4GC5A

Crystal structure of murine tfb1m
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
318
Chain Sequence
FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dimethyladenosine transferase 1, mitochondrial
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
total genus 103
structure length 318
sequence length 319
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc5A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc5A01
3P9IA 3GGDA 1G38A 3FPHA 1FBNA 1VIDA 3KQPA 3BKWA 3FUWA 3R6TA 5GOZA 3OU2A 1D2HA 1XVAA 3D2LA 2QE6A 2YX1A 4RSRA 4GOLD 2ZIGA 2PKWA 5FQOA 5E9WA 5KVAA 4KRGA 1QAMA 2BR5A 1JG1A 3CGGA 1KP9A 4QVKA 3HCAA 4XUCA 5DTMA 5KYGA 4RTSA 3E23A 4AZVA 7MHTA 2VDVE 5LQAA 3TRKA 2C7QA 5FHRA 3E05A 1ZHFA 4GOMD 2Y1XA 3EVZA 3DR5A 4PCAA 5EMKA 5HIMA 3KR0A 4QQNA 3DLCA 4K6MA 3LCUA 4A6DA 2AOVA 2BR3A 3VC2A 4F86A 1L3BA 2FCAA 3DXYA 1VPTA 3M70A 3P97A 4YMHA 5BXYA 2P3LA 3FYDA 3EVDA 2NNWB 3SGLA 2P3QA 3B3JA 3LL7A 3ORHA 1NT2A 2JJQA 4QQKA 2OXTA 1SUSA 2AN5A 4BLWA 4OX9Y 1Y8CA 5ERGB 5EZSA 3M6UA 5FULA 4LG1A 3FTCA 1UIRA 3EPPA 3ELYA 2GA9A 3LBFA 2ONZA 1QAQA 3KKZA 3T0IA 2P40A 5EC8A 3KR1A 5CUQA 3CJRA 2N47A 3FRIA 3GXOA 1JQ3A 1INLA 4KWCA 1ZGJA 2GS9A 2ZBRA 2ZZKA 4WXHA 5HILA 1R00A 1QZZA 4LWOA 4C08A 1DCTA 4PONA 4M36A 3GCZA 4PYLA 3BWMA 2FYTA 4ISCA 2R6ZA 1JTEA 3MERA 1XJ5A 3NVMB 2ZTHA 2ZLBA 3A25A 1XCLA 1X1AA 3FRHA 3CVOA 3LCVB 3M33A 5CVVA 1YFJA 1RI1A 3PFHA 2HR1A 3K0BA 1SQGA 4HTFA 4EMSA 3EVEA 2IBTA 4IWNA 4CWAA 3MQ2A 1I1NA 3LPMA 3Q7EA 3BT7A 4ER6A 3B89A 2FHPA 1UWVA 1D2CA 5CVDA 1YFLA 3THRA 4R6XA 1JSZA 3E8SA 2CWWA 3EVFA 3DMHA 1XDSA 3DTNA 2P3OA 4IKPA 5LQKA 4U7TB 2B78A 1ZQ9A 3C6MA 1EJ6A 2GB4A 2PXXA 1RJDA 3UJ9A 3VYWA 1I9GA 3EVAA 4YV1A 2NXJA 3G5TA 1X1CA 4P7FA 5E1OA 5EQJB 3SX0A 3NTVA 4KIFA 3VC1A 2AZTA 5LQCA 3G2QA 2AOUA 1RI3A 2G8NA 5HEKA 3CBGA 4DF3A 3V97A 1G8AA 1Z3CA 2AOTA 3G2PA 3GRZA 5DX1A 4C07A 5K0JA 3UJCA 5EPEA 3PX3A 4EKGA 3BXOA 1JG4A 5K0BA 3SSNA 2H11A 4G56A 2OB2A 4NECA 3OE4A 5DRTA 4DM3A 3TKYA 2UYOA 3KPYA 4HGYA 4PWYA 3MCZA 2KW5A 1U2ZA 2C7PA 5DWQA 5CVUA 4XUEA 2O57A 2IDJA 3HM2A 4BP3A 2H00A 4E30A 2NXEA 1Q0TA 2CL5A 1P1CA 3OE5A 3BZBA 1VP9A 3O7WA 4RVDA 5CD1A 2NXNA 5KQRA 4KW7A 1F38A 4RTMA 2ZBPA 4PGGA 4LWPA 3DP7A 3LHDA 3P71T 4V0QA 5E1BA 4FSDA 5IH3A 3FUXA 4ATNA 2IH4A 3OFKA 2XYQA 2ZW9A 3FPJA 3HVHA 5K0FA 2G71A 1BHJA 2I9KA 3HCBA 3A7DA 4DA4A 4E2XA 5K0EA 5DPMA 1L3IA 2WA1A 1O9HA 4UOEA 2Z6QA 5E1DA 4HRAA 1EG2A 2HWKA 2Q41A 3I9FA 3Q87B 3SVZA 4RTOA 3A7EA 3P2KA 5LSAA 2QRVA 3PLAE 4FT2A 5CCXA 3NDIA 4KDCA 5KQSA 5EOVA 1JSXA 3VSEA 4DKJA 3K6RA 2HMYB 4BY9E 3SR4A 1FPQA 1X1DA 5FTWA 3MB5A 2OB1A 3GO4A 1QAOA 2ORED 4GC9A 1KPGA 1JG3A 3V8VA 4HGZA 3BWCA 3IYLW 1G55A 2IGTA 2PV0A 4BP1A 4MWZA 1QANA 3PB3A 4YV2A 3BWYA 1WXXA 5EKXA 1KYZA 1NV8A 3LDGA 5FWDA 2AN4A 2AOXA 3BKXA 1SVUA 4GOOD 2CMHA 3EMDA 3GJYA 4IV0A 4MQ4A 1YUBA 3U81A 3GRYA 1O9GA 5EZQA 2UYCA 3UJBA 1L3CA 2JG3A 1R18A 2GPYA 1NBIA 4X1OA 2GAFA 2JH8A 3OZTA 4FP9A 5HIKA 3GNLA 3SM3A 1NW3A 2AR0A 3A27A 4POOA 1N7JA 3JWGA 3JWHA 5DSXA 3EVGA 5DXJA 3FZGA 1XCJA 2P35A 3O31A 2PVCA 2ONYA 3DMFA 5EKUA 4FSXA 3GRRA 3EVCA 1DL5A 5GP1A 5G02A 2NYUA 5FHQA 5ICCA 5B1SA 3GRUA 5U4XA 1T43A 3AXTA 4OQDA 3EVBA 4RVGA 5HFJA 4E32A 3M6WA 1TW3A 1AV6A 4DQ0A 2DULA 3KPWA 4FGZA 5E1MA 5E9QA 4P58A 4PYIA 2WA2A 1UFKA 2NXCA 5EEHA 3NDJA 3TOSA 1ZGAA 1YZ3A 4GUAA 5DM2A 3P9NA 3QOXA 3BGIA 4QTUB 2FK8A 3MAGA 4QPPA 4C4AA 3ID6C 2IDKA 4EKIA 3SSMA 2B25A 1WZNA 3EEYA 2XVAA 5DM1A 1HNNA 5DRYA 2O06A 2ZIFA 5E8RA 3LDUA 4EVIA 3UA4A 3G8AA 3P9CA 2OPBA 1SQFA 2IBSA 3DXZA 3AXSA 3ELUA 1VE3A 2PXAA 3H2BA 4PIPA 5EVJA 4ER7A 4BLUA 1YF3A 2HNKA 3KU1A 5F2KA 2Z6UA 3CJQA 5HOQA 3LKDA 1N7IA 1SKMA 3CJTA 4FR0A 4L7VA 2YVLA 3HA7A 1XTPA 2ADMA 3DUWA 5C9ZA 2PGXA 1QYRA 2A14A 3REOA 2OKCA 2JH9A 3MGGA 5FWAA 2IFTA 2YXDA 4AX8A 4YUYA 1PRYA 2EFJA 5FQNA 3FTDA 5K01A 5GINE 1RJFA 3IHTA 3SMQA 3SSOA 2V74B 2ZSUA 3CKKA 4DCGA 1KXZA 4OQEA 1G60A 3P8ZA 8MHTA 2ZCJA 1M6YA 4E70A 1X1BA 1XDZA 2PWPA 3THSA 3I5UA 3QV2A 4RTLA 4KDRA 3KPUA 2O05A 3TPZA 3AJDA 3HCDA 5K0NA 3UA3A 1YB2A 2ESRA 1AQIA 5JR3A 1RI5A 3ER8A 4AZTA 4CKBA 3HVKA 3RIEA 3OPNA 1P91A 5H02A 1AQJA 1IY9A 1R74A 4R8SA 2VP3A 2UYHA 2JHPA 1KYWA 3G89A 1NKVA 4R05A 3DMGA 3OFJA 1RI4A 5E8JA 2ZZMA 1G6Q1 3PX2A 2AN3A 3NJRA 1VP3A 3RW9A 1M0EA 5K0GA 2XVMA 5CVEA 3BUSA 3IV6A 5EMJA 2OBFA 3KPJA 4QDKA 3KHKA 4WVLA 4PYNA 4AZSA 4CTKA 5EGSA 4RTJA 2I7CA 3TMAA 3FTEA 1VLMA 1EAMA 2G70A 5ICFA 5DX0A 5T64A 5BW5A 4X61A 4MIKA 4C05A 3EMBA 5K0LA 3WSTA 3TQSA 5K0CA 5EHIA 1JTFA 3I53A 1BKYA 2YXLA 3HCCA 2IP2A 2ZWAA 4XUDA 2BM9A 1NW7A 4M7RA 5C1IA 4PINA 3UJ7A 3TKAA 4GF5A 2K4MA 2P41A 4E31A 3G5LA 4JXJA 3EGEA 3HA5A 3HA3A 3C3YA 3C6KA 3HP7A 3MCTA 5EMLA 3LGAA 3RODA 10MHA 2PSSA 2ZULA 3FPEA 3PFGA 5FA5A 5BP7A 5DX8A 4Y30A 3HVIA 2ZVJA 1WY7A 2JHAA 4CXMA 3UJ6A 2PX5A 5MHTA 4P7KA 1AF7A 4HTFB 2CKDA 2UZ4A 5K05A 1DUSA 4RTPA 1L9KA 5DT2A 3B5IA 3KQSA 1B42A 3T7RA 2R3SA 2AOWA 3O4FA 3G8BA 4RTNA 5DTRA 2PLWA 2WK1A 4B17A 1F3LA 4ER3A 5BW4A 3T7SA 4XCXA 2B2CA 2VZ9A 2OY0A 3EGIA 3FPGA 3UBTA 1R6AA 1XDUA 4YMGA 4RTKA 2EJUA 1N2XA 2BM8A 4QTTB 3DULA 1ZKDA 2EJTA 4GQBA 1JR4A 2FPOA 1Q0SA 1H1DA 2ZWVA 3M4XA 4IV8A 3UJAA 4E2YA 2BH2A 2O0LA 3JWIA 3TR6A 4HG2A 3IEIA 3OU7A 2XYRA 1IXKA 1NW6A 2FK7A 4PCLA 5EIFA 2LD4A 4RV9A 2F8LA 4V0RA 4EQZA 4YUZA 3P9KA 3HCEA 1NBHA 3NVKI 1MHTA 2AOUB 2Y1WA 1KIAA 4E33A 4RVFA 3LDFA 1NW5A 5CVJA 5ICEA 3UJDA 3SXJA 5EG5A 3A26A 2AOTB 2B9EA 3I58A 2Z6AA 2YXEA 4QPNA 1ORIA 3JWJA 3R24A 1KR5A 2PX4A 4OA5A 4YUWA 5T6BA 4ER0A 5K8VA 2O07A 3LBYA 5K03A 3DH0A 2XYVA 3KQTA 3QOWA 2ZBQA 3G88A 1YZHA 3LCCA 5GWXA 5D1NA 1BC5A 3G2OA 4FZVA 2QY6A 1IM8A 2PX2A 3F4KA 4R6WA 5GIPE 1JQEA 2G1PA 4QVGA 1RJGA 4ZTBA 5LQUA 3R9XB 1R8XA 4U7PB 5FCDA 3NW9A 4Z2YA 4YUVA 1ORHA 3MTEA 3KQOA 2I6GA 4M38A 3R0QA 3HEMA 3R3HA 1OR8A 3PTAA 2GLUA 3KQVA 2QM3A 4KIGA 2VS1A 3HCFA 5FA8A 3KQYA 1P1BA 3FTFA 5LQJA 2BZGA 5D1HA 2YQZA 4C03A 2GH1A 3MHTA 2NP6A 2NP7A 1BOOA 2B3TA 2C7OA 2ZIEA 4OA8A 4RVHA 1MJFA 3FYCA 5EMMA 4HSGA 3TM5A 1M6EX 2QRVB 2P7IA 3I64A 2ZZNA 2IPXA 3P2IA 3FUTA 1V39A 3DXXA 3HNRA 4X63A 5M5BA 2YUIA 3HTXA 3B7PA 4F84A 1FP1D 3ANXA 3FUUA 3PT9A 3M6VA 2I62A 1R8YA 2PY6A 1VQ1A 4A6EA 5KS2A 2HV9A 1X19A 2OO3A 3A4TA 3G7UA 3OU6A 4GBED 2PXCA 2OZVA 3E7PA 4HC4A 4RTRA 4X41A 5DTQA 5GIOE 3KQQA 1HMYA 5HIJA 4RX1A 4QDJA 1VL5A 4P7GA 3UWPA 4Y2HA 4M37A 4EK9A 4PYQA 5DM4A 1SG9A 1P39A 1RI2A 1XXLA 2YTZA 3M6XA 4AUKA 5CCBA 2IH5A 3LECA 2IH2A 2PT6A 5E2BA 5CIYA 1KPHA 1NV9A 2EX4A 4RYLA 3KQWA 3GU3A 5JUWA 4OBXA 3OZRA 2PJDA 1VBFA 4F85A 5EEGA 5LR6A 5ICGA 4C04A 1FJXA 3S68A 2P7HA 4PYJA 3LX6A 2G72A 4PYOA 1O54A 1KHHA 1D2GA 4C06A 1WG8A 2UYQA 1JQDA 3B3GA 3G2MA 4O29A 1JG2A 5E2AA 5HIIA 3TM4A 5FADA 1SUIA 3EEOA 4X60A 4FT4A 2YR0A 5HZMA 1NE2A 3KR2A 1EJ0A 3NMUF 3UFBA 3DLIA 3KQMA 4GOND 2BR4A 3LKZA 4DMGA 3B3FA 3X0DA 3ME5A 3TLJA 4DZRA 4ER5A 3BGVA 2ERCA 2CMGA 3AY0A 1TW2A 3FPFA 4YV0A 3ELWA 2V7EA 1FP2A 1WXWA 2FRXA 3BWBA 1G8SA 5DXAA 1KPIA 3NWBA 3GWZA 3T7TA 2PX8A 5FUBA 2AS0A 3ER9A 4MHTA 5DM0A 2ZFUA 2H1RA 3ERCA 3ELDA 1EQAA 2HTEA 3LSTA 3PVCA 4YUXA 2XBMA 1RJEA 4DCMA 2PWYA 5DSTA 5LQNA 3EGVA 4CTJA 4E2WA 3GIWA 4LECA 3OCJA 4HH4A 5C0OE 2VDUE 4FS8A 1EIZA 2IIPA 5LQRA 2AVNA 3C3PA 4P7JA 1I4WA 5CM2Z 3CCFA 4KVZA 3KPVA 2JHCA 4AZWA 4GC5A 2DPMA 2P1DA 3UJ8A 5T67A 4CKCA 5E9JA 4E2ZA 2AVDA 5F2OA 2E5WA 3L8DA 5EIWA 3AWIA 5F2NA 5DLYA 3OZSA 3PS9A 4GEKA 4OBWA 4PYKA 4PYMA 5EHGA 5K09A 3NWEA 2PBFA 3GDHA 2P8JA 3C0KA 3BGDA 4H0NA 4R8RA 1PJZA 3FUVA 2QYOA 4BLVA 4PIMA 2OYRA 9MHTA 3GRVA 1L1EA 3MTIA 4RTQA 3P2EA 5GM1A 4MTLA 2VDWA 3DOUA 3TFWA 5IKMA 2C7RA 3KR9A 5GM2A 3UZUA 4PGHA 1TPYA 1WS6A 2EG5A 2PT9A 1NW8A 3HVJA 5P8WA 1ZG3A 4RWZA 4CKEA 4PNEA 3CC8A
chains in the Genus database with same CATH superfamily
4P4TA 1FYFA 1OCEA 3I09A 4O4HA 4XUGB 3VHXA 5DNVA 2YX1A 4HWOA 2HU5A 3KP1E 4B7CA 1Y33E 2R11A 5J23A 5JNTA 1XCMA 5AVJA 1H8HD 1ZD3A 4P35A 3CRRA 2O8FB 3WNVA 4UHBA 1LBSA 2BI4A 2ZBGA 4U2EA 2GA9A 5C3MA 2XCUA 3ETEA 4Y6QA 2VZLA 1QG0A 5F12A 4IBOA 3QITA 2BSAA 1IZYA 4NYIR 3D81A 2WJVA 4CWAA 5B58C 4D3YA 1XIVA 1HDZA 4W5HA 1NM5A 2CMKA 2HBQA 4OMUA 1J0DA 3IUYA 1OAKA 2WZJA 5MFZA 1T4CA 2FJPA 2IYZA 4ZVTA 3M4YA 3Q6MA 1VLHA 2YBDA 4WD3A 1CJCA 1I0LA 1P4JA 3I2KA 5K0BA 2UYOA 2C7PA 1QLWA 2RH4A 1QKKA 3ED5A 5LMUB 5SZKB 4I4CA 3RFXA 4UCQA 3WMRA 1QSGA 1PYGA 5K0EA 5JXJA 1L3IA 4E5PA 5CNKA 1ZEJA 2IYNA 2HW8A 5LSAA 5JYCA 1Q1QA 3MUFA 4HZIA 4NXMB 1VMKA 1LB1B 3D6FA 1LF0A 3BIFA 2RRUA 3RS3A 4ZVNA 2HF2A 4AO6A 5JCOC 4U39A 1TQHA 2H8GA 2Q5HA 3THWB 4XAQA 3TBFA 3QNUA 2IXEA 2GCOA 3CV3A 4P1ZA 4HDKB 4YXWA 5AESA 1ILWA 3U4HA 3EVTA 4YROA 4GBJA 3GYBA 4QPDA 1SQFA 1ETUA 2FFAA 3THYB 3TI7A 5LB2A 1JE1A 1X42A 4ZYTA 3ESXA 3IXMA 3DWFA 2DY0A 1YS1X 1GGHA 1IXRC 1G60A 1O03A 4TTIA 4AG5A 3E0XA 4PAGA 5BUSA 3ZBTA 2Q3JA 4NPHA 5TQVA 2F48A 1BQEA 3QEMB 5IJWA 2DQSA 4DR2B 2IYOA 3OWHA 4TV8F 4ESEA 3CUSA 4J90A 1P1JA 3U1TA 1UEXC 4EY8A 2PV7A 4MA5A 2QI9C 2EG9A 2QW1A 3UMVA 4C5BA 3D1VA 5JSKA 3GT7A 4JN6A 4NXNB 2P2SA 1E3TA 1PVOA 3PQ8A 1F06A 1IN5A 1IY8A 4D8VA 1US8A 4TUYF 4M7RA 4EA8A 1KO7A 3ETJA 4ZDWA 4EY6A 3IAS6 2AJ8A 1N34M 3IECA 2X1LA 1P2SA 5FWNA 5JSZB 2VPTA 2PL9A 3C5HA 3LXUX 1IULA 1DUSA 2Z56A 5B1EA 2WMOB 1Q14A 1WULS 3HN6A 3N0TA 5BNZA 1YKGA 2FPOA 2V7TA 2C3MA 5EIFA 4M4SA 2QX6A 4DNOA 2RI1A 3WQQA 3BK7A 1DRUA 5G3YA 3DMTC 2WSEF 3FTNA 2RGOA 5CM9C 2ZB4A 2I4IA 4FYIA 1SAYA 2WG1A 5E0OA 2IXFA 5EGNA 5K99A 3KQVA 1B74A 4X7BA 2YS7A 4D5EA 3QXHA 4QUJA 4UHDA 2JHGA 1NGSA 4YY3B 2X0FA 5EESA 4DJ5X 5YASA 2ZE8A 4R2WA 4QOHA 4BNTA 1MABB 1GP2A 4IQ8A 3ORFA 4JI0B 1T1RA 4EK9A 3O9MA 5LQDA 4KWIA 3TTSA 3GJ4A 1QX4A 5JSFA 1PWXA 4PCZA 3I2GA 4EW1A 3IG8A 1XD8A 2GK3A 2DHQA 2FRDA 1HG0A 1OWMA 1NXQA 1YS9A 1LDBA 2Q07A 3ELWA 1OIZA 5GONF 2EWVA 4LXUA 5IBCA 1CE8A 1O6GA 2H5EA 4BNVA 1T9AA 2PAAA 3U4DA 2ZDQA 4GC5A 3TRFA 1NPDA 1V5WA 2EP5A 3WLEA 2CDRA 5GM2A 1JF8A 3N76A 3PXEA 3GZNB 4TXNA 2AXPA 4CZ2A 5BSMA 1WTAA 3JARB 1KTIA 3WQHA 1XVAA 2NZVG 1F6WA 2V7PA 5EFOA 1NJ2A 4TVOA 1GT6A 3JQRA 4LF7M 1TM1E 1NT4A 3VSDA 5L6MB 4MGYR 4KWHA 2A9VA 2W6CX 5AI4A 1DJMA 1YOVB 1KIFA 4MWTA 3AL2A 4EITA 4HXFB 4JR1A 1GAEO 2KBEA 5CDFE 1R16A 1RJWA 1HH4A 3JD4A 4AVYA 4YEDA 5TPWA 2RGRA 1YLAA 3CX4A 2V54A 2YS6A 4P4SB 3ZWOA 2G0AA 1TJYA 1Z7EA 1UP6A 4HEA6 4GHLA 2J3EA 4BMDA 1PEYA 2XB6A 3TO5A 5DWDA 1U02A 3MWFA 2I2AA 3URMA 4LQCA 1P2GA 3V7NA 3I62A 3AKYA 2Q2VA 1K1EA 2ATEA 2FPRA 3BXOA 4RCZA 2AFHE 1DXHA 3BYZA 1RXEA 3R41A 5KQRA 3DEFA 2QQ8A 1C1KA 5TQ0B 2O25A 3FOWA 3OZVA 5DOVA 4JMPA 3MWJA 3WLTA 4P34A 2Z1NA 1F2TA 3SZUA 4HVTA 1PR3A 4QX6A 1UUFA 4JCCA 1WR1B 4Q4AB 1DBIA 1NPYA 1IEQA 1SXJA 2OV2A 3GEBA 1QHXA 4NZYA 5IT4A 4F7WA 4DBVO 4CMIB 4XPIB 4IIWA 4KTTE 2GZSA 1ECBA 4QO7A 1AHPA 2DPYA 2Q4DA 3FDZB 2KMLA 3DKPA 5KHAA 1NHWA 1MVLA 2F17A 1HEUA 4CEIA 1D9XA 4BKQA 2OO9A 5ES3A 1OIXA 1PEDA 3WL8A 2PUDA 1G2PA 4F38A 3ACCA 3MGGA 3MWEB 1T9KA 1OTXA 4J1SA 1RJFA 3T95A 2QNIA 5AK5A 4M60A 1I2MA 4I8IA 1FSFA 4G9BA 3AOEA 4E4YA 1YQTA 3MK31 4EPVA 1R74A 3C3KA 4L28A 5JD5A 5DWVA 2OECA 3IV9A 3N5KA 5KDOA 4D4GA 1P81A 1NVFA 3MT0A 4EQ6A 5GJCA 4ZHQF 4OW0A 1U8AA 1CEEA 2X5OA 4NBNA 4YCCA 1JP7A 3QF7A 1K0FA 2GBGA 4E31A 4UBNA 1RYYA 1WE2A 1S0UA 1FVOA 3O03A 2VSNA 2XGNA 3VNRA 4DR1M 3LC2O 1JBKA 5JCJD 4WRRA 3SAUA 3MXTA 1J25A 5BW4A 2LXEA 2G83A 2AR7A 2R6DA 3TZCA 5HZHA 1O8BA 3RRBA 1AUVA 3DM9B 1QKIA 4OLFA 3C6BA 4DDVA 3UMMA 3C14C 3BM5A 4DG8A 3RD5A 1MB3A 4HVCA 1QIHA 1JHQA 2ECFA 2WI8A 2ZUUA 4PIVA 3BJRA 5MN6A 3CA8A 5H5JA 2G36A 1V26A 1UK9A 3HUEA 4IIVA 5IF3A 2FJUA 1DT3A 4WZAA 4J3NA 4B8WA 3TL6A 2Q1YA 4C03A 1AURA 3VI4B 3AKEA 3F2IA 3TD9A 4TSKA 1TNDA 4JV5M 3M6IA 3KL4A 1N1MA 2XDWA 3WX0A 1O4WA 3M9LA 3DYVA 2NO5A 3IH5A 2ZR7A 5K4GA 4HQLA 5EKTA 2N0SA 4JT9A 3GLHB 3GU3A 3BX1A 4EX6A 2XE8A 3PQFA 2R85A 3BN3A 2OYSA 2IYXA 1A1VA 5A5EA 4JYZA 3P0JA 3NHWA 4TQAA 2P9EA 3LKZA 4W5WA 2VF4X 3H16A 3DBLA 4WKPA 4UW9A 1XZPA 4BC1A 1JVBA 3EF1A 5HJ2A 1RJEA 4QGHA 5IG2A 3QPAA 3I05A 3CVWA 2BSXA 1SVSA 4OJTA 1J70A 2P2CA 1G8KA 1H1LA 3IUPA 1DO2A 2HIHA 1Z45A 5K09A 3BGDA 2R7KA 4JOSA 2XYHA 1PR1A 2R7MA 5ETJA 3GGDA 1QORA 2EJSA 4RHFA 2O2SA 1ZPDA 1V5EA 2JFUA 4OJKA 3FJ1A 1VG0B 2ZWOA 2XH8A 4BB0A 3T1YB 4I7EA 1OAOC 1A8QA 1MQ8B 3MRXA 1L6IA 4F9TA 3D3WA 4QHSA 3FBWA 3CH7A 3QPBA 2Z3VA 2Q7OE 5EZSA 4FFVA 4KB5A 3PUYA 2OAP1 4QXMA 1X92A 2Z3XA 1L5ZA 5JXHA 3AI3A 1ZK3A 2G6TA 1SHLA 2I1WA 3D5TA 3NX4A 1ENPA 2O2DA 2XMGA 2Y1DA 1QUFA 5KWEA 4FEYA 5JH7F 4RSHA 4O4JF 3SEAA 4R0NA 1XBTA 1QU2A 5LYJF 3OCCA 4YT5A 3TEMA 2V98A 5JCZA 3WK8A 1KH2A 1X7ZB 2CBXA 1A5SB 2IZ0A 3Q8XB 4YJ2A 1RC0A 4D4HA 4QYSA 4NECA 2CF5A 3UC9A 1O0BA 4DM7A 3QTTA 4UOQA 3WMGA 3SCZA 3RC3A 2NU8A 3HHXA 3RKUA 2AZXA 3JQAB 3FHTA 2IV7A 4BMXA 1GZ7A 2RH5A 1M1YB 3T4UA 2C2XA 4L4XA 4RLSA 4RQBA 4EECA 2DWLA 4DV3M 2ZJOA 4BQIA 2I1QA 3Q8GA 2V7GA 3F6SA 3P5BA 4W6QA 1GGEA 3QPDA 1OU4A 4MWZA 1XE3A 4O2BF 3H2GA 1UT8A 1HWYA 1L4EA 5B1SA 4Z0TA 3AJ9A 1UBNA 2QLJA 4OQPA 3HHYA 3EGDB 4LDJA 2H65A 4QTUB 4Q1FA 4LVUA 3ITDA 2ZRNA 3IBTA 2PBZA 1WUKS 5LLSA 2H4WA 3BFPA 2HOQA 3GA7A 4M9RA 1JJ7A 5NULA 2C83A 2CMDA 3FJOA 2A14A 5FWYA 1SHTX 3S8MA 1R0CA 1KY3A 5C1PA 4J16C 3L4JA 3HCDA 3GJSA 4PM4A 1S5PA 4B7AA 4L85A 1ZRHA 2OBBA 1C3OA 1R4MA 3H9CA 5KNCH 1Q17A 1BXGB 2QTBA 4LX8A 4C14A 3RKSA 1MB2A 3HADA 2O8FA 2PX0A 2VP5A 1S2IA 1IUNA 2Q5LA 1GNTA 1SB8A 1MN3A 5D5PA 4GR5A 2G0TA 3HO1A 1T5BA 3TJRA 1KRWA 4BO6A 3GFRA 1KO4A 1KVSA 3PCXA 1XNQB 4E11A 3AY3A 3L84A 3M1YA 3ROGA 5KIAA 1Y5NA 4JEMA 3FSEA 4MICA 3QLUA 2HZBA 1G3QA 1FX0B 1CV2A 5GPBA 2Q3HA 5EVCA 3A0UA 1JFFB 4FYHA 1IBRA 1K8ZB 3L46A 5CJ2A 2CCKA 1XTTA 2VCHA 2QM3A 4OQYA 2X22A 3Q5DA 4AW9A 7YASA 2B3TA 1NZDA 1JAHA 3EEIA 2R00C 2QRUA 3A32A 1SCAA 2YW9A 3HLTA 3ADBA 5FBRB 5EIEA 2OLJA 1GQ2A 1UOQA 4FDMA 5KPDA 1U98A 4C21A 3V6MA 4MJ7A 3NUGA 4LIPD 3AHEA 3RPEA 2YR0A 4RD6A 4TLDA 3KQMA 1JDBB 4BMCA 4DPMA 3X0DA 3VSCA 1NRIA 3LT2A 3GRCA 1RWPA 2IEIA 3GNTA 3ITEA 4ENPA 4BNMA 3PVCA 5JISA 3KD3A 5IEJA 4EH1A 5C0OE 1EIZA 2VFAA 1QXSA 3E4DA 4WJKB 2R6CA 2I55A 2NZWA 4YB8A 1DP4A 4Y2SA 4MUAA 4H77A 4RPCA 3R6DA 1XMOB 1KF0A 1VPVA 3A1SA 3R6TA 1DG1G 4J2HA 3TWLA 1MV8A 3D2LA 3BJEA 1TUBB 2QTAA 3QEMA 3RGPA 3CX7A 5JG7A 2FQYA 2IUUA 1JHUA 4F86A 5KPRA 1NUPA 3ORHA 3VA7A 4TUWA 3T7JA 4PE5B 5JY1A 4J4TA 2OL4A 3K9NA 4KE8A 2IYYA 5FFMA 2I87A 4IO1A 1H0HA 5IKPA 1SKBA 1T2DA 4Q21A 3C8DA 4FX2A 3D8HA 2ZTHA 1RAEA 1K5HA 5CBKA 4MITA 1L5RA 5JSZA 3TLAA 2RGAA 3UJHA 3GRKA 2I3DA 2NUPA 2B2NA 2JAUA 4TXLA 1BIFA 1K3UB 5L4NA 4HGNA 3ZJ5A 1SUFA 2VHCA 3NB0A 3CISA 1ISPA 3UAYA 1P62B 1IL0A 3SKYA 4DM3A 1XRMA 2XWQA 2Q5OA 2IOFK 3M2TA 3LWZA 5F78A 3RVBA 4OXXA 3CQ9A 2RARA 4QYXA 4UHFA 2PUWA 4K03A 1MQ9A 3T3IA 4F2HA 4WCVA 3NDIA 3IPYA 4IWYA 3AM3A 3IYLW 3E9YA 3ZDQA 1KYZA 3HHZA 3RS0A 1JV2B 4L51A 3DDSA 1U8FO 3K30A 4QD3A 2QX7A 3WC4A 8CATA 4D57A 3PEEA 4MKFA 4MARA 3EZ6A 1D04A 5C34B 5KQLA 3U7QB 3A42A 1BU5A 2ILTA 4FMDF 1VG8A 4OU5A 3EXEA 3GN2A 3LE8A 4KPGA 3EYAA 5EJ5A 1T5IA 3DCIA 1H2WA 3LLSA 5IP5A 1RBZA 5C9ZA 4A4DA 4Y2UA 1SHJA 2B69A 4OU4A 5BT9A 4HQ0A 2ZYAA 4ND3A 4FKMA 5KNBH 3QYFA 4JODA 3UA3A 2WYOA 2FPXA 1CUXA 3TTVA 4KZPA 4IBEA 5EAIA 2ZJFA 1RQ7A 2Z08A 3E8MA 3LZ6A 1Z6TA 3OUZA 1UWKA 4GPD1 2BGMA 1PSWA 2XMDA 3M5PA 5BWOA 2R46A 3DPSA 2K4MA 4GQIA 1Z6XA 4J0IA 2R60A 1RMTA 3PQDA 4B71A 4I4LA 5JTUA 2VUUA 1KMIY 4EHAA 3AQIA 3A1CA 3DR3A 3VR3A 3HB5X 2A5YB 4HYQA 1T36B 3LU1A 1NW5A 4BUZA 1O94C 1FDIA 1UDWA 4YT4A 4G86A 1BRTA 1JAYA 4ZZ2A 5ALJA 3TE7A 1CU1A 1IM8A 3WYFA 3SZGA 3V48A 3KSRA 3SE0A 4EYQA 2Q6OA 4CMGA 4W5QA 5LP1A 5K3FB 2PH1A 1HDYA 2F3UA 1N9GB 4PPFA 3ZXIA 1C0KA 2NU9A 5I9MA 5A5DA 3UFXB 4A23A 3HNRA 5TQ0A 2PY6A 2QQEA 1GFZA 3NKVA 3ZNOA 4C43A 2EW8A 5TMDA 3DDCA 2ZXUA 3LQQA 5FYDA 2EOAA 3OWXA 1T1GA 4NZ9A 4JUDX 4YJ3B 5AKLA 1TMKA 5DGHA 6AT1A 4IJFA 1WG8A 3HY3A 3H8WA 4XPIA 4JQSA 1NP7A 4EGJA 2QK4A 1AC5A 4EUHA 1JNYA 2YVUA 2IC5A 2QAJA 2A5GA 3ZWYA 2H1RA 1L4FA 4N5LA 3WB1A 2HZ7A 2HCJB 4ITQA 3NHMA 1I4WA 1Z5OA 2JLQA 1K6MA 3LCRA 4Q7JA 3HM9A 5FUXA 2CLKB 3K6JA 3CO5A 2HCBA 1KGSA 2QT0A 3MWEA 5COQA 3KQHA 3MTIA 4QGSA 1FVFA 2HA5A 2VNKA 5ADUS 1NNEA 3VC3A 3O2JA 3X2SA 4B7XA 1I7PA 4UTPA 4MS4A 2VHVA 1ABBA 3ZWXA 2FCAA 1LI4A 4PLVA 1GAQA 3R5JA 3F46A 1IUPA 4YAGA 1N33M 1P33A 1JDBC 4IIHA 5HILA 2HYDA 4M36A 1X0XA 2FLKA 1UOEA 1ODTC 4BZWA 3M6AA 5A1TA 4B85A 4DUPA 2YCLA 3V4RA 3BPSA 1GGJA 3LPMA 4JP5A 2J30A 1H6BA 3H84A 2YWEA 4EVSA 3LQYA 4O4HB 5CRIA 3HXMA 1MZPA 4X95A 1GYPA 5SY4A 5AUNB 1IZ0A 1U8TA 4QUIA 5DGTA 2Z30A 2QORA 1FW8A 1Q22A 2J7OA 3OE4A 1AXRA 2DWZB 4PPGA 1U2ZA 3MUEA 3UMFA 2CL5A 5K8JB 2HN9A 3TW8A 3L9WA 3T0GA 5AW7A 4R9RA 3P71T 5DHPA 3HVHA 4ACAA 3AF4A 3F3KA 4ZQIA 4X71A 1E98A 1V4VA 3E35A 2WWRA 3ABOB 4TL7A 2PRKA 3UJPA 1D2AA 3WBKA 3K6RA 3WLOA 3JRNA 4Q3BA 4MKGA 5ITUA 4G81A 5AVRA 1S6YA 5ITWA 1AXGA 1U7ZA 3UJBA 1ZRSA 5DSXA 2V9PA 2JHFA 2ERYA 3L6EA 4IHJF 3ZHOA 4C3ZA 4IYRA 2PMKA 3H0EA 5JAOA 2KNZA 1UQRA 2OQVA 2QT9A 1S7GA 1KI4A 2GRUA 1DIHA 4MGIE 3IQHX 3LPDA 3QU5A 4I66A 2IBSA 2D1TA 3LUHA 1W1WA 3HPQA 3DO6A 4KYUA 1ZMUA 1WLYA 4KL8S 4LZWA 1TM5E 5B2FA 2IFTA 5JSQA 2G1KA 2C8JA 1L5LA 4JI4B 3SN6A 5TARA 3U3XA 1Q77A 5FA6A 1B8OA 5A3QA 1ODJA 2VXYA 4DJTA 3CWZA 3FFAA 3IAHA 4F4JA 1VRVA 4F11A 2QJTA 5L7YA 1UBRS 2HCFA 5KQPA 4HNTA 5T64A 3RF6A 1QUTA 1XWIA 2LKDA 3A46A 1IAQA 4OKSA 5B7NA 1O1YA 1NC3A 3VSBA 4WGGA 5EIBD 4R9VA 3UJ3X 3GZJA 4A0SA 1LLQA 1PZXA 5IAKA 2FW0A 3C39A 3FI0A 4QOGA 1XELA 4ZVSA 3IE2A 5C35A 3NHZA 4PG4A 2ODBA 2OZKA 5G4KB 3G1TA 4F2GA 2EJUA 3DO5A 4XB1A 3B20A 8OHMA 1BCSA 3K1JA 2Z98A 1JYFA 3CR7A 3QVMA 2PVSA 2W11A 5EMHA 2OE2A 2C57A 2YWXA 1SCJA 4D4KA 3Q8XA 1YU9A 2H1HA 5GGXA 4JN6B 3ABQB 5E4JA 2ZU0C 1IJFA 4R5MA 4ZCMA 1DX9A 1US8B 5EYPB 4BZPA 3U6LA 3PXBA 2WTMA 4KIGA 5DN6A 1F60A 2WAOA 3EXHA 5KAMA 5E26A 4RORA 1RWBA 4FE4A 1U3TA 1V8DA 1F9AA 5A4KA 5DN9A 1FJGM 4ZA2A 4JIGA 4U9HS 2VDNB 5HIJA 3E7DA 4N3GA 4NG5A 4UEJA 4MRSA 4Z7NB 2XKKA 4NEHB 3O9VA 3ZV4A 4C6TA 1M5RA 3BFJA 2A3RA 5F7ZA 3H8VA 4WUTA 5HM8A 4AU1A 1C3LA 3QMMA 1RDFA 3UFBA 3BK2A 2BONA 3QE3A 4PPQA 3TLJA 1CUWA 4KDFA 1KBQA 2BIFA 3OP4A 3RYCB 1P3Y1 1E77A 4L0MA 1YQDA 4ZCIA 2VSOA 4KQJA 4KO1S 3QI7A 1YZNA 4L4UA 1G3UA 3OAAD 5HTOA 4XCVA 2QRPA 4JUCA 3T1VA 2V6ZM 1O96B 5HDBB 1IU9A 4MLCA 1SHKA 4ZYYA 2VF5X 1THGA 4KH1A 2V0NA 3K1ZA 1PJ8A 3HXPA 2QVXX 3RE1A 3GFPA 4OK3A 3PGJA 5A71A 3FSJX 3OU2A 1G8FA 4PBTA 3R5TA 4RM2A 1RM3A 3IKLA 3CGGA 3TRDA 1RLMA 1Z36A 3WYEA 1GRVA 1JQKA 1V16B 3X44A 3MWYW 4K26A 4A6DA 4GKBA 2V65A 1T1EA 3VR6H 2EARA 4CL3A 3WB9A 1T5LA 2WJ3A 2A1UB 4RA6A 3X2EA 4J3FA 1QAQA 1NJ1A 4PSCA 1J9EA 1G18A 3SZRA 5HQTA 2G4LA 2OZLA 2Y99A 3PFHA 3FTPA 3ONVA 1WB9A 1W94A 3G17A 4J7AA 4KLZA 4NYJQ 2E5LM 4P6VF 5H8WA 3ZDZB 1KEPA 4HDOB 1A2OA 4M1WA 3FYSA 1QHIA 4RF3A 3FA2A 1WRBA 3B8EA 2CL7X 3N6XA 3QP9A 1Z5GA 2C1EA 4DV1M 2OGWA 1PN3A 2QHOB 4UMVA 3ZX4A 2BFCA 4BGIA 3ZY3A 6ADHA 2ATCA 1JH8A 5TPWB 4KDCA 3ZV7A 5IASA 3DEHA 1NY6A 3J7AS 2JH3A 2R68A 3QG5A 2ZRIA 4L08A 3IQFA 5G53C 2ZB8A 1XQ9A 2ZB3A 1FB5A 4JI2M 5HKBA 8AT1A 1TO6A 4M46A 4B6OA 2R44A 3A27A 1K4YA 5A5VA 4ERXA 4BB6A 2ZRKA 1FUEA 3E81A 4UXHA 3RFUA 5E1MA 1O9BA 4G1EB 4YIHA 2JRCA 3KXKA 2AEMA 3ZY5A 4LMRA 3P9RA 2NO7A 1X7GA 1OILA 2ZQZA 4FEEA 4RSMA 2Y9PB 4XSHA 4J4HA 4FU0A 1QLJA 1SCBA 2TECE 3LSYA 4Q3CA 1F2TB 4DMCA 3GBSA 2WICA 1OU0A 3A1VA 5D87A 1VPWA 3ETLA 1J2EA 3AJDA 4EHDA 4UPVA 1RI5A 2XT6A 4LGCA 1YRQA 4MQUA 4FWHA 1VP3A 4IRXA 4PVCA 1M33A 1TUBA 4OHRA 1NM5C 3ZDDA 3TQSA 1J1IA 4EM6A 2Y66A 2J0SA 2BAGA 3UUGA 1F7UA 2NYAA 1GJSA 3KOXA 4H6PA 1YR3A 1QTIA 3QWBA 1QRSA 3OZGA 4P36A 3B5IA 3C3AA 4FFPA 1UKZA 3CLRD 3R5HA 4JR2A 4A8JB 1HF3A 3KOUA 2HAKA 3I6IA 1A5BB 1D4ZA 3NVKI 3W5UA 4R4JA 1X7DA 3RQSA 5BW6B 2G7ZA 2X41A 3IMCA 3H5RA 4EQ6B 4BX2A 3K20A 1KJZA 4KUEA 2WWYA 5D1NA 1HTTA 4D3DA 5CFQA 2NTEA 3MW8A 2FJ0A 4S1PA 4QYTA 3DHEA 1SCQA 4L3VA 4JLWA 4WPGA 3Q15C 3OF5A 4G4SO 3PNOA 1WXHA 4DAEA 4HSGA 1UBJS 3AG5A 1P75A 1D4FA 2KEBA 2DLCX 5J2UB 3DHWC 1X15A 4OAPA 2IXAA 4DV6B 1HMYA 2KW0A 1RM5A 4N3CA 1VL5A 4FN4A 2Q8PA 1UL1X 2R7NA 3E2PA 3T3OA 2XUOA 2FUG6 3P94A 5AUPB 3JTEA 3WBJA 1W49A 2I80A 2ZR8A 4O02B 4I3FA 1JN0A 2Q4OA 3VVLA 4CIAA 1T9GR 1QWOA 4ND5A 3MIZA 3CN7A 2PUEA 3WNBA 3V1YA 3OQIB 3SSAA 5H81A 4WZAB 1RP1A 2PWYA 4IILA 4G4RA 3AIMA 1K9SA 2P79A 3DAHA 1P5FA 4JFAA 2YWCA 5E9JA 3S2SA 1EHCA 1HRDA 4EYOA 4LJ7A 1J7JA 3PQ4A 4DLPA 1G0OA 4LPKA 3LWBA 4NI5A 4US0R 1NDUA 1TQ2A 1AMUA 3NG1A 5KKNB 4C3UA 2NUBA 2ACKA 2VAWA 2BHSA 3UCXA 4Y6PA 3R9KA 4M9XA 2AL7A 3L0CA 4RFSB 2E6UX 4LC0A 4PSAA 3PFCA 1IG0A 5A6SB 2FYTA 1E2LA 2ACVA 1ULHA 1JLKA 1SOVA 1S2GA 3LXXA 2GEVA 4TQGA 1YA8A 1RQRA 2DR3A 2GEJA 1U0GA 4X6XA 1GLNA 1DQNA 3RIYA 3M6LA 1OFTA 1T36A 3E18A 3KLOA 4U7HA 4YAKA 3PQ5A 4G4OA 3OEHD 3PL1A 3O95A 4V0SA 3RTGA 3FIUA 2GKOA 4Y0VA 2WUGA 1ZEMA 3KVNA 1V7QA 2A30A 2V6FA 5CLLA 4Q0MA 3V46A 3D3WB 4RK1A 2ID8A 3A14A 1AY0A 5GZ1A 1A3CA 4Z9XA 1WMBA 2FRDC 1N9GA 1QRRA 3V7UA 2VJBA 5JAQA 2KE5A 4X90A 3UFXA 2FPLA 4ND7A 3HN2A 1ECFA 1IH8A 4UN2B 1W5SA 3BBPA 4GPBA 3ABIA 3FWZA 3U2QA 1CJSA 5EZQA 1R18A 2B8TA 1TT7A 3E9CA 3JWGA 4YJ2B 4RJLA 4URHA 4YJ3A 2XSZA 3HABA 2HK8A 4YLGA 3O1IC 3MOGA 4OI1A 2WR8A 4MUMA 1DMSA 1TDZA 1S2DA 1V1JA 4EMTA 5DEOA 3HCRA 3ENWA 3G8AA 2C00A 1WXGA 2YY7A 3QVVA 2NU7B 6LDHA 1KI7A 1E1RD 1EGMB 3IA7A 5KNCD 4UE6A 4CN8A 1OC2A 2XGGA 3MAJA 3BA6A 1UDBA 5EJIA 2ZUDA 1AGXA 4EEXA 3NXSA 4R0VA 2VJLA 3C15C 1SR8A 2XGSA 3NJRA 3HY6A 2ZU6A 2HMTA 1OPXA 3PUHA 2QE7A 5B57C 2Z7JA 4G01B 1B26A 2XTMA 3BGWA 6NULA 1USVA 4K6OA 4PNHA 3C3YA 4M1KA 1QOPB 4CV0A 3GQVA 4OK6A 3UMRA 2G5TA 1NQ5A 1U5AA 2PMWB 3PPVA 3AY6A 3G8BA 1MOQA 4Q05A 1IZZA 3FVTA 1KFEB 2BM8A 5AFSA 3KG2A 5C7YA 3MT8A 1PUXA 3DC7A 2M6KA 1NBHA 1IHXA 1K4KA 3R24A 1R4MB 3UO8B 4MP3A 3HX3A 3LCCA 4DDWA 1SXJC 5FUMA 4FGSA 3AR4A 2XMSA 3ORYA 3ZVNA 3DWEX 2FG7C 1OX6A 3JRXA 2Z83A 1CDOA 1VSTA 4HXYA 1N36M 2EEPA 3ZJVA 3O2SB 3SY8A 4J07A 4AURA 2BEKA 1NHWC 4U2CA 4MQLA 3A2KA 1G21E 3NTLA 2EKLA 3TSOA 3UWPA 1COWA 1CUYA 3KIPA 3C3CA 1QPZA 2QAGB 4C7VA 1N5OX 4J7XA 1OPRA 3WA7A 2ZWMA 1E3DA 2JLVA 4C6RA 1SPXA 4TS1A 3I12A 1E32A 4CM9D 4IBFA 4L9SA 2DETA 4E5YA 4XGKA 3VO9A 4XM1A 1W35A 5GV7A 3AOEC 4YV0A 2FZ4A 2P0AA 4NLLA 4MAAA 4BMZA 1HXHA 2ET6A 3CRQA 2OP1A 3LSTA 1UBSB 1ZJZA 4OHMA 3I4YA 2VJAA 3FCYA 2MT9A 2E87A 3GUUA 1A95A 3OECA 1LY1A 4LRXA 1MF7A 2QDKA 2OT3B 2WKRA 4QDXA 4CR7A 2YWRA 2PKWA 4R1UA 2ZOSA 1KP9A 4QVKA 4OP1A 5H37D 2H3HA 3SEZA 4UM7A 2Y1XA 4CQJA 3KR0A 4D9JA 2IUEA 3N1UA 4BLWA 2D1FA 3WGGA 2D4HA 2PLNA 5K3OA 4DWWA 1L5OA 3SM9A 3T6PA 1V7ZA 3KRTA 5HF6A 3EF3A 3OX3A 1WABA 1YE9A 3ND8A 5DH9A 5KTSA 4HEHA 3ZI4A 1JAZA 2P2GA 3T7CA 2VRWA 4LE0A 3FD9A 5G4KA 3DTNA 2OOSA 4CLDA 4U4AA 1OYYA 2HMSA 4EABA 5I5EA 1Z5CA 3SX4A 1UMKA 4ZKEA 2OHXA 2AZTA 3VK8A 1NI5A 5HYVA 2P2ZA 3EC2A 3O3MB 4QATA 3DV2A 2XUGA 4C76A 4FWDA 1PF7E 4RF2A 4BP3A 1J9GA 1QNLA 4LRTB 2J31A 3RRMA 1C9EA 2VSYA 4W82A 4BBAA 5EYPA 2BDUA 4Y2GA 1FDVA 5IWAM 3W34A 2IGBA 1FEZA 3DMRA 3AQ4A 4UOEA 3VH4A 4E3WA 3K71B 3M82A 2QB5A 3WBFA 4HRXA 1GJRA 4BPBA 3L40A 2NUPB 4IV0A 1Y6QA 4DVJA 1NTRA 2R4UA 2OFXA 4PGAA 4FSHA 1KORA 5DW0A 2YY6A 3LUFA 4IXDA 1MO5A 1SC9A 3TPCA 3NDJA 4BDSA 4J7CA 4E5KA 3T1NA 1ZD4A 4WT7A 5KNBD 3RYCA 1J8FA 3V1TC 4N76A 3Q2IA 3UA4A 1OYVA 4NZOA 5FOWA 4L74A 1Z73A 2ZRCA 4L4SA 2OKCA 4JQYA 3MNFA 1PRYA 1GARA 4NE2A 1O96A 4JMLA 3FFBA 1KJYA 2B35A 4LFCM 1I9CA 2CMFA 1Q02A 3USCS 4TZKA 3T5TA 2I76A 5D2CA 4LAFA 5IXSA 1Q0PA 3TMAA 4MVJE 1SB9A 4MIKA 3W8RA 1V16A 2DRIA 2V7QA 3EXEB 1W0CA 3ZCUA 3DQPA 2XNSA 2ZJ1A 4REMA 3C6KA 5JNSA 2A1UA 4Y30A 1FXUA 2PD4A 3BB1A 3TL3A 3NM6B 4AF8A 5DTRA 5BSUA 5L8RF 1P4SA 3INNA 2DPLA 5CGQB 2HI0A 4HG2A 3Q7TA 5CLQA 4F97A 1ZP6A 3HV2A 4FGWA 2PL1A 4LXHA 5EMNA 4TLLB 3PNVA 1VMAA 2G3YA 2HK9A 1S2MA 1MX9A 4O8ZA 2WD7A 4MQBA 1CEYA 1DHRA 2YRWA 4BNGA 2ZSBA 2B1IA 4S1OA 4Y2QA 3QXJA 4BKUA 4ZC8A 5E3JA 1PTJA 5JJKA 3FYCA 4D43A 1O5OA 4GDMA 3DOJA 1CZUA 2O59A 4TL6A 4PO9A 4ZK2A 4PLCA 4XIYA 4FHFA 3SC4A 1HYGA 1NYTA 1HEYA 1N6IA 2XQVA 1HZJA 5HKOA 4KQMA 1G2OA 1JDNA 1PDWA 3D0RA 4FOPA 4PYOA 5BN1A 3G2MA 3A3NA 1QIKA 3DOIA 4TMXA 3L8YA 2HQRA 1PSDA 2G9QA 1A8IA 1U0EA 3BWBA 1K7YA 2A0FA 4JGIA 3CEMA 3KJQA 1EDZA 2AF4C 4B5LA 2IIBA 2NU9B 4DUYM 3K09A 2WUWE 1TCUA 2E5WA 1LSJA 3K53A 1P3DA 1P61B 3C1TA 3FUVA 1GPYA 3ZNQA 5CDYA 2GVZC 4UCXA 1VE6A 4TXJA 5DGDA 4BYGA 1FNDA 3CVJA 1U6JA 2OHFA 2FSSA 4TLAA 4IDHA 1CR4A 3IQEA 2DAMA 4JZYA 1IHDA 1QVAA 3O8LA 3VDQA 4RFLA 2BVNA 3KD2A 2RDMA 1Q92A 5BXYA 2LE0A 3NYRA 4J7UA 3ND7A 3OBIA 3FFTA 3QLUC 4GVPA 3FZYA 4XGIA 4R3UC 1U7WA 3L6DA 2AEFA 4X7MA 3I6ZA 3L05A 4HNAA 1YVUA 2B1GA 2PMBA 2O5CA 4Q7JB 4K88A 3RK1A 4GKKB 3KQKA 1K2VN 2AJDA 2D5BA 3RVOA 3EQZA 3VR4A 2ANBA 3P0RA 4P84A 3ZZNA 5DMXA 4CKXA 1KVTA 3TSYA 3SIXA 2ZITA 4A8JA 3FOFC 2YJ5A 3R3JA 2QPLA 1GTJ1 2XOKA 4OGLA 4MS4B 4JJ6A 1QP7A 1E5VA 1X1TA 3CVUA 3I4CA 5AM0A 4WFIA 3PGVA 4E30A 2DQZA 3Q9SA 4DV7B 5ADWA 4XBOA 1E0SA 3T9BA 3UENA 4DLZA 3EMVA 4FFDA 3FFWA 2VA8A 1II9A 5CH3A 1S02A 3TQFA 1KSFX 5J2UA 3PB3A 2IP4A 4MV9A 1EGVB 3OZEA 3ZDYB 4B73A 5DCWA 2A0UA 1T5HX 3BXFA 5J3JA 1I4OA 3DBRB 3OE1A 4KXYA 5ICCA 1OGIA 3CF4G 2HGSA 4B8ZA 1AV6A 3DSRA 1FSZA 3GGGA 4LG2A 1YAHA 3TW8B 3KDPA 3OQIA 4LXIA 1EVIA 5TGDA 4BUJA 1B0PA 3U3JA 1HFEL 2C4NA 1G3MA 3E9SA 1KJ8A 4R31A 2UXCB 5EXPA 2ZJ3A 4KXXA 2C2BA 3SMQA 3DE0X 2CFIA 4RF4A 3RIXA 1YS7A 1TF7A 3OPYB 4A0HA 1PZNA 3CIOA 3CNHA 2AWNA 2Z8YA 1STOA 3JALA 3PR2B 5DP1A 1EUZA 2QRLA 1GEEA 2ZYTX 5G0UA 3AT1A 3GNSA 1E6WA 2C5SA 2WAAA 3PI6A 4MWSA 4E09A 1YRLA 4YBRA 2LVOC 4LDZA 1T15A 4L57A 4PRZA 2PSSA 2PKEA 4O63O 3T3HA 3GUVA 4RFSA 3K5HA 2A78A 4TYYA 1CF9A 4OFBA 1MC8A 2O7NA 4R7GA 5JD4A 5ALYA 3ZU3A 5A6SA 3KQSA 4X45A 4RZXA 3DFUA 3T7SA 3O38A 1Y8QA 5BO5A 4V0LA 2HMWA 3MMXA 3HFSA 1E9EA 4MQ6A 2OENG 3IBFA 2RJ3A 1WMEA 5I7AA 3BXZA 3GQ3A 2UZ3A 1AVTA 1JZSA 2B9EA 2XAAA 3BMQB 5T6BA 4JKIA 4KAAA 3EPLA 4GWKA 2OCAA 3H1FA 2VWPA 2UUBB 3TECE 3U9SA 4UVDA 3Q7QA 3N8NA 3K3PA 3TTXA 1P5JA 1QF9A 3KT3A 4LJ4A 1Z56C 1H2BA 3E61A 4MA0A 3B2QA 1SUEA 2VRBA 3PGA1 2RJNA 1DUVG 5JO9A 1C30A 2Q1SA 4EJ0A 2WKQA 1YFKA 2IOHA 3RU7A 5AVVA 1BCSB 2IE8A 4GZLA 1EFLA 2G7MC 3D5EA 2QQ5A 4RPGA 1FVXA 1H8ED 1N6NA 5THQA 3ROXA 3REQA 3VISA 4B6RA 4TT3A 3NV7A 4BVKA 1J8QA 4N47A 5KBYA 4V38A 4BO0A 3KVOA 2V7EA 3DDNA 4RKQA 3SDSA 3OICA 1ZVVA 3M3DA 3EXHB 4QJIA 5F64A 5LC1A 3VU9B 3W05A 2VSQA 2D5IA 1U0TA 2NU7A 3PS9A 4D74A 1Y1QA 1PJSA 4UFNA 4AJLA 1QFMA 1UM8A 2IOFA 2EFYA 2VYND 3VR6D 4C6TB 1RYNA 1W44A 1RCFA 1I0ZA 4B34A 3KXEC 1FDSA 5HKAA 2NUTA 3GLUA 4R83A 2FFQA 3LCUA 1Q7GA 4D80A 1RYHA 3B3JA 2YXBA 5EL0A 1GAXA 1UIRA 2FF5A 1FLAA 5IT0A 2W82A 5CA1B 3PQ6A 5CLFA 2IZZA 3KKOA 5HRUA 3KLNA 3QHPA 4N8SA 3IV7A 3IAXA 1SC3A 4AF6A 1RI1A 3KKQA 4LYYA 3EVEA 3AUUA 1LBEA 5BY2A 3CCCA 4LF4B 3BH7A 1H66A 5IBPA 2YV3A 3U4AA 3VDNB 3LGSA 4LWZA 1Z7YA 2DWQA 3CZ9A 3GPPA 2KM1A 3G2QA 4AMGA 5IAGA 2XIQA 4N54A 4IJKA 1FRFS 4DBGB 4FHDA 3ZE8A 2BBWA 2W2LD 1JR3D 3DJFA 4RA6B 1B76A 3KU4A 4CJ6A 4B83A 1P9WA 4KVAA 3HB1A 2OZLB 1ABEA 1Q50A 1ZMWA 3AL0C 4WASA 5I51A 1E6CA 4BATA 1ZU4A 4NJEA 4FOOA 1ST2A 2K6GA 2GWRA 4KR9A 5L3SB 2QAGA 1UDAA 4EY7A 5J43A 1MU5A 1UPXA 1WCV1 4AIIA 2A9QA 3A4VA 3RO7A 3W2EA 4TSRA 4X6LA 3A9UA 1Z74A 1BDBA 4DUZM 2QX4A 5E4TA 2A1TR 3H4IA 3RCBA 1PGJA 4IUBS 1UJ5A 2BFCB 1NSTA 4AFNA 3GGCA 1JUDA 4DDKA 4WK2B 2C95A 4M1YA 1ZOLA 2I6TA 4E5NA 1KZGB 3A3OA 5TVGA 1XDZA 3INRA 2R87A 4C7JA 2CVQA 3QHAA 2UYHA 3TTWA 2B83A 1AHIA 2WDZA 2OXRA 4HXEB 5FLYA 1E79D 1UR5A 1VLMA 1U4NA 5BW5A 3KJXA 4IJMA 3QE4A 1YJXA 1J6UA 4I6GA 2XGMA 3SYTA 1U8YA 3BILA 3P7MA 3H05A 3ESQA 2DWMA 4CUJA 3CURA 4INOA 4B6GA 3Q10A 3FPGA 3RU3A 3K6KA 1HY3A 3D3JA 4NK5A 2J1LA 2EJTA 3RM3A 3AVYA 2HWXA 3IEIA 2BTOA 1HTBA 5GY7A 3FRJA 3ZIAD 4KO3S 1FXWF 3HZOA 2JGLA 5EIXA 1YR7A 1QNFA 1CUJA 1IDOA 3QLTA 1H1TA 2NO1A 3MTEA 4HDSA 3CWQA 3QKUA 3SX2A 3I3OA 2GNOA 3QIAA 1H6DA 3PWSA 1P1BA 3VKWA 4LRTA 2G4VA 1AKEA 4WFQA 5DHSA 2DT5A 3MGKA 1UODA 3L8FA 4RTRA 4XQCA 1ZBQA 3H5VA 3D02A 3H2KA 4ZYXA 2ZSFA 3SQNA 3TLXA 2IH5A 4R8MA 4KQFA 4RS4A 2YHIB 1Z3IX 1ZJ4A 3GDOA 2QP4A 2YMPA 5AKXA 2NV6A 3DOHA 4X62M 3V4SA 1CULC 2C7GA 3DFFA 1YA4A 5FTKA 1FE8A 4NRDA 3JWEA 5IPFA 2IF2A 4DSAA 1EE2A 2JBWA 1NQWA 3M0EA 3VYSB 5DBFA 3T6KA 2AB0A 1CIVA 2IHTA 3LVFO 1G5RA 3O1HB 4AJOA 5TQJA 4DHEA 4I46A 1MOZA 4C0JA 1LZLA 4DCNA 1XNRB 3AINA 1QHHA 3MC1A 5FTMA 5AXAA 4LRUA 2HRCA 1M9NA 4LFAB 3L1VA 4RSRA 1PIWA 3IP1A 5IT5A 5L53A 2HIAA 4M9ZA 4MYSA 4KAJA 4BE9A 2WNHA 3IIIA 3WJ1A 3LC1O 3MPOA 1KFKB 3E05A 1XSEA 4WERA 2AOVA 5J63A 1VPTA 1JG7A 5F5XA 2V59A 1MG5A 4OGWA 2XMBA 5IZCA 3KEOA 1VA4A 2XB4A 3EOBI 3L29A 1GTG1 1EK0A 4DV5B 2O3UA 4DDMA 3RTDA 4MYTA 1HFJA 1N32B 3EXHC 3SQLA 1VE5A 5BNIA 4YP1A 5KC9A 4Y2TA 2W37A 3DE5X 4L8RC 4WNIA 2QRHA 3MBOA 2Q28A 1KHTA 16PKA 4B2LA 4KBFA 4US2R 4CQMD 4TTQA 4YCDA 3BZUA 3BMOB 4KR3A 2DAGA 2QUBA 4UDXX 1A9TA 1HT1E 3X1JA 4OB6A 4KLCA 5TS3A 5JNWA 5BPVA 2Q6LA 1F8FA 4I6EA 3IKMB 1UDXA 2OBXA 1RTKA 4IBJA 2PWZA 1QIJA 2I7XA 1P4RA 2OHVA 3PHJA 4YJ3F 2G4CA 4ZVQA 5GQSA 4FWGA 2CDCA 3EXG1 3V1MA 4HI0E 2XUFA 3WGTA 4RW0A 4LE2A 2VUSA 2L4EA 4ZWNA 3LAWA 4EZIA 2Q6IA 2CMHA 1C29B 3I01M 1S1CA 4KX5A 1E2IA 5ILOA 4QBKA 3ZLVA 5CIQA 4DYDA 2QY9A 4QJ5A 2VP0A 3RV3A 1V8BA 4RK4A 2BM0A 5FBKA 4P58A 2QTCA 4HZGA 3ZC3A 3RGWS 4IMJB 5KQMA 4GFDA 2WE7A 3RBXA 2XNHA 1YDMA 2Y1GA 3H2BA 2QNRA 1EIWA 5CTAA 3S5UA 2EYUA 2IHJA 1KJJA 3IJ5A 1B41A 1DO0A 4B4KA 3L7IA 1VBMA 3BMXA 1PM5A 3CEJA 1KMCA 5HW0A 4FYXA 2ZSUA 4JJ4A 3CG4A 3THSA 1WV1A 5JR3A 4RJIA 4ESOA 1ECGA 3D3QA 2FGKA 1NVBA 4BUCA 5G40A 2GFQA 3LLCA 4LCEA 4WVFA 4P7BA 2BBTA 2WHPB 1Z68A 1NMYA 1VKRA 4KNVA 2GZ1A 2X9QA 3GHHA 2YC2C 2QRZA 5EMLA 3LO8A 5JZVA 3OJ0A 2CFRA 2VHYA 4CXMA 3IO3A 3Q3VA 4DQLA 2H17A 3DBVO 4HTFB 4RNCA 2XKJE 4O4HF 5B3KA 3P5SA 1NLUA 5DHAA 3FLEA 1N2XA 4LY6A 4B7GA 2Q1XA 1RLOA 3C1AA 1SUWA 2ZKIA 1BD3A 1H2FA 1W87A 2CYCA 4OCZA 4WLNA 2VEOA 4ER0A 5LLDA 3W3AH 1NN0A 4Q1VA 2HDHA 1NBME 3N28A 4AMYA 2D2IA 3O0DA 3UVEA 2YZ2A 2PZGA 1KZ1A 5FA8A 2ETVA 1T5SA 2NP7A 4YDQA 3FWYA 1Q7EA 4G65A 4P17A 1L2BA 4DW8A 3TIVA 4DUGA 1DDGA 3UMYA 1U04A 4RHYA 3QBTA 3DZHA 3L1KA 3HJCA 1TC1A 1LRJA 3M6XA 4FZJA 2RK3A 4WINA 1DEKA 2OP0A 1FTGA 3RS8A 2MJLA 2PJDA 2OGUA 3V8PA 2VYVD 4GU5A 3TG2A 3T4PA 2N35A 3LX6A 3QEBZ 1Z5VA 1JQDA 3A04A 4X60A 1R0BA 3B3FA 4CMAA 3GP3A 3DBRA 1QV6A 4IMRA 4JQOA 4BCDA 2JGNA 2OWDA 3EPHA 3SZLA 3AETB 2H1OA 3W1VA 4XD7D 3MJTA 3CIFA 2JHCA 4P86A 2DAPA 3N8DA 3OZSA 1DRVA 4OSPA 3DMDA 3EZ7A 1BGXT 2PT9A 3OPYA 3BKWA 5GOZA 4RF1A 4DIEA 3ESCA 3P9PA 1BAPA 3L6OO 5H9VA 2RC5A 5EJFA 3LVVA 3IERA 1NRWA 2P3QA 1Y8CA 1TCVA 6YASA 2Y93A 3C97A 2R8EA 3VTFA 4LK2A 2W5UA 3H87A 4FK8A 5CYPA 5JAPA 3TW6A 1I3NA 1VL1A 1C0LA 5LB4A 3VYUB 2J4CA 3L6BA 1FJHA 2FZGA 4CV2A 1YWGO 5AQ1A 3PNMA 4GMKA 4JVNA 1JL3A 3AHDA 4I4IA 2WUVA 3MJDA 1K7SN 2XDYA 4U2BA 4J0EA 1GGVA 3BMQA 1I2ZA 4NOOB 2LVAA 4EYEA 1VKNA 5C5IA 2JD1A 3DP7A 3LHDA 3DE6X 5F52A 3DG9A 1FP4A 4TQUS 4YP5A 3NTQA 1Z4QA 3EZYA 1IFXA 4MP6A 3H0CA 1II0A 1YO6A 4B2YA 5DF1A 2W22A 1EP3B 3F67A 4BY9E 2MSLA 1I3CA 2FSFA 3K15A 3J81k 3IDQA 4XEUA 1J56A 5EKXA 5AQEA 3IHPA 4ECEA 2H1CA 4ZYLA 4AROA 2QQGA 3GA5A 3CSSA 1XEAA 4ANRA 3W9BA 3TUIC 3ZTYA 4BS9A 1UBHS 4QYMA 2Y27A 2FOLA 4J29A 3U39A 5AI5A 4YRMA 3NGXA 5A6VA 3SHOA 1XZJA 2G5PA 3WTCA 3NANA 2A9JA 5JATA 3HP1A 5IANA 5JALA 1TCCA 4N7MA 3L0BA 3RRFA 4KK4A 3VU9A 2JK1A 4B46A 2PZ8A 2J09A 1U4SA 2CUNA 4D25A 5ED4A 1MD9A 3KPUA 4XIFA 4GW3A 2AD1A 4MWDA 3TQHA 3QOYA 4JD5A 2WJWA 4HMOA 1OTRA 2AMJA 3GDFA 3IV6A 1GCGA 4BLPA 5GZ3A 1BHQ1 1VKJA 2XYPA 1C2TA 5AVQA 3SKXA 5I7OA 4YCNA 1U2EA 2X4IA 2WF7A 1X6VA 3M5WA 5FPKA 3QA3E 1QPBA 3MSXA 1GGNA 3QXGA 2RIRA 4IAOA 4EFNA 5CA1A 1PHPA 3DGFC 3HB7A 4MPTA 3VPBA 2VZ9A 1KXJA 4G9EA 3RJMA 3U40A 1E6KA 1HR0M 4MW6A 2GM9A 1Y6RA 2WM9B 3AKCA 2Z2YA 5D6NA 5ICEA 4GZ5A 4ED9A 3S2ZA 1Y81A 5F3DA 3G6WA 4HYEA 3LY7A 1J90A 2D1SA 5FCDA 3KFLA 3KBBA 2O2GA 1QK3A 3RHFA 2VWGA 1J5EM 3OEEA 3E3OA 3FYTA 1SVNA 2FH5B 4F6LA 5CITA 4C4SA 1OY1A 4MW7A 3RFCA 4EY5A 2CZCA 1XTJA 2C97A 1IZ9A 3INGA 4YR9A 1GWNA 2PQ0A 3GLSA 1Q15A 1QB7A 2WUEA 4TKVA 4Z4HA 2QL6A 1W36B 3WWZA 1OBOA 4ASUA 4BXOB 3PEFA 2A4MA 1D2GA 3E9RA 3FYHA 4L5YA 3TM4A 4NWIA 1VCNA 2JCSA 5L3SA 5DV9A 5ITYA 4P3XA 2HU2A 4A8TA 2CSXA 1QUSA 2WD7B 2BGUA 3G3EA 3ICEA 2JEYA 1WXWA 4MPRA 5DM0A 4PLPA 1FTQA 4ZQEA 1Z4NA 3O1LA 5DSTA 4XM0A 1V1MA 1CIPA 3KOZE 2AVNA 3N86A 3TPFA 5FWXB 2KLBA 2AVDA 3TCKA 4DIFA 3EEQA 3V76A 3CUUA 4M0WA 2JFWA 1JVNA 2XNCA 5BPHA 4UHJA 5IKOA 4BNHA 4CUKA 3CC8A 4MUKA 4ND8A 2A9OA 3PA6A 3GJTA 2Z0MA 3VPCA 1E8MA 1E99A 1E4OA 3ZCSA 5LQAA 5H1YA 4BMPB 2OCDA 4V0KA 3TG8A 4KIWA 3NP7A 3OZWA 4LG1A 4FFOA 3F4BA 3MLAA 4I50A 3MJFA 2ZSDA 3OF2A 6Q21A 5IZ4A 3CR8A 1F48A 2AW3A 5SZHB 1PJCA 2XZDA 3FBTA 2AWOA 1XPJA 4KPYA 4OBBA 4XJTA 1DLIA 2X0JA 1DIGA 4UARA 3G9QA 2QMYA 4JYMA 1BMDA 1L7OA 4L8VA 1I33A 1N5LA 3T4XA 3GLKA 3RYFA 2CYBA 2O2YA 1G98A 3FUCA 1GU7A 4PSVA 3D1JA 4HY3A 4ZRMA 1WXDA 3LPLA 3SJCA 3TIIA 1GG2A 1ICEA 1F38A 5J2UF 1PJRA 3K9GA 4B2PA 2KNAA 4X93A 2REQB 4HNAB 4GDFA 2PLFA 1T2EA 3BOSA 1M2EA 1LC3A 4Z4FA 5SY9A 3EIWA 2C5RA 3MB5A 1OE0A 1JG3A 2Z9BA 5E3HA 3H6GA 5F1PA 2BMFA 4ZP1A 3DCYA 1RU3A 2ODNA 2YHIA 1QGZA 3WGQA 3GRRA 4C4OA 2EBUA 2MYNA 1T0BA 1QQ6A 1R64A 4RVGA 3VZDA 1IOLA 5BR8B 1G4AE 3N9IA 1Q11A 5A06A 5AW5A 1MX5A 3HDQA 1ZGAA 2C2OA 2IUYA 2X2FA 1JNXX 3I52A 4IDEA 4EVIA 2B4KA 4HATA 4C4XA 4Y0NA 2YVLA 2QOEA 1AQUA 3WZMA 1LGYA 4BJ3A 3LA8A 4Z9AA 3CH4B 5JQGB 3VAAA 2B20A 3DFIA 1I2CA 1YB2A 1IOZA 4RGVA 1AIPA 2I22A 2CV1A 4C0HA 1DT5A 4FS3A 2W83A 3B70A 5EMJA 2XA1A 3L2AA 1BX3A 4E07A 4EI2A 4FHEA 1QDEA 2R66A 1JXAA 4JUAA 5C1IA 3GV0A 3TZQA 3WZ2A 2PRZA 3AUAA 4DBLC 2ODQA 2VQFB 1AKVA 4TTPA 4IHAA 1IVYA 2QJRA 3AP2A 3T7RA 2B6HA 1FW6A 5GJVC 4PTLA 2OGTA 4ABYA 3L04A 2VDLB 3OUUA 5KZMB 1RPNA 3JALB 4W1PA 5KWVA 3KALA 5CVJA 3FPSA 3I2HA 1XN4A 4D5GA 2OCPA 5K8VA 1U9CA 3G2OA 1U9IA 4J3JA 4JCOA 4EUFA 4E4TA 2HHHM 2ZYRA 1HYQA 3BMOA 4M38A 3IEVA 2CVZA 5BUZA 5KOYA 2ZTMA 3CNNA 1RXWA 2JLRA 4AXXA 3T7IA 1CIJA 5T4HA 1C8VB 4MH0E 1QR6A 2POCA 1EFVA 1ADBA 4YJ2F 4RX1A 1OZHA 1Y8QB 4TMYA 2EF0A 3KWLA 1IVSA 4RLHA 2VT6A 4M21A 2VT3A 1K6XA 1T5TA 1BEZA 3MRSA 3GMSA 2ID7A 2XNDA 5TIIA 3UV3A 3DOAA 3SQXA 1N3IA 2ENWA 2ZAMA 2ERCA 3E9EA 4P92A 3WGYA 1KAMA 3QXCA 2I6XA 5A3SA 3K4HA 4XFKA 3OA2A 1U8CB 2JKVA 1PP4A 1NURA 1RQ2A 1G3IA 4E2WA 1R10A 4U8GA 4HPXB 3OTHA 5BRNA 5EP2A 1Z16A 4EPYA 2A5LA 5K6AA 5DLYA 1C30B 3QWIA 2NPOA 3A3PA 4CLHA 1RWXA 4PIMA 1IQ0A 4FEGA 1FFBA 2COKA 4ML3A 4RH3A 2PTHA 5PNTA 3C2QA 3HBNA 3REQB 5AMXA 1PJTA 1Q3HA 2ZI3A 4PHTA 4MULA 2XQJA 3LTNC 2RGWA 1QO7A 3MFYA 1MCZA 1EX1A 3JTMA 3ROQA 1ZOOA 1W36C 1FNCA 4YTEA 1GAWA 3U7FB 2PGIA 3F98A 1JDTA 1EHYA 2WHPA 1JA0A 1R00A 1ZD5A 3KWFA 1HKHA 3ODPA 1PGOA 4XVCA 3K0BA 4HTFA 4BMNA 1E92A 1B6RA 4NDZA 1PTJC 3NASA 3H8SA 4KAXA 1P0FA 2C20A 3UAXA 2JVJA 3SX0A 2I7TA 4MGEA 1AO3A 1HTWA 4YAIA 2NUTB 3PX3A 5JADA 2OB2A 1I6LA 2RHRA 1SKQA 3N07A 5I7UA 2BWJA 2B1RA 2GPBA 2FMKA 4F92B 3SASA 4I19A 3SAWA 6CHYA 4J4BA 1L5VA 1BHJA 3HCBA 1K89A 2PR2A 4N41A 3D7NA 3ZY4A 2ORVA 3F6EX 4OGGA 2PSEA 3FCAA 1FVHA 2WWXA 5LD2B 4AYTA 1WXXA 2JC3A 3K09C 3OETA 1B73A 3UB2A 4EMBA 2VBCA 3EVGA 1NXTA 5CT6A 1ZMBA 3OT1A 1ISSA 3V1UA 3RSLA 4WBSA 5H80A 4II2A 1GKIA 1KIMA 3JR4A 4IZHA 2GETA 1LW6E 4C7MA 3EASA 2UYYA 3ISTA 3AETA 4UDNA 4RJTA 5JZ9A 3KM0A 3L7KA 3ANYB 4QDOA 1Z6ZA 1FUUA 2IEYA 3HKBB 4O4LA 5J4HA 3K70D 4NJEB 3NAQA 3Q0IA 3ENKA 3G5UA 3H5LA 1V2HE 2VDJA 2HLHA 2IDMA 1X3SA 4MAFA 1XU7A 1HQDA 5KWJA 3NHYA 1MO2A 3EZFA 3UT0A 4A8JC 3EWIA 3K94A 4YN3A 4Q9NA 2WMDA 1QOZA 5EJ9A 1E2DA 4PDGA 1PVVA 2DZNB 1AQYA 1YFZA 1LC0A 5F4BA 1LLFA 5FLXS 2HHLA 2XZUA 1UWLA 3W2HA 1U2GA 2VHTA 3ZLTA 1CBUA 3QXXA 5B3AA 2J45A 2XTJA 2QPTA 2WU0A 1D0MA 2QW0X 4C4PA 3SF0A 3JWJA 1O97C 2GQFA 2B5WA 5DGXA 1HLFA 3QNWA 2PWAA 3UF0A 1JDUA 3VR2A 4LQDA 2CHVA 1TH4A 4U6QA 3IURA 1KY2A 3K2BA 4F1IA 4S1TA 4YRTA 1TD9A 5LXTA 4MKIA 3PJRA 4FDUA 1P2BA 4M37A 2YWHA 3JV7A 2BCEA 3NIBA 4GWLA 5K45A 1KPHA 4ZZ3A 1NF2A 3OCXA 2R48A 4N3BA 5AK3A 5ITSA 1YL5A 4FZ3A 2YL2A 3RUEA 4XQ0A 2E55A 3KL2A 2G63A 1ZWLA 3PTLA 1J2YA 3P0IA 4JB2A 4CF5A 4R9SA 1NYLA 4RFVA 4WLEA 2MYPA 1SEVA 4U6SA 3WLKX 4HDSB 4K2AA 1H3NA 5AM5A 3V2HA 2XBMA 1AA9A 1ZCAA 4MUHA 4GR9A 2X1HA 2HJGA 5FAKA 5GJWC 3FE2A 3ZWQA 5AO9A 3ZHYA 1W85B 1XR3A 4XYBA 1ISHA 1UQTA 1NKSA 4DMRA 4AXBA 1R7RA 4W9NA 4RYDA 1RIFA 4OUDB 1LFAA 1W76A 3MHPA 2APJA 3OUTA 4KHPB 3AEUA 2ECPA 4QQRA 4XWTA 4YJKA 1P7ZA 2YIMA 4BMYA 3CKLA 4OU7A 2XUIA 1O87A 1Z83A 4S1WA 2GBCA 5T5QA 5DNUA 3ZIUA 4ITVA 1Z08A 3P9YA 4OVZA 5HCUA 3H1EA 2C3UA 3ELYA 1H23A 1ZN9A 4OL0A 3AR5A 2VUHB 3TGPA 1XMOM 3TCNA 4R1NA 3PR3A 4Y2XA 2O14A 3TFOA 1ZCZA 3QBDA 3I5YA 1QHHB 1RZ3A 2YWGA 3R0IA 4L16A 1T35A 2WJAA 4BKRA 4EO7A 4HN4B 5KOHB 3F0TA 5LWQA 1QB8A 1WW2A 1OKSA 2ZTUA 4RIHA 3WLHA 1ACMA 3G79A 1J8VA 1TYBE 4HGYA 4YH1A 1DWUA 4I8XA 4BJHB 4DB2A 3HM2A 2FWIA 4FC7A 2Z2KA 3EXAA 4O4IA 1IN4A 4HFRA 3QU2A 2R84A 1RWMA 2FSUA 1XO1A 4ZMSA 2JL1A 4AQYM 1JFVA 5HZKA 1CNMA 4EHBA 1LSUA 3TQOA 2IU3A 4EJ2A 2DLNA 1XTZA 1Z5NA 2X8BA 3RIHA 4L2IA 1LK7A 2HBYA 3A31A 5KKAA 4OLHA 4S04A 2WWHA 2H29A 2O1WA 1A04A 2CL6X 1TJ5A 2RBEA 3JYNA 4BXOA 3A1NA 3WXBA 5AUQA 1OI3A 3CPSA 1HL3A 4OI0A 4QUGA 1Q2XA 3GLFA 3FCOA 4TXHA 1SCDA 3N0XA 4GUAA 2H9IA 1JJBA 1Z8DA 4N7JA 4E08A 1U3FA 2FZKA 3W4JA 5EXDA 4D9HA 4YRRA 2GCNA 3W0LB 2WQ7A 1SA0B 2WLTA 2BCGY 5I9BA 3D7LA 1VEGA 2ACWA 1Z5AA 5FWXA 4EB8A 2Z4SA 2ZCJA 1N4AA 3WYNA 1YBFA 1MGOA 1YGYA 1MU0A 5J40A 4IOMA 4MWOA 4YUAA 2KA6B 1JIJA 3UKJA 3F3SA 1G64A 4NV3A 5LM3A 2CB9A 4XYLA 2VRNA 1F4VA 4KODA 1OIVA 2CKMA 1P2VA 1H6AA 3T5AA 3HO6A 4MV8A 1EVLA 2WSSA 4CDMA 3OX4A 1NXSA 2PZFA 4RCVA 3BWEA 3LPAA 1H4TA 1EVZA 3UMJA 3AJ8A 3VOAA 1LTQA 1NVGA 2W2PA 2W71A 1M3SA 4YDRA 5C1BA 5LJIA 1VDZA 2AK2A 2H4YA 4URVR 5IH7A 2AI1A 3IB6A 2VKQA 2C9ZA 1XLTA 1ZH4A 1R8XA 4YUVA 1C50A 2QD5A 2J6HA 1P3JA 2ZRPA 1CKEA 2GBPA 5BWLA 2QAGC 3ZZUA 2FMUA 1PW7A 4YWHA 4XK8F 5LQJA 1SVWA 4DC0A 5KWIA 2FEPA 2PCJA 2PUFA 3MJCA 2REQA 3D6VA 3JZAA 1GPAA 3ZDXB 3ZE1B 3KAQA 3IQGX 4KP7A 5IX8A 1QQAA 1P39A 3MS4A 4CKZA 3JQEA 5C7OO 4TN5A 2VLBA 3HCWA 1F8YA 4HAVA 2F1KA 4UQOA 4UUOA 4JSTA 4LJ9A 3QPCA 4C30A 1G2IA 3QFCA 1C9YA 2R751 4Y98A 5A7FA 4K87A 4ARUA 3JW8A 2EKDA 1YQQA 4RPJA 2CE2X 3O4VA 1P17A 4X94A 3IIKA 5CPFA 3O91A 1WIWA 2QLFA 2QTNA 4WI1A 4PC2A 2DPMA 2Z43A 3KLPX 3VKHA 2BRUA 5FX2A 1ZL0A 1GGFA 1WW8A 4TYNA 1KYQA 1Y3BE 1QHFA 4RQAA 5JQGA 3GPUA 5P8WA 3OOJA 1DSSG 1FBNA 4D46A 1RBQA 2BJHA 4JHXA 2YJNA 4QQNA 1XMXA 1OT5A 3SHQA 4QQKA 2OXTA 2C3PA 4ME6A 2ILVA 3CEAA 3LMMA 2J9YB 4L9AA 4ZI5A 1DV0A 1DC5A 3EPKA 1OV6A 4UTRA 3WNDA 5E9AA 4ZN6A 2A5DA 3FRHA 1QBKC 1C9JA 5ICMA 5FJIA 3NT5A 3UK2A 3N7AA 2YOHA 4ER6A 2FW6A 2WIKA 2JBHA 2JIZD 4L5AA 4U7TB 5FDFA 3FVRA 3BEOA 1XKXA 2C9YA 2BGGA 3ZXSA 3ICVA 4CM4A 4KIFA 4TROA 5FLKA 5EJ6A 1NDQA 3OEHA 4LY3A 1NVMA 1MO4A 2EP8A 4ZIRB 2H51A 3A98B 1JB1A 5CD1A 2QD2A 3K5WA 3ZTTA 3GFGA 3B53X 5DBIA 3FUXA 2XIJA 4D0GA 4RY2A 4TM8A 1XQVA 3Q5EA 2ZIAA 3U37A 1JEJA 3S55A 4BO8A 4QJ3A 5C18A 3R7WB 1PT9A 1M2GA 1KMHA 1YZGA 1XV5A 3OKPA 3A37A 4NMMA 4CLXA 4E13A 4INPA 2IITA 1N78A 2DGDA 3DC2A 4IQ0A 4HDMA 5A3JA 3RC9A 4H31A 1FK8A 3C24A 5FHQA 3TNJA 1NSYA 3AXTA 2PJZA 3KOWE 2YN0A 3EDQA 2D7HA 2CNWD 2UYGA 5LWHA 2F8SA 1J9ZA 3A6HA 3BD6A 2XTZA 4GIBA 1V6CA 4B44A 4Y3UA 4D3ZA 1YDWA 4JROA 2BY4A 4WW0A 1FP4B 3AXSA 3O4JA 4PHHA 1ZK1A 4BLUA 3LJKA 2Z6UA 5CB6A 1A7AA 2QGZA 3HC7A 4R51A 2HL6A 3Q1KA 5IZCC 1VG5A 3X2FA 3HGMA 3FWKA 4G07A 1HX7A 4CKEB 1NOIA 4LI0A 3S28A 2JZ1A 1LH0A 4D4IA 4TZTA 2JFPA 4QXAA 1A2BA 3L8HA 3I04A 4EKDA 3KFXA 3UUWA 3PYMA 2XRFA 1Z4PX 1PZHA 1YNSA 1E8DA 4OF4A 4JXZA 4PX3A 1LTKA 4E5UA 4H1VA 1K86A 1BFUA 3KPJA 2F5PA 5CA1F 5HS6A 1VEJA 4XIJA 1C7YA 3HCCA 5LNK1 1IOVA 4KE7A 3ZV5A 5KYNA 3HA3A 5EE1A 3FOBA 3LGAA 1YB6A 4YAFA 1L9XA 3Q88A 4B3SB 4JWTA 4WZBA 1OT3A 3HYTA 4YECA 1DS6A 4N0EA 4TTTS 2RONA 1YQ9A 4CFSA 4IV8A 1K4MA 1N2BA 2VOJA 1YQXA 2GARA 3RRNA 2NIPA 5L95A 3C45A 5LZ7A 4HVLA 2BT4A 1L2CA 4BWVA 4J9VA 4C01A 1UMBA 4OMCA 4KSYA 1CJBA 2ZRJA 4YCBA 2FW9A 1H8HA 5L6LB 1S7CA 2EC5A 3QJGA 5CPBA 1XTVA 2GRAA 1MA0A 5CDSA 4BVJA 1ENOA 3G0CA 4WEOA 5KJCA 3B3QA 1WB6A 3QZUA 1Z4JA 5FNVA 3GPLA 2OO3A 3G7UA 3JSXA 1EVEA 3KAPA 2AC2A 3A4MA 4RY8A 4MJ3A 1W0JD 3RBVA 5FBWB 2PKRA 3P26A 4EFLA 1X14A 4YP7A 4DHWA 3MGAA 1G8SA 3GN1A 5A03A 4JVSB 4BE4A 3FKJA 3RG2A 4M1QA 4Q9JA 4OREX 4JUIA 2ADFA 3UUFA 4YREA 1U8EA 2H0RA 5GZ6A 3E4CA 1DEAA 2GNPA 4U9UA 3G0IA 4BRZA 1RP7A 2PUCA 4TKVB 4HMQA 3HKBA 3TZBA 3U9TA 1CZOA 5LBTA 1JECA 3AGPA 4MGIR 1IBMB 4S1VA 4QWWA 1EQ2A 2F5SA 4D79A 3EE6A 2ZKLA 1YR9A 1C9MA 4TQ9A 1VLVA 3OCVA 3KJFA 4NH4A 3T3DA 1VMDA 1A2KC 4C0LA 1VJ0A 1V1MB 3VX3A 4EX7A 4KH0A 2Q5FA 4KGVA 5B6JA 4IDFA 1XRRA 4LV5B 5CVVA 4ZKDA 4F2WA 1G5TA 2IBTA 1KZ7B 1HK7A 2B99A 4QZVA 4B3MB 1CTQA 2QV0A 3IP7A 2G88A 2B78A 5A4FS 5AKZA 3UGKA 4ND8B 2NXJA 1L8OA 5T4BA 3FY4A 2JZCA 3MS7A 3HU3A 1QTNA 3EEBA 1U1CA 3PQEA 4EKGA 3GA0A 2OGZA 4AMZA 2J0EA 3FVQA 4ZZ0A 2X13A 1ZHHA 4I50B 1UKEA 1FLVA 1D1SA 2RHBA 1SO8A 2YZKA 3JU3A 4CYMA 5ITXE 4I1SA 3J7AC 2RG1A 3OJFA 4M0DA 2P65A 3DLTA 1VECA 4IBDA 3KW6A 3VJKA 3BWYA 3ORRA 3EUEA 2CLFB 5L8VA 4H7KA 1LPMA 2X6QA 3RYFB 4LZOA 1Y7IA 1ISRA 2HIGA 2FXVA 5CEJA 4L0DA 5K3CA 1GUBA 1YQEA 4RLQA 3BBZA 1Z33A 2QZ4A 3WGJA 4BO7A 5JBIA 4IUCS 4B6QA 3LDUA 3ORSA 2XPCA 5PGMA 4MQFB 3K05A 3RUPA 4GPAA 3OTWA 1GZUA 2UVQA 2A9KA 3KYCA 1W85A 4QOIA 5IK2D 1T5DX 1IQRA 4YMLA 4OUDA 4XIGS 5IMSA 4QRDA 2J6CA 1MIHA 1GY8A 3VAYA 4OV6B 4PYNA 5EGSA 4EL5A 1WBJB 1JTFA 4BVLA 3GZTB 2R6AA 1KQFA 4HB4A 1ZJYA 3GEGA 3ZCVA 4RELA 3WSVA 5BOSB 1MH9A 5JPCA 3HU5A 2WWFA 1Y1PA 2CBGA