1XMQM

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xmqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xmqM02
3A42A 3GQ3A 1KFVA 1HR0M 5LMNM 4JI3M 1MU5A 3U6OA 4GKKM 4LF7M 3JAMS 3U6PA 2Q2EB 1L1ZA 5A2QS 1N36M 3U6DA 1IBMM 4NRWA 2VQEM 2EA0A 2UXDM 5BR8M 1L2BA 4JV5M 2UUAM 4DV1M 1XNQM 2ZBKB 2HHHM 5FLXS 3U6EA 4JI2M 3J7AS 1IBLM 4LF5M 3SARA 1Z59A 3U6SA 3GQ5A 1TDZA 1N33M 4G4QA 4B3TM 5ITUA 4DV6M 4G4RA 4G4NA 1TDHA 3GPXA 4ITQA 2XZUA 1N34M 2E5LM 4NXNM 4LFCM 2ZM6M 4NRVA 3GO8A 4DV0M 3OTOM 4DV5M 3VK7A 4DV3M 1L2CA 4JI1M 2UXBM 4DR2M 3J80S 1Z5CA 5IWAM 2UUCM 4YHHM 4B3SM 3U6CA 4DV2M 4JI0M 1IBKM 3JR5A 2OQ4A 1XMQM 4YY3M 1N32M 1Z5BA 1L1TA 4LF8M 4JI4M 4LFBM 1EE8A 3GPYA 3TWMA 4PD2A 1HNXM 1L2DA 4X64M 3JR4A 2VQFM 4B3RM 2UXCM 3U6MA 4PDGA 5ITXE 3W0FA 1K3XA 2UU9M 1FJGM 4DV7M 3SBJA 3SAUA 5ITQA 4DUZM 2XZFA 4JYAM 5LMUM 3DOAA 3GPUA 4LFAM 1NNJA 3T1HM 1XNRM 1XMOM 3GP1A 4K0KM 4JI6M 3TWKA 3SATA 4PDIA 1Q3CA 4DR7M 1Z5AA 3SAWA 4OX9M 1HNWM 1Q3BA 3VK8A 4JI8M 4LF9M 4DR1M 1R2ZA 3J81S 3GPPA 3SASA 3A45A 1PM5A 3SAVA 1PJIA 5ITXA 4LF4M 1MX0A 4JI7M 2F5SA 3C58A 2F5QA 2F5PA 1K3WA 1I94M 2OPFA 4DV4M 1K82A 1J5EM 4DR5M 4X66M 4B3MM 4GKJM 4G4OA 3A46A 4AQYM 4CISA 4DR4M 4PCZA 5ITTA 4LF6M 3T1YM 1HNZM 1R2YA 2F5NA 4NXMM 2F4VM 4JI5M 3GQ4A 1PJJA 2HKJA 2UUBM 2F5OA 4X65M 1XC8A 3TWLA 4DUYM 4MB7A 3U6QA 5ITRA 4KHPM 4DR3M 5IT9S 4X62M 3U6LA 4DR6M 5ITYA 1Q39A
chains in the Genus database with same CATH superfamily
1OAIA 1WIVA 3FKEA 1S3SA 2WSEF 2MH8A 1HR0M 2KHHA 1QVRA 2CUZA 2Y0TA 3LVWA 4JI3M 4DBGB 3U6OA 3QAUA 4R3DA 2XF3A 2L09A 4MGHA 2C9OA 2JZ1A 1C1KA 1NHGC 1PGYA 2DHYA 1QAQA 2Q2EB 3GRUA 2LVPC 5A2QS 2VQEM 2EA0A 4F2LA 3L2AA 2XSZA 2XSZD 1XB2B 3FTCA 2ZBKB 3VKGA 1IN4A 1NO1A 1WR1B 4S12A 4KODA 4NSOB 1D2NA 1G59A 3SARA 3RGPA 2DAKA 1Z59A 2L4EA 4I5SA 2C9CA 3V76A 1G8PA 2X4AA 4DV6M 2EKKA 2J5YA 2QHOB 4ITQA 4IBIA 2R45A 4Z6YA 2LHCA 2X8AA 3KXEC 4DV0M 4M0WA 3R8FA 3LW5F 8CATA 1VDDA 2DWNA 2Y0QA 3D8BA 4L15A 1LV7A 2LNHC 4JI0M 4YY3M 3U61B 3HU2A 4JI4M 2YFQA 1EE8A 3GPYA 1IXSA 2KDLA 4PD2A 2R44A 3R9XB 1L2DA 2LVNC 4L16A 2VQFM 2VF7A 4B3RM 3PNVA 2UXCM 3U6MA 3FYDA 2DWMA 2O5RA 3T6PA 3FUXA 2R65A 4GHAA 2QP9X 5ITXE 3CGWA 4P17A 4LJ6A 1P3QQ 3J27B 1CUKA 4BLCA 4FVMA 5KQ8A 2C5RA 3I4YA 1W5TA 3GPUA 3AKZA 1H6UA 1IN6A 1HT2E 3WHKA 3T1HM 1NNJA 1XNRM 1PJQA 2XGNA 4P16A 2L6OA 2DWZB 1FNNA 4LZJA 2FE8A 3GLGB 1X37A 1YLAA 4JI6M 4L8RC 2JP7A 3KP1E 1GJTA 3K2LA 4NSRA 4OX9M 2FS1A 2O01F 3LVVA 2ZTDA 2JY8A 3RFWA 1WHCA 4LJ7A 2DVWB 4PT5A 2BWBA 1DO2A 1NHWC 1OFHA 2L4FA 2KA6B 1OTRA 2DXIA 3EIHA 5ITXA 3VDPA 2JY5A 5FTLA 3U5ZA 2GQFA 3UJNA 3I04M 5EP4A 3FUVA 3FUUA 2F5QA 3E21A 4AKHA 4QNRA 3AOGA 1TF0B 4ZPXA 4RF0A 3F92A 1J7KA 2OO9A 4B7GA 1GABA 2H1RA 2V6ZM 3B7NA 3HHZA 1OAOC 4X66M 4GKJM 3MJ5A 4LGYA 3AJIB 4II7A 3GRVA 2P5TA 1LTMA 3ZH9B 4JXJA 4MGZE 4L6V6 4A3VB 4GMQA 3SYLA 2LVQD 4LJ9A 4PCZA 5KO3A 2CV1A 3TQSA 4LF6M 3KSXA 2F5NA 4NXMM 1OJLA 4NL4H 4IBJA 3RE8A 3A98B 2X49A 4CIZA 1E32A 4RF1A 2QBYA 3E4RA 3QYBA 3FTEA 2F5OA 2KW0A 2AHMA 3DZDA 1OIZA 1VG5A 4MB7A 4FWDA 1EFUB 2CHVA 4IJEA 1GLNA 4B3SM 5KPTA 3A42A 2G5GX 2VIIA 3CF2A 3KS4A 1IXZA 3PFIA 4QOSA 1HQYE 4QNMA 5E26A 3TPZA 1ZQ9A 1G4AE 5IREB 2QQ8A 3BOSA 3U60B 4OVZB 3JAMS 1SXJC 2D7GA 2MJ5B 2R0IA 2DWLA 2DZNB 2UXDM 4GEWA 1R4GA 3C9PA 3FD9A 2V1CA 3K1JA 1ZMVA 5BR8M 1IBMM 3AOEA 4NRWA 4G3OA 2RGOA 2HHHM 2KRKA 2XLJA 3VDUA 4JI2M 3J7AS 2C96A 2EUCA 1IY1A 1ZMUA 3TE6A 2N35A 3U6SA 1C7YA 1TH2A 3L26A 3GQ5A 3PNYA 3VLFB 4B3TM 2CEAA 4G4NA 1W5SA 2DAIA 2M60A 2LXEA 2Y21A 3C3DA 1N34M 4LFCM 2ZM6M 3L27A 2OOAA 3WHLA 3OTOM 4DV5M 3VK7A 3LQRA 2RGHA 4AZFA 4JI1M 3B7QA 3GLHB 2J7OA 3K8ZA 3L29A 2A5YB 4NC6A 5JI2E 4QHTA 3U61A 3JR5A 3GLGE 3CTWB 1N32M 1QAMA 2YQZA 4Q7JA 4HLQA 3TWMA 3PXGA 3GLFB 3GLIE 1PJSA 2MGWA 2R4EA 2BJWA 4LGMA 1KSFX 2DZLA 3AOEC 1WGLA 2KRUA 1Z6TA 1IFYA 1L8QA 2JY6B 3QYEA 1QQWA 1XXHE 1YE9A 1N75A 3FUWA 1QAOA 1K3XA 2G3QA 1FJGM 2K47A 2LWXA 2R4JA 3HJ8A 3SBJA 1E9SA 2FNAA 3TL4X 3HY5A 1AIPC 3KDSE 1WGNA 4M9XA 3GLGA 3GP1A 1XMOM 4K0KM 2K6BA 1QYRA 3TWKA 4BBAA 4GHLA 4FCTA 5DFLA 3SATA 1HQCA 4PDIA 1Q3CA 2HL7A 2DI0A 2DAGA 2XFSA 2HWJA 3SC3A 1V33A 2YR0A 1VEKA 2JNHA 2ZAMA 5FSWA 3HJQA 3VK8A 4JI8M 2EO2A 4DR1M 4MGIE 3UK6A 3J81S 4IBEA 1D0LA 3K92A 3L25A 1PM5A 1MX0A 3HX3A 4MGKE 3KSJA 3FTFA 4M9ZA 2CV0A 3C58A 5EP2A 2F5PA 4HEOA 5FTJA 1I94M 3VKHA 4IBFA 4DV4M 5KPZA 5EXSA 4AW4A 4DR5M 1AUAA 2H5XA 2KZUA 4F1IA 2Z3XA 4CISA 2I7PA 4DR4M 4Z8XA 1BVSA 1ORYB 4REZA 1I4WA 4LJAA 5ITTA 1R6BX 3T38A 3I4VA 3LCUA 4FCWA 2C98A 3B74A 3GLIB 3CF0A 2HKJA 2R6FA 4X65M 2G8LA 1V34A 5DYGA 3ZC7B 3U6QA 3UMMA 3RGSA 5ITRA 1KYIA 3NBXX 4X62M 1XXHB 4R71A 1DGHB 3SMSA 3AFHA 1Q39A 2K0BX 4MM3B 4IBBA 2QSFX 4G6ZA 5EXXA 1SXJE 2Z4RA 1E94E 2KNVA 3FE3A 5C1BA 4OVZA 3U60A 4FCVA 1NV8A 4GKKM 2WSFF 1G41A 4LCBA 3MK6A 3GLHE 4R7GA 3SYKA 4MGYE 2ERCA 2YNMD 2L7IA 4JV5M 3I51A 2UUAM 1XNQM 2VF8A 3M7GA 5FLXS 1OKSA 1VQ1A 3HGIA 4FWHA 3GLFE 1IBLM 4LF5M 1JR3E 1D0MA 4I8OA 4OU7A 3HZJA 4G4RA 2KNAA 1E9RA 1TDHA 2XZUA 2QZ4A 2FFJA 1Y8GA 1TR8A 2QNJA 1NVMA 2OOBA 3GLHA 4LRSA 4LY6A 4DV3M 1L2CA 2XEPA 3H4JA 2LHGA 1IN5A 3Q8GA 3AL0C 5IWAM 5EQTA 4YHHM 5GKNA 2NQ8C 3U6CA 1TGUA 1IN7A 3FUTA 4DV2M 1IBKM 3B89A 2Z7JA 1XWIA 1DGGA 3NBIA 1Z5BA 1HJPA 5FTMA 3HJSA 3GLFA 4LFBM 2J7NA 1JR3A 4LJ8A 4I4LA 1HT1E 2DAMA 1DGFA 2BWEA 2B3TA 3SMPA 4X64M 3JR4A 2ZAOA 1G3IA 1QUTA 1TH3A 2WZJA 3HHWA 3KVWA 1QUSA 1T6OA 3W0FA 5F3WA 2UU9M 1GL7A 4IBDA 2Z4SA 3ZQJA 2KNZA 4DV7M 1VEJA 1SXJB 4DUZM 4ANRA 5LMUM 4JYAM 2BJVA 2QCUA 1YSYA 2W82A 2JA2A 3FRIA 4CHTB 5EP1A 1VEGA 3KW6A 1OFIA 2DNAA 2LVOC 4IBCA 4GITA 1WJ7A 2MROB 3GRYA 4DR7M 4AG5A 2L2DA 2APLA 4LF9M 1R2ZA 4L78A 5IZ7D 3SASA 3A45A 1PJIA 1QZMA 4OW0A 3W68A 3LCVB 4EIWA 4LF4M 1NY5A 3E46A 3W0LB 2VDBB 2F5SA 1K3WA 1IN8A 2OPFA 4W5WA 1N78A 2KEBA 2CE7A 4D82A 1R5LA 4B3MM 1TH4A 4FW9A 3GRRA 2QPAA 5C18A 1IM2A 2V1UA 3CF6E 1IQPA 3EIEA 5EJCA 3T1YM 1OIPA 4JI5M 3GLIA 2DAEA 2ZANA 1PJJA 1ZV1A 1NSFA 1UFZA 3D8LA 4GH9A 4LJ5A 4UN2B 2ZTCA 4B08A 1XC8A 3THGA 2D7HA 3K9OA 1XXHA 1DO0A 4NOOB 1DGHA 4IBKA 2R62A 4CJ6A 4KHPM 1GO5A 1PRBA 4DR6M 1NJFA 5ITYA 4KT0F 2C99A 3GQ3A 3LQQA 1SG9A 1KFVA 3KS8A 1F4IA 3J2PB 5LMNM 1T3TA 3HWSA 1MN3A 4WW0A 1JQJC 1MU5A 2KZSA 3KOYE 2CHGA 4QHSA 1NNUC 2EJSA 4FD2A 2KXEA 4M0DA 4LF7M 2QENA 2FH0A 3U6PA 4GC5A 5BPVA 3DFZA 1L1ZA 2HAKA 2R18A 3E9SA 1N36M 3U6DA 3SFZA 1L2BA 3LMMA 1NY6A 4Y28F 4DV1M 3UGJA 3U6EA 2O25A 2CHQA 1A5TA 2Y20A 4BB9A 1QDRA 1OQYA 3BBZA 3M0EA 4JN6A 4RNAA 1TDZA 1N33M 4GC9A 4WP2A 4G4QA 3HU3A 3FTDA 3H4MA 5ITUA 3BXWA 4KLNA 3B7ZA 3GPXA 2CV2A 3IG8A 2E5LM 4AKGA 2Z8YM 4NXNM 4CGYB 4NRVA 3GO8A 1T43A 2RRUA 1QDTA 4IJFA 5KQDA 4DR2M 3J80S 1Z5CA 3W67A 2UUCM 5DYIA 2FOIC 4LJ4A 3ZCBB 2M5ZA 3IECA 5H37D 2OQ4A 2UXBM 1XMQM 1NJGA 4AKIA 2JWSA 1L1TA 3Q8XA 4LF8M 3DA1A 2CRUA 1TTEA 2LVAA 5EXTA 2JXNA 2RKOA 5FTNA 3T15A 3KP0E 1HNXM 1IXSB 3MMPA 1YUBA 2HCBA 4HL4A 1IY2A 1V92A 1GL6A 1MJGM 1UM8A 4PDGA 1VDLA 3KOZE 4D80A 4I81A 4L4UA 1SXJA 2EKFA 2BNKA 3VFDA 4KO8A 1SXJD 3HU1A 3MHVC 3SAUA 5ITQA 2XZFA 1NV9A 3DOAA 1DV0A 2GNOA 4LFAM 1IXRC 1JB0F 3I01M 4IBGA 4RKUF 1Q02A 4FWGA 2JY7A 3J7BA 5EP3A 2DENA 4LRTA 3HHYA 1Z5AA 1R7RA 7CATA 1G71A 2LBCA 3K9PA 4WURA 2CWBA 3FYCA 2MR9A 5DNYA 4LZZA 1Q3BA 3AV0A 5FTKA 1HNWM 4AI6A 2JUJA 5E6JA 3M6AA 3SHFA 1N77A 1JR3D 1RU3A 5KPRA 3GPPA 3SHGB 2WSCF 3SAVA 1ZMWA 4B7FA 5JI3E 2L7HA 3NWLA 3HHXA 3KOXE 4JI7M 3U5ZB 4IIWA 3IG5A 1IY0A 4B7HA 4MH0E 3PVSA 3KOWE 1GKIA 1K82A 4QOZC 1EIJA 3B9PA 3QWLA 1J5EM 5EXPA 1GJSA 5L8RF 2I7NA 4G4OA 2JZ0A 1ZAEA 3A46A 4AQYM 2CP8A 2XFTA 4GIPA 4GRIA 4M9SA 4XBOA 3UZUA 4D81A 2R46A 3SAWA 1J09A 2LTUA 1HNZM 2CFOA 1R2YA 3IHPA 2F4VM 2DZOB 3GQ4A 3L28A 4LG2A 1PJTA 3FRHA 1GVNA 3KFUG 1QANA 2UUBM 2QBYB 4TUWA 2D7EA 1QZEA 2DKLA 1WXQA 3TWLA 4DUYM 2K9DA 4XGIA 3ILKA 4AG6A 1D0KA 1XHBA 3C3EA 3HKPA 4DR3M 4XK8F 1DGBA 5IT9S 3U6LA 2LH0A 2XH9A 2DHRA
chains in the Genus database with same CATH topology
3FKEA 1S3SA 1HR0M 1QVRA 2CUZA 2Y0TA 3LVWA 4JI3M 3U6OA 3QAUA 4R3DA 2XF3A 2L09A 4MGHA 2C9OA 1C1KA 1NHGC 1QAQA 2Q2EB 3GRUA 5A2QS 2VQEM 2EA0A 3L2AA 2XSZA 2XSZD 3FTCA 2ZBKB 3VKGA 1IN4A 4S12A 4KODA 4NSOB 1D2NA 1G59A 3SARA 3RGPA 1Z59A 4I5SA 2C9CA 1G8PA 2X4AA 4DV6M 4ITQA 4IBIA 2R45A 4Z6YA 2X8AA 3KXEC 4DV0M 4M0WA 3R8FA 8CATA 1VDDA 2DWNA 2Y0QA 3D8BA 4L15A 1LV7A 2LNHC 4JI0M 4YY3M 3U61B 3HU2A 4JI4M 2YFQA 1EE8A 3GPYA 4PD2A 3R9XB 1L2DA 4L16A 2VQFM 4B3RM 3PNVA 2UXCM 3U6MA 3FYDA 2DWMA 2O5RA 3FUXA 2R65A 4GHAA 2QP9X 5ITXE 4LJ6A 3J27B 4BLCA 4FVMA 5KQ8A 2C5RA 3I4YA 1W5TA 3GPUA 3AKZA 1H6UA 1IN6A 1HT2E 3WHKA 3T1HM 1NNJA 1XNRM 2XGNA 4P16A 2L6OA 2DWZB 1FNNA 4LZJA 2FE8A 3GLGB 1X37A 4JI6M 4L8RC 3KP1E 3K2LA 4NSRA 4OX9M 3LVVA 3RFWA 4LJ7A 2DVWB 4PT5A 1DO2A 1NHWC 1OFHA 2DXIA 2KA6B 3EIHA 5ITXA 3VDPA 5FTLA 3U5ZA 3UJNA 5EP4A 3FUVA 3FUUA 2F5QA 4QNRA 3AOGA 4ZPXA 4RF0A 1J7KA 4B7GA 2H1RA 2V6ZM 3HHZA 4X66M 4GKJM 3MJ5A 4LGYA 3AJIB 4II7A 3GRVA 2P5TA 3ZH9B 4JXJA 4MGZE 4A3VB 4GMQA 3SYLA 4LJ9A 4PCZA 5KO3A 2CV1A 3TQSA 4LF6M 3KSXA 2F5NA 4NXMM 1OJLA 4NL4H 4IBJA 3RE8A 3A98B 2X49A 1E32A 4RF1A 2QBYA 3E4RA 3FTEA 2F5OA 2KW0A 2AHMA 3DZDA 4MB7A 4FWDA 2CHVA 4IJEA 1GLNA 4B3SM 5KPTA 3A42A 2G5GX 2VIIA 3CF2A 3KS4A 1IXZA 3PFIA 4QOSA 1HQYE 4QNMA 5E26A 3TPZA 1ZQ9A 1G4AE 5IREB 3BOSA 3U60B 4OVZB 3JAMS 1SXJC 2D7GA 2DWLA 2DZNB 2UXDM 1IBMM 3FD9A 4NRWA 3K1JA 2V1CA 4AKHA 5BR8M 3AOEA 2RGOA 2HHHM 2KRKA 2XLJA 3VDUA 4JI2M 3J7AS 2C96A 2EUCA 1IY1A 3TE6A 3U6SA 1TH2A 3L26A 3GQ5A 3PNYA 3VLFB 4B3TM 2CEAA 4G4NA 1W5SA 2M60A 2LXEA 2Y21A 1N34M 4LFCM 2ZM6M 3L27A 3WHLA 3OTOM 4DV5M 3VK7A 3LQRA 2RGHA 4AZFA 4JI1M 3GLHB 2J7OA 3K8ZA 3L29A 2A5YB 5JI2E 4QHTA 3U61A 3JR5A 3CTWB 1N32M 1QAMA 2YQZA 4HLQA 3TWMA 3PXGA 3GLFB 2R4EA 2BJWA 4LGMA 1KSFX 3AOEC 2KRUA 1Z6TA 1L8QA 1QQWA 1YE9A 1N75A 3FUWA 1QAOA 1K3XA 1FJGM 2K47A 2LWXA 2R4JA 3HJ8A 3SBJA 1E9SA 2FNAA 3TL4X 3KDSE 4M9XA 3GLGA 3GP1A 1XMOM 4K0KM 1QYRA 3TWKA 4BBAA 4GHLA 4FCTA 3SATA 1HQCA 4PDIA 1Q3CA 2HL7A 2XFSA 3SC3A 2YR0A 2ZAMA 5FSWA 3HJQA 3VK8A 4JI8M 2EO2A 4DR1M 4MGIE 3UK6A 3J81S 4IBEA 3K92A 3L25A 1PM5A 1MX0A 4MGKE 3FTFA 3KSJA 4M9ZA 2CV0A 3C58A 5EP2A 2F5PA 5FTJA 1I94M 3VKHA 4IBFA 4DV4M 5KPZA 5EXSA 4AW4A 4DR5M 2KZUA 2Z3XA 4CISA 2I7PA 4DR4M 4Z8XA 1ORYB 4REZA 1I4WA 4LJAA 5ITTA 1R6BX 3T38A 3I4VA 4FCWA 2C98A 3GLIB 3CF0A 2HKJA 4X65M 2G8LA 5DYGA 3ZC7B 3U6QA 3UMMA 3RGSA 5ITRA 1KYIA 4X62M 1XXHB 1DGHB 3SMSA 3AFHA 1Q39A 4MM3B 4IBBA 4G6ZA 5EXXA 1SXJE 2Z4RA 1E94E 5C1BA 3U60A 4OVZA 4GKKM 4FCVA 1G41A 4LCBA 3MK6A 4R7GA 3SYKA 4MGYE 2ERCA 2YNMD 2L7IA 4JV5M 3I51A 2UUAM 1XNQM 3M7GA 5FLXS 1IBLM 3HGIA 4FWHA 4LF5M 4I8OA 4OU7A 4G4RA 1E9RA 1TDHA 2XZUA 2QZ4A 2FFJA 1NVMA 3GLHA 4LRSA 4LY6A 4DV3M 1L2CA 3AL0C 2XEPA 2UXBM 1IN5A 5IWAM 5EQTA 4YHHM 5GKNA 2NQ8C 3U6CA 1TGUA 1IN7A 3FUTA 4DV2M 1IBKM 2Z7JA 1XWIA 1DGGA 3NBIA 1Z5BA 5FTMA 3HJSA 3GLFA 4LFBM 2J7NA 1JR3A 4LJ8A 4I4LA 1HT1E 1DGFA 4X64M 3JR4A 3SMPA 2ZAOA 1G3IA 1TH3A 3HHWA 3KVWA 3W0FA 5F3WA 2UU9M 1GL7A 4IBDA 2Z4SA 4DV7M 1SXJB 4DUZM 4JYAM 5LMUM 2BJVA 2QCUA 1YSYA 2W82A 2JA2A 4CHTB 5EP1A 3KW6A 1OFIA 4IBCA 4GITA 3GRYA 4DR7M 4AG5A 4LF9M 1R2ZA 4L78A 5IZ7D 3SASA 3A45A 1PJIA 1QZMA 4OW0A 4EIWA 4LF4M 1NY5A 3W0LB 2F5SA 1K3WA 1IN8A 2OPFA 4W5WA 1N78A 2KEBA 2CE7A 4D82A 4B3MM 1TH4A 4FW9A 3GRRA 2QPAA 5C18A 1IM2A 2V1UA 3CF6E 1IQPA 3EIEA 5EJCA 3T1YM 4JI5M 3GLIA 2ZANA 1PJJA 1NSFA 3D8LA 4GH9A 4LJ5A 4B08A 1XC8A 3THGA 2D7HA 4NOOB 1XXHA 1DO0A 4KHPM 1DGHA 4IBKA 2R62A 4DR6M 1NJFA 5ITYA 2C99A 3GQ3A 3LQQA 1KFVA 3KS8A 3J2PB 5LMNM 1T3TA 3HWSA 4WW0A 1JQJC 1MU5A 2KZSA 3KOYE 2CHGA 4QHSA 1NNUC 4FD2A 2KXEA 4M0DA 4LF7M 2QENA 3U6PA 4GC5A 5BPVA 3DFZA 1L1ZA 2R18A 3E9SA 1N36M 3U6DA 3SFZA 1L2BA 3LMMA 1NY6A 4DV1M 3UGJA 3U6EA 2Y20A 2CHQA 4BB9A 3M0EA 4JN6A 4RNAA 1TDZA 1N33M 4GC9A 4G4QA 3HU3A 3FTDA 3H4MA 5ITUA 4KLNA 3GPXA 2CV2A 3IG8A 2E5LM 4AKGA 4NXNM 4CGYB 4NRVA 3GO8A 4IJFA 5KQDA 4DR2M 3J80S 1Z5CA 2UUCM 5DYIA 2FOIC 4LJ4A 3ZCBB 2M5ZA 5H37D 2OQ4A 1XMQM 1NJGA 4AKIA 1L1TA 3Q8XA 4LF8M 3DA1A 5EXTA 5FTNA 2RKOA 3T15A 3KP0E 1HNXM 1IXSB 1YUBA 2HCBA 4HL4A 1IY2A 1GL6A 1UM8A 4PDGA 3KOZE 4D80A 4I81A 4L4UA 1SXJA 2BNKA 3VFDA 4KO8A 1SXJD 3HU1A 3MHVC 3SAUA 5ITQA 2XZFA 3DOAA 4LFAM 1IXRC 4IBGA 4FWGA 3J7BA 5EP3A 4LRTA 3HHYA 1Z5AA 1R7RA 7CATA 4WURA 3SAWA 5DNYA 3FYCA 4LZZA 1Q3BA 3AV0A 5FTKA 1HNWM 4AI6A 5E6JA 3M6AA 3SHFA 1N77A 1JR3D 5KPRA 3GPPA 3SHGB 3SAVA 4B7FA 5JI3E 2L7HA 3NWLA 3HHXA 3KOXE 4JI7M 3U5ZB 4IIWA 3IG5A 1IY0A 4B7HA 4MH0E 3PVSA 3KOWE 1GKIA 1K82A 4QOZC 3B9PA 3QWLA 1J5EM 5EXPA 2I7NA 4G4OA 1ZAEA 3A46A 4AQYM 2XFTA 4GIPA 4GRIA 4M9SA 4XBOA 3UZUA 4D81A 2R46A 1J09A 1HNZM 2CFOA 1R2YA 2F4VM 2DZOB 3GQ4A 3L28A 4LG2A 3KFUG 1GVNA 1QANA 2UUBM 2QBYB 4TUWA 2D7EA 3TWLA 1WXQA 4DUYM 4XGIA 3ILKA 4AG6A 1XHBA 3HKPA 4DR3M 5IT9S 1DGBA 3U6LA 2LH0A 2XH9A 2DHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A42 A;  3GQ3 A;  1KFV A;  1HR0 M;  5LMN M;  4JI3 M;  1MU5 A;  3U6O A;  4GKK M;  4LF7 M;  3JAM S;  3U6P A;  2Q2E B;  1L1Z A;  5A2Q S;  1N36 M;  3U6D A;  1IBM M;  4NRW A;  2VQE M;  2EA0 A;  2UXD M;  5BR8 M;  1L2B A;  4JV5 M;  2UUA M;  4DV1 M;  1XNQ M;  2ZBK B;  2HHH M;  5FLX S;  3U6E A;  4JI2 M;  3J7A S;  1IBL M;  4LF5 M;  3SAR A;  1Z59 A;  3U6S A;  3GQ5 A;  1TDZ A;  1N33 M;  4G4Q A;  4B3T M;  5ITU A;  4DV6 M;  4G4R A;  4G4N A;  1TDH A;  3GPX A;  4ITQ A;  2XZU A;  1N34 M;  2E5L M;  4NXN M;  4LFC M;  2ZM6 M;  4NRV A;  3GO8 A;  4DV0 M;  3OTO M;  4DV5 M;  3VK7 A;  4DV3 M;  1L2C A;  4JI1 M;  2UXB M;  4DR2 M;  3J80 S;  1Z5C A;  5IWA M;  2UUC M;  4YHH M;  4B3S M;  3U6C A;  4DV2 M;  4JI0 M;  1IBK M;  3JR5 A;  2OQ4 A;  1XMQ M;  4YY3 M;  1N32 M;  1Z5B A;  1L1T A;  4LF8 M;  4JI4 M;  4LFB M;  1EE8 A;  3GPY A;  3TWM A;  4PD2 A;  1HNX M;  1L2D A;  4X64 M;  3JR4 A;  2VQF M;  4B3R M;  2UXC M;  3U6M A;  4PDG A;  5ITX E;  3W0F A;  1K3X A;  2UU9 M;  1FJG M;  4DV7 M;  3SBJ A;  3SAU A;  5ITQ A;  4DUZ M;  2XZF A;  4JYA M;  5LMU M;  3DOA A;  3GPU A;  4LFA M;  1NNJ A;  3T1H M;  1XNR M;  1XMO M;  3GP1 A;  4K0K M;  4JI6 M;  3TWK A;  3SAT A;  4PDI A;  1Q3C A;  4DR7 M;  1Z5A A;  3SAW A;  4OX9 M;  1HNW M;  1Q3B A;  3VK8 A;  4JI8 M;  4LF9 M;  4DR1 M;  1R2Z A;  3J81 S;  3GPP A;  3SAS A;  3A45 A;  1PM5 A;  3SAV A;  1PJI A;  5ITX A;  4LF4 M;  1MX0 A;  4JI7 M;  2F5S A;  3C58 A;  2F5Q A;  2F5P A;  1K3W A;  1I94 M;  2OPF A;  4DV4 M;  1K82 A;  1J5E M;  4DR5 M;  4X66 M;  4B3M M;  4GKJ M;  4G4O A;  3A46 A;  4AQY M;  4CIS A;  4DR4 M;  4PCZ A;  5ITT A;  4LF6 M;  3T1Y M;  1HNZ M;  1R2Y A;  2F5N A;  4NXM M;  2F4V M;  4JI5 M;  3GQ4 A;  1PJJ A;  2HKJ A;  2UUB M;  2F5O A;  4X65 M;  1XC8 A;  3TWL A;  4DUY M;  4MB7 A;  3U6Q A;  5ITR A;  4KHP M;  4DR3 M;  5IT9 S;  4X62 M;  3U6L A;  4DR6 M;  5ITY A;  1Q39 A; 
#chains in the Genus database with same CATH topology
 1OAI A;  1WIV A;  3FKE A;  1S3S A;  2WSE F;  2MH8 A;  1HR0 M;  2KHH A;  1QVR A;  2CUZ A;  2Y0T A;  3LVW A;  4JI3 M;  4DBG B;  3U6O A;  3QAU A;  4R3D A;  2XF3 A;  2L09 A;  4MGH A;  2C9O A;  2JZ1 A;  1C1K A;  1NHG C;  1PGY A;  2DHY A;  1QAQ A;  2Q2E B;  3GRU A;  2LVP C;  5A2Q S;  2VQE M;  2EA0 A;  4F2L A;  3L2A A;  2XSZ A;  2XSZ D;  1XB2 B;  3FTC A;  2ZBK B;  3VKG A;  1IN4 A;  1NO1 A;  1WR1 B;  4S12 A;  4KOD A;  4NSO B;  1D2N A;  1G59 A;  3SAR A;  3RGP A;  2DAK A;  1Z59 A;  2L4E A;  4I5S A;  2C9C A;  3V76 A;  1G8P A;  2X4A A;  4DV6 M;  2EKK A;  2J5Y A;  2QHO B;  4ITQ A;  4IBI A;  2R45 A;  4Z6Y A;  2LHC A;  2X8A A;  3KXE C;  4DV0 M;  4M0W A;  3R8F A;  3LW5 F;  8CAT A;  1VDD A;  2DWN A;  2Y0Q A;  3D8B A;  4L15 A;  1LV7 A;  2LNH C;  4JI0 M;  4YY3 M;  3U61 B;  3HU2 A;  4JI4 M;  2YFQ A;  1EE8 A;  3GPY A;  1IXS A;  2KDL A;  4PD2 A;  2R44 A;  3R9X B;  1L2D A;  2LVN C;  4L16 A;  2VQF M;  2VF7 A;  4B3R M;  3PNV A;  2UXC M;  3U6M A;  3FYD A;  2DWM A;  2O5R A;  3T6P A;  3FUX A;  2R65 A;  4GHA A;  2QP9 X;  5ITX E;  3CGW A;  4P17 A;  4LJ6 A;  1P3Q Q;  3J27 B;  1CUK A;  4BLC A;  4FVM A;  5KQ8 A;  2C5R A;  3I4Y A;  1W5T A;  3GPU A;  3AKZ A;  1H6U A;  1IN6 A;  1HT2 E;  3WHK A;  3T1H M;  1NNJ A;  1XNR M;  1PJQ A;  2XGN A;  4P16 A;  2L6O A;  2DWZ B;  1FNN A;  4LZJ A;  2FE8 A;  3GLG B;  1X37 A;  1YLA A;  4JI6 M;  4L8R C;  2JP7 A;  3KP1 E;  1GJT A;  3K2L A;  4NSR A;  4OX9 M;  2FS1 A;  2O01 F;  3LVV A;  2ZTD A;  2JY8 A;  3RFW A;  1WHC A;  4LJ7 A;  2DVW B;  4PT5 A;  2BWB A;  1DO2 A;  1NHW C;  1OFH A;  2L4F A;  2KA6 B;  1OTR A;  2DXI A;  3EIH A;  5ITX A;  3VDP A;  2JY5 A;  5FTL A;  3U5Z A;  2GQF A;  3UJN A;  3I04 M;  5EP4 A;  3FUV A;  3FUU A;  2F5Q A;  3E21 A;  4AKH A;  4QNR A;  3AOG A;  1TF0 B;  4ZPX A;  4RF0 A;  3F92 A;  1J7K A;  2OO9 A;  4B7G A;  1GAB A;  2H1R A;  2V6Z M;  3B7N A;  3HHZ A;  1OAO C;  4X66 M;  4GKJ M;  3MJ5 A;  4LGY A;  3AJI B;  4II7 A;  3GRV A;  2P5T A;  1LTM A;  3ZH9 B;  4JXJ A;  4MGZ E;  4L6V 6;  4A3V B;  4GMQ A;  3SYL A;  2LVQ D;  4LJ9 A;  4PCZ A;  5KO3 A;  2CV1 A;  3TQS A;  4LF6 M;  3KSX A;  2F5N A;  4NXM M;  1OJL A;  4NL4 H;  4IBJ A;  3RE8 A;  3A98 B;  2X49 A;  4CIZ A;  1E32 A;  4RF1 A;  2QBY A;  3E4R A;  3QYB A;  3FTE A;  2F5O A;  2KW0 A;  2AHM A;  3DZD A;  1OIZ A;  1VG5 A;  4MB7 A;  4FWD A;  1EFU B;  2CHV A;  4IJE A;  1GLN A;  4B3S M;  5KPT A;  3A42 A;  2G5G X;  2VII A;  3CF2 A;  3KS4 A;  1IXZ A;  3PFI A;  4QOS A;  1HQY E;  4QNM A;  5E26 A;  3TPZ A;  1ZQ9 A;  1G4A E;  5IRE B;  2QQ8 A;  3BOS A;  3U60 B;  4OVZ B;  3JAM S;  1SXJ C;  2D7G A;  2MJ5 B;  2R0I A;  2DWL A;  2DZN B;  2UXD M;  4GEW A;  1R4G A;  3C9P A;  3FD9 A;  2V1C A;  3K1J A;  1ZMV A;  5BR8 M;  1IBM M;  3AOE A;  4NRW A;  4G3O A;  2RGO A;  2HHH M;  2KRK A;  2XLJ A;  3VDU A;  4JI2 M;  3J7A S;  2C96 A;  2EUC A;  1IY1 A;  1ZMU A;  3TE6 A;  2N35 A;  3U6S A;  1C7Y A;  1TH2 A;  3L26 A;  3GQ5 A;  3PNY A;  3VLF B;  4B3T M;  2CEA A;  4G4N A;  1W5S A;  2DAI A;  2M60 A;  2LXE A;  2Y21 A;  3C3D A;  1N34 M;  4LFC M;  2ZM6 M;  3L27 A;  2OOA A;  3WHL A;  3OTO M;  4DV5 M;  3VK7 A;  3LQR A;  2RGH A;  4AZF A;  4JI1 M;  3B7Q A;  3GLH B;  2J7O A;  3K8Z A;  3L29 A;  2A5Y B;  4NC6 A;  5JI2 E;  4QHT A;  3U61 A;  3JR5 A;  3GLG E;  3CTW B;  1N32 M;  1QAM A;  2YQZ A;  4Q7J A;  4HLQ A;  3TWM A;  3PXG A;  3GLF B;  3GLI E;  1PJS A;  2MGW A;  2R4E A;  2BJW A;  4LGM A;  1KSF X;  2DZL A;  3AOE C;  1WGL A;  2KRU A;  1Z6T A;  1IFY A;  1L8Q A;  2JY6 B;  3QYE A;  1QQW A;  1XXH E;  1YE9 A;  1N75 A;  3FUW A;  1QAO A;  1K3X A;  2G3Q A;  1FJG M;  2K47 A;  2LWX A;  2R4J A;  3HJ8 A;  3SBJ A;  1E9S A;  2FNA A;  3TL4 X;  3HY5 A;  1AIP C;  3KDS E;  1WGN A;  4M9X A;  3GLG A;  3GP1 A;  1XMO M;  4K0K M;  2K6B A;  1QYR A;  3TWK A;  4BBA A;  4GHL A;  4FCT A;  5DFL A;  3SAT A;  1HQC A;  4PDI A;  1Q3C A;  2HL7 A;  2DI0 A;  2DAG A;  2XFS A;  2HWJ A;  3SC3 A;  1V33 A;  2YR0 A;  1VEK A;  2JNH A;  2ZAM A;  5FSW A;  3HJQ A;  3VK8 A;  4JI8 M;  2EO2 A;  4DR1 M;  4MGI E;  3UK6 A;  3J81 S;  4IBE A;  1D0L A;  3K92 A;  3L25 A;  1PM5 A;  1MX0 A;  3HX3 A;  4MGK E;  3KSJ A;  3FTF A;  4M9Z A;  2CV0 A;  3C58 A;  5EP2 A;  2F5P A;  4HEO A;  5FTJ A;  1I94 M;  3VKH A;  4IBF A;  4DV4 M;  5KPZ A;  5EXS A;  4AW4 A;  4DR5 M;  1AUA A;  2H5X A;  2KZU A;  4F1I A;  2Z3X A;  4CIS A;  2I7P A;  4DR4 M;  4Z8X A;  1BVS A;  1ORY B;  4REZ A;  1I4W A;  4LJA A;  5ITT A;  1R6B X;  3T38 A;  3I4V A;  3LCU A;  4FCW A;  2C98 A;  3B74 A;  3GLI B;  3CF0 A;  2HKJ A;  2R6F A;  4X65 M;  2G8L A;  1V34 A;  5DYG A;  3ZC7 B;  3U6Q A;  3UMM A;  3RGS A;  5ITR A;  1KYI A;  3NBX X;  4X62 M;  1XXH B;  4R71 A;  1DGH B;  3SMS A;  3AFH A;  1Q39 A;  2K0B X;  4MM3 B;  4IBB A;  2QSF X;  4G6Z A;  5EXX A;  1SXJ E;  2Z4R A;  1E94 E;  2KNV A;  3FE3 A;  5C1B A;  4OVZ A;  3U60 A;  4FCV A;  1NV8 A;  4GKK M;  2WSF F;  1G41 A;  4LCB A;  3MK6 A;  3GLH E;  4R7G A;  3SYK A;  4MGY E;  2ERC A;  2YNM D;  2L7I A;  4JV5 M;  3I51 A;  2UUA M;  1XNQ M;  2VF8 A;  3M7G A;  5FLX S;  1OKS A;  1VQ1 A;  3HGI A;  4FWH A;  3GLF E;  1IBL M;  4LF5 M;  1JR3 E;  1D0M A;  4I8O A;  4OU7 A;  3HZJ A;  4G4R A;  2KNA A;  1E9R A;  1TDH A;  2XZU A;  2QZ4 A;  2FFJ A;  1Y8G A;  1TR8 A;  2QNJ A;  1NVM A;  2OOB A;  3GLH A;  4LRS A;  4LY6 A;  4DV3 M;  1L2C A;  2XEP A;  3H4J A;  2LHG A;  1IN5 A;  3Q8G A;  3AL0 C;  5IWA M;  5EQT A;  4YHH M;  5GKN A;  2NQ8 C;  3U6C A;  1TGU A;  1IN7 A;  3FUT A;  4DV2 M;  1IBK M;  3B89 A;  2Z7J A;  1XWI A;  1DGG A;  3NBI A;  1Z5B A;  1HJP A;  5FTM A;  3HJS A;  3GLF A;  4LFB M;  2J7N A;  1JR3 A;  4LJ8 A;  4I4L A;  1HT1 E;  2DAM A;  1DGF A;  2BWE A;  2B3T A;  3SMP A;  4X64 M;  3JR4 A;  2ZAO A;  1G3I A;  1QUT A;  1TH3 A;  2WZJ A;  3HHW A;  3KVW A;  1QUS A;  1T6O A;  3W0F A;  5F3W A;  2UU9 M;  1GL7 A;  4IBD A;  2Z4S A;  3ZQJ A;  2KNZ A;  4DV7 M;  1VEJ A;  1SXJ B;  4DUZ M;  4ANR A;  5LMU M;  4JYA M;  2BJV A;  2QCU A;  1YSY A;  2W82 A;  2JA2 A;  3FRI A;  4CHT B;  5EP1 A;  1VEG A;  3KW6 A;  1OFI A;  2DNA A;  2LVO C;  4IBC A;  4GIT A;  1WJ7 A;  2MRO B;  3GRY A;  4DR7 M;  4AG5 A;  2L2D A;  2APL A;  4LF9 M;  1R2Z A;  4L78 A;  5IZ7 D;  3SAS A;  3A45 A;  1PJI A;  1QZM A;  4OW0 A;  3W68 A;  3LCV B;  4EIW A;  4LF4 M;  1NY5 A;  3E46 A;  3W0L B;  2VDB B;  2F5S A;  1K3W A;  1IN8 A;  2OPF A;  4W5W A;  1N78 A;  2KEB A;  2CE7 A;  4D82 A;  1R5L A;  4B3M M;  1TH4 A;  4FW9 A;  3GRR A;  2QPA A;  5C18 A;  1IM2 A;  2V1U A;  3CF6 E;  1IQP A;  3EIE A;  5EJC A;  3T1Y M;  1OIP A;  4JI5 M;  3GLI A;  2DAE A;  2ZAN A;  1PJJ A;  1ZV1 A;  1NSF A;  1UFZ A;  3D8L A;  4GH9 A;  4LJ5 A;  4UN2 B;  2ZTC A;  4B08 A;  1XC8 A;  3THG A;  2D7H A;  3K9O A;  1XXH A;  1DO0 A;  4NOO B;  1DGH A;  4IBK A;  2R62 A;  4CJ6 A;  4KHP M;  1GO5 A;  1PRB A;  4DR6 M;  1NJF A;  5ITY A;  4KT0 F;  2C99 A;  3GQ3 A;  3LQQ A;  1SG9 A;  1KFV A;  3KS8 A;  1F4I A;  3J2P B;  5LMN M;  1T3T A;  3HWS A;  1MN3 A;  4WW0 A;  1JQJ C;  1MU5 A;  2KZS A;  3KOY E;  2CHG A;  4QHS A;  1NNU C;  2EJS A;  4FD2 A;  2KXE A;  4M0D A;  4LF7 M;  2QEN A;  2FH0 A;  3U6P A;  4GC5 A;  5BPV A;  3DFZ A;  1L1Z A;  2HAK A;  2R18 A;  3E9S A;  1N36 M;  3U6D A;  3SFZ A;  1L2B A;  3LMM A;  1NY6 A;  4Y28 F;  4DV1 M;  3UGJ A;  3U6E A;  2O25 A;  2CHQ A;  1A5T A;  2Y20 A;  4BB9 A;  1QDR A;  1OQY A;  3BBZ A;  3M0E A;  4JN6 A;  4RNA A;  1TDZ A;  1N33 M;  4GC9 A;  4WP2 A;  4G4Q A;  3HU3 A;  3FTD A;  3H4M A;  5ITU A;  3BXW A;  4KLN A;  3B7Z A;  3GPX A;  2CV2 A;  3IG8 A;  2E5L M;  4AKG A;  2Z8Y M;  4NXN M;  4CGY B;  4NRV A;  3GO8 A;  1T43 A;  2RRU A;  1QDT A;  4IJF A;  5KQD A;  4DR2 M;  3J80 S;  1Z5C A;  3W67 A;  2UUC M;  5DYI A;  2FOI C;  4LJ4 A;  3ZCB B;  2M5Z A;  3IEC A;  5H37 D;  2OQ4 A;  2UXB M;  1XMQ M;  1NJG A;  4AKI A;  2JWS A;  1L1T A;  3Q8X A;  4LF8 M;  3DA1 A;  2CRU A;  1TTE A;  2LVA A;  5EXT A;  2JXN A;  2RKO A;  5FTN A;  3T15 A;  3KP0 E;  1HNX M;  1IXS B;  3MMP A;  1YUB A;  2HCB A;  4HL4 A;  1IY2 A;  1V92 A;  1GL6 A;  1MJG M;  1UM8 A;  4PDG A;  1VDL A;  3KOZ E;  4D80 A;  4I81 A;  4L4U A;  1SXJ A;  2EKF A;  2BNK A;  3VFD A;  4KO8 A;  1SXJ D;  3HU1 A;  3MHV C;  3SAU A;  5ITQ A;  2XZF A;  1NV9 A;  3DOA A;  1DV0 A;  2GNO A;  4LFA M;  1IXR C;  1JB0 F;  3I01 M;  4IBG A;  4RKU F;  1Q02 A;  4FWG A;  2JY7 A;  3J7B A;  5EP3 A;  2DEN A;  4LRT A;  3HHY A;  1Z5A A;  1R7R A;  7CAT A;  1G71 A;  2LBC A;  3K9P A;  4WUR A;  2CWB A;  3FYC A;  2MR9 A;  5DNY A;  4LZZ A;  1Q3B A;  3AV0 A;  5FTK A;  1HNW M;  4AI6 A;  2JUJ A;  5E6J A;  3M6A A;  3SHF A;  1N77 A;  1JR3 D;  1RU3 A;  5KPR A;  3GPP A;  3SHG B;  2WSC F;  3SAV A;  1ZMW A;  4B7F A;  5JI3 E;  2L7H A;  3NWL A;  3HHX A;  3KOX E;  4JI7 M;  3U5Z B;  4IIW A;  3IG5 A;  1IY0 A;  4B7H A;  4MH0 E;  3PVS A;  3KOW E;  1GKI A;  1K82 A;  4QOZ C;  1EIJ A;  3B9P A;  3QWL A;  1J5E M;  5EXP A;  1GJS A;  5L8R F;  2I7N A;  4G4O A;  2JZ0 A;  1ZAE A;  3A46 A;  4AQY M;  2CP8 A;  2XFT A;  4GIP A;  4GRI A;  4M9S A;  4XBO A;  3UZU A;  4D81 A;  2R46 A;  3SAW A;  1J09 A;  2LTU A;  1HNZ M;  2CFO A;  1R2Y A;  3IHP A;  2F4V M;  2DZO B;  3GQ4 A;  3L28 A;  4LG2 A;  1PJT A;  3FRH A;  1GVN A;  3KFU G;  1QAN A;  2UUB M;  2QBY B;  4TUW A;  2D7E A;  1QZE A;  2DKL A;  1WXQ A;  3TWL A;  4DUY M;  2K9D A;  4XGI A;  3ILK A;  4AG6 A;  1D0K A;  1XHB A;  3C3E A;  3HKP A;  4DR3 M;  4XK8 F;  1DGB A;  5IT9 S;  3U6L A;  2LH0 A;  2XH9 A;  2DHR A; 
#chains in the Genus database with same CATH homology
 3FKE A;  1S3S A;  1HR0 M;  1QVR A;  2CUZ A;  2Y0T A;  3LVW A;  4JI3 M;  3U6O A;  3QAU A;  4R3D A;  2XF3 A;  2L09 A;  4MGH A;  2C9O A;  1C1K A;  1NHG C;  1QAQ A;  2Q2E B;  3GRU A;  5A2Q S;  2VQE M;  2EA0 A;  3L2A A;  2XSZ A;  2XSZ D;  3FTC A;  2ZBK B;  3VKG A;  1IN4 A;  4S12 A;  4KOD A;  4NSO B;  1D2N A;  1G59 A;  3SAR A;  3RGP A;  1Z59 A;  4I5S A;  2C9C A;  1G8P A;  2X4A A;  4DV6 M;  4ITQ A;  4IBI A;  2R45 A;  4Z6Y A;  2X8A A;  3KXE C;  4DV0 M;  4M0W A;  3R8F A;  8CAT A;  1VDD A;  2DWN A;  2Y0Q A;  3D8B A;  4L15 A;  1LV7 A;  2LNH C;  4JI0 M;  4YY3 M;  3U61 B;  3HU2 A;  4JI4 M;  2YFQ A;  1EE8 A;  3GPY A;  4PD2 A;  3R9X B;  1L2D A;  4L16 A;  2VQF M;  4B3R M;  3PNV A;  2UXC M;  3U6M A;  3FYD A;  2DWM A;  2O5R A;  3FUX A;  2R65 A;  4GHA A;  2QP9 X;  5ITX E;  4LJ6 A;  3J27 B;  4BLC A;  4FVM A;  5KQ8 A;  2C5R A;  3I4Y A;  1W5T A;  3GPU A;  3AKZ A;  1H6U A;  1IN6 A;  1HT2 E;  3WHK A;  3T1H M;  1NNJ A;  1XNR M;  2XGN A;  4P16 A;  2L6O A;  2DWZ B;  1FNN A;  4LZJ A;  2FE8 A;  3GLG B;  1X37 A;  4JI6 M;  4L8R C;  3KP1 E;  3K2L A;  4NSR A;  4OX9 M;  3LVV A;  3RFW A;  4LJ7 A;  2DVW B;  4PT5 A;  1DO2 A;  1NHW C;  1OFH A;  2DXI A;  2KA6 B;  3EIH A;  5ITX A;  3VDP A;  5FTL A;  3U5Z A;  3UJN A;  5EP4 A;  3FUV A;  3FUU A;  2F5Q A;  4QNR A;  3AOG A;  4ZPX A;  4RF0 A;  1J7K A;  4B7G A;  2H1R A;  2V6Z M;  3HHZ A;  4X66 M;  4GKJ M;  3MJ5 A;  4LGY A;  3AJI B;  4II7 A;  3GRV A;  2P5T A;  3ZH9 B;  4JXJ A;  4MGZ E;  4A3V B;  4GMQ A;  3SYL A;  4LJ9 A;  4PCZ A;  5KO3 A;  2CV1 A;  3TQS A;  4LF6 M;  3KSX A;  2F5N A;  4NXM M;  1OJL A;  4NL4 H;  4IBJ A;  3RE8 A;  3A98 B;  2X49 A;  1E32 A;  4RF1 A;  2QBY A;  3E4R A;  3FTE A;  2F5O A;  2KW0 A;  2AHM A;  3DZD A;  4MB7 A;  4FWD A;  2CHV A;  4IJE A;  1GLN A;  4B3S M;  5KPT A;  3A42 A;  2G5G X;  2VII A;  3CF2 A;  3KS4 A;  1IXZ A;  3PFI A;  4QOS A;  1HQY E;  4QNM A;  5E26 A;  3TPZ A;  1ZQ9 A;  1G4A E;  5IRE B;  3BOS A;  3U60 B;  4OVZ B;  3JAM S;  1SXJ C;  2D7G A;  2DWL A;  2DZN B;  2UXD M;  1IBM M;  3FD9 A;  4NRW A;  3K1J A;  2V1C A;  4AKH A;  5BR8 M;  3AOE A;  2RGO A;  2HHH M;  2KRK A;  2XLJ A;  3VDU A;  4JI2 M;  3J7A S;  2C96 A;  2EUC A;  1IY1 A;  3TE6 A;  3U6S A;  1TH2 A;  3L26 A;  3GQ5 A;  3PNY A;  3VLF B;  4B3T M;  2CEA A;  4G4N A;  1W5S A;  2M60 A;  2LXE A;  2Y21 A;  1N34 M;  4LFC M;  2ZM6 M;  3L27 A;  3WHL A;  3OTO M;  4DV5 M;  3VK7 A;  3LQR A;  2RGH A;  4AZF A;  4JI1 M;  3GLH B;  2J7O A;  3K8Z A;  3L29 A;  2A5Y B;  5JI2 E;  4QHT A;  3U61 A;  3JR5 A;  3CTW B;  1N32 M;  1QAM A;  2YQZ A;  4HLQ A;  3TWM A;  3PXG A;  3GLF B;  2R4E A;  2BJW A;  4LGM A;  1KSF X;  3AOE C;  2KRU A;  1Z6T A;  1L8Q A;  1QQW A;  1YE9 A;  1N75 A;  3FUW A;  1QAO A;  1K3X A;  1FJG M;  2K47 A;  2LWX A;  2R4J A;  3HJ8 A;  3SBJ A;  1E9S A;  2FNA A;  3TL4 X;  3KDS E;  4M9X A;  3GLG A;  3GP1 A;  1XMO M;  4K0K M;  1QYR A;  3TWK A;  4BBA A;  4GHL A;  4FCT A;  3SAT A;  1HQC A;  4PDI A;  1Q3C A;  2HL7 A;  2XFS A;  3SC3 A;  2YR0 A;  2ZAM A;  5FSW A;  3HJQ A;  3VK8 A;  4JI8 M;  2EO2 A;  4DR1 M;  4MGI E;  3UK6 A;  3J81 S;  4IBE A;  3K92 A;  3L25 A;  1PM5 A;  1MX0 A;  4MGK E;  3FTF A;  3KSJ A;  4M9Z A;  2CV0 A;  3C58 A;  5EP2 A;  2F5P A;  5FTJ A;  1I94 M;  3VKH A;  4IBF A;  4DV4 M;  5KPZ A;  5EXS A;  4AW4 A;  4DR5 M;  2KZU A;  2Z3X A;  4CIS A;  2I7P A;  4DR4 M;  4Z8X A;  1ORY B;  4REZ A;  1I4W A;  4LJA A;  5ITT A;  1R6B X;  3T38 A;  3I4V A;  4FCW A;  2C98 A;  3GLI B;  3CF0 A;  2HKJ A;  4X65 M;  2G8L A;  5DYG A;  3ZC7 B;  3U6Q A;  3UMM A;  3RGS A;  5ITR A;  1KYI A;  4X62 M;  1XXH B;  1DGH B;  3SMS A;  3AFH A;  1Q39 A;  4MM3 B;  4IBB A;  4G6Z A;  5EXX A;  1SXJ E;  2Z4R A;  1E94 E;  5C1B A;  3U60 A;  4OVZ A;  4GKK M;  4FCV A;  1G41 A;  4LCB A;  3MK6 A;  4R7G A;  3SYK A;  4MGY E;  2ERC A;  2YNM D;  2L7I A;  4JV5 M;  3I51 A;  2UUA M;  1XNQ M;  3M7G A;  5FLX S;  1IBL M;  3HGI A;  4FWH A;  4LF5 M;  4I8O A;  4OU7 A;  4G4R A;  1E9R A;  1TDH A;  2XZU A;  2QZ4 A;  2FFJ A;  1NVM A;  3GLH A;  4LRS A;  4LY6 A;  4DV3 M;  1L2C A;  3AL0 C;  2XEP A;  2UXB M;  1IN5 A;  5IWA M;  5EQT A;  4YHH M;  5GKN A;  2NQ8 C;  3U6C A;  1TGU A;  1IN7 A;  3FUT A;  4DV2 M;  1IBK M;  2Z7J A;  1XWI A;  1DGG A;  3NBI A;  1Z5B A;  5FTM A;  3HJS A;  3GLF A;  4LFB M;  2J7N A;  1JR3 A;  4LJ8 A;  4I4L A;  1HT1 E;  1DGF A;  4X64 M;  3JR4 A;  3SMP A;  2ZAO A;  1G3I A;  1TH3 A;  3HHW A;  3KVW A;  3W0F A;  5F3W A;  2UU9 M;  1GL7 A;  4IBD A;  2Z4S A;  4DV7 M;  1SXJ B;  4DUZ M;  4JYA M;  5LMU M;  2BJV A;  2QCU A;  1YSY A;  2W82 A;  2JA2 A;  4CHT B;  5EP1 A;  3KW6 A;  1OFI A;  4IBC A;  4GIT A;  3GRY A;  4DR7 M;  4AG5 A;  4LF9 M;  1R2Z A;  4L78 A;  5IZ7 D;  3SAS A;  3A45 A;  1PJI A;  1QZM A;  4OW0 A;  4EIW A;  4LF4 M;  1NY5 A;  3W0L B;  2F5S A;  1K3W A;  1IN8 A;  2OPF A;  4W5W A;  1N78 A;  2KEB A;  2CE7 A;  4D82 A;  4B3M M;  1TH4 A;  4FW9 A;  3GRR A;  2QPA A;  5C18 A;  1IM2 A;  2V1U A;  3CF6 E;  1IQP A;  3EIE A;  5EJC A;  3T1Y M;  4JI5 M;  3GLI A;  2ZAN A;  1PJJ A;  1NSF A;  3D8L A;  4GH9 A;  4LJ5 A;  4B08 A;  1XC8 A;  3THG A;  2D7H A;  4NOO B;  1XXH A;  1DO0 A;  4KHP M;  1DGH A;  4IBK A;  2R62 A;  4DR6 M;  1NJF A;  5ITY A;  2C99 A;  3GQ3 A;  3LQQ A;  1KFV A;  3KS8 A;  3J2P B;  5LMN M;  1T3T A;  3HWS A;  4WW0 A;  1JQJ C;  1MU5 A;  2KZS A;  3KOY E;  2CHG A;  4QHS A;  1NNU C;  4FD2 A;  2KXE A;  4M0D A;  4LF7 M;  2QEN A;  3U6P A;  4GC5 A;  5BPV A;  3DFZ A;  1L1Z A;  2R18 A;  3E9S A;  1N36 M;  3U6D A;  3SFZ A;  1L2B A;  3LMM A;  1NY6 A;  4DV1 M;  3UGJ A;  3U6E A;  2Y20 A;  2CHQ A;  4BB9 A;  3M0E A;  4JN6 A;  4RNA A;  1TDZ A;  1N33 M;  4GC9 A;  4G4Q A;  3HU3 A;  3FTD A;  3H4M A;  5ITU A;  4KLN A;  3GPX A;  2CV2 A;  3IG8 A;  2E5L M;  4AKG A;  4NXN M;  4CGY B;  4NRV A;  3GO8 A;  4IJF A;  5KQD A;  4DR2 M;  3J80 S;  1Z5C A;  2UUC M;  5DYI A;  2FOI C;  4LJ4 A;  3ZCB B;  2M5Z A;  5H37 D;  2OQ4 A;  1XMQ M;  1NJG A;  4AKI A;  1L1T A;  3Q8X A;  4LF8 M;  3DA1 A;  5EXT A;  5FTN A;  2RKO A;  3T15 A;  3KP0 E;  1HNX M;  1IXS B;  1YUB A;  2HCB A;  4HL4 A;  1IY2 A;  1GL6 A;  1UM8 A;  4PDG A;  3KOZ E;  4D80 A;  4I81 A;  4L4U A;  1SXJ A;  2BNK A;  3VFD A;  4KO8 A;  1SXJ D;  3HU1 A;  3MHV C;  3SAU A;  5ITQ A;  2XZF A;  3DOA A;  4LFA M;  1IXR C;  4IBG A;  4FWG A;  3J7B A;  5EP3 A;  4LRT A;  3HHY A;  1Z5A A;  1R7R A;  7CAT A;  4WUR A;  3SAW A;  5DNY A;  3FYC A;  4LZZ A;  1Q3B A;  3AV0 A;  5FTK A;  1HNW M;  4AI6 A;  5E6J A;  3M6A A;  3SHF A;  1N77 A;  1JR3 D;  5KPR A;  3GPP A;  3SHG B;  3SAV A;  4B7F A;  5JI3 E;  2L7H A;  3NWL A;  3HHX A;  3KOX E;  4JI7 M;  3U5Z B;  4IIW A;  3IG5 A;  1IY0 A;  4B7H A;  4MH0 E;  3PVS A;  3KOW E;  1GKI A;  1K82 A;  4QOZ C;  3B9P A;  3QWL A;  1J5E M;  5EXP A;  2I7N A;  4G4O A;  1ZAE A;  3A46 A;  4AQY M;  2XFT A;  4GIP A;  4GRI A;  4M9S A;  4XBO A;  3UZU A;  4D81 A;  2R46 A;  1J09 A;  1HNZ M;  2CFO A;  1R2Y A;  2F4V M;  2DZO B;  3GQ4 A;  3L28 A;  4LG2 A;  3KFU G;  1GVN A;  1QAN A;  2UUB M;  2QBY B;  4TUW A;  2D7E A;  3TWL A;  1WXQ A;  4DUY M;  4XGI A;  3ILK A;  4AG6 A;  1XHB A;  3HKP A;  4DR3 M;  5IT9 S;  1DGB A;  3U6L A;  2LH0 A;  2XH9 A;  2DHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...