3VK8A

Crystal structure of dna-glycosylase bound to dna containing thymine glycol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PQGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Probable formamidopyrimidine-DNA glycosylase
publication title Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vk8A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3vk8A01
4DR3M 5ITTA 5ITYA 5FLXS 1HNXM 2ZBKB 4DV2M 4LFAM 1EE8A 3GPXA 4GKKM 2F5SA 4KHPM 3U6SA 4G4OA 4X64M 2OQ4A 1N36M 3SATA 1R2YA 4X65M 4DR6M 3U6OA 2OPFA 2F5NA 2XZUA 1FJGM 3GPUA 3U6EA 2HKJA 1L1ZA 4JI2M 4JI7M 4LF9M 5ITXA 3A45A 4JI1M 2VQFM 1XC8A 1L2BA 2XZFA 4ITQA 1K3WA 5IWAM 3VK7A 1HNWM 3JAMS 1Z5BA 1L2DA 2E5LM 1K82A 4DR1M 3VK8A 3U6LA 1Q3BA 1PJJA 4DV0M 4G4NA 1XNRM 4LF4M 4LFCM 5A2QS 4B3RM 4DV3M 4JI6M 3U6PA 4PDIA 4CISA 1N32M 4DUYM 2UXDM 1MU5A 3SAWA 4AQYM 4DV7M 1Z5AA 1XMOM 1I94M 4X62M 3JR4A 2HHHM 4NXNM 5IT9S 4PDGA 3J81S 4DR2M 5ITQA 3GQ4A 1HNZM 1N33M 3TWKA 3SARA 1L2CA 4JYAM 4OX9M 5LMNM 2Q2EB 4X66M 3JR5A 4DUZM 4G4QA 5BR8M 4LF5M 2F5OA 1MX0A 3J7AS 3A42A 4DR4M 4DV5M 4JV5M 4JI8M 2EA0A 3GP1A 1R2ZA 1Z5CA 4JI4M 3TWMA 4NRVA 5LMUM 1KFVA 1XNQM 2ZM6M 4MB7A 2UU9M 4DV6M 4JI0M 4LF7M 3DOAA 3C58A 5ITXE 3GPYA 4NXMM 4LF6M 1Q39A 4PCZA 5ITUA 1TDZA 3T1HM 1L1TA 1IBKM 3SAVA 3GQ3A 4B3MM 4LF8M 4JI3M 4DV1M 5ITRA 3SAUA 4B3SM 3J80S 2UUCM 1NNJA 4DR7M 3W0FA 4YY3M 2UXBM 1PJIA 1N34M 1PM5A 1K3XA 1Z59A 3GPPA 4DV4M 4G4RA 4JI5M 4YHHM 3T1YM 4B3TM 2UUBM 4NRWA 3GO8A 2UUAM 3U6MA 2F4VM 1HR0M 4K0KM 2UXCM 1XMQM 3U6DA 1IBMM 2VQEM 3U6QA 3SBJA 1Q3CA 2F5PA 1TDHA 3OTOM 4PD2A 3SASA 1IBLM 3U6CA 3GQ5A 4GKJM 1J5EM 3A46A 4LFBM 3TWLA 2F5QA 4DR5M
chains in the Genus database with same CATH superfamily
1QQWA 3K8ZA 4Q7JA 4DR3M 3NBIA 4DV2M 2GQFA 3GPXA 4GKKM 3AOEC 3VFDA 4GH9A 2WZJA 3AKZA 3E4RA 1GLNA 1SXJC 3CF0A 3MK6A 3U60A 5E6JA 4LRTA 2CV0A 3B89A 1YLAA 2XZUA 3K1JA 3E21A 4AI6A 3LCUA 5DYIA 4JI2M 1YSYA 3C3EA 3FUVA 3KXEC 1T43A 4REZA 1R5LA 4R71A 4AKIA 2G5GX 1DGGA 1MJGM 3VK7A 3D8BA 1Z5BA 1K82A 2QBYB 1XXHA 5F3WA 4L8RC 3U6LA 4QNRA 1NVMA 2WSEF 4Y28F 1KYIA 2LVAA 4DV0M 1G41A 1XNRM 2YFQA 4LF4M 1ZQ9A 5C1BA 3K9PA 3HZJA 4I81A 1QAMA 4QOSA 4DV3M 2QPAA 4CISA 2Z7JA 2UXDM 1VEKA 1VEJA 1MU5A 3LQRA 5L8RF 3SAWA 1WR1B 4DV7M 1D0MA 1I94M 4LZJA 2BJWA 2CHQA 2LVNC 1IXRC 3PNYA 1WGNA 4GEWA 3LVWA 4IBEA 3KDSE 4OVZB 4P16A 1UM8A 3TWKA 4LY6A 4IIWA 3KP0E 4LRSA 1Q02A 1ZMWA 2Y0TA 5DYGA 4B7GA 3GLFA 4X66M 3UK6A 4R7GA 3FTDA 4LF5M 3J7AS 1XHBA 3A42A 2LVOC 4MGKE 4JV5M 4JI8M 2KRKA 1NO1A 2O5RA 4L16A 3K2LA 3I04M 2YQZA 3TL4X 5LMUM 1XNQM 2OOAA 5DFLA 4KT0F 1QZEA 1D2NA 2R18A 5EXTA 3DOAA 2VF8A 3C58A 3GPYA 3VDPA 2Y21A 4LF6M 4PCZA 2YR0A 4AG5A 4KODA 4IBFA 2EKFA 2OO9A 2WSFF 1QUSA 4LJ8A 2DVWB 3FUTA 4JI3M 3KP1E 1VQ1A 2C9CA 4IBCA 5KQ8A 4DR7M 3TPZA 2LHCA 1PJIA 1K3XA 1I4WA 1PM5A 2EUCA 4JXJA 3GPPA 1DO0A 3ZH9B 2DHRA 4MM3B 4JI5M 3GLIE 4B3TM 1X37A 1ZMVA 3KW6A 4R3DA 5EP1A 4FCTA 3L25A 1WIVA 5JI3E 1E9SA 2Z3XA 3U6MA 4Z8XA 2UXCM 4IJEA 3U6DA 1IBMM 2CUZA 2VQEM 3SBJA 2HCBA 3BBZA 4LJ5A 4PD2A 4CHTB 4RNAA 1TR8A 2AHMA 3GLIB 3U5ZA 1RU3A 4GKJM 3AJIB 1GVNA 3LQQA 3TQSA 4XBOA 1J5EM 1D0LA 3PNVA 5KQDA 2QQ8A 1D0KA 2JUJA 1HQYE 5EXSA 2APLA 2F5QA 5ITTA 3KVWA 5FLXS 1HNXM 4NL4H 1W5SA 3M7GA 2KEBA 2VF7A 3U6SA 1GKIA 1DO2A 2L4EA 1VDDA 4M9ZA 1N36M 2R44A 4HEOA 2FE8A 2QCUA 3QAUA 4X65M 2OPFA 3U6OA 4DR6M 2R4EA 2RRUA 3GRYA 3L28A 1FJGM 3SHFA 1OAOC 4QHSA 3U6EA 2C98A 3UGJA 3BOSA 2HKJA 1L1ZA 1VDLA 1V34A 3CF2A 4L15A 4JI7M 4LF9M 2RGOA 5ITXA 4M9XA 4BB9A 3ZCBB 2C96A 1QDRA 1K3WA 3GRVA 2CWBA 1QAQA 4RF0A 1TH3A 3SMSA 3E46A 1NV9A 4DR1M 1Q3BA 1PJJA 4KLNA 2N35A 1SXJE 1TH2A 4D81A 4LFCM 4B3SM 1YUBA 2JXNA 3GLHA 2QZ4A 1R4GA 3T15A 1TH4A 4DUYM 3H4MA 4LGYA 4CJ6A 2BNKA 1Z5AA 3KFUG 5IT9S 2XH9A 2J7OA 4PDGA 1JR3E 5C18A 1SXJB 3J81S 4IBDA 2FFJA 4UN2B 4GHAA 1N33M 1TF0B 2MH8A 1GO5A 3SARA 4L78A 4OU7A 1L2CA 2H5XA 2CHGA 2K47A 2KXEA 4OX9M 2CEAA 2X49A 4FD2A 3HJQA 3RFWA 2R65A 2KA6B 2ZAMA 4G4QA 2KNVA 2JP7A 3MJ5A 4QHTA 1DGFA 2OOBA 3ILKA 2F5OA 1SXJD 2XEPA 2DWNA 1XB2B 4W5WA 5FTNA 2DAIA 3KSXA 1OQYA 2XFTA 3A98B 4I8OA 1Z5CA 2LWXA 3CGWA 4FW9A 2W82A 4NRVA 3RE8A 1OIPA 4CIZA 2DWZB 5FTJA 1WHCA 4Z6YA 3HU1A 2ZM6M 2Z4RA 3FTCA 1W5TA 3L29A 1AUAA 4ZPXA 3LMMA 3VLFB 4GMQA 5ITUA 5FTLA 2WSCF 3U60B 3FRHA 4CGYB 2V1UA 4QOZC 3SAVA 4EIWA 4B3MM 4JN6A 2HWJA 4IJFA 5ITRA 1XXHE 3TE6A 4XK8F 3SAUA 1P3QQ 3KS4A 3VKGA 2KZUA 4AG6A 1IXZA 1F4IA 1NHGC 4M0DA 1XXHB 3L26A 5IREB 3WHKA 2R46A 3I51A 1IN4A 1YE9A 2D7EA 3KOZE 3GO8A 1T6OA 1UFZA 2F4VM 1KSFX 3CTWB 4K0KM 3SYKA 2F5PA 1OAIA 1Q3CA 2CE7A 2VDBB 1TDHA 4A3VB 4MGHA 3QYEA 2JNHA 4MGYE 3OTOM 2Z4SA 3Q8GA 3GLFE 3U6CA 2JY8A 4IBIA 3FUWA 2D7GA 3HGIA 1E32A 4GITA 1DGHA 3FUXA 2KRUA 1QDTA 2QHOB 2ZTDA 4LFBM 3FTEA 1GJTA 2F5SA 4AW4A 2H1RA 1IXSB 2CFOA 1H6UA 3GLFB 2ZBKB 2DNAA 3LVVA 3Q8XA 1LTMA 4FCWA 3FE3A 4LCBA 4WP2A 4LFAM 2KHHA 4KHPM 3MHVC 3QWLA 3AL0C 2C5RA 2K6BA 1DGBA 2C99A 4GIPA 4HLQA 3V76A 4G4OA 4OW0A 4RF1A 2OQ4A 3SATA 1R2YA 1J09A 3K9OA 4TUWA 1HT1E 4F2LA 1CUKA 2XSZA 3KSJA 1IFYA 3J27B 2LH0A 2R6FA 4M9SA 3PVSA 1G59A 3A45A 1IN8A 1QYRA 1GJSA 2VQFM 2DZLA 1XC8A 1L2BA 1OTRA 4FWDA 5IWAM 1HNWM 1L2DA 2LNHC 5H37D 1Z6TA 1ZAEA 3C9PA 3VK8A 2ERCA 4FCVA 4D82A 1NJFA 4G4NA 4G6ZA 2J7NA 5FTKA 4G3OA 3T6PA 2MR9A 5A2QS 1FNNA 4B3RM 2LBCA 2LTUA 1OJLA 4JI6M 2J5YA 2K0BX 4PDIA 3U6PA 2L4FA 2K9DA 3SFZA 1N32M 3T38A 1OIZA 4D80A 4AQYM 2JA2A 2DZOB 5IZ7D 4GC9A 4X62M 2HL7A 1IM2A 2I7PA 3JR4A 1XMOM 2HHHM 1N77A 3FKEA 3B9PA 3GQ4A 1N78A 4HL4A 3AV0A 2XFSA 1EIJA 2R4JA 4IBBA 4JYAM 4LZZA 3M0EA 5KPRA 3RGPA 1VEGA 2FH0A 3B7QA 3W67A 2Q2EB 3SYLA 3KOXE 3GLGE 4DUZM 4I5SA 3U5ZB 5BR8M 1R7RA 3F92A 4IBGA 2GNOA 2DAMA 2LVPC 5EJCA 5EP2A 1DV0A 1GL7A 1PRBA 2CV2A 1IQPA 2P5TA 3B7NA 4F1IA 2JY5A 3AOEA 4DR4M 3HX3A 2JY7A 3M6AA 2EA0A 4DV5M 1R2ZA 3IHPA 1NY5A 3KOYE 3J7BA 2QNJA 3GLGB 3TWMA 2FS1A 1KFVA 4FWHA 1GABA 1MN3A 2LVQD 4P17A 1IY2A 3NWLA 1E94E 3GRRA 2V6ZM 1IN6A 2ZAOA 4MGZE 1PJTA 5E26A 2BWEA 5ITXE 1Q39A 2O01F 2KNAA 4NSRA 3B74A 1TDZA 2QBYA 1L1TA 1EFUB 4BLCA 3H4JA 3SHGB 4NC6A 4DV1M 1NHWC 2ZANA 1IY0A 2LHGA 3HKPA 2L7IA 4LGMA 2XLJA 3J2PB 4GC5A 4M0WA 1IN5A 3W0LB 7CATA 3U61B 3J80S 2DWMA 3LW5F 2UUCM 1NNJA 3HHXA 1G3IA 3I4VA 4S12A 4YY3M 2UXBM 2MJ5B 3GLHE 3QYBA 3GRUA 1Z59A 2M5ZA 2Y20A 5EP3A 3T1YM 2VIIA 2G3QA 2UUBM 2MGWA 4OVZA 2UUAM 3ZC7B 3DZDA 1HR0M 4LG2A 5EXPA 1JR3D 3GLHB 3U6QA 2DXIA 4L4UA 2BWBA 3IECA 3HHZA 3HHYA 3E9SA 3SASA 5KO3A 3AOGA 1ZMUA 2QSFX 2L09A 2A5YB 2L6OA 2R45A 2EKKA 4GRIA 1QZMA 3A46A 1NNUC 1WGLA 1G71A 3AFHA 3TWLA 2CRUA 5JI2E 4DR5M 4FWGA 5ITYA 2M60A 2FNAA 1QANA 3ZQJA 3FYDA 1EE8A 1N75A 1SG9A 1C1KA 1T3TA 1WJ7A 5KPZA 2DWLA 4WW0A 3RGSA 1TGUA 1WXQA 1ORYB 4RKUF 2CP8A 4DBGB 1OKSA 2ZTCA 4X64M 3KS8A 2DHYA 1VG5A 2F5NA 2JZ0A 3R8FA 2L2DA 3GPUA 3DFZA 3NBXX 1G4AE 3CF6E 2C9OA 4AKHA 1IXSA 4JI1M 2G8LA 2DZNB 3FRIA 5EP4A 3HU2A 2XZFA 4ITQA 2MROB 3UMMA 4B7FA 2X4AA 2XF3A 3JAMS 3UZUA 4FVMA 2E5LM 2JWSA 2RGHA 1QVRA 2DKLA 1HT2E 3IG5A 3DA1A 4LJ7A 2DAGA 1XWIA 4IBKA 3THGA 3GLIA 3PXGA 5DNYA 2KDLA 4NXNM 5EXXA 2O25A 1GL6A 1Y8GA 4DR2M 5ITQA 2R62A 5BPVA 2KW0A 3UJNA 1HNZM 2KNZA 1IY1A 4KO8A 4WURA 3VDUA 3L27A 1V92A 5LMNM 1QUTA 4I4LA 3K92A 5FTMA 1S3SA 3JR5A 8CATA 2YNMD 2HAKA 3SMPA 1HJPA 2DAKA 1J7KA 1MX0A 3BXWA 3SC3A 2CV1A 1NJGA 1OFHA 1DGHB 4QNMA 4ANRA 3B7ZA 4L6V6 4BBAA 3GP1A 3I4YA 3FYCA 3EIEA 5GKNA 4JI4M 2KZSA 4NOOB 3WHLA 1ZV1A 4B7HA 1JQJC 2RKOA 3HWSA 2EO2A 4MB7A 2UU9M 4AZFA 4JI0M 1A5TA 4DV6M 4LF7M 1BVSA 4MGIE 4MH0E 2D7HA 1QAOA 3EIHA 4NXMM 3C3DA 4IBJA 1NY6A 1E9RA 3W68A 4B08A 3T1HM 1NSFA 2JY6B 4XGIA 1IBKM 3HHWA 2B3TA 2EJSA 2V1CA 5FSWA 3GQ3A 4LF8M 1NV8A 5EQTA 1HQCA 3IG8A 1L8QA 2DENA 1JB0F 3GLGA 3FUUA 2DI0A 2Z8YM 4II7A 1IN7A 1C7YA 3W0FA 1OFIA 2XGNA 5KPTA 1N34M 1AIPC 4DV4M 3I01M 4G4RA 3HJSA 3L2AA 4YHHM 2XSZD 2QENA 1SXJA 3HU3A 4AKGA 4NRWA 2X8AA 4LJ9A 4LJAA 2L7HA 1G8PA 4PT5A 2JZ1A 1XMQM 2CHVA 2DAEA 1R6BX 3KOWE 3FTFA 2QP9X 3HY5A 2NQ8C 1PGYA 3U61A 2BJVA 4LJ6A 1IBLM 1JR3A 2FOIC 4GHLA 1V33A 2I7NA 2R0IA 3FD9A 3GQ5A 1PJSA 3HJ8A 1TTEA 3LCVB 3MMPA 3PFIA 4LJ4A 3D8LA 2Y0QA 3R9XB 3VKHA 1PJQA 4NSOB 2LXEA 1LV7A
chains in the Genus database with same CATH topology
1QQWA 3K8ZA 4DR3M 3NBIA 4DV2M 3GPXA 4GKKM 3AOEC 3VFDA 4GH9A 3AKZA 3E4RA 1GLNA 1SXJC 3CF0A 3MK6A 3U60A 5E6JA 4LRTA 2CV0A 2XZUA 3K1JA 4AI6A 5DYIA 4JI2M 1YSYA 3FUVA 3KXEC 4REZA 4AKIA 2G5GX 1DGGA 3VK7A 3D8BA 1Z5BA 1K82A 2QBYB 1XXHA 5F3WA 4L8RC 3U6LA 4QNRA 1NVMA 4DV0M 1XNRM 1KYIA 1G41A 2YFQA 4LF4M 1ZQ9A 5C1BA 4I81A 1QAMA 4QOSA 4DV3M 2QPAA 4CISA 2Z7JA 2UXDM 1MU5A 3LQRA 3SAWA 4DV7M 1I94M 4LZJA 2BJWA 2CHQA 1IXRC 3PNYA 3LVWA 4IBEA 3KDSE 4OVZB 4P16A 1UM8A 3TWKA 4LY6A 4IIWA 3KP0E 4LRSA 2Y0TA 4B7GA 3GLFA 5DYGA 4X66M 3UK6A 4R7GA 3FTDA 4LF5M 3J7AS 1XHBA 3A42A 4MGKE 4JV5M 4JI8M 2KRKA 2O5RA 4L16A 3K2LA 2YQZA 3TL4X 5LMUM 1XNQM 1D2NA 2R18A 5EXTA 3DOAA 3C58A 3GPYA 3VDPA 2Y21A 4LF6M 4PCZA 2YR0A 4AG5A 4KODA 4IBFA 4LJ8A 2DVWB 3FUTA 4JI3M 3KP1E 2C9CA 4IBCA 5KQ8A 4DR7M 3TPZA 1PJIA 1K3XA 1I4WA 1PM5A 2EUCA 4JXJA 3GPPA 1DO0A 3ZH9B 2DHRA 4MM3B 4JI5M 4B3TM 1X37A 3KW6A 4R3DA 5EP1A 4FCTA 3L25A 5JI3E 1E9SA 2Z3XA 3U6MA 4Z8XA 2UXCM 4IJEA 3U6DA 1IBMM 2CUZA 2VQEM 3SBJA 2HCBA 4LJ5A 4PD2A 4CHTB 4RNAA 2AHMA 3GLIB 3U5ZA 4GKJM 3AJIB 1GVNA 3LQQA 3TQSA 4XBOA 1J5EM 3PNVA 5KQDA 1HQYE 2F5QA 5EXSA 5ITTA 3KVWA 5FLXS 1HNXM 4NL4H 1W5SA 3M7GA 2KEBA 3U6SA 1GKIA 1DO2A 4M9ZA 1VDDA 1N36M 2FE8A 2QCUA 3QAUA 4X65M 2OPFA 3U6OA 4DR6M 2R4EA 3GRYA 3L28A 1FJGM 3SHFA 4QHSA 3U6EA 2C98A 3UGJA 3BOSA 2HKJA 1L1ZA 3CF2A 4L15A 4JI7M 4LF9M 2RGOA 5ITXA 4M9XA 4BB9A 3ZCBB 2C96A 1K3WA 3GRVA 1QAQA 4RF0A 1TH3A 3SMSA 4DR1M 1Q3BA 1PJJA 4KLNA 4D81A 1SXJE 1TH2A 4LFCM 1YUBA 3GLHA 2QZ4A 3T15A 1TH4A 4DUYM 3H4MA 4LGYA 2BNKA 1Z5AA 3KFUG 5IT9S 2XH9A 2J7OA 4PDGA 5C18A 1SXJB 3J81S 4IBDA 2FFJA 1N33M 4GHAA 3SARA 4L78A 4OU7A 1L2CA 2K47A 2CHGA 2KXEA 4OX9M 2CEAA 2X49A 4FD2A 3HJQA 3RFWA 2R65A 2KA6B 2ZAMA 4G4QA 4QHTA 3MJ5A 2F5OA 1DGFA 3ILKA 1SXJD 2XEPA 2DWNA 4W5WA 5FTNA 3KSXA 2XFTA 3A98B 4I8OA 1Z5CA 2LWXA 4FW9A 2W82A 4NRVA 3RE8A 2DWZB 5FTJA 4Z6YA 3HU1A 2ZM6M 2Z4RA 3FTCA 1W5TA 3L29A 4ZPXA 3LMMA 3VLFB 4GMQA 5ITUA 5FTLA 3U60B 4CGYB 2V1UA 3SAVA 4EIWA 4B3MM 4JN6A 4IJFA 5ITRA 3TE6A 3SAUA 3KS4A 3VKGA 2KZUA 4AG6A 1IXZA 1NHGC 4M0DA 1XXHB 3L26A 5IREB 3WHKA 2R46A 3I51A 1IN4A 1YE9A 2D7EA 3KOZE 3GO8A 2F4VM 1KSFX 3CTWB 4K0KM 3SYKA 2F5PA 1Q3CA 2CE7A 1TDHA 4A3VB 4MGHA 3OTOM 4MGYE 2Z4SA 3U6CA 4IBIA 3FUWA 2D7GA 3HGIA 1E32A 4GITA 1DGHA 3FUXA 2KRUA 4LFBM 3FTEA 2F5SA 4AW4A 2H1RA 1IXSB 2CFOA 1H6UA 3GLFB 2ZBKB 3Q8XA 3LVVA 4FCWA 4LCBA 4LFAM 4KHPM 3MHVC 3QWLA 3AL0C 2C5RA 1DGBA 2C99A 4GIPA 4HLQA 4G4OA 4OW0A 4RF1A 2OQ4A 3SATA 1R2YA 1J09A 4TUWA 1HT1E 2XSZA 3KSJA 3J27B 2LH0A 4M9SA 3PVSA 1G59A 3A45A 1IN8A 1QYRA 2VQFM 1XC8A 1L2BA 4FWDA 5IWAM 1HNWM 1L2DA 2LNHC 5H37D 1Z6TA 1ZAEA 3VK8A 2ERCA 4FCVA 4D82A 1NJFA 4G4NA 4G6ZA 2J7NA 5FTKA 5A2QS 4B3RM 1FNNA 1OJLA 4JI6M 3U6PA 4PDIA 1N32M 3SFZA 3T38A 4D80A 4AQYM 2JA2A 2DZOB 5IZ7D 4GC9A 4X62M 2HL7A 1IM2A 2I7PA 3JR4A 1XMOM 2HHHM 1N77A 3FKEA 3B9PA 3GQ4A 1N78A 4HL4A 3AV0A 2XFSA 2R4JA 4IBBA 4JYAM 4LZZA 3M0EA 5KPRA 3RGPA 2Q2EB 3SYLA 3KOXE 4DUZM 4I5SA 3U5ZB 5BR8M 1R7RA 5EP2A 4IBGA 5EJCA 1GL7A 2CV2A 1IQPA 2P5TA 3VKHA 3AOEA 4DR4M 4DV5M 3M6AA 2EA0A 1R2ZA 1NY5A 3KOYE 3J7BA 3GLGB 3TWMA 1KFVA 4FWHA 1IY2A 3NWLA 1E94E 3GRRA 2V6ZM 1IN6A 2ZAOA 4MGZE 5E26A 5ITXE 1Q39A 4NSRA 1TDZA 2QBYA 1L1TA 4BLCA 3SHGB 4DV1M 1NHWC 2ZANA 1IY0A 3HKPA 4LGMA 2L7IA 2XLJA 3J2PB 4GC5A 4M0WA 1IN5A 3W0LB 7CATA 3U61B 3J80S 2DWMA 2UUCM 4B3SM 1NNJA 3HHXA 1G3IA 3I4VA 4S12A 4YY3M 2UXBM 3GRUA 1Z59A 2M5ZA 2Y20A 5EP3A 3T1YM 2VIIA 2UUBM 4OVZA 2UUAM 3ZC7B 3DZDA 1HR0M 4LG2A 5EXPA 1JR3D 3GLHB 3U6QA 2DXIA 4L4UA 3HHZA 3HHYA 3E9SA 3SASA 5KO3A 3AOGA 2L09A 2A5YB 2L6OA 2R45A 4GRIA 1QZMA 3A46A 1NNUC 3TWLA 3AFHA 5JI2E 4DR5M 4FWGA 5ITYA 2M60A 2FNAA 1QANA 3FYDA 1EE8A 1N75A 5KPZA 1C1KA 1T3TA 2DWLA 4QOZC 4WW0A 3RGSA 1TGUA 1WXQA 1ORYB 4X64M 3KS8A 2F5NA 3R8FA 3GPUA 3DFZA 1G4AE 3CF6E 2C9OA 4AKHA 4JI1M 2G8LA 2DZNB 5EP4A 2XZFA 3HU2A 4ITQA 3UMMA 4B7FA 2X4AA 2XF3A 3JAMS 3UZUA 4FVMA 2E5LM 2RGHA 1QVRA 1HT2E 3IG5A 3DA1A 4LJ7A 1XWIA 4IBKA 3THGA 3GLIA 3PXGA 5DNYA 4NXNM 5EXXA 1GL6A 4DR2M 5ITQA 2R62A 5BPVA 2KW0A 3UJNA 1HNZM 1IY1A 4KO8A 4WURA 3VDUA 3L27A 5LMNM 4I4LA 3K92A 5FTMA 1S3SA 3JR5A 8CATA 2YNMD 3SMPA 1MX0A 1J7KA 3SC3A 2CV1A 1NJGA 1OFHA 1DGHB 4QNMA 4BBAA 3GP1A 3I4YA 3FYCA 3EIEA 5GKNA 4JI4M 2KZSA 4NOOB 3WHLA 4B7HA 1JQJC 2RKOA 3HWSA 2EO2A 4MB7A 2UU9M 4AZFA 4JI0M 4DV6M 4LF7M 4MGIE 4MH0E 2D7HA 1QAOA 3EIHA 4NXMM 4IBJA 1NY6A 1E9RA 4B08A 3T1HM 1NSFA 1IBKM 4XGIA 3HHWA 3GQ3A 2V1CA 5FSWA 4LF8M 5EQTA 1HQCA 3IG8A 1L8QA 3GLGA 3FUUA 4II7A 1IN7A 3W0FA 1OFIA 2XGNA 5KPTA 1N34M 4DV4M 4G4RA 3HJSA 3L2AA 4YHHM 2XSZD 2QENA 1SXJA 3HU3A 4AKGA 4NRWA 2X8AA 4LJ9A 4LJAA 2L7HA 1G8PA 4PT5A 1XMQM 2CHVA 1R6BX 3KOWE 3FTFA 2QP9X 2NQ8C 3U61A 2BJVA 4LJ6A 1IBLM 1JR3A 2FOIC 4GHLA 2I7NA 3GQ5A 3HJ8A 3PFIA 4LJ4A 3D8LA 2Y0QA 3R9XB 3FD9A 4NSOB 2LXEA 1LV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 M;  5ITT A;  5ITY A;  5FLX S;  1HNX M;  2ZBK B;  4DV2 M;  4LFA M;  1EE8 A;  3GPX A;  4GKK M;  2F5S A;  4KHP M;  3U6S A;  4G4O A;  4X64 M;  2OQ4 A;  1N36 M;  3SAT A;  1R2Y A;  4X65 M;  4DR6 M;  3U6O A;  2OPF A;  2F5N A;  2XZU A;  1FJG M;  3GPU A;  3U6E A;  2HKJ A;  1L1Z A;  4JI2 M;  4JI7 M;  4LF9 M;  5ITX A;  3A45 A;  4JI1 M;  2VQF M;  1XC8 A;  1L2B A;  2XZF A;  4ITQ A;  1K3W A;  5IWA M;  3VK7 A;  1HNW M;  3JAM S;  1Z5B A;  1L2D A;  2E5L M;  1K82 A;  4DR1 M;  3VK8 A;  3U6L A;  1Q3B A;  1PJJ A;  4DV0 M;  4G4N A;  1XNR M;  4LF4 M;  4LFC M;  5A2Q S;  4B3R M;  4DV3 M;  4JI6 M;  3U6P A;  4PDI A;  4CIS A;  1N32 M;  4DUY M;  2UXD M;  1MU5 A;  3SAW A;  4AQY M;  4DV7 M;  1Z5A A;  1XMO M;  1I94 M;  4X62 M;  3JR4 A;  2HHH M;  4NXN M;  5IT9 S;  4PDG A;  3J81 S;  4DR2 M;  5ITQ A;  3GQ4 A;  1HNZ M;  1N33 M;  3TWK A;  3SAR A;  1L2C A;  4JYA M;  4OX9 M;  5LMN M;  2Q2E B;  4X66 M;  3JR5 A;  4DUZ M;  4G4Q A;  5BR8 M;  4LF5 M;  2F5O A;  1MX0 A;  3J7A S;  3A42 A;  4DR4 M;  4DV5 M;  4JV5 M;  4JI8 M;  2EA0 A;  3GP1 A;  1R2Z A;  1Z5C A;  4JI4 M;  3TWM A;  4NRV A;  5LMU M;  1KFV A;  1XNQ M;  2ZM6 M;  4MB7 A;  2UU9 M;  4DV6 M;  4JI0 M;  4LF7 M;  3DOA A;  3C58 A;  5ITX E;  3GPY A;  4NXM M;  4LF6 M;  1Q39 A;  4PCZ A;  5ITU A;  1TDZ A;  3T1H M;  1L1T A;  1IBK M;  3SAV A;  3GQ3 A;  4B3M M;  4LF8 M;  4JI3 M;  4DV1 M;  5ITR A;  3SAU A;  4B3S M;  3J80 S;  2UUC M;  1NNJ A;  4DR7 M;  3W0F A;  4YY3 M;  2UXB M;  1PJI A;  1N34 M;  1PM5 A;  1K3X A;  1Z59 A;  3GPP A;  4DV4 M;  4G4R A;  4JI5 M;  4YHH M;  3T1Y M;  4B3T M;  2UUB M;  4NRW A;  3GO8 A;  2UUA M;  3U6M A;  2F4V M;  1HR0 M;  4K0K M;  2UXC M;  1XMQ M;  3U6D A;  1IBM M;  2VQE M;  3U6Q A;  3SBJ A;  1Q3C A;  2F5P A;  1TDH A;  3OTO M;  4PD2 A;  3SAS A;  1IBL M;  3U6C A;  3GQ5 A;  4GKJ M;  1J5E M;  3A46 A;  4LFB M;  3TWL A;  2F5Q A;  4DR5 M; 
#chains in the Genus database with same CATH topology
 1QQW A;  3K8Z A;  4Q7J A;  4DR3 M;  3NBI A;  4DV2 M;  2GQF A;  3GPX A;  4GKK M;  3AOE C;  3VFD A;  4GH9 A;  2WZJ A;  3AKZ A;  3E4R A;  1GLN A;  1SXJ C;  3CF0 A;  3MK6 A;  3U60 A;  5E6J A;  4LRT A;  2CV0 A;  3B89 A;  1YLA A;  2XZU A;  3K1J A;  3E21 A;  4AI6 A;  3LCU A;  5DYI A;  4JI2 M;  1YSY A;  3C3E A;  3FUV A;  3KXE C;  1T43 A;  4REZ A;  1R5L A;  4R71 A;  4AKI A;  2G5G X;  1DGG A;  1MJG M;  3VK7 A;  3D8B A;  1Z5B A;  1K82 A;  2QBY B;  1XXH A;  5F3W A;  4L8R C;  3U6L A;  4QNR A;  1NVM A;  2WSE F;  4Y28 F;  1KYI A;  2LVA A;  4DV0 M;  1G41 A;  1XNR M;  2YFQ A;  4LF4 M;  1ZQ9 A;  5C1B A;  3K9P A;  3HZJ A;  4I81 A;  1QAM A;  4QOS A;  4DV3 M;  2QPA A;  4CIS A;  2Z7J A;  2UXD M;  1VEK A;  1VEJ A;  1MU5 A;  3LQR A;  5L8R F;  3SAW A;  1WR1 B;  4DV7 M;  1D0M A;  1I94 M;  4LZJ A;  2BJW A;  2CHQ A;  2LVN C;  1IXR C;  3PNY A;  1WGN A;  4GEW A;  3LVW A;  4IBE A;  3KDS E;  4OVZ B;  4P16 A;  1UM8 A;  3TWK A;  4LY6 A;  4IIW A;  3KP0 E;  4LRS A;  1Q02 A;  1ZMW A;  2Y0T A;  5DYG A;  4B7G A;  3GLF A;  4X66 M;  3UK6 A;  4R7G A;  3FTD A;  4LF5 M;  3J7A S;  1XHB A;  3A42 A;  2LVO C;  4MGK E;  4JV5 M;  4JI8 M;  2KRK A;  1NO1 A;  2O5R A;  4L16 A;  3K2L A;  3I04 M;  2YQZ A;  3TL4 X;  5LMU M;  1XNQ M;  2OOA A;  5DFL A;  4KT0 F;  1QZE A;  1D2N A;  2R18 A;  5EXT A;  3DOA A;  2VF8 A;  3C58 A;  3GPY A;  3VDP A;  2Y21 A;  4LF6 M;  4PCZ A;  2YR0 A;  4AG5 A;  4KOD A;  4IBF A;  2EKF A;  2OO9 A;  2WSF F;  1QUS A;  4LJ8 A;  2DVW B;  3FUT A;  4JI3 M;  3KP1 E;  1VQ1 A;  2C9C A;  4IBC A;  5KQ8 A;  4DR7 M;  3TPZ A;  2LHC A;  1PJI A;  1K3X A;  1I4W A;  1PM5 A;  2EUC A;  4JXJ A;  3GPP A;  1DO0 A;  3ZH9 B;  2DHR A;  4MM3 B;  4JI5 M;  3GLI E;  4B3T M;  1X37 A;  1ZMV A;  3KW6 A;  4R3D A;  5EP1 A;  4FCT A;  3L25 A;  1WIV A;  5JI3 E;  1E9S A;  2Z3X A;  3U6M A;  4Z8X A;  2UXC M;  4IJE A;  3U6D A;  1IBM M;  2CUZ A;  2VQE M;  3SBJ A;  2HCB A;  3BBZ A;  4LJ5 A;  4PD2 A;  4CHT B;  4RNA A;  1TR8 A;  2AHM A;  3GLI B;  3U5Z A;  1RU3 A;  4GKJ M;  3AJI B;  1GVN A;  3LQQ A;  3TQS A;  4XBO A;  1J5E M;  1D0L A;  3PNV A;  5KQD A;  2QQ8 A;  1D0K A;  2JUJ A;  1HQY E;  5EXS A;  2APL A;  2F5Q A;  5ITT A;  3KVW A;  5FLX S;  1HNX M;  4NL4 H;  1W5S A;  3M7G A;  2KEB A;  2VF7 A;  3U6S A;  1GKI A;  1DO2 A;  2L4E A;  1VDD A;  4M9Z A;  1N36 M;  2R44 A;  4HEO A;  2FE8 A;  2QCU A;  3QAU A;  4X65 M;  2OPF A;  3U6O A;  4DR6 M;  2R4E A;  2RRU A;  3GRY A;  3L28 A;  1FJG M;  3SHF A;  1OAO C;  4QHS A;  3U6E A;  2C98 A;  3UGJ A;  3BOS A;  2HKJ A;  1L1Z A;  1VDL A;  1V34 A;  3CF2 A;  4L15 A;  4JI7 M;  4LF9 M;  2RGO A;  5ITX A;  4M9X A;  4BB9 A;  3ZCB B;  2C96 A;  1QDR A;  1K3W A;  3GRV A;  2CWB A;  1QAQ A;  4RF0 A;  1TH3 A;  3SMS A;  3E46 A;  1NV9 A;  4DR1 M;  1Q3B A;  1PJJ A;  4KLN A;  2N35 A;  1SXJ E;  1TH2 A;  4D81 A;  4LFC M;  4B3S M;  1YUB A;  2JXN A;  3GLH A;  2QZ4 A;  1R4G A;  3T15 A;  1TH4 A;  4DUY M;  3H4M A;  4LGY A;  4CJ6 A;  2BNK A;  1Z5A A;  3KFU G;  5IT9 S;  2XH9 A;  2J7O A;  4PDG A;  1JR3 E;  5C18 A;  1SXJ B;  3J81 S;  4IBD A;  2FFJ A;  4UN2 B;  4GHA A;  1N33 M;  1TF0 B;  2MH8 A;  1GO5 A;  3SAR A;  4L78 A;  4OU7 A;  1L2C A;  2H5X A;  2CHG A;  2K47 A;  2KXE A;  4OX9 M;  2CEA A;  2X49 A;  4FD2 A;  3HJQ A;  3RFW A;  2R65 A;  2KA6 B;  2ZAM A;  4G4Q A;  2KNV A;  2JP7 A;  3MJ5 A;  4QHT A;  1DGF A;  2OOB A;  3ILK A;  2F5O A;  1SXJ D;  2XEP A;  2DWN A;  1XB2 B;  4W5W A;  5FTN A;  2DAI A;  3KSX A;  1OQY A;  2XFT A;  3A98 B;  4I8O A;  1Z5C A;  2LWX A;  3CGW A;  4FW9 A;  2W82 A;  4NRV A;  3RE8 A;  1OIP A;  4CIZ A;  2DWZ B;  5FTJ A;  1WHC A;  4Z6Y A;  3HU1 A;  2ZM6 M;  2Z4R A;  3FTC A;  1W5T A;  3L29 A;  1AUA A;  4ZPX A;  3LMM A;  3VLF B;  4GMQ A;  5ITU A;  5FTL A;  2WSC F;  3U60 B;  3FRH A;  4CGY B;  2V1U A;  4QOZ C;  3SAV A;  4EIW A;  4B3M M;  4JN6 A;  2HWJ A;  4IJF A;  5ITR A;  1XXH E;  3TE6 A;  4XK8 F;  3SAU A;  1P3Q Q;  3KS4 A;  3VKG A;  2KZU A;  4AG6 A;  1IXZ A;  1F4I A;  1NHG C;  4M0D A;  1XXH B;  3L26 A;  5IRE B;  3WHK A;  2R46 A;  3I51 A;  1IN4 A;  1YE9 A;  2D7E A;  3KOZ E;  3GO8 A;  1T6O A;  1UFZ A;  2F4V M;  1KSF X;  3CTW B;  4K0K M;  3SYK A;  2F5P A;  1OAI A;  1Q3C A;  2CE7 A;  2VDB B;  1TDH A;  4A3V B;  4MGH A;  3QYE A;  2JNH A;  4MGY E;  3OTO M;  2Z4S A;  3Q8G A;  3GLF E;  3U6C A;  2JY8 A;  4IBI A;  3FUW A;  2D7G A;  3HGI A;  1E32 A;  4GIT A;  1DGH A;  3FUX A;  2KRU A;  1QDT A;  2QHO B;  2ZTD A;  4LFB M;  3FTE A;  1GJT A;  2F5S A;  4AW4 A;  2H1R A;  1IXS B;  2CFO A;  1H6U A;  3GLF B;  2ZBK B;  2DNA A;  3LVV A;  3Q8X A;  1LTM A;  4FCW A;  3FE3 A;  4LCB A;  4WP2 A;  4LFA M;  2KHH A;  4KHP M;  3MHV C;  3QWL A;  3AL0 C;  2C5R A;  2K6B A;  1DGB A;  2C99 A;  4GIP A;  4HLQ A;  3V76 A;  4G4O A;  4OW0 A;  4RF1 A;  2OQ4 A;  3SAT A;  1R2Y A;  1J09 A;  3K9O A;  4TUW A;  1HT1 E;  4F2L A;  1CUK A;  2XSZ A;  3KSJ A;  1IFY A;  3J27 B;  2LH0 A;  2R6F A;  4M9S A;  3PVS A;  1G59 A;  3A45 A;  1IN8 A;  1QYR A;  1GJS A;  2VQF M;  2DZL A;  1XC8 A;  1L2B A;  1OTR A;  4FWD A;  5IWA M;  1HNW M;  1L2D A;  2LNH C;  5H37 D;  1Z6T A;  1ZAE A;  3C9P A;  3VK8 A;  2ERC A;  4FCV A;  4D82 A;  1NJF A;  4G4N A;  4G6Z A;  2J7N A;  5FTK A;  4G3O A;  3T6P A;  2MR9 A;  5A2Q S;  1FNN A;  4B3R M;  2LBC A;  2LTU A;  1OJL A;  4JI6 M;  2J5Y A;  2K0B X;  4PDI A;  3U6P A;  2L4F A;  2K9D A;  3SFZ A;  1N32 M;  3T38 A;  1OIZ A;  4D80 A;  4AQY M;  2JA2 A;  2DZO B;  5IZ7 D;  4GC9 A;  4X62 M;  2HL7 A;  1IM2 A;  2I7P A;  3JR4 A;  1XMO M;  2HHH M;  1N77 A;  3FKE A;  3B9P A;  3GQ4 A;  1N78 A;  4HL4 A;  3AV0 A;  2XFS A;  1EIJ A;  2R4J A;  4IBB A;  4JYA M;  4LZZ A;  3M0E A;  5KPR A;  3RGP A;  1VEG A;  2FH0 A;  3B7Q A;  3W67 A;  2Q2E B;  3SYL A;  3KOX E;  3GLG E;  4DUZ M;  4I5S A;  3U5Z B;  5BR8 M;  1R7R A;  3F92 A;  4IBG A;  2GNO A;  2DAM A;  2LVP C;  5EJC A;  5EP2 A;  1DV0 A;  1GL7 A;  1PRB A;  2CV2 A;  1IQP A;  2P5T A;  3B7N A;  4F1I A;  2JY5 A;  3AOE A;  4DR4 M;  3HX3 A;  2JY7 A;  3M6A A;  2EA0 A;  4DV5 M;  1R2Z A;  3IHP A;  1NY5 A;  3KOY E;  3J7B A;  2QNJ A;  3GLG B;  3TWM A;  2FS1 A;  1KFV A;  4FWH A;  1GAB A;  1MN3 A;  2LVQ D;  4P17 A;  1IY2 A;  3NWL A;  1E94 E;  3GRR A;  2V6Z M;  1IN6 A;  2ZAO A;  4MGZ E;  1PJT A;  5E26 A;  2BWE A;  5ITX E;  1Q39 A;  2O01 F;  2KNA A;  4NSR A;  3B74 A;  1TDZ A;  2QBY A;  1L1T A;  1EFU B;  4BLC A;  3H4J A;  3SHG B;  4NC6 A;  4DV1 M;  1NHW C;  2ZAN A;  1IY0 A;  2LHG A;  3HKP A;  2L7I A;  4LGM A;  2XLJ A;  3J2P B;  4GC5 A;  4M0W A;  1IN5 A;  3W0L B;  7CAT A;  3U61 B;  3J80 S;  2DWM A;  3LW5 F;  2UUC M;  1NNJ A;  3HHX A;  1G3I A;  3I4V A;  4S12 A;  4YY3 M;  2UXB M;  2MJ5 B;  3GLH E;  3QYB A;  3GRU A;  1Z59 A;  2M5Z A;  2Y20 A;  5EP3 A;  3T1Y M;  2VII A;  2G3Q A;  2UUB M;  2MGW A;  4OVZ A;  2UUA M;  3ZC7 B;  3DZD A;  1HR0 M;  4LG2 A;  5EXP A;  1JR3 D;  3GLH B;  3U6Q A;  2DXI A;  4L4U A;  2BWB A;  3IEC A;  3HHZ A;  3HHY A;  3E9S A;  3SAS A;  5KO3 A;  3AOG A;  1ZMU A;  2QSF X;  2L09 A;  2A5Y B;  2L6O A;  2R45 A;  2EKK A;  4GRI A;  1QZM A;  3A46 A;  1NNU C;  1WGL A;  1G71 A;  3AFH A;  3TWL A;  2CRU A;  5JI2 E;  4DR5 M;  4FWG A;  5ITY A;  2M60 A;  2FNA A;  1QAN A;  3ZQJ A;  3FYD A;  1EE8 A;  1N75 A;  1SG9 A;  1C1K A;  1T3T A;  1WJ7 A;  5KPZ A;  2DWL A;  4WW0 A;  3RGS A;  1TGU A;  1WXQ A;  1ORY B;  4RKU F;  2CP8 A;  4DBG B;  1OKS A;  2ZTC A;  4X64 M;  3KS8 A;  2DHY A;  1VG5 A;  2F5N A;  2JZ0 A;  3R8F A;  2L2D A;  3GPU A;  3DFZ A;  3NBX X;  1G4A E;  3CF6 E;  2C9O A;  4AKH A;  1IXS A;  4JI1 M;  2G8L A;  2DZN B;  3FRI A;  5EP4 A;  3HU2 A;  2XZF A;  4ITQ A;  2MRO B;  3UMM A;  4B7F A;  2X4A A;  2XF3 A;  3JAM S;  3UZU A;  4FVM A;  2E5L M;  2JWS A;  2RGH A;  1QVR A;  2DKL A;  1HT2 E;  3IG5 A;  3DA1 A;  4LJ7 A;  2DAG A;  1XWI A;  4IBK A;  3THG A;  3GLI A;  3PXG A;  5DNY A;  2KDL A;  4NXN M;  5EXX A;  2O25 A;  1GL6 A;  1Y8G A;  4DR2 M;  5ITQ A;  2R62 A;  5BPV A;  2KW0 A;  3UJN A;  1HNZ M;  2KNZ A;  1IY1 A;  4KO8 A;  4WUR A;  3VDU A;  3L27 A;  1V92 A;  5LMN M;  1QUT A;  4I4L A;  3K92 A;  5FTM A;  1S3S A;  3JR5 A;  8CAT A;  2YNM D;  2HAK A;  3SMP A;  1HJP A;  2DAK A;  1J7K A;  1MX0 A;  3BXW A;  3SC3 A;  2CV1 A;  1NJG A;  1OFH A;  1DGH B;  4QNM A;  4ANR A;  3B7Z A;  4L6V 6;  4BBA A;  3GP1 A;  3I4Y A;  3FYC A;  3EIE A;  5GKN A;  4JI4 M;  2KZS A;  4NOO B;  3WHL A;  1ZV1 A;  4B7H A;  1JQJ C;  2RKO A;  3HWS A;  2EO2 A;  4MB7 A;  2UU9 M;  4AZF A;  4JI0 M;  1A5T A;  4DV6 M;  4LF7 M;  1BVS A;  4MGI E;  4MH0 E;  2D7H A;  1QAO A;  3EIH A;  4NXM M;  3C3D A;  4IBJ A;  1NY6 A;  1E9R A;  3W68 A;  4B08 A;  3T1H M;  1NSF A;  2JY6 B;  4XGI A;  1IBK M;  3HHW A;  2B3T A;  2EJS A;  2V1C A;  5FSW A;  3GQ3 A;  4LF8 M;  1NV8 A;  5EQT A;  1HQC A;  3IG8 A;  1L8Q A;  2DEN A;  1JB0 F;  3GLG A;  3FUU A;  2DI0 A;  2Z8Y M;  4II7 A;  1IN7 A;  1C7Y A;  3W0F A;  1OFI A;  2XGN A;  5KPT A;  1N34 M;  1AIP C;  4DV4 M;  3I01 M;  4G4R A;  3HJS A;  3L2A A;  4YHH M;  2XSZ D;  2QEN A;  1SXJ A;  3HU3 A;  4AKG A;  4NRW A;  2X8A A;  4LJ9 A;  4LJA A;  2L7H A;  1G8P A;  4PT5 A;  2JZ1 A;  1XMQ M;  2CHV A;  2DAE A;  1R6B X;  3KOW E;  3FTF A;  2QP9 X;  3HY5 A;  2NQ8 C;  1PGY A;  3U61 A;  2BJV A;  4LJ6 A;  1IBL M;  1JR3 A;  2FOI C;  4GHL A;  1V33 A;  2I7N A;  2R0I A;  3FD9 A;  3GQ5 A;  1PJS A;  3HJ8 A;  1TTE A;  3LCV B;  3MMP A;  3PFI A;  4LJ4 A;  3D8L A;  2Y0Q A;  3R9X B;  3VKH A;  1PJQ A;  4NSO B;  2LXE A;  1LV7 A; 
#chains in the Genus database with same CATH homology
 1QQW A;  3K8Z A;  4DR3 M;  3NBI A;  4DV2 M;  3GPX A;  4GKK M;  3AOE C;  3VFD A;  4GH9 A;  3AKZ A;  3E4R A;  1GLN A;  1SXJ C;  3CF0 A;  3MK6 A;  3U60 A;  5E6J A;  4LRT A;  2CV0 A;  2XZU A;  3K1J A;  4AI6 A;  5DYI A;  4JI2 M;  1YSY A;  3FUV A;  3KXE C;  4REZ A;  4AKI A;  2G5G X;  1DGG A;  3VK7 A;  3D8B A;  1Z5B A;  1K82 A;  2QBY B;  1XXH A;  5F3W A;  4L8R C;  3U6L A;  4QNR A;  1NVM A;  4DV0 M;  1XNR M;  1KYI A;  1G41 A;  2YFQ A;  4LF4 M;  1ZQ9 A;  5C1B A;  4I81 A;  1QAM A;  4QOS A;  4DV3 M;  2QPA A;  4CIS A;  2Z7J A;  2UXD M;  1MU5 A;  3LQR A;  3SAW A;  4DV7 M;  1I94 M;  4LZJ A;  2BJW A;  2CHQ A;  1IXR C;  3PNY A;  3LVW A;  4IBE A;  3KDS E;  4OVZ B;  4P16 A;  1UM8 A;  3TWK A;  4LY6 A;  4IIW A;  3KP0 E;  4LRS A;  2Y0T A;  4B7G A;  3GLF A;  5DYG A;  4X66 M;  3UK6 A;  4R7G A;  3FTD A;  4LF5 M;  3J7A S;  1XHB A;  3A42 A;  4MGK E;  4JV5 M;  4JI8 M;  2KRK A;  2O5R A;  4L16 A;  3K2L A;  2YQZ A;  3TL4 X;  5LMU M;  1XNQ M;  1D2N A;  2R18 A;  5EXT A;  3DOA A;  3C58 A;  3GPY A;  3VDP A;  2Y21 A;  4LF6 M;  4PCZ A;  2YR0 A;  4AG5 A;  4KOD A;  4IBF A;  4LJ8 A;  2DVW B;  3FUT A;  4JI3 M;  3KP1 E;  2C9C A;  4IBC A;  5KQ8 A;  4DR7 M;  3TPZ A;  1PJI A;  1K3X A;  1I4W A;  1PM5 A;  2EUC A;  4JXJ A;  3GPP A;  1DO0 A;  3ZH9 B;  2DHR A;  4MM3 B;  4JI5 M;  4B3T M;  1X37 A;  3KW6 A;  4R3D A;  5EP1 A;  4FCT A;  3L25 A;  5JI3 E;  1E9S A;  2Z3X A;  3U6M A;  4Z8X A;  2UXC M;  4IJE A;  3U6D A;  1IBM M;  2CUZ A;  2VQE M;  3SBJ A;  2HCB A;  4LJ5 A;  4PD2 A;  4CHT B;  4RNA A;  2AHM A;  3GLI B;  3U5Z A;  4GKJ M;  3AJI B;  1GVN A;  3LQQ A;  3TQS A;  4XBO A;  1J5E M;  3PNV A;  5KQD A;  1HQY E;  2F5Q A;  5EXS A;  5ITT A;  3KVW A;  5FLX S;  1HNX M;  4NL4 H;  1W5S A;  3M7G A;  2KEB A;  3U6S A;  1GKI A;  1DO2 A;  4M9Z A;  1VDD A;  1N36 M;  2FE8 A;  2QCU A;  3QAU A;  4X65 M;  2OPF A;  3U6O A;  4DR6 M;  2R4E A;  3GRY A;  3L28 A;  1FJG M;  3SHF A;  4QHS A;  3U6E A;  2C98 A;  3UGJ A;  3BOS A;  2HKJ A;  1L1Z A;  3CF2 A;  4L15 A;  4JI7 M;  4LF9 M;  2RGO A;  5ITX A;  4M9X A;  4BB9 A;  3ZCB B;  2C96 A;  1K3W A;  3GRV A;  1QAQ A;  4RF0 A;  1TH3 A;  3SMS A;  4DR1 M;  1Q3B A;  1PJJ A;  4KLN A;  4D81 A;  1SXJ E;  1TH2 A;  4LFC M;  1YUB A;  3GLH A;  2QZ4 A;  3T15 A;  1TH4 A;  4DUY M;  3H4M A;  4LGY A;  2BNK A;  1Z5A A;  3KFU G;  5IT9 S;  2XH9 A;  2J7O A;  4PDG A;  5C18 A;  1SXJ B;  3J81 S;  4IBD A;  2FFJ A;  1N33 M;  4GHA A;  3SAR A;  4L78 A;  4OU7 A;  1L2C A;  2K47 A;  2CHG A;  2KXE A;  4OX9 M;  2CEA A;  2X49 A;  4FD2 A;  3HJQ A;  3RFW A;  2R65 A;  2KA6 B;  2ZAM A;  4G4Q A;  4QHT A;  3MJ5 A;  2F5O A;  1DGF A;  3ILK A;  1SXJ D;  2XEP A;  2DWN A;  4W5W A;  5FTN A;  3KSX A;  2XFT A;  3A98 B;  4I8O A;  1Z5C A;  2LWX A;  4FW9 A;  2W82 A;  4NRV A;  3RE8 A;  2DWZ B;  5FTJ A;  4Z6Y A;  3HU1 A;  2ZM6 M;  2Z4R A;  3FTC A;  1W5T A;  3L29 A;  4ZPX A;  3LMM A;  3VLF B;  4GMQ A;  5ITU A;  5FTL A;  3U60 B;  4CGY B;  2V1U A;  3SAV A;  4EIW A;  4B3M M;  4JN6 A;  4IJF A;  5ITR A;  3TE6 A;  3SAU A;  3KS4 A;  3VKG A;  2KZU A;  4AG6 A;  1IXZ A;  1NHG C;  4M0D A;  1XXH B;  3L26 A;  5IRE B;  3WHK A;  2R46 A;  3I51 A;  1IN4 A;  1YE9 A;  2D7E A;  3KOZ E;  3GO8 A;  2F4V M;  1KSF X;  3CTW B;  4K0K M;  3SYK A;  2F5P A;  1Q3C A;  2CE7 A;  1TDH A;  4A3V B;  4MGH A;  3OTO M;  4MGY E;  2Z4S A;  3U6C A;  4IBI A;  3FUW A;  2D7G A;  3HGI A;  1E32 A;  4GIT A;  1DGH A;  3FUX A;  2KRU A;  4LFB M;  3FTE A;  2F5S A;  4AW4 A;  2H1R A;  1IXS B;  2CFO A;  1H6U A;  3GLF B;  2ZBK B;  3Q8X A;  3LVV A;  4FCW A;  4LCB A;  4LFA M;  4KHP M;  3MHV C;  3QWL A;  3AL0 C;  2C5R A;  1DGB A;  2C99 A;  4GIP A;  4HLQ A;  4G4O A;  4OW0 A;  4RF1 A;  2OQ4 A;  3SAT A;  1R2Y A;  1J09 A;  4TUW A;  1HT1 E;  2XSZ A;  3KSJ A;  3J27 B;  2LH0 A;  4M9S A;  3PVS A;  1G59 A;  3A45 A;  1IN8 A;  1QYR A;  2VQF M;  1XC8 A;  1L2B A;  4FWD A;  5IWA M;  1HNW M;  1L2D A;  2LNH C;  5H37 D;  1Z6T A;  1ZAE A;  3VK8 A;  2ERC A;  4FCV A;  4D82 A;  1NJF A;  4G4N A;  4G6Z A;  2J7N A;  5FTK A;  5A2Q S;  4B3R M;  1FNN A;  1OJL A;  4JI6 M;  3U6P A;  4PDI A;  1N32 M;  3SFZ A;  3T38 A;  4D80 A;  4AQY M;  2JA2 A;  2DZO B;  5IZ7 D;  4GC9 A;  4X62 M;  2HL7 A;  1IM2 A;  2I7P A;  3JR4 A;  1XMO M;  2HHH M;  1N77 A;  3FKE A;  3B9P A;  3GQ4 A;  1N78 A;  4HL4 A;  3AV0 A;  2XFS A;  2R4J A;  4IBB A;  4JYA M;  4LZZ A;  3M0E A;  5KPR A;  3RGP A;  2Q2E B;  3SYL A;  3KOX E;  4DUZ M;  4I5S A;  3U5Z B;  5BR8 M;  1R7R A;  5EP2 A;  4IBG A;  5EJC A;  1GL7 A;  2CV2 A;  1IQP A;  2P5T A;  3VKH A;  3AOE A;  4DR4 M;  4DV5 M;  3M6A A;  2EA0 A;  1R2Z A;  1NY5 A;  3KOY E;  3J7B A;  3GLG B;  3TWM A;  1KFV A;  4FWH A;  1IY2 A;  3NWL A;  1E94 E;  3GRR A;  2V6Z M;  1IN6 A;  2ZAO A;  4MGZ E;  5E26 A;  5ITX E;  1Q39 A;  4NSR A;  1TDZ A;  2QBY A;  1L1T A;  4BLC A;  3SHG B;  4DV1 M;  1NHW C;  2ZAN A;  1IY0 A;  3HKP A;  4LGM A;  2L7I A;  2XLJ A;  3J2P B;  4GC5 A;  4M0W A;  1IN5 A;  3W0L B;  7CAT A;  3U61 B;  3J80 S;  2DWM A;  2UUC M;  4B3S M;  1NNJ A;  3HHX A;  1G3I A;  3I4V A;  4S12 A;  4YY3 M;  2UXB M;  3GRU A;  1Z59 A;  2M5Z A;  2Y20 A;  5EP3 A;  3T1Y M;  2VII A;  2UUB M;  4OVZ A;  2UUA M;  3ZC7 B;  3DZD A;  1HR0 M;  4LG2 A;  5EXP A;  1JR3 D;  3GLH B;  3U6Q A;  2DXI A;  4L4U A;  3HHZ A;  3HHY A;  3E9S A;  3SAS A;  5KO3 A;  3AOG A;  2L09 A;  2A5Y B;  2L6O A;  2R45 A;  4GRI A;  1QZM A;  3A46 A;  1NNU C;  3TWL A;  3AFH A;  5JI2 E;  4DR5 M;  4FWG A;  5ITY A;  2M60 A;  2FNA A;  1QAN A;  3FYD A;  1EE8 A;  1N75 A;  5KPZ A;  1C1K A;  1T3T A;  2DWL A;  4QOZ C;  4WW0 A;  3RGS A;  1TGU A;  1WXQ A;  1ORY B;  4X64 M;  3KS8 A;  2F5N A;  3R8F A;  3GPU A;  3DFZ A;  1G4A E;  3CF6 E;  2C9O A;  4AKH A;  4JI1 M;  2G8L A;  2DZN B;  5EP4 A;  2XZF A;  3HU2 A;  4ITQ A;  3UMM A;  4B7F A;  2X4A A;  2XF3 A;  3JAM S;  3UZU A;  4FVM A;  2E5L M;  2RGH A;  1QVR A;  1HT2 E;  3IG5 A;  3DA1 A;  4LJ7 A;  1XWI A;  4IBK A;  3THG A;  3GLI A;  3PXG A;  5DNY A;  4NXN M;  5EXX A;  1GL6 A;  4DR2 M;  5ITQ A;  2R62 A;  5BPV A;  2KW0 A;  3UJN A;  1HNZ M;  1IY1 A;  4KO8 A;  4WUR A;  3VDU A;  3L27 A;  5LMN M;  4I4L A;  3K92 A;  5FTM A;  1S3S A;  3JR5 A;  8CAT A;  2YNM D;  3SMP A;  1MX0 A;  1J7K A;  3SC3 A;  2CV1 A;  1NJG A;  1OFH A;  1DGH B;  4QNM A;  4BBA A;  3GP1 A;  3I4Y A;  3FYC A;  3EIE A;  5GKN A;  4JI4 M;  2KZS A;  4NOO B;  3WHL A;  4B7H A;  1JQJ C;  2RKO A;  3HWS A;  2EO2 A;  4MB7 A;  2UU9 M;  4AZF A;  4JI0 M;  4DV6 M;  4LF7 M;  4MGI E;  4MH0 E;  2D7H A;  1QAO A;  3EIH A;  4NXM M;  4IBJ A;  1NY6 A;  1E9R A;  4B08 A;  3T1H M;  1NSF A;  1IBK M;  4XGI A;  3HHW A;  3GQ3 A;  2V1C A;  5FSW A;  4LF8 M;  5EQT A;  1HQC A;  3IG8 A;  1L8Q A;  3GLG A;  3FUU A;  4II7 A;  1IN7 A;  3W0F A;  1OFI A;  2XGN A;  5KPT A;  1N34 M;  4DV4 M;  4G4R A;  3HJS A;  3L2A A;  4YHH M;  2XSZ D;  2QEN A;  1SXJ A;  3HU3 A;  4AKG A;  4NRW A;  2X8A A;  4LJ9 A;  4LJA A;  2L7H A;  1G8P A;  4PT5 A;  1XMQ M;  2CHV A;  1R6B X;  3KOW E;  3FTF A;  2QP9 X;  2NQ8 C;  3U61 A;  2BJV A;  4LJ6 A;  1IBL M;  1JR3 A;  2FOI C;  4GHL A;  2I7N A;  3GQ5 A;  3HJ8 A;  3PFI A;  4LJ4 A;  3D8L A;  2Y0Q A;  3R9X B;  3FD9 A;  4NSO B;  2LXE A;  1LV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...