3VK8A

Crystal structure of dna-glycosylase bound to dna containing thymine glycol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PQGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase/dna
molecule keywords Probable formamidopyrimidine-DNA glycosylase
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vk8A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3vk8A01
4X66M 3U6LA 1FJGM 4X62M 4G4OA 4JI5M 1PM5A 4LFBM 1Z5BA 3U6MA 2OPFA 4LF7M 4JV5M 1Z5AA 4DV2M 4DR4M 3A46A 4DV6M 4GKJM 3GO8A 1Q3BA 4K0KM 1TDHA 3GPPA 1L1ZA 4B3TM 4NXMM 1N33M 1HNWM 3VK8A 2UXCM 2UXDM 5ITXA 4MB7A 2ZM6M 4G4NA 4DV1M 4KHPM 4DR5M 2UU9M 4DR7M 1Q39A 1N34M 4JI2M 4PDGA 2VQEM 3J80S 5ITYA 5IWAM 4DV3M 1IBLM 2HHHM 5ITXE 3SBJA 3TWMA 1J5EM 4DUZM 5A2QS 2XZUA 2UXBM 1MX0A 4OX9M 1NNJA 4LF9M 3U6EA 4NXNM 4CISA 4ITQA 5BR8M 3T1HM 4DV7M 1EE8A 2EA0A 1R2ZA 3A45A 2F5SA 1N32M 3VK7A 4PD2A 1N36M 1L2CA 2UUCM 3JR5A 4NRVA 2E5LM 3SARA 5ITUA 1IBMM 4DR1M 4LFCM 4PDIA 4JI3M 1K3XA 4NRWA 1Q3CA 3GQ3A 4LF8M 1Z5CA 3OTOM 3T1YM 3A42A 2F5OA 5ITTA 1XC8A 2VQFM 3SASA 4DV5M 1KFVA 3SAVA 3GQ4A 3GPYA 2XZFA 5ITRA 2HKJA 2UUAM 1HNXM 1R2YA 4LFAM 4X65M 4GKKM 3GP1A 4DV0M 4DUYM 5LMNM 1IBKM 3TWKA 2UUBM 1PJIA 4JI8M 4JI0M 1XNQM 3U6QA 3U6OA 3SAWA 3J7AS 4B3RM 3W0FA 3GQ5A 1K82A 5FLXS 4DR6M 3TWLA 1L2BA 4JI6M 2F5QA 2Q2EB 1L1TA 1K3WA 3SAUA 3DOAA 4X64M 2F5NA 1PJJA 4JI4M 3GPXA 4JI7M 5IT9S 4G4QA 4YY3M 1Z59A 1XMOM 1XMQM 4LF4M 1MU5A 1HNZM 2F5PA 4B3MM 4G4RA 4LF5M 3U6CA 4AQYM 3JR4A 3C58A 2ZBKB 2F4VM 1L2DA 3J81S 5ITQA 3U6PA 4JI1M 4PCZA 1XNRM 3U6DA 4DR2M 3SATA 1HR0M 4JYAM 4LF6M 5LMUM 3U6SA 3JAMS 4DV4M 3GPUA 2OQ4A 4B3SM 4DR3M 4YHHM 1TDZA 1I94M
chains in the Genus database with same CATH superfamily
2X8AA 4X66M 1NY5A 3GLHA 4LJ8A 3GLIB 1PM5A 4JI5M 4LFBM 3U6MA 2OPFA 1ZQ9A 1DV0A 3T38A 4IBEA 1YUBA 2KW0A 2JZ0A 3A46A 4GKJM 4WP2A 4NSOB 4K0KM 3GPPA 4QOSA 3FTFA 1PGYA 2LVNC 3L28A 5E26A 2UXDM 3FD9A 1ZV1A 4D81A 3FKEA 4F1IA 1YLAA 2EUCA 2CFOA 3IHPA 4P16A 4DV1M 2C9OA 3WHKA 1P3QQ 2HAKA 2LBCA 1N34M 3PNVA 2VQEM 4Z8XA 3J80S 2XGNA 5ITYA 3RGSA 1IN5A 4DV3M 1XXHB 3C3EA 4L78A 3FTCA 4BB9A 3DZDA 2XEPA 3HGIA 1J5EM 1E9RA 2XFTA 3E4RA 4DUZM 2MROB 3CTWB 4ANRA 2CP8A 3K9PA 2ERCA 1N77A 3QAUA 4CISA 5BR8M 4L8RC 1TH4A 5EXPA 2RGOA 2X4AA 1R2ZA 1L8QA 3HJSA 4LJ5A 2F5SA 1N36M 1VQ1A 1N32M 5C18A 1SG9A 3JR5A 4LJ9A 2LVPC 1DGFA 2XFSA 1GVNA 4GRIA 3GQ3A 1E32A 3T1YM 3A42A 3K1JA 1TH3A 3LCVB 3W67A 1G41A 4BLCA 4DBGB 4ZPXA 3RGPA 1NHGC 2NQ8C 1QAOA 2VF8A 2EJSA 2ZANA 3VDUA 2Y0QA 3SMPA 1A5TA 3D8BA 2XZFA 2RGHA 2HKJA 3C3DA 1HNXM 2UUAM 4LFAM 3LMMA 2DAEA 5DYGA 2QZ4A 3ZQJA 2DNAA 2WSFF 2XH9A 1WGNA 1IN8A 4A3VB 2DI0A 2KZUA 4GMQA 4G3OA 3SAWA 4WURA 2CE7A 3J7AS 3MK6A 5KPRA 4B3RM 2KA6B 2O5RA 2BWBA 4FCWA 3IG5A 4B7GA 5FLXS 3TWLA 3GQ5A 1K82A 2YFQA 1G3IA 4DR6M 3K8ZA 2F5QA 2XF3A 1SXJE 5KQ8A 2J7NA 3KOXE 3GLGB 1K3WA 1L1TA 1HT1E 1TF0B 2L09A 3DOAA 1PJJA 3B7NA 1V33A 2L7IA 4L6V6 2VDBB 2VF7A 3GPXA 3AV0A 2CV1A 2DWMA 2K6BA 1TTEA 3IECA 1NNUC 1NV8A 1QANA 1ZMVA 2APLA 3SYLA 1IN7A 3UZUA 1HNZM 1AIPC 2F5PA 2WZJA 1NJFA 1QAMA 3LCUA 3HJQA 3UK6A 4LRTA 4MGHA 1I4WA 3LQRA 1R6BX 3HY5A 3HU1A 1XXHE 4QNMA 4CIZA 4AKIA 4FD2A 1V92A 1DO2A 1L2DA 2QBYA 4QNRA 4JI1M 1DGHA 2DZNB 1SXJD 1J09A 4M9XA 1XNRM 3E9SA 4AG5A 5C1BA 4YHHM 4L15A 1HR0M 4AW4A 3A98B 1LV7A 4Y28F 2A5YB 4GITA 4LF6M 2LHGA 2GNOA 4AI6A 2MGWA 4CJ6A 3FYDA 3GPUA 3KS8A 3HHZA 1JQJC 1DGHB 4QHTA 4OW0A 5H37D 2C9CA 5L8RF 2KRKA 1I94M 3W68A 4OVZB 2CEAA 1FJGM 1YE9A 4X62M 1Z5BA 2R0IA 2C96A 2VIIA 3M6AA 3GRVA 2QQ8A 4GH9A 4LCBA 4DV6M 3I51A 1XWIA 4HL4A 1UM8A 4B3TM 4RKUF 1HNWM 3VK8A 2CV0A 2MH8A 1YSYA 4MB7A 1OIZA 1GO5A 3KXEC 4KHPM 1G71A 4DR7M 1Q39A 4MGYE 2ZAOA 2R45A 4HLQA 1G8PA 4UN2B 1FNNA 2DAKA 2CHVA 3V76A 3PNYA 4M9ZA 5A2QS 2JY7A 4Q7JA 2XZUA 2V6ZM 2X49A 3D8LA 2Y21A 1MX0A 3I04M 5KO3A 2LH0A 3U6EA 1WGLA 4LRSA 4LF9M 1WHCA 3Q8GA 4ITQA 4I81A 1GL7A 1EE8A 4DV7M 2DAGA 3SHFA 2R4JA 1PJTA 1L2CA 1LTMA 3U5ZB 1ZMUA 3H4MA 4MGKE 3H4JA 1HJPA 1QVRA 2V1CA 2L7HA 1Q3CA 3C9PA 3GRUA 2DWLA 1R5LA 2JY6B 4AZFA 3L25A 1XC8A 2CRUA 3KSJA 2Y0TA 3AL0C 2VQFM 3I4YA 1OAOC 1ORYB 2LTUA 1NY6A 2KZSA 3RFWA 2CHQA 2P5TA 1GJTA 1BVSA 2Z7JA 2R65A 4RNAA 3TE6A 4AKHA 1R2YA 4X65M 3MHVC 1TH2A 4DV0M 4DUYM 3WHLA 3KFUG 2M5ZA 5LMNM 3HU2A 3DA1A 3J2PB 1CUKA 2UUBM 3TWKA 8CATA 1VDLA 4JI0M 1OFHA 3UGJA 4JI8M 2KXEA 2I7PA 3QWLA 3KP0E 3AFHA 4F2LA 1L2BA 4QHSA 4IBKA 3SYKA 1OAIA 2MR9A 3FTEA 1Z6TA 2F5NA 2LVAA 2DXIA 4M0WA 4IBDA 3GLFE 3VDPA 1D0LA 4JI7M 1D2NA 2QBYB 4HEOA 5FTKA 7CATA 3R8FA 1GJSA 1IXZA 2QP9X 4GC5A 4MGZE 4LY6A 3PXGA 1N75A 4II7A 2JNHA 1N78A 1OQYA 4XGIA 4CGYB 5KPZA 4R71A 1S3SA 3HZJA 2WSCF 3JR4A 2O25A 3GLHE 1HQCA 3K2LA 1SXJB 3CF2A 2C5RA 3I01M 3B9PA 2V1UA 3VKGA 2QENA 3M0EA 2LNHC 4JN6A 4R3DA 3HHYA 1NVMA 1QYRA 2OOBA 4R7GA 1QZEA 1EIJA 4EIWA 3ZC7B 4KODA 4S12A 4JYAM 4FCVA 3L26A 3U6SA 3T6PA 5JI2E 2Z4SA 5KPTA 2OQ4A 4M0DA 4B3SM 3TQSA 4GC9A 1DGGA 4IBFA 4DR3M 1TDZA 2K0BX 3SC3A 2DVWB 3K9OA 2LVOC 5FTMA 4G4OA 2N35A 4JV5M 1D0KA 2QNJA 1G4AE 2RKOA 3KS4A 2YR0A 1VEGA 3GO8A 3CGWA 1TDHA 5EP1A 1SXJA 1L1ZA 4NXMM 4GHLA 2D7HA 1OIPA 1OKSA 1QQWA 2W82A 1GABA 3HX3A 1DO0A 1VG5A 2R62A 3E46A 2LVQD 4OVZA 3U61A 2JXNA 4DR5M 2OOAA 4JI2M 3HU3A 3DFZA 1EFUB 5IWAM 3UMMA 1H6UA 4AKGA 2I7NA 5DFLA 3FUXA 2CV2A 1IBLM 2G5GX 1V34A 4FWDA 4L4UA 4IIWA 4B08A 2BJVA 3CF6E 3LQQA 3TWMA 3SBJA 2HHHM 3AOEA 4D82A 3QYBA 4I5SA 1OJLA 4XBOA 1QZMA 2L6OA 1NNJA 2CHGA 3FUUA 1MN3A 1JB0F 1XXHA 3L27A 4GIPA 5DNYA 2CUZA 2FS1A 3A45A 4PT5A 4WW0A 3VK7A 4MM3B 1C7YA 2UUCM 4LZJA 3SARA 5ITUA 3PFIA 3UJNA 4KLNA 4PDIA 1IXSA 2KNZA 3QYEA 1Z5CA 3OTOM 4B7FA 2ZTDA 4REZA 5ITTA 2LWXA 4DV5M 1KFVA 4LZZA 2G8LA 3FRIA 1WIVA 3SAVA 1JR3A 3TPZA 3AOGA 3GQ4A 2KNVA 3CF0A 4BBAA 5FSWA 5EXTA 5FTNA 2KEBA 2HL7A 1DGBA 3GP1A 3THGA 3J7BA 3KOZE 4RF0A 3F92A 1W5TA 2WSEF 4W5WA 2B3TA 1WXQA 2DHRA 3MMPA 1IBKM 1XNQM 3U6OA 1GL6A 3FE3A 2R18A 5IREB 1IXSB 2JA2A 3W0FA 2HWJA 3HKPA 2XSZD 2M60A 1QUTA 4P17A 1MJGM 4LJ6A 4LG2A 2R44A 3K92A 3SAUA 4FCTA 3BOSA 3L2AA 4X64M 4JI4M 4IJEA 3HWSA 4FWGA 4LGMA 3GLHB 5FTLA 3FTDA 1Z59A 3HHXA 1XMOM 2L4FA 3B7QA 2HCBA 3LVWA 3T15A 1XMQM 2L4EA 3NBIA 2QCUA 2BWEA 3GLFA 4B3MM 3B89A 3VLFB 2GQFA 1QDTA 2DZLA 1RU3A 1GKIA 2EKKA 1T43A 3C58A 5EXXA 1E94E 4AG6A 5IZ7D 4NC6A 2ZBKB 4GEWA 1ZAEA 3RE8A 1NV9A 3VKHA 3U6PA 3KP1E 2O01F 1D0MA 1OFIA 1Y8GA 3U6DA 4DR2M 3SATA 4QOZC 3U60B 1T3TA 1R7RA 3AOEC 3JAMS 1TR8A 4DV4M 2KNAA 1NJGA 3VFDA 1JR3D 4TUWA 1XB2B 2YNMD 4MH0E 2FFJA 4OU7A 1W5SA 4L16A 3U6LA 3IG8A 2JY5A 4M9SA 1J7KA 1G59A 2FH0A 3SHGB 3I4VA 4NL4H 1Z5AA 4LF7M 4DV2M 4DR4M 2KDLA 1Q3BA 2DHYA 1HQYE 5FTJA 3TL4X 1N33M 1QAQA 4IJFA 2UXCM 4Z6YA 1VEJA 2DKLA 5ITXA 2ZM6M 4G4NA 2BNKA 3W0LB 3B74A 3GRRA 2DZOB 3U60A 2UU9M 4GHAA 4PDGA 1VDDA 3SFZA 3B7ZA 2DAMA 5KQDA 1PJQA 2C99A 2QHOB 3EIEA 3HHWA 4FWHA 3GLGA 5ITXE 4G4QA 2ZAMA 1KYIA 2Y20A 2J5YA 1C1KA 1IY2A 2JWSA 3PVSA 3LW5F 3EIHA 5E6JA 2DWNA 4XK8F 1X37A 2UXBM 4RF1A 3ILKA 4KO8A 5EP3A 4OX9M 3R9XB 4LGYA 4IBJA 3GLFB 4CHTB 4KT0F 4NXNM 3T1HM 2DAIA 2G3QA 3ZH9B 2EA0A 3FUVA 1VEKA 4PD2A 2E5LM 3M7GA 4NRVA 3FRHA 2L2DA 1IBMM 1R4GA 4DR1M 4IBCA 4LFCM 1WJ7A 2JZ1A 4JI3M 1K3XA 4NRWA 4LF8M 3GLGE 4NOOB 3KVWA 2F5OA 2QPAA 3E21A 2Z4RA 1IFYA 3SASA 2R6FA 3HJ8A 1IM2A 2MJ5B 2DENA 1PJSA 3FUWA 1IN6A 3KDSE 1Q02A 2KRUA 5EP2A 3NWLA 1WR1B 2YQZA 3GPYA 1GLNA 5ITRA 2H1RA 2JY8A 1SXJC 4GKKM 1IY0A 2XLJA 2DWZB 1XHBA 4I4LA 3U5ZA 4LJ4A 1KSFX 2FNAA 1PJIA 2FOIC 2H5XA 3BXWA 4FW9A 3U6QA 3U61B 3KOYE 3Q8XA 2KHHA 2K9DA 3GRYA 4JI6M 2JP7A 3L29A 1ZMWA 2EKFA 1AUAA 2Q2EB 2K47A 2ZTCA 3LVVA 2XSZA 2CWBA 5EJCA 3J27B 3KW6A 5EXSA 1T6OA 5F3WA 3NBXX 5IT9S 3GLIE 4YY3M 1UFZA 2R4EA 4LF4M 1QDRA 1MU5A 3ZCBB 3BBZA 3AJIB 4LJ7A 4G4RA 1IN4A 4IBBA 2JUJA 3SMSA 2QSFX 1QUSA 4LF5M 4G6ZA 4B7HA 3U6CA 1OTRA 3KOWE 1JR3E 4JXJA 4LJAA 4AQYM 3KSXA 1NO1A 5EP4A 3MJ5A 2J7OA 5BPVA 5EQTA 2F4VM 4I8OA 3AKZA 1TGUA 2LHCA 5ITQA 3J81S 2AHMA 1IQPA 4MGIE 2C98A 4PCZA 4IBIA 5JI3E 2FE8A 2RRUA 1F4IA 2OO9A 1HT2E 4IBGA 4D80A 3GLIA 1NHWC 1E9SA 4NSRA 5LMUM 2Z8YM 2BJWA 2D7EA 4FVMA 2R46A 2LXEA 2D7GA 1PRBA 3FYCA 5GKNA 1IY1A 2Z3XA 1NSFA 2EO2A 3FUTA 5DYIA 1IXRC
chains in the Genus database with same CATH topology
2X8AA 4X66M 1NY5A 3GLHA 4LJ8A 3GLIB 1PM5A 4JI5M 4LFBM 3U6MA 2OPFA 1ZQ9A 3T38A 4IBEA 1YUBA 2KW0A 3A46A 4GKJM 4NSOB 4K0KM 3GPPA 4QOSA 3FTFA 5E26A 3L28A 2UXDM 3FD9A 4D81A 3FKEA 2EUCA 2CFOA 4P16A 4DV1M 2C9OA 3WHKA 1N34M 3PNVA 2VQEM 4Z8XA 3J80S 2XGNA 5ITYA 3RGSA 1IN5A 4DV3M 1XXHB 4L78A 4BB9A 3FTCA 3DZDA 2XEPA 3HGIA 1J5EM 1E9RA 2XFTA 3E4RA 4DUZM 3CTWB 2ERCA 1N77A 3QAUA 4CISA 5BR8M 4L8RC 1TH4A 5EXPA 2RGOA 2X4AA 1R2ZA 1L8QA 3HJSA 4LJ5A 2F5SA 1N36M 1N32M 5C18A 3JR5A 4LJ9A 1DGFA 2XFSA 1GVNA 4GRIA 3GQ3A 1E32A 3T1YM 3A42A 3K1JA 1TH3A 4BLCA 1G41A 4ZPXA 3RGPA 1NHGC 2NQ8C 1QAOA 2ZANA 3VDUA 2Y0QA 3SMPA 3D8BA 2XZFA 2RGHA 2HKJA 2UUAM 1HNXM 4LFAM 3LMMA 5DYGA 2QZ4A 4A3VB 2XH9A 1IN8A 2KZUA 4GMQA 3SAWA 4WURA 2CE7A 3J7AS 3MK6A 5KPRA 4B3RM 2KA6B 2O5RA 4FCWA 4B7GA 3IG5A 5FLXS 3GQ5A 3TWLA 1K82A 4DR6M 2YFQA 1G3IA 3K8ZA 2F5QA 2XF3A 1SXJE 5KQ8A 2J7NA 3KOXE 3GLGB 1K3WA 1L1TA 1HT1E 2L09A 3DOAA 1PJJA 2L7IA 3GPXA 3AV0A 2CV1A 2DWMA 4G4QA 3UZUA 4TUWA 1NNUC 1QANA 3SYLA 1IN7A 1HNZM 2F5PA 1NJFA 1QAMA 3HJQA 3UK6A 4LRTA 4MGHA 1I4WA 3LQRA 1R6BX 3HU1A 4QNMA 4AKIA 4FD2A 1DO2A 1L2DA 2QBYA 4QNRA 4JI1M 1DGHA 2DZNB 1SXJD 1J09A 4M9XA 1XNRM 3E9SA 4AG5A 5C1BA 4YHHM 4L15A 1HR0M 4AW4A 3A98B 1LV7A 4LF6M 2A5YB 4GITA 4AI6A 3FYDA 3GPUA 3KS8A 3HHZA 1JQJC 1DGHB 4QHTA 4OW0A 5H37D 2C9CA 2KRKA 1I94M 4OVZB 2CEAA 1FJGM 1YE9A 4X62M 1Z5BA 2C96A 2VIIA 3M6AA 3GRVA 4GH9A 4LCBA 4DV6M 3I51A 1XWIA 4HL4A 1UM8A 4B3TM 1HNWM 3VK8A 2CV0A 1YSYA 4MB7A 3KXEC 4KHPM 4DR7M 1Q39A 4MGYE 2ZAOA 2R45A 4HLQA 1G8PA 1FNNA 2CHVA 3PNYA 4M9ZA 5A2QS 2XZUA 2V6ZM 2X49A 3D8LA 2Y21A 1MX0A 5KO3A 2LH0A 3U6EA 4LRSA 4LF9M 4ITQA 4I81A 1GL7A 1EE8A 4DV7M 3SHFA 2R4JA 1L2CA 3U5ZB 3H4MA 4MGKE 1QVRA 2V1CA 2L7HA 1Q3CA 3GRUA 2DWLA 4AZFA 3L25A 1XC8A 3AL0C 3KSJA 2Y0TA 2VQFM 3I4YA 1ORYB 1NY6A 2KZSA 3RFWA 2CHQA 2P5TA 2Z7JA 2R65A 4RNAA 3TE6A 4AKHA 1R2YA 4X65M 3MHVC 1TH2A 4DV0M 4DUYM 3WHLA 3KFUG 2M5ZA 5LMNM 3HU2A 3DA1A 3J2PB 2UUBM 3TWKA 8CATA 4JI8M 4JI0M 1OFHA 3UGJA 2KXEA 2I7PA 3QWLA 3KP0E 3AFHA 1L2BA 4QHSA 4IBKA 3SYKA 3FTEA 1Z6TA 2F5NA 2DXIA 4M0WA 4IBDA 3VDPA 4JI7M 1D2NA 2QBYB 5FTKA 7CATA 3R8FA 1IXZA 2QP9X 4GC5A 4MGZE 4LY6A 3PXGA 1N75A 4II7A 1N78A 4XGIA 4CGYB 5KPZA 1S3SA 3JR4A 1HQCA 3K2LA 1SXJB 3CF2A 2C5RA 3VKGA 3B9PA 2V1UA 3M0EA 2QENA 2LNHC 4JN6A 4R3DA 3HHYA 1NVMA 1QYRA 4R7GA 4EIWA 3ZC7B 4KODA 4S12A 4JYAM 4FCVA 3L26A 3U6SA 5JI2E 2Z4SA 5KPTA 2OQ4A 4M0DA 4B3SM 3TQSA 4GC9A 1DGGA 4IBFA 4DR3M 1TDZA 3SC3A 2DVWB 5FTMA 4G4OA 4JV5M 1G4AE 2RKOA 3KS4A 2YR0A 3GO8A 1TDHA 5EP1A 1SXJA 1L1ZA 4NXMM 4GHLA 2D7HA 1QQWA 2W82A 1DO0A 2R62A 4OVZA 3U61A 4DR5M 4JI2M 3HU3A 3DFZA 5IWAM 3UMMA 1H6UA 4AKGA 2I7NA 3FUXA 2CV2A 1IBLM 2G5GX 4FWDA 4L4UA 2HHHM 4IIWA 4B08A 2BJVA 3CF6E 3LQQA 3TWMA 3SBJA 3AOEA 4D82A 4I5SA 1OJLA 4XBOA 1QZMA 2L6OA 1NNJA 2CHGA 3FUUA 3L27A 1XXHA 4GIPA 5DNYA 2CUZA 3A45A 4PT5A 4WW0A 3VK7A 4MM3B 2UUCM 4LZJA 3SARA 5ITUA 3PFIA 3UJNA 4KLNA 4PDIA 1Z5CA 3OTOM 4B7FA 4REZA 5ITTA 2LWXA 4DV5M 1KFVA 4LZZA 2G8LA 3SAVA 1JR3A 3TPZA 3AOGA 3GQ4A 3CF0A 4BBAA 5FSWA 5EXTA 5FTNA 2KEBA 2HL7A 1DGBA 3GP1A 3THGA 3J7BA 3KOZE 4RF0A 1W5TA 4W5WA 1WXQA 2DHRA 1IBKM 1XNQM 3U6OA 1GL6A 2R18A 5IREB 1IXSB 2JA2A 3W0FA 3HKPA 2XSZD 2M60A 4LJ6A 4LG2A 3K92A 3SAUA 4FCTA 3BOSA 3L2AA 4X64M 4JI4M 4IJEA 3HWSA 4FWGA 4LGMA 3GLHB 5FTLA 3FTDA 1Z59A 3HHXA 1XMOM 1XMQM 3LVWA 2HCBA 3T15A 3NBIA 2QCUA 3GLFA 4B3MM 3VLFB 1GKIA 3C58A 5EXXA 1E94E 4AG6A 5IZ7D 2ZBKB 1ZAEA 3RE8A 3VKHA 3U6PA 3KP1E 1OFIA 3U6DA 4DR2M 3SATA 4QOZC 3U60B 1T3TA 1R7RA 3AOEC 3JAMS 4DV4M 1NJGA 3VFDA 1JR3D 2YNMD 4MH0E 2FFJA 4OU7A 1W5SA 4L16A 3U6LA 3IG8A 4M9SA 1J7KA 1G59A 3SHGB 4LF7M 3I4VA 4NL4H 1Z5AA 4DV2M 4DR4M 1Q3BA 1HQYE 5FTJA 3TL4X 1N33M 1QAQA 4IJFA 2UXCM 4Z6YA 5ITXA 2ZM6M 4G4NA 2BNKA 3W0LB 3GRRA 2DZOB 3U60A 2UU9M 4GHAA 4PDGA 1VDDA 3SFZA 5KQDA 2C99A 3EIEA 3HHWA 3GLGA 4FWHA 5ITXE 2ZAMA 1KYIA 2Y20A 1C1KA 1IY2A 3PVSA 3EIHA 5E6JA 2DWNA 1X37A 2UXBM 4RF1A 3ILKA 4KO8A 5EP3A 4OX9M 3R9XB 4LGYA 4IBJA 3GLFB 4CHTB 4NXNM 3T1HM 3ZH9B 2EA0A 3FUVA 4PD2A 2E5LM 3M7GA 4NRVA 1IBMM 4DR1M 4IBCA 4LFCM 4JI3M 1K3XA 4NRWA 4LF8M 4NOOB 3KVWA 2F5OA 2QPAA 2Z4RA 3SASA 3HJ8A 1IM2A 3FUWA 1IN6A 3KDSE 2KRUA 5EP2A 3NWLA 2YQZA 3GPYA 1GLNA 5ITRA 2H1RA 4GKKM 1SXJC 1IY0A 2XLJA 2DWZB 1XHBA 4I4LA 3U5ZA 4LJ4A 1KSFX 2FNAA 1PJIA 2FOIC 3U6QA 4FW9A 3U61B 3KOYE 3Q8XA 3GRYA 4JI6M 3L29A 2Q2EB 2K47A 3LVVA 2XSZA 5EJCA 3J27B 3KW6A 5EXSA 5F3WA 5IT9S 4YY3M 2R4EA 4LF4M 1MU5A 3ZCBB 3AJIB 4LJ7A 4G4RA 1IN4A 4IBBA 3SMSA 4LF5M 4G6ZA 4B7HA 3U6CA 3KOWE 4JXJA 4LJAA 4AQYM 3KSXA 5EP4A 3MJ5A 2J7OA 5BPVA 5EQTA 2F4VM 4I8OA 3AKZA 1TGUA 5ITQA 3J81S 2AHMA 1IQPA 4MGIE 2C98A 4PCZA 4IBIA 5JI3E 2FE8A 1HT2E 4IBGA 4D80A 3GLIA 1NHWC 1E9SA 4NSRA 5LMUM 2BJWA 2D7EA 4FVMA 2R46A 2LXEA 2D7GA 3FYCA 5GKNA 2Z3XA 1IY1A 1NSFA 2EO2A 3FUTA 5DYIA 1IXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 M;  3U6L A;  1FJG M;  4X62 M;  4G4O A;  4JI5 M;  1PM5 A;  4LFB M;  1Z5B A;  3U6M A;  2OPF A;  4LF7 M;  4JV5 M;  1Z5A A;  4DV2 M;  4DR4 M;  3A46 A;  4DV6 M;  4GKJ M;  3GO8 A;  1Q3B A;  4K0K M;  1TDH A;  3GPP A;  1L1Z A;  4B3T M;  4NXM M;  1N33 M;  1HNW M;  3VK8 A;  2UXC M;  2UXD M;  5ITX A;  4MB7 A;  2ZM6 M;  4G4N A;  4DV1 M;  4KHP M;  4DR5 M;  2UU9 M;  4DR7 M;  1Q39 A;  1N34 M;  4JI2 M;  4PDG A;  2VQE M;  3J80 S;  5ITY A;  5IWA M;  4DV3 M;  1IBL M;  2HHH M;  5ITX E;  3SBJ A;  3TWM A;  1J5E M;  4DUZ M;  5A2Q S;  2XZU A;  2UXB M;  1MX0 A;  4OX9 M;  1NNJ A;  4LF9 M;  3U6E A;  4NXN M;  4CIS A;  4ITQ A;  5BR8 M;  3T1H M;  4DV7 M;  1EE8 A;  2EA0 A;  1R2Z A;  3A45 A;  2F5S A;  1N32 M;  3VK7 A;  4PD2 A;  1N36 M;  1L2C A;  2UUC M;  3JR5 A;  4NRV A;  2E5L M;  3SAR A;  5ITU A;  1IBM M;  4DR1 M;  4LFC M;  4PDI A;  4JI3 M;  1K3X A;  4NRW A;  1Q3C A;  3GQ3 A;  4LF8 M;  1Z5C A;  3OTO M;  3T1Y M;  3A42 A;  2F5O A;  5ITT A;  1XC8 A;  2VQF M;  3SAS A;  4DV5 M;  1KFV A;  3SAV A;  3GQ4 A;  3GPY A;  2XZF A;  5ITR A;  2HKJ A;  2UUA M;  1HNX M;  1R2Y A;  4LFA M;  4X65 M;  4GKK M;  3GP1 A;  4DV0 M;  4DUY M;  5LMN M;  1IBK M;  3TWK A;  2UUB M;  1PJI A;  4JI8 M;  4JI0 M;  1XNQ M;  3U6Q A;  3U6O A;  3SAW A;  3J7A S;  4B3R M;  3W0F A;  3GQ5 A;  1K82 A;  5FLX S;  4DR6 M;  3TWL A;  1L2B A;  4JI6 M;  2F5Q A;  2Q2E B;  1L1T A;  1K3W A;  3SAU A;  3DOA A;  4X64 M;  2F5N A;  1PJJ A;  4JI4 M;  3GPX A;  4JI7 M;  5IT9 S;  4G4Q A;  4YY3 M;  1Z59 A;  1XMO M;  1XMQ M;  4LF4 M;  1MU5 A;  1HNZ M;  2F5P A;  4B3M M;  4G4R A;  4LF5 M;  3U6C A;  4AQY M;  3JR4 A;  3C58 A;  2ZBK B;  2F4V M;  1L2D A;  3J81 S;  5ITQ A;  3U6P A;  4JI1 M;  4PCZ A;  1XNR M;  3U6D A;  4DR2 M;  3SAT A;  1HR0 M;  4JYA M;  4LF6 M;  5LMU M;  3U6S A;  3JAM S;  4DV4 M;  3GPU A;  2OQ4 A;  4B3S M;  4DR3 M;  4YHH M;  1TDZ A;  1I94 M; 
#chains in the Genus database with same CATH topology
 2X8A A;  4X66 M;  1NY5 A;  3GLH A;  4LJ8 A;  3GLI B;  1PM5 A;  4JI5 M;  4LFB M;  3U6M A;  2OPF A;  1ZQ9 A;  1DV0 A;  3T38 A;  4IBE A;  1YUB A;  2KW0 A;  2JZ0 A;  3A46 A;  4GKJ M;  4WP2 A;  4NSO B;  4K0K M;  3GPP A;  4QOS A;  3FTF A;  1PGY A;  2LVN C;  3L28 A;  5E26 A;  2UXD M;  3FD9 A;  1ZV1 A;  4D81 A;  3FKE A;  4F1I A;  1YLA A;  2EUC A;  2CFO A;  3IHP A;  4P16 A;  4DV1 M;  2C9O A;  3WHK A;  1P3Q Q;  2HAK A;  2LBC A;  1N34 M;  3PNV A;  2VQE M;  4Z8X A;  3J80 S;  2XGN A;  5ITY A;  3RGS A;  1IN5 A;  4DV3 M;  1XXH B;  3C3E A;  4L78 A;  3FTC A;  4BB9 A;  3DZD A;  2XEP A;  3HGI A;  1J5E M;  1E9R A;  2XFT A;  3E4R A;  4DUZ M;  2MRO B;  3CTW B;  4ANR A;  2CP8 A;  3K9P A;  2ERC A;  1N77 A;  3QAU A;  4CIS A;  5BR8 M;  4L8R C;  1TH4 A;  5EXP A;  2RGO A;  2X4A A;  1R2Z A;  1L8Q A;  3HJS A;  4LJ5 A;  2F5S A;  1N36 M;  1VQ1 A;  1N32 M;  5C18 A;  1SG9 A;  3JR5 A;  4LJ9 A;  2LVP C;  1DGF A;  2XFS A;  1GVN A;  4GRI A;  3GQ3 A;  1E32 A;  3T1Y M;  3A42 A;  3K1J A;  1TH3 A;  3LCV B;  3W67 A;  1G41 A;  4BLC A;  4DBG B;  4ZPX A;  3RGP A;  1NHG C;  2NQ8 C;  1QAO A;  2VF8 A;  2EJS A;  2ZAN A;  3VDU A;  2Y0Q A;  3SMP A;  1A5T A;  3D8B A;  2XZF A;  2RGH A;  2HKJ A;  3C3D A;  1HNX M;  2UUA M;  4LFA M;  3LMM A;  2DAE A;  5DYG A;  2QZ4 A;  3ZQJ A;  2DNA A;  2WSF F;  2XH9 A;  1WGN A;  1IN8 A;  4A3V B;  2DI0 A;  2KZU A;  4GMQ A;  4G3O A;  3SAW A;  4WUR A;  2CE7 A;  3J7A S;  3MK6 A;  5KPR A;  4B3R M;  2KA6 B;  2O5R A;  2BWB A;  4FCW A;  3IG5 A;  4B7G A;  5FLX S;  3TWL A;  3GQ5 A;  1K82 A;  2YFQ A;  1G3I A;  4DR6 M;  3K8Z A;  2F5Q A;  2XF3 A;  1SXJ E;  5KQ8 A;  2J7N A;  3KOX E;  3GLG B;  1K3W A;  1L1T A;  1HT1 E;  1TF0 B;  2L09 A;  3DOA A;  1PJJ A;  3B7N A;  1V33 A;  2L7I A;  4L6V 6;  2VDB B;  2VF7 A;  3GPX A;  3AV0 A;  2CV1 A;  2DWM A;  2K6B A;  1TTE A;  3IEC A;  1NNU C;  1NV8 A;  1QAN A;  1ZMV A;  2APL A;  3SYL A;  1IN7 A;  3UZU A;  1HNZ M;  1AIP C;  2F5P A;  2WZJ A;  1NJF A;  1QAM A;  3LCU A;  3HJQ A;  3UK6 A;  4LRT A;  4MGH A;  1I4W A;  3LQR A;  1R6B X;  3HY5 A;  3HU1 A;  1XXH E;  4QNM A;  4CIZ A;  4AKI A;  4FD2 A;  1V92 A;  1DO2 A;  1L2D A;  2QBY A;  4QNR A;  4JI1 M;  1DGH A;  2DZN B;  1SXJ D;  1J09 A;  4M9X A;  1XNR M;  3E9S A;  4AG5 A;  5C1B A;  4YHH M;  4L15 A;  1HR0 M;  4AW4 A;  3A98 B;  1LV7 A;  4Y28 F;  2A5Y B;  4GIT A;  4LF6 M;  2LHG A;  2GNO A;  4AI6 A;  2MGW A;  4CJ6 A;  3FYD A;  3GPU A;  3KS8 A;  3HHZ A;  1JQJ C;  1DGH B;  4QHT A;  4OW0 A;  5H37 D;  2C9C A;  5L8R F;  2KRK A;  1I94 M;  3W68 A;  4OVZ B;  2CEA A;  1FJG M;  1YE9 A;  4X62 M;  1Z5B A;  2R0I A;  2C96 A;  2VII A;  3M6A A;  3GRV A;  2QQ8 A;  4GH9 A;  4LCB A;  4DV6 M;  3I51 A;  1XWI A;  4HL4 A;  1UM8 A;  4B3T M;  4RKU F;  1HNW M;  3VK8 A;  2CV0 A;  2MH8 A;  1YSY A;  4MB7 A;  1OIZ A;  1GO5 A;  3KXE C;  4KHP M;  1G71 A;  4DR7 M;  1Q39 A;  4MGY E;  2ZAO A;  2R45 A;  4HLQ A;  1G8P A;  4UN2 B;  1FNN A;  2DAK A;  2CHV A;  3V76 A;  3PNY A;  4M9Z A;  5A2Q S;  2JY7 A;  4Q7J A;  2XZU A;  2V6Z M;  2X49 A;  3D8L A;  2Y21 A;  1MX0 A;  3I04 M;  5KO3 A;  2LH0 A;  3U6E A;  1WGL A;  4LRS A;  4LF9 M;  1WHC A;  3Q8G A;  4ITQ A;  4I81 A;  1GL7 A;  1EE8 A;  4DV7 M;  2DAG A;  3SHF A;  2R4J A;  1PJT A;  1L2C A;  1LTM A;  3U5Z B;  1ZMU A;  3H4M A;  4MGK E;  3H4J A;  1HJP A;  1QVR A;  2V1C A;  2L7H A;  1Q3C A;  3C9P A;  3GRU A;  2DWL A;  1R5L A;  2JY6 B;  4AZF A;  3L25 A;  1XC8 A;  2CRU A;  3KSJ A;  2Y0T A;  3AL0 C;  2VQF M;  3I4Y A;  1OAO C;  1ORY B;  2LTU A;  1NY6 A;  2KZS A;  3RFW A;  2CHQ A;  2P5T A;  1GJT A;  1BVS A;  2Z7J A;  2R65 A;  4RNA A;  3TE6 A;  4AKH A;  1R2Y A;  4X65 M;  3MHV C;  1TH2 A;  4DV0 M;  4DUY M;  3WHL A;  3KFU G;  2M5Z A;  5LMN M;  3HU2 A;  3DA1 A;  3J2P B;  1CUK A;  2UUB M;  3TWK A;  8CAT A;  1VDL A;  4JI0 M;  1OFH A;  3UGJ A;  4JI8 M;  2KXE A;  2I7P A;  3QWL A;  3KP0 E;  3AFH A;  4F2L A;  1L2B A;  4QHS A;  4IBK A;  3SYK A;  1OAI A;  2MR9 A;  3FTE A;  1Z6T A;  2F5N A;  2LVA A;  2DXI A;  4M0W A;  4IBD A;  3GLF E;  3VDP A;  1D0L A;  4JI7 M;  1D2N A;  2QBY B;  4HEO A;  5FTK A;  7CAT A;  3R8F A;  1GJS A;  1IXZ A;  2QP9 X;  4GC5 A;  4MGZ E;  4LY6 A;  3PXG A;  1N75 A;  4II7 A;  2JNH A;  1N78 A;  1OQY A;  4XGI A;  4CGY B;  5KPZ A;  4R71 A;  1S3S A;  3HZJ A;  2WSC F;  3JR4 A;  2O25 A;  3GLH E;  1HQC A;  3K2L A;  1SXJ B;  3CF2 A;  2C5R A;  3I01 M;  3B9P A;  2V1U A;  3VKG A;  2QEN A;  3M0E A;  2LNH C;  4JN6 A;  4R3D A;  3HHY A;  1NVM A;  1QYR A;  2OOB A;  4R7G A;  1QZE A;  1EIJ A;  4EIW A;  3ZC7 B;  4KOD A;  4S12 A;  4JYA M;  4FCV A;  3L26 A;  3U6S A;  3T6P A;  5JI2 E;  2Z4S A;  5KPT A;  2OQ4 A;  4M0D A;  4B3S M;  3TQS A;  4GC9 A;  1DGG A;  4IBF A;  4DR3 M;  1TDZ A;  2K0B X;  3SC3 A;  2DVW B;  3K9O A;  2LVO C;  5FTM A;  4G4O A;  2N35 A;  4JV5 M;  1D0K A;  2QNJ A;  1G4A E;  2RKO A;  3KS4 A;  2YR0 A;  1VEG A;  3GO8 A;  3CGW A;  1TDH A;  5EP1 A;  1SXJ A;  1L1Z A;  4NXM M;  4GHL A;  2D7H A;  1OIP A;  1OKS A;  1QQW A;  2W82 A;  1GAB A;  3HX3 A;  1DO0 A;  1VG5 A;  2R62 A;  3E46 A;  2LVQ D;  4OVZ A;  3U61 A;  2JXN A;  4DR5 M;  2OOA A;  4JI2 M;  3HU3 A;  3DFZ A;  1EFU B;  5IWA M;  3UMM A;  1H6U A;  4AKG A;  2I7N A;  5DFL A;  3FUX A;  2CV2 A;  1IBL M;  2G5G X;  1V34 A;  4FWD A;  4L4U A;  4IIW A;  4B08 A;  2BJV A;  3CF6 E;  3LQQ A;  3TWM A;  3SBJ A;  2HHH M;  3AOE A;  4D82 A;  3QYB A;  4I5S A;  1OJL A;  4XBO A;  1QZM A;  2L6O A;  1NNJ A;  2CHG A;  3FUU A;  1MN3 A;  1JB0 F;  1XXH A;  3L27 A;  4GIP A;  5DNY A;  2CUZ A;  2FS1 A;  3A45 A;  4PT5 A;  4WW0 A;  3VK7 A;  4MM3 B;  1C7Y A;  2UUC M;  4LZJ A;  3SAR A;  5ITU A;  3PFI A;  3UJN A;  4KLN A;  4PDI A;  1IXS A;  2KNZ A;  3QYE A;  1Z5C A;  3OTO M;  4B7F A;  2ZTD A;  4REZ A;  5ITT A;  2LWX A;  4DV5 M;  1KFV A;  4LZZ A;  2G8L A;  3FRI A;  1WIV A;  3SAV A;  1JR3 A;  3TPZ A;  3AOG A;  3GQ4 A;  2KNV A;  3CF0 A;  4BBA A;  5FSW A;  5EXT A;  5FTN A;  2KEB A;  2HL7 A;  1DGB A;  3GP1 A;  3THG A;  3J7B A;  3KOZ E;  4RF0 A;  3F92 A;  1W5T A;  2WSE F;  4W5W A;  2B3T A;  1WXQ A;  2DHR A;  3MMP A;  1IBK M;  1XNQ M;  3U6O A;  1GL6 A;  3FE3 A;  2R18 A;  5IRE B;  1IXS B;  2JA2 A;  3W0F A;  2HWJ A;  3HKP A;  2XSZ D;  2M60 A;  1QUT A;  4P17 A;  1MJG M;  4LJ6 A;  4LG2 A;  2R44 A;  3K92 A;  3SAU A;  4FCT A;  3BOS A;  3L2A A;  4X64 M;  4JI4 M;  4IJE A;  3HWS A;  4FWG A;  4LGM A;  3GLH B;  5FTL A;  3FTD A;  1Z59 A;  3HHX A;  1XMO M;  2L4F A;  3B7Q A;  2HCB A;  3LVW A;  3T15 A;  1XMQ M;  2L4E A;  3NBI A;  2QCU A;  2BWE A;  3GLF A;  4B3M M;  3B89 A;  3VLF B;  2GQF A;  1QDT A;  2DZL A;  1RU3 A;  1GKI A;  2EKK A;  1T43 A;  3C58 A;  5EXX A;  1E94 E;  4AG6 A;  5IZ7 D;  4NC6 A;  2ZBK B;  4GEW A;  1ZAE A;  3RE8 A;  1NV9 A;  3VKH A;  3U6P A;  3KP1 E;  2O01 F;  1D0M A;  1OFI A;  1Y8G A;  3U6D A;  4DR2 M;  3SAT A;  4QOZ C;  3U60 B;  1T3T A;  1R7R A;  3AOE C;  3JAM S;  1TR8 A;  4DV4 M;  2KNA A;  1NJG A;  3VFD A;  1JR3 D;  4TUW A;  1XB2 B;  2YNM D;  4MH0 E;  2FFJ A;  4OU7 A;  1W5S A;  4L16 A;  3U6L A;  3IG8 A;  2JY5 A;  4M9S A;  1J7K A;  1G59 A;  2FH0 A;  3SHG B;  3I4V A;  4NL4 H;  1Z5A A;  4LF7 M;  4DV2 M;  4DR4 M;  2KDL A;  1Q3B A;  2DHY A;  1HQY E;  5FTJ A;  3TL4 X;  1N33 M;  1QAQ A;  4IJF A;  2UXC M;  4Z6Y A;  1VEJ A;  2DKL A;  5ITX A;  2ZM6 M;  4G4N A;  2BNK A;  3W0L B;  3B74 A;  3GRR A;  2DZO B;  3U60 A;  2UU9 M;  4GHA A;  4PDG A;  1VDD A;  3SFZ A;  3B7Z A;  2DAM A;  5KQD A;  1PJQ A;  2C99 A;  2QHO B;  3EIE A;  3HHW A;  4FWH A;  3GLG A;  5ITX E;  4G4Q A;  2ZAM A;  1KYI A;  2Y20 A;  2J5Y A;  1C1K A;  1IY2 A;  2JWS A;  3PVS A;  3LW5 F;  3EIH A;  5E6J A;  2DWN A;  4XK8 F;  1X37 A;  2UXB M;  4RF1 A;  3ILK A;  4KO8 A;  5EP3 A;  4OX9 M;  3R9X B;  4LGY A;  4IBJ A;  3GLF B;  4CHT B;  4KT0 F;  4NXN M;  3T1H M;  2DAI A;  2G3Q A;  3ZH9 B;  2EA0 A;  3FUV A;  1VEK A;  4PD2 A;  2E5L M;  3M7G A;  4NRV A;  3FRH A;  2L2D A;  1IBM M;  1R4G A;  4DR1 M;  4IBC A;  4LFC M;  1WJ7 A;  2JZ1 A;  4JI3 M;  1K3X A;  4NRW A;  4LF8 M;  3GLG E;  4NOO B;  3KVW A;  2F5O A;  2QPA A;  3E21 A;  2Z4R A;  1IFY A;  3SAS A;  2R6F A;  3HJ8 A;  1IM2 A;  2MJ5 B;  2DEN A;  1PJS A;  3FUW A;  1IN6 A;  3KDS E;  1Q02 A;  2KRU A;  5EP2 A;  3NWL A;  1WR1 B;  2YQZ A;  3GPY A;  1GLN A;  5ITR A;  2H1R A;  2JY8 A;  1SXJ C;  4GKK M;  1IY0 A;  2XLJ A;  2DWZ B;  1XHB A;  4I4L A;  3U5Z A;  4LJ4 A;  1KSF X;  2FNA A;  1PJI A;  2FOI C;  2H5X A;  3BXW A;  4FW9 A;  3U6Q A;  3U61 B;  3KOY E;  3Q8X A;  2KHH A;  2K9D A;  3GRY A;  4JI6 M;  2JP7 A;  3L29 A;  1ZMW A;  2EKF A;  1AUA A;  2Q2E B;  2K47 A;  2ZTC A;  3LVV A;  2XSZ A;  2CWB A;  5EJC A;  3J27 B;  3KW6 A;  5EXS A;  1T6O A;  5F3W A;  3NBX X;  5IT9 S;  3GLI E;  4YY3 M;  1UFZ A;  2R4E A;  4LF4 M;  1QDR A;  1MU5 A;  3ZCB B;  3BBZ A;  3AJI B;  4LJ7 A;  4G4R A;  1IN4 A;  4IBB A;  2JUJ A;  3SMS A;  2QSF X;  1QUS A;  4LF5 M;  4G6Z A;  4B7H A;  3U6C A;  1OTR A;  3KOW E;  1JR3 E;  4JXJ A;  4LJA A;  4AQY M;  3KSX A;  1NO1 A;  5EP4 A;  3MJ5 A;  2J7O A;  5BPV A;  5EQT A;  2F4V M;  4I8O A;  3AKZ A;  1TGU A;  2LHC A;  5ITQ A;  3J81 S;  2AHM A;  1IQP A;  4MGI E;  2C98 A;  4PCZ A;  4IBI A;  5JI3 E;  2FE8 A;  2RRU A;  1F4I A;  2OO9 A;  1HT2 E;  4IBG A;  4D80 A;  3GLI A;  1NHW C;  1E9S A;  4NSR A;  5LMU M;  2Z8Y M;  2BJW A;  2D7E A;  4FVM A;  2R46 A;  2LXE A;  2D7G A;  1PRB A;  3FYC A;  5GKN A;  1IY1 A;  2Z3X A;  1NSF A;  2EO2 A;  3FUT A;  5DYI A;  1IXR C; 
#chains in the Genus database with same CATH homology
 2X8A A;  4X66 M;  1NY5 A;  3GLH A;  4LJ8 A;  3GLI B;  1PM5 A;  4JI5 M;  4LFB M;  3U6M A;  2OPF A;  1ZQ9 A;  3T38 A;  4IBE A;  1YUB A;  2KW0 A;  3A46 A;  4GKJ M;  4NSO B;  4K0K M;  3GPP A;  4QOS A;  3FTF A;  5E26 A;  3L28 A;  2UXD M;  3FD9 A;  4D81 A;  3FKE A;  2EUC A;  2CFO A;  4P16 A;  4DV1 M;  2C9O A;  3WHK A;  1N34 M;  3PNV A;  2VQE M;  4Z8X A;  3J80 S;  2XGN A;  5ITY A;  3RGS A;  1IN5 A;  4DV3 M;  1XXH B;  4L78 A;  4BB9 A;  3FTC A;  3DZD A;  2XEP A;  3HGI A;  1J5E M;  1E9R A;  2XFT A;  3E4R A;  4DUZ M;  3CTW B;  2ERC A;  1N77 A;  3QAU A;  4CIS A;  5BR8 M;  4L8R C;  1TH4 A;  5EXP A;  2RGO A;  2X4A A;  1R2Z A;  1L8Q A;  3HJS A;  4LJ5 A;  2F5S A;  1N36 M;  1N32 M;  5C18 A;  3JR5 A;  4LJ9 A;  1DGF A;  2XFS A;  1GVN A;  4GRI A;  3GQ3 A;  1E32 A;  3T1Y M;  3A42 A;  3K1J A;  1TH3 A;  4BLC A;  1G41 A;  4ZPX A;  3RGP A;  1NHG C;  2NQ8 C;  1QAO A;  2ZAN A;  3VDU A;  2Y0Q A;  3SMP A;  3D8B A;  2XZF A;  2RGH A;  2HKJ A;  2UUA M;  1HNX M;  4LFA M;  3LMM A;  5DYG A;  2QZ4 A;  4A3V B;  2XH9 A;  1IN8 A;  2KZU A;  4GMQ A;  3SAW A;  4WUR A;  2CE7 A;  3J7A S;  3MK6 A;  5KPR A;  4B3R M;  2KA6 B;  2O5R A;  4FCW A;  4B7G A;  3IG5 A;  5FLX S;  3GQ5 A;  3TWL A;  1K82 A;  4DR6 M;  2YFQ A;  1G3I A;  3K8Z A;  2F5Q A;  2XF3 A;  1SXJ E;  5KQ8 A;  2J7N A;  3KOX E;  3GLG B;  1K3W A;  1L1T A;  1HT1 E;  2L09 A;  3DOA A;  1PJJ A;  2L7I A;  3GPX A;  3AV0 A;  2CV1 A;  2DWM A;  4G4Q A;  3UZU A;  4TUW A;  1NNU C;  1QAN A;  3SYL A;  1IN7 A;  1HNZ M;  2F5P A;  1NJF A;  1QAM A;  3HJQ A;  3UK6 A;  4LRT A;  4MGH A;  1I4W A;  3LQR A;  1R6B X;  3HU1 A;  4QNM A;  4AKI A;  4FD2 A;  1DO2 A;  1L2D A;  2QBY A;  4QNR A;  4JI1 M;  1DGH A;  2DZN B;  1SXJ D;  1J09 A;  4M9X A;  1XNR M;  3E9S A;  4AG5 A;  5C1B A;  4YHH M;  4L15 A;  1HR0 M;  4AW4 A;  3A98 B;  1LV7 A;  4LF6 M;  2A5Y B;  4GIT A;  4AI6 A;  3FYD A;  3GPU A;  3KS8 A;  3HHZ A;  1JQJ C;  1DGH B;  4QHT A;  4OW0 A;  5H37 D;  2C9C A;  2KRK A;  1I94 M;  4OVZ B;  2CEA A;  1FJG M;  1YE9 A;  4X62 M;  1Z5B A;  2C96 A;  2VII A;  3M6A A;  3GRV A;  4GH9 A;  4LCB A;  4DV6 M;  3I51 A;  1XWI A;  4HL4 A;  1UM8 A;  4B3T M;  1HNW M;  3VK8 A;  2CV0 A;  1YSY A;  4MB7 A;  3KXE C;  4KHP M;  4DR7 M;  1Q39 A;  4MGY E;  2ZAO A;  2R45 A;  4HLQ A;  1G8P A;  1FNN A;  2CHV A;  3PNY A;  4M9Z A;  5A2Q S;  2XZU A;  2V6Z M;  2X49 A;  3D8L A;  2Y21 A;  1MX0 A;  5KO3 A;  2LH0 A;  3U6E A;  4LRS A;  4LF9 M;  4ITQ A;  4I81 A;  1GL7 A;  1EE8 A;  4DV7 M;  3SHF A;  2R4J A;  1L2C A;  3U5Z B;  3H4M A;  4MGK E;  1QVR A;  2V1C A;  2L7H A;  1Q3C A;  3GRU A;  2DWL A;  4AZF A;  3L25 A;  1XC8 A;  3AL0 C;  3KSJ A;  2Y0T A;  2VQF M;  3I4Y A;  1ORY B;  1NY6 A;  2KZS A;  3RFW A;  2CHQ A;  2P5T A;  2Z7J A;  2R65 A;  4RNA A;  3TE6 A;  4AKH A;  1R2Y A;  4X65 M;  3MHV C;  1TH2 A;  4DV0 M;  4DUY M;  3WHL A;  3KFU G;  2M5Z A;  5LMN M;  3HU2 A;  3DA1 A;  3J2P B;  2UUB M;  3TWK A;  8CAT A;  4JI8 M;  4JI0 M;  1OFH A;  3UGJ A;  2KXE A;  2I7P A;  3QWL A;  3KP0 E;  3AFH A;  1L2B A;  4QHS A;  4IBK A;  3SYK A;  3FTE A;  1Z6T A;  2F5N A;  2DXI A;  4M0W A;  4IBD A;  3VDP A;  4JI7 M;  1D2N A;  2QBY B;  5FTK A;  7CAT A;  3R8F A;  1IXZ A;  2QP9 X;  4GC5 A;  4MGZ E;  4LY6 A;  3PXG A;  1N75 A;  4II7 A;  1N78 A;  4XGI A;  4CGY B;  5KPZ A;  1S3S A;  3JR4 A;  1HQC A;  3K2L A;  1SXJ B;  3CF2 A;  2C5R A;  3VKG A;  3B9P A;  2V1U A;  3M0E A;  2QEN A;  2LNH C;  4JN6 A;  4R3D A;  3HHY A;  1NVM A;  1QYR A;  4R7G A;  4EIW A;  3ZC7 B;  4KOD A;  4S12 A;  4JYA M;  4FCV A;  3L26 A;  3U6S A;  5JI2 E;  2Z4S A;  5KPT A;  2OQ4 A;  4M0D A;  4B3S M;  3TQS A;  4GC9 A;  1DGG A;  4IBF A;  4DR3 M;  1TDZ A;  3SC3 A;  2DVW B;  5FTM A;  4G4O A;  4JV5 M;  1G4A E;  2RKO A;  3KS4 A;  2YR0 A;  3GO8 A;  1TDH A;  5EP1 A;  1SXJ A;  1L1Z A;  4NXM M;  4GHL A;  2D7H A;  1QQW A;  2W82 A;  1DO0 A;  2R62 A;  4OVZ A;  3U61 A;  4DR5 M;  4JI2 M;  3HU3 A;  3DFZ A;  5IWA M;  3UMM A;  1H6U A;  4AKG A;  2I7N A;  3FUX A;  2CV2 A;  1IBL M;  2G5G X;  4FWD A;  4L4U A;  2HHH M;  4IIW A;  4B08 A;  2BJV A;  3CF6 E;  3LQQ A;  3TWM A;  3SBJ A;  3AOE A;  4D82 A;  4I5S A;  1OJL A;  4XBO A;  1QZM A;  2L6O A;  1NNJ A;  2CHG A;  3FUU A;  3L27 A;  1XXH A;  4GIP A;  5DNY A;  2CUZ A;  3A45 A;  4PT5 A;  4WW0 A;  3VK7 A;  4MM3 B;  2UUC M;  4LZJ A;  3SAR A;  5ITU A;  3PFI A;  3UJN A;  4KLN A;  4PDI A;  1Z5C A;  3OTO M;  4B7F A;  4REZ A;  5ITT A;  2LWX A;  4DV5 M;  1KFV A;  4LZZ A;  2G8L A;  3SAV A;  1JR3 A;  3TPZ A;  3AOG A;  3GQ4 A;  3CF0 A;  4BBA A;  5FSW A;  5EXT A;  5FTN A;  2KEB A;  2HL7 A;  1DGB A;  3GP1 A;  3THG A;  3J7B A;  3KOZ E;  4RF0 A;  1W5T A;  4W5W A;  1WXQ A;  2DHR A;  1IBK M;  1XNQ M;  3U6O A;  1GL6 A;  2R18 A;  5IRE B;  1IXS B;  2JA2 A;  3W0F A;  3HKP A;  2XSZ D;  2M60 A;  4LJ6 A;  4LG2 A;  3K92 A;  3SAU A;  4FCT A;  3BOS A;  3L2A A;  4X64 M;  4JI4 M;  4IJE A;  3HWS A;  4FWG A;  4LGM A;  3GLH B;  5FTL A;  3FTD A;  1Z59 A;  3HHX A;  1XMO M;  1XMQ M;  3LVW A;  2HCB A;  3T15 A;  3NBI A;  2QCU A;  3GLF A;  4B3M M;  3VLF B;  1GKI A;  3C58 A;  5EXX A;  1E94 E;  4AG6 A;  5IZ7 D;  2ZBK B;  1ZAE A;  3RE8 A;  3VKH A;  3U6P A;  3KP1 E;  1OFI A;  3U6D A;  4DR2 M;  3SAT A;  4QOZ C;  3U60 B;  1T3T A;  1R7R A;  3AOE C;  3JAM S;  4DV4 M;  1NJG A;  3VFD A;  1JR3 D;  2YNM D;  4MH0 E;  2FFJ A;  4OU7 A;  1W5S A;  4L16 A;  3U6L A;  3IG8 A;  4M9S A;  1J7K A;  1G59 A;  3SHG B;  4LF7 M;  3I4V A;  4NL4 H;  1Z5A A;  4DV2 M;  4DR4 M;  1Q3B A;  1HQY E;  5FTJ A;  3TL4 X;  1N33 M;  1QAQ A;  4IJF A;  2UXC M;  4Z6Y A;  5ITX A;  2ZM6 M;  4G4N A;  2BNK A;  3W0L B;  3GRR A;  2DZO B;  3U60 A;  2UU9 M;  4GHA A;  4PDG A;  1VDD A;  3SFZ A;  5KQD A;  2C99 A;  3EIE A;  3HHW A;  3GLG A;  4FWH A;  5ITX E;  2ZAM A;  1KYI A;  2Y20 A;  1C1K A;  1IY2 A;  3PVS A;  3EIH A;  5E6J A;  2DWN A;  1X37 A;  2UXB M;  4RF1 A;  3ILK A;  4KO8 A;  5EP3 A;  4OX9 M;  3R9X B;  4LGY A;  4IBJ A;  3GLF B;  4CHT B;  4NXN M;  3T1H M;  3ZH9 B;  2EA0 A;  3FUV A;  4PD2 A;  2E5L M;  3M7G A;  4NRV A;  1IBM M;  4DR1 M;  4IBC A;  4LFC M;  4JI3 M;  1K3X A;  4NRW A;  4LF8 M;  4NOO B;  3KVW A;  2F5O A;  2QPA A;  2Z4R A;  3SAS A;  3HJ8 A;  1IM2 A;  3FUW A;  1IN6 A;  3KDS E;  2KRU A;  5EP2 A;  3NWL A;  2YQZ A;  3GPY A;  1GLN A;  5ITR A;  2H1R A;  4GKK M;  1SXJ C;  1IY0 A;  2XLJ A;  2DWZ B;  1XHB A;  4I4L A;  3U5Z A;  4LJ4 A;  1KSF X;  2FNA A;  1PJI A;  2FOI C;  3U6Q A;  4FW9 A;  3U61 B;  3KOY E;  3Q8X A;  3GRY A;  4JI6 M;  3L29 A;  2Q2E B;  2K47 A;  3LVV A;  2XSZ A;  5EJC A;  3J27 B;  3KW6 A;  5EXS A;  5F3W A;  5IT9 S;  4YY3 M;  2R4E A;  4LF4 M;  1MU5 A;  3ZCB B;  3AJI B;  4LJ7 A;  4G4R A;  1IN4 A;  4IBB A;  3SMS A;  4LF5 M;  4G6Z A;  4B7H A;  3U6C A;  3KOW E;  4JXJ A;  4LJA A;  4AQY M;  3KSX A;  5EP4 A;  3MJ5 A;  2J7O A;  5BPV A;  5EQT A;  2F4V M;  4I8O A;  3AKZ A;  1TGU A;  5ITQ A;  3J81 S;  2AHM A;  1IQP A;  4MGI E;  2C98 A;  4PCZ A;  4IBI A;  5JI3 E;  2FE8 A;  1HT2 E;  4IBG A;  4D80 A;  3GLI A;  1NHW C;  1E9S A;  4NSR A;  5LMU M;  2BJW A;  2D7E A;  4FVM A;  2R46 A;  2LXE A;  2D7G A;  3FYC A;  5GKN A;  2Z3X A;  1IY1 A;  1NSF A;  2EO2 A;  3FUT A;  5DYI A;  1IXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...