1XMQM

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xmqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xmqM02
4JI8M 1K3XA 4B3MM 3U6OA 4B3TM 4DR2M 1IBLM 3SAWA 3U6QA 3SASA 4AQYM 1MX0A 5ITRA 4DV4M 3VK8A 1L2CA 3A42A 2UUBM 2F4VM 4G4OA 3GPPA 1HR0M 3W0FA 4DR6M 3C58A 4LF7M 1K3WA 3T1HM 4GKKM 3SARA 4B3RM 3U6PA 4LF6M 1FJGM 1HNWM 2F5QA 1PM5A 4G4QA 4JI0M 4G4RA 4DR1M 1Q3BA 4X66M 4CISA 3SATA 3GPXA 3TWLA 1I94M 4PCZA 4LF8M 4JI6M 4JI1M 2F5SA 3U6DA 4GKJM 4JI7M 1L2DA 1XMOM 4YY3M 4DUZM 2ZM6M 2OQ4A 2UXCM 2ZBKB 3U6CA 3DOAA 4MB7A 3GP1A 2XZUA 3GQ5A 4PDGA 4DV1M 1TDHA 3A46A 4NXNM 2OPFA 1HNXM 2XZFA 1L1ZA 1J5EM 3A45A 4G4NA 1N33M 5ITUA 3J80S 4DR4M 1Q39A 2Q2EB 3TWKA 4JV5M 4X65M 3OTOM 1NNJA 4PD2A 3SBJA 5IWAM 4X62M 5ITQA 4DR3M 4JI2M 4LF4M 4LFBM 2E5LM 3T1YM 1R2YA 3JAMS 3JR4A 4ITQA 5LMNM 1N32M 3GPUA 4K0KM 2F5NA 2VQEM 2HHHM 3GQ4A 4DUYM 4X64M 4DR7M 3U6SA 5FLXS 3U6LA 1N36M 1Q3CA 4LFCM 4JYAM 3U6EA 3SAVA 4PDIA 1Z5CA 1TDZA 1IBMM 4LF9M 2F5PA 4JI4M 4OX9M 3JR5A 5IT9S 2UXDM 2VQFM 1EE8A 4JI3M 3TWMA 3U6MA 4B3SM 4LF5M 4JI5M 4NXMM 3SAUA 3GPYA 1L2BA 1MU5A 3GO8A 4DV2M 2UUAM 4KHPM 4YHHM 1R2ZA 1XC8A 2UU9M 3J7AS 1XMQM 5LMUM 1K82A 5ITXA 1HNZM 4DV5M 1Z59A 2UUCM 1L1TA 2HKJA 3VK7A 1KFVA 4NRWA 1XNRM 4LFAM 2UXBM 4DV0M 1IBKM 5ITYA 3GQ3A 1XNQM 1Z5BA 1N34M 5ITXE 1PJIA 4DV3M 4DV6M 4DV7M 1PJJA 5ITTA 5A2QS 4DR5M 3J81S 2EA0A 5BR8M 4NRVA 1Z5AA 2F5OA
chains in the Genus database with same CATH superfamily
1UM8A 4AW4A 3UK6A 3KP0E 2DZNB 3RE8A 3FUXA 2LXEA 2R0IA 4LGYA 4B3MM 4DR2M 2L4FA 2R6FA 3D8LA 2YQZA 1IBLM 4MGHA 2JWSA 3VK8A 1L2CA 2F4VM 1GJSA 4G4OA 3GPPA 2EUCA 1ZMVA 3C58A 4DR6M 1MN3A 4GKKM 3BOSA 3FYCA 1V34A 1MJGM 3FRHA 3HKPA 1TR8A 1OAIA 2W82A 1J7KA 4TUWA 1ORYB 3FTDA 2F5QA 3ZC7B 1PM5A 3C3EA 4G4RA 1Q3BA 1IN8A 1QVRA 4LGMA 5GKNA 3ZQJA 1G8PA 4LJAA 3GPXA 3DA1A 5H37D 1I94M 4JI6M 3GRRA 3U60B 3U6DA 1OFIA 2Z7JA 3KS4A 4G6ZA 4OVZB 2XH9A 1IXSA 2CHQA 4AKHA 4JI7M 3PNYA 2FH0A 2LH0A 4BB9A 4YY3M 1XMOM 1L2DA 3KOWE 3THGA 3Q8GA 1YUBA 2ZM6M 4II7A 3DOAA 3FTFA 4MB7A 1G41A 2Z3XA 7CATA 3GQ5A 2RRUA 5EXTA 1HJPA 2DAGA 1P3QQ 2M5ZA 2OPFA 2XZFA 2D7GA 1L1ZA 3FYDA 1G3IA 3A45A 1SG9A 2BNKA 1QYRA 3GRVA 4I5SA 4G4NA 2ZAOA 1I4WA 1J09A 2DKLA 4HEOA 1V92A 3I04M 3J80S 1JQJC 2ERCA 3VDPA 2Q2EB 3NBIA 4Z8XA 3L26A 1QAMA 5KPRA 3ZCBB 3M0EA 1IFYA 1TH3A 5DYIA 5DNYA 3GLIE 2FS1A 2C5RA 4JI2M 3GRYA 3GLIB 4IJFA 2L4EA 3JAMS 3GLFE 4ITQA 4NC6A 4LZZA 3GLFB 1R7RA 3W68A 4K0KM 1N32M 1E32A 2DZOB 3I4VA 2HHHM 1D0KA 3HU3A 4LCBA 2G5GX 4R3DA 4IBCA 3AFHA 3U6LA 1NJGA 4GITA 4LY6A 1XHBA 3KSJA 3AOGA 3PFIA 4PT5A 2R65A 1IBMM 4OW0A 2F5PA 3LCVB 1OJLA 1T43A 4QHTA 3SYLA 3CF2A 4ANRA 4M9XA 1OTRA 4OX9M 2K6BA 2KHHA 3KOYE 3J27B 1EIJA 2QBYB 2QENA 1IY0A 4NXMM 3CGWA 3FTCA 3EIHA 2H1RA 3GO8A 3GLHB 4DV2M 1VG5A 4YHHM 2UUAM 1GABA 3VKGA 4P17A 3SHFA 3RGPA 4L4UA 5EP1A 2Y0QA 4Z6YA 3H4MA 4MH0E 1IXRC 2K0BX 5ITXA 1N77A 2O25A 3IHPA 2ZTDA 1DGHB 4L8RC 2UUCM 5KPTA 3AOEA 3HHZA 2LVOC 2HKJA 1KFVA 1JR3E 4LFAM 5ITYA 3GQ3A 1XNQM 3LQQA 2CUZA 2O01F 2ZTCA 1WGNA 3KOZE 2BJVA 3FUTA 4IBFA 3WHLA 2Y0TA 4AG5A 2L09A 2KZSA 4MGYE 4RF1A 5EP4A 1NJFA 2DHRA 1E9SA 1GKIA 1Z5AA 3MMPA 4NRVA 5FTLA 1G59A 2F5OA 4LZJA 4JI8M 3L25A 1K3XA 1TH4A 3TE6A 3TPZA 1QDRA 2XSZD 2QZ4A 3SAWA 3VKHA 3KW6A 2BWBA 2ZAMA 2C98A 3DFZA 4AKIA 2VF7A 2R46A 4LF7M 2LVQD 1IN6A 2DXIA 1VEJA 4B3RM 5JI3E 3TL4X 3U6PA 1IQPA 5EP3A 3HY5A 1GJTA 1VQ1A 1RU3A 2XFTA 2Y20A 3IG8A 1HNWM 3LQRA 4G4QA 4JI0M 1LTMA 4DR1M 2DVWB 1E9RA 1WXQA 2LTUA 2QQ8A 3U5ZA 3I01M 2CFOA 4GKJM 2MJ5B 2LVNC 2D7HA 2FOIC 3U6CA 1QANA 3KP1E 4DV1M 1HT2E 4IBEA 1F4IA 1TDHA 1GLNA 4NOOB 4NXNM 1IXSB 1NV8A 3NWLA 5IREB 1PGYA 1N33M 1X37A 2P5TA 2FNAA 1BVSA 1NV9A 5KQ8A 2WSEF 2JZ1A 2LNHC 4GEWA 2APLA 1N78A 3U61B 2LVPC 1CUKA 2XFSA 4X65M 4QOSA 3ZH9B 2XF3A 3OTOM 4FCVA 1NNJA 1IXZA 2L2DA 5E6JA 4WW0A 1W5TA 4X62M 1N75A 3BBZA 2DI0A 3RGSA 4LF4M 2E5LM 3T1YM 1R2YA 3JR4A 2XEPA 4MGIE 2KZUA 2BJWA 2CE7A 2KA6B 4AI6A 3E4RA 4KLNA 5KPZA 2D7EA 2XLJA 1IY1A 3MJ5A 5JI2E 1QZEA 3M7GA 2DHYA 3L29A 5FLXS 1N36M 4DR7M 2JP7A 1OKSA 5C1BA 4I4LA 2JUJA 1SXJE 3CF0A 1JR3D 1L8QA 2HCBA 3U6EA 3SAVA 4HLQA 4B7GA 4LF9M 1AUAA 4JI4M 1XXHA 4IBGA 4M0WA 4M0DA 3GRUA 3ILKA 4JXJA 2A5YB 2QSFX 4B7FA 1A5TA 3E21A 2V6ZM 4B3SM 2JNHA 3TWMA 3U6MA 3SAUA 2RKOA 3TQSA 3VFDA 5DYGA 4D80A 5EXPA 4R71A 1V33A 1ZV1A 4KHPM 1SXJA 3AV0A 1XC8A 2CV2A 2UU9M 1HT1E 1OAOC 3FUUA 4AG6A 5LMUM 1K82A 1DGBA 3FD9A 3I4YA 2CHVA 3L27A 4NSOB 3VK7A 4NRWA 2WSCF 3KXEC 1QUSA 1XWIA 3UZUA 1XNRM 1IBKM 4GIPA 2EJSA 5KO3A 3HJQA 3HJ8A 3UMMA 5ITXE 2X8AA 4DV6M 3FKEA 3K9OA 4DV7M 1PJIA 1XB2B 5ITTA 8CATA 1DGFA 4L78A 2N35A 2EA0A 4DR5M 2R44A 5EP2A 1KYIA 3KFUG 4NSRA 4CJ6A 2NQ8C 2VDBB 2K47A 4CGYB 3U6QA 1HQYE 1R4GA 1GL6A 2CWBA 2DAMA 2KW0A 3HU2A 4IBKA 5ITRA 4DV4M 4AQYM 2UUBM 1HR0M 3W0FA 4GRIA 3FRIA 3T15A 1VEKA 1K3WA 3KS8A 2EKKA 1OFHA 1PRBA 2QP9X 3HU1A 1DV0A 2DWLA 1LV7A 1FJGM 4GC9A 2JY7A 2LVAA 2RGOA 1E94E 2HL7A 2J5YA 3M6AA 4BLCA 3SATA 2K9DA 5EQTA 3QAUA 4GHAA 4LF8M 1OQYA 2Z4RA 2F5SA 1H6UA 4P16A 4FCWA 3V76A 2GQFA 1GVNA 3L28A 1QDTA 2FFJA 2KNZA 4DUZM 3FUWA 2OQ4A 4LJ6A 3VLFB 2UXCM 2EO2A 2R62A 2ZBKB 1NVMA 1TGUA 2ZANA 4I81A 4LJ8A 2MH8A 2O5RA 3GP1A 3U5ZB 2VIIA 3MHVC 1T3TA 3K2LA 1J5EM 3WHKA 1IN4A 1NO1A 1IN7A 5ITUA 1D0LA 4IBDA 3UJNA 3GLHA 3W67A 4DR4M 4W5WA 3TWKA 3VDUA 3CF6E 5EXSA 1PJSA 2BWEA 3J7BA 2CV1A 1TH2A 4PD2A 1FNNA 3SYKA 4S12A 5ITQA 4RNAA 4LFBM 3GLGA 2V1CA 3E46A 2R45A 4OU7A 2KRKA 3HZJA 3K1JA 4CIZA 3R8FA 1KSFX 1VDLA 4QNMA 4F1IA 3GQ4A 1W5SA 2KXEA 2MROB 4IJEA 1NY5A 2KDLA 4I8OA 1QAQA 1ZQ9A 2C96A 1TDZA 1QUTA 3MK6A 2LHGA 2JZ0A 2DNAA 2CRUA 2L6OA 4FWHA 4WP2A 4LJ9A 1EFUB 4L6V6 5FTNA 3J2PB 5IT9S 3K8ZA 1EE8A 4IBBA 4JI3M 4JI5M 2OOBA 4MGZE 3SMPA 1AIPC 4LJ7A 1XXHE 2DAKA 4MGKE 1XXHB 3SC3A 4GC5A 1NNUC 1G4AE 2G3QA 2Z8YM 1R2ZA 2X4AA 3DZDA 3SHGB 1NSFA 5FTMA 1XMQM 4Q7JA 4GH9A 3FTEA 1GO5A 3B89A 3KDSE 3KOXE 4FD2A 1Z59A 4RF0A 1L1TA 1NHWC 1QQWA 1VEGA 2DAEA 1OIZA 1SXJB 3AOEC 4DV0M 2UXBM 2YFQA 5BPVA 2GNOA 4A3VB 1N34M 4DV3M 2L7HA 1PJJA 3HHYA 3FUVA 5A2QS 3J81S 1T6OA 2AHMA 1IM2A 5FTKA 5BR8M 2QNJA 1S3SA 2KNAA 2OOAA 4GMQA 3U6OA 2JXNA 2C9OA 3HJSA 4B3TM 3B9PA 4KO8A 3RFWA 4L16A 5IZ7D 4B7HA 3SASA 1MX0A 2VF8A 3A42A 4LJ4A 3U61A 3B74A 3B7NA 1VDDA 3T1HM 3SARA 2CP8A 2QHOB 2H5XA 2XGNA 3U60A 2HWJA 1G71A 4OVZA 5E26A 4LJ5A 3KSXA 4LF6M 3PXGA 2I7NA 2DWMA 3PNVA 4FVMA 4D82A 3CTWB 4RKUF 3LVVA 4G3OA 4AKGA 1Z6TA 3T6PA 2C9CA 2XSZA 5FTJA 4X66M 4CISA 1NHGC 4LG2A 1DO0A 2JY8A 3TWLA 3AKZA 4PCZA 3H4JA 1UFZA 2JA2A 4B08A 3FE3A 4JI1M 5F3WA 2DENA 5L8RF 3QYBA 2C99A 2JY5A 4AZFA 2DWNA 3L2AA 4UN2B 1D0MA 4QNRA 3K92A 3QYEA 2WZJA 2XZUA 2I7PA 4PDGA 1DGGA 4JN6A 1WIVA 1Q02A 3SFZA 3A46A 1HNXM 2HAKA 3NBXX 1WHCA 3LCUA 2QPAA 3R9XB 4NL4H 4KT0F 2KEBA 3B7QA 1Y8GA 3GLIA 1TTEA 4IIWA 1Q39A 2J7OA 3HWSA 1R5LA 1QAOA 2LBCA 3GLFA 4JV5M 4FWDA 2MGWA 1IN5A 3BXWA 3HHWA 2OO9A 3IECA 4IBIA 3SBJA 1ZAEA 1WGLA 5IWAM 2FE8A 4DR3M 4Y28F 2R18A 3PVSA 3K9PA 3GLHE 4ZPXA 2YNMD 3HHXA 4MM3B 1NY6A 5EJCA 2Z4SA 4F2LA 4FWGA 3GPUA 5LMNM 2CV0A 4XGIA 3UGJA 2VQEM 1OIPA 2F5NA 4BBAA 4QOZC 5EXXA 4DUYM 4DBGB 2DZLA 1C1KA 2LWXA 4FCTA 3D8BA 1PJTA 4X64M 3U6SA 3LMMA 3AJIB 3HX3A 2M60A 4HL4A 2DWZB 3GLGE 2V1UA 1IY2A 3GLGB 1Q3CA 1TF0B 1ZMUA 3C3DA 1SXJD 4LFCM 4JYAM 4LRTA 2QBYA 1C7YA 4FW9A 2QCUA 1Z5CA 4PDIA 4GHLA 2G8LA 2CEAA 2DAIA 2J7NA 3QWLA 5FSWA 1QZMA 5C18A 1WJ7A 2R4EA 4M9ZA 3JR5A 3KVWA 1JB0F 5KQDA 2VQFM 1YLAA 2UXDM 2MR9A 4LF5M 4WURA 3HGIA 1WR1B 1DGHA 2JY6B 3GPYA 1L2BA 4EIWA 2B3TA 3T38A 1MU5A 1YSYA 1JR3A 2R4JA 4CHTB 4IBJA 2KRUA 1SXJC 3IG5A 3J7AS 3A98B 4KODA 4XBOA 1GL7A 1PJQA 2X49A 4QHSA 3SMSA 1HNZM 3C9PA 3B7ZA 3LVWA 4DV5M 3F92A 1HQCA 3W0LB 2EKFA 4LRSA 2KNVA 2LHCA 1ZMWA 4L15A 2YR0A 4M9SA 4D81A 1R6BX 4REZA 5DFLA 1D2NA 1Z5BA 4XK8F 3AL0C 2Y21A 3LW5F 3E9SA 2WSFF 3EIEA 1DO2A 2RGHA 3Q8XA 4R7GA 3I51A 2CHGA 2L7IA 1YE9A
chains in the Genus database with same CATH topology
1UM8A 4AW4A 3UK6A 3KP0E 2DZNB 3RE8A 3FUXA 2LXEA 4LGYA 4B3MM 4DR2M 1IBLM 3D8LA 2YQZA 4MGHA 3VK8A 1L2CA 2F4VM 4G4OA 3GPPA 2EUCA 3C58A 4DR6M 4GKKM 3BOSA 3FYCA 3HKPA 2W82A 1J7KA 4TUWA 1ORYB 3FTDA 2F5QA 3ZC7B 1PM5A 4G4RA 1Q3BA 1IN8A 1QVRA 4LGMA 5GKNA 3GPXA 1G8PA 4LJAA 1I94M 3DA1A 5H37D 4JI6M 3GRRA 3U60B 3U6DA 1OFIA 2Z7JA 3KS4A 4G6ZA 4OVZB 2XH9A 4AKHA 2CHQA 4JI7M 3PNYA 4BB9A 2LH0A 1XMOM 4YY3M 1L2DA 3KOWE 3THGA 2ZM6M 1YUBA 4II7A 3DOAA 3FTFA 4MB7A 1G41A 2Z3XA 7CATA 3GQ5A 5EXTA 2M5ZA 2OPFA 2XZFA 2D7GA 1L1ZA 3FYDA 1G3IA 3A45A 3GRVA 2BNKA 1QYRA 4I5SA 4G4NA 2ZAOA 1I4WA 1J09A 3J80S 1JQJC 2ERCA 3VDPA 2Q2EB 3NBIA 4Z8XA 3L26A 1QAMA 5KPRA 3ZCBB 3M0EA 1TH3A 5DYIA 5DNYA 2C5RA 4JI2M 3GRYA 3GLIB 4IJFA 3JAMS 4ITQA 4LZZA 3GLFB 1R7RA 4K0KM 1N32M 1E32A 2DZOB 3I4VA 2HHHM 4LCBA 3HU3A 2G5GX 4R3DA 4IBCA 3AFHA 3U6LA 1NJGA 4GITA 4LY6A 1XHBA 3KSJA 3AOGA 3PFIA 4PT5A 2R65A 1IBMM 4OW0A 2F5PA 1OJLA 3SYLA 4QHTA 3CF2A 4M9XA 4OX9M 3KOYE 3J27B 2QBYB 2QENA 1IY0A 4NXMM 3FTCA 3EIHA 2H1RA 3GO8A 3GLHB 4DV2M 2UUAM 4YHHM 3VKGA 3SHFA 3RGPA 4L4UA 5EP1A 2Y0QA 4Z6YA 3H4MA 4MH0E 1IXRC 1N77A 5ITXA 1DGHB 4L8RC 2UUCM 5KPTA 3AOEA 3HHZA 2HKJA 1KFVA 4LFAM 5ITYA 3GQ3A 1XNQM 3LQQA 2CUZA 4IBFA 3KOZE 2BJVA 3FUTA 3WHLA 2Y0TA 4AG5A 2L09A 2KZSA 4MGYE 4RF1A 5EP4A 1NJFA 2DHRA 1E9SA 1GKIA 1Z5AA 4NRVA 5FTLA 1G59A 2F5OA 4LZJA 4JI8M 3L25A 1K3XA 1TH4A 3TE6A 3TPZA 2XSZD 2QZ4A 3SAWA 3VKHA 3KW6A 2ZAMA 2C98A 3DFZA 4AKIA 2R46A 4LF7M 1IN6A 2DXIA 4B3RM 5JI3E 3TL4X 3U6PA 1IQPA 5EP3A 2XFTA 2Y20A 3IG8A 1HNWM 3LQRA 4G4QA 4JI0M 4DR1M 2DVWB 1E9RA 1WXQA 3U5ZA 2CFOA 4GKJM 2D7HA 2FOIC 3U6CA 1QANA 3KP1E 4DV1M 1HT2E 4IBEA 1TDHA 1GLNA 4NOOB 4NXNM 1IXSB 3NWLA 5IREB 1N33M 1X37A 2P5TA 2FNAA 5KQ8A 1N78A 2LNHC 3U61B 2XFSA 4X65M 4QOSA 3ZH9B 2XF3A 3OTOM 4FCVA 1NNJA 1IXZA 5E6JA 4WW0A 1W5TA 4X62M 1N75A 3RGSA 4LF4M 2E5LM 3T1YM 1R2YA 3JR4A 2XEPA 4MGIE 2KZUA 2BJWA 2CE7A 2KA6B 4AI6A 3E4RA 4KLNA 5KPZA 2D7EA 2XLJA 1IY1A 3MJ5A 5JI2E 3M7GA 4DR7M 3L29A 5FLXS 1N36M 5C1BA 4I4LA 1SXJE 3CF0A 1JR3D 1L8QA 2HCBA 3U6EA 3SAVA 4HLQA 4B7GA 4LF9M 4JI4M 1XXHA 4IBGA 4M0WA 4M0DA 3GRUA 3ILKA 4JXJA 2A5YB 4B7FA 2V6ZM 4B3SM 3TWMA 3U6MA 3SAUA 2RKOA 3TQSA 3VFDA 5DYGA 4D80A 5EXPA 4KHPM 1SXJA 3AV0A 1XC8A 2CV2A 2UU9M 1HT1E 3FUUA 4AG6A 5LMUM 1K82A 1DGBA 3FD9A 3I4YA 2CHVA 3L27A 4NSOB 3VK7A 4NRWA 3KXEC 3UZUA 1XWIA 1XNRM 1IBKM 4GIPA 5KO3A 3HJQA 3HJ8A 3UMMA 5ITXE 2X8AA 4DV6M 3FKEA 4DV7M 1PJIA 5ITTA 8CATA 1DGFA 4L78A 2EA0A 4DR5M 5EP2A 1KYIA 3KFUG 4NSRA 2NQ8C 2K47A 4CGYB 3U6QA 1HQYE 1GL6A 4IBKA 3HU2A 2KW0A 5ITRA 4DV4M 4AQYM 2UUBM 1HR0M 3W0FA 4GRIA 1K3WA 3T15A 3KS8A 1OFHA 2QP9X 3HU1A 2DWLA 1LV7A 1FJGM 4GC9A 2RGOA 1E94E 2HL7A 3M6AA 4BLCA 3SATA 5EQTA 3QAUA 4GHAA 4LF8M 2Z4RA 2F5SA 1H6UA 4P16A 4FCWA 1GVNA 3L28A 2FFJA 4DUZM 3FUWA 2OQ4A 4LJ6A 3VLFB 2UXCM 2EO2A 2R62A 2ZBKB 1NVMA 1TGUA 2ZANA 4I81A 4LJ8A 2O5RA 3GP1A 3U5ZB 2VIIA 3MHVC 1T3TA 3K2LA 1J5EM 3WHKA 1IN4A 1IN7A 5ITUA 4IBDA 3UJNA 3GLHA 4DR4M 4W5WA 3TWKA 3VDUA 3CF6E 5EXSA 3J7BA 2CV1A 1TH2A 4PD2A 1FNNA 3SYKA 4S12A 5ITQA 4RNAA 4LFBM 3GLGA 2V1CA 2R45A 4OU7A 2KRKA 3K1JA 3R8FA 1KSFX 4QNMA 3GQ4A 1W5SA 2KXEA 4IJEA 1NY5A 4I8OA 1QAQA 1ZQ9A 2C96A 1TDZA 3MK6A 4FWHA 2L6OA 4LJ9A 5FTNA 3J2PB 5IT9S 3K8ZA 1EE8A 4IBBA 4JI3M 4JI5M 3SMPA 4MGZE 4LJ7A 4MGKE 1XXHB 3SC3A 4GC5A 1NNUC 1G4AE 1R2ZA 2X4AA 3DZDA 3SHGB 1NSFA 5FTMA 1XMQM 4GH9A 3FTEA 3KDSE 3KOXE 4FD2A 1Z59A 4RF0A 1L1TA 1NHWC 1QQWA 1SXJB 2UXBM 3AOEC 4DV0M 2YFQA 5BPVA 4A3VB 1N34M 4DV3M 2L7HA 1PJJA 3HHYA 3FUVA 5A2QS 3J81S 2AHMA 1IM2A 5FTKA 5BR8M 1S3SA 4GMQA 3U6OA 3HJSA 2C9OA 4B3TM 3B9PA 4KO8A 3RFWA 4L16A 5IZ7D 4B7HA 3SASA 1MX0A 3A42A 4LJ4A 3U61A 1VDDA 3T1HM 3SARA 2XGNA 3U60A 4OVZA 5E26A 4LF6M 4LJ5A 3KSXA 3PXGA 2I7NA 2DWMA 3PNVA 4FVMA 4D82A 3CTWB 3LVVA 4AKGA 1Z6TA 2C9CA 2XSZA 5FTJA 4X66M 4CISA 1NHGC 4LG2A 1DO0A 3TWLA 3AKZA 4PCZA 2JA2A 4B08A 4JI1M 5F3WA 2C99A 4AZFA 2DWNA 3L2AA 4QNRA 3K92A 2XZUA 2I7PA 4PDGA 1DGGA 4JN6A 3SFZA 3A46A 1HNXM 3R9XB 2QPAA 4NL4H 2KEBA 3GLIA 4IIWA 1Q39A 2J7OA 3HWSA 1QAOA 3GLFA 4JV5M 4FWDA 1IN5A 3HHWA 4IBIA 3SBJA 1ZAEA 5IWAM 2FE8A 4DR3M 2R18A 3PVSA 4ZPXA 2YNMD 3HHXA 4MM3B 1NY6A 5EJCA 2Z4SA 5LMNM 4FWGA 3GPUA 2CV0A 4XGIA 3UGJA 2VQEM 2F5NA 4QOZC 4BBAA 5EXXA 4DUYM 2LWXA 1C1KA 4FCTA 4X64M 3D8BA 3U6SA 3LMMA 3AJIB 2M60A 4HL4A 2DWZB 2V1UA 1IY2A 3GLGB 1Q3CA 4LFCM 4JYAM 1SXJD 4LRTA 2QBYA 4FW9A 2QCUA 1Z5CA 4PDIA 4GHLA 2G8LA 2CEAA 2J7NA 3QWLA 5FSWA 1QZMA 5C18A 2R4EA 4M9ZA 3JR5A 3KVWA 5KQDA 2UXDM 2VQFM 4LF5M 4WURA 3HGIA 1DGHA 3GPYA 1L2BA 4EIWA 3T38A 1MU5A 1YSYA 1JR3A 2R4JA 4CHTB 4IBJA 2KRUA 1SXJC 3IG5A 3J7AS 3A98B 4KODA 4XBOA 1GL7A 2X49A 4QHSA 3SMSA 1HNZM 3LVWA 4DV5M 1HQCA 3W0LB 4LRSA 4L15A 4M9SA 2YR0A 4D81A 1R6BX 4REZA 1D2NA 1Z5BA 3AL0C 2Y21A 3E9SA 3EIEA 1DO2A 2RGHA 3Q8XA 4R7GA 3I51A 2CHGA 2L7IA 1YE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 M;  1K3X A;  4B3M M;  3U6O A;  4B3T M;  4DR2 M;  1IBL M;  3SAW A;  3U6Q A;  3SAS A;  4AQY M;  1MX0 A;  5ITR A;  4DV4 M;  3VK8 A;  1L2C A;  3A42 A;  2UUB M;  2F4V M;  4G4O A;  3GPP A;  1HR0 M;  3W0F A;  4DR6 M;  3C58 A;  4LF7 M;  1K3W A;  3T1H M;  4GKK M;  3SAR A;  4B3R M;  3U6P A;  4LF6 M;  1FJG M;  1HNW M;  2F5Q A;  1PM5 A;  4G4Q A;  4JI0 M;  4G4R A;  4DR1 M;  1Q3B A;  4X66 M;  4CIS A;  3SAT A;  3GPX A;  3TWL A;  1I94 M;  4PCZ A;  4LF8 M;  4JI6 M;  4JI1 M;  2F5S A;  3U6D A;  4GKJ M;  4JI7 M;  1L2D A;  1XMO M;  4YY3 M;  4DUZ M;  2ZM6 M;  2OQ4 A;  2UXC M;  2ZBK B;  3U6C A;  3DOA A;  4MB7 A;  3GP1 A;  2XZU A;  3GQ5 A;  4PDG A;  4DV1 M;  1TDH A;  3A46 A;  4NXN M;  2OPF A;  1HNX M;  2XZF A;  1L1Z A;  1J5E M;  3A45 A;  4G4N A;  1N33 M;  5ITU A;  3J80 S;  4DR4 M;  1Q39 A;  2Q2E B;  3TWK A;  4JV5 M;  4X65 M;  3OTO M;  1NNJ A;  4PD2 A;  3SBJ A;  5IWA M;  4X62 M;  5ITQ A;  4DR3 M;  4JI2 M;  4LF4 M;  4LFB M;  2E5L M;  3T1Y M;  1R2Y A;  3JAM S;  3JR4 A;  4ITQ A;  5LMN M;  1N32 M;  3GPU A;  4K0K M;  2F5N A;  2VQE M;  2HHH M;  3GQ4 A;  4DUY M;  4X64 M;  4DR7 M;  3U6S A;  5FLX S;  3U6L A;  1N36 M;  1Q3C A;  4LFC M;  4JYA M;  3U6E A;  3SAV A;  4PDI A;  1Z5C A;  1TDZ A;  1IBM M;  4LF9 M;  2F5P A;  4JI4 M;  4OX9 M;  3JR5 A;  5IT9 S;  2UXD M;  2VQF M;  1EE8 A;  4JI3 M;  3TWM A;  3U6M A;  4B3S M;  4LF5 M;  4JI5 M;  4NXM M;  3SAU A;  3GPY A;  1L2B A;  1MU5 A;  3GO8 A;  4DV2 M;  2UUA M;  4KHP M;  4YHH M;  1R2Z A;  1XC8 A;  2UU9 M;  3J7A S;  1XMQ M;  5LMU M;  1K82 A;  5ITX A;  1HNZ M;  4DV5 M;  1Z59 A;  2UUC M;  1L1T A;  2HKJ A;  3VK7 A;  1KFV A;  4NRW A;  1XNR M;  4LFA M;  2UXB M;  4DV0 M;  1IBK M;  5ITY A;  3GQ3 A;  1XNQ M;  1Z5B A;  1N34 M;  5ITX E;  1PJI A;  4DV3 M;  4DV6 M;  4DV7 M;  1PJJ A;  5ITT A;  5A2Q S;  4DR5 M;  3J81 S;  2EA0 A;  5BR8 M;  4NRV A;  1Z5A A;  2F5O A; 
#chains in the Genus database with same CATH topology
 1UM8 A;  4AW4 A;  3UK6 A;  3KP0 E;  2DZN B;  3RE8 A;  3FUX A;  2LXE A;  2R0I A;  4LGY A;  4B3M M;  4DR2 M;  2L4F A;  2R6F A;  3D8L A;  2YQZ A;  1IBL M;  4MGH A;  2JWS A;  3VK8 A;  1L2C A;  2F4V M;  1GJS A;  4G4O A;  3GPP A;  2EUC A;  1ZMV A;  3C58 A;  4DR6 M;  1MN3 A;  4GKK M;  3BOS A;  3FYC A;  1V34 A;  1MJG M;  3FRH A;  3HKP A;  1TR8 A;  1OAI A;  2W82 A;  1J7K A;  4TUW A;  1ORY B;  3FTD A;  2F5Q A;  3ZC7 B;  1PM5 A;  3C3E A;  4G4R A;  1Q3B A;  1IN8 A;  1QVR A;  4LGM A;  5GKN A;  3ZQJ A;  1G8P A;  4LJA A;  3GPX A;  3DA1 A;  5H37 D;  1I94 M;  4JI6 M;  3GRR A;  3U60 B;  3U6D A;  1OFI A;  2Z7J A;  3KS4 A;  4G6Z A;  4OVZ B;  2XH9 A;  1IXS A;  2CHQ A;  4AKH A;  4JI7 M;  3PNY A;  2FH0 A;  2LH0 A;  4BB9 A;  4YY3 M;  1XMO M;  1L2D A;  3KOW E;  3THG A;  3Q8G A;  1YUB A;  2ZM6 M;  4II7 A;  3DOA A;  3FTF A;  4MB7 A;  1G41 A;  2Z3X A;  7CAT A;  3GQ5 A;  2RRU A;  5EXT A;  1HJP A;  2DAG A;  1P3Q Q;  2M5Z A;  2OPF A;  2XZF A;  2D7G A;  1L1Z A;  3FYD A;  1G3I A;  3A45 A;  1SG9 A;  2BNK A;  1QYR A;  3GRV A;  4I5S A;  4G4N A;  2ZAO A;  1I4W A;  1J09 A;  2DKL A;  4HEO A;  1V92 A;  3I04 M;  3J80 S;  1JQJ C;  2ERC A;  3VDP A;  2Q2E B;  3NBI A;  4Z8X A;  3L26 A;  1QAM A;  5KPR A;  3ZCB B;  3M0E A;  1IFY A;  1TH3 A;  5DYI A;  5DNY A;  3GLI E;  2FS1 A;  2C5R A;  4JI2 M;  3GRY A;  3GLI B;  4IJF A;  2L4E A;  3JAM S;  3GLF E;  4ITQ A;  4NC6 A;  4LZZ A;  3GLF B;  1R7R A;  3W68 A;  4K0K M;  1N32 M;  1E32 A;  2DZO B;  3I4V A;  2HHH M;  1D0K A;  3HU3 A;  4LCB A;  2G5G X;  4R3D A;  4IBC A;  3AFH A;  3U6L A;  1NJG A;  4GIT A;  4LY6 A;  1XHB A;  3KSJ A;  3AOG A;  3PFI A;  4PT5 A;  2R65 A;  1IBM M;  4OW0 A;  2F5P A;  3LCV B;  1OJL A;  1T43 A;  4QHT A;  3SYL A;  3CF2 A;  4ANR A;  4M9X A;  1OTR A;  4OX9 M;  2K6B A;  2KHH A;  3KOY E;  3J27 B;  1EIJ A;  2QBY B;  2QEN A;  1IY0 A;  4NXM M;  3CGW A;  3FTC A;  3EIH A;  2H1R A;  3GO8 A;  3GLH B;  4DV2 M;  1VG5 A;  4YHH M;  2UUA M;  1GAB A;  3VKG A;  4P17 A;  3SHF A;  3RGP A;  4L4U A;  5EP1 A;  2Y0Q A;  4Z6Y A;  3H4M A;  4MH0 E;  1IXR C;  2K0B X;  5ITX A;  1N77 A;  2O25 A;  3IHP A;  2ZTD A;  1DGH B;  4L8R C;  2UUC M;  5KPT A;  3AOE A;  3HHZ A;  2LVO C;  2HKJ A;  1KFV A;  1JR3 E;  4LFA M;  5ITY A;  3GQ3 A;  1XNQ M;  3LQQ A;  2CUZ A;  2O01 F;  2ZTC A;  1WGN A;  3KOZ E;  2BJV A;  3FUT A;  4IBF A;  3WHL A;  2Y0T A;  4AG5 A;  2L09 A;  2KZS A;  4MGY E;  4RF1 A;  5EP4 A;  1NJF A;  2DHR A;  1E9S A;  1GKI A;  1Z5A A;  3MMP A;  4NRV A;  5FTL A;  1G59 A;  2F5O A;  4LZJ A;  4JI8 M;  3L25 A;  1K3X A;  1TH4 A;  3TE6 A;  3TPZ A;  1QDR A;  2XSZ D;  2QZ4 A;  3SAW A;  3VKH A;  3KW6 A;  2BWB A;  2ZAM A;  2C98 A;  3DFZ A;  4AKI A;  2VF7 A;  2R46 A;  4LF7 M;  2LVQ D;  1IN6 A;  2DXI A;  1VEJ A;  4B3R M;  5JI3 E;  3TL4 X;  3U6P A;  1IQP A;  5EP3 A;  3HY5 A;  1GJT A;  1VQ1 A;  1RU3 A;  2XFT A;  2Y20 A;  3IG8 A;  1HNW M;  3LQR A;  4G4Q A;  4JI0 M;  1LTM A;  4DR1 M;  2DVW B;  1E9R A;  1WXQ A;  2LTU A;  2QQ8 A;  3U5Z A;  3I01 M;  2CFO A;  4GKJ M;  2MJ5 B;  2LVN C;  2D7H A;  2FOI C;  3U6C A;  1QAN A;  3KP1 E;  4DV1 M;  1HT2 E;  4IBE A;  1F4I A;  1TDH A;  1GLN A;  4NOO B;  4NXN M;  1IXS B;  1NV8 A;  3NWL A;  5IRE B;  1PGY A;  1N33 M;  1X37 A;  2P5T A;  2FNA A;  1BVS A;  1NV9 A;  5KQ8 A;  2WSE F;  2JZ1 A;  2LNH C;  4GEW A;  2APL A;  1N78 A;  3U61 B;  2LVP C;  1CUK A;  2XFS A;  4X65 M;  4QOS A;  3ZH9 B;  2XF3 A;  3OTO M;  4FCV A;  1NNJ A;  1IXZ A;  2L2D A;  5E6J A;  4WW0 A;  1W5T A;  4X62 M;  1N75 A;  3BBZ A;  2DI0 A;  3RGS A;  4LF4 M;  2E5L M;  3T1Y M;  1R2Y A;  3JR4 A;  2XEP A;  4MGI E;  2KZU A;  2BJW A;  2CE7 A;  2KA6 B;  4AI6 A;  3E4R A;  4KLN A;  5KPZ A;  2D7E A;  2XLJ A;  1IY1 A;  3MJ5 A;  5JI2 E;  1QZE A;  3M7G A;  2DHY A;  3L29 A;  5FLX S;  1N36 M;  4DR7 M;  2JP7 A;  1OKS A;  5C1B A;  4I4L A;  2JUJ A;  1SXJ E;  3CF0 A;  1JR3 D;  1L8Q A;  2HCB A;  3U6E A;  3SAV A;  4HLQ A;  4B7G A;  4LF9 M;  1AUA A;  4JI4 M;  1XXH A;  4IBG A;  4M0W A;  4M0D A;  3GRU A;  3ILK A;  4JXJ A;  2A5Y B;  2QSF X;  4B7F A;  1A5T A;  3E21 A;  2V6Z M;  4B3S M;  2JNH A;  3TWM A;  3U6M A;  3SAU A;  2RKO A;  3TQS A;  3VFD A;  5DYG A;  4D80 A;  5EXP A;  4R71 A;  1V33 A;  1ZV1 A;  4KHP M;  1SXJ A;  3AV0 A;  1XC8 A;  2CV2 A;  2UU9 M;  1HT1 E;  1OAO C;  3FUU A;  4AG6 A;  5LMU M;  1K82 A;  1DGB A;  3FD9 A;  3I4Y A;  2CHV A;  3L27 A;  4NSO B;  3VK7 A;  4NRW A;  2WSC F;  3KXE C;  1QUS A;  1XWI A;  3UZU A;  1XNR M;  1IBK M;  4GIP A;  2EJS A;  5KO3 A;  3HJQ A;  3HJ8 A;  3UMM A;  5ITX E;  2X8A A;  4DV6 M;  3FKE A;  3K9O A;  4DV7 M;  1PJI A;  1XB2 B;  5ITT A;  8CAT A;  1DGF A;  4L78 A;  2N35 A;  2EA0 A;  4DR5 M;  2R44 A;  5EP2 A;  1KYI A;  3KFU G;  4NSR A;  4CJ6 A;  2NQ8 C;  2VDB B;  2K47 A;  4CGY B;  3U6Q A;  1HQY E;  1R4G A;  1GL6 A;  2CWB A;  2DAM A;  2KW0 A;  3HU2 A;  4IBK A;  5ITR A;  4DV4 M;  4AQY M;  2UUB M;  1HR0 M;  3W0F A;  4GRI A;  3FRI A;  3T15 A;  1VEK A;  1K3W A;  3KS8 A;  2EKK A;  1OFH A;  1PRB A;  2QP9 X;  3HU1 A;  1DV0 A;  2DWL A;  1LV7 A;  1FJG M;  4GC9 A;  2JY7 A;  2LVA A;  2RGO A;  1E94 E;  2HL7 A;  2J5Y A;  3M6A A;  4BLC A;  3SAT A;  2K9D A;  5EQT A;  3QAU A;  4GHA A;  4LF8 M;  1OQY A;  2Z4R A;  2F5S A;  1H6U A;  4P16 A;  4FCW A;  3V76 A;  2GQF A;  1GVN A;  3L28 A;  1QDT A;  2FFJ A;  2KNZ A;  4DUZ M;  3FUW A;  2OQ4 A;  4LJ6 A;  3VLF B;  2UXC M;  2EO2 A;  2R62 A;  2ZBK B;  1NVM A;  1TGU A;  2ZAN A;  4I81 A;  4LJ8 A;  2MH8 A;  2O5R A;  3GP1 A;  3U5Z B;  2VII A;  3MHV C;  1T3T A;  3K2L A;  1J5E M;  3WHK A;  1IN4 A;  1NO1 A;  1IN7 A;  5ITU A;  1D0L A;  4IBD A;  3UJN A;  3GLH A;  3W67 A;  4DR4 M;  4W5W A;  3TWK A;  3VDU A;  3CF6 E;  5EXS A;  1PJS A;  2BWE A;  3J7B A;  2CV1 A;  1TH2 A;  4PD2 A;  1FNN A;  3SYK A;  4S12 A;  5ITQ A;  4RNA A;  4LFB M;  3GLG A;  2V1C A;  3E46 A;  2R45 A;  4OU7 A;  2KRK A;  3HZJ A;  3K1J A;  4CIZ A;  3R8F A;  1KSF X;  1VDL A;  4QNM A;  4F1I A;  3GQ4 A;  1W5S A;  2KXE A;  2MRO B;  4IJE A;  1NY5 A;  2KDL A;  4I8O A;  1QAQ A;  1ZQ9 A;  2C96 A;  1TDZ A;  1QUT A;  3MK6 A;  2LHG A;  2JZ0 A;  2DNA A;  2CRU A;  2L6O A;  4FWH A;  4WP2 A;  4LJ9 A;  1EFU B;  4L6V 6;  5FTN A;  3J2P B;  5IT9 S;  3K8Z A;  1EE8 A;  4IBB A;  4JI3 M;  4JI5 M;  2OOB A;  4MGZ E;  3SMP A;  1AIP C;  4LJ7 A;  1XXH E;  2DAK A;  4MGK E;  1XXH B;  3SC3 A;  4GC5 A;  1NNU C;  1G4A E;  2G3Q A;  2Z8Y M;  1R2Z A;  2X4A A;  3DZD A;  3SHG B;  1NSF A;  5FTM A;  1XMQ M;  4Q7J A;  4GH9 A;  3FTE A;  1GO5 A;  3B89 A;  3KDS E;  3KOX E;  4FD2 A;  1Z59 A;  4RF0 A;  1L1T A;  1NHW C;  1QQW A;  1VEG A;  2DAE A;  1OIZ A;  1SXJ B;  3AOE C;  4DV0 M;  2UXB M;  2YFQ A;  5BPV A;  2GNO A;  4A3V B;  1N34 M;  4DV3 M;  2L7H A;  1PJJ A;  3HHY A;  3FUV A;  5A2Q S;  3J81 S;  1T6O A;  2AHM A;  1IM2 A;  5FTK A;  5BR8 M;  2QNJ A;  1S3S A;  2KNA A;  2OOA A;  4GMQ A;  3U6O A;  2JXN A;  2C9O A;  3HJS A;  4B3T M;  3B9P A;  4KO8 A;  3RFW A;  4L16 A;  5IZ7 D;  4B7H A;  3SAS A;  1MX0 A;  2VF8 A;  3A42 A;  4LJ4 A;  3U61 A;  3B74 A;  3B7N A;  1VDD A;  3T1H M;  3SAR A;  2CP8 A;  2QHO B;  2H5X A;  2XGN A;  3U60 A;  2HWJ A;  1G71 A;  4OVZ A;  5E26 A;  4LJ5 A;  3KSX A;  4LF6 M;  3PXG A;  2I7N A;  2DWM A;  3PNV A;  4FVM A;  4D82 A;  3CTW B;  4RKU F;  3LVV A;  4G3O A;  4AKG A;  1Z6T A;  3T6P A;  2C9C A;  2XSZ A;  5FTJ A;  4X66 M;  4CIS A;  1NHG C;  4LG2 A;  1DO0 A;  2JY8 A;  3TWL A;  3AKZ A;  4PCZ A;  3H4J A;  1UFZ A;  2JA2 A;  4B08 A;  3FE3 A;  4JI1 M;  5F3W A;  2DEN A;  5L8R F;  3QYB A;  2C99 A;  2JY5 A;  4AZF A;  2DWN A;  3L2A A;  4UN2 B;  1D0M A;  4QNR A;  3K92 A;  3QYE A;  2WZJ A;  2XZU A;  2I7P A;  4PDG A;  1DGG A;  4JN6 A;  1WIV A;  1Q02 A;  3SFZ A;  3A46 A;  1HNX M;  2HAK A;  3NBX X;  1WHC A;  3LCU A;  2QPA A;  3R9X B;  4NL4 H;  4KT0 F;  2KEB A;  3B7Q A;  1Y8G A;  3GLI A;  1TTE A;  4IIW A;  1Q39 A;  2J7O A;  3HWS A;  1R5L A;  1QAO A;  2LBC A;  3GLF A;  4JV5 M;  4FWD A;  2MGW A;  1IN5 A;  3BXW A;  3HHW A;  2OO9 A;  3IEC A;  4IBI A;  3SBJ A;  1ZAE A;  1WGL A;  5IWA M;  2FE8 A;  4DR3 M;  4Y28 F;  2R18 A;  3PVS A;  3K9P A;  3GLH E;  4ZPX A;  2YNM D;  3HHX A;  4MM3 B;  1NY6 A;  5EJC A;  2Z4S A;  4F2L A;  4FWG A;  3GPU A;  5LMN M;  2CV0 A;  4XGI A;  3UGJ A;  2VQE M;  1OIP A;  2F5N A;  4BBA A;  4QOZ C;  5EXX A;  4DUY M;  4DBG B;  2DZL A;  1C1K A;  2LWX A;  4FCT A;  3D8B A;  1PJT A;  4X64 M;  3U6S A;  3LMM A;  3AJI B;  3HX3 A;  2M60 A;  4HL4 A;  2DWZ B;  3GLG E;  2V1U A;  1IY2 A;  3GLG B;  1Q3C A;  1TF0 B;  1ZMU A;  3C3D A;  1SXJ D;  4LFC M;  4JYA M;  4LRT A;  2QBY A;  1C7Y A;  4FW9 A;  2QCU A;  1Z5C A;  4PDI A;  4GHL A;  2G8L A;  2CEA A;  2DAI A;  2J7N A;  3QWL A;  5FSW A;  1QZM A;  5C18 A;  1WJ7 A;  2R4E A;  4M9Z A;  3JR5 A;  3KVW A;  1JB0 F;  5KQD A;  2VQF M;  1YLA A;  2UXD M;  2MR9 A;  4LF5 M;  4WUR A;  3HGI A;  1WR1 B;  1DGH A;  2JY6 B;  3GPY A;  1L2B A;  4EIW A;  2B3T A;  3T38 A;  1MU5 A;  1YSY A;  1JR3 A;  2R4J A;  4CHT B;  4IBJ A;  2KRU A;  1SXJ C;  3IG5 A;  3J7A S;  3A98 B;  4KOD A;  4XBO A;  1GL7 A;  1PJQ A;  2X49 A;  4QHS A;  3SMS A;  1HNZ M;  3C9P A;  3B7Z A;  3LVW A;  4DV5 M;  3F92 A;  1HQC A;  3W0L B;  2EKF A;  4LRS A;  2KNV A;  2LHC A;  1ZMW A;  4L15 A;  2YR0 A;  4M9S A;  4D81 A;  1R6B X;  4REZ A;  5DFL A;  1D2N A;  1Z5B A;  4XK8 F;  3AL0 C;  2Y21 A;  3LW5 F;  3E9S A;  2WSF F;  3EIE A;  1DO2 A;  2RGH A;  3Q8X A;  4R7G A;  3I51 A;  2CHG A;  2L7I A;  1YE9 A; 
#chains in the Genus database with same CATH homology
 1UM8 A;  4AW4 A;  3UK6 A;  3KP0 E;  2DZN B;  3RE8 A;  3FUX A;  2LXE A;  4LGY A;  4B3M M;  4DR2 M;  1IBL M;  3D8L A;  2YQZ A;  4MGH A;  3VK8 A;  1L2C A;  2F4V M;  4G4O A;  3GPP A;  2EUC A;  3C58 A;  4DR6 M;  4GKK M;  3BOS A;  3FYC A;  3HKP A;  2W82 A;  1J7K A;  4TUW A;  1ORY B;  3FTD A;  2F5Q A;  3ZC7 B;  1PM5 A;  4G4R A;  1Q3B A;  1IN8 A;  1QVR A;  4LGM A;  5GKN A;  3GPX A;  1G8P A;  4LJA A;  1I94 M;  3DA1 A;  5H37 D;  4JI6 M;  3GRR A;  3U60 B;  3U6D A;  1OFI A;  2Z7J A;  3KS4 A;  4G6Z A;  4OVZ B;  2XH9 A;  4AKH A;  2CHQ A;  4JI7 M;  3PNY A;  4BB9 A;  2LH0 A;  1XMO M;  4YY3 M;  1L2D A;  3KOW E;  3THG A;  2ZM6 M;  1YUB A;  4II7 A;  3DOA A;  3FTF A;  4MB7 A;  1G41 A;  2Z3X A;  7CAT A;  3GQ5 A;  5EXT A;  2M5Z A;  2OPF A;  2XZF A;  2D7G A;  1L1Z A;  3FYD A;  1G3I A;  3A45 A;  3GRV A;  2BNK A;  1QYR A;  4I5S A;  4G4N A;  2ZAO A;  1I4W A;  1J09 A;  3J80 S;  1JQJ C;  2ERC A;  3VDP A;  2Q2E B;  3NBI A;  4Z8X A;  3L26 A;  1QAM A;  5KPR A;  3ZCB B;  3M0E A;  1TH3 A;  5DYI A;  5DNY A;  2C5R A;  4JI2 M;  3GRY A;  3GLI B;  4IJF A;  3JAM S;  4ITQ A;  4LZZ A;  3GLF B;  1R7R A;  4K0K M;  1N32 M;  1E32 A;  2DZO B;  3I4V A;  2HHH M;  4LCB A;  3HU3 A;  2G5G X;  4R3D A;  4IBC A;  3AFH A;  3U6L A;  1NJG A;  4GIT A;  4LY6 A;  1XHB A;  3KSJ A;  3AOG A;  3PFI A;  4PT5 A;  2R65 A;  1IBM M;  4OW0 A;  2F5P A;  1OJL A;  3SYL A;  4QHT A;  3CF2 A;  4M9X A;  4OX9 M;  3KOY E;  3J27 B;  2QBY B;  2QEN A;  1IY0 A;  4NXM M;  3FTC A;  3EIH A;  2H1R A;  3GO8 A;  3GLH B;  4DV2 M;  2UUA M;  4YHH M;  3VKG A;  3SHF A;  3RGP A;  4L4U A;  5EP1 A;  2Y0Q A;  4Z6Y A;  3H4M A;  4MH0 E;  1IXR C;  1N77 A;  5ITX A;  1DGH B;  4L8R C;  2UUC M;  5KPT A;  3AOE A;  3HHZ A;  2HKJ A;  1KFV A;  4LFA M;  5ITY A;  3GQ3 A;  1XNQ M;  3LQQ A;  2CUZ A;  4IBF A;  3KOZ E;  2BJV A;  3FUT A;  3WHL A;  2Y0T A;  4AG5 A;  2L09 A;  2KZS A;  4MGY E;  4RF1 A;  5EP4 A;  1NJF A;  2DHR A;  1E9S A;  1GKI A;  1Z5A A;  4NRV A;  5FTL A;  1G59 A;  2F5O A;  4LZJ A;  4JI8 M;  3L25 A;  1K3X A;  1TH4 A;  3TE6 A;  3TPZ A;  2XSZ D;  2QZ4 A;  3SAW A;  3VKH A;  3KW6 A;  2ZAM A;  2C98 A;  3DFZ A;  4AKI A;  2R46 A;  4LF7 M;  1IN6 A;  2DXI A;  4B3R M;  5JI3 E;  3TL4 X;  3U6P A;  1IQP A;  5EP3 A;  2XFT A;  2Y20 A;  3IG8 A;  1HNW M;  3LQR A;  4G4Q A;  4JI0 M;  4DR1 M;  2DVW B;  1E9R A;  1WXQ A;  3U5Z A;  2CFO A;  4GKJ M;  2D7H A;  2FOI C;  3U6C A;  1QAN A;  3KP1 E;  4DV1 M;  1HT2 E;  4IBE A;  1TDH A;  1GLN A;  4NOO B;  4NXN M;  1IXS B;  3NWL A;  5IRE B;  1N33 M;  1X37 A;  2P5T A;  2FNA A;  5KQ8 A;  1N78 A;  2LNH C;  3U61 B;  2XFS A;  4X65 M;  4QOS A;  3ZH9 B;  2XF3 A;  3OTO M;  4FCV A;  1NNJ A;  1IXZ A;  5E6J A;  4WW0 A;  1W5T A;  4X62 M;  1N75 A;  3RGS A;  4LF4 M;  2E5L M;  3T1Y M;  1R2Y A;  3JR4 A;  2XEP A;  4MGI E;  2KZU A;  2BJW A;  2CE7 A;  2KA6 B;  4AI6 A;  3E4R A;  4KLN A;  5KPZ A;  2D7E A;  2XLJ A;  1IY1 A;  3MJ5 A;  5JI2 E;  3M7G A;  4DR7 M;  3L29 A;  5FLX S;  1N36 M;  5C1B A;  4I4L A;  1SXJ E;  3CF0 A;  1JR3 D;  1L8Q A;  2HCB A;  3U6E A;  3SAV A;  4HLQ A;  4B7G A;  4LF9 M;  4JI4 M;  1XXH A;  4IBG A;  4M0W A;  4M0D A;  3GRU A;  3ILK A;  4JXJ A;  2A5Y B;  4B7F A;  2V6Z M;  4B3S M;  3TWM A;  3U6M A;  3SAU A;  2RKO A;  3TQS A;  3VFD A;  5DYG A;  4D80 A;  5EXP A;  4KHP M;  1SXJ A;  3AV0 A;  1XC8 A;  2CV2 A;  2UU9 M;  1HT1 E;  3FUU A;  4AG6 A;  5LMU M;  1K82 A;  1DGB A;  3FD9 A;  3I4Y A;  2CHV A;  3L27 A;  4NSO B;  3VK7 A;  4NRW A;  3KXE C;  3UZU A;  1XWI A;  1XNR M;  1IBK M;  4GIP A;  5KO3 A;  3HJQ A;  3HJ8 A;  3UMM A;  5ITX E;  2X8A A;  4DV6 M;  3FKE A;  4DV7 M;  1PJI A;  5ITT A;  8CAT A;  1DGF A;  4L78 A;  2EA0 A;  4DR5 M;  5EP2 A;  1KYI A;  3KFU G;  4NSR A;  2NQ8 C;  2K47 A;  4CGY B;  3U6Q A;  1HQY E;  1GL6 A;  4IBK A;  3HU2 A;  2KW0 A;  5ITR A;  4DV4 M;  4AQY M;  2UUB M;  1HR0 M;  3W0F A;  4GRI A;  1K3W A;  3T15 A;  3KS8 A;  1OFH A;  2QP9 X;  3HU1 A;  2DWL A;  1LV7 A;  1FJG M;  4GC9 A;  2RGO A;  1E94 E;  2HL7 A;  3M6A A;  4BLC A;  3SAT A;  5EQT A;  3QAU A;  4GHA A;  4LF8 M;  2Z4R A;  2F5S A;  1H6U A;  4P16 A;  4FCW A;  1GVN A;  3L28 A;  2FFJ A;  4DUZ M;  3FUW A;  2OQ4 A;  4LJ6 A;  3VLF B;  2UXC M;  2EO2 A;  2R62 A;  2ZBK B;  1NVM A;  1TGU A;  2ZAN A;  4I81 A;  4LJ8 A;  2O5R A;  3GP1 A;  3U5Z B;  2VII A;  3MHV C;  1T3T A;  3K2L A;  1J5E M;  3WHK A;  1IN4 A;  1IN7 A;  5ITU A;  4IBD A;  3UJN A;  3GLH A;  4DR4 M;  4W5W A;  3TWK A;  3VDU A;  3CF6 E;  5EXS A;  3J7B A;  2CV1 A;  1TH2 A;  4PD2 A;  1FNN A;  3SYK A;  4S12 A;  5ITQ A;  4RNA A;  4LFB M;  3GLG A;  2V1C A;  2R45 A;  4OU7 A;  2KRK A;  3K1J A;  3R8F A;  1KSF X;  4QNM A;  3GQ4 A;  1W5S A;  2KXE A;  4IJE A;  1NY5 A;  4I8O A;  1QAQ A;  1ZQ9 A;  2C96 A;  1TDZ A;  3MK6 A;  4FWH A;  2L6O A;  4LJ9 A;  5FTN A;  3J2P B;  5IT9 S;  3K8Z A;  1EE8 A;  4IBB A;  4JI3 M;  4JI5 M;  3SMP A;  4MGZ E;  4LJ7 A;  4MGK E;  1XXH B;  3SC3 A;  4GC5 A;  1NNU C;  1G4A E;  1R2Z A;  2X4A A;  3DZD A;  3SHG B;  1NSF A;  5FTM A;  1XMQ M;  4GH9 A;  3FTE A;  3KDS E;  3KOX E;  4FD2 A;  1Z59 A;  4RF0 A;  1L1T A;  1NHW C;  1QQW A;  1SXJ B;  2UXB M;  3AOE C;  4DV0 M;  2YFQ A;  5BPV A;  4A3V B;  1N34 M;  4DV3 M;  2L7H A;  1PJJ A;  3HHY A;  3FUV A;  5A2Q S;  3J81 S;  2AHM A;  1IM2 A;  5FTK A;  5BR8 M;  1S3S A;  4GMQ A;  3U6O A;  3HJS A;  2C9O A;  4B3T M;  3B9P A;  4KO8 A;  3RFW A;  4L16 A;  5IZ7 D;  4B7H A;  3SAS A;  1MX0 A;  3A42 A;  4LJ4 A;  3U61 A;  1VDD A;  3T1H M;  3SAR A;  2XGN A;  3U60 A;  4OVZ A;  5E26 A;  4LF6 M;  4LJ5 A;  3KSX A;  3PXG A;  2I7N A;  2DWM A;  3PNV A;  4FVM A;  4D82 A;  3CTW B;  3LVV A;  4AKG A;  1Z6T A;  2C9C A;  2XSZ A;  5FTJ A;  4X66 M;  4CIS A;  1NHG C;  4LG2 A;  1DO0 A;  3TWL A;  3AKZ A;  4PCZ A;  2JA2 A;  4B08 A;  4JI1 M;  5F3W A;  2C99 A;  4AZF A;  2DWN A;  3L2A A;  4QNR A;  3K92 A;  2XZU A;  2I7P A;  4PDG A;  1DGG A;  4JN6 A;  3SFZ A;  3A46 A;  1HNX M;  3R9X B;  2QPA A;  4NL4 H;  2KEB A;  3GLI A;  4IIW A;  1Q39 A;  2J7O A;  3HWS A;  1QAO A;  3GLF A;  4JV5 M;  4FWD A;  1IN5 A;  3HHW A;  4IBI A;  3SBJ A;  1ZAE A;  5IWA M;  2FE8 A;  4DR3 M;  2R18 A;  3PVS A;  4ZPX A;  2YNM D;  3HHX A;  4MM3 B;  1NY6 A;  5EJC A;  2Z4S A;  5LMN M;  4FWG A;  3GPU A;  2CV0 A;  4XGI A;  3UGJ A;  2VQE M;  2F5N A;  4QOZ C;  4BBA A;  5EXX A;  4DUY M;  2LWX A;  1C1K A;  4FCT A;  4X64 M;  3D8B A;  3U6S A;  3LMM A;  3AJI B;  2M60 A;  4HL4 A;  2DWZ B;  2V1U A;  1IY2 A;  3GLG B;  1Q3C A;  4LFC M;  4JYA M;  1SXJ D;  4LRT A;  2QBY A;  4FW9 A;  2QCU A;  1Z5C A;  4PDI A;  4GHL A;  2G8L A;  2CEA A;  2J7N A;  3QWL A;  5FSW A;  1QZM A;  5C18 A;  2R4E A;  4M9Z A;  3JR5 A;  3KVW A;  5KQD A;  2UXD M;  2VQF M;  4LF5 M;  4WUR A;  3HGI A;  1DGH A;  3GPY A;  1L2B A;  4EIW A;  3T38 A;  1MU5 A;  1YSY A;  1JR3 A;  2R4J A;  4CHT B;  4IBJ A;  2KRU A;  1SXJ C;  3IG5 A;  3J7A S;  3A98 B;  4KOD A;  4XBO A;  1GL7 A;  2X49 A;  4QHS A;  3SMS A;  1HNZ M;  3LVW A;  4DV5 M;  1HQC A;  3W0L B;  4LRS A;  4L15 A;  4M9S A;  2YR0 A;  4D81 A;  1R6B X;  4REZ A;  1D2N A;  1Z5B A;  3AL0 C;  2Y21 A;  3E9S A;  3EIE A;  1DO2 A;  2RGH A;  3Q8X A;  4R7G A;  3I51 A;  2CHG A;  2L7I A;  1YE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...