKK A;  1RU3 A;  2DHR A;  2JY5 A;  2YFQ A;  3W0F A;  2KNZ A;  4ANR A;  2BWB A;  5ITR A;  2L2D A;  4AKI A;  4IJE A;  1I4W A;  2DVW B;  3E9S A;  2JUJ A;  5JI2 E;  3L28 A;  5FSW A;  1L2C A;  3GLG E;  4LFA M;  1NJF A;  2WSF F;  3U5Z A;  3VK7 A;  1DGF A;  4BB9 A;  3HZJ A;  3GQ3 A;  2J7O A;  1DGH B;  1PJJ A;  2C98 A;  1J7K A;  1P3Q Q;  2HKJ A;  4B3T M;  1EFU B;  1TGU A;  3LQQ A;  2P5T A;  1G4A E;  4LRS A;  3GLF E;  2DWL A;  4TUW A;  1YE9 A;  2LH0 A;  4REZ A;  3VFD A;  2F5O A;  3VLF B;  3DA1 A;  3T6P A;  4NRW A;  2ZAN A;  2XFS A;  3RFW A;  3SMP A;  1DGB A;  3TL4 X;  4AI6 A;  3QYB A;  5JI3 E;  1J09 A;  2C96 A;  3B9P A;  4LFB M;  1QAQ A;  1IQP A;  1PRB A;  5KPZ A;  1DO0 A;  2EJS A;  1NSF A;  4YHH M;  1MX0 A;  2X49 A;  1NV8 A;  1R2Y A;  2BJV A;  4Z6Y A;  3RGS A;  1SXJ B;  4OX9 M;  4D82 A;  3LW5 F;  2M60 A;  1VG5 A;  8CAT A;  1N75 A;  2F5P A;  5IT9 S;  1OFH A;  1IBK M;  4L4U A;  2EUC A;  4IBK A;  2K47 A;  4CGY B;  3DOA A;  3F92 A;  2C5R A;  1JR3 D;  2X4A A;  4LJ8 A;  3WHL A;  4GHL A;  1DGG A;  5DYI A;  2CE7 A;  3NWL A;  2XFT A;  3AOE C;  3M7G A;  4HEO A;  3SYK A;  1IXZ A;  2BNK A;  2Z4R A;  3KS8 A;  4IBG A;  1QAM A;  1IN6 A;  2MRO B;  3VDP A;  3U6E A;  4IJF A;  1NY5 A;  2ZM6 M;  3U6P A;  2AHM A;  4W5W A;  4R71 A;  4DV1 M;  1XNR M;  3W68 A;  2DAK A;  3AJI B;  4GHA A;  3U6S A;  1N32 M;  2L6O A;  1XWI A;  3TPZ A;  4M0W A;  3U6D A;  4K0K M;  1Q3C A;  2LBC A;  2XSZ D;  3CF0 A;  4HLQ A;  4G4O A;  3R8F A;  3MK6 A;  4JI8 M;  1PJT A;  2OQ4 A;  2JZ1 A;  3D8L A;  1IN8 A;  2K6B A;  4PCZ A;  2DNA A;  2Y0Q A;  4RKU F;  1W5S A;  1BVS A;  5ITY A;  2VF7 A;  4IBB A;  2LHC A;  3GRU A;  2R45 A;  2V1U A;  1DGH A;  4MH0 E;  1VEK A;  4DR5 M;  5DNY A;  1OFI A;  2R0I A;  3GQ5 A;  3T1Y M;  1TDZ A;  2MGW A;  2ZBK B;  3U5Z B;  1DO2 A;  2J5Y A;  1HNW M;  2ERC A;  3L26 A;  5KPT A;  2APL A;  1PJQ A;  3HHX A;  3FTD A;  1NHW C;  3UMM A;  2XLJ A;  2UUA M;  1Q39 A;  4WUR A;  3TWK A;  3MHV C;  4LGM A;  4B7F A;  2HWJ A;  2D7G A;  3K92 A;  4LJ7 A;  1QDR A;  4LZJ A;  1L2D A;  1IN4 A;  3E21 A;  3IEC A;  2JNH A;  4KLN A;  4L6V 6;  1YSY A;  4RNA A;  2L4E A;  4MGZ E;  2DEN A;  5IZ7 D;  4G4N A;  2VQF M;  1HJP A;  4ITQ A;  4Z8X A;  4NSR A;  4CIS A;  2DAI A;  2I7P A;  4AZF A;  3C3E A;  4LF9 M;  3K9P A;  3THG A;  4LG2 A;  1JR3 A;  4I4L A;  3U6O A;  1KSF X;  1QAN A;  2B3T A;  1ZMU A;  2UUC M;  4P17 A;  2UUB M;  4DV0 M;  1I94 M;  4IBF A;  2DZO B;  3RE8 A;  2QQ8 A;  4GMQ A;  2DZL A;  1C1K A;  2CFO A;  5DYG A;  1UFZ A;  4QNM A;  1QZM A;  1WJ7 A;  2LVQ D;  4KHP M;  1T6O A;  3CGW A;  1TH2 A;  3GLH A;  4FCW A;  3E4R A;  3M0E A;  5FTM A;  2G5G X;  2E5L M;  4UN2 B;  5LMN M;  1QZE A;  4NOO B;  2QHO B;  4HL4 A;  2Y20 A;  5EP3 A;  2BJW A;  1TF0 B;  2GQF A;  3U6C A;  3LQR A;  4FWG A;  5F3W A;  2Z7J A;  1HT2 E;  3U60 A;  3GPY A;  4EIW A;  1VEJ A;  5EP4 A;  2EKF A;  2K9D A;  3PNV A;  2R65 A;  3HU3 A;  3ZQJ A;  2JY8 A;  2QSF X;  3FTE A;  3GPX A;  3KFU G;  1IXS A;  1Z5C A;  1WHC A;  3IG5 A;  3QWL A;  4PT5 A;  3SAR A;  2DKL A;  3H4M A;  2ZTC A;  3CF2 A;  3U6L A;  2OOB A;  4ZPX A;  4A3V B;  2R46 A;  5H37 D;  4GKJ M;  4FWD A;  3Q8G A;  3BOS A;  1QUT A;  1Z5A A;  2RKO A;  1SXJ E;  2QNJ A;  3EIH A;  1GL7 A;  3HU2 A;  1NHG C;  2EO2 A;  2H1R A;  1WXQ A;  1G3I A;  3GRY A;  4LFC M;  4R3D A;  2V1C A;  4G3O A;  3B74 A;  3FD9 A;  1WIV A;  3HHW A;  2FOI C;  1W5T A;  3FYD A;  4GEW A;  5E26 A;  5ITU A;  4FCT A;  3M6A A;  1N33 M;  3FE3 A;  4DR2 M;  1Z6T A;  5FTL A;  1IY2 A;  3SC3 A;  3J80 S;  1YUB A;  4YY3 M;  1LTM A;  3ILK A;  2CP8 A;  2R44 A;  1HNZ M;  1N78 A;  1WGL A;  2HHH M;  4AW4 A;  3T1H M;  4GKK M;  3UZU A;  4PDG A;  2QP9 X;  3PVS A;  4JI2 M;  1VDL A;  2QBY B;  4I8O A;  2C9O A;  2YR0 A;  3UGJ A;  4LJ4 A;  2QPA A;  5FLX S;  2UXD M;  4B3R M;  2KNA A;  2FS1 A;  2OOA A;  3KDS E;  3C58 A;  3E46 A;  4Y28 F;  1E9R A;  2HCB A;  4DR3 M;  4LF7 M;  3LMM A;  1OIP A;  3A98 B;  4OU7 A;  3FRH A;  5E6J A;  2K0B X;  1S3S A;  5IWA M;  2F5Q A;  1PJS A;  2KXE A;  2CWB A;  1QUS A;  1QVR A;  2FE8 A;  3W67 A;  2JA2 A;  4NXM M;  3TQS A;  4DUY M;  3GLH B;  3J27 B;  3BXW A;  3TWM A;  1K82 A;  4DR6 M;  1GJT A;  1R2Z A;  4NRV A;  3AOE A;  3KOY E;  4I5S A;  1IN5 A;  1TTE A;  2RGO A;  1JQJ C;  3LCU A;  3W0L B;  3B7Q A;  3U60 B;  2O25 A;  4PD2 A;  3I51 A;  2O01 F;  3GLI A;  3R9X B;  3GLG B;  2YNM D;  1WGN A;  4BLC A;  5FTJ A;  3VDU A;  2DAG A;  3GPP A;  3FUW A;  1FNN A;  1IXS B;  1LV7 A;  3L27 A;  1E9S A;  1GL6 A;  4LJ9 A;  4DR1 M;  2XZU A;  1HR0 M;  1IFY A;  2W82 A;  3QYE A;  5EP2 A;  4GIT A;  1N36 M;  4MGK E;  2C9C A;  5DFL A;  2KRK A;  3ZH9 B;  4LF4 M;  3KVW A;  2CV2 A;  2JZ0 A;  3B7N A;  4MB7 A;  1OIZ A;  2GNO A;  4MGI E;  1Q3B A;  2JXN A;  2Y21 A;  3ZC7 B;  1VQ1 A;  2F5N A;  2DZN B;  1HT1 E;  1Y8G A;  3JR4 A;  4NC6 A;  2FNA A;  2L7H A;  1Z59 A;  4IBJ A;  4LJA A;  5FTK A;  4WP2 A;  4DBG B;  4LGY A;  1XXH A;  2R4J A;  1J5E M;  1CUK A;  5EXP A;  1NY6 A;  2KZS A;  3FYC A;  4GRI A;  4WW0 A;  2Q2E B;  5IRE B;  3FTF A;  1SG9 A;  4JV5 M;  1NVM A;  4JI4 M;  1QQW A;  1V33 A;  3LVW A;  1NNU C;  3HWS A;  1MN3 A;  4KT0 F;  1VEG A;  4JXJ A;  3V76 A;  4G4Q A;  4B7H A;  2QBY A;  5KO3 A;  2WSE F;  3I04 M;  3VKG A;  2JY6 B;  2LWX A;  4QNR A;  2UXB M;  2A5Y B;  3GQ4 A;  1GVN A;  3SHG B;  5FTN A;  3HJQ A;  4D80 A;  3HY5 A;  1AUA A;  1IXR C;  2KW0 A;  1TH3 A;  1XNQ M;  1R5L A;  3T38 A;  3HHZ A;  4JI5 M;  3SAU A;  1WR1 B;  1XB2 B;  4M9Z A;  4CJ6 A;  1PGY A;  2M5Z A;  2YQZ A;  1XC8 A;  1IN7 A;  1XMO M;  4B3S M;  2KRU A;  3HHY A;  4L16 A;  3FTC A;  4PDI A;  4DV4 M;  1UM8 A;  1EE8 A;  2WZJ A;  3HX3 A;  1SXJ C;  1ORY B;  1C7Y A;  3KP0 E;  3SMS A;  2XEP A;  2Z3X A;  4G6Z A;  2XSZ A;  3KOZ E;  1T3T A;  2L7I A;  1GKI A;  3AOG A;  2CEA A;  2ZAO A;  3JR5 A;  2CHV A;  2D7E A;  3GLG A;  1VDD A;  3Q8X A;  4L15 A;  4F1I A;  4JI0 M;  3CTW B;  1AIP C;  2LHG A;  5ITX A;  5KQD A;  4X62 M;  3GLI B;  3K9O A;  2CHG A;  3GP1 A;  3GRV A;  3I4V A;  3L2A A;  1A5T A;  4KOD A;  3VK8 A;  2KA6 B;  3GLF A;  2DI0 A;  4DV3 M;  4FD2 A;  1OKS A;  2ZAM A;  1L1T A;  1IY0 A;  4M0D A;  3HGI A;  2ZTD A;  2QEN A;  4XK8 F;  1EIJ A;  2DWZ B;  5KQ8 A;  1IBL M;  2DXI A;  3UK6 A;  4R7G A;  1JR3 E;  1N34 M;  4JI7 M;  1IM2 A;  1OJL A;  3U6M A;  3AV0 A;  5EJC A;  3HKP A;  2LVO C;  1NV9 A;  2MR9 A;  5A2Q S;  3SYL A;  4MGH A;  2H5X A;  2F4V M;  1L8Q A;  3AKZ A;  2OPF A;  2LXE A;  3U61 B;  5ITQ A;  4X64 M;  4LZZ A;  3IHP A;  1MU5 A;  3NBX X;  3GLH E;  4DR7 M;  2QCU A;  1V34 A;  3GRR A;  2N35 A;  1XXH B; 
#chains in the Genus database with same CATH homology
 3A45 A;  3KSX A;  4G4R A;  2EA0 A;  1TDH A;  3AL0 C;  2KEB A;  3SFZ A;  3FUX A;  4I81 A;  5BR8 M;  4AQY M;  5EXX A;  4LF8 M;  1QAO A;  4GH9 A;  3KOX E;  4P16 A;  4D81 A;  2C99 A;  2FFJ A;  4XBO A;  2O5R A;  1HQY E;  2VQE M;  1ZQ9 A;  4FVM A;  2DWM A;  5ITX E;  2R62 A;  5LMU M;  3FUU A;  4BBA A;  4AKH A;  3FUT A;  4LJ5 A;  3DFZ A;  4QOZ C;  7CAT A;  3FKE A;  3KSJ A;  3LVV A;  3KP1 E;  2XZF A;  5EP1 A;  4AG6 A;  4DV2 M;  4DR4 M;  4JI3 M;  3WHK A;  4M9S A;  1QYR A;  2UU9 M;  4JN6 A;  2VII A;  4OW0 A;  4B7G A;  3K1J A;  2CUZ A;  4QOS A;  4NSO B;  2J7N A;  4RF0 A;  2CV1 A;  2R18 A;  4X65 M;  4B3M M;  1GLN A;  2V6Z M;  1SXJ D;  3HJS A;  2D7H A;  4GC5 A;  3IG8 A;  4DV7 M;  2I7N A;  4OVZ B;  4X66 M;  4LF6 M;  3GLF B;  1Z5B A;  1L1Z A;  2QZ4 A;  1NJG A;  1ZAE A;  2F5S A;  3J81 S;  3RGP A;  1TH4 A;  3PXG A;  3J7A S;  2L09 A;  3MJ5 A;  4M9X A;  3L29 A;  3GPU A;  1XHB A;  2G8L A;  3CF6 E;  3ZCB B;  3PFI A;  3U61 A;  2NQ8 C;  3AFH A;  3OTO M;  1HQC A;  1G41 A;  2UXC M;  1G8P A;  1H6U A;  2XH9 A;  3PNY A;  4QHS A;  1L2B A;  4L78 A;  2XF3 A;  5BPV A;  3SAW A;  3TWL A;  3SBJ A;  1K3X A;  1X37 A;  3SAT A;  1PM5 A;  4LF5 M;  3QAU A;  3DZD A;  1HNX M;  3U6Q A;  5EXS A;  3GO8 A;  1XMQ M;  1NNJ A;  2CV0 A;  2Z4S A;  1N77 A;  4IIW A;  1IBM M;  3KW6 A;  1IY1 A;  1PJI A;  3D8B A;  5KPR A;  4NXN M;  1K3W A;  2XGN A;  4FCV A;  4LRT A;  3JAM S;  1E94 E;  3A46 A;  4GC9 A;  2KZU A;  4QHT A;  4IBE A;  4MGY E;  3L25 A;  4NL4 H;  3K8Z A;  4FWH A;  1D2N A;  4AKG A;  1KYI A;  2R4E A;  3HU1 A;  2HL7 A;  3KS4 A;  5C1B A;  1SXJ A;  3FUV A;  4IBD A;  4II7 A;  2DWN A;  3J7B A;  4FW9 A;  4DV6 M;  4B08 A;  3SAV A;  4L8R C;  4LY6 A;  3EIE A;  3KXE C;  2X8A A;  3SAS A;  4AG5 A;  5ITT A;  3NBI A;  4OVZ A;  4JYA M;  3T15 A;  4LCB A;  3UJN A;  5EQT A;  1R6B X;  3HJ8 A;  3A42 A;  2LNH C;  3J2P B;  4GIP A;  4DUZ M;  3K2L A;  3VKH A;  4KO8 A;  5C18 A;  4JI1 M;  3SHF A;  2CHQ A;  5GKN A;  1R7R A;  5EXT A;  1KFV A;  4IBC A;  2Y0T A;  4MM3 B;  4S12 A;  4XGI A;  4CHT B;  4JI6 M;  3KOW E;  4LJ6 A;  4DV5 M;  4IBI A;  4RF1 A;  1G59 A;  1E32 A;  1FJG M;  3I4Y A;  2RGH A;  3TE6 A;  3W0F A;  2DXI A;  2DHR A;  2YFQ A;  5ITR A;  4AKI A;  4IJE A;  1I4W A;  2DVW B;  3E9S A;  5JI2 E;  3L28 A;  5FSW A;  1L2C A;  4LFA M;  1NJF A;  3U5Z A;  3VK7 A;  1DGF A;  4BB9 A;  3GQ3 A;  2J7O A;  1DGH B;  1PJJ A;  2C98 A;  1J7K A;  2HKJ A;  4B3T M;  1TGU A;  3LQQ A;  2P5T A;  1G4A E;  4LRS A;  4TUW A;  2DWL A;  1YE9 A;  2LH0 A;  4REZ A;  3VFD A;  2F5O A;  3VLF B;  3DA1 A;  4NRW A;  2ZAN A;  2XFS A;  3RFW A;  3SMP A;  1DGB A;  3TL4 X;  4AI6 A;  5JI3 E;  1J09 A;  2C96 A;  3B9P A;  4LFB M;  1QAQ A;  1IQP A;  5KPZ A;  1DO0 A;  1NSF A;  1MX0 A;  2X49 A;  1R2Y A;  2BJV A;  4Z6Y A;  3RGS A;  1SXJ B;  4OX9 M;  4D82 A;  2M60 A;  8CAT A;  1N75 A;  2F5P A;  5IT9 S;  1OFH A;  1IBK M;  4L4U A;  2EUC A;  4IBK A;  2K47 A;  4CGY B;  3DOA A;  2C5R A;  1JR3 D;  2X4A A;  4LJ8 A;  3WHL A;  4GHL A;  1DGG A;  5DYI A;  2CE7 A;  3NWL A;  2XFT A;  3AOE C;  3M7G A;  3SYK A;  1IXZ A;  2BNK A;  2Z4R A;  3KS8 A;  4IBG A;  1QAM A;  1IN6 A;  3VDP A;  3U6E A;  4IJF A;  1NY5 A;  2ZM6 M;  3U6P A;  2AHM A;  4W5W A;  4DV1 M;  1XNR M;  3AJI B;  4GHA A;  1N32 M;  3U6S A;  2L6O A;  1XWI A;  3TPZ A;  4M0W A;  3U6D A;  4K0K M;  1Q3C A;  2XSZ D;  3CF0 A;  4HLQ A;  4G4O A;  3R8F A;  3MK6 A;  4JI8 M;  2OQ4 A;  3D8L A;  1IN8 A;  4PCZ A;  2Y0Q A;  1W5S A;  5ITY A;  4IBB A;  3GRU A;  2R45 A;  2V1U A;  1DGH A;  4MH0 E;  4DR5 M;  5DNY A;  1OFI A;  3GQ5 A;  1TDZ A;  3T1Y M;  2ZBK B;  3U5Z B;  1DO2 A;  1HNW M;  2ERC A;  3L26 A;  5KPT A;  3HHX A;  3FTD A;  1NHW C;  3UMM A;  2XLJ A;  2UUA M;  1Q39 A;  4WUR A;  3TWK A;  3MHV C;  4LGM A;  4B7F A;  2D7G A;  3K92 A;  4LJ7 A;  4LZJ A;  1L2D A;  1IN4 A;  4KLN A;  4RNA A;  1YSY A;  4MGZ E;  5IZ7 D;  4G4N A;  2VQF M;  4ITQ A;  4Z8X A;  4NSR A;  4CIS A;  2I7P A;  4AZF A;  4LF9 M;  3THG A;  4LG2 A;  1JR3 A;  4I4L A;  3U6O A;  1KSF X;  1QAN A;  2UUC M;  2UUB M;  4DV0 M;  1I94 M;  4IBF A;  2DZO B;  3RE8 A;  4GMQ A;  1C1K A;  2CFO A;  5DYG A;  4QNM A;  1QZM A;  4KHP M;  1TH2 A;  3GLH A;  4FCW A;  3E4R A;  3M0E A;  5FTM A;  2G5G X;  2E5L M;  5LMN M;  4NOO B;  4HL4 A;  2Y20 A;  5EP3 A;  2BJW A;  3U6C A;  3LQR A;  4FWG A;  5F3W A;  2Z7J A;  1HT2 E;  3U60 A;  3GPY A;  4EIW A;  5EP4 A;  3PNV A;  2R65 A;  3HU3 A;  3FTE A;  3GPX A;  3KFU G;  1Z5C A;  3IG5 A;  3QWL A;  4PT5 A;  3SAR A;  3H4M A;  3CF2 A;  3U6L A;  4ZPX A;  4A3V B;  2R46 A;  5H37 D;  4GKJ M;  4FWD A;  3BOS A;  1Z5A A;  2RKO A;  1SXJ E;  3EIH A;  3HU2 A;  1GL7 A;  1NHG C;  2EO2 A;  2H1R A;  1WXQ A;  1G3I A;  3GRY A;  4LFC M;  4R3D A;  2V1C A;  3FD9 A;  3HHW A;  2FOI C;  1W5T A;  3FYD A;  5E26 A;  5ITU A;  4FCT A;  3M6A A;  1N33 M;  4DR2 M;  1Z6T A;  5FTL A;  1IY2 A;  3SC3 A;  3J80 S;  1YUB A;  4YY3 M;  3ILK A;  1HNZ M;  1N78 A;  2HHH M;  4AW4 A;  3T1H M;  4GKK M;  3UZU A;  4PDG A;  2QP9 X;  3PVS A;  4JI2 M;  2QBY B;  4I8O A;  2C9O A;  2YR0 A;  3UGJ A;  4LJ4 A;  2QPA A;  5FLX S;  2UXD M;  4B3R M;  3KDS E;  3C58 A;  4DR3 M;  1E9R A;  2HCB A;  4LF7 M;  3LMM A;  3A98 B;  4OU7 A;  5E6J A;  1S3S A;  5IWA M;  2F5Q A;  2KXE A;  1QVR A;  2FE8 A;  2JA2 A;  4NXM M;  3TQS A;  4DUY M;  3GLH B;  3J27 B;  3TWM A;  1K82 A;  4DR6 M;  1R2Z A;  4NRV A;  3AOE A;  3KOY E;  4I5S A;  1IN5 A;  2RGO A;  1JQJ C;  3W0L B;  3U60 B;  4PD2 A;  3I51 A;  3GLI A;  3R9X B;  3GLG B;  2YNM D;  4BLC A;  5FTJ A;  3VDU A;  3GPP A;  3FUW A;  1FNN A;  1IXS B;  1LV7 A;  3L27 A;  1E9S A;  1GL6 A;  4LJ9 A;  4DR1 M;  2XZU A;  1HR0 M;  2W82 A;  5EP2 A;  4GIT A;  1N36 M;  4MGK E;  2C9C A;  2KRK A;  3ZH9 B;  4LF4 M;  3KVW A;  2CV2 A;  4MB7 A;  4MGI E;  1Q3B A;  2Y21 A;  3ZC7 B;  2F5N A;  2DZN B;  1HT1 E;  3JR4 A;  2FNA A;  2L7H A;  1Z59 A;  4IBJ A;  4LJA A;  5FTK A;  4LGY A;  1XXH A;  2R4J A;  1J5E M;  5EXP A;  1NY6 A;  2KZS A;  3FYC A;  4GRI A;  4WW0 A;  2Q2E B;  5IRE B;  3FTF A;  4JV5 M;  1NVM A;  4JI4 M;  1QQW A;  3LVW A;  1NNU C;  3HWS A;  4JXJ A;  4G4Q A;  4B7H A;  2QBY A;  5KO3 A;  3VKG A;  2LWX A;  4QNR A;  2UXB M;  2A5Y B;  3GQ4 A;  1GVN A;  3SHG B;  5FTN A;  3HJQ A;  4D80 A;  1IXR C;  2KW0 A;  1TH3 A;  1XNQ M;  3T38 A;  3HHZ A;  4JI5 M;  3SAU A;  4M9Z A;  2M5Z A;  2YQZ A;  1XC8 A;  1IN7 A;  1XMO M;  4B3S M;  2KRU A;  3HHY A;  4L16 A;  3FTC A;  4PDI A;  4DV4 M;  1UM8 A;  1EE8 A;  1SXJ C;  1ORY B;  3KP0 E;  3SMS A;  2XEP A;  2Z3X A;  4G6Z A;  2XSZ A;  3KOZ E;  1T3T A;  2L7I A;  1GKI A;  3AOG A;  2CEA A;  2ZAO A;  3JR5 A;  2CHV A;  2D7E A;  3GLG A;  1VDD A;  3Q8X A;  4L15 A;  4JI0 M;  3CTW B;  5ITX A;  5KQD A;  4X62 M;  3GLI B;  2CHG A;  3GP1 A;  3GRV A;  3I4V A;  3L2A A;  4KOD A;  3VK8 A;  2KA6 B;  3GLF A;  4DV3 M;  1L1T A;  4FD2 A;  2ZAM A;  1IY0 A;  4M0D A;  3HGI A;  2QEN A;  2DWZ B;  5KQ8 A;  1IBL M;  3UK6 A;  4R7G A;  1N34 M;  4JI7 M;  1IM2 A;  1OJL A;  3U6M A;  3AV0 A;  5EJC A;  3HKP A;  2F4V M;  5A2Q S;  3SYL A;  4MGH A;  1L8Q A;  3AKZ A;  2OPF A;  2LXE A;  3U61 B;  5ITQ A;  4X64 M;  4LZZ A;  1MU5 A;  4DR7 M;  2QCU A;  4YHH M;  3GRR A;  1XXH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...