3VK8A

Crystal structure of dna-glycosylase bound to dna containing thymine glycol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PQGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable formamidopyrimidine-DNA glycosylase
publication title Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase/dna
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vk8A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3vk8A01
4DV0M 5A2QS 3U6EA 4JI4M 4ITQA 3TWKA 4LF9M 4X64M 1IBMM 4DUZM 2ZM6M 4YHHM 1HNXM 2XZFA 3SASA 4MB7A 1R2YA 1R2ZA 1Q39A 5ITTA 1XNRM 4JI0M 2UXDM 2F4VM 1L2DA 4DV6M 5IT9S 4PD2A 1L2CA 4X65M 4NRVA 4GKKM 3GO8A 1HR0M 4JI8M 3U6SA 3U6OA 4X66M 3GQ4A 4JYAM 3U6PA 4DV7M 1FJGM 3GQ3A 1HNWM 4JI2M 5FLXS 2F5SA 4CISA 1XNQM 1I94M 4B3RM 2EA0A 2F5PA 2Q2EB 4KHPM 1IBLM 4NXMM 2E5LM 4PCZA 1MU5A 3TWMA 3SARA 4DV3M 5ITRA 3A46A 1L2BA 1L1TA 3JR5A 4G4OA 2UXBM 4JI7M 4LF8M 1TDHA 3SATA 4DR1M 5ITQA 3JR4A 2HKJA 4LF6M 4DR2M 1NNJA 1K3WA 4LFBM 5ITUA 4LF5M 3GPPA 5IWAM 1XMOM 2UUBM 4LF7M 2F5QA 3J80S 4DUYM 3SBJA 4DV1M 1HNZM 4B3SM 1N34M 4JI1M 4JV5M 3U6MA 1TDZA 4DV2M 4JI3M 4YY3M 1PJJA 4DV5M 4DR4M 4LFCM 2HHHM 1Z59A 3OTOM 3GPUA 4B3MM 4PDIA 3W0FA 4G4NA 1N36M 2UXCM 3T1YM 1K3XA 4NRWA 1Z5CA 5LMNM 4AQYM 4LF4M 1MX0A 4DR3M 1Q3BA 4DR5M 4K0KM 3A45A 1PM5A 3TWLA 1K82A 2UUAM 3GP1A 2F5OA 4G4RA 2UUCM 5BR8M 2OPFA 1Z5AA 5ITXA 2VQFM 3SAVA 3C58A 4DR7M 2F5NA 3SAUA 1N32M 2XZUA 3T1HM 4JI6M 2ZBKB 1IBKM 3GPXA 3A42A 3GQ5A 4LFAM 3SAWA 4DR6M 1N33M 4OX9M 1Q3CA 3J7AS 1L1ZA 1PJIA 4PDGA 4G4QA 3U6LA 3VK7A 1EE8A 3GPYA 2OQ4A 4GKJM 5LMUM 2UU9M 4X62M 3DOAA 3J81S 3U6DA 1XC8A 4DV4M 5ITXE 4NXNM 5ITYA 1XMQM 3U6QA 1J5EM 3U6CA 4B3TM 3JAMS 1Z5BA 2VQEM 4JI5M 3VK8A 1KFVA
chains in the Genus database with same CATH superfamily
2CHVA 3L26A 3HHWA 4B7HA 3FD9A 2MGWA 4GITA 3B9PA 3HHXA 4YHHM 1HNXM 4MGYE 2V6ZM 2BJVA 2LTUA 3B7QA 4AZFA 4IIWA 1R2YA 1R2ZA 4IBIA 2L6OA 1EIJA 1PJSA 5BPVA 2NQ8C 1GL7A 3NBXX 1SXJA 4DV6M 3BBZA 5IT9S 2GQFA 4PD2A 1ZMWA 2CWBA 3HX3A 4G6ZA 3FUUA 1IY1A 4ANRA 2WSCF 1A5TA 1Z6TA 2EKKA 4L6V6 3RE8A 4CGYB 1HR0M 2APLA 4BBAA 1SG9A 3U6SA 3GLFA 4JYAM 2ZTDA 1Q02A 3AOEA 4IBEA 2QHOB 3GQ3A 4BLCA 1QAQA 2DAGA 2VF8A 4W5WA 4ZPXA 3IG5A 3I4YA 2ZAOA 3SFZA 3HHZA 1XNQM 2Y21A 1I94M 4B3RM 3L27A 2Z4RA 3VFDA 4KHPM 1NJGA 2E5LM 3I4VA 1MU5A 3B7ZA 1IY2A 4IBKA 2LNHC 1JR3E 4QNRA 4DV3M 4G3OA 1L1TA 1ZV1A 2LHGA 1VG5A 1G71A 3VLFB 3CF0A 3JR5A 4JI7M 2N35A 2UXBM 4LF8M 2XSZA 4DR1M 2Y0QA 1HQYE 1X37A 4LY6A 1IY0A 2HKJA 4LGYA 5EJCA 4AG6A 3DA1A 2DZLA 1SXJC 1XXHA 2DVWB 4LFBM 4CHTB 4LF5M 1TGUA 1R7RA 5EXPA 2C9OA 1VQ1A 1XMOM 4LF7M 2X4AA 2F5QA 2MROB 2DI0A 3L29A 1QQWA 3L28A 4D80A 2D7GA 1N34M 3KOYE 3AOEC 4B7GA 2DXIA 1WHCA 2HHHM 4B3MM 1R6BX 1NHWC 2YFQA 3R8FA 4MH0E 3SHFA 5C18A 2QPAA 4G4NA 1N36M 1VDDA 2UXCM 3D8LA 1VEJA 2FE8A 1DO0A 1XWIA 1IXSB 2JY7A 4RF0A 4AW4A 4AQYM 3VKHA 2K0BX 2M60A 4DR3M 1J7KA 1Q3BA 3HKPA 2JZ0A 4M9ZA 3U61B 4PT5A 2Z8YM 4FWGA 4FCTA 2P5TA 4NL4H 2F5OA 2KA6B 3HU3A 2GNOA 4G4RA 2KZUA 2JNHA 2VIIA 1TH4A 3DZDA 1WGNA 2R44A 3Q8XA 1XHBA 4F1IA 2VQFM 2Y0TA 1N32M 1E94E 2F5NA 3SAUA 1E9SA 2XZUA 3T1HM 4QHTA 4CIZA 2X49A 3B74A 3BOSA 3GPXA 4LFAM 1QAOA 3J2PB 1WR1B 3SAWA 1QZEA 2DAEA 3RGSA 2K47A 3PNVA 4M9XA 3GLGE 2J5YA 3GRUA 1TR8A 4G4QA 3VK7A 1EE8A 3GPYA 4GIPA 4X62M 2YR0A 3K9PA 3SAVA 3AV0A 4L78A 2RGHA 1QUTA 2X8AA 2C99A 4HL4A 2MJ5B 1XMQM 4MGZE 5EP4A 1T6OA 1G59A 2C98A 4B3TM 2KRKA 3JAMS 3U5ZB 3FE3A 3VK8A 3AL0C 1DGBA 1KFVA 2D7EA 4I81A 2H1RA 4JI4M 1ZMVA 3AFHA 4KO8A 2XFTA 3GLIB 1SXJD 4GH9A 4KODA 2FOIC 4KT0F 4X64M 1IBMM 1L8QA 2LXEA 1QDRA 4DUZM 2DWNA 4UN2B 4QOZC 2XZFA 4KLNA 4LJ9A 3KP1E 2R46A 2K9DA 2B3TA 3WHLA 2C96A 3H4JA 3CGWA 5E6JA 3Q8GA 3M6AA 4M0WA 1DGHA 4LZJA 4LJ7A 1L2DA 2R65A 2R18A 3IG8A 1FNNA 2L4EA 2XLJA 1IXSA 1L2CA 2V1UA 5FTMA 3GO8A 3HJSA 3SMSA 3U61A 3FYDA 4X66M 5KPRA 2I7PA 3FYCA 4R7GA 4HLQA 3ZC7B 1E32A 2QNJA 3KVWA 2RKOA 2DAIA 3U6PA 1FJGM 2D7HA 2L7HA 2KRUA 2R4EA 1W5TA 3UMMA 5FLXS 4CISA 1N75A 2XSZD 2DZNB 1PJQA 1HJPA 3SMPA 1QDTA 3TL4X 2EA0A 1UFZA 2JUJA 2JWSA 1RU3A 2F5PA 1NV8A 1EFUB 4P17A 2FH0A 1PJTA 3TWMA 3SARA 4IBFA 1G41A 2K6BA 1L2BA 2R6FA 2G5GX 5ITQA 3HJ8A 1NJFA 3UJNA 4I5SA 3K1JA 1K3WA 4M0DA 1TTEA 4GC9A 2ERCA 1V92A 2AHMA 2OOBA 3D8BA 3LQRA 1ORYB 2KZSA 3J80S 1IN8A 3SBJA 3U5ZA 3CTWB 1HNZM 5JI3E 4XK8F 1YSYA 2FS1A 3FRIA 2KXEA 1MJGM 1H6UA 3ZCBB 1C7YA 3FRHA 3FTFA 4NC6A 1PJJA 1GO5A 1KSFX 3HU1A 1T43A 1V34A 4PDIA 1OTRA 2I7NA 2MR9A 1K3XA 3FUWA 2G3QA 1NSFA 1E9RA 1Z5CA 1S3SA 2LVPC 5E26A 4AKHA 1QZMA 5LMNM 1G8PA 1F4IA 3A45A 2JA2A 5FTLA 5DNYA 3GLGA 4L15A 1PM5A 1N78A 3LCVB 3TWLA 1K82A 4LJ8A 2UUAM 1YE9A 3GP1A 3QAUA 4FWHA 4OVZB 3LCUA 2UUCM 5BR8M 2DAMA 1OQYA 4IJEA 3UZUA 1YUBA 4F2LA 5FTNA 2CRUA 1GKIA 4R71A 1IQPA 1Y8GA 2C9CA 2DZOB 4XGIA 4D81A 1T3TA 2KHHA 1IBKM 4FCWA 1ZQ9A 4REZA 5IZ7D 2QCUA 1QANA 4P16A 1D0MA 3FUTA 1PGYA 1D2NA 3KXEC 1L1ZA 3W67A 1PJIA 2O5RA 4PDGA 2QBYB 4S12A 3I04M 2JZ1A 3I01M 5C1BA 2OQ4A 3FKEA 4Z8XA 4GKJM 3DOAA 3J81S 3U6DA 1VEGA 3J27B 4MGHA 2OOAA 4IBJA 2L2DA 4D82A 2C5RA 4DV4M 5JI2E 5ITXE 2Z3XA 3KS8A 5KPZA 2JP7A 3GLIE 4IBCA 3U6CA 3M0EA 4JI5M 2VQEM 2LH0A 3EIHA 5A2QS 1BVSA 3H4MA 2XGNA 2KNAA 2HL7A 3TWKA 2YQZA 4LF9M 2RGOA 2CV2A 4FCVA 2EKFA 4B7FA 3SASA 2LHCA 4A3VB 2BNKA 1Q39A 3GLHB 1XNRM 2UXDM 2JY8A 1QVRA 1W5SA 3GLFE 3LMMA 3U60B 4GC5A 2BWEA 1JQJC 3FTCA 2R45A 4X65M 4LRTA 5KQDA 1OAIA 3UK6A 2DENA 2LVNC 4MGKE 1OJLA 2V1CA 1P3QQ 3B7NA 1IN6A 2LVOC 3L2AA 2KNVA 4JN6A 3GQ4A 2LBCA 2OO9A 4B08A 4LJAA 5F3WA 4DV7M 3T15A 1C1KA 2LVAA 1HNWM 4DBGB 3UGJA 4JI2M 2CE7A 3SYLA 2KEBA 3K2LA 3MK6A 2XFSA 2JY5A 1G3IA 1V33A 3KSXA 4FD2A 2Q2EB 1IBLM 1SXJB 2VF7A 3M7GA 3PXGA 4PCZA 1JB0F 1G4AE 2QBYA 4G4OA 1PRBA 3KDSE 2CFOA 1LV7A 2DNAA 3HU2A 2M5ZA 3JR4A 3GLFB 4DR2M 1GABA 4Z6YA 1IXZA 2EO2A 5ITUA 1JR3A 1R5LA 4QOSA 3F92A 5KO3A 1IFYA 1GL6A 4IJFA 1HT1E 5DYIA 2QENA 5EP1A 1HQCA 2XEPA 4M9SA 4B3SM 1LTMA 3PNYA 3VDPA 4YY3M 4LGMA 2DWLA 5FTJA 4LFCM 4NSRA 1OIZA 1Z59A 4DR4M 2FNAA 3W0FA 5IREB 3W0LB 3RGPA 2G8LA 2O01F 3T1YM 2HWJA 2J7NA 3U60A 3FTDA 2CV0A 1XXHB 4DR5M 4K0KM 4AI6A 3VDUA 3HY5A 3LVWA 4WURA 2DWZB 3AOGA 4WW0A 3DFZA 3VKGA 4QNMA 1QAMA 2QP9X 3KOWE 3B89A 3MJ5A 4XBOA 2OPFA 1YLAA 3LW5F 5ITXA 5FTKA 1MN3A 4L16A 2WZJA 3E21A 3C58A 2KW0A 4JI6M 2BJWA 1NY6A 3ZH9B 2ZBKB 3GLIA 3K8ZA 3NBIA 1CUKA 3A42A 3GQ5A 1WGLA 2L7IA 4FWDA 3E46A 3GRYA 1N33M 1NV9A 3C3EA 1Q3CA 3FTEA 3FUXA 4L8RC 4Y28F 3IECA 3U6LA 2DWMA 3GRRA 4MGIE 4GMQA 4RNAA 2W82A 2WSFF 1NVMA 1DGFA 2DAKA 2UU9M 1IXRC 5EQTA 3KFUG 4TUWA 2MH8A 1AUAA 2QSFX 5EP3A 1I4WA 3LVVA 5DFLA 5ITYA 1GVNA 3KW6A 3SC3A 1QYRA 3L25A 4AKIA 3K92A 2QZ4A 2XF3A 4RKUF 2KDLA 4DR7M 1IM2A 3ZQJA 1N77A 4DV0M 3U6EA 4ITQA 3HGIA 3PVSA 3K9OA 3TE6A 2R4JA 4RF1A 2RRUA 3HHYA 2ZM6M 8CATA 1DV0A 3BXWA 2JXNA 3GLHE 2DHRA 2LVQD 4I8OA 4MB7A 1VEKA 5ITTA 4JI0M 2Y20A 4HEOA 2F4VM 4IBDA 3THGA 4JXJA 2HCBA 5EXXA 1OKSA 3EIEA 3IHPA 2CEAA 2CUZA 2XH9A 4NRVA 4GKKM 2ZANA 3J7BA 2QQ8A 2HAKA 3NWLA 3V76A 3C9PA 4Q7JA 1AIPC 2EUCA 3WHKA 1D0KA 4JI8M 4IBBA 3U6OA 4GRIA 1D0LA 4GEWA 3TQSA 2YNMD 5KQ8A 4IBGA 3LQQA 4AKGA 3A98B 1NO1A 2JY6B 4OU7A 3C3DA 2F5SA 2ZTCA 1SXJE 1XB2B 4CJ6A 5EXTA 1VDLA 1DGHB 2ZAMA 3SHGB 3AJIB 3FUVA 3RFWA 4NXMM 3QYBA 1JR3D 1J09A 3SYKA 7CATA 1OFIA 5ITRA 4LJ5A 3A46A 1GJSA 1TDHA 3SATA 1OAOC 1DO2A 4WP2A 4LF6M 1UM8A 1NNJA 2R0IA 3CF2A 1TH3A 5DYGA 3GPPA 5IWAM 4LG2A 1OFHA 2UUBM 3MMPA 3HJQA 4OVZA 3W68A 4DUYM 4DV1M 2VDBB 4R3DA 1WJ7A 3CF6E 1QUSA 1HT2E 3KOXE 4JI1M 4JV5M 3U6MA 5L8RF 1KYIA 3E4RA 4LZZA 4DV2M 1TDZA 4JI3M 4LJ6A 1NNUC 3HWSA 4DV5M 2FFJA 3OTOM 3KP0E 1ZAEA 1WIVA 1TF0B 2DHYA 2DKLA 4LCBA 1ZMUA 3KS4A 3GPUA 3GRVA 1XXHE 4NRWA 4GHLA 4NSOB 1WXQA 4MM3B 2H5XA 4LF4M 1MX0A 2J7OA 5EXSA 5FSWA 2O25A 4FW9A 1R4GA 3T38A 3ILKA 5H37D 2R62A 1IN5A 2CP8A 3TPZA 1IN7A 3I51A 2BWBA 2CHQA 2A5YB 4OW0A 1DGGA 3QYEA 1Z5AA 3QWLA 2LWXA 5KPTA 2CV1A 2L09A 1OIPA 3AKZA 2WSEF 2Z7JA 2Z4SA 1TH2A 3KOZE 4FVMA 1NY5A 4EIWA 1NHGC 3R9XB 4DR6M 3PFIA 4OX9M 3J7AS 3T6PA 4QHSA 5GKNA 4AG5A 3HZJA 3GLHA 4L4UA 4BB9A 5EP2A 2L4FA 2EJSA 1GLNA 4NOOB 3GLGB 5LMUM 3E9SA 2CHGA 3MHVC 4II7A 2KNZA 1GJTA 1XC8A 4LJ4A 1IN4A 4NXNM 3KSJA 4LRSA 3U6QA 1J5EM 4GHAA 1Z5BA 4I4LA
chains in the Genus database with same CATH topology
2CHVA 3L26A 3HHWA 4B7HA 3FD9A 4GITA 3B9PA 3HHXA 4YHHM 1HNXM 4MGYE 2V6ZM 2BJVA 4AZFA 4IIWA 1R2YA 1R2ZA 4IBIA 2L6OA 5BPVA 2NQ8C 1GL7A 5IT9S 1SXJA 4DV6M 4PD2A 4G6ZA 3FUUA 1IY1A 1Z6TA 3RE8A 4CGYB 1HR0M 4BBAA 3U6SA 3GLFA 4JYAM 3AOEA 4IBEA 3GQ3A 4BLCA 1QAQA 4W5WA 4ZPXA 3IG5A 3I4YA 2ZAOA 3SFZA 3HHZA 1XNQM 2Y21A 1I94M 4B3RM 3L27A 2Z4RA 3VFDA 4KHPM 1NJGA 2E5LM 3I4VA 1MU5A 4IBKA 1IY2A 2LNHC 4QNRA 4DV3M 1L1TA 3VLFB 3JR5A 3CF0A 2UXBM 4JI7M 4LF8M 2XSZA 4DR1M 2Y0QA 1HQYE 1X37A 4LY6A 1IY0A 2HKJA 4LGYA 5EJCA 4AG6A 3DA1A 1SXJC 1XXHA 2DVWB 4LFBM 4CHTB 4LF5M 1TGUA 1R7RA 5EXPA 2C9OA 1XMOM 4LF7M 2X4AA 2F5QA 3L29A 1QQWA 3L28A 4D80A 2D7GA 1N34M 3KOYE 3AOEC 4B7GA 2DXIA 2HHHM 4B3MM 1R6BX 1NHWC 2YFQA 3R8FA 4MH0E 3SHFA 5C18A 2QPAA 4G4NA 1N36M 1VDDA 2UXCM 3D8LA 2FE8A 1DO0A 1XWIA 1IXSB 4RF0A 4AW4A 4AQYM 3VKHA 2M60A 4DR3M 1J7KA 1Q3BA 3HKPA 3U61B 4M9ZA 4PT5A 4FWGA 4FCTA 2P5TA 4NL4H 2F5OA 2KA6B 3HU3A 4G4RA 2KZUA 2VIIA 1TH4A 3DZDA 3Q8XA 1XHBA 2VQFM 2Y0TA 1N32M 1E94E 2F5NA 3SAUA 1E9SA 2XZUA 3T1HM 4QHTA 2X49A 3BOSA 3GPXA 4LFAM 1QAOA 3J2PB 3SAWA 3RGSA 2K47A 3PNVA 4M9XA 3GRUA 4G4QA 3VK7A 1EE8A 3GPYA 4GIPA 4X62M 2YR0A 3AV0A 4L78A 2RGHA 2X8AA 2C99A 4HL4A 1XMQM 4MGZE 5EP4A 1G59A 2C98A 4B3TM 2KRKA 3JAMS 3U5ZB 3AL0C 3VK8A 1DGBA 1KFVA 2D7EA 4I81A 2H1RA 4JI4M 4KO8A 3AFHA 3GLIB 2XFTA 3KFUG 1SXJD 4GH9A 4KODA 2FOIC 4X64M 1IBMM 1L8QA 2LXEA 4DUZM 2DWNA 4QOZC 2XZFA 4KLNA 4LJ9A 3KP1E 2R46A 3WHLA 2C96A 5E6JA 4M0WA 3M6AA 1DGHA 4LZJA 4LJ7A 1L2DA 2R65A 2R18A 3IG8A 1FNNA 2XLJA 1L2CA 2V1UA 5FTMA 3GO8A 3HJSA 3SMSA 3U61A 3FYDA 4X66M 5KPRA 2I7PA 3FYCA 4R7GA 4HLQA 3ZC7B 1E32A 3KVWA 2RKOA 3U6PA 1FJGM 2D7HA 2L7HA 2KRUA 2R4EA 1W5TA 3UMMA 5FLXS 4CISA 1N75A 2XSZD 2DZNB 3SMPA 2EA0A 3TL4X 2F5PA 3TWMA 3SARA 4IBFA 1G41A 1L2BA 2G5GX 5ITQA 3HJ8A 1NJFA 3UJNA 4I5SA 3K1JA 1K3WA 4M0DA 4GC9A 2ERCA 2AHMA 3D8BA 3LQRA 1ORYB 2KZSA 3J80S 1IN8A 3SBJA 3U5ZA 3CTWB 1HNZM 5JI3E 1YSYA 2KXEA 1H6UA 3ZCBB 3FTFA 1PJJA 1KSFX 3HU1A 4PDIA 2I7NA 1K3XA 3FUWA 1NSFA 1E9RA 1Z5CA 1S3SA 5E26A 4AKHA 1QZMA 5LMNM 1G8PA 3A45A 2JA2A 5FTLA 5DNYA 3GLGA 4L15A 1PM5A 1N78A 3TWLA 1K82A 4LJ8A 2UUAM 1YE9A 3GP1A 3QAUA 4FWHA 4OVZB 2UUCM 5BR8M 4IJEA 3UZUA 1YUBA 3SAVA 5FTNA 1GKIA 1IQPA 2C9CA 2DZOB 4XGIA 4D81A 1T3TA 1IBKM 4FCWA 1ZQ9A 4REZA 5IZ7D 2QCUA 1QANA 4P16A 3FUTA 3KXEC 1D2NA 2QBYB 1L1ZA 1PJIA 2O5RA 4PDGA 4S12A 5C1BA 2OQ4A 4GKJM 3FKEA 4Z8XA 3DOAA 3J81S 3U6DA 3J27B 4MGHA 4D82A 4IBJA 2C5RA 4DV4M 5JI2E 5ITXE 2Z3XA 3KS8A 5KPZA 3U6CA 4IBCA 3M0EA 4JI5M 2VQEM 2LH0A 3EIHA 5A2QS 3H4MA 2XGNA 2HL7A 3TWKA 2YQZA 4LF9M 2RGOA 2CV2A 4FCVA 4B7FA 3SASA 4A3VB 2BNKA 1Q39A 3GLHB 1XNRM 2UXDM 1QVRA 1W5SA 3LMMA 3U60B 4GC5A 1JQJC 3FTCA 2R45A 4X65M 4LRTA 5KQDA 3UK6A 4MGKE 1OJLA 2V1CA 3L2AA 1IN6A 4JN6A 3GQ4A 4B08A 4LJAA 5F3WA 4DV7M 3T15A 1C1KA 1HNWM 3UGJA 4JI2M 2CE7A 3SYLA 2KEBA 3K2LA 3MK6A 2XFSA 1G3IA 3KSXA 4FD2A 2Q2EB 1IBLM 1SXJB 3M7GA 3PXGA 4PCZA 1G4AE 2QBYA 4G4OA 3KDSE 2CFOA 1LV7A 3HU2A 2M5ZA 3JR4A 3GLFB 4DR2M 4Z6YA 1IXZA 2EO2A 5ITUA 1JR3A 4QOSA 5KO3A 1GL6A 4IJFA 1HT1E 5DYIA 2QENA 5EP1A 1HQCA 2XEPA 4M9SA 4B3SM 3PNYA 3VDPA 4YY3M 4LGMA 2DWLA 5FTJA 4LFCM 4NSRA 1Z59A 4DR4M 2FNAA 3W0FA 5IREB 3W0LB 3RGPA 2G8LA 3T1YM 2J7NA 3U60A 3FTDA 2CV0A 1XXHB 4DR5M 4K0KM 4AI6A 3VDUA 3LVWA 4WURA 2DWZB 3AOGA 4WW0A 3DFZA 3VKGA 4QNMA 1QAMA 2QP9X 3KOWE 3MJ5A 4XBOA 2OPFA 5ITXA 5FTKA 4L16A 3C58A 2KW0A 4JI6M 2BJWA 1NY6A 3ZH9B 2ZBKB 3GLIA 3K8ZA 3NBIA 3A42A 3GQ5A 2L7IA 4FWDA 3GRYA 1N33M 1Q3CA 3FTEA 3FUXA 4L8RC 3U6LA 2DWMA 3GRRA 4MGIE 4GMQA 4RNAA 2W82A 1NVMA 1DGFA 2UU9M 1IXRC 5EQTA 4TUWA 5EP3A 1I4WA 3LVVA 5ITYA 1GVNA 3KW6A 3SC3A 1QYRA 3L25A 4AKIA 3K92A 2XF3A 2QZ4A 4DR7M 1IM2A 1N77A 4DV0M 3U6EA 4ITQA 3HGIA 3PVSA 3TE6A 2R4JA 4RF1A 3HHYA 2ZM6M 8CATA 2DHRA 4I8OA 4MB7A 5ITTA 4JI0M 2Y20A 2F4VM 4IBDA 3THGA 4JXJA 2HCBA 5EXXA 3EIEA 2CEAA 2CUZA 2XH9A 4NRVA 4GKKM 2ZANA 3J7BA 3NWLA 2EUCA 3WHKA 4JI8M 4IBBA 3U6OA 4GRIA 3TQSA 2YNMD 5KQ8A 4IBGA 3LQQA 4AKGA 3A98B 4OU7A 2F5SA 1SXJE 5EXTA 1DGHB 2ZAMA 3SHGB 3AJIB 3FUVA 3RFWA 4NXMM 1JR3D 1J09A 3SYKA 7CATA 1OFIA 5ITRA 4LJ5A 3A46A 1TDHA 3SATA 1DO2A 4LF6M 1UM8A 1NNJA 3CF2A 1TH3A 5DYGA 3GPPA 5IWAM 4LG2A 1OFHA 2UUBM 3HJQA 4OVZA 4DUYM 4DV1M 4R3DA 3CF6E 3KOXE 1HT2E 4JI1M 4JV5M 3U6MA 1TDZA 1KYIA 3E4RA 4LZZA 4DV2M 4JI3M 4LJ6A 1NNUC 3HWSA 4DV5M 2FFJA 3OTOM 3KP0E 1ZAEA 3GPUA 4LCBA 3KS4A 3GRVA 4NRWA 4GHLA 4NSOB 1WXQA 4MM3B 4LF4M 1MX0A 2J7OA 5EXSA 5FSWA 4FW9A 3T38A 3ILKA 5H37D 2R62A 1IN5A 3TPZA 1IN7A 3I51A 2CHQA 2A5YB 4OW0A 1DGGA 1Z5AA 3QWLA 2LWXA 5KPTA 2CV1A 2L09A 3AKZA 2Z7JA 2Z4SA 1TH2A 3KOZE 4FVMA 1NY5A 4EIWA 1NHGC 3R9XB 4DR6M 3PFIA 4OX9M 3J7AS 4QHSA 5GKNA 4AG5A 3GLHA 4L4UA 4BB9A 5EP2A 3GLGB 1GLNA 4NOOB 5LMUM 3E9SA 2CHGA 3MHVC 4II7A 1XC8A 4LJ4A 1IN4A 4NXNM 3KSJA 4LRSA 3U6QA 1J5EM 4GHAA 1Z5BA 4I4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 M;  5A2Q S;  3U6E A;  4JI4 M;  4ITQ A;  3TWK A;  4LF9 M;  4X64 M;  1IBM M;  4DUZ M;  2ZM6 M;  4YHH M;  1HNX M;  2XZF A;  3SAS A;  4MB7 A;  1R2Y A;  1R2Z A;  1Q39 A;  5ITT A;  1XNR M;  4JI0 M;  2UXD M;  2F4V M;  1L2D A;  4DV6 M;  5IT9 S;  4PD2 A;  1L2C A;  4X65 M;  4NRV A;  4GKK M;  3GO8 A;  1HR0 M;  4JI8 M;  3U6S A;  3U6O A;  4X66 M;  3GQ4 A;  4JYA M;  3U6P A;  4DV7 M;  1FJG M;  3GQ3 A;  1HNW M;  4JI2 M;  5FLX S;  2F5S A;  4CIS A;  1XNQ M;  1I94 M;  4B3R M;  2EA0 A;  2F5P A;  2Q2E B;  4KHP M;  1IBL M;  4NXM M;  2E5L M;  4PCZ A;  1MU5 A;  3TWM A;  3SAR A;  4DV3 M;  5ITR A;  3A46 A;  1L2B A;  1L1T A;  3JR5 A;  4G4O A;  2UXB M;  4JI7 M;  4LF8 M;  1TDH A;  3SAT A;  4DR1 M;  5ITQ A;  3JR4 A;  2HKJ A;  4LF6 M;  4DR2 M;  1NNJ A;  1K3W A;  4LFB M;  5ITU A;  4LF5 M;  3GPP A;  5IWA M;  1XMO M;  2UUB M;  4LF7 M;  2F5Q A;  3J80 S;  4DUY M;  3SBJ A;  4DV1 M;  1HNZ M;  4B3S M;  1N34 M;  4JI1 M;  4JV5 M;  3U6M A;  1TDZ A;  4DV2 M;  4JI3 M;  4YY3 M;  1PJJ A;  4DV5 M;  4DR4 M;  4LFC M;  2HHH M;  1Z59 A;  3OTO M;  3GPU A;  4B3M M;  4PDI A;  3W0F A;  4G4N A;  1N36 M;  2UXC M;  3T1Y M;  1K3X A;  4NRW A;  1Z5C A;  5LMN M;  4AQY M;  4LF4 M;  1MX0 A;  4DR3 M;  1Q3B A;  4DR5 M;  4K0K M;  3A45 A;  1PM5 A;  3TWL A;  1K82 A;  2UUA M;  3GP1 A;  2F5O A;  4G4R A;  2UUC M;  5BR8 M;  2OPF A;  1Z5A A;  5ITX A;  2VQF M;  3SAV A;  3C58 A;  4DR7 M;  2F5N A;  3SAU A;  1N32 M;  2XZU A;  3T1H M;  4JI6 M;  2ZBK B;  1IBK M;  3GPX A;  3A42 A;  3GQ5 A;  4LFA M;  3SAW A;  4DR6 M;  1N33 M;  4OX9 M;  1Q3C A;  3J7A S;  1L1Z A;  1PJI A;  4PDG A;  4G4Q A;  3U6L A;  3VK7 A;  1EE8 A;  3GPY A;  2OQ4 A;  4GKJ M;  5LMU M;  2UU9 M;  4X62 M;  3DOA A;  3J81 S;  3U6D A;  1XC8 A;  4DV4 M;  5ITX E;  4NXN M;  5ITY A;  1XMQ M;  3U6Q A;  1J5E M;  3U6C A;  4B3T M;  3JAM S;  1Z5B A;  2VQE M;  4JI5 M;  3VK8 A;  1KFV A; 
#chains in the Genus database with same CATH topology
 2CHV A;  3L26 A;  3HHW A;  4B7H A;  3FD9 A;  2MGW A;  4GIT A;  3B9P A;  3HHX A;  4YHH M;  1HNX M;  4MGY E;  2V6Z M;  2BJV A;  2LTU A;  3B7Q A;  4AZF A;  4IIW A;  1R2Y A;  1R2Z A;  4IBI A;  2L6O A;  1EIJ A;  1PJS A;  5BPV A;  2NQ8 C;  1GL7 A;  3NBX X;  1SXJ A;  4DV6 M;  3BBZ A;  5IT9 S;  2GQF A;  4PD2 A;  1ZMW A;  2CWB A;  3HX3 A;  4G6Z A;  3FUU A;  1IY1 A;  4ANR A;  2WSC F;  1A5T A;  1Z6T A;  2EKK A;  4L6V 6;  3RE8 A;  4CGY B;  1HR0 M;  2APL A;  4BBA A;  1SG9 A;  3U6S A;  3GLF A;  4JYA M;  2ZTD A;  1Q02 A;  3AOE A;  4IBE A;  2QHO B;  3GQ3 A;  4BLC A;  1QAQ A;  2DAG A;  2VF8 A;  4W5W A;  4ZPX A;  3IG5 A;  3I4Y A;  2ZAO A;  3SFZ A;  3HHZ A;  1XNQ M;  2Y21 A;  1I94 M;  4B3R M;  3L27 A;  2Z4R A;  3VFD A;  4KHP M;  1NJG A;  2E5L M;  3I4V A;  1MU5 A;  3B7Z A;  1IY2 A;  4IBK A;  2LNH C;  1JR3 E;  4QNR A;  4DV3 M;  4G3O A;  1L1T A;  1ZV1 A;  2LHG A;  1VG5 A;  1G71 A;  3VLF B;  3CF0 A;  3JR5 A;  4JI7 M;  2N35 A;  2UXB M;  4LF8 M;  2XSZ A;  4DR1 M;  2Y0Q A;  1HQY E;  1X37 A;  4LY6 A;  1IY0 A;  2HKJ A;  4LGY A;  5EJC A;  4AG6 A;  3DA1 A;  2DZL A;  1SXJ C;  1XXH A;  2DVW B;  4LFB M;  4CHT B;  4LF5 M;  1TGU A;  1R7R A;  5EXP A;  2C9O A;  1VQ1 A;  1XMO M;  4LF7 M;  2X4A A;  2F5Q A;  2MRO B;  2DI0 A;  3L29 A;  1QQW A;  3L28 A;  4D80 A;  2D7G A;  1N34 M;  3KOY E;  3AOE C;  4B7G A;  2DXI A;  1WHC A;  2HHH M;  4B3M M;  1R6B X;  1NHW C;  2YFQ A;  3R8F A;  4MH0 E;  3SHF A;  5C18 A;  2QPA A;  4G4N A;  1N36 M;  1VDD A;  2UXC M;  3D8L A;  1VEJ A;  2FE8 A;  1DO0 A;  1XWI A;  1IXS B;  2JY7 A;  4RF0 A;  4AW4 A;  4AQY M;  3VKH A;  2K0B X;  2M60 A;  4DR3 M;  1J7K A;  1Q3B A;  3HKP A;  2JZ0 A;  4M9Z A;  3U61 B;  4PT5 A;  2Z8Y M;  4FWG A;  4FCT A;  2P5T A;  4NL4 H;  2F5O A;  2KA6 B;  3HU3 A;  2GNO A;  4G4R A;  2KZU A;  2JNH A;  2VII A;  1TH4 A;  3DZD A;  1WGN A;  2R44 A;  3Q8X A;  1XHB A;  4F1I A;  2VQF M;  2Y0T A;  1N32 M;  1E94 E;  2F5N A;  3SAU A;  1E9S A;  2XZU A;  3T1H M;  4QHT A;  4CIZ A;  2X49 A;  3B74 A;  3BOS A;  3GPX A;  4LFA M;  1QAO A;  3J2P B;  1WR1 B;  3SAW A;  1QZE A;  2DAE A;  3RGS A;  2K47 A;  3PNV A;  4M9X A;  3GLG E;  2J5Y A;  3GRU A;  1TR8 A;  4G4Q A;  3VK7 A;  1EE8 A;  3GPY A;  4GIP A;  4X62 M;  2YR0 A;  3K9P A;  3SAV A;  3AV0 A;  4L78 A;  2RGH A;  1QUT A;  2X8A A;  2C99 A;  4HL4 A;  2MJ5 B;  1XMQ M;  4MGZ E;  5EP4 A;  1T6O A;  1G59 A;  2C98 A;  4B3T M;  2KRK A;  3JAM S;  3U5Z B;  3FE3 A;  3VK8 A;  3AL0 C;  1DGB A;  1KFV A;  2D7E A;  4I81 A;  2H1R A;  4JI4 M;  1ZMV A;  3AFH A;  4KO8 A;  2XFT A;  3GLI B;  1SXJ D;  4GH9 A;  4KOD A;  2FOI C;  4KT0 F;  4X64 M;  1IBM M;  1L8Q A;  2LXE A;  1QDR A;  4DUZ M;  2DWN A;  4UN2 B;  4QOZ C;  2XZF A;  4KLN A;  4LJ9 A;  3KP1 E;  2R46 A;  2K9D A;  2B3T A;  3WHL A;  2C96 A;  3H4J A;  3CGW A;  5E6J A;  3Q8G A;  3M6A A;  4M0W A;  1DGH A;  4LZJ A;  4LJ7 A;  1L2D A;  2R65 A;  2R18 A;  3IG8 A;  1FNN A;  2L4E A;  2XLJ A;  1IXS A;  1L2C A;  2V1U A;  5FTM A;  3GO8 A;  3HJS A;  3SMS A;  3U61 A;  3FYD A;  4X66 M;  5KPR A;  2I7P A;  3FYC A;  4R7G A;  4HLQ A;  3ZC7 B;  1E32 A;  2QNJ A;  3KVW A;  2RKO A;  2DAI A;  3U6P A;  1FJG M;  2D7H A;  2L7H A;  2KRU A;  2R4E A;  1W5T A;  3UMM A;  5FLX S;  4CIS A;  1N75 A;  2XSZ D;  2DZN B;  1PJQ A;  1HJP A;  3SMP A;  1QDT A;  3TL4 X;  2EA0 A;  1UFZ A;  2JUJ A;  2JWS A;  1RU3 A;  2F5P A;  1NV8 A;  1EFU B;  4P17 A;  2FH0 A;  1PJT A;  3TWM A;  3SAR A;  4IBF A;  1G41 A;  2K6B A;  1L2B A;  2R6F A;  2G5G X;  5ITQ A;  3HJ8 A;  1NJF A;  3UJN A;  4I5S A;  3K1J A;  1K3W A;  4M0D A;  1TTE A;  4GC9 A;  2ERC A;  1V92 A;  2AHM A;  2OOB A;  3D8B A;  3LQR A;  1ORY B;  2KZS A;  3J80 S;  1IN8 A;  3SBJ A;  3U5Z A;  3CTW B;  1HNZ M;  5JI3 E;  4XK8 F;  1YSY A;  2FS1 A;  3FRI A;  2KXE A;  1MJG M;  1H6U A;  3ZCB B;  1C7Y A;  3FRH A;  3FTF A;  4NC6 A;  1PJJ A;  1GO5 A;  1KSF X;  3HU1 A;  1T43 A;  1V34 A;  4PDI A;  1OTR A;  2I7N A;  2MR9 A;  1K3X A;  3FUW A;  2G3Q A;  1NSF A;  1E9R A;  1Z5C A;  1S3S A;  2LVP C;  5E26 A;  4AKH A;  1QZM A;  5LMN M;  1G8P A;  1F4I A;  3A45 A;  2JA2 A;  5FTL A;  5DNY A;  3GLG A;  4L15 A;  1PM5 A;  1N78 A;  3LCV B;  3TWL A;  1K82 A;  4LJ8 A;  2UUA M;  1YE9 A;  3GP1 A;  3QAU A;  4FWH A;  4OVZ B;  3LCU A;  2UUC M;  5BR8 M;  2DAM A;  1OQY A;  4IJE A;  3UZU A;  1YUB A;  4F2L A;  5FTN A;  2CRU A;  1GKI A;  4R71 A;  1IQP A;  1Y8G A;  2C9C A;  2DZO B;  4XGI A;  4D81 A;  1T3T A;  2KHH A;  1IBK M;  4FCW A;  1ZQ9 A;  4REZ A;  5IZ7 D;  2QCU A;  1QAN A;  4P16 A;  1D0M A;  3FUT A;  1PGY A;  1D2N A;  3KXE C;  1L1Z A;  3W67 A;  1PJI A;  2O5R A;  4PDG A;  2QBY B;  4S12 A;  3I04 M;  2JZ1 A;  3I01 M;  5C1B A;  2OQ4 A;  3FKE A;  4Z8X A;  4GKJ M;  3DOA A;  3J81 S;  3U6D A;  1VEG A;  3J27 B;  4MGH A;  2OOA A;  4IBJ A;  2L2D A;  4D82 A;  2C5R A;  4DV4 M;  5JI2 E;  5ITX E;  2Z3X A;  3KS8 A;  5KPZ A;  2JP7 A;  3GLI E;  4IBC A;  3U6C A;  3M0E A;  4JI5 M;  2VQE M;  2LH0 A;  3EIH A;  5A2Q S;  1BVS A;  3H4M A;  2XGN A;  2KNA A;  2HL7 A;  3TWK A;  2YQZ A;  4LF9 M;  2RGO A;  2CV2 A;  4FCV A;  2EKF A;  4B7F A;  3SAS A;  2LHC A;  4A3V B;  2BNK A;  1Q39 A;  3GLH B;  1XNR M;  2UXD M;  2JY8 A;  1QVR A;  1W5S A;  3GLF E;  3LMM A;  3U60 B;  4GC5 A;  2BWE A;  1JQJ C;  3FTC A;  2R45 A;  4X65 M;  4LRT A;  5KQD A;  1OAI A;  3UK6 A;  2DEN A;  2LVN C;  4MGK E;  1OJL A;  2V1C A;  1P3Q Q;  3B7N A;  1IN6 A;  2LVO C;  3L2A A;  2KNV A;  4JN6 A;  3GQ4 A;  2LBC A;  2OO9 A;  4B08 A;  4LJA A;  5F3W A;  4DV7 M;  3T15 A;  1C1K A;  2LVA A;  1HNW M;  4DBG B;  3UGJ A;  4JI2 M;  2CE7 A;  3SYL A;  2KEB A;  3K2L A;  3MK6 A;  2XFS A;  2JY5 A;  1G3I A;  1V33 A;  3KSX A;  4FD2 A;  2Q2E B;  1IBL M;  1SXJ B;  2VF7 A;  3M7G A;  3PXG A;  4PCZ A;  1JB0 F;  1G4A E;  2QBY A;  4G4O A;  1PRB A;  3KDS E;  2CFO A;  1LV7 A;  2DNA A;  3HU2 A;  2M5Z A;  3JR4 A;  3GLF B;  4DR2 M;  1GAB A;  4Z6Y A;  1IXZ A;  2EO2 A;  5ITU A;  1JR3 A;  1R5L A;  4QOS A;  3F92 A;  5KO3 A;  1IFY A;  1GL6 A;  4IJF A;  1HT1 E;  5DYI A;  2QEN A;  5EP1 A;  1HQC A;  2XEP A;  4M9S A;  4B3S M;  1LTM A;  3PNY A;  3VDP A;  4YY3 M;  4LGM A;  2DWL A;  5FTJ A;  4LFC M;  4NSR A;  1OIZ A;  1Z59 A;  4DR4 M;  2FNA A;  3W0F A;  5IRE B;  3W0L B;  3RGP A;  2G8L A;  2O01 F;  3T1Y M;  2HWJ A;  2J7N A;  3U60 A;  3FTD A;  2CV0 A;  1XXH B;  4DR5 M;  4K0K M;  4AI6 A;  3VDU A;  3HY5 A;  3LVW A;  4WUR A;  2DWZ B;  3AOG A;  4WW0 A;  3DFZ A;  3VKG A;  4QNM A;  1QAM A;  2QP9 X;  3KOW E;  3B89 A;  3MJ5 A;  4XBO A;  2OPF A;  1YLA A;  3LW5 F;  5ITX A;  5FTK A;  1MN3 A;  4L16 A;  2WZJ A;  3E21 A;  3C58 A;  2KW0 A;  4JI6 M;  2BJW A;  1NY6 A;  3ZH9 B;  2ZBK B;  3GLI A;  3K8Z A;  3NBI A;  1CUK A;  3A42 A;  3GQ5 A;  1WGL A;  2L7I A;  4FWD A;  3E46 A;  3GRY A;  1N33 M;  1NV9 A;  3C3E A;  1Q3C A;  3FTE A;  3FUX A;  4L8R C;  4Y28 F;  3IEC A;  3U6L A;  2DWM A;  3GRR A;  4MGI E;  4GMQ A;  4RNA A;  2W82 A;  2WSF F;  1NVM A;  1DGF A;  2DAK A;  2UU9 M;  1IXR C;  5EQT A;  3KFU G;  4TUW A;  2MH8 A;  1AUA A;  2QSF X;  5EP3 A;  1I4W A;  3LVV A;  5DFL A;  5ITY A;  1GVN A;  3KW6 A;  3SC3 A;  1QYR A;  3L25 A;  4AKI A;  3K92 A;  2QZ4 A;  2XF3 A;  4RKU F;  2KDL A;  4DR7 M;  1IM2 A;  3ZQJ A;  1N77 A;  4DV0 M;  3U6E A;  4ITQ A;  3HGI A;  3PVS A;  3K9O A;  3TE6 A;  2R4J A;  4RF1 A;  2RRU A;  3HHY A;  2ZM6 M;  8CAT A;  1DV0 A;  3BXW A;  2JXN A;  3GLH E;  2DHR A;  2LVQ D;  4I8O A;  4MB7 A;  1VEK A;  5ITT A;  4JI0 M;  2Y20 A;  4HEO A;  2F4V M;  4IBD A;  3THG A;  4JXJ A;  2HCB A;  5EXX A;  1OKS A;  3EIE A;  3IHP A;  2CEA A;  2CUZ A;  2XH9 A;  4NRV A;  4GKK M;  2ZAN A;  3J7B A;  2QQ8 A;  2HAK A;  3NWL A;  3V76 A;  3C9P A;  4Q7J A;  1AIP C;  2EUC A;  3WHK A;  1D0K A;  4JI8 M;  4IBB A;  3U6O A;  4GRI A;  1D0L A;  4GEW A;  3TQS A;  2YNM D;  5KQ8 A;  4IBG A;  3LQQ A;  4AKG A;  3A98 B;  1NO1 A;  2JY6 B;  4OU7 A;  3C3D A;  2F5S A;  2ZTC A;  1SXJ E;  1XB2 B;  4CJ6 A;  5EXT A;  1VDL A;  1DGH B;  2ZAM A;  3SHG B;  3AJI B;  3FUV A;  3RFW A;  4NXM M;  3QYB A;  1JR3 D;  1J09 A;  3SYK A;  7CAT A;  1OFI A;  5ITR A;  4LJ5 A;  3A46 A;  1GJS A;  1TDH A;  3SAT A;  1OAO C;  1DO2 A;  4WP2 A;  4LF6 M;  1UM8 A;  1NNJ A;  2R0I A;  3CF2 A;  1TH3 A;  5DYG A;  3GPP A;  5IWA M;  4LG2 A;  1OFH A;  2UUB M;  3MMP A;  3HJQ A;  4OVZ A;  3W68 A;  4DUY M;  4DV1 M;  2VDB B;  4R3D A;  1WJ7 A;  3CF6 E;  1QUS A;  1HT2 E;  3KOX E;  4JI1 M;  4JV5 M;  3U6M A;  5L8R F;  1KYI A;  3E4R A;  4LZZ A;  4DV2 M;  1TDZ A;  4JI3 M;  4LJ6 A;  1NNU C;  3HWS A;  4DV5 M;  2FFJ A;  3OTO M;  3KP0 E;  1ZAE A;  1WIV A;  1TF0 B;  2DHY A;  2DKL A;  4LCB A;  1ZMU A;  3KS4 A;  3GPU A;  3GRV A;  1XXH E;  4NRW A;  4GHL A;  4NSO B;  1WXQ A;  4MM3 B;  2H5X A;  4LF4 M;  1MX0 A;  2J7O A;  5EXS A;  5FSW A;  2O25 A;  4FW9 A;  1R4G A;  3T38 A;  3ILK A;  5H37 D;  2R62 A;  1IN5 A;  2CP8 A;  3TPZ A;  1IN7 A;  3I51 A;  2BWB A;  2CHQ A;  2A5Y B;  4OW0 A;  1DGG A;  3QYE A;  1Z5A A;  3QWL A;  2LWX A;  5KPT A;  2CV1 A;  2L09 A;  1OIP A;  3AKZ A;  2WSE F;  2Z7J A;  2Z4S A;  1TH2 A;  3KOZ E;  4FVM A;  1NY5 A;  4EIW A;  1NHG C;  3R9X B;  4DR6 M;  3PFI A;  4OX9 M;  3J7A S;  3T6P A;  4QHS A;  5GKN A;  4AG5 A;  3HZJ A;  3GLH A;  4L4U A;  4BB9 A;  5EP2 A;  2L4F A;  2EJS A;  1GLN A;  4NOO B;  3GLG B;  5LMU M;  3E9S A;  2CHG A;  3MHV C;  4II7 A;  2KNZ A;  1GJT A;  1XC8 A;  4LJ4 A;  1IN4 A;  4NXN M;  3KSJ A;  4LRS A;  3U6Q A;  1J5E M;  4GHA A;  1Z5B A;  4I4L A; 
#chains in the Genus database with same CATH homology
 2CHV A;  3L26 A;  3HHW A;  4B7H A;  3FD9 A;  4GIT A;  3B9P A;  3HHX A;  4YHH M;  1HNX M;  4MGY E;  2V6Z M;  2BJV A;  4AZF A;  4IIW A;  1R2Y A;  1R2Z A;  4IBI A;  2L6O A;  5BPV A;  2NQ8 C;  1GL7 A;  5IT9 S;  1SXJ A;  4DV6 M;  4PD2 A;  4G6Z A;  3FUU A;  1IY1 A;  1Z6T A;  3RE8 A;  4CGY B;  1HR0 M;  4BBA A;  3U6S A;  3GLF A;  4JYA M;  3AOE A;  4IBE A;  3GQ3 A;  4BLC A;  1QAQ A;  4W5W A;  4ZPX A;  3IG5 A;  3I4Y A;  2ZAO A;  3SFZ A;  3HHZ A;  1XNQ M;  2Y21 A;  1I94 M;  4B3R M;  3L27 A;  2Z4R A;  3VFD A;  4KHP M;  1NJG A;  2E5L M;  3I4V A;  1MU5 A;  4IBK A;  1IY2 A;  2LNH C;  4QNR A;  4DV3 M;  1L1T A;  3VLF B;  3JR5 A;  3CF0 A;  2UXB M;  4JI7 M;  4LF8 M;  2XSZ A;  4DR1 M;  2Y0Q A;  1HQY E;  1X37 A;  4LY6 A;  1IY0 A;  2HKJ A;  4LGY A;  5EJC A;  4AG6 A;  3DA1 A;  1SXJ C;  1XXH A;  2DVW B;  4LFB M;  4CHT B;  4LF5 M;  1TGU A;  1R7R A;  5EXP A;  2C9O A;  1XMO M;  4LF7 M;  2X4A A;  2F5Q A;  3L29 A;  1QQW A;  3L28 A;  4D80 A;  2D7G A;  1N34 M;  3KOY E;  3AOE C;  4B7G A;  2DXI A;  2HHH M;  4B3M M;  1R6B X;  1NHW C;  2YFQ A;  3R8F A;  4MH0 E;  3SHF A;  5C18 A;  2QPA A;  4G4N A;  1N36 M;  1VDD A;  2UXC M;  3D8L A;  2FE8 A;  1DO0 A;  1XWI A;  1IXS B;  4RF0 A;  4AW4 A;  4AQY M;  3VKH A;  2M60 A;  4DR3 M;  1J7K A;  1Q3B A;  3HKP A;  3U61 B;  4M9Z A;  4PT5 A;  4FWG A;  4FCT A;  2P5T A;  4NL4 H;  2F5O A;  2KA6 B;  3HU3 A;  4G4R A;  2KZU A;  2VII A;  1TH4 A;  3DZD A;  3Q8X A;  1XHB A;  2VQF M;  2Y0T A;  1N32 M;  1E94 E;  2F5N A;  3SAU A;  1E9S A;  2XZU A;  3T1H M;  4QHT A;  2X49 A;  3BOS A;  3GPX A;  4LFA M;  1QAO A;  3J2P B;  3SAW A;  3RGS A;  2K47 A;  3PNV A;  4M9X A;  3GRU A;  4G4Q A;  3VK7 A;  1EE8 A;  3GPY A;  4GIP A;  4X62 M;  2YR0 A;  3AV0 A;  4L78 A;  2RGH A;  2X8A A;  2C99 A;  4HL4 A;  1XMQ M;  4MGZ E;  5EP4 A;  1G59 A;  2C98 A;  4B3T M;  2KRK A;  3JAM S;  3U5Z B;  3AL0 C;  3VK8 A;  1DGB A;  1KFV A;  2D7E A;  4I81 A;  2H1R A;  4JI4 M;  4KO8 A;  3AFH A;  3GLI B;  2XFT A;  3KFU G;  1SXJ D;  4GH9 A;  4KOD A;  2FOI C;  4X64 M;  1IBM M;  1L8Q A;  2LXE A;  4DUZ M;  2DWN A;  4QOZ C;  2XZF A;  4KLN A;  4LJ9 A;  3KP1 E;  2R46 A;  3WHL A;  2C96 A;  5E6J A;  4M0W A;  3M6A A;  1DGH A;  4LZJ A;  4LJ7 A;  1L2D A;  2R65 A;  2R18 A;  3IG8 A;  1FNN A;  2XLJ A;  1L2C A;  2V1U A;  5FTM A;  3GO8 A;  3HJS A;  3SMS A;  3U61 A;  3FYD A;  4X66 M;  5KPR A;  2I7P A;  3FYC A;  4R7G A;  4HLQ A;  3ZC7 B;  1E32 A;  3KVW A;  2RKO A;  3U6P A;  1FJG M;  2D7H A;  2L7H A;  2KRU A;  2R4E A;  1W5T A;  3UMM A;  5FLX S;  4CIS A;  1N75 A;  2XSZ D;  2DZN B;  3SMP A;  2EA0 A;  3TL4 X;  2F5P A;  3TWM A;  3SAR A;  4IBF A;  1G41 A;  1L2B A;  2G5G X;  5ITQ A;  3HJ8 A;  1NJF A;  3UJN A;  4I5S A;  3K1J A;  1K3W A;  4M0D A;  4GC9 A;  2ERC A;  2AHM A;  3D8B A;  3LQR A;  1ORY B;  2KZS A;  3J80 S;  1IN8 A;  3SBJ A;  3U5Z A;  3CTW B;  1HNZ M;  5JI3 E;  1YSY A;  2KXE A;  1H6U A;  3ZCB B;  3FTF A;  1PJJ A;  1KSF X;  3HU1 A;  4PDI A;  2I7N A;  1K3X A;  3FUW A;  1NSF A;  1E9R A;  1Z5C A;  1S3S A;  5E26 A;  4AKH A;  1QZM A;  5LMN M;  1G8P A;  3A45 A;  2JA2 A;  5FTL A;  5DNY A;  3GLG A;  4L15 A;  1PM5 A;  1N78 A;  3TWL A;  1K82 A;  4LJ8 A;  2UUA M;  1YE9 A;  3GP1 A;  3QAU A;  4FWH A;  4OVZ B;  2UUC M;  5BR8 M;  4IJE A;  3UZU A;  1YUB A;  3SAV A;  5FTN A;  1GKI A;  1IQP A;  2C9C A;  2DZO B;  4XGI A;  4D81 A;  1T3T A;  1IBK M;  4FCW A;  1ZQ9 A;  4REZ A;  5IZ7 D;  2QCU A;  1QAN A;  4P16 A;  3FUT A;  3KXE C;  1D2N A;  2QBY B;  1L1Z A;  1PJI A;  2O5R A;  4PDG A;  4S12 A;  5C1B A;  2OQ4 A;  4GKJ M;  3FKE A;  4Z8X A;  3DOA A;  3J81 S;  3U6D A;  3J27 B;  4MGH A;  4D82 A;  4IBJ A;  2C5R A;  4DV4 M;  5JI2 E;  5ITX E;  2Z3X A;  3KS8 A;  5KPZ A;  3U6C A;  4IBC A;  3M0E A;  4JI5 M;  2VQE M;  2LH0 A;  3EIH A;  5A2Q S;  3H4M A;  2XGN A;  2HL7 A;  3TWK A;  2YQZ A;  4LF9 M;  2RGO A;  2CV2 A;  4FCV A;  4B7F A;  3SAS A;  4A3V B;  2BNK A;  1Q39 A;  3GLH B;  1XNR M;  2UXD M;  1QVR A;  1W5S A;  3LMM A;  3U60 B;  4GC5 A;  1JQJ C;  3FTC A;  2R45 A;  4X65 M;  4LRT A;  5KQD A;  3UK6 A;  4MGK E;  1OJL A;  2V1C A;  3L2A A;  1IN6 A;  4JN6 A;  3GQ4 A;  4B08 A;  4LJA A;  5F3W A;  4DV7 M;  3T15 A;  1C1K A;  1HNW M;  3UGJ A;  4JI2 M;  2CE7 A;  3SYL A;  2KEB A;  3K2L A;  3MK6 A;  2XFS A;  1G3I A;  3KSX A;  4FD2 A;  2Q2E B;  1IBL M;  1SXJ B;  3M7G A;  3PXG A;  4PCZ A;  1G4A E;  2QBY A;  4G4O A;  3KDS E;  2CFO A;  1LV7 A;  3HU2 A;  2M5Z A;  3JR4 A;  3GLF B;  4DR2 M;  4Z6Y A;  1IXZ A;  2EO2 A;  5ITU A;  1JR3 A;  4QOS A;  5KO3 A;  1GL6 A;  4IJF A;  1HT1 E;  5DYI A;  2QEN A;  5EP1 A;  1HQC A;  2XEP A;  4M9S A;  4B3S M;  3PNY A;  3VDP A;  4YY3 M;  4LGM A;  2DWL A;  5FTJ A;  4LFC M;  4NSR A;  1Z59 A;  4DR4 M;  2FNA A;  3W0F A;  5IRE B;  3W0L B;  3RGP A;  2G8L A;  3T1Y M;  2J7N A;  3U60 A;  3FTD A;  2CV0 A;  1XXH B;  4DR5 M;  4K0K M;  4AI6 A;  3VDU A;  3LVW A;  4WUR A;  2DWZ B;  3AOG A;  4WW0 A;  3DFZ A;  3VKG A;  4QNM A;  1QAM A;  2QP9 X;  3KOW E;  3MJ5 A;  4XBO A;  2OPF A;  5ITX A;  5FTK A;  4L16 A;  3C58 A;  2KW0 A;  4JI6 M;  2BJW A;  1NY6 A;  3ZH9 B;  2ZBK B;  3GLI A;  3K8Z A;  3NBI A;  3A42 A;  3GQ5 A;  2L7I A;  4FWD A;  3GRY A;  1N33 M;  1Q3C A;  3FTE A;  3FUX A;  4L8R C;  3U6L A;  2DWM A;  3GRR A;  4MGI E;  4GMQ A;  4RNA A;  2W82 A;  1NVM A;  1DGF A;  2UU9 M;  1IXR C;  5EQT A;  4TUW A;  5EP3 A;  1I4W A;  3LVV A;  5ITY A;  1GVN A;  3KW6 A;  3SC3 A;  1QYR A;  3L25 A;  4AKI A;  3K92 A;  2XF3 A;  2QZ4 A;  4DR7 M;  1IM2 A;  1N77 A;  4DV0 M;  3U6E A;  4ITQ A;  3HGI A;  3PVS A;  3TE6 A;  2R4J A;  4RF1 A;  3HHY A;  2ZM6 M;  8CAT A;  2DHR A;  4I8O A;  4MB7 A;  5ITT A;  4JI0 M;  2Y20 A;  2F4V M;  4IBD A;  3THG A;  4JXJ A;  2HCB A;  5EXX A;  3EIE A;  2CEA A;  2CUZ A;  2XH9 A;  4NRV A;  4GKK M;  2ZAN A;  3J7B A;  3NWL A;  2EUC A;  3WHK A;  4JI8 M;  4IBB A;  3U6O A;  4GRI A;  3TQS A;  2YNM D;  5KQ8 A;  4IBG A;  3LQQ A;  4AKG A;  3A98 B;  4OU7 A;  2F5S A;  1SXJ E;  5EXT A;  1DGH B;  2ZAM A;  3SHG B;  3AJI B;  3FUV A;  3RFW A;  4NXM M;  1JR3 D;  1J09 A;  3SYK A;  7CAT A;  1OFI A;  5ITR A;  4LJ5 A;  3A46 A;  1TDH A;  3SAT A;  1DO2 A;  4LF6 M;  1UM8 A;  1NNJ A;  3CF2 A;  1TH3 A;  5DYG A;  3GPP A;  5IWA M;  4LG2 A;  1OFH A;  2UUB M;  3HJQ A;  4OVZ A;  4DUY M;  4DV1 M;  4R3D A;  3CF6 E;  3KOX E;  1HT2 E;  4JI1 M;  4JV5 M;  3U6M A;  1TDZ A;  1KYI A;  3E4R A;  4LZZ A;  4DV2 M;  4JI3 M;  4LJ6 A;  1NNU C;  3HWS A;  4DV5 M;  2FFJ A;  3OTO M;  3KP0 E;  1ZAE A;  3GPU A;  4LCB A;  3KS4 A;  3GRV A;  4NRW A;  4GHL A;  4NSO B;  1WXQ A;  4MM3 B;  4LF4 M;  1MX0 A;  2J7O A;  5EXS A;  5FSW A;  4FW9 A;  3T38 A;  3ILK A;  5H37 D;  2R62 A;  1IN5 A;  3TPZ A;  1IN7 A;  3I51 A;  2CHQ A;  2A5Y B;  4OW0 A;  1DGG A;  1Z5A A;  3QWL A;  2LWX A;  5KPT A;  2CV1 A;  2L09 A;  3AKZ A;  2Z7J A;  2Z4S A;  1TH2 A;  3KOZ E;  4FVM A;  1NY5 A;  4EIW A;  1NHG C;  3R9X B;  4DR6 M;  3PFI A;  4OX9 M;  3J7A S;  4QHS A;  5GKN A;  4AG5 A;  3GLH A;  4L4U A;  4BB9 A;  5EP2 A;  3GLG B;  1GLN A;  4NOO B;  5LMU M;  3E9S A;  2CHG A;  3MHV C;  4II7 A;  1XC8 A;  4LJ4 A;  1IN4 A;  4NXN M;  3KSJ A;  4LRS A;  3U6Q A;  1J5E M;  4GHA A;  1Z5B A;  4I4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...