4GC5A

Crystal structure of murine tfb1m
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
318
Chain Sequence
b'FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase 1, mitochondrial
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 103
structure length 318
sequence length 319
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc5A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc5A01
3AWIA 5CVVA 4E2ZA 2GA9A 3PFGA 1U2ZA 1EIZA 2PX2A 5FA5A 2XVMA 1VE3A 3FPGA 4QDJA 2VDUE 3SVZA 4GQBA 3RIEA 5DM4A 5E1BA 5BW5A 4ISCA 4KDRA 4YMGA 3U81A 3A26A 4WVLA 5DSXA 2ZVJA 4C05A 2P40A 3CVOA 3TOSA 2FPOA 3LGAA 4CTKA 2YXLA 2ONYA 2K4MA 3G2PA 1L1EA 2AN5A 1JG3A 1N2XA 1UWVA 3M33A 3NJRA 4GBED 3BWMA 4MQ4A 4RWZA 5ICGA 4YV0A 4CKBA 3LDUA 3JWGA 3PS9A 2P7IA 5K0NA 2ZCJA 4FT4A 3CGGA 3OZTA 4GOOD 4RVFA 5LQRA 5DSTA 3TRKA 1YZ3A 2G1PA 1AQJA 2QE6A 1JG2A 3OU2A 2GB4A 2BR3A 4HSGA 2P8JA 3FTCA 2YXDA 3HCFA 4AZWA 5F2KA 2EX4A 4E33A 3KQSA 5GIPE 5G02A 5M5BA 5FUBA 3OE5A 1G6Q1 3A7EA 4KDCA 3UJ7A 5K09A 5CVEA 4E30A 3M6WA 4ATNA 2H1RA 2IDJA 1ZHFA 4EKIA 3ERCA 2KW5A 4QDKA 2YR0A 1V39A 3G5TA 5FHRA 3TLJA 4G56A 2CWWA 3LL7A 3VC1A 3DXYA 5C1IA 2Z6QA 3IYLW 2Y1XA 2HV9A 1VBFA 2GLUA 3DMHA 4RTPA 3OZSA 1FP1D 4XUDA 4ER6A 1RI4A 2PT6A 5HIKA 3GDHA 2XBMA 4ER7A 3NVKI 2CMHA 1JSZA 1FP2A 3FPFA 5E1MA 3ER9A 3E8SA 3OFKA 3KR0A 1XDSA 1KYZA 2ZTHA 3DXZA 3HCEA 5EMLA 2OYRA 3LECA 1AQIA 2E5WA 3SGLA 2V7EA 3KQTA 2YUIA 2XVAA 3BKXA 5IKMA 2B25A 3UWPA 1VIDA 3AXSA 2CL5A 4DMGA 8MHTA 2PWPA 4CXMA 3DULA 5K8VA 3FRIA 1EG2A 2ZIEA 5E2BA 4BLUA 3M6UA 3BGVA 3VSEA 4R6XA 5EMKA 1QYRA 2ZWVA 2ZZMA 3B89A 2V74B 2HTEA 1R18A 4U7TB 3B5IA 3FTEA 2NYUA 1SQFA 3B7PA 1O54A 1L3CA 2PJDA 3I9FA 3GGDA 1HNNA 1ORHA 3KHKA 1NBHA 1EJ0A 4XUCA 5HFJA 2YQZA 4L7VA 3ELDA 3X0DA 2HMYB 2HNKA 1FJXA 4OX9Y 2DULA 2IH4A 2ORED 3G8BA 2JH9A 2ERCA 3AXTA 5T6BA 1R74A 3DTNA 2OKCA 4BY9E 2FRXA 4F84A 2PKWA 2O57A 5HILA 3EMBA 4KIFA 4CWAA 2PSSA 1G8SA 3GCZA 3REOA 3SR4A 5K0CA 3FTFA 3B3GA 5GWXA 3G88A 4P7GA 3NW9A 5EIFA 3ANXA 1PJZA 4AUKA 4B17A 4MIKA 4PGGA 4P7JA 1X19A 1X1BA 1XVAA 2Y1WA 3SM3A 5DX0A 1YB2A 4KRGA 4AZVA 2N47A 2PX4A 4M36A 3KQQA 2PXCA 5DM0A 5DTQA 1JQDA 4QQNA 3KQWA 3FPJA 3FPEA 3JWIA 3EVDA 3DR5A 2AOVA 5DTMA 4F85A 4GC9A 4KWCA 5EGSA 3DXXA 4ER3A 3FUWA 2ZZKA 3GNLA 5LQNA 1XCJA 2VS1A 1JQ3A 1WY7A 4YMHA 4FR0A 1NW8A 3E7PA 1QZZA 3S68A 4C07A 3DH0A 5GP1A 3BZBA 5LQAA 4RTNA 1INLA 2PWYA 5HIIA 2G72A 3GRZA 3K6RA 3C3YA 3KPVA 4IKPA 5GM2A 3KPJA 2JHCA 1X1CA 1WXXA 3HVIA 5KVAA 3LX6A 3TMAA 2Z6AA 10MHA 5EKXA 1Q0TA 2C7QA 3A25A 3HCCA 4DM3A 1KPHA 2P3OA 3A7DA 1RJGA 2B9EA 5FULA 3LBFA 4BP3A 5C9ZA 3M4XA 1KXZA 5HIJA 5CCBA 3NWEA 3TR6A 1RJDA 3MAGA 5GINE 5HOQA 2NP7A 3TQSA 5CUQA 2OY0A 4YV1A 1HMYA 2FK7A 3EVFA 5EOVA 5GIOE 3THRA 3V97A 3SX0A 4PIMA 2P7HA 4EQZA 2PX8A 2G70A 4QPPA 4V0RA 5EMMA 3MTIA 2XYVA 3AY0A 5C0OE 2A14A 2WA2A 4PYOA 4EKGA 7MHTA 2GS9A 2QYOA 2R6ZA 1FBNA 3P8ZA 3UJBA 4Y30A 1VL5A 3UJDA 3EVZA 2EJTA 3OPNA 3WSTA 2EJUA 2ESRA 4QTTB 1NE2A 3CJRA 3UA4A 3BWBA 2JJQA 3M6VA 4C4AA 1N7IA 3KPYA 2P1DA 1G38A 4P7KA 1ZKDA 3P71T 2OB1A 3RW9A 1D2CA 5GM1A 4HTFB 4CKEA 5K01A 4RVHA 1G60A 4UOEA 3BGDA 2H11A 5CD1A 1AV6A 2JHPA 3G7UA 5E1DA 5H02A 2IIPA 3LCUA 2O06A 3SXJA 4E32A 3PTAA 1R8YA 3O31A 5E9WA 4R8SA 2HR1A 4PCAA 3DP7A 2XYRA 1VPTA 3PX2A 4RSRA 5EVJA 5CM2Z 1M6YA 4M37A 5DPMA 1NW7A 5F2NA 3P9NA 3UBTA 2VDWA 3L8DA 4PYLA 4RYLA 1NV8A 2ADMA 3ID6C 3SSMA 5FCDA 3C6MA 3NVMB 4RTKA 3GWZA 3G89A 2UYHA 4BLVA 1I9GA 3DUWA 3HVJA 4FP9A 4ZTBA 2C7OA 2JG3A 2BH2A 2ZWAA 4PWYA 1X1AA 2Z6UA 4FSDA 4HTFA 4V0QA 4DCGA 1RI5A 3R9XB 1WXWA 4MTLA 4C03A 3HVHA 2IGTA 2O07A 2ZBPA 3MERA 4OBXA 4QVKA 4QVGA 2F8LA 4DF3A 1RI1A 5K03A 1ZQ9A 3KQVA 2AOXA 3O7WA 4PONA 4QTUB 1EAMA 5D1HA 5DXJA 1JSXA 3PB3A 3HVKA 2FHPA 3QV2A 2FCAA 3LHDA 3R0QA 1R00A 4MWZA 3SSOA 4IWNA 4H0NA 5BP7A 1TW3A 3Q87B 1QANA 3PT9A 3BXOA 5EZSA 3UJ6A 4F86A 4PYJA 2GAFA 4QPNA 1TPYA 3KPWA 3FUXA 4PYMA 5FADA 5LQCA 4PYKA 1X1DA 3C3PA 3NWBA 4RVDA 2O05A 2PVCA 2I6GA 4EK9A 1NW5A 2IFTA 2BR4A 3GIWA 4BP1A 3PLAE 2P41A 3PFHA 1RJEA 1ZG3A 5EMJA 3BKWA 3RODA 4K6MA 3R6TA 1SUSA 2P35A 1I1NA 2ZFUA 2NNWB 2VZ9A 3NDIA 3Q7EA 3GRVA 4PIPA 1P39A 5EPEA 2EG5A 3MCZA 1YZHA 4M7RA 4NECA 3UJ8A 2C7RA 4DKJA 4CTJA 4OA8A 2UYOA 1SVUA 1VQ1A 3HCBA 4FZVA 4R8RA 5HEKA 3EPPA 5T64A 4EVIA 1XDUA 2I9KA 4A6EA 5CVJA 1QAMA 2NXCA 2ZIFA 1QAQA 3C6KA 2XYQA 3KR2A 1KR5A 1VLMA 2OZVA 1D2HA 3KQMA 5E8JA 3EVBA 4GC5A 2JH8A 2WK1A 2B78A 2OB2A 4YV2A 5K0FA 5LQJA 2I62A 1KHHA 3E05A 4DZRA 4EMSA 1MHTA 2DPMA 3BWYA 1F3LA 2YVLA 1L3BA 1IY9A 3LDGA 1YUBA 3HA3A 3G5LA 3FUTA 3M6XA 4FGZA 5HZMA 4POOA 1Q0SA 3IEIA 4CKCA 2EFJA 4KW7A 1PRYA 4HRAA 5E1OA 3KR1A 2UYCA 3B3FA 3T0IA 2R3SA 1OR8A 2GH1A 3KR9A 4KVZA 2PV0A 3TFWA 2ZBRA 2AN3A 4FS8A 5EG5A 5JUWA 2ZZNA 2IPXA 2P3LA 1MJFA 3OE4A 1F38A 1DCTA 3BGIA 4U7PB 1IXKA 3SSNA 5DRYA 1KP9A 1UFKA 2AN4A 4E2XA 2PXAA 3ELWA 2LD4A 2VP3A 3UJCA 4RTJA 3UJ9A 1I4WA 3QOWA 1TW2A 4C08A 3GO4A 1UIRA 4RTQA 4RTOA 1BOOA 1O9GA 2C7PA 3V8VA 3LKZA 3EVAA 1SKMA 2IP2A 4DCMA 3PX3A 1BHJA 1M6EX 2AOUB 3OFJA 3LKDA 2B3TA 3I58A 1IM8A 3MTEA 2AVNA 1R8XA 3HM2A 4X60A 3K0BA 5FTWA 1JTFA 2GPYA 4C06A 1L3IA 5KQRA 4A6DA 5FA8A 4YUWA 1NV9A 1KPIA 3EGEA 1SG9A 5EHGA 2AOTB 4R05A 3FYCA 4FSXA 4YUVA 4E2WA 2YTZA 1G8AA 1Y8CA 5BXYA 2OPBA 3E23A 1NW3A 2JHAA 3G8AA 3KKZA 5DXAA 3MHTA 3NMUF 2AVDA 3UZUA 5F2OA 4PYIA 5MHTA 3UA3A 3B3JA 3JWHA 4AZSA 1EJ6A 3P9KA 1JG4A 4QQKA 3KQPA 4XUEA 4GF5A 4GOMD 3T7RA 2AZTA 3JWJA 2Q41A 1D2GA 3MCTA 3TPZA 1B42A 4Y2HA 2AOUA 2AOWA 4ER5A 5CIYA 1G55A 3FPHA 2OXTA 3EGIA 5K0GA 2UZ4A 1BC5A 1WS6A 4X1OA 3DLCA 5LR6A 3FUVA 4R6WA 4YUYA 3HTXA 4PYQA 3CCFA 3I5UA 3PVCA 1XDZA 3LBYA 3ELUA 3EGVA 2AOTA 1P1CA 4OA5A 5GOZA 5U4XA 3THSA 2OBFA 5FWAA 5LSAA 3EVCA 3ORHA 2PXXA 1EQAA 3P2EA 3TM5A 3CC8A 3AJDA 2QRVB 3IV6A 5E2AA 1XXLA 4X61A 1P91A 1BKYA 3HEMA 3GRRA 2PT9A 9MHTA 1NW6A 2ZW9A 1O9HA 3MQ2A 1JR4A 3UJAA 4GUAA 4ER0A 3P9IA 3I53A 3DMGA 3DOUA 3NTVA 5IH3A 2CKDA 4JXJA 3P2KA 4GEKA 4RTMA 2UYQA 5E9QA 3KQOA 3HA7A 5ERGB 3LCCA 1L9KA 4LG1A 5DX1A 1KPGA 2YX1A 3CKKA 3HNRA 3P9CA 2I7CA 1KIAA 4Z2YA 3TKYA 4DQ0A 5ICEA 4PINA 5CVDA 2PX5A 3TKAA 3LCVB 2BM9A 2QM3A 1DUSA 2B2CA 3G2OA 5EHIA 3VC2A 4AX8A 2IH5A 3FUUA 3EMDA 4PGHA 3P2IA 2QRVA 3VYWA 3G2MA 5P8WA 2YXEA 4PNEA 5DM1A 2G8NA 3EVEA 1JQEA 1RI3A 4HC4A 4YUZA 5EEHA 5DLYA 4IV0A 2FYTA 4DA4A 3O4FA 5EQJB 4RTRA 1RI2A 3LDFA 5CCXA 1N7JA 3GRYA 1YFLA 1H1DA 4RVGA 1T43A 5DX8A 1QAOA 1SUIA 2CMGA 3TM4A 4C04A 1VP9A 3KPUA 1Z3CA 1XTPA 3LSTA 4WXHA 5D1NA 3OZRA 1JTEA 4RTLA 2AR0A 3LPMA 3UFBA 4RTSA 3CJTA 5B1SA 4IV8A 2G71A 2BR5A 3DMFA 2H00A 4OBWA 3HA5A 2IDKA 4XCXA 5K0BA 4BLWA 3R24A 3OU7A 4M38A 1XCLA 5DM2A 5T67A 4HGYA 2IBTA 3EEOA 3I64A 5JR3A 5ICFA 3A27A 2P3QA 3R3HA 5DTRA 2O0LA 2NXNA 5EIWA 4AZTA 4YUXA 5K0EA 4P58A 3F4KA 2WA1A 4OQEA 4HH4A 4P7FA 4RX1A 4GOLD 5KQSA 3T7TA 3QOXA 3A4TA 4O29A 3G2QA 4FT2A 4PCLA 5EC8A 3MB5A 1XJ5A 5K05A 2ZIGA 2BZGA 4X63A 2IH2A 4LWOA 1ZGJA 1AF7A 2VDVE 4X41A 5DT2A 1YF3A 3IHTA 2AS0A 3GXOA 4RV9A 5DWQA 5E9JA 5EKUA 5LQUA 4LWPA 5CVUA 5DRTA 3HP7A 2HWKA 5FQNA 1R6AA 2ZULA 5K0JA 5KS2A 1ZGAA 2NXEA 5LQKA 1M0EA 5K0LA 3ELYA 1VP3A 1RJFA 2ZLBA 3DLIA 2PY6A 2PGXA 3BWCA 4OQDA 4PYNA 3FYDA 3H2BA 1ORIA 5FQOA 4E2YA 2NP6A 3GRUA 2BM8A 5FWDA 5FHQA 4LECA 4HGZA 4E31A 3ME5A 2ZSUA 4KIGA 3CJQA 3FTDA 3GU3A 5E8RA 3D2LA 3FZGA 2IBSA 3FRHA 3M70A 1NKVA 3MGGA 4E70A 3C0KA 2OO3A 2QY6A 5BW4A 3OCJA 5KYGA 1WZNA 3ER8A 1NBIA 3EVGA 4GOND 5EZQA 1FPQA 3BUSA 3BT7A 3OU6A 2PBFA 5EEGA 5HIMA 3KQYA 1KYWA 2NXJA 3P97A 2ONZA 1NT2A 5ICCA 1P1BA 4HG2A 1SQGA 1YFJA 3T7SA 1DL5A 2ZBQA 2FK8A 3CBGA 2PLWA 3EEYA 3GJYA 3HCAA 3HCDA 3KU1A 3NDJA 4MHTA 1JG1A 3SMQA 1WG8A
chains in the Genus database with same CATH superfamily
1MO4A 4JODA 2YC2C 5TRTA 1B0ZA 5I9BA 4RKEA 2HCTA 3SIPA 4R54A 4CTOA 1G6OA 2VNJA 3E3NA 2IF2A 2D3TA 4Y2TA 3BIJA 2ONYA 4DIEA 2QVLA 2P0YA 1Q20A 3I6YA 3IOYA 5IT5A 1QK5A 2AK3A 1JG2A 1RTKA 3NHWA 2DPLA 1MRSA 5A05A 5HRAA 3NORA 1MFPA 1VJDA 5FUVA 2DBZA 4PCVA 3MA0A 4RIFA 1UKBA 4RFSA 3PENA 4XX0A 4A27A 4LOKA 1T9BA 2DPGA 1V7QA 4K86A 4DJJA 3HE3A 3DBHA 1ZMTA 3JQAA 3KVOA 4EYSA 1HFJA 3EDCA 5TQJA 4JP1A 2NYUA 2HLNA 4BNMA 3VDRA 2ZI6A 2A84A 4BFSA 1KMHB 3G88A 1ARZA 3KS4A 3GYGA 1HM5A 2C5SA 1DSSG 2BEKA 1H6BA 1RXYA 1C1KA 2QVYX 4RDIA 5C8VA 3I0ZA 1JJAA 3NV7A 2WM2A 5YASA 3T1TA 3MWJA 2RIRA 3OIGA 2N1BA 3C4QA 4BX8A 3LQKA 4WLOA 2A1TR 1VG9B 3OAAA 1WXEA 1D5WA 3GUYA 1X39A 1CUDA 5ESWA 3ILYA 1E4VA 2ORIA 4YP0A 1PLKA 4DYDA 3CLTC 5ALNA 2C7GA 4E07A 5JYEA 4G1BA 4CIZA 4N18A 2XTJA 5F2NA 5HXAA 1JIQA 3O7MA 3HZOA 4CMIA 1TQDA 1E2NA 2LUOA 4HTFA 2Z5LA 5IK2D 1WW3A 3L7IA 3RC2A 1EAMA 1GPKA 1NC1A 3LVRE 4M0DA 2LHCA 4OVZA 5C18A 4LBYA 3U4HA 2VA9A 5I7OA 3MRXA 2QTNA 3QMPA 2HGZA 2VZ9A 1HG1A 2AI3A 5EPEA 5EWJB 2WI8A 2ZTDA 4URYR 4MDYA 2FPPA 4IZIA 2NXCA 1QF7A 4B32A 2PMWB 1CUWA 3OO0A 1OGJA 5K8UA 2FLWA 1RYEA 2FZEA 1JJVA 1HDXA 3K0EA 4PR0A 4YACA 3DVRX 1GGFA 3SEQA 3O4JA 1E1RA 3PXBA 1S8AA 2VWGA 1BOOA 1XWFA 1GM5A 1JDTA 3D1LA 1U8ZA 3PX3A 2V7GA 3LKDA 2GM3A 3VHLB 1NI3A 3T3MB 5JAHA 3A11A 1QYWA 3K8ZA 2R8RA 4KQ9A 3IR7A 4B82A 5EKDA 1A50B 4ZCQA 2CHQA 1GQYA 4MYSA 1PZGA 2J31A 3HJQA 4OA5A 3OOYA 1OYYA 4RD1A 4HCJA 1QYXA 2ZUCA 2O50A 4P0QB 1B8OA 2QLLA 1UBMS 4PSVA 4WK2B 4FONA 4WBNB 1NI5A 5LYJB 4OHOA 2P2LA 1PE0A 3CTPA 4LGMA 4L02A 1T0PA 1U28A 3CR8A 2HT1A 1TF2A 1RXUA 4FFBB 3RABA 1Z5GA 4C21A 3I9LA 1XMOB 3HMQA 1LSJA 4TMZA 4WLEA 2ZITA 1FLVA 2F1OA 2DWOA 3STXA 1SRRA 1U0RA 4QXMA 1ULTA 4NCJA 1VDLA 3RC7A 5AVUA 3HJCA 1TU3A 1KKUA 4ZJYA 4O3FA 2PY6A 3JPYA 1I7DA 2PRZA 3SZMA 1L5HA 5FBWB 5KOIA 4Q6BA 3GU3A 1RYFA 3Q11A 3ZX5A 1EVQA 4ABTA 2X9QA 4Q1VA 3GAAA 4O4JF 4UEWA 3BWVA 4XGNA 3NAGA 3I6BA 5KI6A 2LV8A 1OX6A 2XFSA 3B9PA 2PX3A 4AIRA 4BNUA 4JYZA 3VO8A 5K6AC 3BILA 1AK2A 1G4UR 4MQ4A 2CFIA 3O75A 2PKEA 3N0WA 2WMYA 3CHYA 3VKVA 2DB3A 3ZKAA 3O74A 4J0EA 5E7JA 3M2PA 3JD2A 3DVAA 4WXRA 4E30A 2IXGA 3OE7A 4MKFA 4CI9A 3OZSA 3MD0A 2XGMA 2E4ZA 4C6TA 4ALKA 1SBCA 1REQB 2C5FA 2EYQA 4L95C 4KBGA 3AEZA 3HADA 4J1SA 4KJZA 3JVIA 4JSTA 3ASYA 2O5RA 2JH9A 4ETWA 1K7XB 2HYDA 3GCZA 1NNUC 2BFCA 4K3VA 2XTZA 3T4UA 3NWOA 1Z2CA 1JQDA 2H1OA 1PI3A 4LZWA 4YMSA 3AONB 1WCWA 3HWRA 1D2RA 3DH0A 3EGCA 1IOVA 3COPA 1ZKMA 5AQEA 3O4VA 4Q4AA 2NZYA 1WXXA 1ESDA 4M0UA 4LRTB 1Q7TA 2J5XA 2OY0A 3D7NA 3ZU3A 2PNFA 1K7SN 2ADOA 1R4ZA 3V4PB 1JIUA 3AR8A 1UBSB 4IKEA 4PE5B 2YWGA 3HCPA 1JR2A 1V1JA 4N5IX 3INTA 3F78A 4F3RA 1GPUA 1SY7A 3ILKA 1MX0A 4W9NA 3UJHA 4TS4A 1M2OA 1Z7YA 4AYTA 3DV2A 1E79D 1HNXM 1S9DA 3LA6A 4FGKA 4IXDA 5KQGA 3SSMA 1CLEA 4TKZA 4PWYA 2QAJA 2O6HA 2I1WA 1FRZA 4IILA 3LRTA 4QVGA 1LFAA 3E22A 2XUPA 3TJMA 5TEWA 3PT9A 4MDEA 5E7IA 3OUZA 2Y1GA 3KPWA 3ZYCA 3RU9A 2CUZA 1HY3A 3Q7EA 4HN2A 3R9XA 5I45A 5JVDA 1G0NA 5LOVA 5BXQC 3VISA 3BSFA 3O3CA 4GMDA 5J5AA 4I2NA 4FFNA 3HU3A 1RRVA 1QGUB 5JRZA 2VVTA 1QH8B 2F4NA 3EFBA 4C7MA 1M6WA 4Y1FA 1RWKA 3HL4A 2X4AA 2BSAA 5AM5A 4RTQA 1GTL1 1QTRA 1LSOA 2BMJA 1BHJA 3VMFA 3X2SA 4PZUA 4YUWA 5EHGA 1WTCA 4BNGA 4R05A 2PKXA 2E0IA 2QGFA 3SFVA 1N6LA 3EBPA 4P3YA 4AJLA 2XI4A 1E61A 4GF5A 1VJGA 4JV5B 3SC3A 2EKPA 3S29A 1A3CA 4FUQA 3W78A 3LT1A 4PS0A 4A4DA 2UUCM 2VJCA 1VHLA 1QGZA 4LF8M 1CULC 1JNYA 5CH3A 1TFRA 4ASUD 3IV6A 5HKKA 5AVRA 4Q3BA 1QRUA 4N6NA 2MR5A 1QQ7A 5J47A 3RSZA 2BWBA 4EA7A 3WDSA 3IUEA 3MTJA 3U49A 2I7CA 5LYYA 3WY9A 4B2LA 1QSGA 4KQWA 3DF9A 1GJSA 3V4FA 1SBTA 1LX7A 1K8RA 4QG7A 3EEIA 4N6GA 4E09A 4PT5A 1IWOA 1NLUA 5JZ9A 1GFWA 4W7HA 1UMCA 4WL0A 1CY8A 2YJNA 1BMFD 2ZTCA 2IBTA 1RXWA 3RQSA 1IJKA 2PZMA 3NHAA 4GXQA 2IZ7A 3PYLA 3TAUA 2Y99A 1TKRA 3L6BA 2WAYA 1N33B 4OQDA 2G1JA 2HWYA 3ZK8A 4YECA 5JAQA 3OE1A 3JWEA 2E37A 3MGGA 1G5FA 2FU5C 2FEPA 3F5FA 5B3LA 1PBNA 1PD0A 3V9AA 1FTQA 1QHHA 4EYKA 3O2QB 3ZIUA 3ZHBA 4K6CA 1U3DA 3OZUA 1WB9A 4XDGA 1ADYA 3KCNA 1VHWA 5B1DA 1XO1A 1O6CA 4KMSA 4LV8B 5ICGA 3MW8A 1HOTA 5IJ9A 1I4EB 3WGHA 2R8PA 3KIPA 5HZGA 2RGEA 4G4GA 2ZYDA 3EXG1 4LGVA 4OAPA 4Y0VA 1Y6JA 3NLLA 5C1IA 3S7ZA 4RTPA 4MGKE 4RVUA 2A9FA 2YUIA 3PNOA 1Q6YA 3L0IB 5IABA 1WA5A 1Z45A 5E2BA 3CF6R 1RQLA 4GR5A 4OKSA 2CFTA 3AX6A 1R16A 4HS9A 2P78A 3K30A 1IN4A 3ZJYA 1T8SA 2YQZA 4ZK2A 3CW2A 2H06A 2WFMA 4M54A 1VBMA 1SD2A 3I92A 3CSSA 1WETA 1QWSA 4ZRDA 3H97A 2WDPA 4H4CA 4RK5A 3TGPA 3MJ4A 3CNOA 4E0BA 3ROEA 5F1YA 3BZBA 1O89A 2HK8A 4UTZA 3DKVA 1OJLA 1OWOA 3TZQA 4RQBA 3PPXA 4H1WA 3LPAA 5KNBA 3LCMA 3N2KA 1I6WA 4QFDA 1JEQB 3PF9A 1XZQA 1A2KC 5B12A 4UTPA 4Q7MB 4MGIE 1KH1A 4W5OA 5JJBA 1XVUA 2I7XA 3GJ5A 1RRCA 1IBRA 3FPBA 1HL7A 3O8QA 1X14A 1LK7A 1OF1A 4DMFA 4L4SA 4G4SP 1A9ZA 1UCFA 3DP7A 4JVMA 2JAUA 3EA5A 4JI1M 4R7ZA 4JLMA 3ID6C 2PWBA 1C0IA 3OFSA 3E84A 4P92A 4AECA 3FVVA 3CU5A 4DSNA 4GRDA 1NJ2A 4MWZA 3QU9A 2OV8A 3AY7A 2P41A 4JLPA 2Q6VA 3O8CA 1F9AA 4K88A 3UT5B 4Z2AA 2J08A 2BGIA 1BE6A 4LJAA 1YSCA 3W8FA 3U31A 2W82A 2FMHA 4YR9A 2ZSKA 3SXUA 4EFNA 1IEXA 2P5UA 2RGOA 2OHVA 3VR1A 3FSEA 5AW7A 4BVEA 3HWSA 3T0IA 1E0AA 4HADA 3OE4A 5JEEA 2HPVA 1N3BA 3AI2A 4O2AB 1NBME 1LF0A 1K8XB 1AKMA 3A9VA 2QT0A 3R5FA 1IJEA 2QRGA 4J3FA 4X60A 2VPIA 1KPIA 3SN6A 1EX1A 5JI2E 3UAWA 3L7CA 1GYQA 3UA3A 2G25A 4RSGA 3L6UA 5JEDA 2RG1A 1I3OA 1R8QA 4PLZA 2OBFA 3BHJA 3H11B 1SFRA 3CUYA 1P91A 1AQUA 4LTMA 1YIDA 2UYQA 4BE7B 8OHMA 5ERGB 2DUNA 3SVLA 4WINA 1Z2EA 2VH5R 1JWLA 3WZ2A 5ALTA 2JLUA 5JS6A 3M9LA 2QRVA 3A06A 4A5SA 1WDTA 1QJ4A 3VU0A 3U60B 4Q7JA 3KHTA 5FOUA 2KNVA 5HF9A 4B3FX 2P68A 4GMFA 3JAWA 1A7KA 5JSHA 4NMWA 4I1SA 5TE9A 2C2BA 1JPUA 5JNLA 4Z9FA 3VR4D 3ZS9A 3FJYA 1Z16A 1JE0A 3QMMA 2GEJA 4FM9A 2D1TA 4LYHA 4BRSA 3LT4A 4M98A 5KYNA 1VL2A 3AJEA 2FR8C 3CE6A 5DHPA 4YAIA 4DAEA 2PAAA 1DJNA 2JJ8A 3FZGA 3RLIA 1JMVA 4NBUA 3R0XA 4GYYA 4KNWA 1O6GA 1WX1A 2P2GA 1BVRA 1Q02A 1Q91A 1HR0B 4HL6A 1M5RA 3WAGA 3LC0A 4QUIA 4Z4CA 2EFEB 3RBVA 3VKWA 3PV0A 3KOUA 5BOSA 2C8VA 3L05A 1OQAA 1Z22A 1L2DA 1K8ZB 5L3RA 4E1AA 4RFSB 3WHPA 4R2MA 4XX0B 1N1DA 3SXPA 1IRXA 4YRPA 3CSDA 2WC1A 3DPSA 5GIPE 1QTQA 3SQWA 1IY0A 2AXPA 3DBHB 4NF2A 1E2PA 3JQAB 4M1OA 1A9TA 4EUSA 2VIIA 3ZLVA 6YASA 3TOXA 3BS4A 2QDKA 2GO7A 4KIWA 4BLUA 1G17A 3CIFA 2GK6A 3OPYI 3V7UA 1HDOA 3EXHB 1EBBA 1JXMA 3GGDA 4XUCA 2E4VA 3AIIA 1YB6A 3EAFA 4UEQA 3Q5EA 5D87A 3ESAA 1RLJA 2R5FA 1U0JA 3VFDA 2Z2KA 4RM2A 1JLRA 1UINA 1PJZA 2UUOA 3KB8A 3T7DA 2EBUA 4UHCA 4TRJA 1YWGO 3K4PA 4AY2A 1CVLA 1XCBA 4K46A 3SZRA 2CVFA 1Y3FE 1I94B 2HQRA 3C3YA 3E9YA 1T2FA 3S1LA 1I3LA 3HVIA 4LRUA 3LX6A 1ZNYA 4FS3A 3HCCA 1IJBA 2XZDA 3JWPA 4BBZA 5IUJC 1V92A 2GNAA 1AHPA 4NOJA 2GAAA 3HK2A 2C98A 1X7WA 4CMIB 1EFRD 2XB6A 2GETA 4HTFB 3OZDA 2AZMA 4Z54A 1IQ0A 3HFRA 2PKYX 1EE8A 4OVZB 3OQHA 3L8DA 1OAOA 2DFVA 2I67A 4V39A 4J0DA 4DIKA 4C03A 4GLBA 4ZI7F 2F8LA 3T1OA 1N9GA 1M34E 2W11A 2FPPB 2PRYA 2R6FA 3O03A 3WADA 1RWXA 2RHMA 2B8TA 3A3NA 1CNFA 2ZPUA 4C4OA 2CZCA 2QL7A 3ZKWA 5FI3A 4G67A 4RM3A 5CB4F 1I24A 1MFZA 3KQUA 3TTSA 1BXRA 3QQ5A 4OYYA 2AX3A 4B40A 5A3VA 2AT1A 2OCLA 2MYNA 1RBZA 3KR9A 2WIFA 2IPXA 5BQXA 2KQUA 2ZSDA 4UDYX 5DNWA 5C4MA 2LD4A 3PFIA 5BW8A 3BJEA 3BF8A 1UT5A 1SXJA 1N5LA 3W2IA 2YWFA 4RLQA 5A3QA 1GGVA 3A42A 1AUAA 2WJYA 1STOA 4HNSA 3IXLA 1X8XA 5CLIA 3V48A 2DENA 1W4LA 5G0TA 2R6R1 1PTJA 4AZSA 1EJ6A 3ZDZB 1TU0A 3VDNB 1E7MA 1CY2A 4I46A 4UOZA 3VR6A 4R6WA 2ATEA 1VLHA 2P2DA 2YJTD 4FFWA 2HA6A 3LW8A 3FY4A 2BIFA 2D2EA 5T4FA 4ITQA 3VSAA 3CX4A 3DMGA 1XLVA 3NOQA 3A0UA 1H0KA 2JY8A 3WDMA 3CUWA 3S70A 1ZA2A 2A0YA 2JZ0A 3P9XA 4BGUA 3J81A 5JBQA 5LP6F 3ZWYA 1TYDE 3NOVA 5DN6A 2FZWA 3OQ1A 5IFLA 4FOTA 1KI6A 5F4BA 3NCTA 2G71A 2POCA 4M86A 3T7IA 3PVSA 2OC4A 3LTNC 1L5HB 4FJ2A 4YCBA 1E9CA 5DYTA 3LTEA 4CQNA 4BMNA 2F8MA 4D56A 1JE1A 4EI9A 2GHQA 2J85A 3H9CA 4LI0A 5ALPA 4EHKA 3ECSA 4RETA 4RHEA 2FAXA 1PFUA 1Z2OX 3AUUA 1E62A 4Q47A 1UT8A 1SXGA 3A6LA 1ENPA 1GZ3A 3CX7A 1PSWA 2OFWA 3QEJA 4ISCA 3EPHA 2R11A 3DVAB 5IP5A 4GBED 3ZZ1A 4M0LA 4LF9B 1V33A 3W8RA 4C6TB 4JBIA 4IGEA 4P4LA 2QJOA 1KR2A 5JAIA 3W4IA 3KT0A 1JMYA 1RAAA 2EKQA 3PP8A 1QH0A 3EULA 1LLCA 4GZMA 1ZIOA 1H6CA 4IM7A 3PCXA 3FR8A 2X8WA 2ZSHA 2JLZA 3DO6A 4QBFA 2ZI9A 1NKSA 4I9HA 2JD2A 1VXRA 3D0OA 4G4RA 2BFCB 3B7PA 1E9DA 3CW8X 3MJTA 1FSZA 3NJ8A 3B3GA 4Q4AB 4J6EA 3TB4A 1YH3A 1LSUA 3KQQA 2FRDC 2Q1UA 1NZDA 1ZJ6A 1Y5MA 3Q3JB 4F8JA 3VBCA 1LSSA 3KZXA 1NXXA 1WY7A 4OQNA 2OGTA 3L04A 2VPYA 2AI2A 1LLUA 4R69A 1M2OB 4XJVA 3HI4A 3DOAA 3NG1A 2XB2A 1LNSA 2O1XA 3W9UA 5AKHA 4QICA 1A9PA 4RSMA 3G5UA 3A36A 2N35A 1J9EA 1TJ3A 3E22B 5FD8A 5IC6A 1QHGA 2AH5A 5BNIA 3WKBA 1IUKA 2R68A 4LJRA 3G89A 1EUZA 3QPVA 4MV3A 2JG3A 4D9IA 3Q41A 3R9XB 1KAMA 4MDFA 1KORA 5JVDB 1MOZA 3LC1O 3KXPA 5LOVB 1UPCA 2BBTA 1TW3A 1LWNA 1KDOA 4AIIA 4URXR 4XWOA 1OV6A 1XZKA 3OZ7A 4UULA 3NDIA 1M8PA 2Y4OA 5E38A 4IL5A 1KS9A 4UTOA 3H4TA 2WK1A 3ZE9A 1R0LA 2GRAA 2GFQA 3BWYA 1IY9A 2HEGA 1S96A 1ZD9A 1GTZA 2A5JA 3GLHE 3GJ4A 4CKCA 4DCOA 1Y81A 4JJZA 2HO4A 4Z1MD 1U7OA 1F8YA 2BKAA 4MUIA 3V33A 4GU5A 1U2PA 3B9BA 4U2BA 1FS5A 5A0FA 3VH4A 3N87A 3USES 3NOXA 4HEOA 1QTNA 1IXZA 5IT4A 1M76A 2XMCA 3RYIA 1I5EA 1NMYA 3MLAA 3GQBA 4E2WA 2NUPA 3L26A 4PYIA 3U7JA 3I5XA 3WYCA 1ZM4A 2GJ8A 4GXNA 2BKLA 3IVXA 3VUFA 1VL0A 4FWIB 4P3OA 3MPUA 3AF4A 1WS6A 1XA4A 4ZU1X 4U1RA 3SAWA 3THSA 5FWAA 1D2NA 5I01A 4ZYZA 4LSWA 4XB1A 1FL9A 1CFZA 3KHSA 4KBYA 3G85A 3OIUA 3C1TA 2CKDA 3MLBA 4P93A 1C80A 3FDJA 3OKPA 4MVJA 1UMCB 4FHCA 4AY5A 3Q7TA 3C2QA 1JQEA 4MUNA 5KWIA 2H65A 1SOMA 4DR5M 1WLYA 3DTTA 1D5CA 4BECA 5HE8A 3AT1A 5JS8A 2OC9A 1I2DA 1XRRA 3L7NA 3VHRA 4YAWA 4KL8S 4WXEA 1XTBA 3U6KA 4Q1DA 1M8GA 2BY4A 1JG6A 3BCHA 1QHHB 1C0LA 3TFOA 4FTWA 4JR0A 5DIFA 5DEIA 1F8GA 4MUGA 3FTDA 5CXXA 4X91A 3EIOA 1HZZC 3ZLTA 4FYXA 3TZCA 3LU1A 2NXJA 2OO9A 5KCMA 5IJ9B 1WG8A 2AR9A 2IZOA 1R4GA 2FMXA 4CTKA 2G40A 3TEJA 2NADA 1K27A 4B3TB 4CGYA 1JS1X 1UBGA 1J09A 4Y2SA 1HDCA 1L9XA 1RZRD 5LLDA 4N9WA 3HABA 5J40A 3S5UA 2A3NA 2PZFA 2NZJA 1UXHA 4KFRA 1ZOIA 2HSJA 2GASA 2J59A 2QSYA 5JYDA 1T8WA 2Q4EA 2ZT6A 5HIKA 2KSQA 2WPDA 2J9ZB 4OAQA 3GWGA 4GYJA 4OLBA 2AL7A 3IG8A 3QW2A 5FAKA 3LQ1A 2V7WA 2HBYA 4G09A 1E3MA 4P0PB 3DAHA 1TO1E 3ON5A 5AKZA 4WNYA 1M73E 1WNFA 2HWJA 2ACKA 1RHJA 5KDLA 4RANA 4DA0A 2UU9M 4J0FA 1U2TA 2QW0X 1ORYB 3BSYA 4E5NA 1P4JA 3N2KB 4FXOA 1S3GA 3FETA 3OUTA 4BTEA 4BTLA 1T4MA 3MT8A 4TPKA 2VS1A 4YY3B 3NGMA 4J49A 3GRZA 3IJRA 4F6LA 2FLVA 1ZIYA 4CF7A 2JAPA 3FFWA 5JJCA 2CNDA 1AZLA 2J0SA 4J3JA 5LZ7A 1XIVA 4LMRA 2VF5X 3O8QB 4HDQB 1RXSA 3H5VA 4MMYB 4B9EA 1OBFO 4RZ3A 4PIMA 2X7JA 2MSDB 3B1XA 4EGSA 1BFDA 4YXWD 3DZHA 2XSZA 5KTYA 4TS3A 1XRMA 2OHXA 1EU1A 4ZGGA 4IUYA 4JJEA 3IVGA 4CDMA 3OEYA 3CGWA 2Q3DA 1J2YA 2F3RA 4RPIA 3S27A 4RQUA 4OGKA 1AV6A 3FVQA 1YJ8A 4NZNA 1GT91 2G4CA 1F6WA 1OB2A 3WMRA 1IAVA 2NZ8A 4FN4A 1CRPA 3FW1A 1L7BA 2F1KA 4I5DA 1PEYA 3U9LA 1RIIA 4KO4S 5I51A 3OX4A 3SXUB 5BR7A 4C0SA 2EKLA 4G5FA 2VF7A 4J9VA 1YL7A 4PSAA 4PHTA 1JHZA 1XDUA 3UAVA 3EVBA 1YUMA 1AHIA 1M74A 1NJFA 5KNDD 2CXTA 4L75A 4G8CA 5LZ2A 2F00A 3AG5A 1B16A 5CXQA 4XGRA 1Q0LA 4DGQA 4FYKA 4FS8A 4X8HA 3U09A 4DSTA 2XUIA 4KIUA 1RC8A 1ETUA 5C8XA 1NUPA 5LMUB 2ETVA 1QDEA 1KOGA 4FDMA 2IP2A 4M1TA 1TGVA 4EVQA 2R45A 2ZBKB 2EDAA 1AKWA 2FPSA 4ENTA 2I2WA 5BV0A 2QJTA 1WHCA 3E0QA 2DWMA 2E1PA 4UBOA 1RKVA 4JKOA 4CLOA 3W7VA 5D3QA 5F9MA 1T3SA 1MAUA 1T4DA 3OO1A 2Y0PA 1ZW1A 2QRVB 1SOVA 4Z1OA 1E2FA 1T9AA 1Z4JA 2X5NA 5FLYA 4Q7JB 4I9NA 1NFFA 3GD5A 4KDEA 5LU9A 4EECA 2H7XA 5CP8A 4PINA 1ZK4A 3FCOA 3JAWB 1RMQA 2A7QA 1GR1A 1MPTA 2QD2A 2WAMA 4CMCA 4D3SA 1MCZA 4C6RA 5T4BA 1KYTA 3EIEA 5BV2P 4NMHA 1S4QA 1T34A 4XCXA 2WF7A 4XVQA 1IN1A 1I2MA 4RIHA 2VP2A 2P3QA 5TPZA 1BHO1 1F5SA 4UM7A 2VLIA 1MQ8B 3MB5A 1PUIA 3L0OA 2YV5A 2O23A 4RV9A 2PMEA 2O2YA 5I9SA 2XQIA 4OHYA 1SHTX 4M9UA 3VI3B 2WVHA 3R5KA 3QJ5A 3VKGA 1T2DA 4BC1A 2YXBA 2HTFA 2YHBA 3BFPA 2H6EA 4J4HA 4HFJA 2GZRA 3IKTA 5BOSB 4IAOA 1WOYA 4R5MA 5BSGA 3KJQA 1IB6A 4G01B 1DCFA 2FZKA 3W6PA 1X1RA 3QU5A 5FX2A 1ZWLA 1GVNA 1WXHA 4KXYA 4N5DA 2PGDA 5LQDA 1NHGC 1Z36A 3THOA 3ZVKA 2ZM6M 3TX6A 2IHUA 2IY9A 4RWEA 5KB3A 4KC0A 4YHBA 1EGQA 5ECWA 1PR3A 1VCNA 1U7TA 2F64A 4P84A 4XSVA 3L43A 3TJRA 2D4AA 3NAQA 1V8FA 2LWXA 3HBNA 4EUNA 1JXOA 5L6LB 3TB6A 1RYHA 3ZK9A 1GAEO 1GGJA 4UAUA 3IVCA 1GLNA 3W6OA 1NUAA 4HWPA 4JIGA 1E4YA 3Q0IA 2J5RA 2D2XA 5KDDA 2OR3A 3QNUA 3P0HA 4D8TA 1KYVA 4HAUA 2VUTA 2DGDA 1W9HA 3DG9A 1G1MA 3TTXA 3CH7A 3P0JA 3SLKA 3E1GA 3ZNOA 3A58B 3FYUC 2JKYA 2R4UA 3WC4A 3VV2A 5HIIA 3EZNA 3OURA 1X7WB 4PLTA 3ACCA 3SMPA 2BMWA 4M49A 2A30A 1Q0TA 1JHXA 4K81B 2AG5A 3TR5A 5G3YA 2OHHA 3NHSA 4G0XA 1UBUS 1HMYA 2EO2A 3AJRA 2XXAA 4CI0B 1RRGA 4IIJB 1Z56C 2FR1A 3URKA 3IT1A 1U0TA 4FE3A 3Q7IA 5ITUA 3TECE 2B0JA 3KJIA 3SOPA 4D9JA 1LW6E 2TMKA 1T8UA 3ZDYB 1SKAA 3ZCSA 5COQA 3RW9A 3S2UA 1XZCA 5KQDA 1KQPA 4G85A 1N9GB 2ES4A 2DKLA 3GLFA 2YV3A 1MENA 5AM4A 1JX6A 1YU6A 3V3KA 5CFZA 3ESRA 2Z09A 4WAUA 2CNKA 1A1SA 4KV7A 4HNGA 1UPAA 3VK7A 1RNLA 4IIGA 1QUTA 1OFUA 1RI1A 3ZKWB 4ZAXA 2JFGA 4H6PA 2XUAA 1EHYA 1Z9BA 3RRXA 4TZ6A 3ENWA 1Z5ZA 1BXRB 3QHAA 5LQCA 4EWLA 4RVNA 4RUKA 1XK7A 1CRZA 2IQ5A 4C4XA 2XE6A 3GXBA 5HUQA 1UKYA 4OHPA 1CNEA 4TYWA 4I8IA 2ZBDA 5A3JA 1EVYA 2XKKA 1SXJB 2H0RA 1A98A 4QTZA 5KC8A 4AL4A 4C3VA 5I8ZA 1HE8B 4Z4HA 2D2IA 5CDTA 4B6JA 2AN4A 3TLBA 3E21A 2WP0A 2RCNA 2C9DA 2FH5B 5C2JB 2VQFM 3TSZA 4Y7DA 4BJ3A 1K66A 5IM4A 5CB6A 3MCWA 2VDPB 2PJZA 1Z5CA 4L6IA 4C0HA 4A8JA 3KEMA 1U5AA 4MA5A 1GUFA 4B3CA 5JHHB 1HZJA 2QLBA 4DLZA 1FLDA 1G4HA 4YDQA 1ZOSA 5DX1A 1K8QA 1KI6B 4P17A 2OLEA 3STVA 3VYWA 4RKRA 3J2PB 3JYQA 2F7SA 1S2GA 1Z6AA 4XYEA 4N9QA 2J07A 1KI3A 3OJXA 3ZDEA 4PF1A 4MQUA 3W9YA 2RAVA 3IOCA 3FZEA 1BKSB 1ZR2A 2KI5A 3WBKA 1K7FB 3BORA 1WV1A 1UM9A 3JALA 2FKAA 2OCIA 3FB1A 4PCLA 7AT1A 1EXDA 1GV1A 3GLUA 3VOSA 2WTBA 4MKXA 3EXHA 3CCBA 4O0LA 1CQJA 5EE5B 1XRJA 4QE3A 1R9GA 3HI6A 3MS7A 4XLLA 3U7EB 3F1KA 3N6VA 3FVRA 3PJRA 1F17A 1YQWA 2XHZA 3IT2A 4DDHA 2CXRA 4MJLA 5AW6A 2D7CA 1JH9A 2JFOA 1QG4A 3K15A 3Q3HA 1Y1LA 3LZDA 5FFNA 5DI3A 1E3SA 1R15A 4F2HA 1PV4A 4LF4B 3EIFA 1L0BA 1F4LA 2GCOA 2A9KA 4EY4A 1E3DA 4JMLA 4BU0A 1MU5A 2BR3A 1T0UA 3S4YA 5DEOA 3O1HB 3DM5A 5ECDA 3I2FA 1P5RA 3ZR4B 2ECOA 5M04A 1NR5A 2GJ9A 4LYGA 3GDHA 1YI8A 3JR3A 3E8SA 3QNMA 3ZU4A 1FQOA 3D8TA 4UXIA 3M1AA 3IUMA 2IHJA 4I5FA 1KE1A 4E5KA 1YV9A 4G6ZA 5T7BA 3ZBPA 3BMXA 1YC2A 1H0SA 2RHGB 3QGMA 1SZCA 2PGOA 1CZRA 5EJ7A 2DPHA 4AUKA 1MJGA 4KRGA 3P9PA 2C0CA 4M36A 1NWCA 2I29A 4LXXA 4BVAA 4MGZR 1JQ3A 4RTNA 3BTUA 1MB9A 1GUDA 1UMKA 2WD8A 2VT3A 3ZHCA 4P34A 4CG2A 2ZRBA 5HIJA 2FPGA 3TQSA 1U0BB 1Q39A 3R2JA 5GMOA 2BGGA 4IHJF 1H23A 2BWEA 4LHEA 3UF0A 4NOMA 1OLUA 3EBLA 4COKA 2FW8A 4DBGB 1XHEA 2Q5QA 3F7TA 1L8XA 3UV7A 1D2CA 3O3MB 4MICA 3ANMA 4D45A 3C5EA 2V97A 3EQ7A 1I01A 1JF8A 1ZM7A 1M8JA 2J4FA 3R3WA 1K92A 4E1VA 3OUUA 2I65A 3SM9A 5H9VA 3HNPA 2ZXEA 1R7RA 3T5PA 2HJRA 4QTUB 4ZK6A 4R7TA 1BMDA 2CVHA 4S2EA 3Q7SA 1DP4A 2WSEF 5FADA 4OUKX 4JYMA 3QX8A 5LD2B 3A98B 2L4EA 2AQKA 4CKCB 3SWWA 4G37A 5KEIA 3ZDAA 2CE7A 4PFKA 4FOSA 3LV8A 3LYHA 2X3FA 3A4MA 3T52A 4NYMQ 3FUTA 1LF5A 1YFKA 3KKOA 3K1JA 3RYIB 1AXGA 2C31A 4LDPA 3GQBB 3H8VA 2XECA 2NUPB 3A1UA 5L6MB 4U39A 4Q5IA 2A7XA 4OV6B 4TM7A 1JDVA 2G0TA 3NBMA 4EW3A 3V76A 4HSEA 5G2OA 4DKXA 1YUNA 2EUCA 4HWKA 1UFRA 1LPSA 1W0CA 1FU7A 1RHKA 4CODB 1QR6A 4HV4A 1SUAA 5IAEA 5JMPA 5FWYA 2C9YA 3RO7A 2C1ZA 4OQMA 3IEMA 3OG9A 5FBHA 1SVKA 5EY5B 1D4OA 1SQ5A 3LP5A 1GLVA 4MB2A 5FBRB 5F35A 3VX3A 1RE1A 3Q9UA 3OA2A 5JY1A 3LSTA 3L7MA 1YACA 2CHGA 3A46A 4N0QA 1U90A 1XELA 1GARA 1A95A 1C1DA 5CDUA 1N6KA 2QS9A 3BAZA 1Y3HA 2EU8A 3QKTA 2HMSA 1F8FA 3ST7A 2JK0A 5CDYA 3EH1A 3U7FB 3BEDA 4BZPA 5A4FS 1XKLA 4PCZA 2Q5EA 2ZIXA 2AMJA 2PE5A 4B3MB 5G1NA 5EIAA 2DX7A 3AVXA 5A04A 3RBZA 2QY6A 1MQSA 3T3NA 3CNLA 4LDZA 1IL0A 4CGYB 4OU7A 2XMRA 2ZSIA 1IQRA 3FB4A 2X42A 1LQ2A 5ICMA 4DB4A 1BX1A 4UBJA 1E0SA 1F2TA 2R62A 4DARA 1T1IA 2HYIC 1T6OA 3P32A 4ARBA 1RR6A 1T3LA 3UC9A 5G41A 1NYTA 2P7IA 4AKSA 4H7KA 5A0VA 2ZRFA 3B48A 2ODTX 4FIDA 2ZREA 4E6PA 2D54A 3BBZA 2OE2A 5ES3A 3NM6B 2RI0A 3BVPA 2RHDA 2YR0A 2HA3A 1W93A 2PT6A 4I50F 3DXZA 5IVKA 4HZGA 4TMFA 3SGLA 4IGAA 1N92A 3OTIA 4DR6M 2QYHA 3VR5H 2YRFA 4Y2RA 3C7KA 3UH1A 4L5AA 1GQ2A 1ORHA 2YINC 5J5CA 3FWNA 4QDTA 1GT6A 3BH6A 5JCPA 4ZZ3A 4PX5A 2C9BA 3WNBA 1WUYA 5BSUA 2Z5VA 2CXUA 2XGOA 3CH5A 1AUPA 3QVOA 4LJLA 5IN5A 4G2TA 3ENNA 4RNDB 4DLWA 5ALSA 3OD5A 3WGMA 3T9BA 2FZ4A 3IAAA 5T4EA 1GPYA 2Y1EA 4GI2A 3W5SA 5J2TF 1P8JA 2Y0TA 2WM8A 3T6PA 4FN5A 4O4HA 3FI0A 1CUUA 2E48A 3THXA 3IQZA 5CFMA 4EB0A 3B70A 1JECA 1GKUB 1H4VB 4C89A 3I76A 4B6PA 3BGDA 3L3BA 5FI5A 2JZCA 4PVCA 3AB3A 4EO4A 2H59A 4L8GA 1KI7A 1JQLB 3GGPA 2IU6A 4K26A 5KYWA 4QGBA 4B3XA 2PDAA 4ND3A 3UEOA 3ZBTA 1TTEA 2C2ZA 1G9SA 3C41J 1QPZA 4IKOA 5DWVA 1DAIA 4TMXA 2P35A 3PE3A 4M7RA 3D7RA 5T64A 1T5BA 3JARA 2Q50A 3PHGA 4BQNA 3F6YA 2RHWA 2PZKA 5KTNA 3K9NA 3H99A 2HSEA 7ABPA 4UBLA 3QLTA 4Q03A 1V3TA 5CG1A 3IFSA 3R6GA 4AWBA 3R7NA 1DQNA 2JIMA 1W30A 2V6ZM 1E6WA 2EWWA 4CLOB 4A0GA 2ISCA 1FQKA 4WKCA 2F1HA 2CNWD 2X7HA 4HUTA 1KRXA 4B2YA 4XX1A 1YBMA 3ETCA 3L4BA 5DO9A 3P9YA 2IW1A 5KTTA 3OZCA 4DQUA 4GSKA 5HCNA 4P5DA 2QJRA 4ZAWA 1XCMA 2L2QA 3GELA 1YSYA 2I4NA 1GHTA 4JKIA 1RAEA 4E5UA 5F12A 3CSUA 4HNUA 3WYDA 2ET6A 3FNBA 1T1RA 3ZVRA 1EZ1A 1Z82A 1PNQA 4IF4A 4WXYB 4FCWA 1DV0A 5TS3A 3K05A 5LL6P 1LX6A 2C29D 4RTLA 2SKEA 6PFKA 3HCOA 1N8SA 3ADOA 2CLOB 1QHXA 3I64A 5JR3A 3AVUA 3QX3A 4KN8A 5K3OA 4OQEA 4HXYA 4KLNA 2ZUEA 4XOIA 1Z06A 1K3XA 3HP7A 4BQIA 1ZD8A 2ACEA 1NDUA 2BRUA 2JCGA 4NBWA 5G0VA 3E61A 4E2YA 1PZHA 4MWEA 4JUFA 1UK6A 3L0YA 3LUGA 1V7PC 1M2JA 3C7TA 1YR3A 2HXSA 3ZD6A 1GVNB 4GOND 2ZUFA 1KH2A 5T3YA 5A0TA 4ZZ2A 3UKJA 1WXFA 4F3NA 4TXHA 1TCBA 4EBFA 4DPLA 5DCLA 1O95C 4MVXA 5HKAA 2WG1A 4TGLA 1M5UA 1IIRA 4D3ZA 2KRUA 1XHFA 1VIYA 1SB8A 3WYBA 4N49A 1QX3A 1LI7A 3L8FA 4XDZA 3FBWA 1OSNA 4ENSA 1WQ3A 3EC1A 3NXKA 3RS3A 4D9GA 2UUPA 3QW4B 2XT6A 4CT4B 2OZPA 4FUTA 2E4WA 4NARA 3ILXA 4MW0A 1XI2A 1L8AA 5ILOA 1E9VA 4ACAA 1I7QB 1P44A 1I1QB 3DW3X 1W581 4IJKA 5NULA 3L7LA 4OHWA 2VHVA 1V1MA 3QVKA 2IH4A 2P8SA 5K3CA 4MQBA 1O08A 4KYIB 3K16A 1PLLA 1CPYA 4LRXA 1L4UA 5D86A 3RHTA 1ZYUA 2C4UA 2W4QA 3DQZA 4WN9A 5JYCA 2CKMA 3Q9LA 2RHTA 1U80A 4JB3A 1T25A 2ACWA 1QQ5A 2R65A 2VRNA 2FWJA 2GZ1A 1R3UA 2XXAB 4MW7A 1DJLA 3IERA 3D8SA 4TTQA 5KVAA 3GT4A 5AKJA 4KPEC 3PD1A 1WPRA 2OQRA 1FP6A 4FGJA 1PCXA 5CCBA 3RJ5A 5CUQA 4FSHA 1DG3A 4ZTZB 4MSUA 5BUCA 4C7OA 3GLFB 3N76A 2XB9A 3GQVA 1FUEA 1TNDA 5HVNA 3PC7A 1MHPA 2VXYA 4HRXA 3AR4A 1CUYA 1QUEA 4LXYA 1K5PA 1S8NA 1H5UA 2ZGVA 2Q29A 3BXPA 3L0ZA 3GWZA 3OI7A 4JI3M 4UTRA 5B4TA 3SDSA 1JEDA 2CVPA 4II2A 2G63A 3E4RA 2HD4A 4AICA 1U8FO 1JAIA 3ECCA 1W36C 4RE5A 3TRIA 4EK9A 1OIXA 4YDRA 4LV6A 3B53X 1DT5A 3Q88A 2ZK7A 4YP1A 2JGRA 1X1TA 2FX2A 3TLCA 3HL0A 3SBJA 5I8PA 3N74A 3NHKA 2QM8A 1JIIA 4V02A 2ZBGA 1UC9A 5FRDA 2PXHA 4K2HA 5J58A 3EVAA 2O20A 2PSDA 3HY6A 2JCVA 5E7QA 2IZ1A 5IC5A 4A8JB 2O7RA 1G20E 2BAGA 3K94A 2PO7A 1C14A 1BE8A 2CWDA 3DLAA 1SG6A 1EK0A 2QRNA 3CRZA 1GAWA 2VOJA 3IQFA 2UUBM 3UGKA 1Q1ZA 1UBKS 4BKPA 1X74A 4UNSA 1NMXA 2CUKA 4KI0A 2BJVA 1MOSA 1RKUA 4EJFA 3H3JA 4JLDA 4YR7A 1XQ6A 2B5VA 3VSCA 3M81A 1J22A 4FZRA 1VE5A 3UV3A 1OTHA 3HKDA 2IELA 3PUHA 3W2GA 1UM9B 3DBOB 3ZDRA 2NYAA 3ESBA 5CGQB 1G4AE 3JALB 4RELA 3DZKA 1ZDMA 1N36M 4PU0A 2G36A 2IYQA 3WQHA 4CKYA 1V8DA 2J9XB 4BLOA 5TQVA 4D3YA 1CQJB 4BNLA 1ILEA 1TJYA 3LY8A 3CRMA 1ZSNA 3BBLA 2UVDA 2QKYA 3LPLA 3E9RA 3NHLA 1BGXT 5H1YA 2YVQA 2EJVA 2YOGA 4IOJA 3ZJ5A 3PGLA 1HE1C 4LRSA 5DI3B 3VKUA 2OO3A 1KYYA 2EBWA 5ITVA 3EVGA 5LWQA 2RHJA 1SRQA 1SQSA 3U61A 4DY6A 5HIMA 4RMIA 1VXOA 2AMLA 5C7YA 3KXIA 2GCOB 1YRAA 1HQYE 2WU0A 1HT3A 3QXHA 4OKNA 1ZCAA 4EMUA 2EZ4A 2VG8A 3A26A 4EA6A 4FDLA 3OLCX 4XD2A 2G82A 1BCRA 3VTKA 1XPJA 3NWLA 1HC7A 1P19A 2P1RA 1QZTA 2BBWA 1F8UA 1U3UA 2QE6A 3SEZA 1BWRA 3H2SA 1DTWA 2GBIA 4DRXA 1JFSA 3OQVA 1HE2A 2CC2A 4B3DA 5B6PA 4IIJA 2FW0A 5BR4A 4TL6A 1QIEA 4Q7LA 1XTTA 3ROMA 3TQRA 3AUAA 1U7WA 1I33A 3TI9A 8MHTA 1BXKA 5ALRA 4LMAA 4IUBS 3ZQUA 1L4NA 2PRKA 3D6NB 3V42A 3GRAA 2BKEA 3B82A 5LA6A 1EUCA 3JYPA 3HY3A 5T6BA 4KXLA 4BWGA 1M66A 3T15A 2D8MA 2P1ZA 3NFYA 2Y1WA 3H2JA 2PX4A 1Z8HA 1Z63A 5JLAA 5DTQA 3MWFA 4LMPA 4YRRA 1L4MA 2FPGB 1Y1KE 2IDMA 1JILA 3FUWA 5P21A 2JANA 2I55A 5AK3A 4ZOQI 2BSXA 3ROGA 5MN6A 1OLUB 3ZWCA 3UMYA 3QIAA 4ODIA 1IMOA 4B7FA 2DHCA 4EMTA 3PSAA 1XNRM 4CIYA 4P80A 4MDHA 4P35A 3F7OA 3GEMA 5JDCC 2RC6A 1LPMA 2H7YA 1KJJA 2NQ2C 4AUMA 4EP1A 3MB8A 4EI2A 2IYXA 3P71T 1P0PA 3LI2A 3IL2A 2ZU0C 3HX3A 1SJ9A 2QL9A 4OSEA 3REQA 5CM2Z 3GRKA 1YAHA 3JQBC 4MJ7A 2HEIA 4TYQA 1CK4A 2H4WA 1LV8A 3GVHA 4BB9A 4OREX 5HJ2A 2Q4RA 3L46A 4MS3A 4KO1S 2BMDA 4XYMA 3KRTA 2LKDA 4OVKA 4FKZA 3O83A 1USGA 3TZKA 3SZGA 1ZG3A 3BKWA 4P0TA 2V5UA 5ELMA 3BIOA 1IXYA 3QI2A 2OENG 3E5MA 1LJLA 3N5KA 4AJKA 4J7UA 1QU3A 4IWXA 4OAOA 4P3NA 4TTSA 1W6RA 1SC6A 1VI5A 3C3DA 2H4FA 1M2HA 4R98A 2QR3A 2EL7A 3HB1A 2IX9A 1VM6A 2GT1A 5T4HA 3DL4A 1R8XA 1T4CA 3FE2A 1KI2A 3EGEA 5JPIA 5AUPB 4F8YA 3BL8A 2VATA 2PK3A 5FWYB 4FHGA 3MLEA 1LI4A 3D7MA 3I05A 2VK2A 4LV5B 3EGIA 5KSWB 3M4NA 3MUEA 3BF7A 4M83A 1HT2E 4LDJA 4F06A 4E4TA 1J0DA 3FBTA 3RYFB 3UBMA 3FMGA 4DSZA 2JY7A 3UOWA 3L1VA 3RS4A 1OXBB 4EY6A 1C1DB 4EG5A 1II9A 5AI5A 4DV4M 3ENZA 2HA7A 3I51A 4NONA 2JFVA 1IK4A 1RAFA 1T9GR 4D92A 4BATA 3JAMA 3WS7A 3ZWNA 5B1SA 3HA5A 3TW8A 4LDRA 4S1PA 4ROTA 3CRRA 4BNFA 1A7AA 1F9EA 2ZIXB 3FGZA 1HL3A 7REQA 1V6SA 3G2QA 2B4QA 3L7AA 1KOLA 3E9MA 1DAKA 3UMMA 2YYZA 1T10A 2QUKA 3QLUA 4Y67A 1P2GA 3SQMA 5JW6A 3W8DA 4PYNA 2XF3A 1ZGZA 3OCUA 1Z0DA 1K6XA 1MDFA 3OEED 1F2TB 4CF4A 1XG5A 2J3MA 1VGVA 3QY0A 4LSZA 3ORRA 3O38A 1SQGA 1JYEA 1TZBA 3DGEC 4G0MA 2BL4A 5C81A 2NUTA 5F73A 5CVVA 3FPCA 4ZCSA 5TJ9A 5B58T 2PN1A 4PPQA 3RUCA 1CDOA 4XGKA 4DV3M 1CKEA 3TVYA 4NV1A 1DC4A 4OHMA 5KQ8A 2DAEA 4ZAVA 4F2LA 3GEEA 4TQUS 4PAMA 5F1PA 1GNLA 1AXRA 3AUXA 1U1FA 2MJ5B 4YQFA 1PJTA 3CT4A 1TUEA 3AR9A 1D7OA 3D5QA 2I2XB 1D1PA 3RT1A 1XDSA 1BRTA 4WNCA 4GI5A 4EHFA 2C3OA 4JVOA 2IHYA 5H9WA 3D2CA 2PUEA 2PQ6A 1G9TA 3VPDA 5HFJA 5FWNA 4EPTA 4X90A 3L0SA 1JHYA 3FTFA 2FUG6 2QNJA 4Q82A 3WGLA 1XVAA 1KJNA 2WYUA 4B08A 5BNTA 2NAPA 4JQYA 5LDHA 2QJWA 1CJUC 2CJPA 2XNDD 4O4HB 3PE6A 4I4NA 3SKYA 3THXB 2YVUA 4NU8X 2ONKA 1Y9EA 1GTMA 4JP3A 4G4JA 4PTZA 1UEIA 5JANA 3CPJB 3KZCA 3M5WA 2AFIE 4HLCA 1LNQA 3EVZA 2YJZA 2JAXA 3M89A 2IEIA 4H6WA 5KYWB 1TTQB 1E9SA 4UM9B 4K0KM 2D0OB 1P1FA 2GYWA 4H7IA 3ICPA 5IJWA 2C97A 3O2NA 5C35A 2R7MA 1NW7A 2GHTA 4FIZA 1YVEI 1FDOA 4EL5A 3CLRC 2AYZA 2H5IA 2I4RA 3JARB 1D0SA 2XJ4A 4Q3KA 4P1ZA 2RHLA 4M46A 1U0GA 1SNYA 3T7KA 1XV5A 5I9MA 1Q2UA 4W4TA 4NZOA 4I6EA 3TXYA 2BJHA 4KQFA 2YW2A 4OA8A 4PPGA 1QQAA 2QD1A 2DAGA 4FGLA 2OORC 1IVNA 1KHHA 1L7EA 2C4HA 4RPLA 2BGWA 4FYPA 1Y4ZA 2IWRA 5KWVA 1NNJA 3U6DA 3NRCA 1VIAA 4L72A 2ZBRA 4GMHA 5DHTA 2X13A 2MR9A 1T6NA 4QLOA 4BHTA 1HT1E 1VRVA 2HBZA 3IBTA 5BUSA 1UKEA 3MTEA 1C7JA 4Z7NB 3VX4A 4A6XA 3MVEA 3I9V1 4NZZA 2W6NA 4ESVA 3W1WA 4LQ4A 5FOQA 1DHTA 2XWJI 1PR5A 1IHPA 2ZWIA 2JRLA 2R4QA 1BC5A 5F77A 5BQPA 2JLCA 3BAFA 3AFOA 3PD0A 5FLKA 4QHYA 3IIJA 5JCOC 9ATCA 3GRFA 2Q9AA 3C3BA 4EEXA 1NAIA 3G2JA 4U3JA 4KPFC 4EO9A 4R2KA 4ZD6A 2ST1A 1EA7A 2CL0X 4WEQA 1A9SA 4P4TA 3KNZA 1F0PA 2F5SA 4WZBA 4RTRA 3ZHOA 3GRYA 2WYHA 5I48A 5JTTA 1AGXA 4FQ8A 4YPVA 5FTMA 3GVXA 1D4ZA 4DV2B 4XLTA 3UMBA 2FZCA 2ZRQA 4NYMR 2WSYB 1IZ7A 1JQJC 2FA9A 5HX7A 4F12A 2D7EA 1LZKA 1UODA 5B5SA 4OQLA 2QVZX 2WUEA 5E9JA 3L8ZA 4EITA 1BROA 2G6TA 4EHBA 1NDHA 3F71A 2ZS8A 3PUJA 4ZI7B 3CLUC 3H0CA 5DBEX 1XQYA 2YMQA 3L6DA 4KIGA 3CXUA 2G9UA 3DKIA 1S3IA 1G7RA 5LNK6 5CDFA 2XRZA 2PUVA 1N1EA 3BJRA 3BCUA 1GNTA 2WNHA 3BFXA 2RGUA 5IJ0A 2RGCA 4HEJA 2RGNA 3FPKA 3A6EA 3MGKA 4WA7A 4BIMA 2FN8A 5BN3A 2WNSA 3HCRA 3TPFA 4BN5A 1TE2A 5BSTA 4UUBA 1XMPA 5M7EA 1DIOB 1N2XA 4NV0A 1CR1A 2ZCJA 5L4SA 1E5DA 1ZMXA 3WA7A 5ARDA 2J09A 1JJ7A 3A9SA 2VH1A 4ZYVA 3WWDA 2ANBA 5EIBC 1UBJS 1KVQA 3CF2A 2B4RO 1M0WA 3JZAA 5FIUA 1ISJA 3FIUA 3U7RA 4JYAM 2D06A 1V1MB 5C3MA 1H85A 3B5JA 4P9NA 1Y1QA 2PWPA 4M3NA 1ZD1A 4GLFA 3KVRA 4FZJA 1SMKA 2WKQA 2V0NA 4WN9B 2KX7A 5B3JA 1JV2B 2GM5A 1QB7A 1AH2A 3WLNA 3KHKA 1EXNA 2HMVA 4JITA 2HA0A 1YL6A 4DR4M 4NCBA 4U8HA 3L2OB 3X1JA 1YFZA 1E69A 2ECKA 3OD1A 3MIZA 4ZYWA 3O21A 4QL3A 3KELA 3NBUA 3JWIA 4NKRA 4GDFA 2IPMA 5L45A 5LP6B 1HDEA 2ZZKA 1DT3A 2AR7A 3CEHA 2W6JA 4MWDA 1RWWA 1OWMA 3TW4A 2GGSA 3K6RA 2B2XA 4C7OB 2J6CA 3U4DA 4CT5A 1Z62A 5H82A 2B9EA 3K09A 5D2CA 3K4QA 4D4LA 5TJHA 4WA8A 4X84A 2YN0A 3EIUA 3L27A 2JXNA 2WMNB 1G8JA 2CMFA 1L4EA 3UK6A 4MRRA 3ZY2A 3ND5A 1HTBA 5K0SA 1EFCA 4XVHA 3W7BA 1VSBA 1W5TA 1RQPA 3PDJA 2W7TA 5AIBA 3QG5A 1I3CA 3K70B 5JS1A 1YRQA 1AKVA 1NV8A 4LZPA 2C77A 5DNCA 4OP1A 3ZWVA 2O3QA 3ANTA 4BNXA 2FPWA 4L85A 4BNHA 1AK1A 3IAFA 5AKGA 1SC4A 4DF3A 4DJTA 3FF4A 5G1PA 3NZEA 2WWTA 1GDHA 2ZDGA 1B26A 2ZTMA 1ORWA 2DTXA 4JT4A 1B0AA 4RK1A 2PUBA 2IFTA 4XR4A 4MLZA 1ECCA 1RLTA 4LNUA 4KRXA 1RE0A 2PIDA 4UJ5A 3FTQA 1MO5A 3CPHA 2C3MA 1U7HA 2WTUA 3CXRA 4W6ZA 3F47A 4W7IA 1M33A 2R1VA 5DP1A 4XWWA 2W5UA 3I42A 1AA9A 4Q3AA 1YBFA 4CIVA 2Q6KA 3RS7A 5D00A 1NX9A 3COJA 4RORA 2E4XA 4HPWA 4LJ8A 3A9WA 5J1SB 3IELA 2PGIA 1JMKC 2PR2A 3T94A 1RW4A 2CFSA 4L07A 8ADHA 2HKIA 1KERA 4FFMA 5KAPA 4Z5XA 4YS6A 4U6NA 2IUYA 1X0VA 3W3AH 3EZYA 3HKDB 3Q8GA 1USVA 3PPVA 3M6IA 3GDWA 5SY4A 1R27A 3GL9A 1R8JA 4JP5A 3VZRA 4P4SA 2DAKA 4X66M 3ZWBA 3VC2A 3BA1A 4F9GA 2Z43A 3CKYA 2QTMA 3B36A 3LDFA 1SUBA 4GPAA 3HHEA 1ZVJA 2JWSA 3HJAA 4ENVA 2V3CC 1NFRA 4DR3B 4LTNA 4D9KA 4E1BA 5J23A 1Q0PA 4HGYA 4YRDA 1WCXA 3HP1A 3AUFA 2QENA 2AWNA 1BAPA 4L2IA 4LRSB 5LQUA 1QVWA 4MGEA 5IT9S 3U61B 3IBYA 1V96A 4JHXA 5B64A 3GT7A 5DNAA 3QTBA 1ZITA 3FOEC 4MZXA 3WTCA 5E8RA 2B4TO 4D8UA 1PQ4A 1VDMA 2XZLA 4TZKA 1BCRB 1WKVA 1UDAA 1OW3B 2OYSA 3WK8A 4MARA 2BFPA 2X86A 3ZTYA 3T9CA 2YWRA 1DTWB 4WVLA 4DRXB 1EWYA 3COVA 2QE7A 3V1YA 2FPOA 4W5QA 2OBYA 4J7XA 3J7AC 1ZM3A 1B6RA 1UXIA 3HEAA 3DM9B 2CUNA 2KZSA 5JSKA 3KQSA 1JRLA 3SAUA 5JH7F 5HRUA 3FNIA 1Q7CA 2WSSA 2NPFA 2XD9A 3OIWA 3RYTC 2X9LA 1RABA 5BN4A 4US1R 4ARUA 3E03A 5LA6B 1EUCB 5CXSA 4TM8A 4RHFA 2ZJ2A 3UUGA 3LUHA 4JEUA 5FEMA 2QRKA 4J16C 1KETA 4ZYUA 1ZHHA 3D3NA 3ORQA 2B7LA 3K8QA 4O4JA 1RYMA 3LQ4A 2HMYB 3IKJA 1Y89A 4IJVA 1H8HA 4TKLA 3G6WA 4IIUA 4OOEA 4RHTA 1T4BA 4HNTA 5F23A 2WZJA 2YN4A 3UYLA 2O5EA 2C59A 2C2KA 4FMBB 5EJ4A 1PGOA 1VRCA 2OVBA 3YASA 1YZNA 3AZOA 4Z0NA 2X19A 4X64B 3K6JA 3GK3A 1E20A 4PN7A 3VNUA 1VL1A 3HHZA 4D8VA 3T1HM 2G70A 1X8KA 4C29A 1NQXA 3REQB 3KEQA 1VL5A 1J8MF 1WMDA 4ZVNA 5CIQA 9ABPA 3SZUA 1KZYC 3K20A 4D41A 1R4NB 4QOHA 4Q1BA 4IIEA 4IINA 3KLMX 1G16A 1IN6A 4MS3B 5EFZA 1E96A 2JIZD 1E2GA 1LBHA 1F4PA 3QK7A 4KO2S 4RU1A 4YIHA 4OLAA 1OLOA 1SKUA 2COUA 3GFGA 2JFYA 5DGXA 1MV8A 3TLEA 1X1AA 2Y68A 2DZLA 4JBGA 2C00A 4YHHB 2ZSAA 3SC6A 4D4JA 4NG4A 2YRXA 2YVKA 2CBXA 4B3RM 5IAOA 1C3OA 5E1BA 4EPRA 2MINA 1P39A 1ZH2A 2XDQA 2B7CA 3JZFA 2MIIA 2FEXA 3IE2A 5JJLA 3JR5A 2E82A 3D02A 5JXWA 3HLYA 4UUMA 1F0KA 1P9OA 4G8DA 3NCHA 2RMKA 1T4CB 5E1OA 5KTMA 1XZ8A 3ZWDA 1TIPA 2QMQA 4LGCA 5B2FA 4A0QA 3EASA 4B2PA 1B93A 3UB2A 2GEKA 1HYQA 2DUMA 2PD4A 3NBFA 4N8SA 1O97C 4Z99A 2ZYWX 2JHAA 2VF8A 3ZTWA 4WJZA 4XUEA 2WQ7A 4DNFA 4HWSA 4X1OA 1QP4A 2QPAA 2YZGA 4RVSA 3OTWA 2GDZA 2HC9A 3PHHA 4Q1CA 3P2KA 5J59A 4IGIA 1OBVA 1FFWA 2E89A 2LXEA 1WW8A 3QX7A 2M60A 3TW8B 1Y37A 3VGJA 5CW2A 1VZ3A 3MTQA 2KRKA 7REQB 1KFCB 3JASA 3SNHA 5D5PA 2C3YA 4LFBM 3ETHA 1YMUA 3GY0A 3ABIA 5J2TA 1PZNA 1KTIA 5HFNA 3BD8A 3H4JA 3FFBA 3H0EA 1GTVA 3B9RA 1SVLA 1FOEB 1YRHA 2VUSA 3RVPA 4G23A 2VDJA 1IATA 5AHWA 1COWA 1NMZA 4IDHA 2A5LA 1MDBA 2NUTB 1PJ4A 1LI5A 3T7CA 2KDLA 3HS3A 5EFOA 3QFCA 3H1BA 5EJFA 2D8AA 5HBRA 4JI7B 4EY7A 4GP6A 3HA2A 2IRWA 3PFGA 2GNPA 3SR3A 4MS1A 4Q7EA 1RYNA 1YR7A 2ATCA 3CLSD 2JVJA 2BTOA 4OXQA 4PQYA 4LW8A 1JDUA 3S2YA 3WK7A 1NRXA 4QGSA 1YASA 2NV2B 4RKFA 3UPUA 1LDBA 1A76A 2PGJA 1ONNA 5ALZA 4ER7A 4FYJA 4RJJA 1Q1GA 3OOHA 3I1JA 3JQDA 2WQZA 1LVUA 1VJ5A 3QHPA 1NT4A 5EJMA 4IRMA 4EJ2A 1TGUA 1MA0A 2B94A 4YV7A 4OXNA 4R6XA 4DGSA 1GL3A 4WPGA 4U00A 2I4TA 4XZ3A 3IB3A 1ZMRA 2A78A 4RPJA 3UN1A 1UDXA 1JJFA 3T3OA 1VLLA 2QUZA 4Q4HA 2GWHA 5L8VA 4UUAA 1QZUA 2X9VA 2N42A 4ZCMA 3G9TA 2EBHX 4RZQA 4JX8A 3AC0A 1QC5A 4Q7KA 4TSFA 4N5HX 3O2SB 3IVMA 3MWEA 2JFBA 4FB5A 2H57A 4YAOA 3HGIA 1RCFA 3VPFA 4FWDA 1X1CA 2VF2A 1SHJA 2CW5A 3JQFC 4ILEA 4NZ9A 3BIXA 2INGX 2AG8A 2WSIA 3GGJA 3WDKA 4MWGA 1VLQA 4V0NA 1M1NA 3O73A 2BM1A 3HDHA 4ZT6A 3WB1A 1BYUA 4C1NA 2OT3B 4EO7A 2ISSD 2D1QA 1ZRHA 3ZG6A 1N7IA 2HLDD 4LYYA 3N0VA 2AMYA 1Z73A 3KYDA 5HDQA 3FMPB 3AL2A 4OI2A 2WMOB 4JOBA 2SHKA 4TMYA 2R44A 3QEKA 3RFTA 1M6YA 4D79A 3OJCA 1PSDA 2PPVA 2VHYA 3U6PA 2GUWA 3BWXA 5CITA 2OAP1 2Z6UA 4QU0A 2XRYA 2Z5GA 4TSRA 3BRWD 2WB2A 4BNDA 3R4VA 4MV4A 3FNGA 2GAFA 3RJ9A 4DAOA 3FUXA 1T5LA 4DV0B 3KLNA 4NXMM 5J43A 3PQ4A 3RYFA 3HM9A 4II3A 1S1CA 3N7AA 3GVIA 1CY6A 2F9FA 2JFWA 4R8RA 1UXKA 4UCWA 1SVWA 3NAMA 1PO7A 5IBPA 1W0JA 2HW8A 2DWZB 1XYVA 2DLNA 4ND5A 1IEVA 3HZRA 1DCTA 4U7PB 2C9OA 1Q7RA 1U0HC 3JATA 3NUGA 3RRFA 1K86A 1N6IA 2X15A 4HPJB 1LWOA 2ZI4A 3OP4A 3DZDA 1XP5A 1SB9A 4E51A 4I5EA 3E2MA 3E23A 4KE8A 3ESZA 3LHIA 4GFDA 2PUTA 3B3JA 4AN4A 3P9KA 5IYZF 3WYNA 1NE7A 2HGSA 4U3JB 4R1QA 1GZDA 4BJ1A 1T36A 4KPGA 4ZV9A 3GEDA 4TWRA 2WWYA 4X61A 3GRRA 5IEBA 4WZBB 3QFFA 1MC8A 4EI8A 4UPEA 1OIZA 4YT2A 3P0IA 3U3OA 5EIHA 1QFZA 5BV7A 3JZIA 3KAPA 5FOWA 4LXGA 2ZYHA 4AWAA 4P16A 2VDKB 4G5OA 1E7SA 3IMGA 1RRMA 1ZH4A 1VLVA 2LCFA 1ZUHA 1QB8A 3DEFA 3W9BA 2NVOA 1ZRNA 3GN2A 4ML3A 3EBOA 2JS7A 1YL5A 3WI7A 4XWGA 2UXCB 3WJ2A 1IPFA 4EGQA 4BV9A 4Q66C 4O29A 2ZJYA 1HX7A 1U2GA 4NULA 4EUFA 3PTZA 2Q0XA 2OD9A 4QBKA 1YR2A 4MGYR 5IJ0B 8AT1A 4UU8A 4DDVA 2PU5A 1L6RA 4WKNA 1JDNA 2R8EA 3BB4A 5BN3B 5T8KA 4AM8A 1KGSA 5E0KB 4GPIB 4B6OA 1NU8A 1KH3A 4E14A 4RD6A 3ICCA 3EVNA 2Z4TA 3BX1A 1DLIA 2QTWB 1N2OA 3I23A 4FCVA 1Q16A 1WHTA 1QP7A 3IOMA 1ZISA 1QBKC 5CHEA 3HSYA 4H77A 2RK4A 3ICVA 1ACLA 4ZXPA 1JFVA 3L1HA 4K87A 1N2SA 3PGA1 5AVYA 1G71A 3PU6A 4LC0A 1Q3TA 4CKXA 4RA6A 4J0IA 1QCYA 5KPJA 4ZAGA 4ND8A 1V8BA 1DVRA 4A5OA 1FNBA 3EDOA 5G4KA 1S8OA 2Y0CA 3LLSA 1J56A 3C1AA 4JGBA 5ALOA 3K0SA 1MF7A 4YFVA 2NTYC 3PGKA 1MP0A 3RTAA 5BY2A 3N1UA 3VH3A 4IBOA 3L01A 4RMGA 1DMSA 1CYDA 2AYYA 2BF7A 3VSDA 1YB4A 2DC1A 3B13B 1H22A 4URHA 1G8SA 4V0LA 3DQPA 1YR8A 4IJ6A 1QIGA 1J00A 2EF1A 5T57A 1P9RA 1NM5A 1OZFA 2OGUA 3SS9X 4B46A 2D5IA 2ZJ0A 1FXUA 2Z3WA 1BXGA 5KNCD 1SBQA 5AW2A 3FLBA 1SBIA 3AR6A 4E94A 1B8VA 1VKNA 4ZCTA 1TCAA 2FK7A 1IC6A 2XITA 2FY8A 3ROXA 2V9CA 1USWA 1HBJA 3ZVNA 1SHZA 3AJ8A 3D4IA 4FFRA 3Q9SA 2EIXA 4E13A 4EG3A 4C4AA 2H2HA 4YP5A 5TT1A 2FEAA 4KP7A 3R9KA 1J5XA 1SOAA 4WXPA 3ZQKA 1NOKA 1BJTA 4KFCA 2XMBA 4L0MA 3TTYA 1KXJA 3QQPA 3RVLA 3LIIA 1RPTA 4OB6A 1OHHD 2WSFF 2JI6A 2IS6A 4F97A 3HRIA 3MERA 3WYFA 4LNUB 1DG9A 3UHJA 1I32A 1QV7A 2L7HA 5AH0A 4HDRA 2LNDA 2PMKA 3BMQA 1W2WB 1ESCA 4FGWA 2FR0A 5JZBA 4LVOA 4BBJA 5JS2A 1U8UA 2R1VB 4RW0A 4AY4A 4XEUA 1AGNA 1KVSA 1I36A 2VXBA 4CMGA 2DPMA 1L5FA 4RV4A 5DIZA 4CRWB 3QVXA 2I99A 3B3FA 1NQOA 1GFSA 2ZWOA 4LDQA 5I6DA 2A5FA 5DRYA 3P0EA 3KKPA 2LVOC 2JIDA 1KJIA 2FPMA 3B6ZA 3GPBA 3F46A 3AY3A 5DFLA 3QE2A 4HMPA 3V6LA 1TQ2A 2NO6A 4EHAA 2OO5A 4FSXA 1QHIA 3Q0TA 4FMDF 4ZI7A 2DR3A 4AMYA 1EFLA 2QA5A 2AZTA 4Y2VA 4URUR 4MWBA 4AJEA 4ESHA 1EFVA 3CCFA 4P4SB 4LZAA 4V24A 1P1CA 3EXFA 2R2AA 4KX3A 1FJHA 3EZLA 1L5QA 3E53A 1XALA 5JOQA 2C9MA 3UWOA 5CB4A 4I4TF 4ZQCB 1QKKA 1KU0A 2X22A 2PQMA 4PZ9A 1BX0A 3FLMA 4D97A 3I09A 1ZAYA 2L2DA 1THGA 1CUSA 1ZP6A 2ZEJA 4W9NC 3TOVA 2Z8ZA 1D4FA 1G7TA 1L8LA 2VJDA 3ES9A 4U9HS 4ZC1A 3G9ZA 3IAHA 5JT1A 4Y1RA 3TN7A 3GUZA 1YK0A 4L2IB 1DBSA 2EOAA 2YNMC 3IE1A 2VJBA 1JQ5A 1DXQA 3GZTB 3WMWA 1YTUA 4BC0A 1Z39A 1I6KA 1L6IA 5AOAA 3TNLA 3BWDD 3ZHXA 1NVBA 2W22A 2YIJA 4OX9B 1J0BA 3KCQA 2V7UA 3KKQA 4NU5A 2LIPA 1POXA 2IXEA 4JI6M 2PCLA 1NR1A 3O8LA 3U2QA 5AW5A 4DCUA 1P4GA 2NO4A 2ODNA 1KU6A 1OT3A 4X1IA 5TMPA 1XPOA 2L09A 4IDPA 2R25B 2I3DA 5JS7A 4GHAA 3IOBA 2HF2A 4B6GA 3HHYA 1QS0A 4I2VA 2XVMA 4QGHA 3G9UA 3SVZA 4A82A 3ZHQA 2VUUA 2CLDX 5LP6A 1Z34A 5I3CA 3IEXA 3LUAA 4C05A 4MTCA 4FWTA 1L7XA 4OFBA 4NH0A 5L3SA 3L6RA 5BN4B 4AG3A 1QLWA 3NYWA 4MUAA 4DYVA 1EDEA 2BDTA 2GM4A 2IV2X 2HIHA 4PSUA 1ZM9A 5JFGA 5J4LA 1U31A 2B37A 3QV1A 2W42A 5HS6A 1X80A 2YIMA 4I08A 4O4JB 1M54A 4F93B 1J2TA 2DR2A 3QBJA 3ETEA 3K3PA 4ED9A 3JRWA 4V1CI 1NVDA 3GNQA 1YNSA 2CEKA 1XU7A 2A35A 3FH0A 3GH1A 3RFWA 3GPLA 1SQFA 3FPSA 4HYQA 1FJXA 1GDDA 3ELDA 2WFLA 1J0AA 4K9KA 2Q5HA 3DKKA 1BMQA 2AFHA 1NLMA 4N3GA 5AJHA 5K3AA 4BDTA 4ZMRA 2HAKA 3OZBA 3ZJVA 3JVVA 3LMKA 3R0IA 4B5KA 2ZI5A 5EJ2A 1M10A 4EPWA 3ICOA 3IPLA 1T24A 3PNYA 4JI5M 1UZLA 1R5JA 1J5PA 5HUHA 1YMQA 4M1ZA 2G28A 3ISTA 5CURA 4F2GA 4LEIA 1EDOA 2OP0A 4KYTA 4F4DA 2VJYA 5EXPA 3ML1A 4QYMA 1U0SY 2YMMA 2VQ3A 3O95A 5GM1A 1MB3A 2HT6A 1PJ8A 1U2SA 4GL2A 3TK1A 5EVJA 4B6RA 5DPMA 3KVNA 5CH8A 3F5SA 3ZGVA 4Q48A 3LZ6A 2D7HA 1GJRA 3WOHA 3JVDA 1G2IA 4CMEA 2DHQA 1C3OB 2MINB 2XDQB 4B33A 4TL7A 1K1EA 1JH8A 1ZSVA 4A92A 5D01A 1P7VA 4CM7A 3SPXA 3KOWE 4EHIA 4OG2A 1RTTA 1U0FA 3F6SA 3I6ZA 3SHWA 3RANA 2V1UA 2FG7C 4PHHA 3EYWA 3BL5A 4HGRA 1L5NA 5BRNA 3K5IA 5K2MA 2JNHA 4WOKA 3WMEA 5DHSA 3UUWA 2OCGA 2X2PA 3B1JA 1Q0QA 3PKJA 5FF9A 3V00A 3PHJA 4LUCA 4XSHA 4YRGA 4M55A 4FILA 5HJ7A 5IK2A 3SSNA 3OIYA 4MLPA 2BWJA 2VT7A 1QKIA 2VP0A 3J80A 3FYHA 4REOA 4IIFA 1BMTA 3RUDA 3DA1A 3NPAA 2DG2A 2BFFA 3PNVA 1AGYA 1WUIS 2Z4RA 4AXXA 2OPBA 3KQNA 2ZBEA 3R6LA 2WFZA 2IZ0A 3GJ6A 1FCJA 4U6QA 2HFKA 3T7RA 4W9RA 4JXKA 2VTBA 4E88A 2H2IA 1UXJA 1TYZA 1JBEA 4JA0A 5E95A 4Z53A