2DWMA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*T)-3'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 16
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwmA01
2DWLA 2D7GA 2D7HA 2DWNA 2D7EA 2DWMA 4NL4H
chains in the Genus database with same CATH superfamily
3T38A 3U61B 5EP3A 3QYBA 4FVMA 3FTEA 1ZMUA 2DWMA 2R44A 4LRTA 1XWIA 3JR4A 3LQQA 2EKKA 1YLAA 4RNAA 2UXDM 3M0EA 1V92A 3TWKA 1N32M 2VF8A 3GLHA 5EXPA 4LJ5A 4LFBM 2LVNC 3KOXE 2L4EA 3DA1A 2CHVA 5ITXA 2R46A 4IBGA 3U60A 3R8FA 3B7QA 2LTUA 1IN6A 2I7NA 4F1IA 2YNMD 3HHXA 3VK8A 3HJQA 2G3QA 3VDUA 2R65A 2O01F 4JI7M 1NNJA 4DR6M 4AQYM 4G6ZA 4WURA 1GKIA 2DWZB 2KRUA 1EFUB 2DHRA 4RKUF 3LW5F 3DZDA 3FTDA 2YFQA 4OW0A 5E6JA 4I81A 5IWAM 4AKHA 3GLFE 3U5ZA 1HQCA 2DHYA 2H5XA 2Z4SA 3IHPA 3C3EA 2ZTDA 1G41A 3U6CA 1L1ZA 4IBKA 4LJAA 3JR5A 2QENA 3B74A 5EQTA 3SARA 4GHAA 5H37D 4LG2A 4OX9M 5EP1A 2CV1A 4IJFA 3T6PA 4AKGA 1QDRA 4X65M 2J7NA 3ILKA 3MHVC 4P16A 4GC5A 1K82A 1YE9A 2KZUA 3SBJA 1J5EM 5EJCA 3UMMA 2WSFF 3A45A 3LVVA 3K9OA 2C9OA 4NL4H 2QHOB 5C1BA 4WP2A 3D8BA 2D7GA 3HZJA 2FOIC 1LTMA 1UM8A 4LF6M 5FLXS 5IT9S 3NBXX 3SMSA 2QZ4A 4LJ4A 3CF2A 4JI0M 1ORYB 3K8ZA 1HNZM 2FNAA 2VF7A 2EUCA 2LHCA 2Q2EB 3GLHE 4LF7M 3W0LB 2JY8A 4M0DA 2DZLA 4PDIA 5ITXE 2ZAMA 1IY0A 1MN3A 2DWLA 1BVSA 2JUJA 1NY6A 2V6ZM 3LCUA 4B3MM 2LBCA 1R2YA 3GPXA 3E4RA 2KNZA 3SATA 4DUYM 1DGHB 1DV0A 2AHMA 3MK6A 4IBEA 2ZANA 4DV2M 4UN2B 3TL4X 4B3TM 2QCUA 4Q7JA 3U6SA 5ITQA 2JA2A 3K9PA 4X66M 3GRYA 3AKZA 3UK6A 2J7OA 2KA6B 3TWLA 4DV5M 1VEJA 2DAKA 4G4QA 2XZUA 1GL6A 4DBGB 2JP7A 2J5YA 4QNRA 1VDLA 4OVZB 1D0KA 4BB9A 4G4OA 2C5RA 4DV4M 3GQ5A 4GHLA 4LZJA 3SYLA 1SXJA 2R45A 3B7NA 4D81A 5DYGA 1GLNA 2EO2A 4JI6M 1WIVA 3MMPA 3FUTA 3LCVB 4GKKM 2OO9A 4AG6A 3KSJA 2HAKA 3PFIA 3J81S 3GP1A 4JYAM 2ZM6M 1X37A 2XSZD 3M6AA 3HU1A 3QAUA 4CISA 2KNAA 4G4RA 4DR7M 1KSFX 1N78A 1NO1A 4DR1M 2KZSA 4DV7M 4GEWA 3GPYA 3IECA 5EP4A 3KW6A 2BNKA 3KP1E 4PDGA 2Z3XA 3JAMS 4NSRA 4MGYE 2VDBB 3GLFB 3C9PA 3HKPA 3UGJA 1OQYA 4DR3M 2W82A 1YUBA 1J09A 1E9SA 1YSYA 2MR9A 3Q8GA 2LXEA 5FTKA 1R4GA 2DZOB 5EXXA 3ZQJA 1VG5A 1L2BA 3C58A 3GLGE 1L8QA 1S3SA 2DWNA 1N33M 3FUUA 2CFOA 3RGSA 4CGYB 4R7GA 4NSOB 4A3VB 2BWBA 4NXNM 1RU3A 1Z5BA 4B3SM 2QSFX 3T1YM 3LQRA 4JI1M 4Z8XA 1QAMA 1HT2E 1TH3A 2L09A 3VFDA 1AUAA 2X4AA 2I7PA 2QPAA 3HJSA 2DI0A 4FWHA 1L2CA 1WJ7A 2DKLA 1SXJE 5EP2A 5F3WA 1F4IA 4WW0A 3D8LA 3GLHB 3QWLA 1OKSA 2KRKA 4RF1A 4CJ6A 3TWMA 5KO3A 4L78A 2MH8A 4D80A 3U6LA 3U60B 4FD2A 3CF6E 1PGYA 3VLFB 2LVOC 1N77A 4YHHM 1TDHA 1R6BX 2N35A 1PRBA 3BOSA 2HWJA 1HT1E 4M9XA 4JI4M 2HHHM 1Q3CA 2Y0TA 3L25A 1QUTA 2JWSA 4AG5A 1PJSA 1K3XA 2JY6B 1GL7A 4FW9A 2JZ1A 1XMQM 1PM5A 1EE8A 3HU3A 2C9CA 2UUBM 1Z6TA 1NVMA 1V33A 3HJ8A 4AZFA 4REZA 2ERCA 3GLIA 1JR3D 1SG9A 3H4JA 3DOAA 4F2LA 2QBYA 2WSEF 3BXWA 5C18A 2OPFA 3W68A 2CP8A 3HGIA 1R2ZA 1ZAEA 4GC9A 3FRHA 4GH9A 1G3IA 3AOEA 3FUWA 2MROB 4X62M 4PCZA 3PNYA 2F5QA 2QP9X 4LF4M 4KHPM 3AFHA 1HR0M 1QAQA 1AIPC 1NHGC 4JI3M 3J7AS 4MGIE 3NWLA 4CHTB 1MU5A 4I5SA 3GO8A 4HEOA 1WR1B 2VQFM 5JI3E 1ZV1A 4DR4M 3FYDA 3RE8A 1NV8A 3A42A 3AV0A 2CV0A 3THGA 2Y0QA 4II7A 4IJEA 2RGHA 5IZ7D 1NJFA 1QUSA 4MGZE 1EIJA 1DGGA 5KQ8A 4EIWA 1QYRA 3AOEC 5E26A 2KHHA 1R7RA 1G59A 3GLGB 3E46A 1PJQA 1TTEA 4JI2M 3K2LA 2DENA 3TE6A 1CUKA 3HHYA 5ITTA 3E9SA 4DV6M 1VEKA 2L7HA 4IBFA 3QYEA 4NRWA 2R62A 2UUCM 4DR5M 4QOZC 3PNVA 1MJGM 2Z4RA 1N75A 2DAEA 3J80S 2LVQD 1OIZA 3U6PA 2FS1A 1SXJB 5EXSA 1XHBA 3ZCBB 3SHFA 5KPZA 2E5LM 2HL7A 1XXHA 1ZMWA 2K0BX 1IQPA 1OAIA 4BBAA 1IBMM 3PVSA 5IREB 2HKJA 2A5YB 3BBZA 2UXBM 3W0FA 3GPPA 1FJGM 2UXCM 4LZZA 1TH4A 1Q3BA 1VEGA 2XF3A 3FUVA 2P5TA 3U6QA 1XB2B 3KFUG 2QQ8A 3WHLA 2YQZA 1LV7A 3AL0C 3PXGA 1VDDA 5FTMA 4LF9M 4B7HA 3VKGA 1TR8A 4XGIA 3GRRA 2DAMA 1DO0A 1T43A 4DUZM 2JZ0A 4DV0M 1QZMA 1JR3A 1KFVA 2F5PA 1G4AE 2XGNA 8CATA 3KOZE 1Z5AA 1DGHA 2RKOA 4ITQA 1IXZA 2WSCF 4G4NA 2LNHC 2CUZA 3RFWA 3KOYE 3U6EA 2UU9M 1N36M 4TUWA 2XEPA 3KXEC 2D7EA 4PT5A 1C1KA 2R4JA 1IXSA 3SAUA 4LF5M 2ZAOA 4LRSA 3SHGB 3B89A 1GVNA 1V34A 1PJIA 1L1TA 3B9PA 1IBLM 3E21A 2M60A 4JI8M 4JXJA 1XXHE 1TF0B 2KXEA 3FTFA 2O25A 3AOGA 3KP0E 4JN6A 2UUAM 2V1CA 4QNMA 3LMMA 1NY5A 2L7IA 5FTJA 4DV3M 4S12A 2G8LA 3AJIB 4GRIA 4DR2M 1OIPA 3I01M 1TH2A 7CATA 3HU2A 4NC6A 1HNWM 1Q02A 2VIIA 1TDZA 3T15A 2OOAA 5FTLA 1IM2A 1D0MA 2R18A 4L8RC 4FWGA 2L4FA 4M0WA 2KNVA 2Z7JA 3FRIA 3SASA 3I04M 4D82A 4JI5M 3CF0A 4LJ8A 2QBYB 3DFZA 4GKJM 2ZBKB 4XK8F 4R3DA 3A46A 3GLFA 4XBOA 5EXTA 1ZMVA 5ITRA 4B3RM 2BJVA 4JV5M 1PJJA 1QQWA 2RRUA 4X64M 1NV9A 4M9SA 3B7ZA 1JB0F 2V1UA 1VQ1A 2Z8YM 5A2QS 3L26A 4YY3M 3U5ZB 2XFSA 3C3DA 1W5TA 3SC3A 2JY5A 3TQSA 1HQYE 3I51A 1DGBA 1G8PA 2L2DA 2R6FA 4AI6A 2GQFA 4CIZA 2KDLA 5KQDA 4KODA 2F5NA 3HX3A 3IG5A 2K9DA 2F4VM 1OFHA 1OAOC 1QAOA 1SXJD 2F5OA 3MJ5A 3GQ4A 2KW0A 3FYCA 4NRVA 1D2NA 2CRUA 4Z6YA 2H1RA 1KYIA 4LY6A 1WXQA 2OOBA 2JY7A 3U61A 2XSZA 1G71A 1QZEA 2C96A 2XZFA 4LCBA 2Y20A 3I4YA 4KO8A 3SYKA 3H4MA 2FFJA 3FTCA 2K47A 1WHCA 3HWSA 1OTRA 5GKNA 1QDTA 4DV1M 1Z59A 2DXIA 3OTOM 3GQ3A 3K1JA 5DFLA 1QANA 5KPTA 2CWBA 4LJ6A 5BR8M 1QVRA 2RGOA 3J27B 5DYIA 2FE8A 3KOWE 4OU7A 1XXHB 2LWXA 2C99A 1XC8A 4HL4A 4AW4A 1GJTA 2D7HA 4B7GA 2BJWA 3RGPA 4MB7A 3J2PB 1NNUC 3GLIE 1J7KA 3FE3A 4IIWA 1DGFA 1IY1A 2Y21A 3IG8A 1IFYA 2LH0A 4ANRA 1OFIA 4FCVA 2WZJA 3KS8A 1I4WA 3KVWA 1K3WA 1OJLA 5LMUM 1MX0A 3VKHA 4AKIA 2R0IA 4IBJA 5DNYA 2DNAA 3ZH9B 4MM3B 4MGHA 3SFZA 1L2DA 2L6OA 1E32A 3WHKA 1PJTA 3M7GA 4L16A 3A98B 2F5SA 2EKFA 4LGMA 4RF0A 3HHWA 3FUXA 1XNRM 2KEBA 1E9RA 3NBIA 3U6OA 1NJGA 2MGWA 2CV2A 1UFZA 4LGYA 1T6OA 2MJ5B 2XH9A 3EIHA 2NQ8C 2K6BA 3GLGA 1E94E 3KSXA 4IBDA 3ZC7B 2O5RA 1A5TA 1IXSB 2G5GX 3UZUA 3U6DA 1XNQM 4K0KM 1XMOM 3K92A 4FCWA 3EIEA 4IBCA 4LJ9A 4GIPA 1Q39A 3L28A 4NOOB 5FTNA 4LJ7A 4R71A 3U6MA 3TPZA 3VK7A 2X8AA 1HNXM 5JI2E 2FH0A 1IN5A 4L15A 5BPVA 2LVPC 5KPRA 3R9XB 2HCBA 1IXRC 1WGNA 2YR0A 4L6V6 3KS4A 3J7BA 5ITUA 2X49A 4MGKE 4Y28F 4LFAM 3L29A 4L4UA 1I94M 2DVWB 1Z5CA 2JXNA 4W5WA 4I4LA 2GNOA 1Y8GA 2DAIA 2XFTA 5LMNM 4QOSA 1IBKM 4KLNA 4OVZA 3FKEA 3V76A 1HJPA 4LF8M 1P3QQ 5FSWA 2VQEM 3L27A 1JQJC 3L2AA 4G3OA 1NHWC 2CHGA 5L8RF 3UJNA 4GITA 4I8OA 1GO5A 3I4VA 4IBIA 1N34M 3CTWB 4GMQA 2DZNB 1C7YA 2CHQA 3SAWA 2C98A 2B3TA 4FCTA 4PD2A 2DAGA 2LHGA 4QHTA 2JNHA 2R4EA 3KDSE 4BLCA 4NXMM 1SXJC 3Q8XA 1T3TA 2CE7A 2CEAA 3GRVA 4P17A 3T1HM 1DO2A 3F92A 4M9ZA 4LFCM 1H6UA 1FNNA 3GLIB 1NSFA 1IY2A 1TGUA 2OQ4A 1JR3E 2M5ZA 4FWDA 2XLJA 3W67A 2BWEA 1IN7A 4QHSA 1IN8A 4B7FA 3SAVA 1GABA 1WGLA 3GRUA 1D0LA 1GJSA 2ZTCA 5ITYA 1IN4A 3LVWA 3VDPA 3HHZA 2EA0A 4KT0F 1W5SA 4HLQA 1R5LA 3FD9A 2EJSA 2APLA 3SMPA 3GPUA 3CGWA 4IBBA 4B08A 4MH0E 2LVAA 4ZPXA 1ZQ9A 3HY5A 2QNJA
chains in the Genus database with same CATH topology
3T38A 3U61B 5EP3A 4FVMA 3FTEA 2DWMA 4LRTA 1XWIA 3JR4A 3LQQA 2UXDM 4RNAA 3M0EA 3TWKA 1N32M 3GLHA 5EXPA 4LJ5A 4LFBM 3KOXE 3DA1A 2CHVA 5ITXA 2R46A 4IBGA 3U60A 3R8FA 1IN6A 2I7NA 2YNMD 3HHXA 3VK8A 3HJQA 3VDUA 2R65A 4JI7M 4DR6M 1NNJA 4AQYM 4G6ZA 4WURA 1GKIA 2DWZB 2KRUA 2DHRA 5E6JA 4OW0A 3DZDA 3FTDA 2YFQA 5IWAM 4AKHA 4I81A 3U5ZA 1HQCA 2Z4SA 1G41A 3U6CA 1L1ZA 4IBKA 4LJAA 3JR5A 2QENA 5EQTA 3SARA 4GHAA 5H37D 4LG2A 4OX9M 5EP1A 2CV1A 4IJFA 4AKGA 4X65M 2J7NA 3ILKA 3MHVC 4P16A 4GC5A 1K82A 1YE9A 2KZUA 3SBJA 1J5EM 5EJCA 3UMMA 3A45A 3LVVA 4NL4H 2C9OA 5C1BA 3D8BA 2D7GA 2FOIC 5IT9S 1UM8A 4LF6M 5FLXS 3SMSA 2QZ4A 4LJ4A 3CF2A 4JI0M 1ORYB 3K8ZA 1HNZM 2FNAA 2EUCA 2Q2EB 4LF7M 3W0LB 4M0DA 4PDIA 5ITXE 2ZAMA 1IY0A 2DWLA 4B3MM 1NY6A 2V6ZM 1R2YA 3GPXA 3E4RA 3SATA 4DUYM 1DGHB 2AHMA 3MK6A 4IBEA 2ZANA 4DV2M 3TL4X 4B3TM 2QCUA 3U6SA 5ITQA 2JA2A 4X66M 3GRYA 3AKZA 3UK6A 2J7OA 2KA6B 3TWLA 4DV5M 4G4QA 2XZUA 1GL6A 4QNRA 4OVZB 4BB9A 4G4OA 2C5RA 4DV4M 3GQ5A 4GHLA 4LZJA 3SYLA 1SXJA 2R45A 4D81A 5DYGA 1GLNA 2EO2A 4JI6M 3FUTA 4GKKM 4AG6A 3KSJA 3PFIA 3J81S 3GP1A 4JYAM 2ZM6M 1X37A 2XSZD 3M6AA 3HU1A 3QAUA 4CISA 4G4RA 4DR7M 1KSFX 1N78A 4DR1M 2KZSA 4DV7M 3GPYA 5EP4A 3KW6A 2BNKA 3KP1E 4PDGA 2Z3XA 3JAMS 4NSRA 4MGYE 3GLFB 3HKPA 3UGJA 4DR3M 2W82A 1YUBA 1J09A 1E9SA 1YSYA 2LXEA 5FTKA 2DZOB 5EXXA 1L2BA 3C58A 1L8QA 1S3SA 2DWNA 1N33M 3FUUA 2CFOA 3RGSA 4CGYB 4R7GA 4NSOB 4A3VB 4NXNM 1Z5BA 4B3SM 4JI1M 3T1YM 3LQRA 4Z8XA 1QAMA 1HT2E 1TH3A 2L09A 3VFDA 2X4AA 2I7PA 2QPAA 3HJSA 4FWHA 1L2CA 5EP2A 1SXJE 5F3WA 4WW0A 3D8LA 3GLHB 3QWLA 2KRKA 4RF1A 3TWMA 5KO3A 4L78A 4D80A 3U6LA 3U60B 4FD2A 3CF6E 3VLFB 1N77A 4YHHM 1TDHA 1R6BX 3BOSA 4M9XA 1HT1E 4JI4M 2HHHM 1Q3CA 2Y0TA 4AG5A 1K3XA 1GL7A 4FW9A 1XMQM 1PM5A 1EE8A 3HU3A 2C9CA 2UUBM 1Z6TA 1NVMA 3HJ8A 4AZFA 4REZA 2ERCA 3GLIA 1JR3D 3DOAA 2QBYA 5C18A 2OPFA 3HGIA 1R2ZA 1ZAEA 4GC9A 4GH9A 1G3IA 3AOEA 3FUWA 4X62M 4PCZA 3PNYA 2F5QA 2QP9X 4LF4M 4KHPM 3AFHA 1HR0M 1QAQA 1NHGC 4JI3M 3J7AS 4MGIE 3NWLA 4CHTB 1MU5A 4I5SA 3GO8A 2VQFM 5JI3E 4DR4M 3FYDA 3RE8A 3A42A 3AV0A 2CV0A 3THGA 2Y0QA 4II7A 4IJEA 2RGHA 5IZ7D 1NJFA 4MGZE 1DGGA 5KQ8A 4EIWA 1QYRA 3AOEC 5E26A 1R7RA 1G59A 3GLGB 4JI2M 3K2LA 3TE6A 5ITTA 3HHYA 3E9SA 4DV6M 2L7HA 4NRWA 2R62A 2UUCM 4DR5M 4QOZC 3PNVA 2Z4RA 1N75A 3J80S 3U6PA 1SXJB 5EXSA 1XHBA 3ZCBB 3SHFA 5KPZA 2E5LM 2HL7A 1XXHA 1IQPA 4BBAA 1IBMM 3PVSA 5IREB 2HKJA 2A5YB 2UXBM 2UXCM 3W0FA 3GPPA 1FJGM 4LZZA 1TH4A 1Q3BA 2XF3A 3FUVA 2P5TA 3U6QA 3KFUG 3WHLA 2YQZA 1LV7A 3AL0C 3PXGA 1VDDA 5FTMA 4LF9M 4B7HA 3VKGA 4XGIA 3GRRA 1DO0A 4DUZM 4DV0M 1QZMA 1JR3A 1KFVA 2F5PA 1G4AE 2XGNA 8CATA 3KOZE 1Z5AA 1DGHA 2RKOA 4ITQA 1IXZA 4G4NA 2LNHC 2CUZA 3RFWA 3KOYE 3U6EA 2UU9M 1N36M 4TUWA 2XEPA 3KXEC 2D7EA 4PT5A 1C1KA 2R4JA 3SAUA 4LF5M 2ZAOA 4LRSA 3SHGB 1GVNA 1PJIA 1IBLM 1L1TA 3B9PA 4JI8M 2M60A 4JXJA 3FTFA 2KXEA 3KP0E 3AOGA 4JN6A 2UUAM 2V1CA 4QNMA 3LMMA 1NY5A 2L7IA 5FTJA 4DV3M 4S12A 2G8LA 3AJIB 4GRIA 4DR2M 1TH2A 7CATA 3HU2A 1HNWM 2VIIA 1TDZA 3T15A 5FTLA 1IM2A 2R18A 4L8RC 4FWGA 4M0WA 2Z7JA 3SASA 4D82A 4JI5M 3CF0A 4LJ8A 2QBYB 3DFZA 4GKJM 2ZBKB 3A46A 4R3DA 3GLFA 4XBOA 5EXTA 5ITRA 4B3RM 2BJVA 4JV5M 1PJJA 1QQWA 4X64M 4M9SA 2V1UA 5A2QS 3L26A 4YY3M 3U5ZB 2XFSA 1W5TA 3SC3A 3TQSA 1HQYE 3I51A 1DGBA 1G8PA 4AI6A 5KQDA 4KODA 2F5NA 3IG5A 2F4VM 1OFHA 1QAOA 1SXJD 2F5OA 3MJ5A 3GQ4A 2KW0A 3FYCA 4NRVA 1D2NA 4Z6YA 2H1RA 1KYIA 4LY6A 1WXQA 3U61A 2XSZA 2C96A 2XZFA 4LCBA 2Y20A 3I4YA 4KO8A 3SYKA 3H4MA 2FFJA 3FTCA 2K47A 3HWSA 5GKNA 2DXIA 4DV1M 1Z59A 3OTOM 3GQ3A 3K1JA 1QANA 5KPTA 4LJ6A 5BR8M 1QVRA 2RGOA 3J27B 5DYIA 2FE8A 3KOWE 4OU7A 1XXHB 2LWXA 2C99A 1XC8A 4HL4A 4AW4A 2D7HA 4B7GA 2BJWA 3RGPA 4MB7A 3J2PB 1NNUC 1J7KA 4IIWA 1DGFA 1IY1A 2Y21A 3IG8A 2LH0A 1OFIA 4FCVA 3KS8A 1I4WA 3KVWA 1K3WA 1OJLA 5LMUM 1MX0A 3VKHA 4AKIA 4IBJA 5DNYA 3ZH9B 4MM3B 4MGHA 3SFZA 1L2DA 2L6OA 1E32A 3WHKA 3M7GA 4L16A 3A98B 2F5SA 4LGMA 4RF0A 3HHWA 3FUXA 1XNRM 2KEBA 1E9RA 3NBIA 3U6OA 1NJGA 2CV2A 4LGYA 3EIHA 2XH9A 2NQ8C 3GLGA 1E94E 3KSXA 4IBDA 3ZC7B 2O5RA 1IXSB 2G5GX 3UZUA 3U6DA 1XNQM 4K0KM 1XMOM 3K92A 4FCWA 3EIEA 4IBCA 4LJ9A 4GIPA 1Q39A 3L28A 4NOOB 5FTNA 4LJ7A 3U6MA 3TPZA 3VK7A 2X8AA 1HNXM 5JI2E 1IN5A 4L15A 5BPVA 5KPRA 3R9XB 2HCBA 1IXRC 2YR0A 3KS4A 3J7BA 5ITUA 2X49A 4MGKE 4LFAM 3L29A 4L4UA 1I94M 2DVWB 1Z5CA 4W5WA 4I4LA 2XFTA 5LMNM 4QOSA 1IBKM 4KLNA 4OVZA 3FKEA 4LF8M 5FSWA 2VQEM 3L27A 1JQJC 3L2AA 1NHWC 2CHGA 3UJNA 4GITA 4I8OA 3I4VA 4IBIA 1N34M 3CTWB 4GMQA 2DZNB 2CHQA 3SAWA 2C98A 3L25A 4FCTA 4PD2A 4QHTA 3KDSE 2R4EA 4BLCA 4NXMM 1SXJC 3Q8XA 1T3TA 2CE7A 2CEAA 3GRVA 3T1HM 1DO2A 4M9ZA 4LFCM 1H6UA 1FNNA 3GLIB 1NSFA 1IY2A 1TGUA 2OQ4A 4FWDA 2M5ZA 2XLJA 1IN7A 4QHSA 1IN8A 4B7FA 3SAVA 3GRUA 5ITYA 1IN4A 3LVWA 3VDPA 3HHZA 2EA0A 1W5SA 4HLQA 3FD9A 3GPUA 3SMPA 4IBBA 4B08A 4MH0E 4ZPXA 1ZQ9A 4IBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWL A;  2D7G A;  2D7H A;  2DWN A;  2D7E A;  2DWM A;  4NL4 H; 
#chains in the Genus database with same CATH topology
 3T38 A;  3U61 B;  5EP3 A;  3QYB A;  4FVM A;  3FTE A;  1ZMU A;  2DWM A;  2R44 A;  4LRT A;  1XWI A;  3JR4 A;  3LQQ A;  2EKK A;  1YLA A;  4RNA A;  2UXD M;  3M0E A;  1V92 A;  3TWK A;  1N32 M;  2VF8 A;  3GLH A;  5EXP A;  4LJ5 A;  4LFB M;  2LVN C;  3KOX E;  2L4E A;  3DA1 A;  2CHV A;  5ITX A;  2R46 A;  4IBG A;  3U60 A;  3R8F A;  3B7Q A;  2LTU A;  1IN6 A;  2I7N A;  4F1I A;  2YNM D;  3HHX A;  3VK8 A;  3HJQ A;  2G3Q A;  3VDU A;  2R65 A;  2O01 F;  4JI7 M;  1NNJ A;  4DR6 M;  4AQY M;  4G6Z A;  4WUR A;  1GKI A;  2DWZ B;  2KRU A;  1EFU B;  2DHR A;  4RKU F;  3LW5 F;  3DZD A;  3FTD A;  2YFQ A;  4OW0 A;  5E6J A;  4I81 A;  5IWA M;  4AKH A;  3GLF E;  3U5Z A;  1HQC A;  2DHY A;  2H5X A;  2Z4S A;  3IHP A;  3C3E A;  2ZTD A;  1G41 A;  3U6C A;  1L1Z A;  4IBK A;  4LJA A;  3JR5 A;  2QEN A;  3B74 A;  5EQT A;  3SAR A;  4GHA A;  5H37 D;  4LG2 A;  4OX9 M;  5EP1 A;  2CV1 A;  4IJF A;  3T6P A;  4AKG A;  1QDR A;  4X65 M;  2J7N A;  3ILK A;  3MHV C;  4P16 A;  4GC5 A;  1K82 A;  1YE9 A;  2KZU A;  3SBJ A;  1J5E M;  5EJC A;  3UMM A;  2WSF F;  3A45 A;  3LVV A;  3K9O A;  2C9O A;  4NL4 H;  2QHO B;  5C1B A;  4WP2 A;  3D8B A;  2D7G A;  3HZJ A;  2FOI C;  1LTM A;  1UM8 A;  4LF6 M;  5FLX S;  5IT9 S;  3NBX X;  3SMS A;  2QZ4 A;  4LJ4 A;  3CF2 A;  4JI0 M;  1ORY B;  3K8Z A;  1HNZ M;  2FNA A;  2VF7 A;  2EUC A;  2LHC A;  2Q2E B;  3GLH E;  4LF7 M;  3W0L B;  2JY8 A;  4M0D A;  2DZL A;  4PDI A;  5ITX E;  2ZAM A;  1IY0 A;  1MN3 A;  2DWL A;  1BVS A;  2JUJ A;  1NY6 A;  2V6Z M;  3LCU A;  4B3M M;  2LBC A;  1R2Y A;  3GPX A;  3E4R A;  2KNZ A;  3SAT A;  4DUY M;  1DGH B;  1DV0 A;  2AHM A;  3MK6 A;  4IBE A;  2ZAN A;  4DV2 M;  4UN2 B;  3TL4 X;  4B3T M;  2QCU A;  4Q7J A;  3U6S A;  5ITQ A;  2JA2 A;  3K9P A;  4X66 M;  3GRY A;  3AKZ A;  3UK6 A;  2J7O A;  2KA6 B;  3TWL A;  4DV5 M;  1VEJ A;  2DAK A;  4G4Q A;  2XZU A;  1GL6 A;  4DBG B;  2JP7 A;  2J5Y A;  4QNR A;  1VDL A;  4OVZ B;  1D0K A;  4BB9 A;  4G4O A;  2C5R A;  4DV4 M;  3GQ5 A;  4GHL A;  4LZJ A;  3SYL A;  1SXJ A;  2R45 A;  3B7N A;  4D81 A;  5DYG A;  1GLN A;  2EO2 A;  4JI6 M;  1WIV A;  3MMP A;  3FUT A;  3LCV B;  4GKK M;  2OO9 A;  4AG6 A;  3KSJ A;  2HAK A;  3PFI A;  3J81 S;  3GP1 A;  4JYA M;  2ZM6 M;  1X37 A;  2XSZ D;  3M6A A;  3HU1 A;  3QAU A;  4CIS A;  2KNA A;  4G4R A;  4DR7 M;  1KSF X;  1N78 A;  1NO1 A;  4DR1 M;  2KZS A;  4DV7 M;  4GEW A;  3GPY A;  3IEC A;  5EP4 A;  3KW6 A;  2BNK A;  3KP1 E;  4PDG A;  2Z3X A;  3JAM S;  4NSR A;  4MGY E;  2VDB B;  3GLF B;  3C9P A;  3HKP A;  3UGJ A;  1OQY A;  4DR3 M;  2W82 A;  1YUB A;  1J09 A;  1E9S A;  1YSY A;  2MR9 A;  3Q8G A;  2LXE A;  5FTK A;  1R4G A;  2DZO B;  5EXX A;  3ZQJ A;  1VG5 A;  1L2B A;  3C58 A;  3GLG E;  1L8Q A;  1S3S A;  2DWN A;  1N33 M;  3FUU A;  2CFO A;  3RGS A;  4CGY B;  4R7G A;  4NSO B;  4A3V B;  2BWB A;  4NXN M;  1RU3 A;  1Z5B A;  4B3S M;  2QSF X;  3T1Y M;  3LQR A;  4JI1 M;  4Z8X A;  1QAM A;  1HT2 E;  1TH3 A;  2L09 A;  3VFD A;  1AUA A;  2X4A A;  2I7P A;  2QPA A;  3HJS A;  2DI0 A;  4FWH A;  1L2C A;  1WJ7 A;  2DKL A;  1SXJ E;  5EP2 A;  5F3W A;  1F4I A;  4WW0 A;  3D8L A;  3GLH B;  3QWL A;  1OKS A;  2KRK A;  4RF1 A;  4CJ6 A;  3TWM A;  5KO3 A;  4L78 A;  2MH8 A;  4D80 A;  3U6L A;  3U60 B;  4FD2 A;  3CF6 E;  1PGY A;  3VLF B;  2LVO C;  1N77 A;  4YHH M;  1TDH A;  1R6B X;  2N35 A;  1PRB A;  3BOS A;  2HWJ A;  1HT1 E;  4M9X A;  4JI4 M;  2HHH M;  1Q3C A;  2Y0T A;  3L25 A;  1QUT A;  2JWS A;  4AG5 A;  1PJS A;  1K3X A;  2JY6 B;  1GL7 A;  4FW9 A;  2JZ1 A;  1XMQ M;  1PM5 A;  1EE8 A;  3HU3 A;  2C9C A;  2UUB M;  1Z6T A;  1NVM A;  1V33 A;  3HJ8 A;  4AZF A;  4REZ A;  2ERC A;  3GLI A;  1JR3 D;  1SG9 A;  3H4J A;  3DOA A;  4F2L A;  2QBY A;  2WSE F;  3BXW A;  5C18 A;  2OPF A;  3W68 A;  2CP8 A;  3HGI A;  1R2Z A;  1ZAE A;  4GC9 A;  3FRH A;  4GH9 A;  1G3I A;  3AOE A;  3FUW A;  2MRO B;  4X62 M;  4PCZ A;  3PNY A;  2F5Q A;  2QP9 X;  4LF4 M;  4KHP M;  3AFH A;  1HR0 M;  1QAQ A;  1AIP C;  1NHG C;  4JI3 M;  3J7A S;  4MGI E;  3NWL A;  4CHT B;  1MU5 A;  4I5S A;  3GO8 A;  4HEO A;  1WR1 B;  2VQF M;  5JI3 E;  1ZV1 A;  4DR4 M;  3FYD A;  3RE8 A;  1NV8 A;  3A42 A;  3AV0 A;  2CV0 A;  3THG A;  2Y0Q A;  4II7 A;  4IJE A;  2RGH A;  5IZ7 D;  1NJF A;  1QUS A;  4MGZ E;  1EIJ A;  1DGG A;  5KQ8 A;  4EIW A;  1QYR A;  3AOE C;  5E26 A;  2KHH A;  1R7R A;  1G59 A;  3GLG B;  3E46 A;  1PJQ A;  1TTE A;  4JI2 M;  3K2L A;  2DEN A;  3TE6 A;  1CUK A;  3HHY A;  5ITT A;  3E9S A;  4DV6 M;  1VEK A;  2L7H A;  4IBF A;  3QYE A;  4NRW A;  2R62 A;  2UUC M;  4DR5 M;  4QOZ C;  3PNV A;  1MJG M;  2Z4R A;  1N75 A;  2DAE A;  3J80 S;  2LVQ D;  1OIZ A;  3U6P A;  2FS1 A;  1SXJ B;  5EXS A;  1XHB A;  3ZCB B;  3SHF A;  5KPZ A;  2E5L M;  2HL7 A;  1XXH A;  1ZMW A;  2K0B X;  1IQP A;  1OAI A;  4BBA A;  1IBM M;  3PVS A;  5IRE B;  2HKJ A;  2A5Y B;  3BBZ A;  2UXB M;  3W0F A;  3GPP A;  1FJG M;  2UXC M;  4LZZ A;  1TH4 A;  1Q3B A;  1VEG A;  2XF3 A;  3FUV A;  2P5T A;  3U6Q A;  1XB2 B;  3KFU G;  2QQ8 A;  3WHL A;  2YQZ A;  1LV7 A;  3AL0 C;  3PXG A;  1VDD A;  5FTM A;  4LF9 M;  4B7H A;  3VKG A;  1TR8 A;  4XGI A;  3GRR A;  2DAM A;  1DO0 A;  1T43 A;  4DUZ M;  2JZ0 A;  4DV0 M;  1QZM A;  1JR3 A;  1KFV A;  2F5P A;  1G4A E;  2XGN A;  8CAT A;  3KOZ E;  1Z5A A;  1DGH A;  2RKO A;  4ITQ A;  1IXZ A;  2WSC F;  4G4N A;  2LNH C;  2CUZ A;  3RFW A;  3KOY E;  3U6E A;  2UU9 M;  1N36 M;  4TUW A;  2XEP A;  3KXE C;  2D7E A;  4PT5 A;  1C1K A;  2R4J A;  1IXS A;  3SAU A;  4LF5 M;  2ZAO A;  4LRS A;  3SHG B;  3B89 A;  1GVN A;  1V34 A;  1PJI A;  1L1T A;  3B9P A;  1IBL M;  3E21 A;  2M60 A;  4JI8 M;  4JXJ A;  1XXH E;  1TF0 B;  2KXE A;  3FTF A;  2O25 A;  3AOG A;  3KP0 E;  4JN6 A;  2UUA M;  2V1C A;  4QNM A;  3LMM A;  1NY5 A;  2L7I A;  5FTJ A;  4DV3 M;  4S12 A;  2G8L A;  3AJI B;  4GRI A;  4DR2 M;  1OIP A;  3I01 M;  1TH2 A;  7CAT A;  3HU2 A;  4NC6 A;  1HNW M;  1Q02 A;  2VII A;  1TDZ A;  3T15 A;  2OOA A;  5FTL A;  1IM2 A;  1D0M A;  2R18 A;  4L8R C;  4FWG A;  2L4F A;  4M0W A;  2KNV A;  2Z7J A;  3FRI A;  3SAS A;  3I04 M;  4D82 A;  4JI5 M;  3CF0 A;  4LJ8 A;  2QBY B;  3DFZ A;  4GKJ M;  2ZBK B;  4XK8 F;  4R3D A;  3A46 A;  3GLF A;  4XBO A;  5EXT A;  1ZMV A;  5ITR A;  4B3R M;  2BJV A;  4JV5 M;  1PJJ A;  1QQW A;  2RRU A;  4X64 M;  1NV9 A;  4M9S A;  3B7Z A;  1JB0 F;  2V1U A;  1VQ1 A;  2Z8Y M;  5A2Q S;  3L26 A;  4YY3 M;  3U5Z B;  2XFS A;  3C3D A;  1W5T A;  3SC3 A;  2JY5 A;  3TQS A;  1HQY E;  3I51 A;  1DGB A;  1G8P A;  2L2D A;  2R6F A;  4AI6 A;  2GQF A;  4CIZ A;  2KDL A;  5KQD A;  4KOD A;  2F5N A;  3HX3 A;  3IG5 A;  2K9D A;  2F4V M;  1OFH A;  1OAO C;  1QAO A;  1SXJ D;  2F5O A;  3MJ5 A;  3GQ4 A;  2KW0 A;  3FYC A;  4NRV A;  1D2N A;  2CRU A;  4Z6Y A;  2H1R A;  1KYI A;  4LY6 A;  1WXQ A;  2OOB A;  2JY7 A;  3U61 A;  2XSZ A;  1G71 A;  1QZE A;  2C96 A;  2XZF A;  4LCB A;  2Y20 A;  3I4Y A;  4KO8 A;  3SYK A;  3H4M A;  2FFJ A;  3FTC A;  2K47 A;  1WHC A;  3HWS A;  1OTR A;  5GKN A;  1QDT A;  4DV1 M;  1Z59 A;  2DXI A;  3OTO M;  3GQ3 A;  3K1J A;  5DFL A;  1QAN A;  5KPT A;  2CWB A;  4LJ6 A;  5BR8 M;  1QVR A;  2RGO A;  3J27 B;  5DYI A;  2FE8 A;  3KOW E;  4OU7 A;  1XXH B;  2LWX A;  2C99 A;  1XC8 A;  4HL4 A;  4AW4 A;  1GJT A;  2D7H A;  4B7G A;  2BJW A;  3RGP A;  4MB7 A;  3J2P B;  1NNU C;  3GLI E;  1J7K A;  3FE3 A;  4IIW A;  1DGF A;  1IY1 A;  2Y21 A;  3IG8 A;  1IFY A;  2LH0 A;  4ANR A;  1OFI A;  4FCV A;  2WZJ A;  3KS8 A;  1I4W A;  3KVW A;  1K3W A;  1OJL A;  5LMU M;  1MX0 A;  3VKH A;  4AKI A;  2R0I A;  4IBJ A;  5DNY A;  2DNA A;  3ZH9 B;  4MM3 B;  4MGH A;  3SFZ A;  1L2D A;  2L6O A;  1E32 A;  3WHK A;  1PJT A;  3M7G A;  4L16 A;  3A98 B;  2F5S A;  2EKF A;  4LGM A;  4RF0 A;  3HHW A;  3FUX A;  1XNR M;  2KEB A;  1E9R A;  3NBI A;  3U6O A;  1NJG A;  2MGW A;  2CV2 A;  1UFZ A;  4LGY A;  1T6O A;  2MJ5 B;  2XH9 A;  3EIH A;  2NQ8 C;  2K6B A;  3GLG A;  1E94 E;  3KSX A;  4IBD A;  3ZC7 B;  2O5R A;  1A5T A;  1IXS B;  2G5G X;  3UZU A;  3U6D A;  1XNQ M;  4K0K M;  1XMO M;  3K92 A;  4FCW A;  3EIE A;  4IBC A;  4LJ9 A;  4GIP A;  1Q39 A;  3L28 A;  4NOO B;  5FTN A;  4LJ7 A;  4R71 A;  3U6M A;  3TPZ A;  3VK7 A;  2X8A A;  1HNX M;  5JI2 E;  2FH0 A;  1IN5 A;  4L15 A;  5BPV A;  2LVP C;  5KPR A;  3R9X B;  2HCB A;  1IXR C;  1WGN A;  2YR0 A;  4L6V 6;  3KS4 A;  3J7B A;  5ITU A;  2X49 A;  4MGK E;  4Y28 F;  4LFA M;  3L29 A;  4L4U A;  1I94 M;  2DVW B;  1Z5C A;  2JXN A;  4W5W A;  4I4L A;  2GNO A;  1Y8G A;  2DAI A;  2XFT A;  5LMN M;  4QOS A;  1IBK M;  4KLN A;  4OVZ A;  3FKE A;  3V76 A;  1HJP A;  4LF8 M;  1P3Q Q;  5FSW A;  2VQE M;  3L27 A;  1JQJ C;  3L2A A;  4G3O A;  1NHW C;  2CHG A;  5L8R F;  3UJN A;  4GIT A;  4I8O A;  1GO5 A;  3I4V A;  4IBI A;  1N34 M;  3CTW B;  4GMQ A;  2DZN B;  1C7Y A;  2CHQ A;  3SAW A;  2C98 A;  2B3T A;  4FCT A;  4PD2 A;  2DAG A;  2LHG A;  4QHT A;  2JNH A;  2R4E A;  3KDS E;  4BLC A;  4NXM M;  1SXJ C;  3Q8X A;  1T3T A;  2CE7 A;  2CEA A;  3GRV A;  4P17 A;  3T1H M;  1DO2 A;  3F92 A;  4M9Z A;  4LFC M;  1H6U A;  1FNN A;  3GLI B;  1NSF A;  1IY2 A;  1TGU A;  2OQ4 A;  1JR3 E;  2M5Z A;  4FWD A;  2XLJ A;  3W67 A;  2BWE A;  1IN7 A;  4QHS A;  1IN8 A;  4B7F A;  3SAV A;  1GAB A;  1WGL A;  3GRU A;  1D0L A;  1GJS A;  2ZTC A;  5ITY A;  1IN4 A;  3LVW A;  3VDP A;  3HHZ A;  2EA0 A;  4KT0 F;  1W5S A;  4HLQ A;  1R5L A;  3FD9 A;  2EJS A;  2APL A;  3SMP A;  3GPU A;  3CGW A;  4IBB A;  4B08 A;  4MH0 E;  2LVA A;  4ZPX A;  1ZQ9 A;  3HY5 A;  2QNJ A; 
#chains in the Genus database with same CATH homology
 3T38 A;  3U61 B;  5EP3 A;  4FVM A;  3FTE A;  2DWM A;  4LRT A;  1XWI A;  3JR4 A;  3LQQ A;  2UXD M;  4RNA A;  3M0E A;  3TWK A;  1N32 M;  3GLH A;  5EXP A;  4LJ5 A;  4LFB M;  3KOX E;  3DA1 A;  2CHV A;  5ITX A;  2R46 A;  4IBG A;  3U60 A;  3R8F A;  1IN6 A;  2I7N A;  2YNM D;  3HHX A;  3VK8 A;  3HJQ A;  3VDU A;  2R65 A;  4JI7 M;  4DR6 M;  1NNJ A;  4AQY M;  4G6Z A;  4WUR A;  1GKI A;  2DWZ B;  2KRU A;  2DHR A;  5E6J A;  4OW0 A;  3DZD A;  3FTD A;  2YFQ A;  5IWA M;  4AKH A;  4I81 A;  3U5Z A;  1HQC A;  2Z4S A;  1G41 A;  3U6C A;  1L1Z A;  4IBK A;  4LJA A;  3JR5 A;  2QEN A;  5EQT A;  3SAR A;  4GHA A;  5H37 D;  4LG2 A;  4OX9 M;  5EP1 A;  2CV1 A;  4IJF A;  4AKG A;  4X65 M;  2J7N A;  3ILK A;  3MHV C;  4P16 A;  4GC5 A;  1K82 A;  1YE9 A;  2KZU A;  3SBJ A;  1J5E M;  5EJC A;  3UMM A;  3A45 A;  3LVV A;  4NL4 H;  2C9O A;  5C1B A;  3D8B A;  2D7G A;  2FOI C;  5IT9 S;  1UM8 A;  4LF6 M;  5FLX S;  3SMS A;  2QZ4 A;  4LJ4 A;  3CF2 A;  4JI0 M;  1ORY B;  3K8Z A;  1HNZ M;  2FNA A;  2EUC A;  2Q2E B;  4LF7 M;  3W0L B;  4M0D A;  4PDI A;  5ITX E;  2ZAM A;  1IY0 A;  2DWL A;  4B3M M;  1NY6 A;  2V6Z M;  1R2Y A;  3GPX A;  3E4R A;  3SAT A;  4DUY M;  1DGH B;  2AHM A;  3MK6 A;  4IBE A;  2ZAN A;  4DV2 M;  3TL4 X;  4B3T M;  2QCU A;  3U6S A;  5ITQ A;  2JA2 A;  4X66 M;  3GRY A;  3AKZ A;  3UK6 A;  2J7O A;  2KA6 B;  3TWL A;  4DV5 M;  4G4Q A;  2XZU A;  1GL6 A;  4QNR A;  4OVZ B;  4BB9 A;  4G4O A;  2C5R A;  4DV4 M;  3GQ5 A;  4GHL A;  4LZJ A;  3SYL A;  1SXJ A;  2R45 A;  4D81 A;  5DYG A;  1GLN A;  2EO2 A;  4JI6 M;  3FUT A;  4GKK M;  4AG6 A;  3KSJ A;  3PFI A;  3J81 S;  3GP1 A;  4JYA M;  2ZM6 M;  1X37 A;  2XSZ D;  3M6A A;  3HU1 A;  3QAU A;  4CIS A;  4G4R A;  4DR7 M;  1KSF X;  1N78 A;  4DR1 M;  2KZS A;  4DV7 M;  3GPY A;  5EP4 A;  3KW6 A;  2BNK A;  3KP1 E;  4PDG A;  2Z3X A;  3JAM S;  4NSR A;  4MGY E;  3GLF B;  3HKP A;  3UGJ A;  4DR3 M;  2W82 A;  1YUB A;  1J09 A;  1E9S A;  1YSY A;  2LXE A;  5FTK A;  2DZO B;  5EXX A;  1L2B A;  3C58 A;  1L8Q A;  1S3S A;  2DWN A;  1N33 M;  3FUU A;  2CFO A;  3RGS A;  4CGY B;  4R7G A;  4NSO B;  4A3V B;  4NXN M;  1Z5B A;  4B3S M;  4JI1 M;  3T1Y M;  3LQR A;  4Z8X A;  1QAM A;  1HT2 E;  1TH3 A;  2L09 A;  3VFD A;  2X4A A;  2I7P A;  2QPA A;  3HJS A;  4FWH A;  1L2C A;  5EP2 A;  1SXJ E;  5F3W A;  4WW0 A;  3D8L A;  3GLH B;  3QWL A;  2KRK A;  4RF1 A;  3TWM A;  5KO3 A;  4L78 A;  4D80 A;  3U6L A;  3U60 B;  4FD2 A;  3CF6 E;  3VLF B;  1N77 A;  4YHH M;  1TDH A;  1R6B X;  3BOS A;  4M9X A;  1HT1 E;  4JI4 M;  2HHH M;  1Q3C A;  2Y0T A;  4AG5 A;  1K3X A;  1GL7 A;  4FW9 A;  1XMQ M;  1PM5 A;  1EE8 A;  3HU3 A;  2C9C A;  2UUB M;  1Z6T A;  1NVM A;  3HJ8 A;  4AZF A;  4REZ A;  2ERC A;  3GLI A;  1JR3 D;  3DOA A;  2QBY A;  5C18 A;  2OPF A;  3HGI A;  1R2Z A;  1ZAE A;  4GC9 A;  4GH9 A;  1G3I A;  3AOE A;  3FUW A;  4X62 M;  4PCZ A;  3PNY A;  2F5Q A;  2QP9 X;  4LF4 M;  4KHP M;  3AFH A;  1HR0 M;  1QAQ A;  1NHG C;  4JI3 M;  3J7A S;  4MGI E;  3NWL A;  4CHT B;  1MU5 A;  4I5S A;  3GO8 A;  2VQF M;  5JI3 E;  4DR4 M;  3FYD A;  3RE8 A;  3A42 A;  3AV0 A;  2CV0 A;  3THG A;  2Y0Q A;  4II7 A;  4IJE A;  2RGH A;  5IZ7 D;  1NJF A;  4MGZ E;  1DGG A;  5KQ8 A;  4EIW A;  1QYR A;  3AOE C;  5E26 A;  1R7R A;  1G59 A;  3GLG B;  4JI2 M;  3K2L A;  3TE6 A;  5ITT A;  3HHY A;  3E9S A;  4DV6 M;  2L7H A;  4NRW A;  2R62 A;  2UUC M;  4DR5 M;  4QOZ C;  3PNV A;  2Z4R A;  1N75 A;  3J80 S;  3U6P A;  1SXJ B;  5EXS A;  1XHB A;  3ZCB B;  3SHF A;  5KPZ A;  2E5L M;  2HL7 A;  1XXH A;  1IQP A;  4BBA A;  1IBM M;  3PVS A;  5IRE B;  2HKJ A;  2A5Y B;  2UXB M;  2UXC M;  3W0F A;  3GPP A;  1FJG M;  4LZZ A;  1TH4 A;  1Q3B A;  2XF3 A;  3FUV A;  2P5T A;  3U6Q A;  3KFU G;  3WHL A;  2YQZ A;  1LV7 A;  3AL0 C;  3PXG A;  1VDD A;  5FTM A;  4LF9 M;  4B7H A;  3VKG A;  4XGI A;  3GRR A;  1DO0 A;  4DUZ M;  4DV0 M;  1QZM A;  1JR3 A;  1KFV A;  2F5P A;  1G4A E;  2XGN A;  8CAT A;  3KOZ E;  1Z5A A;  1DGH A;  2RKO A;  4ITQ A;  1IXZ A;  4G4N A;  2LNH C;  2CUZ A;  3RFW A;  3KOY E;  3U6E A;  2UU9 M;  1N36 M;  4TUW A;  2XEP A;  3KXE C;  2D7E A;  4PT5 A;  1C1K A;  2R4J A;  3SAU A;  4LF5 M;  2ZAO A;  4LRS A;  3SHG B;  1GVN A;  1PJI A;  1IBL M;  1L1T A;  3B9P A;  4JI8 M;  2M60 A;  4JXJ A;  3FTF A;  2KXE A;  3KP0 E;  3AOG A;  4JN6 A;  2UUA M;  2V1C A;  4QNM A;  3LMM A;  1NY5 A;  2L7I A;  5FTJ A;  4DV3 M;  4S12 A;  2G8L A;  3AJI B;  4GRI A;  4DR2 M;  1TH2 A;  7CAT A;  3HU2 A;  1HNW M;  2VII A;  1TDZ A;  3T15 A;  5FTL A;  1IM2 A;  2R18 A;  4L8R C;  4FWG A;  4M0W A;  2Z7J A;  3SAS A;  4D82 A;  4JI5 M;  3CF0 A;  4LJ8 A;  2QBY B;  3DFZ A;  4GKJ M;  2ZBK B;  3A46 A;  4R3D A;  3GLF A;  4XBO A;  5EXT A;  5ITR A;  4B3R M;  2BJV A;  4JV5 M;  1PJJ A;  1QQW A;  4X64 M;  4M9S A;  2V1U A;  5A2Q S;  3L26 A;  4YY3 M;  3U5Z B;  2XFS A;  1W5T A;  3SC3 A;  3TQS A;  1HQY E;  3I51 A;  1DGB A;  1G8P A;  4AI6 A;  5KQD A;  4KOD A;  2F5N A;  3IG5 A;  2F4V M;  1OFH A;  1QAO A;  1SXJ D;  2F5O A;  3MJ5 A;  3GQ4 A;  2KW0 A;  3FYC A;  4NRV A;  1D2N A;  4Z6Y A;  2H1R A;  1KYI A;  4LY6 A;  1WXQ A;  3U61 A;  2XSZ A;  2C96 A;  2XZF A;  4LCB A;  2Y20 A;  3I4Y A;  4KO8 A;  3SYK A;  3H4M A;  2FFJ A;  3FTC A;  2K47 A;  3HWS A;  5GKN A;  2DXI A;  4DV1 M;  1Z59 A;  3OTO M;  3GQ3 A;  3K1J A;  1QAN A;  5KPT A;  4LJ6 A;  5BR8 M;  1QVR A;  2RGO A;  3J27 B;  5DYI A;  2FE8 A;  3KOW E;  4OU7 A;  1XXH B;  2LWX A;  2C99 A;  1XC8 A;  4HL4 A;  4AW4 A;  2D7H A;  4B7G A;  2BJW A;  3RGP A;  4MB7 A;  3J2P B;  1NNU C;  1J7K A;  4IIW A;  1DGF A;  1IY1 A;  2Y21 A;  3IG8 A;  2LH0 A;  1OFI A;  4FCV A;  3KS8 A;  1I4W A;  3KVW A;  1K3W A;  1OJL A;  5LMU M;  1MX0 A;  3VKH A;  4AKI A;  4IBJ A;  5DNY A;  3ZH9 B;  4MM3 B;  4MGH A;  3SFZ A;  1L2D A;  2L6O A;  1E32 A;  3WHK A;  3M7G A;  4L16 A;  3A98 B;  2F5S A;  4LGM A;  4RF0 A;  3HHW A;  3FUX A;  1XNR M;  2KEB A;  1E9R A;  3NBI A;  3U6O A;  1NJG A;  2CV2 A;  4LGY A;  3EIH A;  2XH9 A;  2NQ8 C;  3GLG A;  1E94 E;  3KSX A;  4IBD A;  3ZC7 B;  2O5R A;  1IXS B;  2G5G X;  3UZU A;  3U6D A;  1XNQ M;  4K0K M;  1XMO M;  3K92 A;  4FCW A;  3EIE A;  4IBC A;  4LJ9 A;  4GIP A;  1Q39 A;  3L28 A;  4NOO B;  5FTN A;  4LJ7 A;  3U6M A;  3TPZ A;  3VK7 A;  2X8A A;  1HNX M;  5JI2 E;  1IN5 A;  4L15 A;  5BPV A;  5KPR A;  3R9X B;  2HCB A;  1IXR C;  2YR0 A;  3KS4 A;  3J7B A;  5ITU A;  2X49 A;  4MGK E;  4LFA M;  3L29 A;  4L4U A;  1I94 M;  2DVW B;  1Z5C A;  4W5W A;  4I4L A;  2XFT A;  5LMN M;  4QOS A;  1IBK M;  4KLN A;  4OVZ A;  3FKE A;  4LF8 M;  5FSW A;  2VQE M;  3L27 A;  1JQJ C;  3L2A A;  1NHW C;  2CHG A;  3UJN A;  4GIT A;  4I8O A;  3I4V A;  4IBI A;  1N34 M;  3CTW B;  4GMQ A;  2DZN B;  2CHQ A;  3SAW A;  2C98 A;  3L25 A;  4FCT A;  4PD2 A;  4QHT A;  3KDS E;  2R4E A;  4BLC A;  4NXM M;  1SXJ C;  3Q8X A;  1T3T A;  2CE7 A;  2CEA A;  3GRV A;  3T1H M;  1DO2 A;  4M9Z A;  4LFC M;  1H6U A;  1FNN A;  3GLI B;  1NSF A;  1IY2 A;  1TGU A;  2OQ4 A;  4FWD A;  2M5Z A;  2XLJ A;  1IN7 A;  4QHS A;  1IN8 A;  4B7F A;  3SAV A;  3GRU A;  5ITY A;  1IN4 A;  3LVW A;  3VDP A;  3HHZ A;  2EA0 A;  1W5S A;  4HLQ A;  3FD9 A;  3GPU A;  3SMP A;  4IBB A;  4B08 A;  4MH0 E;  4ZPX A;  1ZQ9 A;  4IBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...