4GC5A

Crystal structure of murine tfb1m
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
318
Chain Sequence
FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Dimethyladenosine transferase 1, mitochondrial
total genus 103
structure length 318
sequence length 319
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc5A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc5A01
3CKKA 4QTTB 2AOXA 4U7PB 2P40A 3B5IA 1BHJA 1VL5A 4DM3A 1JR4A 3HCAA 5GIOE 3UJ6A 3B3GA 3CBGA 1QYRA 3M6WA 3EEYA 4RTKA 3CGGA 4FP9A 3FZGA 4C4AA 2ZZMA 1JG2A 1WZNA 2PT9A 5GP1A 5E2AA 2JH8A 3SSMA 3LBFA 4CWAA 3UJ9A 4DCGA 2G8NA 5FUBA 5EQJB 2UYHA 3REOA 3M6UA 4PGHA 4E2WA 5E9JA 4OA5A 4PYQA 3TKYA 4F85A 1WXWA 4RYLA 4YUYA 3FTFA 3M6VA 2ZWVA 3AJDA 5F2KA 1INLA 1JTFA 1RI2A 3KQVA 3SSOA 4WVLA 5DT2A 5M5BA 4UOEA 3DXXA 5EOVA 5C1IA 4CKEA 4FR0A 2HMYB 5EIWA 3C0KA 1R74A 3QV2A 3A7EA 4GBED 4RWZA 2OYRA 5ICGA 3OZRA 2BM9A 2C7QA 1FPQA 3E23A 1TPYA 3G5LA 2P3OA 3NTVA 1NBHA 2HV9A 3A25A 4KVZA 4RSRA 2C7RA 4IV8A 5FCDA 4FSXA 2PVCA 2IFTA 2UYQA 4PYOA 2NNWB 3I58A 1P91A 4RTLA 3P9IA 1I1NA 2B9EA 1X1BA 5K09A 3S68A 3PTAA 3HVKA 1YZHA 2PWPA 1M6YA 3FUXA 5JR3A 3I64A 3HP7A 2PJDA 5CVVA 1XCLA 3EVZA 5DM1A 2IDKA 5D1NA 5E1OA 1R8YA 3B3JA 5ERGB 2OZVA 2ZWAA 2AVDA 2P35A 4HGYA 4DZRA 4X60A 2IP2A 2OXTA 4EQZA 5DRYA 2VDUE 4R05A 4F84A 1ZGJA 4Z2YA 2UYCA 1NW6A 1SQGA 4FGZA 3E7PA 4E33A 4P7GA 1G38A 4PINA 2P1DA 4FSDA 3HVHA 4R8RA 2IH4A 4HC4A 4P7JA 3HVJA 5E1MA 2EX4A 3ID6C 3ELDA 2O05A 4FS8A 2PY6A 2CL5A 2HWKA 3TR6A 3L8DA 4C06A 4E2YA 4KDRA 8MHTA 1F3LA 3FTEA 1PJZA 4R6XA 4HRAA 5K0BA 5FADA 3GRVA 3TOSA 5DTMA 4ER3A 1YB2A 4DMGA 3X0DA 3LCVB 2NP7A 2P7HA 4AX8A 1X1CA 3LDGA 2ORED 2GA9A 2IDJA 1I9GA 1DCTA 3THRA 5ICCA 4KIGA 3BWYA 3GO4A 5E1DA 1QANA 5GOZA 5FHQA 3FUTA 4C03A 5EKXA 4E2XA 5DSTA 4ER0A 4KWCA 5LSAA 3HNRA 2B25A 2XYQA 4MHTA 3SX0A 5DM2A 5LQCA 4A6DA 1IY9A 1G55A 2P3QA 3GNLA 1T43A 4YV1A 5T67A 3C3YA 1NV9A 3TKAA 2YVLA 2YUIA 2PWYA 2YR0A 3HEMA 4U7TB 4E32A 5BW5A 2VDVE 2JHPA 1M6EX 3ELUA 1O54A 3ELYA 3JWGA 4HG2A 3FPGA 2UYOA 1QAQA 4IKPA 3UA3A 4RTOA 2IH5A 4OX9Y 2Z6QA 3LCUA 5FTWA 3IEIA 5BXYA 5K0LA 3BUSA 2EFJA 2I62A 3U81A 2NXEA 3MTIA 1JSXA 3F4KA 2H00A 2JHAA 4RX1A 1RI1A 3SR4A 4V0RA 3AXTA 4C04A 3RODA 4C08A 1JQ3A 2IH2A 1RJDA 2O0LA 2PX4A 2PXAA 3EVAA 3NJRA 3PX3A 5ICEA 2YXLA 3C3PA 3O4FA 2ZBQA 1EG2A 4R8SA 2ZIFA 4YV2A 2A14A 3GCZA 1JG1A 3CJQA 3T0IA 3P9NA 4KRGA 4XUEA 3G2PA 1NW8A 4FT2A 2IBTA 2PX5A 2ADMA 1BC5A 2YTZA 3LECA 3HTXA 3G89A 3BWBA 5CD1A 2H11A 3OU2A 4GOOD 2OY0A 4E2ZA 4HH4A 4PIMA 5K0FA 2ZCJA 2ZIEA 3KQPA 2AOUB 2VS1A 3DMFA 4RVFA 5LQAA 2OKCA 1B42A 1FBNA 3PT9A 3MERA 3TM4A 4PNEA 5C9ZA 1JG4A 1WG8A 4DKJA 3AY0A 5KQSA 1H1DA 3ERCA 3OU6A 4QVKA 1YFJA 1R18A 5K0CA 4PWYA 3MQ2A 1NT2A 3G5TA 5E2BA 1VLMA 4AZTA 1DL5A 1YUBA 1HNNA 2PKWA 5DXJA 2K4MA 2I6GA 2FPOA 4RVHA 3ER9A 4OQEA 5HOQA 2FCAA 5BP7A 2Y1XA 5K0JA 1KP9A 3HA3A 1OR8A 2B2CA 2FYTA 3DUWA 2G72A 2AVNA 5GIPE 3FYCA 2IPXA 3BGIA 3LHDA 3KPJA 5HILA 2OPBA 2WA1A 1JQDA 3OZSA 1VQ1A 2YXDA 3A26A 3LPMA 4OA8A 3UA4A 4QQKA 2ZIGA 1ZGAA 2PLWA 3NWEA 3OFJA 3CVOA 2PGXA 2VZ9A 3UJCA 4KDCA 1RI3A 2QYOA 3JWJA 3KQTA 5IKMA 2V7EA 3HCEA 1AV6A 5HFJA 1O9HA 2ZBRA 3DH0A 3KQOA 4K6MA 2R3SA 4EKIA 4RTRA 1YFLA 4EKGA 2ERCA 1P1BA 4MWZA 2HNKA 3G2QA 1ZQ9A 3SVZA 3KQMA 3DP7A 2HTEA 1JTEA 3FYDA 4XUDA 4POOA 4GC5A 3OE5A 3FPHA 3R9XB 1XTPA 3EGIA 3KHKA 3PVCA 4HSGA 2AOTB 4PIPA 4ER5A 5E8RA 5B1SA 2P3LA 4ISCA 4CKCA 3OFKA 1N7IA 2ONZA 5FWAA 5K01A 1KYWA 3CJTA 3P9CA 4GUAA 3RIEA 3FTCA 2F8LA 5CM2Z 1F38A 2WK1A 5K0NA 3HCCA 4DQ0A 4GEKA 4PYMA 4E70A 3O7WA 7MHTA 2JHCA 2AN5A 4PONA 2IIPA 4P7KA 5FQNA 1Y8CA 3VC2A 3EEOA 4RVDA 1EJ0A 3P2EA 3BWMA 3B89A 4MIKA 1Q0SA 1VP9A 2CKDA 3M4XA 3R6TA 1ZKDA 3BGDA 4LG1A 5E9QA 3UFBA 1M0EA 1IXKA 2GB4A 2EJTA 2XVMA 3LSTA 4L7VA 1I4WA 4BLVA 4CTJA 4F86A 1EQAA 4AZSA 1EAMA 1NKVA 2O07A 5E9WA 1WXXA 1XDUA 5MHTA 4GOMD 5KS2A 4YMHA 5DTQA 3BXOA 3T7TA 3DLCA 5LQRA 3IHTA 3EMDA 4R6WA 3TPZA 5LQNA 2QRVA 5EMJA 3E05A 2UZ4A 5LQJA 3GRYA 3JWHA 1JSZA 4HTFA 5HZMA 5FQOA 4EVIA 1L3CA 3CCFA 3DULA 5CVUA 2XVAA 4YMGA 5K8VA 3DTNA 2BM8A 1X1DA 4BY9E 3GRUA 2NXNA 5DPMA 2GAFA 1UFKA 3K6RA 3UJBA 3EVCA 3FUUA 3Q7EA 2G1PA 3EVBA 4XCXA 5HEKA 5KYGA 2JJQA 2B3TA 2B78A 1VE3A 3MCTA 2WA2A 4QVGA 4M38A 1UWVA 3KKZA 4H0NA 4P7FA 1VP3A 3M70A 2IGTA 3HCBA 3B3FA 1U2ZA 2IBSA 3M33A 1RI4A 4OBXA 3V8VA 3WSTA 4AZVA 1WS6A 4P58A 2C7OA 1G8SA 3THSA 2BR4A 2N47A 2BZGA 3GGDA 3P8ZA 3BT7A 2OB1A 4PYIA 1FP2A 3GXOA 3UJDA 4MTLA 2P41A 4E31A 2BR5A 4RVGA 2PSSA 5BW4A 5E8JA 2VDWA 1X19A 1UIRA 2G71A 2PT6A 2PX8A 4QPPA 4ER6A 1L9KA 2PXCA 1VPTA 1EIZA 3QOXA 2BH2A 4GOLD 5EMKA 4XUCA 2QY6A 5HIIA 4PCAA 5EHGA 1JQEA 3I5UA 1RJGA 3KQSA 4RV9A 1ORHA 4RTPA 3R3HA 1NW3A 2XBMA 3AWIA 2DULA 4X61A 3OCJA 4YV0A 3K0BA 1XDSA 3G8BA 1KHHA 2YX1A 1HMYA 3MAGA 3CJRA 3GWZA 2JG3A 3BZBA 3G2MA 1ZG3A 4YUXA 5CCXA 5EC8A 2V74B 4ER7A 1L1EA 1G60A 4YUWA 5EEHA 1D2CA 5FWDA 1R00A 1SG9A 4IWNA 5K0EA 4BLUA 1SUIA 5KVAA 3MGGA 3BWCA 3NDJA 4RTJA 4DA4A 5EZSA 4NECA 2ZZKA 3KPWA 3TQSA 1D2GA 1V39A 3R24A 3LDFA 1QZZA 3CC8A 1D2HA 4M7RA 3B7PA 3BKWA 3PB3A 4ZTBA 5DTRA 2CMHA 5EVJA 4MQ4A 4ATNA 1NE2A 3VC1A 5DXAA 1G8AA 2YXEA 3T7RA 4GOND 4IV0A 3P97A 3ANXA 3DR5A 1IM8A 3ER8A 3NW9A 2PBFA 2KW5A 4C05A 1R6AA 3BKXA 4M37A 5CVEA 5F2NA 2FRXA 3LL7A 2AR0A 3KPYA 3R0QA 1KIAA 4X63A 4DCMA 1AQJA 3A4TA 3FUVA 5LR6A 4C07A 3NVKI 2GS9A 3KR1A 5DLYA 5EHIA 1JG3A 3UJ7A 3JWIA 4QDKA 4CTKA 3EMBA 3V97A 5K05A 1VIDA 5EEGA 2O57A 1Q0TA 3G88A 4G56A 5DX0A 2Z6AA 2AZTA 1VBFA 10MHA 1KPHA 3SXJA 3AXSA 5E1BA 5CUQA 3H2BA 1NBIA 4LWOA 5EKUA 5EGSA 3PFGA 3TM5A 3NVMB 1G6Q1 3G8AA 1MJFA 3KR9A 3SGLA 1XDZA 3KPVA 3P71T 4B17A 3DLIA 3UWPA 4YUZA 2ZULA 3BGVA 3LDUA 2AOVA 4X41A 3G2OA 5DWQA 2QE6A 4HGZA 3UJAA 3I53A 1Z3CA 2ZLBA 3SMQA 5T6BA 1O9GA 1FP1D 3GJYA 4AUKA 3KR2A 1KR5A 5FA5A 5HIKA 1P1CA 2NYUA 1QAMA 3GRRA 2Z6UA 3PX2A 5JUWA 3EPPA 5GWXA 4O29A 4QPNA 3FUWA 3OU7A 5CIYA 5K0GA 2OO3A 3ORHA 3Q87B 5G02A 2DPMA 1R8XA 3DXZA 3SM3A 3SSNA 2NXJA 4GF5A 3LKDA 4RTMA 5GM2A 3FPEA 5EG5A 4OBWA 4GC9A 3GRZA 1ZHFA 4RTNA 1XCJA 3EVFA 3G7UA 4QDJA 4QQNA 2BR3A 3RW9A 2NP6A 1X1AA 1ORIA 2AOUA 3HA5A 2ZBPA 5KQRA 1XXLA 3I9FA 3MCZA 3TMAA 5LQKA 4X1OA 2LD4A 3VSEA 1NW5A 3EVDA 1SKMA 2OBFA 5F2OA 4FZVA 4M36A 2GH1A 2H1RA 5GINE 1WY7A 4WXHA 5HIJA 2FK7A 2JH9A 2I9KA 4JXJA 3NWBA 2VP3A 1AQIA 5GM1A 2AOWA 2NXCA 3D2LA 1SVUA 5LQUA 3TRKA 5P8WA 3KQQA 3EVGA 2XYRA 3MTEA 4Y2HA 1QAOA 3P9KA 1EJ6A 2PX2A 5C0OE 3EGVA 1N2XA 5FA8A 2C7PA 1DUSA 4PYLA 2R6ZA 2ONYA 3GU3A 3IYLW 2EG5A 4PYNA 2I7CA 3DXYA 5CCBA 1NV8A 4PGGA 3IV6A 2E5WA 3HM2A 3KPUA 3KQWA 4Y30A 3GIWA 5DM0A 4KIFA 1XVAA 4BLWA 4OQDA 3PLAE 5H02A 2CMGA 3VYWA 5U4XA 3FPJA 1MHTA 3A27A 5EMMA 4EK9A 4BP3A 5CVDA 2P7IA 2YQZA 3KU1A 3NDIA 4AZWA 2ZSUA 2ZW9A 3FPFA 5EIFA 4LWPA 4PYKA 3MHTA 2GLUA 3QOWA 5K03A 3A7DA 4PCLA 3E8SA 1KXZA 2G70A 4RTQA 2O06A 2ZFUA 4CKBA 3DMGA 2AOTA 3C6KA 1YF3A 2FHPA 3UZUA 5CVJA 1SUSA 3FTDA 1FJXA 1XJ5A 3HVIA 2ZZNA 2Y1WA 3UJ8A 3KR0A 1L3IA 5D1HA 3KQYA 3MB5A 2QM3A 1SQFA 4KW7A 5DM4A 1BKYA 4FT4A 1TW3A 3O31A 3TFWA 9MHTA 3P2IA 3C6MA 5DX1A 5FHRA 1RJFA 3PFHA 3GDHA 5DRTA 5EPEA 1AF7A 3M6XA 2CWWA 4E30A 5DX8A 5EZQA 3OE4A 2AN3A 2XYVA 2ESRA 1KPGA 3HA7A 2GPYA 2P8JA 2ZTHA 3FRHA 1BOOA 1PRYA 1RJEA 1YZ3A 4V0QA 5IH3A 1RI5A 4EMSA 3P2KA 2ZVJA 2PXXA 1P39A 3ELWA 4YUVA 4DF3A 3PS9A 4PYJA 2AS0A 5ICFA 4A6EA 1KYZA 3OZTA 3LGAA 5T64A 2PV0A 3TLJA 2Q41A 3T7SA 3FRIA 4CXMA 1TW2A 4LECA 3EGEA 2QRVB 3OPNA 5EMLA 3UBTA 3ME5A 4HTFB 3LX6A 4QTUB 3EVEA 3LBYA 3LKZA 3DOUA 5DSXA 3NMUF 1NW7A 2FK8A 1L3BA 5HIMA 5FULA 3LCCA 3HCFA 4BP1A 3HCDA 4RTSA 1N7JA 2AN4A 4GQBA 2HR1A 2OB2A 3DMHA 2EJUA 1KPIA
chains in the Genus database with same CATH superfamily
1KZGB 3SZMA 4YJGA 4JYPA 3CH6A 4RS3A 2ZU0C 5IN5A 1VYUA 1RWWA 1ZS9A 3QVGA 1E9DA 4L3OA 1FSGA 2OV8A 4BLRA 2BFDA 3TDKA 5GIOE 1YR8A 4C0LA 1B3RA 1X8LA 4I08A 5KX5B 2YMMA 1O89A 1TYZA 4XPZA 4DXHA 2D0PB 2PGOA 2IC5A 4TTJA 1E5TA 2ZI9A 5TR9A 3VI4B 4F6RB 5BY2A 3PIIA 1IUOA 1P81A 2H4ZA 3TSAA 3SBDA 3WLTA 1EBBA 3GA5A 3ZXIA 4BE9A 3ZG6A 4BZQA 4LY9A 1INLA 3GPYA 1NMEA 3GLGA 4GXTA 4IGEA 3ML1A 3GLKA 3HC7A 3LUJA 4IX9A 4N7MA 2PUGA 2C99A 4KBGA 2PMDA 1TE2A 4GXRA 3C0KA 5FB3A 3RGWS 4MV4A 3OZRA 3L5KA 3MWLA 2EXXA 4TL7A 1ZSNA 2HV9A 1VPWA 2D7GA 5ESDA 3EPHA 2DCMA 2FPRA 3EPJA 4PSAA 3RS7A 4Q9LA 1T4CB 2AFIB 3VTZA 2RHHA 3L84A 1XFDA 1QZMA 3LGSA 3E9MA 3F97A 3KTAA 1ZVMA 4MGZE 3CW2A 4M9QA 2OBXA 4MEJA 2C88A 1U04A 3QLVA 2Y1EA 3QVMA 1QFMA 2GNOA 4DCVA 1VG1A 4DIEA 5CVVA 4E46A 4IXDA 4PAOA 1T2VA 3WRXC 4U8HA 4OHXA 5EESA 4BIIA 1X7YA 4L4XA 1UQRA 4UEJA 1FXUA 3ZTYA 3FHCB 2H2HA 1QGZA 2BCJQ 2B1IA 3GUCA 3ZZNA 4ENTA 1PTKA 4Z6YA 3AKEA 2GBLC 4KKVA 1Q1NA 3DVLA 1PFKA 3EZNA 3HVHA 3IAM6 2VEDA 4YI5A 5BN4B 1NNUC 4CIYA 2BGNA 4QELA 3E2MA 3OX1A 2ONJA 4CYMA 5AJWA 4O4LB 3LYAA 1FF9A 2HMSA 4O4JB 3MT7A 3FTNA 3A8TA 4JI4M 2IY9A 3DMDA 5NULA 1SULA 3ZZ1A 2WPNA 1DBWA 1SHZA 5JAHA 1X70A 1R37A 4IJQA 2R1VA 3QEMB 4K28A 2GZMA 2P7HA 4KNWA 3QE2A 4URVR 3GG9A 1VYHA 4RMJA 4DWOA 1U0EA 4EJ6A 4TRJA 1XJWA 3EF3A 1IHYA 1L5QA 4URHA 2BKUA 4IIWA 1Q0ZA 5LVAA 1EFPA 4J2OA 5ABPA 1VPVA 4FGLA 1H3EA 2B25A 3Q3VA 4B09A 1JFSA 3QWAA 3TRHA 3Q0TA 1P6UA 1TYAE 3KZKA 4J2HA 1LB1B 2OT3B 2P4UA 1J2TA 4IF4A 3WGUA 4BVJA 3DPSA 1VG0B 4XH9B 1SKBA 2VF8A 2GLTA 2IPNA 1X7DA 1T5TA 2X13A 5BW5A 2O8FA 2VDVE 5LD2B 3ELUA 4UQLA 3UA3A 4DQXA 1Y33E 2QNRA 4TKLA 4BJHB 1YCFA 4ND6A 4F7DA 4YAUA 5IT9A 4OX9Y 4RK0A 2PGAA 1WZIA 2CP8A 1T5DX 4YGXB 1DARA 2QTVB 3GMDA 5EFZA 1ZA1A 1OVMA 1QH0A 1KOJA 1H4VB 3MWEB 3WDMA 1TT5B 4EZBA 3D4LA 6YASA 3L6DA 4E32A 1A50B 2F43B 4IIYA 4TS9A 5GQSA 4UDNA 4DMUB 1Q3KA 2IH2A 5HGJA 3LWBA 2Y0TA 2PX4A 3QFRA 4RACA 2CEAA 2RAFA 1U6KA 3DLAA 5AVTA 2E4XA 4LA4A 4DV4B 5I8WA 3DOJA 3ZDCA 3QJ5A 1PAUA 1XSEA 1RYZA 4II3A 4G1EB 1JG1A 4HNAA 1NBEA 4DZTA 1RYBA 4B47A 5KYYA 1PIWA 4HS9A 2XGOA 2AZMA 2YTZA 1IAQA 3VHXA 2H4XA 3HCNA 3QKRB 4IYJA 2EUCA 1YJXA 1OLXB 1RJWA 4BZPA 2OV3A 1NTRA 2KS6A 2YINC 3H97A 1NRJB 1JF8A 3D6NB 3IR5A 4QWMA 4U4AA 5CM8B 5J59A 1G4UR 4H1VA 3HJNA 4PXAA 3TL6A 1RXUA 4UNRA 5LQAA 3RPEA 1GLNA 3AFMA 4G0PA 3KXIA 4CLOB 1O5IA 4QJ5A 4ARIA 3FE2A 2J08A 3BQNB 1A76A 2QVGA 5LBIA 3OZGA 3PZBA 2X1HA 3C7DB 3CUEF 2O2JA 1BNCA 2CLMB 2SCUB 1Y1KE 2W83A 3GF4A 3DA1A 2VCHA 2IHYA 4QGFA 4AZTA 5BR8B 3U6PA 4EA7A 2JFWA 3E22A 3VKHA 1H2AS 4ZI7F 5TPZD 4GWGA 3OZCA 1TC2A 2A7XA 1NVMA 3PJEA 4BEVA 5BSGA 5IABA 3IERA 2IPXA 4DTIA 1C4WA 1Q2UA 1IQ0A 3U37A 1UP7A 4L16A 4FLEA 2ZJ1A 4Y1EA 4QPZA 4CCAA 5FOXA 1Z08A 4MCIA 1ST3A 1PG2A 4I81A 1ZLXA 3CKMA 3IODA 3PITA 4RD6A 1U1GA 3CCCA 5GJWC 3A6FA 4BQOA 1AV6A 4DNPA 2OCGA 4YN3A 3W6NA 4X71A 3UNXA 5ULLA 1YFLA 4EZEA 1M54A 2ERCA 4EKGA 4HDSB 2H1IA 2XKJE 2CL7X 3HP4A 3JQ9A 4MIEA 1YU9A 2IPOA 5CIWA 3DP7A 5CXUA 5KZMB 5UKDA 1I51A 4ZU6X 3GGPA 3UMRA 3JR4A 4HGNA 1AMOA 1I33A 1G4HA 5FFFA 3W5IA 2QP9X 2EF1A 4RVNA 4XYBA 3MC1A 2AOTB 3QBTA 2HCFA 5F77A 3L7NA 4RXUA 5G0WA 2DPLA 5A1TA 4BO4A 5JADA 1N7IA 4GFDA 1PRBA 2Y1GA 4FDTA 4MWBA 2WUFA 4NYMQ 5AI6A 5FRDA 4RV5A 1ZW6A 2SKEA 2WWFA 1VE9A 2HLHA 1I4DD 1U8YA 3WGJA 3HUUA 3MWDB 3ZIDA 3REGA 4BNKA 4MB0A 4HGQA 1IOZA 1FFEA 2PS0A 3FOWA 1Q12A 2QLNA 2K2WA 3Q3IA 4G2NA 5ECYA 4MYTA 5I7UA 4QOIA 3IB3A 1XPJA 4RKWA 1W85B 4I50B 1HL7A 2CXQA 3LWDA 4UMEA 1OTYA 1JIVA 3FDZA 4Q0MA 1O6ZA 3I37X 4BGVA 2UUOA 1L7OA 1GGVA 1OBVA 2HJVA 1ES9A 2B7LA 2B35A 2OGZA 3G3EA 3BB3A 3LG2A 1XDUA 3JQ7B 2P69A 3K70D 4GRIA 2W6ZA 3CF4A 4EBFA 2QDXA 4YJFB 3HCWA 3LTEA 5HP4A 2JCSA 2AHOA 3U3KA 3ER6A 1RBMA 1Q3HA 2YIJA 4ID3A 1SM4A 3K31A 4CLEA 1L5YA 2VVTA 4GPD1 1XXHA 4S2UA 3RR2A 4AJEA 3O73A 1N6KA 3CCFA 3UICA 3N9IA 4XA8A 3ROTA 2WIAA 5AVSA 4B3TB 4UM5A 3OCVA 3HJAA 4PYRA 1T8WA 3SG0A 3QFSA 1BRTA 3Q7EA 4D9GA 2Q4BA 1R0SA 2FAXA 1UDWA 2JJQA 2QX4A 3RROA 5A2GA 1K88A 3DMNA 2DZLA 2XF8A 4O4IF 4HO1X 1LLQA 4YACA 2B8TA 4LSMA 3RC3A 3L3BA 3RKSA 5A02A 5I3CA 1NOJA 2XB8A 1E5DA 5JS1A 2ZJ7A 3OX2A 1WU7A 3VOTA 4X85A 1FYWA 1GKLA 2IVZA 3IIIA 1M74A 3W2HA 3T7CA 4BVGA 3AUXA 3A32A 1NNEA 2QORA 2HDNB 5TE9A 3T99A 1Y4DE 4ILKA 1AHPA 2IU0A 2PSSA 2HYDA 2VSFA 3WFZA 4MDEA 1U0FA 1VDZA 4FOSA 3OD1A 3A4YA 1HFKA 2XE8A 4EHDA 2HCTA 1K8QA 4DUPA 5BQ3A 4Q7LA 2R5NA 1P1HA 4GPTA 4YBRA 3K0HA 4ZVKA 2GEKA 5CW1A 2HSDA 3UG7A 1T8SA 4PS0A 5K9ZA 5EMKA 3SOZA 2JJ1D 1JEYA 5K3SA 3G0DA 1QCDA 1C1KA 1JR3E 3PD1A 5HIIA 3STXA 4BO2A 1RQXA 2YJGA 1AOXA 3T3IA 1KMMA 5BNTA 5IAAA 3S1SA 4RCVA 1X8XA 1FUKA 3BXHA 3R3HA 3A3OA 3D5EA 5DGDA 1TD9A 5TEWA 1H2YA 5BV1A 4JB2A 4JN6A 1MH9A 1NM5A 1TKAA 1F4VA 1PR5A 4K6FA 1T0JB 2YN2A 2A9RA 2V96A 1PVDA 3SC2B 4EA9A 4QM6A 1OGJA 4JQZA 4Q1BA 4UQOA 3PT5A 2IIQA 3ZV4A 3VR4H 2O7RA 3G2MA 2J07A 1SZPA 5EC8A 1G0OA 2GESA 2VUHB 1UJ5A 2YWEA 3RGGA 5GMOA 1G17A 4CCSA 2X58A 3X1DA 4AULA 3THWB 4DADA 3BJRA 3K70C 5AMXA 2GJAA 3DDCA 3QXSA 4EFKA 1O2DA 2VQEM 4EY8A 1XNJA 3CO0S 2IEAA 2XJ9A 4LUCA 1R5NA 4O0MA 5A71A 1ADBA 3KV1A 1KS9A 2HK6A 3D54D 3EXEA 2R6JA 3QELB 4YLGA 3HJHA 3S2ZA 2YDXA 1DCMA 3RQIA 3ZW7A 1MAAA 2RAPA 4AD8A 1UM8A 4JI7B 1CUXA 4HQOA 5FI5A 4CM3A 4DLXA 3WGYA 3FPLA 2P9QA 2KW0A 2E1PA 2H8GA 3RC7A 1HH4A 5TF0A 1B1CA 1L8LA 4CIWA 2WILA 3P2OA 2IYPA 2Q9UA 1WNTA 4C14A 4R83A 1NUHA 3GLVA 4LYJA 1GPJA 1WB9A 1SIBE 3GPCA 3O9ZA 3RVJA 2QJTA 1KA9H 3QX7A 3V6LA 1Y7TA 2QVYX 2AD5A 2XODA 3DBHA 5LR6A 2PUFA 2CMFA 1MVNA 2IY8A 2Q2VA 5EHIA 1TJYA 3W4JA 1KC1A 3H5TA 3WAKA 2VTKA 4PLPA 2AJBA 3ROPA 4C0AC 4G56A 4TWRA 2AZTA 2P6MA 3D2BA 3HLYA 1XMPA 3W1VA 4EHKA 1Y8QB 5IUJC 4PZ9A 4DAOA 1A2BA 1DZIA 3L0DA 4FDLA 2C8LA 4EF6A 4XWOA 5CG2A 2FWRA 4KI7A 5EKUA 1VLJA 3QV1A 2WWVD 2GN8A 5B57C 1G6Q1 2NO1A 4YS6A 2Q28A 4Q4HA 3CLRC 1Y63A 1Z15A 1H3NA 2QN7A 1FQKA 1NZJA 2GO1A 2R68A 2O2SA 3F8WA 3M9WA 4JA0A 4RD3A 2RG1A 4WJLA 5J2TB 4NMHA 4B3DA 1CQIB 2R62A 2R7KA 2CLCX 3A1VA 4IQ4A 4BRSA 4EYKA 3PEWA 1V71A 3K73O 1M75A 1VL6A 4BHTA 2W4MA 3FROA 4QOZC 4EVRA 1KMNA 3JQAA 1CUBA 4N5IX 3B2QA 5H80A 5C8YA 5BV2P 1C9MA 4OB8A 1ZI8A 1U2RA 4GHLA 1TLTA 2VXOA 4XWGA 3EQ6A 2QMQA 4YAEA 2W6NA 5FF9A 3W68A 1WRBA 4LFCB 5IXSA 3BFPA 4I1VA 5EG5A 3HFGA 4JC5A 3MRVA 1TMKA 1V4VA 1E3IA 2X0IA 4YNBA 1LQUA 4PZZA 3MLEA 2ATXA 1X1AA 5FTNA 1YKSA 2JCBA 5KQRA 1GZ6A 1DIOB 1C30B 2D2EA 1WXEA 4UZSA 4YIKA 5GPBA 2IZ0A 4JUAA 1JFRA 2CUNA 1PS9A 3P20A 4LOKA 1KZ1A 2FN4A 2FPIA 4E07A 1GG5A 2AB0A 4BMXA 1UZNA 1S8OA 4V0SA 3T9AA 5GINE 3D8RA 1CUSA 1QRTA 4HLQA 2JH9A 5HNKA 2PS1A 2G28A 2ZXFA 4LC1A 4LW8A 2ZP1A 5BN3B 4P4GA 3U9LA 3D4OA 1VJTA 4GMHA 4OGWA 2ZUVA 2CLOB 4IL5A 2FA9A 3TGPA 4JI2M 3ZDZB 2QTFA 1VI5A 4R1UA 4YRZA 4FVTA 5FPQA 4WY2A 1XRNA 3S27A 2Y92A 3JASB 5FA8A 3R7DA 1NRWA 1CYEA 1V9LA 4ID9A 4FFVA 4ND5A 1OMOA 1KZYC 3JW8A 2WJWA 5BW4A 4L5YA 2X3YA 1JIJA 4YRLA 5H4GA 2BPOA 2HSWA 3QSYA 2B37A 5B1YA 1Z73A 3ZC3A 4RENA 4C4OA 2BGKA 4M8SA 1M6VB 2AN1A 1POXA 1JA1A 4ITVA 4ZCPA 3RG8A 3FVVA 4TKVA 1IEXA 3EC2A 3KX2A 4Q4LA 3UK2A 1GPKA 4GPEA 2HL7A 1ODLA 1GR0A 4PPNA 1S02A 4QLBA 5I7SA 3BH7A 1E6LA 3DEFA 4OP1A 2VQFB 3WGZA 1NNSA 4NH0A 3UMCA 2BF7A 4Q4JB 4MIYA 4FYMA 4RNDB 4NE2A 4DSTA 2EKBA 1XE3A 3B1XA 3KCNA 2P9YA 3DZKA 4RMNA 1YRLA 4I4LA 4X8LA 2M6KA 4F5DA 2F8SA 3KXEC 2O23A 2A5JA 1BN7A 1USGA 3PK0A 2CLHB 4M4SA 1K27A 4OKNA 5ESRA 3CZ4A 4KW7A 3GRCA 1TRHA 3FOAA 5DM4A 1NVGA 4FT4A 2HW8A 4CKYA 2ZJAA 2LVPC 5DX1A 4AY5A 2G6BA 4U6SA 4B2LA 5J4LA 3WLEA 3ZCSA 1BGXT 4QG3A 5EXEA 4Z2AA 1W59A 2EFEB 3VPAA 4I8OA 1ZNWA 4W9RA 4ZA2A 1ESZA 4JXXA 3L9WA 1AXEA 2OBNA 2QUJA 2N3ZA 4FGKA 3GEEA 4ESEA 1DELA 5IDVA 5GZ3A 1AY0A 1ZA2A 1W88A 5LDHA 2D00A 1J0AA 5IJZA 2O8EB 4ZI3A 3RLFA 4D4JA 2R751 5JQWA 3SJUA 2GHTA 1PR1A 5EWMA 2B0CA 2Q41A 2WG1A 2HMAA 1OYYA 3BORA 3GJ4A 2OK7A 4IHJF 1PJJA 1E9VA 1YFZA 2HGSA 2ILTA 2VWHA 2ZVQX 5AOAA 5TVGA 1RQ2A 1S2GA 1TK2A 4EJSA 2XRMA 1X7XB 4L74A 4QTUB 4DIDA 3OD5A 5ITZA 3H99A 4UHJA 5JNUA 1UQTA 4J0GA 5TV2A 1VMAA 4NJEB 1L3BA 5AW6A 3BL8A 3E15A 5KI6A 2B6HA 2J5YA 3DCNA 2VRCA 4V0KA 3DSRA 4G4IA 4P2BA 1NKTA 2HX1A 3LY8A 3SC3A 2QQFA 3C5WP 2BHLA 3VPFA 4EY5A 2P4EA 1NVWQ 4RLQA 4XWYA 3SAJA 3AEKA 3EZYA 4ILEA 3U6KA 5E0OA 1AKYA 1L5HA 3NAZA 3MJRA 4M6WA 3W8DA 2GI4A 3FBGA 1JG2A 3VZSA 4DZZA 1FTQA 3CVYA 3GRAA 1R0WA 4Q82A 2VEOA 2I80A 1PR2A 4JL6A 3RS4A 5LUBA 3DVAA 3E9CA 1X80B 3KSBC 2GNPA 5D5HA 1ZIPA 1ML4A 1C7JA 2ZTMA 3UG6A 1QYVA 2XGGA 1B0ZA 3ACBA 2VK1A 4Y2SA 1PFVA 4N3AA 1W0JA 2QDKA 4CQJA 4Z7QB 5JRZA 2NVOA 2C7QA 3OJWA 2WKQA 3C70A 2RAVA 2HQRA 3NTVA 5EJIA 1NW9B 4JBNA 5JH7A 2ZE6A 3AF6A 3LHIA 5LQMA 3BRQA 2ACWA 1JXOA 4GMGA 4XM1A 3ESDA 3TL4X 1WU8A 3GJRA 4KXMA 5LXTF 3H6GA 1AK1A 1B23P 2FZVA 3RUFA 3FAZA 3NWPA 2O7VA 2G88A 4EFNA 2NO9A 4C4RA 5HJEA 1U0GA 1OXKB 2BMWA 3DHYA 4MR9A 2J9XB 1U0JA 3NTQA 2D74A 2MOKA 1F2TB 2BSQA 4YJKA 2CFOA 2VCYA 3KHSA 2WV7A 2GTHA 3ORRA 4UM8B 1K9VF 3TPFA 5A4JA 3ITEA 3QQPA 3U31A 3EQ8A 3LXXA 2WVJA 4QXRA 3FLMA 4AJ2A 2VDUE 2AX3A 1A82A 3LVFO 1T8RA 3STYA 4E33A 4CV1A 2Q1WA 4YXFA 1JXQA 3EGXB 2WQ6A 3PE6A 4DKXA 3ZHCA 1FC0A 3SQMA 2WJZB 2R96A 3ELDA 3ID6C 4UU7A 4BB5A 5ADWA 2XVZA 4GIPA 5EWJA 4D8UA 5D51S 5LWQA 2OKGA 3HKPA 2UYGA 3K9BA 3A4NA 3SHOA 5CB4A 1Q3CA 3VKFA 3GRVA 1YB5A 4ZQEA 4D3DA 3HKCB 3ROMA 3O6VA 1HYHA 1DRKA 4WI1A 3OE7A 4CMKA 5KOHB 2BUBA 1MABA 1WZUA 2YHIA 3SEQA 4RORA 1UBNA 4L22A 2WFLB 521PA 4OYHA 4MLPA 3ZCXA 1A4IA 1ARZA 1RXYA 1SVOA 1QANA 1UWLA 1F3OA 3MVEA 4PZEA 4MB6A 4ITQA 2F9MA 3PXUA 3CW9A 4YAGA 1YO6A 2BBTA 2VP2A 1Q14A 1QONA 1WW2A 2DUJA 2WFAA 3A2NA 4BMCA 1WDMA 3PIDA 4GOXA 4Z9FA 5JECA 4ZVLA 3TNLA 3T52A 5L6MB 4L6AA 4D6PA 3W8FA 5HZGA 2RHRA 1MD9A 2M6RA 4JSRA 4DGQA 3OEHA 4MVJE 3OOEA 3ANMA 4U7TB 1V0JA 3IUEA 3BAZA 1UFVA 4JLMA 5EVJA 3N8NA 2NU8B 4IKPA 3FLAA 1RM3A 4G4SP 4PS1A 3TQRA 3V1YA 3TB6A 4RTOA 1ZHOA 2W2PA 1N33M 2RB4A 1JS1X 1U02A 2GFQA 1Z13A 4FHZA 4FU0A 4Z9BA 4AMUA 3SZRA 1SXJE 2J7NA 1JSXA 4F91B 1NUTA 1T2FA 1XVLA 1C7QA 3AXTA 3C7CB 4U9HS 4X3CA 1HYBA 3AHIA 4ZGGA 1X74A 4RW0A 2GCOA 2WUGA 2C2YA 4QEDA 4BKMA 4EJ2A 2X8AA 1JB0F 3T0IA 1R5LA 4D0SA 3B9RA 1NW8A 5AP9A 5DOZA 2VTBA 3X1MA 1BC5A 5ELLA 3CX7A 3E2PA 4GOOD 2A67A 3LXUX 2RHOA 4CEJA 3O8OB 1MIOB 1KGSA 2ZIEA 2J45A 1A71A 1M2EA 1TX4B 3NLLA 3NC1C 1NVDA 4RZXA 1AO0A 1ZD1A 3OF5A 3VM6A 4JODA 4Q18A 3JZAA 5D6OA 4G4QA 2BTQA 4R84A 3CZCA 4EI2A 4S04A 2TS1A 2JKYA 3AY0A 2QAGB 3HA2A 3INTA 4XVQA 3UK1A 3VX3A 1C0IA 4OO3A 4QVKA 4MV9A 4IJKA 2RKOA 3PDJA 4Y9TA 5K0CA 4IDAA 3FFBA 2J4CA 1U5CA 3BWVA 4OXKA 4QDOA 3MGAA 3AUYA 2NO4A 5EHQA 2X0FA 4I1YA 4BZXA 2OVFA 5DNYA 1GAJA 5AHKA 4RE6A 4Q4CA 1P8AA 3DJFA 2ZDQA 1GHTA 1TH3A 3ND8A 3DUWA 1C2YA 3NUZA 4I4TF 8GPBA 5JBQA 2VF7A 3H2GA 3JYOA 2JLBA 1UM9B 4MDHA 2PD6A 4B8ZA 1PFQA 3GLFA 2K9DA 1DQYA 1KQPA 4IRMA 5ENDA 1E2HA 4D0LB 2Q8NA 1EFLA 3EAFA 2R00A 1Y80A 4IYRA 1UMDA 2PGXA 3P45A 5AM1A 3RIXA 3KT3A 4GD3Q 1L4FA 3NJ8A 1Y42X 1E7RA 4F9GA 4EFLA 3DMTC 3MN1A 4NDAA 2DHYA 1EE8A 1WABA 4KIJA 1OAIA 3B7WA 2LVAA 1DKPA 4LJ7A 1G2PA 4S24A 4Y2GA 5C46F 5IFKA 2J9FB 2TRSB 2AUNA 2Z8XA 5CX1A 4Z9YA 2AL7A 2OWEA 3CEAA 4EW2A 1R4GA 5D86A 4BC0A 3IB6A 4CMIA 3KHKA 4UBLA 5DYGA 2DAEA 1ZHHA 2CFCA 5B1SA 2E4YA 5AXCA 6GPBA 4DR5B 4UUAA 1XRMA 1CY7A 2IQ5A 3CJTA 1JKXA 1WKCA 5LP6C 5B7PA 2JCGA 3QKIA 1N0VC 1F4LA 2WK1A 2LR0A 4G97A 4GWKA 3UAWA 3CX3A 1TAHA 3HDQA 4BFCA 4F11A 4X20B 4MRVA 3BEOA 2FEKA 1QRAA 4RNCA 4ON9A 1IOVA 3PHHA 1X0XA 3ZU2A 5LPNA 4DV2B 1RJ9A 3W2TA 1LS6A 4XGRA 3AVUA 2IYLD 2ZM5A 4B0OA 1WW8A 2B30A 2GB4A 4DBLC 4ZJPA 4Q7JA 1GUBA 1IE3A 1KERA 4TWJA 4M9SA 2WT9A 2ZPAA 1HYEA 4PZUA 1EAMA 4CIZA 3NTXA 4F1KA 3ONDA 5HG0A 5HR5A 1JZTA 4REZA 2ZR9A 5DTQA 2VATA 3N87A 2O14A 5DI3B 3ZNPA 2W11A 4LY3A 1PKEA 3JWHA 3MB8A 4MGKE 3K2QA 3FYUA 1NC3A 1S1CA 1PKXA 2HY7A 3KYJB 2QTAA 2YH2A 4UU1A 1J8YF 3V4RA 3BH0A 4IQFA 1M2WA 1SVMA 1TZKA 2WD7B 2ZRKA 1YL6A 3H4TA 3URKA 4QEKA 2R6FA 3WLSA 4DPKA 4YCNA 2JJ8A 3FDFA 2ZYRA 2G1PA 4O4JF 4XCXA 2XDQA 2AFIE 2HWXA 2JFBA 3ZDFA 5A4IS 5BSWA 5FPKA 5GADl 2JI8A 3MS2A 2EOAA 2XWPA 1GPUA 4RK1A 1RKXA 4CIBA 5EP1A 1PR3A 1PUXA 5J2UF 1G21E 4DY6A 3P5BA 1E1DA 2P1ZA 2FEMA 3LLCA 4YP5A 1SKQA 3E82A 1I4TD 5IFLA 1E2UA 3P8ZA 3BB4A 3TD9A 4PR0A 3RS0A 2IYEA 1DFIA 1V2GA 4B1FA 1Y3CE 2PD3A 4EY6A 4IUYA 2LWXA 1Z0KA 2BR5A 2C61A 1S2LA 5KOJB 1G63A 3GQBB 1ZJYA 2H57A 1H93A 3HSYA 2GCIA 1TVMA 2OOAA 4LXXA 4A91A 4M9ZA 4EUKA 3H9UA 4PPFA 3HY6A 5JE8A 4WJKB 3UO8B 5IMSA 2VJOA 2IXEA 1SUBA 3HBLA 1Q0PA 2E6KA 2VT7A 1UXKA 1DIHA 2L4EA 1DC8A 1UADA 2WU1A 2DFKB 1RYNA 1RC1A 2CLEB 2QY6A 4AT1A 2ZS9A 4EPXA 4MJ3A 2QVZX 1KYQA 4I55F 4W8HA 3WJ7A 3RU3A 1E2FA 4R40A 2XMCA 3DOFA 3IR7A 4RD1A 2ID4A 4NRVA 2G08A 3SIRA 4F72A 3S2FA 4Q3LA 3GA7A 2JY5A 3OESA 3FPCA 4I8IA 1FFGA 2DULA 4WZ6A 4ZI5A 1UDCA 4DARA 4DWWA 4PXSA 2UU9M 4ONEA 4H15A 5CYFA 3W5SA 3CVXA 3VR0A 4G0QA 1CERA 2HHJA 2QSZA 1HETA 4PG7A 4KR3A 1OT5A 3C8UA 1H6DA 3GWZA 3I72A 3ZNQA 1HGXA 4IVRA 4OXRA 4MYRA 3S28A 2N35A 1BA2A 4PSUA 4F45A 4Y6PA 2OXCA 4DR6B 1VHWA 3B51X 3PQFA 4AKHA 3IVMA 1P4RA 1GFZA 5GY7A 3MGGA 4A1FA 4ALLA 5AM3A 2IXBA 3QU9A 4HNSA 4KE7A 4PNZA 4F06A 3R24A 4Z7OB 1FFXB 4N18A 3Q8GA 3MWGA 2F1RA 4BE7B 4ZAWA 4UE6A 3N3AC 3ZHSA 2I67A 2PZKA 5DTRA 3TFOA 1RLTA 4K46A 4ASUA 1DC6A 3OLZA 3GLIA 2DPGA 3UY4A 1DO2A 2HU5A 1HKUA 4AF7A 4QE3A 2NSHA 4K88A 4QC2A 4MVXA 4MQMA 4J16A 4IOJA 5B6JA 1IEWA 2VDQB 3AYXB 1ZY2A 3ZX5A 3RS5A 1E2NA 1E2LA 2C2OA 2XQFA 1MC8A 3CSUA 4YK7A 3RV3A 1GAXA 4F9EA 2C5BA 3QYFA 2ZDHA 4EYSA 3I3OA 4JI5B 3E9YA 4Y1RA 3N76A 2QX9A 5AI0A 2ZJ5A 3D1VA 2DWMA 1AKWA 4F8EA 4NBNA 4ZU1X 4PTLA 4DQUA 4E5UA 1V2HE 2P0EA 1HDRA 2VSXA 1R4MA 1SCUA 1CLUA 3R5JA 1KFKB 2AW3A 4N7RA 1NP7A 2OCLA 3QXXA 4TTIA 2QUZA 3VU3A 3UT5A 4G85A 4WA7A 3ILVA 4B4OA 1RWPA 4WJZA 5IT4A 4Y1FA 5HS4A 4X65B 1TYCA 4JOCA 5BW6B 1W36B 4BQFA 1C5KA 4FYJA 1QZTA 1YI1A 3O82A 4NJMB 3Q72A 4XDYA 4EL0A 3WWDA 3PFIA 1U3VA 4WVFA 1MO5A 1Z0UA 5FFMA 3TCKA 5LZ4A 2MYNA 4FOLA 5FFNA 1LPOA 2CV1A 4IP0A 3NDBB 3BFKA 3VDUA 1E61A 3S8MA 3SU8A 3RRFA 2M32A 3A9CA 5CEJA 4MQEB 1OYOA 1VB3A 5AKYA 6REQA 3TDMA 1V96A 2JLCA 4O29A 3OT4A 3BHIA 2NYVA 3CKYA 1G3UA 3IIKA 1XNRM 1USKA 2CL6X 2V0NA 4K0KM 3ANLA 3U4AA 1ISRA 2XOEA 1XI2A 3VZRA 3ZQ6A 5IT9S 2Q0HA 3IILA 1DQSA 4MUKA 1RAGA 2C2WA 2F1IA 3VO8A 1RYEA 1NY5A 4D4GA 1QTQA 4JYCA 2HGZA 1E6EA 1ORIA 5I45A 1TUEA 1XXLA 1N2GA 2Z2IA 4UBOA 4KFTA 4C4ZA 3TKLA 3DKKA 4AIRA 3EVDA 4GMQA 4NZOA 3V8QA 5B3JA 4F2PA 5F23A 2V7UA 2JHFA 4W5TA 4EECA 4Q9IA 3ICQB 1R3DA 2FEOA 2VAMA 5AW4A 1YZVA 2C4UA 2C9MA 4FQ7A 4INOA 3R3XA 2IF0A 3V5NA 4NYJR 1TCBA 3IQIX 1NT4A 3PC4A 4CE6A 1BVHA 4DA7A 3T38A 5LQUA 2P9ZA 1O97D 4CQLA 1UAGA 2QN9A 5GJVC 3GZJA 3U61B 1HYQA 4DCNA 4WFKA 4J94A 3G8YA 3IUNA 4F93B 2PKQO 5KREA 2ZRFA 3HRHA 5FOUA 4BIMA 3MT0A 1CRWG 4DMLA 5B1IA 4IRUB 4EF5A 1SBHA 1KR2A 2HF9A 2FR8C 4PHCA 5A5DA 5G1PA 4ENWA 2AWOA 1I0ZA 1SBQA 3RJTA 1XAHA 4FMPA 1FQOA 2FX2A 2BE9A 3FD8A 4X45A 5EHXA 5EMMA 3ZTWA 5JI2E 5JBNA 4B74A 3WGLA 2QRKA 2CFRA 1M3SA 1EX6A 1SA0A 1VRVA 1GNRA 1I2CA 3MUNA 1VJCA 3EXFA 1WPQA 1GA1A 4PSDA 1EJBA 1Z56C 3VNAA 3WK5A 1LBQA 2Z09A 1O6CA 4NV0A 2G70A 5JJKA 1YR9A 2EKDA 2FG6C 3D6TB 4KO4S 5JPIA 3RQSA 3LWZA 4B2PA 3R9XA 4EEKA 4POAA 5J2TF 4XAQA 3PD0A 3TOZA 3JQRA 1PGYA 4OUDB 3S29A 1K3WA 4ZT3A 3BXXA 5HE8A 2I29A 3WB9A 4BZZA 4CTOA 3MHVC 1YS9A 3BJEA 2CNKA 4M1SA 5DISB 4JR0A 5ADHA 4ANRA 2FSGA 3ZGOA 4QT4A 5FTKA 2OESA 3Q9NA 3UC5A 1AF7A 1Z2PX 1F0PA 1CLEA 1Z5OA 3OE4A 4J7AA 2Y0DA 3MS4A 1BOOA 3O4IA 3GLQA 2WUEA 4OHBA 3RB8A 2JFNA 5PNTA 5TGTA 3RSCA 3RT7A 1P39A 2PYDA 4C9BA 4KLCA 1HTTA 2UVQA 4OHPA 4RBNA 5ALZA 2DAGA 2DT8A 2XMRA 5HFNA 2BKEA 3L4BA 3TLJA 2QRLA 4EFDA 3H87A 5MF6A 2VTEA 2CB0A 2A33A 1U1DA 2W6MA 3C8HA 4L1KA 3RJ9A 3TXYA 3U7EB 1P7PA 2DHCA 1BS9A 1LNSA 3H2HA 4C89A 1RAHA 3OICA 4FR5A 4XCVA 5DSXA 1EM8A 3QUTA 1KZ4A 1HE1C 2H52A 2MSWA 2VNSA 3G1TA 3G79A 4G0XA 2Q5HA 2VI5A 1I5EA 1M8FA 2PL5A 3DT8A 3NHYA 1SOWA 1IXSB 1BS1A 1OIXA 2UXCM 3HXLA 2HQBA 1CS0B 3NXSA 3O92A 3CKKA 1I3NA 4NP6A 4CT0A 4U7PB 1OF1A 4WH0A 3TNFA 5I6DA 5JLJA 3R76A 1E3WB 3PYMA 2DETA 1JR4A 5EXDA 3E58A 2RH8A 3G8DA 1IPHA 1Q6YA 2A92A 4D82A 3M6WA 3QVJA 1SUAA 4LCJA 4OB6A 4XR9A 5H83A 2QL9A 5CLGA 5JZBA 1KEKA 1JHQA 3IVAA 4M7WA 1GNLA 5K8JB 5B1HA 4WIAA 1UAYA 1SC6A 3HUEA 1F6BA 3GVCA 4QYIA 3VDRA 1M1YE 3VR6A 4DR7B 3TW4A 2ECPA 1J56A 3L6BA 3G1UA 1RQRA 3U6CA 2CD7A 4HH3C 3MMPA 3HO8A 1A9QA 2WQ7A 3UYKA 4Y6OA 5BQXA 2EJSA 3T9EA 2H1WA 3AVTA 4QARA 3SBJA 2X0JA 4A10A 2J3EA 2AWNA 4OCZA 3NUQA 2X49A 1FFAA 4DJJA 2GJ8A 1GRVA 2PJUA 3AF3A 3ODPA 5BVHB 4DHWA 1M2NA 1QZ3A 1SCDA 2JVJA 2QRQA 3UCEA 3T7EA 4V1CA 2QQEA 2C5GA 1NBHA 3GCDA 3RYIA 1AV7A 1R66A 1J9GA 4CCYA 2GVNA 3GFGA 2IFTA 3JQQA 4OGGA 3ELBA 5IJXA 3UK7A 4ZAXA 2DAKA 1ZNYA 2WLSA 2HLPA 2IS4A 1AQ6A 1OBOA 5HRCA 1U5BA 4GBGA 5F2EA 5BOVA 1YQWA 1KFCB 4ZAYA 2ZWIA 1GL3A 2PJDA 2BMEA 1A1SA 3DTTA 4KPEC 3UWKA 2HQOA 3UKOA 3WFIA 1IRIA 1TR8A 4CQMB 4M1TA 1JHMA 4KLZA 4IO0A 5CDTA 1WMSA 4MJXA 1SY7A 3BJIC 1NW6A 1BA3A 4F97A 1YBFA 1FDWA 4C4XA 4G26A 3OKPA 4PINA 3MJDA 4R8RA 3DTYA 4CKXA 4NENA 4RIGA 5LOVF 1EUYA 2EX4A 2PY6A 4I1SA 1XKTA 1NXSA 1LQTA 1TQ8A 2GASA 8AT1A 4B3MM 2WHEA 4HBZA 4BB0A 1P9RA 3MILA 3PHBE 4YRFA 5F73A 2G0NA 1L7EA 1QE3A 2GZSA 3FIJA 2J67A 5C80A 3KQLA 3LCVB 2WU8A 2WOOA 3QYBA 4BO0A 3I42A 4Q4DA 1ESCA 3DAPA 2KE5A 2WTMA 4BASA 2CWDA 3GO4A 3U6QA 5E1DA 4NV3A 4C0QC 2A30A 5CFLA 5HF5A 1WY5A 4KWCA 3ZUPA 4HRYA 3C5HA 3HNRA 1QGYA 2WSMA 3JD4A 4JDPA 3TQFA 1I94M 1B6RA 2ORVA 3RHZA 5A9RA 1YB4A 3NHRA 1AKQA 3QE3A 1TIPA 2WABA 2ZYGA 4MS1B 3KLOA 2J3HA 2B4TO 2F67A 3DB1A 4DQLA 1WVIA 1QH8A 3VKGA 1T8UA 3MTBA 4D4KA 3PE4A 1MAHA 1M6EX 4TM7A 3PEEA 3FPGA 1LTHR 3K2IA 3TZ6A 4MCJA 7GPBA 2HIGA 2CN1A 4TROA 4E03A 1K6XA 1BEEA 1E18A 4P17A 4RPLA 3Q11A 4ACAA 4BQEA 3OJ0A 4OQXA 1LPBB 2IYVA 1THGA 3TLXA 4JI4B 1C8BA 1D6NA 1Z2AA 3PRHA 1IULA 2W48A 2XUAA 3I39X 3K9CA 3UMMA 3SQWA 2X7HA 2KEBA 3EQ2A 4GOJA 4J43A 2ZTDA 4WUVA 1QX4A 2P30A 3RBZA 2O2GA 3PQ4A 1IM2A 3EUEA 3P4XA 2W71A 2OC9A 4Y6LA 1Y8RA 4LRYA 3EMVA 4RESA 2BI4A 3K4HA 1YB7A 1TA0A 3KJXA 3L7LA 1JEQB 3HPQA 3NV9A 3EODA 5ALVA 2AOUB 1UJ6A 5EAIA 4N6OA 1C1DA 5C7IO 2PUCA 3CS3A 3T3EA 2YYAA 3JQPA 4MW9A 3DEJA 5A4KA 5C1PA 3EEBA 3NFYA 4IDGA 4KACA 4DIOA 3ERCA 1G8GA 4HMOA 3BIJA 4QGHA 4JLKA 1AKRA 1RTTA 4RELA 4BPBA 3WLKX 1P1JA 2X3UA 3CR3C 4KXQA 2HWUA 1X8KA 2D4AA 2XTMA 1KFJB 3OZUA 4HNUA 4E3ZA 3TTWA 4YRJA 3RC9A 1WPXA 2FCAA 4Q3AA 1YK0A 1QUSA 1O57A 1M6HA 2ZGVA 4V1CI 5L6LB 1HMPA 5IS2A 2FZLA 2CZQA 1UEXC 1T15A 2JF0A 2WMNB 3V6MA 1IHDA 1Y3AA 4L3WA 4ZYWA 3M6AA 1U0OC 1N92A 3ZZUA 1NGSA 4E6PA 9LDBA 3L8FA 2EQAA 4FI3C 2IEGA 4C6TB 3UJCA 4RPHA 1K2WA 3J81k 1GVHA 3CUKA 4M1ZA 4NZPA 4B08A 4R2LA 2AF3C 3DNMA 4LVNA 5EGNA 5EMHA 2ODAA 3LUGA 3KQOA 3SKXA 3DE7X 4S1NA 4ZC8A 1EUDA 2PAAA 4LK3A 4OYYA 3KKOA 1O7JA 3NYRA 1P1BA 2GUWA 3U0VA 1T5LA 3WBKA 1ZQ9A 1E2GA 4ZC1A 1YAJA 3SVZA 1PJAA 5J4YA 4Y67A 1VYVA 3SS8A 3P7MA 1XQ6A 2VNIA 5AM4A 4ZFNA 3AJEA 3V8EA 4GC5A 2G9VA 2OV1A 1VKOA 2WJ4A 1WA5A 3A9TA 3PDIA 2VZLA 1X8JA 4IIGA 4A6PA 4PBTA 3SD7A 4ER5A 5F7JA 5A4AA 2PANA 1IHOA 4NR0A 3BREA 4PX9A 2AJTA 1TRKA 1NX9A 1KYWA 3P9CA 2H65A 2F8LA 3W1EA 2PKEA 1MRSA 1VBKA 3RBVA 3MCUA 2JLRA 1ZNZA 3GV0A 4LVCA 5EA2A 1WHSB 3L27A 2WSIA 2ZSJA 3O8QB 4WGFA 5K3CA 3IRVA 3NRBA 2DWLA 1FK8A 2EYQA 5EJAA 4C0BA 1ZK4A 2WWYA 1RPNA 3JQ8B 4JB8A 2CXOA 3CZQA 1U7PA 4P36A 4BFSA 5ESWA 1G3QA 1VLVA 3T3GA 3H9GA 1LSOA 1L2TA 2X5KO 1FMJA 1NN3A 3CF0A 1JHOA 4DL9A 4WD3A 4YMHA 5HVNA 3LVVA 1O03A 2JPDA 1NDQA 2OORC 3AWDA 3BXOA 1A7KA 3K94A 3L0OA 4FJ0A 3F6CA 1Y34E 4PAWA 4DS3A 3E9QA 1YS1X 2DEUA 5A2QA 1I6KA 3ZY3A 1TUGA 2FUNB 1X6VA 1ZSYA 2GD2A 2WFMA 1Z7YA 3MAJA 4FYHA 4UD6A 1OUMA 3J7AS 3M2PA 4JQOA 4J6EA 4KHZA 3RRZA 3W3AD 4EPYA 5GZ1A 2BM8A 2I22A 3JATA 2J5KA 5L3RA 2I87A 1QKJA 2RBEA 2RGBA 3HB9A 3FHOA 2WIDA 3RVOA 2FMXA 5A5FA 4TZ6A 5DJ5A 2W2TA 2YHSA 3AUSA 4IJWA 1Z06A 3KKZA 4J3FA 1ZJ4A 3HSSA 2YBEA 4JLVA 4ZVOA 5KO3A 3AB7A 3OUTA 1JWAB 1MPXA 1TGYA 2BBOA 2K2QB 2QOEA 4I7EA 2FZWA 2OAEA 4TKUA 5DCYA 3VTAA 1D0VA 3GROA 4RABA 3UUEA 5C4IA 3AUFA 1FL9A 1SXJC 1BE0A 1T8TA 4MTLA 4F6CA 3BE4A 1HQYE 3DS8A 4YB8A 1T0PA 1J21A 1HFEL 2DR3A 4M0KA 5JJLA 3DZDA 1GYPA 2JDID 3AR6A 1Z2OX 2ENWA 2G71A 1WLYA 5JHGB 3FJYA 1QK4A 3HWWA 4FFPA 4BKQA 3UT6A 2GK6A 3UV6A 4JT2A 1QF7A 1XXHE 1EVJA 1KBOA 4PGMA 1Q44A 5K8CA 2W82A 1PNVA 1OA0A 4PR3A 4RKUF 1O4WA 1DXHA 3HXKA 4IDOA 4RHYA 1ILEA 4HDQB 2EP8A 1A95A 3SEZA 1G64A 1GZ4A 3DDHA 2HA5A 2VHCA 1Y3IA 3LUFA 3OH8A 4OMCA 1E2IA 1FCJA 1CVIA 1OAOC 1P3JA 3DEKA 3QWFA 1V6AA 4DVJA 1JHUA 1MKYA 4ZK2A 3HU3A 1K8YB 2AE1A 5JD3A 3TIGA 3L9XA 1Z5PA 2X2FA 3WIBA 5CA1A 2IZOA 2MSEB 3ILHA 3MSXA 4FILA 4AJLA 5GGXA 1XROA 5F98A 3ZE8A 3PQ7A 1HMYA 5FR1A 3CJRA 5KNDA 2XMSA 4I99A 3RFXA 5CCXA 3I2FA 1C8LA 5CT5A 1W8DA 3GJZA 4GPBA 4RPIA 3GP8A 4NPAA 3VKVA 2L82A 3ZV3A 1D2CA 3GQ5A 2IRWA 4A0QA 1L2DA 5AHOA 2ZBGA 3WS7A 3MJEA 1Z29A 4D4IA 3ZHRA 2W4IA 3L6OO 4FHEA 2CLIB 3CC8A 1CUDA 4PO1A 5EJ7A 3CB4A 5KPZA 2NN3C 1NSYA 4NF2A 4DLKA 4FJ2A 3QVTA 2MH8A 1EK5A 2Q3JA 4P16A 1P4AA 3IMFA 3O90A 5BV0A 1E0AA 2HT1A 2YWCA 1N5RA 1NXOA 3K1AA 4IIVA 4KQ1A 1OX4A 5JY1A 2L42A 4NCBA 1B3BA 4IV0A 1DJLA 4OGKA 1FDIA 4MHOA 2Q3EA 1HORA 1Z12A 1D04A 2CDBA 3NW9A 3QY0A 1FVHA 2EQBA 3SDZA 3C1OA 1KJQA 1XFAA 2PH5A 2X5JO 1H0HA 3PSHA 5DHTA 1KI9A 4NH4A 2Q27A 3JX9A 2NV6A 3WIDA 2ZJZA 2OL4A 5LKAA 1FSSA 1N2HA 3CG0A 4AQDA 3F90A 4Y2VA 1TMOA 3I01A 5F33A 4DR2M 2VDMB 4QDKA 5K05A 5DEOA 4HDKB 1CDOA 3RC2A 4JJFA 2DWPA 4KGVA 1SPXA 3NAGA 2EGGA 2O8NA 4GKAA 1TJ5A 1JHVA 3UOAB 2BM1A 1DBVO 3BPSA 3E3LA 2B69A 3B7ZA 3NVMB 2XMPA 1N8NA 3AINA 1GAWA 2FW9A 4J0EA 1EE9A 2M6SA 3JQCA 4IINA 4RK6A 3TH5A 3OPMA 3CEHA 5JMOA 3IHPA 2P9HA 4PG5A 5ITYA 2D7CA 2IVFA 3G2OA 4KE6A 5LMCA 1FQWA 3CUVA 5LL6P 1KO1A 4F1WA 2J0SA 1U2GA 2JZ1A 2RGAA 4FB5A 4MVYA 1PJSA 5CT6A 3VYSB 1I1HA 1MHPA 3F5MA 4DQVA 1Q0QA 4FWDA 4BFLA 4G0WA 1VLLA 3QG1A 1Z38A 4QPNA 2WJVA 1YIAA 4JL8A 4RGBA 1HK7A 1P0CA 4JGBA 3ORHA 4ND1A 2BM0A 1YSYA 1UCFA 4YAFA 2O5VA 4A2WA 3QEJA 1LFAA 1QNFA 4CPDA 2V4UA 1KI1A 3OCWA 2CNOA 2ODNA 5JS2A 3V55A 3ZBUA 2FPWA 2VJMB 3OWXA 4O33A 4GC9A 2Y6UA 5IBPA 1ZBDA 1I30A 1QHGA 3ESQA 4DCPA 5AVVA 4Z4EA 2I6UA 4BNIA 4EHIA 4X66B 2X1MA 1UMBA 4D02A 4Q3KA 3TMAA 5HXAA 2EW2A 3B5JA 1U7TA 1PT7A 2WF6A 3RIMA 2A58A 4NMMA 4ARBA 3MRTA 8ADHA 1OWLA 1Z4PX 3Q4GA 2XQGA 1DLIA 2P5YA 2OHHA 1GRQA 4NDZA 5E4YA 4Z8YA 5AR1A 3SC4A 4YMTA 2VP3A 5SYNA 1GZ3A 1F2UB 5KYKA 4H7HA 2NXCA 1VM6A 2ZR0A 3ZHOA 1ZH2A 4B6RA 5P8WA 1BGWA 5TLSA 3EVGA 4JL5A 4Z4QA 2QSYA 3BTOA 4B8YA 1MO3A 3VU9B 3SF8A 3M89A 4HDMA 4G01B 2YDYA 3U7RA 4F5YA 2LDBA 4UUQA 3Q2OA 4O2BA 4P4UA 5JSYA 1PR9A 1GGEA 1W35A 2PL3A 3RAPR 4PZLA 4AQYM 1N2SA 1YRBA 4FS3A 3U7QB 2GAAA 2JFQA 2W37A 3G85A 3H5WA 5CU7A 5TGDA 4N3BA 4JUBA 3JQBA 3ISTA 1QDUA 3TZKA 4A5SA 3LQ2A 2DZNB 3HKBA 1XC7A 3M4NA 2HSGA 5D3MB 4EHLA 5A05A 1PDVA 2C3MA 4OJTA 1PJQA 3GPIA 3A27A 3LT0A 5BWLA 2PLRA 5HWSA 3AMVA 1AA6A 4XD7A 3R41A 2UU9B 5LCXA 4BNLA 2Y27A 4B4WA 2QVLA 2Y0PA 2V8OA 3ZKWB 2ZW9A 5LKRA 2OXFA 1EFDN 2LKDA 3GCGA 3H2JA 2VPPA 4JK3A 5DBGA 4WV3A 5DB4A 3BMNB 3FMVA 2OO7A 2Y99A 2APLA 4R2HA 4WLVA 3S2GA 2Y93A 1Z18A 1JDBB 3RABA 4CKBA 1A0OA 1S8FA 2I6XA 3UZUA 3AZQA 1S2MA 1MB0A 2WU3A 3C24A 3ETHA 3KBBA 3VAYA 2ZRIA 1H0RA 2ZYVX 3IHKA 2DECA 3KEFA 4R1SA 1DLJA 1N34B 1MZPA 2Q3CA 3Q10A 3BXPA 4I1OA 1CQJB 4R7ZA 1B93A 3FB4A 1Y7LA 1P2DA 2A86A 2K87A 3G9ZA 1BE8A 1DDIA 4V24A 4KLNA 3O2NA 4H60A 4KPUB 2QZ4A 3HB5X 4MS4B 3VMMA 2XGJA 1LTMA 4B9AA 1PX0A 2GN9A 1TXGA 4L2IA 1XZGA 3WRVA 1E66A 5IH7A 1NOKA 4EG7A 5FUWA 2AKAB 3VPBA 3BA6A 4FXPA 5BWBA 2GPYA 2XXJA 1ECJA 1GARA 1GQFA 3E9NA 2KRUA 3EBOA 1RI5A 3EH2A 4JVOA 4LDNA 4DF3A 4PYJA 2W9XA 5CEEA 2IP4A 4XGKA 4A6EA 3WB1A 5G4KB 4ZARA 3RUCA 3HNOA 3ULKA 1R2QA 2FZ4A 1EX1A 1ZUHA 3E21A 3R3YA 5G53C 1CZKA 1TJ3A 1YHYA 3BB1A 3H11A 4JU9A 4LYEA 2OGSA 4P98A 4R9NA 4ENRA 2OGWA 1ZOLA 4D0GA 2JNHA 4NNOA 4KRFA 3EBLA 1L7DA 2NADA 2OHJA 1T4BA 4MXDA 3E48A 2J32A 4TVKA 4PX3A 5LNK1 1XOIA 2QJFA 4JI3M 5BVGB 1IQPA 1J8DA 3AESB 3LCCA 4XOIA 2VYNA 4INZA 1LNQA 4LDPA 4YCSA 2QX6A 1PFUA 1DGHB 2ZJBA 3B3QA 4H0CA 1RE1A 2EJUA 3UENA 4HNHA 3BFVA 3I9MA 2HN9A 1Z45A 3P0EA 2CNDA 1JE1A 3HCAA 5IYZA 3TGWA 4CETA 3GVXA 1Y6ZA 4MICA 3R74A 3L29A 2WBLC 5IXJA 4U02A 5EP2A 1W9MA 5EXSA 4URWR 1O96A 3HI6A 3ZY5A 3T06B 4NPHA 1IHUA 1O95D 4LV5B 1XN1A 2G8NA 2R8OA 4DV2M 2I1QA 4RY9A 2P2NA 4C5BA 3PP8A 3PNKA 3H84A 4PGHA 4J7CA 2NW6A 1SH7A 4P31A 4TT8A 1SU6A 5CFNA 5IEJA 1GFIA 1EH5A 3DOOA 2GAIA 2ONKA 5DNAA 4MV0A 2VK4A 1PQPA 2WG2A 1UBSB 3NANA 3G5MA 4G4RA 1YJQA 5IU6A 4B6PA 3DXXA 3AJ9A 3LV8A 4FR0A 2JATA 2Z43A 4B3SM 3CO5A 2WZCA 4IXMA 4HX9A 3JRWA 4M0DA 5TEVA 1FPQA 4DV6B 2XCUA 3X1JA 4CM4A 1QP7A 1CE8B 1ISHA 2P3OA 2QTCA 1YE3A 3DPUA 5DW3A 3TIIA 2I03A 3WC4A 1E1LA 3AVXA 3CX8A 5LYYA 4Z3KA 3HS3A 1RRGA 2UYQA 4QUEA 3IDQA 3AX6A 4OK3A 1E60A 3EUFA 3I58A 3M5DA 4QUBA 1YE9A 3BYZA 5HCNA 2OOSA 2VAWA 4FOPA 2GEJA 4KPFC 3FFTA 4DCUA 5K09A 4QUJA 2BKVA 4A36A 4LRSB 3MJCA 2Q2EB 4NHEA 2GPSA 1DB3A 2XUFA 5IAEA 5ERGB 1XF1A 2OZVA 4FNAA 1VHQA 3N0TA 4WNYA 2XGSA 2OXTA 3MCVA 4AP5A 2D3WA 3ED5A 1F8YA 4QHSA 1S3GA 2D2VA 2GJKA 2WF5A 4FMDF 5EJMA 4CFSA 3BXFA 3NRCA 4KGXA 1G38A 4XCQA 1NVBA 4DC0A 4HC4A 4OD0A 1DQZA 4Q1CA 2WDPA 3VUEA 3H5NA 2GRAA 3E7FA 4BVFA 2BI8A 5JS7A 4YT8A 4H7IA 5BR4A 3OE1A 1KO8A 4P34A 2JRCA 4FFMA 5C7OO 1W29A 1VZ3A 1LGYA 3FWPA 4Q93A 3N6RA 1SBNE 2XZOA 4TMVA 3IQZA 5FADA 1Z26A 2XJ4A 4MARA 1GNTA 1SGWA 3O0TA 5FUVA 4NBVA 4Q03A 1C0LA 1CF2O 1RLJA 2RGCA 3ESZA 2A9PA 5IZCC 2PX0A 4MRNA 2A5FA 1R0RE 2GA9A 3GG2A 5CLLA 3STTA 3W1WA 4CKWB 2ZQ5A 4C03A 2RCYA 1J7KA 3SZLA 3DKIA 4P3XA 3A42A 3NWOA 3AOEC 1MR3F 2FPKA 1N5LA 4ER0A 1VG8A 4K9SA 1TTQB 4V0MA 3ZBQA 4QUDA 2EO2A 3QNUA 4YP6A 1X1TA 1FX1A 1RQNA 2ZWPA 4MRMB 4BDTA 3O95A 4FKMA 5IDXA 2PUAA 1JIIA 3BJZA 4I9NA 3FN4A 1Z34A 3VU1A 4E3WA 5MN6A 1QX3A 4HLCA 3K0FB 1FNDA 5EJ6A 4W8GA 4JUCA 3IDAA 5CA1F 5KYWB 3QE0A 2JLQA 3DWEX 5LU8A 3U09A 4V0OA 4YH1A 2C5EA 1HE8B 1RWKA 2FH0A 1JQLB 1V3QE 2XLBA 4DV3M 3M1IA 1OIPA 1FDVA 3D4PA 4FD3A 4DJTA 1G19A 1NMZA 4QYWA 2WJAA 2I2FA 2PWBA 5I47A 1II9A 3QVUA 2ENUA 3B6JA 1HM5A 4MYHA 3SEAA 1RJDA 3OO0A 4XLZA 1SXIA 3PU6A 3A6DA 4N0DA 1E9RA 5ECGC 1GOTA 4E09A 5EZ5A 1FP4A 1EFRD 2OPFA 3E4DA 3IEKA 5IC4A 2A14A 2O0JA 5F1KA 3T0GA 1Y6JA 1OBFO 1EFTA 2E49A 1D0SA 2RJNA 1YHNA 2IHZA 1XELA 3GCZA 3JSXA 3MT8A 5K3FB 4BVBA 3HKDB 3VDMA 1TAGA 3DPIA 5TPWA 1GXSA 3DQQA 1Z4KA 3DT6A 1PS0A 5DLPA 3LECA 1YWGO 1YQ9A 2BP7B 1QXSA 2ZB7A 1PX2A 2G07A 3EGDA 2O50A 4J3NA 1D3AA 4EO7A 2GWHA 4H1WA 4U0JA 5JZSA 2V59A 3R5HA 1YL5A 4HP8A 1JLSA 1T1SA 2OKCA 3FVTA 1DMSA 1XEXA 3H04A 3KAQA 4HD8A 3S4YA 4X3PA 3V4SA 5KQSA 2ZRHA 4RF0A 1DBRA 2PH7A 3GQVA 1KMHA 4WZAE 4IVPA 4S1TA 1A5AB 1SCAA 5KKNB 2QX8A 4CM7A 4HEA1 3IC5A 1X77A 1V8ZA 2QU7A 2MSDB 2VAPA 4M49A 1Q1EA 4U8GA 2AI1A 4PPYA 5E6SA 3CONA 3VHLB 1P61B 1YBHA 3P2MA 2XT9A 3R0ZA 3VZBA 1M1YA 2G72A 1Y4SA 2PMEA 4MS3B 4WCDA 4QSMA 3CLHA 3LHDA 3HWX1 4ZRMA 4TWBA 2OPBA 2QYSA 1EFCA 3KJQA 1IK4A 4DSOA 3ECSA 5F5LA 5IKPA 2Z3VA 3N2GA 4J0CA 3QEKA 4PT5A 2YIVX 3K9WA 4BFXA 3C3XA 1XL0A 1KY3A 1SZDA 2Z9CA 1WHTB 2FHSA 4OX9M 1I5RA 3I05A 1KY2A 2C20A 2GJ4A 1D1SA 5A4DA 3LUBA 1ZRMA 1KDOA 1YNOA 4QRHA 1G16A 1WB6A 3PPXA 1KI7A 3RVBA 2R7MA 3B60A 3QF4A 3WL6A 3TXAA 5BQFA 1NF2A 3WL5A 1QS0A 1CG6A 1VRWA 3NBZC 3OIDA 3PEFA 1C4XA 4U2GA 3U4QA 3ITDA 1BMFA 3HCOA 4XVRA 3W9UA 1EWKA 4ZAFA 4KDEA 1VRCA 3WYGA 3AKYA 3F5QA 4CKCA 2UUAM 5AVUA 1K06A 2R0IA 1AD2A 4PG4A 5ELMA 1TDJA 4C88A 4CGYA 4EZIA 7REQB 1CUFA 4E70A 2JHCA 4AMZA 3RK4A 4P7KA 3U39A 3VC2A 2VJYA 3EEOA 1FVXA 1Q0UA 5A4MS 1XA3A 2VJKA 3N70A 3PQ8A 1QPBA 1EVLA 1SCQA 3IS3A 4INPA 3T41A 2CYCA 3UFBA 3B2NA 2EJTA 2AXEA 2OCAA 3DOEA 1G8KA 1W5SA 4AJOA 4DOMA 4KQEA 4EGAA 1BJTA 1I9CA 3SKVA 4KOAA 4ZDJA 1HLFA 5MHTA 1HNZB 2PS9A 5FP0A 3SLGA 5LQRA 2Q6LA 1VG5A 3LBHA 1Q7BA 3GX1A 3TPZA 3WB2A 1P3QQ 4YYZA 1PSZA 1E6MA 5LQJA 1L5FA 3NGMA 4UNSA 3DR3A 5LOVB 5ITVA 1L3CA 2ASVA 1BG6A 3E8XA 2TMKA 4LQCA 2MCFA 4XQCA 1CUIA 3TD2A 1MGOA 3WV4A 2HC9A 1T3SA 3ETCA 4QUKA 3K6RA 2H59A 1EE2A 2C57A 4OQLA 4BB9A 1K7FB 4YJ3B 4ZMSA 1Z17A 1V5FA 1KF0A 4G37A 4IW3B 1URPA 3ZWYA 3N2NA 4M7OA 3D6HA 2BFDB 2P2CA 4WGGA 1WZ2A 4NXMB 1NNLA 5T4EA 1M6WA 2PRIA 2DHDA 3DDUA 4F2WA 1OZGA 1E3LA 1GJTA 2XWQA 3LUDA 4QUIA 2C7OA 1WQ3A 2Q6KA 5ITXA 5HM6A 1Q22A 2MSCB 3BT7A 1JWLA 3C3MA 1E5XA 2WF7A 2P41A 1SPBS 2C0QA 3U3RA 1PQUA 1QR2A 2XUPA 4BDSA 1P9LA 2O5CA 2ZSDA 2WW8A 3PRYA 3N8HA 1I0IA 2VBFA 4JIMA 4R9VA 4WOKA 1FY2A 2FN3A 2VNKA 3PC3A 4RQUA 3OZDA 3UUGA 1QQ5A 3TJRA 3WIUA 4AC9A 3A6EA 4Y2JA 4JY7A 4RPJA 3QPCA 2DBVO 2W6ID 4AROA 3ANNA 2ZRBA 3TZCA 1NU6A 3QFFA 4FIZA 3G23A 4TSFD 5DMXA 5EHGA 1B6GA 3I5UA 5G0VA 3AUTA 5EKDA 1V7CA 2YIDA 5SYAA 1Q2XA 3MINB 1TTEA 1YIDA 3BM5A 4C7XA 2DT5A 1UDRA 3QUBA 3KYDA 4D3YA 4HFRA 1EGAA 1EA5A 1J8MF 3IPCA 4QJ4A 1R88A 4AJ1A 4CRWB 5M04A 1CR1A 3OQNA 5L8RF 1QORA 3DEIA 4JBHA 4PQYA 1P7YA 3SNKA 2V7BA 4A7PA 2JG3A 4RA6B 3IDZA 5CG1A 1G41A 2PCJA 2VF5X 3MJHA 3X1ZA 2Q46A 4HV4A 1O3YA 2GFHA 3ON5A 4BNXA 3D3QA 5DGHA 1MV8A 1R00A 2DQSA 4IWNA 4LOHA 4UBNA 1UL1X 3EDQA 1ZGBA 1CZNA 3TQSA 1UKYA 1V39A 4RF2A 2XZUA 2BFWA 4KFSA 1J90A 3IO5A 3GAAA 5HPYB 3B7PA 3NBFA 4P8RA 3DW3X 2ZYAA 3WBFA 1QR6A 3PHCA 4MQ4A 1MRZA 2BEJA 4O4LA 4QX6A 4AZ0A 3L1UA 1X42A 1XJQA 2EAUA 2QM8A 4O4JA 1SFRA 4L9AA 4MUJA 2RGOA 2RHGB 2YXEA 3WYFA 4EKDA 3HXMA 4LWQA 2YNMD 2YY5A 3JAKA 1U2DC 1UQUA 3K30A 2Z3ZA 3SM9A 3U40A 2OLKA 1KQNA 2OFOA 4KNVA 4KJXA 1R6AA 4AMYA 3AL3A 5F2NA 1K3UB 1X94A 2EQ5A 4LJLA 4PEVA 2ZIZA 4D42A 3T5BA 5GJBA 3KJNA 5E26A 2C2GA 3IBTA 3QUSA 1Q11A 2GS9A 4TWZA 5LMZA 3RIYA 3C4QA 1EG7A 2GK7A 5EZYA 1X7ZA 4O3MA 1KWKA 1R7RA 2O57A 1VIAA 3ZC7B 1Q74A 3DBLA 4GX0A 3G88A 4QD3A 4QASA 2NUAB 4C4PA 2CE2X 3SXJA 3GB9A 2JVIA 3D3WA 5E1BA 4NL4H 5MFPA 5GKNA 1SN7A 2W2VA 4LWOA 1HXHA 4NZZA 4RHXA 3LOPA 5HBRA 1GTJ1 2FLKA 4YRCA 5G2OA 2P9JA 1H4QA 1N4DA 1IDOA 4KE8A 1XRPA 5LA6A 4IDEA 4YUZA 2BTEA 5SZHB 4HKTA 4P1ZA 5HBGA 1B8UA 2QTVA 1E3MA 3ZQKA 4NARA 4CJXA 1A2KC 3SMQA 4GPZA 1CEEA 4MVJP 4BMZA 4C6HA 4PCZA 1FRNA 3KR2A 1PBNA 4M9XA 1OX6A 1Z47A 3JRNA 1GQ2A 1VGRA 5ECWA 2YFHA 3TAHA 3HYNA 1H9AA 2FFRA 2J33A 1IYZA 3MMSA 4AWBA 5K0GA 1Z6ZA 3CXRA 2WU4A 2H1HA 2I4MA 3VR6H 1R8XA 1GN8A 1XZAA 2AFHE 5KYYB 5DLDA 4FINA 4KFUA 4AMVA 4GF5A 3ZDRA 4RTMA 1NLMA 2JK0A 2JAQA 3FPEA 3QKRA 2I8CA 1W44A 4I4CA 5K51A 1GPMA 1RNLA 2I78A 1LLFA 4Y9RA 1LPPA 3PD7A 4AZ3B 1JEJA 2GR9A 2PH3A 2XTJA 2NX2A 4KGDA 1E32A 2RGNC 2KJQA 1QHYA 5FYDA 4CLOA 1PFGA 1AX9A 4L0MA 5DIFA 3E84A 4CW7A 1CJBA 4IGFA 3I1IA 2B99A 4XZ3A 1TLLA 3K9LA 3RIGA 1EB9A 1QDRA 1Z5UA 3BMXA 4AY2A 4TQUS 1N3IA 3ZJUA 4RYDA 3TZHA 3NETA 3KSAC 3MTEA 4CF3A 3DAFA 4NMWA 2WP0A 1AA9A 2PX2A 1XRQA 2C97A 1JFFB 3KP1E 3WXMA 3T4PA 2R6ZA 4DB2A 4UW9A 4ZV7A 3VTKA 1BMQA 1RPZA 1ZOOA 1L5NA 1GG9A 3QIVA 2OA0A 4FFLA 1HOTA 2FXVA 2C2XA 3TLZA 2X9GA 1OI2A 2P27A 1F4IA 4KXUA 2PZ8A 3GJQA 4C5AA 5IASA 1ZIXA 3AZPA 3RRJA 4NTZA 5MDHA 2PUVA 2V6BA 2GYWA 4NOMA 4QO8A 2JCYA 2VT3A 1RZ3A 4P80A 1IXZA 4AKTA 4UMVA 2JJ2D 1PWYE 3OBIA 3ZXYA 1ODCA 3OPYI 1J23A 3DD5A 4G1FA 4JENA 4M9RA 4QUGA 1PGOA 2ZVDA 2P65A 1K86A 1GPH1 2ZSFA 1P6QA 3FWKA 4IS2A 3NHLA 4IDBA 3SHWA 4ZJUA 1GVNB 3HR7A 3SX2A 2GA8A 1B74A 2BY4A 5HKLA 5IBQA 4E13A 4RH1A 1OJLA 4EVSA 4ZYTA 4KI0A 5LNK6 2BDTA 2PSJA 2FSFA 1QJ4A 3HVIA 3I9V1 1UOQA 4IDCA 4UDYX 1APBA 1BQEA 1T9GR 2LW7A 1ZM2A 1TUIA 1SQFA 5BYBA 4LXQA 3GEHA 1EUZA 1DU4A 2QLTA 2G9QA 3MWDA 3DYIA 2QXUA 3YASA 4X8HA 4FEYA 2BMDA 1BKSB 1MX9A 2B1GA 3IQWA 1W85A 4I50A 3JVVA 5ALGA 2H85A 5FH9A 5IRCD 2PBZA 3ONWA 2G06A 4PN7A 4EABA 4PVDA 5LQDA 2UXBM 4V0QA 2ZAYA 5AK5A 1IIRA 1G1MA 3WHLA 2AS0A 1W0JD 3Q6NA 5DV9A 3DTVA 3E35A 5IVPA 1TMYA 1PEDA 1I5OA 1P0PA 1XMJA 3L0CA 5DNDA 1TW2A 3VA7A 4HEQA 2FP4B 3EGEA 5JJIA 5T4HA 4Y2TA 4LMPA 4AKSA 3MZ0A 1KYTA 1LU9A 1V6SA 3I8OA 4YCDA 5DHRA 4DV3B 2ZJYA 3HEBA 5LMNM 2F5SA 4CM6A 3NMUF 3GOHA 4MLCA 1LX6A 5CK4A 3L0ZA 4I6GA 1P0QA 1N2CA 4B3HA 4M46A 1YFKA 4G0OA 3U3ZA 4F4JA 2Y0BA 3HJFA 3IFSA 2OB2A 5DM60 1VKZA 1XZKA 1HDOA 2FQ1A 3EZGA 2VDOB 1A8SA 3QU4A 4WEOA 2J48A 3ZDBA 4D0NA 3QAUA 4M6WB 4MLDA 3D1JA 4H08A 5CMLA 1YOVA 2F4VB 1XR3A 2VPIA 1KFBB 4C4AA 4Z53A 3LF2A 1WZNA 1IB0A 4MW6A 3L49A 2JH8A 2Q1YA 2G80A 4HYQA 3O3NB 3UJ9A 4BQQA 3V32A 2BBWA 3GAMA 3GR6A 1V7PC 4KYVA 4M0MA 4QPCA 2C9BA 2ODPA 4Q7KA 4DJDC 1P74A 1ICIA 1WXWA 4UHDA 1JAXA 3OM9A 4PICA 4B45A 3BRSA 1W36D 2UZ3A 3AP2A 2PO5A 2Q6IA 1RI2A 1SUPA 5DHPA 2WAXA 4B34A 3CRNA 2CHEA 2O2XA 5DT2A 4WOCA 3VAAA 5J5AA 3U5ZA 1GGHA 2B6NA 2HMYB 3DV2A 3RWOA 2VKTA 1LH0A 4YALA 4C30A 5ICGA 2OYRA 1Q57A 3DKPA 2XOKD 1ZMTA 2VK2A 1Q7RA 3I9OA 4GICA 2IU3A 2QYHA 3AV3A 3KCQA 3E23A 2I8AA 3G5LA 2DYKA 2VDJA 3C7TA 1QK3A 4KPGA 3UPTA 3M6LA 2R6HA 1E2QA 3PNBA 1DAHA 3L0SA 4KQKA 1NF3A 3ND9A 4PYOA 2MROB 1ODIA 1Z6QA 2HRZA 5E3IA 2DGDA 4FEGA 3T3DA 1YTUA 2J0QA 3RE8A 1EZ4A 2RSLA 5BQOA 3THOA 3C43A 3Q9UA 1MENA 2YXNA 4JN6B 4AYTA 1OXTA 4LJ9A 3OFNA 4WURA 3HDJA 4Y9UA 1BWRA 3FUXA 1NQXA 2QKYA 4BYMA 4EEXA 5E7JA 2NZWA 2INGX 2Z95A 3VPGA 3WLOA 4I3HA 1Z63A 4OHVA 3ZR4B 3C9PA 4YJ3F 3PC2A 1RRMA 1T9CA 3OZWA 2UYCA 4FWBA 2ALJA 5KQ8A 3VPDA 5B7QA 2XV1A 1GTG1 4L73A 3Q0EA 5EP4A 2G9UA 3JQDA 4OREX 5CYOA 4B6FA 1O5TA 1S3SA 1YKFA 4FS8A 1FLNA 2HWKA 4IBOA 5EIOA 2WJ3A 1REQB 4KDRA 3TMYA 3VPHA 1J0DA 1P31A 2OK8A 3L8GA 3MBOA 1YR2A 2H4WA 5HM8A 3C15C 4HX2A 4JLSA 1S01A 1DQPA 3REQB 4UKDA 2P6NA 3LA6A 2ZKIA 4B3IA 3KB6A 5F1PA 5AVWA 1Z62A 3X0DA 3UXYA 4FOTA 1K5PA 3AFGA 3K15A 2R86A 1DFGA 4Q9HA 4JOQA 4MPPA 4KIGA 4G41A 4RLFA 1VLHA 4Q15A 3THRA 2K6BA 1COZA 3D59A 1NBMD 3H83A 5EE9A 3RSZA 2IKQA 5C5CA 2CC2A 5AJXA 4DN6A 1DXQA 3F73A 1WBBA 2R7LA 3DQZA 2LZ0A 3ZD7A 2RC5A 4JJKA 1DO8A 1ELOA 4BECA 4MW4A 2BSAA 4DLZA